3OYLA

Crystal structure of the pfv s217h mutant intasome bound to magnesium and the insti mk2048
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 111
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oylA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oylA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oylA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oylA03
4ZTFA 1RT7A 2X4XA 4CFCA 3HM9A 3LP2A 4KKOA 5D3GA 4KTQA 3SUPA 3TARA 2MWOA 4CESA 4DU3A 2D0CA 3VQ9A 3V1RA 4KHSA 2Q3SA 2LVMA 3RRGA 3NF9A 3M8PA 4JRPA 4F8RA 5IAYA 2XRIA 2K3XA 2L3RA 2XY5A 4MFBA 3VQPA 2OYQA 3RTVA 1RT5A 2RJFA 3T19A 4CJWA 4DTMA 4DU1A 4HUEA 2DFFA 1KTQA 1UA1A 4CJLA 1T05A 3L2VA 5CYQA 1HYVA 1HNIA 5E41A 4NYFA 3C6TA 3ZSRA 2HVHA 3HP6A 2E6MA 2NLUA 5I3UA 1HYSA 1ITGA 2BDPA 3I8DA 3SI6A 4CHOA 4FZYA 4CJSA 4DS5A 4CJEA 4KHQA 2X35A 2KZMA 4HHTA 3NBPA 2G3RA 4E7KA 4O0IA 2PYLA 3D45A 3D0PA 3C6UA 1L3TA 2A1SA 5J1EA 4IFYA 2ZQBA 2ETJA 3TAEA 3NTKA 3NH0A 1GOCA 3AVMA 4EP5A 4FM0A 1NK5A 3OYJA 3ZSVA 3DB3A 1F21A 1L3SA 3V4IA 3F70A 3OYLA 3DB4A 4AHVA 1Z26A 4HCBA 2WOMA 4I7FA 1S1VA 4LSLA 3H8ZA 1U48A 3P5JA 3ZSZA 1BI4A 3ZSOA 4B8AB 4O44A 1DTQA 3S3MA 3PO4A 1JKHA 3AVNA 4H4MA 1DTTA 4E7LA 1L5UA 1BL3A 2RHIA 2O4XB 1VSHA 1ZYQA 5KCHA 4E7JA 1RT6A 2Z1IA 4FJNA 3AA3A 4NCGA 1BQNA 4DTRA 3SUQA 4E89A 4QAGA 3DOKA 4CGFA 4TSXA 2EQMA 2IAJA 3V1OA 3AA2A 3RMBA 1S9EA 2QQSA 4PA1A 4FVMA 2XO7A 3RWUA 4OVLA 3CYMA 4OLBA 5KRSA 3SZ2A 3PX6A 1Q8IA 5DMRA 2M0OA 1RBTA 3SD4A 3HT3A 1SKWA 3HYFA 1XHZA 2DAQA 4B9NA 2HB5A 4AHSA 1X1PA 4Z0UA 3VQDA 1XHXA 3ASMA 3VQQA 3KD1E 3ZSWA 3OQ5A 4CK3A 4FK4A 2QXFA 4RG8A 1JLFA 3TAPA 1HQEA 1JXBA 4FW1A 4UC4A 3CM6A 1TGOA 3OYBA 4IKFA 2VWJA 4IG0A 2G8WA 3ZT0A 3OS1A 1BIUA 1S1WA 2IC3A 4NS5A 1TK5A 4KI4A 1T7PA 3ZT2A 1BCOA 4CGIA 4FLYA 2EHGA 1NKCA 1DLOA 1JL1A 3SPYA 4QCLA 4DQSA 2HHQA 4RW6A 3LLRA 4I2PA 2E4LA 4AHCA 5KTQA 1EETA 1D9DA 3MXMA 2KQ2A 2EQUA 1LWCA 4DTXA 2I5JA 5T7BA 4FYDA 4W5TA 2YHAA 4FJJA 3IAYA 1NK8A 1RTIA 4Y1CA 2OPSA 1RDAA 3KJVA 4CK2A 1VSLA 1KCFA 4DTNA 1TL1A 4DTUA 4DSKA 3OS0A 3TANA 3SNNA 4O55A 4B9UA 4X34A 3U3YA 3QLHA 2HW3A 2IS3A 1TK8A 4M3TA 4ZTJA 5SWMA 4CEFA 4B08A 2YRVA 3KK3A 4RW4A 5JS1A 1RI0A 4DFPA 1NKBA 2FBTA 1UA0A 3KKSA 3PNWC 2RO0A 4O5BA 1L3UA 1WJQA 2O4XA 3LWLA 1T03A 4N4HA 3CFRA 1WJRA 3WNGA 1WSGA 5FRMA 2R7YA 3U3GA 2IOCA 3MEDA 3V6DA 2P51A 3S9HA 3QEVA 4ICLA 2ZD1A 2B5JA 4CJQA 3IG1A 4CHQA 5SZTA 2F8TA 1IH7A 3FDRA 4I2QA 2XY8A 3O8VA 4IG3A 2HHXA 4A4EA 2L8DA 3KD5E 3HL8A 4K8ZA 4CFAA 1SL1A 3CFPA 3PV8A 3SPZA 2YNIA 2HHWA 4CGDA 4PL6A 4CF2A 4BACA 2YNHA 3PMIA 4DSJA 3P1GA 3OMCA 4DTJA 1VSJA 2D9TA 5KE2A 2RHXA 3LAMA 3AVLA 3VA0A 4NZGA 4YNQA 5DK5A 3TAFA 1ZBUA 4DS4A 4KB1A 1MHNA 2JZ2A 3M8SA 4DQPA 3QEWA 3VA3A 1QSSA 4FJ8A 2P5GA 2M16A 2R5AA 4I9LA 2QKBA 4BDPA 4W5NA 4HTUA 4C5IA 2M1HA 2OZSA 1YT3A 2X74A 1RBVA 4FW2A 4F3TA 2X4YA 5FDLA 4FU6A 3PY8A 1BI4B 2DIQA 4LH4A 1YTUA 2IGIA 4B9TA 2X6NA 4CFDA 3VQ6A 3HVTA 1QQCA 2YKMA 1OZ3A 1KLMA 4E7HA 4B9SA 3E9GA 1HPZA 2L89A 1JLGA 1N6QA 3ITHA 3DRPA 3FFIA 2HMIA 4J2AA 3AVFA 3LGLA 1QHTA 3E9FA 4CGGA 4KV8A 2BE2A 3RR8A 3IS9A 2R58A 1Q9YA 4Q0BA 3MEAA 2XY6A 5FRNA 1RBRA 3MEWA 3P8DA 3NCIA 2HNZA 3ZSYA 1NK0A 3IRXA 3HVRA 1NK7A 4FJIA 4Q5WA 3L2WA 2RKIA 4M3XA 4CJFA 1RCHA 1ZBLA 4GY5A 2OZMA 2HQEA 1JLEA 3DI6A 1C1AA 4DSIA 2KZZA 4CFBA 1XWLA 4CJTA 3QKJA 5C0MA 3K2PA 2VWKA 1SL2A 4FLXA 4FJMA 3SUNA 1FK9A 4CEAA 3KK2A 1FXXA 2F5KA 4B9WA 3SV3A 3JSMA 3OYHA 3DOLA 3HJFA 2D0AA 3AV9A 4HUGA 4RW9A 2F8SA 3VN5A 4FJLA 3LH0A 5HRSA 4DFMA 2XHBA 3V9UA 2R5MA 2XK0A 3MP8A 4JS4A 4M3UA 1D5AA 2YNFA 3QIIA 1TKXA 3AVIA 1IO2A 3NGIA 3OVNA 4Z02A 1KFDA 4FJ7A 5IN1A 1JLCA 3SQ4A 3DLEA 3ASKA 1U04A 4DFJA 5HP1A 4CIGA 1CZBA 1NJZA 4CRIA 3L8BA 4E1NA 4B9XA 2RHZA 4EP4A 4QW2A 1UAXA 4DTSA 4CF8A 4W5QA 3CFOA 4FZXC 3MP1A 2IDOA 1NKEA 4RW8A 2GFUA 3KLEA 5J2NA 3FEOA 1IKXA 4M3RA 4FJXA 2HHVA 3AO1A 4CJKA 1BCMA 1ASUA 3K57A 4FK2A 4F2SA 3OB9A 3TABA 3ZSQA 1XC9A 1YTAA 1OZ2A 4B3OA 4BWJA 2G8VA 3AO4A 1VRTA 1RTHA 4B9VA 4KHWA 3NTIA 1S1XA 3KIOA 4KHUA 2JLEA 1U47A 2F96A 3V9WA 1HMVA 4ZHRA 3OYAA 1U49A 4OKJA 4DLEA 1H3ZA 3SCXA 4IUUA 1C1BA 3HPHA 3KK1A 3VQBA 4DFKA 5HRPA 4CJ3A 3NTHA 4CIEA 1GOBA 4CE9A 1TVRA 4QQGA 2DFEA 2EX3A 1RDCA 3O3FA 5EU7A 1VSDA 2EFIA 3BDLA 2LCCA 1WSJA 4C5GA 3MXJA 3QIPA 1HYZA 1VSIA 2DTUA 3MEEA 1TL3A 1NOYA 2XY7A 3NFAA 4IBNA 5HBMA 4PY5A 2YV0X 4HCZA 4FJ9A 1LW0A 3WNHA 3K5OA 1KVCA 4E1MA 2HVIA 1X9MA 3HSTB 4CF9A 2EKOA 1HNVA 3AVGA 4RW7A 2QKKA 3V1QA 3FLGA 4IUTA 3LYIA 4YFUA 4N5SA 2RHYA 4OKEA 2YNGA 1SUQA 3WNFA 3MP6A 1B92A 3TAQA 3CEYA 4DF8A 2LTOA 2RI2A 3OJSA 4KFBA 5CY4A 3U6FA 2G8UA 5HRNA 4KHNA 3TR8A 2FHDA 1N5YA 3G0ZA 4PLLA 2O4GA 4OPJA 3NE6A 3CM5A 4CEEA 5D6XA 3RMCA 4FLTA 4CHZA 1RILA 1TAQA 1WAFA 3AA4A 3DYAA 4DMNA 3I0SA 1WSFA 2LRQA 4FM2A 3LANA 3DLKA 1Z25A 5KE3A 4ELVA 3UIQA 1QE1A 5C24A 3L3VA 4HVJA 2Z1HA 4B9LA 1J5OA 3K59A 4FLZA 4UQGA 2RHUA 3VQ5A 3ALYA 1IKWA 3AVJA 1U45A 3SV4A 1RBSA 4LH5A 3K5NA 5KRTA 4QOZB 4N76A 4FLWA 4EZ9A 3L2UA 3SQ2A 4AHRA 1MU2A 2ITGA 1I39A 3EAEA 3VQEA 1RBUA 2PZSA 4AILC 2KFNA 2PQWA 4Z4HA 4IURA 4LY7A 1C0UA 3DLRA 1SKSA 2E6NA 3LZIA 2FBXA 3KTQA 4KAZA 1J54A 3VQ4A 3H6ZA 3QBYA 4GW6A 1C6VA 3L3UA 1REVA 1VK0A 1LV5A 2VYTA 1VSKA 3MEGA 4CHPA 3ZSXA 3UWNA 3LP1A 4OGEA 4N56A 2PYJA 2JGUA 4LD6A 4KO0A 4E0DA 5D6WA 3MAQA 2GF7A 3KLHA 1TKZA 4DQIA 1KVAA 1ASWA 1VRUA 4ELTA 3BGRA 4ELUA 3JYTA 1GOAA 3MXIA 1QTMA 2OPPA 3RMAA 4FM1A 3DM2A 4I9QA 2IG0A 3DLBA 2AJQA 1QSYA 3C4SA 1UOCA 4M45A 4OLAA 2KFZA 4GMJB 3ULDA 4JS5A 4JRQA 5C42A 4QQ6A 1BHLA 2HNDA 4LSNA 4IUPA 2DIGA 3LAKA 1KHCA 2HQXA 4BE0A 1K6YA 3K58A 3THVA 4HUFA 3QO9A 3B6PA 3QIOA 2BGGA 3OYNA 4Z4GA 4CEZA 3EY1A 2HHUA 4DU4A 4BDYA 4XIUA 1S5JA 3L42A 4QQDA 2DFHA 3PX4A 1NOZA 4KI6A 1G15A 5CYMA 1BQMA 4FXDA 3OYEA 4HCCA 5J39A 2VG7A 3OA6A 2HNYA 3QETA 1X9WA 3TI0A 4ID5A 3I0RA 3MECA 5HLFA 3KLFA 4Z4IA 5J2QA 3SQ0A 3T3FA 4B9MA 3QNOA 3WNEA 1S1TA 4C8LA 4OKKA 4FZZA 4Y1DA 1ZBIA 3F9KA 4DSLA 1NK6A 1TKTA 4KRFA 3Q1JA 2GBZA 1EP4A 2YHBA 3P83D 3META 3QESA 2RI3A 2G8KA 4II1A 3S3NA 1W0HA 5C25A 1TV6A 2RPIA 3HPOA 1ZBFA 1BISA 4IUQA 3MEVA 3B6OA 3MO8A 3O4QA 3PMTA 4G1QA 1W9HA 3QEIA 4F2RA 3O3HA 4OVAA 3NF7A 4C5HA 3DMJA 4FJ5A 3NNQA 1CXQA 3NGZA 2A1RA 2GV9A 4L59A 1WAJA 4Z4FA 3O3GA 4FCYA 3NHGA 1WN7A 3OYDA 3LGFA 2O4IA 3NAEA 4DTPA 3NF6A 3AVCA 2G8HA 1RNHA 4E3SA 2B6AA 5J2MA 4CF1A 1U4BA 2KTQA 5HROA 3L2RA 4DWIA 4N4IA 5CZ1A 1X9SA 2LSNA 1LW2A 3QERA 1XNIA 2B4JA 2QK9A 3SUOA 4FJKA 4CK1A 1FKOA 2ZE2A 4K8XA 1EX4A 3UT1A 3OS2A 1WSEA 5KGWA 2BANA 3AO3A 5JS2A 1B9DA 4WE1A 4N4GA 1SSFA 1CZ9A 1S1UA 3CQ8A 2R57A 3AA5X 4B8CA 1NJYA 3DRSA 4C8NA 2FC0A 3NGYA 1JXEA 3P8HA 2B8AA 3AO5A 3KUFA 3H08A 4Q5VA 1JLBA 4FL6A 1Y97A 2EQKA 2CKKA 1D8YA 3ZCMA 3V9ZA 2RI5A 3KLIA 4FLVA 3O4NA 3KKRA 3LX7A 4KREA 1EKEA 4CERA 4CGJA 1L3VA 3EZ5A 4CJVA 1HJRA 2VG6A 5D6YA 4F4KA 1BIZA 1KFSA 4IDKA 2WACA 4O4GA 1WNSA 1OI1A 3A2FA 4DF4A 2K3YA 4Z4EA 3SYZA 2OPQA 1B9FA 3OYMA 4CEDA 4M3YA 4BWMA 3QJ6A 1NK9A 4M42A 1OYXA 4W5OA 4E7IA 1LWFA 2D0BA 2LDMA 1CXUA 4PUOA 2NUBA 4CECA 3ISNC 1WGSA 2Y1JA 4M3WA 3K5MA 3OYKA 1T8EA 1G5VA 2G8FA 4J2BA 3M8RA 2GFAA 1RT4A 4EDUA 3GOXA 4IFVA 4CGHA 5CIUA 3SQ1A 4L8RB 5C6SA 4OGCA 3CG7A 4BE2A 4A4HA 4CF0A 1WSHA 1J53A 4CJRA 4AHTA 1N27A 2P5OA 1RT3A 1TK0A 4H8KA 2KW4A 3VQ7A 3LDSA 4OPKA 2PY5A 4PQUA 4F3OA 3NH2A 2GUIA 1KRPA 3DLMA 3G10A 5I42A 1KSPA 1SKRA 1VSMA 3AVAA 2BIVA 4C8OA 4DSFA 2VG5A 3QEPA 3DLHA 3OJUA 3DLGA 3V81A 4CHNA 4CEBA 3ME9A 1QSLA 4C8KA 4CEOA 1A5VA 4A4FA 1NK4A 1JL2A 4CJPA 1NJXA 4KTZA 3S3OA 1HQUA 2OPRA 4DQRA 1JLQA 4Z4CA 4A4GA 4BD3A 2Y1IA 5FROA 1RT2A 1LAVA 3NH1A 4NYNA 3S6WA 3OYFA 3AVBA 4FLUA 2G8IA 1XI1A 2RN2A 1CLQA 3KLGA 2DY4A 1TKDA 2X78A 3ZT3A 1HRHA 1KVBA 4KHYA 2WONA 3M9QA 1BGXT 1S6PA 4FJGA 1QS4A 3LZJA 1ASVA 3AO2A 3QINA 3MEUA 3LPTA 4PLIA 4DSEA 5J26A 5M9OA 3HK2A 1O1WA 5K14A 4DLGA 4RG2A 3OYIA 3RMDA 3TAGA 3SJJA 1ZBHA 2EQJA 3M8QA 3HP9A 2P1JA 4DTOA 2XDPA 2OA8A 2FBYA 3ZEHA 1VSFA 2FBVA 3ZT4A 4QVZA 1A5WA 4J2EA 4J2DA 1JLAA 3VQ8A 1LAWA 3AVKA 2RJCA 4BE1A 3C94A 3QEXA 1C1CA 3F73A 1UWBA 1C0TA 3OYGA 2D5RA 4IUVA 2E6LA 4CHYA 3NF8A 3HXMA 3RR7A 1LWEA 2MWPA 1VSEA 1NJWA 2YKNA 1C0MA 4N47A 3NDKA 2E5QA 2QQRA 3DRRA 3ZT1A 4O0JA 1IKVA 4CCHA 1IKYA 3C95A 2RJDA 3LPUA 1RT1A 4EZ6A 3QNNA 3HO1A 3OY9A 4MQ3A 4DQQA 1WLJA 5KCOA 3RRHA 3PFSA 3FC3A 3T1AA 1SV5A 1EXQA 1R0AA 4C8MA 3AVHA 2RJEA 5KGXA 3L2QA 4N41A 1TAUA 4ID1A 5CZ2A 1I3AA 3LWMA 3PX0A 3EYZA 1S9GA 1YVUA 1FKPA 5KI6A 2X6SA 3TAMA 2BKDN 4CJ5A 3OMGA 1RTDA 2Z1GA 4C5EA 2BUDA 1RDBA 4LD0A 3LP3A 3V9SA 4CIFA 4W5RA 1D9FA 3LP0A 3OYCA 4NCAA 4KPYA 4KB0A 1Q9XA 4GVMA 3E01A 5HRRA 4OJRA 4M41A 1IG9A 4AHUA 2HHSA 4CJUA 3V9XA 4AH9A 2Z1JA 1SL0A 2HHTA 2P0KA 4NCBA 5J2PA 1A5XA 1RTJA 4R5PA 5KH6A 4KTWA 4JLHA 1S6QA 4PWDA 2W42A 3BDPA 2JTFA 2ATQA 3HPGA 4FJHA 1WJSA 4CJ4A 4H4OA 1WSIA 4DG1A 3PO5A 3K5LA 4M3ZA 1RDDA 3LALA 4CEQA 4BDZA 1J9AA 4E19A 3VQCA 3TWHA 2RF2A 2X4WA 4FK0A 3VQAA 3PUFA 1KLNA
chains in the Genus database with same CATH superfamily
4ZTFA 4AI4A 3QBXA 2PUKB 4M3GA 1ZGAA 2KISA 4KIFA 1YHQN 3QG1A 4MDXA 1UHFA 1H1VA 2AQFA 1N78A 2MI6A 2MWOA 4CESA 3CCJA 2VCPA 1I07A 4RLQA 1AKHA 4KBOA 2Q3SA 5E26A 4XEIA 3GOIA 1CKAA 4F55A 3F3XA 1SD4A 1MMAA 2YWWA 2QWLA 4X1VA 2JJ9A 4WXHA 2E60A 2DXTA 4RDUA 4FWNA 3H3UA 1Q7YO 3DAWA 2IAIA 2ID3A 2A6TA 2WADA 4CJWA 1ZBXA 4MEYF 4DU1A 4HUEA 1M8MA 1KTQA 4OX9K 4A3JJ 4M71A 1ZSZC 2WY8Q 3VU3C 1VQ6A 4O8UA 2CMPA 1T05A 4BU2A 4IQJA 1HNIA 4NYFA 2EYQA 2HVHA 5BOXA 1NH3A 4DZJA 4BJ6C 3E9PA 3M8JA 1M3AA 3I8DA 4B1XB 4BRAA 5ILUA 2QA4N 3VGKA 1D5VA 1O75A 3CBPA 4CJEA 5A2QZ 2X35A 5LRRA 4M7DE 3GBQA 1KU2A 2QBYA 4HHTA 3EKSA 1MNEA 2G3RA 2Y30A 1WZOA 3CCSN 2PN6A 1QRYA 3HL2A 3D45A 2V79A 2MD0A 4MO5A 5K1YA 5CHIA 4IFYA 1YJNI 3AAPA 3CCRA 2ZQBA 2HCKA 3KP2A 2ETJA 1Z9QA 4A3GJ 3VS2A 1Z3XA 1JXSA 3NTKA 2JUFA 4EP5A 4AT1B 1TYQB 2RD1A 3OYJA 3ZSVA 4BI4A 1GXQA 3DB3A 2AIRB 3QO3A 4LG3A 1MV0B 1IREB 1QWEA 1T6DA 2ZJ2A 4CYCA 1NM7A 1FYLA 4YTLA 3C7NB 1VQPI 3A2KA 4XORA 2JRMA 3P5JA 4S04A 3ZSZA 1BI4A 3ZSOA 4BRNA 3KPHA 4B8AB 1BYMA 4O44A 2HD0A 4B1RA 5CR2A 2VQFK 2SEMA 1TNTA 2YU9J 2Y75A 3V42A 2DODA 4F7ZA 5IYDJ 2O4XB 3TVTA 2OBPA 2EBIA 2GOMA 5FLXE 4E7JA 1JRIA 1CGPA 2PFBA 2NS0A 3I59A 3H6EA 3ATVA 1W7PB 4NUBA 4HNVA 3CCSQ 4CGFA 4TSXA 3K70D 2ISZA 3RMBA 2QW9A 1JI8A 1R77A 4G7OF 4FVMA 3TTDA 3RWUA 4BH9A 5CE3A 1VUBA 1GLBG 1I27A 1Q8IA 4C0ZA 1TNSA 4YEJA 1ODDA 2LKXA 1RBTA 1T0FC 5E3NA 4D1QA 3ZL7C 3HT3A 1SKWA 1OPKA 1IXDA 1YI2Q 2LR8A 1FTZA 2HB5A 4O3MA 1BOBA 3D1NI 3ASMA 3OQ5A 4CK3A 4FK4A 3I53A 2QXFA 4K25A 3C0CA 3CCVA 1V4SA 3HBTA 2F48A 4LE9A 2A37A 2EQRA 4EIKA 2EZIA 4E9HA 4YOYA 4BGAA 4IKFA 5K7FA 3ZT0A 2GIVA 1M9SA 1WBBA 1BIUA 1R1TA 4ZH4F 3RUXA 2AZSA 5CVJA 4E7ZA 2W82A 1S1WA 1XMAA 1AHDP 5I9EB 2VL8A 1E3PA 4PJOD 2EYXA 1J75A 4C3IJ 1BCOA 3WVEB 4FLYA 1TL8A 3BG7A 1OCTC 4XTYA 2BH1A 1VQ5T 3GXOA 1VQLI 2A5YB 2TRTA 1K73C 4UY8O 1OLTA 2ADUA 2DK5A 4WF2A 4GLMA 4PJ0C 1UUEA 1T38A 3LLRA 2NRRA 2P9IB 4LFAK 1H8AC 1X1DA 5GTHC 5KTQA 1I1SA 1EFNA 2KQ2A 4PSWA 3O9QA 4DTXA 1SD5A 3H41A 1VQKA 4FYDA 2VVKA 2O8KA 4AM7A 1WBDA 4V2SA 5LLQA 1ENHA 2YHAA 2HL5C 1NK8A 5GAMd 2J05A 2R5ZA 4O5VA 1V3FA 3RCOA 3BR1A 4N9HA 3KJVA 4AFZC 1X43A 1TYQA 1NYGA 1UJ0A 1TL1A 1I0CA 3U1DA 3JCMf 5ICCA 3KLOA 3HZJA 3SNNA 5GAOr 4O55A 4B9UA 4X34A 3U3YA 2DYSH 1KSWA 1ETXA 2YR2A 2HW3A 5FPDA 3KEQA 2H8HA 2XPVA 4G7ZF 4IHWA 4E2FB 2NYXA 2GCXA 3SBTA 4ZTJA 4QWQA 4LLGF 4B08A 3WXJA 3KK3A 4RW4A 2QEXA 1YWOA 1YCSB 2WA0A 2EFOA 1RI0A 4FWRA 4XK8E 4M75G 2JHNA 3M53A 3CVSA 5AQLA 4AIAA 4JDSA 1SD6A 3PNWC 1R36A 1RKWA 3T1YK 3WU0A 2O4XA 3GMEA 2BHYA 1WHKA 1PUFB 4IEIA 2VC1A 4IQ4A 4X65K 3K1MA 4A93J 5CCAA 3OTOK 2IOCA 1B9NA 2E20A 4CC3A 1ACMB 5A0GA 2B5JA 4CJQA 4F14A 1UELB 1Q81R 2Y0MA 4I2QA 3KCCA 5GIPA 1AU7A 2ZPHB 1Y6IA 1R1UA 4XR6A 4A4EA 2L8DA 1N6AA 3BF3A 1PU8A 1ZLJA 2VT2A 4K8ZA 4CFAA 3TQNA 1K76A 2YRDA 2RV8A 2HU9A 2YNHA 5J4VA 4CI6A 2A68F 1ZSZB 3KEYA 4JI1K 3P1GA 3VGLA 2UXDK 3D2EB 4HYEA 1VSJA 2KL4A 3UPUA 2CYYA 1SFEA 3ULRB 4M78E 3CCJN 4J8FA 4XIDA 2JPBA 4NZGA 3TAFA 5KYNA 4AUXA 5E1ZB 1ZRDA 3M1FA 1QCOA 2Q2EB 4AU7A 1QP3A 4UUSB 1QSSA 1R5ID 4FJ8A 3CXCM 2M16A 4AM6A 2ZJRL 5GAN2 4JX6A 4I9LA 3WHCA 4I99C 1XDUA 5IPAA 2IP2A 5KHDA 2RM4A 5FD5A 2QKBA 2O8XA 2OA4A 4YOQA 1FYNA 3ZBDA 4C5IA 1LOTB 2OZSA 1RR8C 1YT3A 4LB5A 3Q0UA 3PJRA 1RBVA 1AOYA 1Q81O 2X4YA 4XU1A 4IOAF 3LM9A 4DIQA 3K70C 1QHHD 1PDNC 3MWTA 4LH4A 1YTUA 1QVFA 2I2LA 4B9TA 2O8FB 5LJ3f 2GAUA 3VQ6A 1QZEA 1QVPA 2K5LA 1E0EA 1O57A 1QQCA 1KLMA 1HPZA 1FBSA 3GTLJ 5CKHA 3ITHA 2WV1A 2HMIA 2X48A 1WKMA 2DA2A 3LGLA 2QLZA 1M5Q1 3LW5E 1VQNI 3C2HA 1UB9A 1W1FA 2BE2A 4K42A 1TWBA 3CCRN 1G99A 3CCJQ 2FSWA 1FWZA 3BROA 3VF4A 3HG9A 1BB9A 3S14J 4F7UB 4BRHA 3EE8A 3X28B 3OV8A 3P8DA 1UTIA 1IXSB 2JSCA 3VSLA 3ZGKA 2PUOB 3SBGA 1HKTA 2E5ZA 1B34A 5EVZA 1LVAA 3RBBB 2NOZA 3EG3A 4C8QF 1TWFJ 3HEFA 2B63J 4CJFA 1M90R 3FXKA 2FNAA 2GNCA 2OZMA 1VQ6Q 2RQWA 4A5NA 4OMFB 4CZJA 2R0QC 1TSFA 4FSXA 2KPMA 4J7IA 4JI8K 1KG1A 3EFRA 5GJVB 4PJOC 1IV0A 2LQKA 1Q82U 1R5GA 3BJAA 3DOLA 4B3TK 2F6CA 2HR3A 3HJFA 1XSVA 2D0AA 4PFOA 1S3XA 3CCET 2O8CA 2ZBKA 4ETSA 2EGEA 2CG4A 4FJLA 1NGHA 3O8HA 5ADXH 1B3QA 2XK0A 1E3MA 2E4HA 1K9MO 4NXMK 2ZPFB 1NK2P 1RAFB 3JRCA 2BY1A 5LBQA 2K85A 1TKXA 1AWWA 5F1XA 4I2OA 3OVNA 5B5EC 4FE7A 4CZEA 1HSJA 1JLCA 3CCRQ 5BRDA 1CZBA 1AEYA 3HTSB 4KMFA 3S1QJ 4A2BA 1MSFC 5AT1B 4QW2A 3ZFJA 4OP0A 1UAXA 2D1HA 2CT4A 4F91B 5GMKm 3CFOA 1SFOJ 4FZXC 1GL5A 3MP1A 2YG9A 3JSCA 4NB4A 1NKEA 4DV5K 3H9QA 2DL8A 3LA2A 4RW8A 2GFUA 2UWMA 3JCMJ 1M90O 2QSGX 1IKXA 2F1LA 3QPTA 1VYTA 4C0GA 1YHQT 4V2GA 2P0PA 4NC8A 1BCMA 3WTYC 4C8QD 3P8BB 4J6WA 2XGXA 4F2SA 3TABA 2IVMA 2Y48A 4HF1A 4BWJA 2V1QA 2P4TA 3M1EA 3LMMA 1VRTA 3R8EA 1Y96B 4C30A 3X20B 4KHWA 3NTIA 1EBMA 4RTUA 5A2QO 3D5RC 3CWTA 1WHJA 2JLEA 2DE0X 1KYZA 2HEOA 3OYAA 2GEMA 5GAHP 3K4JA 4I0AA 3VEZA 4C23A 4Q4ZF 4OKJA 1VRLA 3OR1C 2A08A 3SCXA 1KG6A 4EIAA 3VF6A 4B3RK 2DA5A 4LG0A 4HRIA 1OEBA 2GXGA 4DFKA 4M3DA 4CZKA 2DF6A 4U7DA 5CKFA 3K9KA 2R93J 5AYFA 4CJ3A 5BRFA 4CIEA 1TVRA 2QA4T 2DFUA 1W97L 1I5ZA 3O3FA 2O61A 4GDFA 1N3CA 4PHTX 1JCGA 3E1YA 3K4NA 1WUAA 5AJ3K 3CCST 1VSIA 2QGFB 2YX4A 4MLHA 3I55I 3E0JB 3CC7N 2DTUA 3FWEA 3CCVQ 2XV4S 3IRRA 3MEEA 4HLYA 2V8JA 1X6GA 3P4IA 1VAZA 1P8ZA 3NFAA 4IBNA 4PY5A 4RA2A 2M7AA 4EAHD 3N5NX 5K7HA 4HNUA 4M77E 1FX7A 2VBYA 4E1MA 4A12A 1J0RA 3ZMTA 3GTGJ 2R5YB 1ZKGA 3SLCA 3REBB 4GLKA 4AG1C 2NS7A 4CICA 2J5PA 4B1YB 2QWRA 2HHHK 2PVOB 2F69A 4J7FA 4XRMA 3K10A 1P2FA 2RHYA 2R7WA 4D7NA 3RZDJ 3OR2C 3DLLA 1JXMA 2W84A 5F27A 4TVRA 4LDUA 5GAOl 2HYFA 2PVGB 4R56A 3C65A 1VQPA 2E2HJ 4NL3A 2XU8A 3GTMJ 1VQKQ 3V7RA 3M5RA 3COAC 2LTOA 5CHZA 1K61A 4FSSA 3TDUC 3HKZN 3T1BA 4KFBA 5CY4A 4BQQA 3U6FA 2R7ZJ 5HRNA 4JK1X 3QUIA 1IBMK 1WZ2A 4WCEL 2G9WA 2R4GA 3G0ZA 4YORA 4PLLA 1J3TA 3UB5A 2KXCA 2EKHA 2FOWA 1SPKA 5B3SH 1NPRA 3RMCA 3B73A 3M58A 4B3AA 3WTXC 2EZLA 2LSOA 3CF2A 5LGTA 4LF4K 1VQ4I 2Y2ZA 3DLKA 2PBDA 2E1MC 2PI0A 3PQKA 3UIQA 1QE1A 2NRTA 2G0EA 3F10A 2QEXQ 2XIDA 3WTZA 3QYFA 1KQSS 4KT5C 2DBMA 3K6GA 3VQ5A 1WHUA 4RTTA 3AVJA 1TH7A 1P7MA 5FKOA 2FEIA 3U4LA 1Y96A 3V8KA 3K5NA 5KRTA 4H5NA 2A6AA 1XMXA 4QOZB 1RI7A 1BIBA 2MAMA 3SQ2A 2P0WA 4DR5K 1OR7A 2ITGA 1I39A 2ZCFB 3EAEA 4B48A 3VQEA 1PP7U 2JPSA 4AILC 2CQ7A 2PQWA 1W2BM 3CCMI 5ECAA 2DILA 1LFPA 2A28A 3DLLF 1G59A 4NLCA 1ZG1A 4DV1K 3DLRA 2D2WA 2XSDC 3QFPA 1SKSA 1LDJA 4JV5K 5D6EA 1NJIC 3VQ4A 1ZA2B 4GW6A 2FL7A 2BY0A 4EM1A 1FBQA 1EJ9A 4GV6A 5K5QA 4J6YA 1C6VA 3L3UA 2P9LA 3CLQA 1REVA 1WA7A 4XU0A 1VK0A 4MO7A 8AT1B 1Z67A 4JLGA 1S72I 4CHPA 1YIJA 4Z88A 3UWNA 4MQVA 4PJOB 4G12A 1V55H 1YJ9I 2PYJA 3UATA 4LD6A 4KO0A 4C3HJ 3IP4B 4XTUA 4UOBA 4WCIA 3MAQA 2DXUA 3R6NA 1H88C 2QTVA 3KLHA 3HDDA 1TKZA 4MNUA 1BKBA 3CD6A 4D5CA 1XGMA 4ELTA 4ELUA 1YW8A 1V1CA 3JYTA 4YY3K 3MXIA 4X66K 4IJNA 3VWBA 1Y56A 1KU9A 3DFGA 3WTWC 1FEXA 3FB9A 2OQRA 4LK1F 3CMAI 3D6RA 4IOAL 1P4XA 2R5YA 1MMSA 1NYFA 3O3KA 3VEOA 2AJQA 3NMZC 2J7IA 4LMYA 1KQ1A 1N8RU 2NVUB 4XMYA 4YDUC 4A54A 2D0NA 1UOCA 2GWKA 1LJ9A 4BC4A 5DM7R 4JS5A 3SB2A 4I01A 3BCBA 2VPRA 3OW2M 1KD1C 4QQ6A 1M2VB 1Z91A 2HNDA 2CV0A 3ASNH 5EG0A 4DGWB 1KHCA 4UNOA 3K58A 4HUFA 3B6PA 1LCUA 5EEGA 4FYWB 4XLHA 2DMNA 2HHUA 3CPEA 2MGQA 4XIUA 4XLCA 2E2PA 4Y91A 3LL3A 5ICFA 4O5FA 3PX4A 2NVXJ 3MK6A 1NOZA 1K73R 2DBBA 3DBLB 1G15A 5CYMA 2PJRA 5HDGA 3N4QA 4FXDA 2O8DB 2DOEA 2V9VA 3M6GA 1NBWA 1WGXA 3EHRA 5J39A 4KT6A 3SWNC 2QQ8A 1TQIA 2YUSA 2HNYA 4PCQA 2NNYA 4A3BJ 2N8GA 3JSOA 3D2FB 2XAJA 3RDIA 2P9NB 5J2QA 3SQ0A 2PBIA 3CCJT 3CWSA 2OU2A 2P5KA 1FPQA 2DRMA 5H1SQ 2QWWA 2VONA 4OKKA 1OCCH 4FZZA 2VC8A 1Q86R 3JRZA 2EH3A 3K4BA 4BR0A 2BVLA 3GLXA 2ZFUA 1ZBIA 4ISGA 1QA6A 1ETOA 4EGZA 2HSTA 2E64A 3ENHA 4KRFA 2GBZA 1P7JA 2DDBA 2EJRA 1M4ZA 5GAN5 4KFCA 5AZJB 3META 3QESA 4RGXA 3DWLE 5EYRA 1F9NA 1KA8A 4HPQA 3DEEA 2G6FX 3G7ZA 3IH2A 1C0WA 2VB6A 4IUQA 4EMSA 4U0YA 3PMTA 2LH9A 2XAHA 3TBIA 2NOFA 4G1QA 1W9HA 2X1EA 5GAHJ 1K73O 1ETYA 1ESVA 3O3HA 3I0XA 4OVAA 2ZGYA 3TSWA 3NF7A 3I8BA 2D5VA 1VQOI 3LDOA 2X6XA 3NGZA 4L59A 4BR7A 4FCYA 3NHGA 4AIJA 4Q48A 3F8NA 3WG7H 4DTPA 2RNJA 3CCRT 4OINF 1RNHA 2GLOA 2RK2A 4JD2B 1U4BA 4ESFA 1HPMA 3ABUA 2FPEA 1XSXA 2NOEA 4HVWA 2IA0A 1X9SA 1UGQB 1GBRA 3WXKA 3ECHA 3QERA 1QWFA 1XNIA 2ACJA 2QK9A 4LD9K 2DRKA 1U9OA 4CZHA 3WE2A 4CK1A 4XN0A 1VQNA 1MMNA 2CV1A 2K40A 2ZE2A 4K8XA 3G0QA 1IJJA 2JS0A 3BR3A 5A2QE 2X9HA 2EPFA 1B9DA 2PTKA 4LLLA 1KYWA 4CCKA 4N4GA 3WHBA 1T6SA 2HXOA 3CQ8A 2L7MP 1U78A 3HSBA 3AA5X 3QWXX 3MMVA 1M2VA 4NLBA 4J9IA 3DRSA 3OW2P 2E2NA 2RQQA 1OULA 3S1MJ 1LWYA 2E1MB 4DYRA 2YUQA 1JXEA 2F5EA 2B8AA 4U0VA 4BKXA 3AO5A 5F2RA 2EK5A 4CCNA 5KYXB 4Q5VA 5I2SA 1QHAA 3FK6A 4JI7K 4IZZA 3KE2A 4DK9A 2E5KA 2D8HA 1J6ZA 3V9ZA 5GAMe 5GMKj 3O4NA 3ABMH 3LCNA 3KKRA 4KREA 5BNGA 3PIOA 2HFHA 4B8XA 4HQMA 4M6YA 2R7XA 4CGJA 2KR3A 1HF0A 4E7SA 2KROA 3EUHA 5BPLA 2O8DA 1HJRA 2MOXA 2OC6A 2FO0A 2O9VA 3OA9A 4R1HA 3HB9A 1T56A 2WSCE 2WACA 4O4GA 1YNZA 2MG4A 3NQOA 2QGUA 4BQNA 3WG9A 3D2FA 2JT1A 2KJBA 4DF4A 1WQ7A 1NGFA 1B9FA 3JAMZ 4CEDA 1YJNQ 2OTJN 3WXIA 1WXTA 4B3MK 3EYIA 2ZXJA 3QJ6A 2UYTA 1NK9A 2Z2SB 3QP5A 2Q97A 1JJ8C 4J9DA 1LWFA 3HTRA 3BZKA 4IEJA 2LDMA 2AQEA 1AZEA 1CXUA 2NUBA 3EG9B 4C92C 1X58A 3KZZA 1TP4A 1WGSA 1KG4A 1VQPQ 2DA6A 3KFWX 3JCMV 3OYKA 4BG8A 2Y69H 1FSHA 1G5VA 5HLHA 2G8FA 4ESRA 3F0ZA 3H0HA 3QICA 4KIBA 4CGHA 1MDMB 1NG9A 5CIUA 4Y7NJ 3SQ1A 2DJNA 1XMKA 4OOIA 3BG3A 1VQMA 3VS4A 3FGUA 2A05A 4X6AJ 4A4HA 4CF0A 3R6SA 3NEUA 2QWQA 5HCKA 3FXRA 1RT3A 2DYBA 3UKRB 4M63C 4H8KA 1Y8QB 5FKNA 1JUPA 3TQ7P 4KHPK 4MHGA 4EMKC 1HC8A 3KVGA 1YIJN 1RL2A 2F9TA 2D1XA 4PQUA 4F3OA 3NH2A 1JT6A 1WWXA 1KRPA 5L3EA 3DLMA 3VS5A 2R7VA 3JR9A 3JCMg 5AQSA 4LFCK 1X1CA 2GBYA 2CWEA 4F92B 4DSFA 1TWAJ 2EGAA 3I4PA 3QEPA 3FM3A 2K57A 3HSCA 2KDZA 3OJUA 1Y8RB 4EJYA 5AQRA 3ME9A 3CC7T 5IOZA 3LWFA 1FP1D 3FXMA 3CD6N 3BQYA 3CJQB 2RE2A 1UJ8A 2H09A 1OPCA 4A4FA 3NMUA 1JL2A 4CJPA 1ZLMA 3H5NA 4HSTA 1WJAA 2LJ1A 3LL7A 3S3OA 3H3NO 1HQUA 5IWAK 2OPRA 4DQRA 3ZMVA 1NU0A 3TSQA 4L5EA 1C0FA 4A4GA 4EMGA 1KGSA 2LD5A 1K0SA 2YDLA 1RT2A 2EB7A 1NG2A 3GNGA 1UHCA 3FZVA 4NYNA 3ECOA 1I5OB 3OOPA 3OYFA 3AVBA 4D6WA 4FLUA 1OFCX 3CJBA 1WJFA 4GV9A 3ZQIA 4KH5A 3S2WA 5GAEP 3KLGA 4PKCC 2DY4A 2XKOC 4M7AA 1Z05A 2X78A 4WQ4C 3L1AA 2MLKA 3M57A 3SWNB 1TWCJ 5JVTA 5GANj 2PX9A 1BGXT 3LSKA 2VJ4A 5CPRB 3VOEA 5KYXA 1IUFA 1D1AA 2XROA 3L7WA 2JTEA 3MEUA 2HDCA 5TGTA 3OGDA 5M9OA 1OH8A 3HK2A 1Q18A 1T6CA 2WAQN 3RPUA 3JCMc 1XDSA 1NBEB 2JVGA 3PIPA 4DEXA 1AZGB 2K9LA 3RMDA 3SJJA 1WHHA 2EQJA 1CZAN 2QM1A 4MDAA 2K6DA 2X6YA 1MPGA 4BY6C 1PVEA 2CW7A 1K8KA 2H3GX 2XDPA 4JYAK 4PFZA 2PEXA 2J5OA 3CD6Q 2VOOA 3C2BA 1EV7A 2LRDA 4JI0K 1JLAA 3NGPA 3CERA 1AWXA 3C94A 3F73A 3PO3J 4AMCA 1P92A 3OYGA 1QQOA 2OZUA 2KT8A 4IUVA 2CGLA 1OOTA 1VSEA 2GUPA 1ZG3A 1NJWA 2YKNA 2IGOA 4KJZA 1Q82C 4P5NA 1ORKA 5DD4A 1LE8B 2M0MA 1SD7A 1E7OA 1J7KA 4F7UE 5BRHA 3SAHA 1GLJO 3GF2A 4DQQA 3FKJA 1L3LA 5LJ3g 1OYYA 2MBFA 4M7AF 2XF6A 2VXEA 4HEA2 5B1BH 1MDMA 2EQIA 3WGGA 1HOMA 3PFSA 3MHXA 3J81K 1W5TA 1R0AA 3VENA 2ZSIB 1TAUA 5CZ2A 4XTWA 3K9JA 3UNGC 3UKRA 1S9GA 3CMEI 3JCMb 3PIPF 4Y17A 2P84A 1W1WE 2NVYJ 1NTCA 3IAS2 1U06A 2BZYA 2DD4A 2BKDN 1BOTO 3QBWA 3OMGA 1RTDA 2Z1GA 3LA3A 4C5EA 2DMTA 1SQKA 1HLVA 2A61A 1DQUA 3V9SA 4L9VA 3UKUB 4W5RA 3E5XA 1OCPA 1BC8C 1XJWB 1K78B 5IYCJ 4YOWA 1Q9XA 5FLXK 4RWTA 3GFJA 1QHGA 4BR4A 3WVDB 1IG9A 4IVNA 5AQKA 1CKBA 1FTTA 1NEGA 4XKVA 3JCMd 2E8AA 4HSBA 1VQNN 1SL0A 2MD5A 3FKIJ 4J9EA 4IHVA 4J9BA 1ZA1B 4RM2A 2OZ6A 4BGDA 5J2PA 1TUYA 5GAN6 4R5PA 2ZMEC 1A6QA 3IQLA 4EEFG 1R23A 3ZMSA 3CUQA 1XQHA 1U9NA 2FU4A 1EWQA 3MX5A 2JM8A 3HPGA 4BY7J 1K4TA 1USSA 4D8DA 3G2BA 2HVSA 1R7JA 3IUCA 4CEQA 3PO2J 3EZWA 4E19A 4M7AD 5C4XJ 4D9JA 3TWHA 2MA3A 5A0DA 2L02A 3O6BB 3VGMA 3PUFA 2AA4A 5E8IA 2DK8A 2HDAA 4OF1A 1RLPC 2HZTA 2I0NA 4CFCA 3HM9A 3KYCB 3RPUD 2OJ2A 2ZKZA 1OYWA 3E2UA 4JKGA 3VYSB 4EJOA 2A0FB 2M9HA 2IGKA 1JKQC 3KZYA 3HOSA 5CVVA 4KTQA 2K5CA 2D0CA 4BRDA 5DCFA 1NK3P 4C92B 4ILGB 1NJIR 3NF9A 3M8PA 4F8RA 2FJ1A 2XY5A 4PL8A 1LWWA 2KIUA 1RT5A 2JK3A 2UXNA 1VQNQ 1KK7A 4A57A 1S22A 3S6IA 3CXCS 2VI6A 2MF2A 1VQ9A 2FMLA 2P5LC 5M1QA 1UA1A 1XD7A 4UNFA 2LFBA 3CWAA 2FVUA 2DDAA 2L9NA 1HYVA 4Y52J 4HXJA 3AGRA 4L0YB 3GLLA 1JQQA 3HP6A 2D1VA 4CCMA 3BJ6A 2NLUA 3GG4A 4EMKB 1IAWA 2OQGA 4DQ8A 3SI6A 4MMKA 5JHFA 1HCRA 2RHKA 2EVRA 1GLLO 3CLOA 3LWIA 2KZMA 3NBPA 5KYWA 3JRFA 2I5WA 2P9UA 3JRGA 2YXYA 4E7KA 1OQYA 5IT9K 3P38A 1RFQA 2VXZA 5E84A 3HHHA 2BTTA 1VQMN 4BRMA 4ZNXA 4AYBN 2HBWA 4L9NA 3TAEA 3GZ6A 3FXJA 5CKTA 1M1KU 1FLIA 2F5CA 1NJIO 1KD1R 5LJ3d 4FM0A 1SFKA 2DMUA 2KHOA 3ESWB 2VXFA 2W6LA 1SSHA 3EEQA 1U5SA 2IS2A 5B66C 1RADB 3GL1A 3L1PA 5A0LA 2A07F 4J01A 1XGNA 2UZKA 3UKUA 3F70A 2CZ1B 1KC8U 3F8CA 2XF5A 2F5FA 4U7BA 4A53A 2WOMA 4LSLA 3M54A 4HV5A 1MMDA 3T9NA 1NMDA 5GAMf 1GT0C 3GNFB 3REAB 5EZGA 3TDZC 3PO4A 4A61A 2P9KB 3AVNA 1VQOA 1DTTA 1BL3A 1RC9A 4I6MA 2RHIA 2LREA 1ZYQA 5KCHA 4NBQA 3VEXA 1B72B 1IGNA 4JPBW 3G1MA 3I58A 1KAZA 5FJ8J 2LKSA 4IRHA 4NCGA 1BQNA 1IGQA 4M78C 3SUQA 4E89A 2Q31A 4BY6B 3ULEB 4CH7A 1RAEB 2M0YA 2IAJA 3FJ5A 4LF9K 2LDUA 3E1SA 4PUSA 1T39A 2RN8A 2NRHA 2XO7A 3GF5A 4OVLA 1KD1O 1G3TA 2ROLA 4OLBA 5HK3A 4HA8A 3A1YA 3PX6A 5TKWA 4RTXA 5GAEJ 5AQFA 4FX0A 4E9FA 4ILHA 3MKDA 1ZC6A 1BW5A 2A41A 1IZ6A 3BJOA 4KRTA 5GTIC 2X51A 2GQQA 1X1AA 4OWRB 1IHVA 3JAMO 5BMZA 3ZN1A 3CVTA 5AQXA 2R7SA 1SHGA 4XU2A 2OF7A 4IEEA 1JLFA 1YJWI 1VQ7I 2AK5A 1HQEA 4JJDA 3MAJA 4XK4A 4FW1A 3PFYA 3RTRA 3OYBA 4H03B 4IG0A 3HSFA 2G8WA 3F23A 1G4DA 2P8TA 3AAFA 1VHXA 3OS1A 2CDTA 2YHYA 5F08A 3CCUI 2X6WA 3HOYJ 3I55Q 3CQZJ 3SZGA 1NLPC 4DV4K 2ASPA 1PUEE 2ZO4A 2JA7J 4NS5A 2K3BA 1N9SA 1TK5A 3D7EO 2DMQA 2OTJT 1N8RC 3G25A 1WH7A 3ZT2A 1VQ8A 2VKVA 3RQ4A 2HOSA 1SF9A 3R9PA 4DOWA 2L3DA 1P6RA 3LSIA 1OVYA 2EHGA 4EMKA 4PJOE 1NKCA 2GGRA 3PTAA 4FE4A 1XGSA 1D3BA 4RW6A 2DA4A 2QF7A 1EIFA 1FC3A 4I2PA 2E1YA 3ZQQA 2MK5A 3AGKA 2JTVA 3BUZB 2VKNA 3U21A 4OMMA 1QNTA 5HODA 2JOYA 2Z5UA 1LWCA 4W5TA 2QQBA 3HFOA 4XICA 3LAPA 3IAYA 3FXUA 4PJLA 3HGYA 4X62K 1RTIA 2L7ZA 3RSEA 1TOVA 1KQ0A 3EPZA 1VSLA 4LLNA 4DTNA 4E1JA 1BR4A 2KRSA 4LDWA 2ZMEB 4BC2A 5I21A 1P90A 4EJWA 3EL2A 3BEXA 1SS6A 2DTOA 2CP0A 1YIJT 2CUFA 1R4MB 3IFRA 3E97A 3VRZA 2I7PA 1WVRA 1FMVA 1MNDA 2YRVA 1X1BA 3H0FA 2HVQA 4GY2B 9ANTA 4DFPA 1LUJB 3L0QA 4IL6C 4HDUA 1EZZB 4UB6C 2M8EA 2OTLN 2EGCA 2RO0A 5KQDA 1LDDA 3CD6T 2H56A 4WTOB 1MUYA 1M8VA 1SKUB 1NMNA 1A6IA 1T03A 2IW5A 1FJLA 3CFRA 4M75F 1WSUA 1B72A 1WJRA 4A4KA 5FRMA 1LVKA 3U3GA 4MLOA 1GLEG 1T98A 3MEDA 1K7AA 5AQPA 3QEVA 2ZD1A 3OW2A 4L3QA 3ULEA 5SZTA 3FDRA 2DKGA 1W4MA 4IG3A 2F4MB 2HHXA 4A69C 2FQ4A 3KD5E 3HL8A 3O1WA 5GPAA 1IRGA 3O4WA 3ZR8X 2Y31A 4M7DA 1B4AA 1YITI 1S1NA 2DZ9A 4PKHA 3PV8A 4A2AA 2VODA 4JJCA 3G71I 2VKEA 4CGDA 2HHWA 1HJOA 3JSPA 2AZVA 1NGCA 5AN4A 5GAOm 3PMIA 1RETA 4V19S 1YS7A 1E17A 3Q0VA 2D0QB 4DTJA 2HVRA 2D9TA 1T8IA 4X0GA 3VEYA 2QVOA 1BO5O 3OSSC 1MJBA 3AVLA 3VA0A 1U3EM 5KYUB 1A35A 4CC4B 4CZFA 2FZGB 2YCHA 4DYQA 4QS7A 5LGNA 3R3LA 1XNQK 1ZBUA 2DA7A 3OIQA 2IRFG 2FBKA 1JCEA 4DQPA 4UY8I 1V5FA 1R6RA 3NWSA 2C0IA 1Q7YU 1GLAG 3VA3A 3VB2A 2R5AA 5C0YA 1BBYA 1VQ9N 2LBFA 2ASOA 4ISEA 1KZHA 3WODF 3A8LB 2E2OA 3MMYB 4F3QA 2LQ8A 4HTUA 1LNXA 1D8KA 2IBDA 4FW2A 4M75D 5FDLA 3PY8A 2AXTC 3O9RA 4L9JA 2YLBA 1H3HA 4MZPA 1W2BS 2O3FA 1ZK8A 2X6NA 5HLTA 3I56N 3SDZA 2Y0SN 1OZ3A 1RRQA 4O8KA 4Y0WA 1X6BA 4LIUA 1JLGA 1JHFA 3FFIA 2WUSA 5JVGL 1GXIE 2MC3A 2RQUA 4FT8A 5C4JJ 4CGGA 4KV8A 4M7DF 1X3ZB 2E1NA 5AQNA 4N0AA 2UXXA 1P59A 4LC9B 2WB1A 5BPIA 2P4WA 5TJJA 1SHFA 1N75A 2QDYB 4FM4B 3ID8A 4MFEA 2LMDA 5D5VB 4C2UA 1JJ2S 4XKBA 4ZGJB 2HNZA 3ZSYA 3IRXA 4A0ZA 2FRWA 1BG3A 4P9UA 3X25B 4WCGA 4M78B 3K2AA 3L2WA 1R22A 1VQ9Q 1ZBLA 1JLEA 5J1UA 4FPAA 4DSIA 2KYMA 2ABKA 4RM3A 2YG8A 1E6HA 1XWLA 3QKJA 3LQRA 3S17J 1R0CB 1BL0A 4JN4A 4AFSC 3KK2A 3NFCA 1FXXA 4PGGA 2BOLA 3OYHA 3R0JA 2E1OA 5FFXA 3GFIA 1RUNA 5HRSA 1B6AA 1K0XA 1DUXC 2FPFA 2VIXA 1YXQA 3V9UA 2R5MA 4KDPA 3MP8A 4DOZA 4FIBA 1D5AA 1MH4A 1U5TA 1CF7A 4JZ4A 3ZEUA 3GZNB 1FP2A 3AVIA 1IO2A 3MKWB 4E9GA 2BE9B 4EJUA 4HKEA 4Z02A 2KK4A 1VFCA 1BK2A 1OU9A 3DLEA 5M5WJ 1Q82R 3T7ZA 1BUPA 2KT0A 4DFJA 5F04A 1NJZA 4E1NA 4B9XA 4C1NK 2EINH 1ULYA 3VETA 4JZ3A 3QSUA 4F52A 3DCFA 4FTHA 3ZQHA 1U1TA 5DPKA 1H641 1O3RA 2IDOA 2K4BA 5LEJA 3EGUA 3LA7A 4D0PA 4AM3A 3KLEA 4DR6K 4JAXA 3F0CA 1FN7A 4M3RA 1TUDA 1IBLK 2HHVA 2RA2A 5M3MJ 1W5CC 1QP2A 3AT1B 2VUMJ 2AHQA 2LT4A 1KU7A 4C8QE 1ONVA 1XC9A 3I64A 4M73A 1YTAA 1VQOQ 1MGTA 3HBLA 2G8VA 5F0FA 3AO4A 3IH7A 2K2MA 2ABLA 4P9FA 1AOJA 1S1XA 3KIOA 3BG9A 3SMPA 5CKDA 5EX5A 3WTTC 3MFKA 1U47A 3KP6A 4BY1J 1VQ8N 3MN5A 1AT1B 5LJ5d 3S2HJ 2V6CA 3L2CA 1DP7P 2A5WA 1NLOC 4K2EA 3H45C 2KGTA 3VS3A 3U9ZA 1Q82O 4BRQA 3DXKB 2HYGD 3N4PA 3IV5A 4G94A 3F2KA 2LLKA 3KK1A 5GAOp 4F16A 3WTVC 5DUKA 2EIJH 1APLC 1RI9A 2EX3A 2EYZA 2BW3A 2FUG2 4OB1B 5EU7A 4YPRA 1VSDA 3K0SA 4KGZB 3AAQA 2LKPA 2LCCA 1XN7A 1WSJA 2M30A 4C5GA 3MXJA 1HYZA 5DCMB 2KIFA 4WQ5C 1KQSM 1YVNA 2GTOA 3ABTA 3JAME 3ZETB 1VQMT 1X3NA 5LY3A 3JRDA 2NWMA 2NLXA 3CPWM 2ZPEB 2E36A 1WJEA 1VQ5I 4UUVA 1LKXA 3CJAA 2P9SB 2YV0X 3DTEA 3WQTA 5AQVA 4FJ9A 3WNHA 2W1OA 2P7VB 4YFKF 1PRLC 4NDLA 3O80A 4YRVA 3UA7A 1S3JA 5AFUA 3DLAA 3W6KB 5EGOB 4HCKA 1JJ6C 3CC4A 2L9VA 2ESWA 2XRLA 4H5VA 3FLGA 1VQ8Q 4EATA 4IUTA 5K7ZA 3LYIA 2QYOA 4BRPA 1BWFO 4CZGA 2JJ7A 2CS7A 2QCOA 4KH6A 3EDPA 1U6ZA 3OSFA 3BT9A 1ZTRA 4II3A 1CSKA 2NAZA 2KRFA 4RTVA 4BHBA 3GFMA 3GP8A 5FD6A 5LGUA 3ELKA 2YNGA 1T3SA 2DTZA 1YG2A 1T0HA 1B92A 4HBLA 1KQ2A 3TAQA 3CEYA 4DF8A 4CSWA 3ONQA 4AIHA 3A8YA 4CBWA 3H9JA 1TZLA 3UA6A 3OJSA 4GCVA 2XHIA 4KHNA 2ECBA 3T8RA 2RNGA 4J00A 3TR8A 1N5YA 3SZPA 5BR9A 1AD5A 2O4GA 4WK8F 2VOPA 1ILYA 3D0SA 5JI6A 2JA5J 4CEEA 5IY5H 1YTYA 3N4MA 3IC7A 1U2VA 4FLTA 4A62A 1TAQA 1WAFA 3THXB 3VMFB 3ZN0A 5KVRA 2XDVA 3DYAA 4E47A 4DMNA 3I0SA 5BS6A 4NQWA 4A6DA 5HKCA 1S8NA 1F36A 4ESJA 1SAXA 5C24A 1XOVA 3Q5FA 1ACIA 2O0YA 3KX2A 2WAEA 4B3SK 4B9LA 1QVGS 1J5OA 1VZ0A 1YFHA 4OIOF 4UQGA 1NGEA 1X2KA 3BZ6A 1RBSA 3JCMe 4A5AA 1QO0D 4EW4A 4FLWA 4EZ9A 4BRLA 3V4GA 4QLCU 2COBA 4WXDA 4XH4A 1E2XA 1QZYA 1RBUA 1Q81U 2B0LA 4E70A 1WEFA 3S41A 2XPWA 2QWOA 1ZQ1A 4X1EA 1YJWA 3BR0A 4ZGEB 1VQ7A 1G3WA 1YO5C 3SQNA 1FOWA 3FHFA 1RAGB 2KE9A 4OPHA 2E6NA 1KEAA 1K9AA 3BFMA 4KAZA 1B9MA 2FE3A 1J54A 2RQRA 4C9YA 3CCUA 3HUGB 2XIGA 4RMOA 3RERA 2VYTA 1VSKA 5CKEA 3FXLA 5DCMA 2NOIA 4CD1A 1YQLA 1ERDA 2WB1N 4H5RA 5M1NA 3G73A 1LWVA 2JGUA 1KQSP 1IV8A 4JRIA 4RTZA 3VS6A 3ZQGA 2P9SA 5CK9A 4OMOA 3FXQA 4BRFA 5A2QK 4DQIA 1ASWA 2KLAA 4OFHA 3BGRA 1YX3A 4GGGA 4FWMA 1QTMA 4BL0B 2CH4W 5HVQC 4FM1A 4A3DJ 4F9OA 3N0UA 4I9QA 1GHCA 2IG0A 4EJZA 1BI1A 1YQKA 1QSYA 2DL5A 5JFRA 2OCEA 1ZR2A 1MBGA 2YLCA 3RDVA 2KFZA 3RMQA 3I35A 4GMJB 1SC7A 2A7YA 3ULDA 2QQAA 2XDDA 2OTLT 2DEQA 4JRQA 2EJ9A 4H0XB 3CCLT 3C6AA 3MKLA 4M74A 5AQMA 1K9MU 3IH3A 3A01A 2W25A 4O6JA 4EA5A 3DU6A 4MGRA 4C92E 1QQNA 2DMOA 4BE0A 3THVA 3GO5A 4Z4GA 1XQPA 1HSTA 5GAN4 1N8RR 3Q0WA 4CEZA 1DU6A 3DTIA 2XG8D 2KSSA 4DU4A 4RB2C 1S5JA 4MTDA 4QQDA 4RAGA 5F1JA 4CJ7A 3CMYA 3L2ZA 4CBXA 3OIPA 4YELA 1M1KC 2L3SA 2PJPA 2IIMA 3CCEI 3LSGA 1HK9A 2UXCK 3DEWA 4B43A 4FWPA 3OYEA 1YRNB 1XG1A 2BBYA 1U8RA 2LJ3A 1WIEA 4ID5A 2GTDA 1KC8C 4QPOA 2HNIA 4JX4A 1WLPB 2R7TA 1D5YA 3PVLA 2E88A 1S1TA 3ID6A 3IKVA 2ZPBB 1YITA 4M77A 2A3ZA 4A63B 3EQLF 4JKFA 3KHYA 3I0TA 3LQQA 1UECA 3F9KA 4DSLA 3G6EA 2CZ0B 4RB1A 2CH5A 4CHUA 1EF4A 3O9TA 2JPCA 1TKTA 3Q1JA 3LFKA 1EP4A 1VQ9T 3KZIC 5GJWB 3P83D 1GCQC 4II2A 3WXMB 1FIAA 2G8KA 4II1A 1R9TJ 2VGNA 1TV6A 1BU6O 2PQ8A 1BISA 1N8RO 4A3IJ 1YHQI 4Y3OA 1X9JA 4DOVA 4ZYEA 3B6OA 1ZAOA 3MO8A 2WAFA 4XN3A 3QHSA 2LF7A 5E3MA 2HQAA 2M1BA 6AT1B 4XTZA 3F72A 5LD2C 3QEIA 3QODA 4JKEA 2ELKA 3I56T 2L7KA 3CDLA 3DBRB 3HUGA 2VE8A 1WH5A 5EC7A 4NO7A 3F5TA 4R55A 2BZXA 1Y0MA 3CQYA 2DN0A 1WAJA 3O3GA 1UZCA 1R58A 3VKIA 2O4IA 2KIMA 3JREA 2GXBA 3NF6A 4FT2A 2G8HA 5DY9A 4E3SA 5J2MA 1IN6A 2BVMA 4N4IA 4PSXA 3CQXA 5CZ1A 2LSNA 2NUPB 3R0AA 1UGSB 3BF1A 3SUOA 3M4GA 2E71A 3ABKH 1HBXG 1QPMA 2QA4I 5GAMg 1OH5A 4BVPA 3S1RJ 2JUCA 2DM1A 1FKOA 1EX4A 3CC4N 4M77F 3UT1A 1MGQA 4B23A 3CDIA 3G4SA 2BANA 3ML6A 3W3DA 2QDLA 2KDOA 2MABA 3H0DA 3CCSI 4FASD 2LNBA 3QOPA 2DPPB 3LSTA 5M5YJ 3WT0A 1OCOH 4OMLA 4DR3K 3LDLA 1NJYA 4FQGA 5KYYB 4C8NA 2C06A 5IP6A 4K11A 2PVDB 1UCRA 2QK0A 4UVBA 3P8HA 2LQNA 1K1ZA 2RQTA 3KUFA 3H08A 2X1CA 3X26B 1XB4A 1YI2N 2NUTA 2L0KA 2B86A 5DUIA 3DEUA 4LIVA 4N4NB 3ZCMA 3HI0A 3K1PA 2RI5A 2V7ZA 1DGRM 3KLIA 4FLVA 2GZWA 1K8AU 2ELHA 1EKEA 4CJVA 3IH4A 2RPNA 2VG6A 5D6YA 1YRNA 3RI4A 1BIZA 3S15J 3BTLA 1KFSA 1VYVA 2JN6A 2CGHA 1OH6A 4GVEA 1BA0A 1OH7A 1Z1DA 5J4YA 1LPLA 3NRVA 2FPDA 1WXBA 2CYZB 2K3YA 4IZ9A 3SYZA 4DUYK 2RGVA 3CC4Q 4GV3A 4M3YA 3FRNA 4MZMA 1KQ8A 4DQ2A 2K9SA 1WHGA 1I1JA 2M51A 4W5OA 4M77D 2ZJQF 3HRTA 4I6ZA 3LDPA 1VYUA 4KT0E 2JMCA 3I0WA 1R59O 4KBMB 4PUOA 4ANJA 3JCMP 1B1BA 4HF2A 3G1JA 1EO1A 4M7XA 1ZREA 1MUZA 1YIOA 3RIRA 3AKZA 1T8EA 3P9CA 1VQ7N 3M8RA 1ZHIA 1MV3A 1VQ8T 3A4CA 4JLIA 2DW4A 3OYYA 2QTXA 4M9XA 1MJ9A 4L8RB 3GVAA 5C6SA 4OGCA 2DERA 3INZA 2GBQA 2MLGA 1R8OB 1OV3A 4BE2A 2DFIA 1WSHA 4CJRA 4AHTA 2H1KA 1N27A 4Y13A 3TMOA 1TK0A 2ZXIA 4KISA 2PY5A 4QSHA 1OCZH 3K4KA 2GUIA 4CZZA 3JB9F 1N33K 2EV5A 2I7NA 1VSMA 3AVAA 2JVHA 2YS9A 3DLHA 2KFDA 1OJLA 1DKGD 4G9YA 1PNJA 2O8EB 1QSLA 4C8KA 3DTKA 3WU1B 4OIQF 4BRKA 2NUPA 2EWSA 3E6DA 2K27A 4EFHA 1NJXA 4JP0A 2XSJC 2GTJA 8ATCB 4DR4K 5K5RA 1ETQA 4WF9L 3HGGA 3CIPA 2W0ZA 1MIJA 4G8XA 4BQZA 2XAQA 1YCYA 3J80Z 3OHRA 1AHJB 5FLVA 2XRNA 3S6WA 1YJWQ 1VQ7Q 3DPLC 3QDRB 1JXOA 1OKRA 1IXRC 5KYYA 1CLQA 1IN8A 1JTYA 3I71A 3SAFA 4CCLA 1TLHB 5TRDA 1W36D 1KVBA 3VERA 2WONA 3M9QA 1S6PA 1QS4A 3LZJA 3DWLA 3CCUQ 1Q86C 1TQPA 2JHJA 1DT9A 4OIPF 1WQWA 4FSVA 4DSEA 5J26A 2NS8A 1PSEA 2JM9A 1O1WA 3OH6A 2W41A 5IXBA 4WX9A 5K14A 3VPZA 1LEBA 4DLGA 4B4CA 3C7NA 3AG4H 2YPRA 4AQYK 3MWPA 3SK3A 3TU5A 1UG0A 1MBEA 3U1KA 1ZBHA 3BTIA 2Z33A 3JB9D 3X24B 2CZ6B 1OX8A 4DTOA 4QS9A 3QMLA 1YBYA 2FBYA 3A5MC 1VSFA 4FWKA 4RTYA 3BPXA 4BREA 3PM1A 4J6XA 1A5WA 1Y39A 4J2DA 4Z6YA 3VQ8A 4BQLA 1C1CA 3BC8A 2K02A 2UUZA 2D5RA 4B44A 5FU7C 5LL6S 3GIBA 4RAFA 3LOCA 2MWPA 1W7PA 4LF6K 4J8OA 5AQTA 2P0QA 3RNJA 3CCQA 2QQRA 3ZT1A 1WJBA 1YW7A 5LJ3j 1TT0A 2CS3A 1IKVA 1P4WA 2QG9B 1X01A 2HBMA 3G6EN 3AARA 3CC2A 2DXCA 5DM6F 1IKYA 3M8FA 2Z3YA 3I33A 1OX9A 4D8KA 2DA1A 2FEZA 3EUKL 2X6OA 2F2EA 3G1OA 1YLFA 2VQLA 1ATSA 2ZXWH 1WLJA 2O88A 3RRHA 3J7ZI 1RUOA 4DW6A 3T1AA 4Q5SF 1SV5A 2L5QA 5F0XA 4M72A 2RJEA 1E3OC 4DZPA 2OJED 2V75A 5ELZA 2UUBK 1HKBA 2UU9K 3M0RA 3TTCA 3EG0A 5IHIA 4QPQA 1ZG5A 1SVOA 1Z77A 3FMRA 5GMKl 3HOVJ 4R8HA 4CJ5A 4LUDA 1Y07A 2BUDA 3CO6C 2DK3A 5GP9A 3BTJA 3A8GB 6PAXA 4CIFA 5GINA 5LJ5h 2XICA 2EA2A 1VQ6N 4F17A 1SFUA 3M0QA 1Z7UA 3Q9VA 4WFBL 1Z9CA 3LP0A 1M3CA 2Y4XA 3OYCA 1B7TA 4NCAA 2Q0UA 2WC9A 4KB0A 1YITQ 1QW1A 2CSQA 4OJRA 4M41A 2VBWA 1H0MA 4CJUA 4LK0F 4AH9A 3G6EQ 2DNUA 4OMZA 1QCNA 2HHTA 5TISC 4NCBA 2P9IA 1ZRCA 1QU3A 2CFXA 4LDYA 1HD3A 3MEXA 4M7DG 2COYA 5C15A 3J7YP 3G4SN 1G8XA 5D4SA 1BU1A 1JGGA 4AIKA 5KH6A 4XAXB 4JLHA 1P7IA 2ZNYA 1MSEC 2KEAA 3BDPA 3SEMA 1G3SA 3M55A 2JTFA 2ATQA 3CI5A 4FJHA 1NGNA 5LJ5e 1PD0A 1WJSA 5KPTA 2EJFA 2W57A 1L0OC 2Y90A 5DD8A 2RDPA 3CCRI 1IG8A 3A0HC 1NGJA 3GBTA 4M3ZA 3D4VA 1ZLKA 1RDDA 3IMXA 1V4RA 4QT7A 4IHYA 4BDZA 1G3YA 4P1WA 2EYWA 2NOJB 1SZ2A 1R4NB 4ME7A 4M7AE 5GADP 1YS6A 3KNTA 2QZ8A 1QVFM 1RT7A 1G2BA 2KQRA 1NGIA 3OBWA 3R61A 1UE9A 1XQOA 2V8KA 5D3GA 1V29B 1RKTA 2IS6A 1D1BA 3S1NJ 2E70A 3TARA 4DU3A 3WEEB 3X2QH 2BTFA 5KN9A 3J7AF 3CWUA 2CZ7B 2Y4YA 2LVMA 2LYCA 3RRGA 4BR2A 4JRPA 3PL8A 4FYYB 2K5FA 1OKJA 5JLFA 2L3RA 1IW7F 4MFBA 4UHTA 3VQPA 1PUFA 4KUIA 2FLOA 2OYQA 2LF8A 3A0IX 2EV0A 2XF7A 3VEWA 3ERED 4LDVA 4DTMA 2DD5A 4EJVA 2DFFA 3LM2A 2XHCA 1BR1A 3G4SQ 3I5RA 1XQSC 1W7PD 4XKCA 2KMUA 4CJLA 2A6HF 3L2VA 5CYQA 2GOXB 3VJPA 5E41A 4QVCA 3C6TA 4CVNE 3LDNA 3ZSRA 1J5YA 3CCEA 3F22A 5H20A 2AP1A 5I3UA 1HYSA 3MQ0A 1ITGA 2BDPA 3SEZA 1W36C 2D6FA 3PNYA 3QWLA 3MVPA 4BC3A 3MWMA 4FZYA 4CJSA 2VLAA 2XVCA 1ZSZA 1JCFA 2FF6A 2ME6A 3D2EA 1U84A 3I4MJ 4HSRA 1E6GA 2FNPA 1ORPA 2ELJA 2VQEK 2PYLA 3SFIA 1MUDA 4RB0A 3C6UA 1L3TA 2A1SA 4JI2K 3IKTA 3TPQA 1MA9B 3CCVN 2JUGA 5H6RA 5GPCA 2EYYA 5JVHL 4JBAA 3NH0A 5CVIA 3ATUA 2Q2EA 4IFEA 4AFQC 1NK5A 4UUSA 3CJ7A 1KQSA 4HAMA 3AFHA 3SZTA 1FOXA 1F21A 3MD2A 1L3SA 3CXCP 1EA3A 3KLNA 1Z3YA 2ED0A 1FOYA 3DP7A 1C6VX 1MBKA 3DB4A 4ABZA 1UFFA 1D1CA 2M7BA 2CO5A 1YHQA 4AHVA 2VJIA 4I7FA 2ZJQL 5AQJA 3P9IA 4EM0B 4EV0A 3H8ZA 1WFXA 3G1LA 4G6TB 1N9RA 3J81O 1QZ6A 2XAUA 1M1KR 4OB3B 3KP3A 2O8FA 4IF4A 3L09A 4M9ZA 2HDWA 5F0CA 4H4MA 2JWKA 3Q7CA 1VSHA 3D5LA 4BS9A 1BC7C 1N36K 1UFMA 4CI0C 1PCXA 2BXZA 4J9GA 4FJNA 1KC8R 4KN4X 1VQKN 5FPMA 3CC4T 2FF3B 4MIMA 4QAGA 3DOKA 1HUXA 2EQMA 3V1OA 1S9EA 3BG6A 2XC7A 3CC7I 4F7UA 4PA1A 2HOTA 1U6GA 2HSPA 1K4US 2CGJA 5KRSA 3SZ2A 2R92J 1T33A 5FU7B 4A2UA 5DMRA 5B8HA 4RCHA 3SD4A 1XHZA 2DAQA 2ETHA 4AHSA 1YI2T 1MZBA 1KAXA 1X1PA 4GXOA 4CC7A 3C6HA 2OI3A 5AQQA 1PVSA 3VQDA 3WEEA 1I81A 4BG9A 2QEXN 4W97A 3ZSWA 3A02A 2DZCA 1X2MA 1YJNA 5DYMA 3HRUA 5L3GA 1M1KO 3K2ZA 3H5RA 5CAIA 3K4LA 5D5UB 1JXBA 1V4TA 3F9MA 2QXLA 2PLYA 4YOVA 1T0FA 2X0LA 2OAWA 3QJYA 4ISFA 3HC7A 2VWJA 2L54A 3LSRA 3E5QA 5CLSA 2HKQB 3IRQA 2COWA 2W48A 4QIWN 4ZYHA 4B22A 2WV0A 1KC8O 2YI1A 2A69F 3PLAA 3CCQN 3THWB 4KI4A 3RR6A 1O3SA 3WGIA 4CGIA 3HFNA 3A8MB 4B1ZA 2LG4A 3CC2N 2K4YA 4XRFA 1T0JA 1QKXA 1JL1A 2ZFWA 3ZCOA 5E18F 3MN9A 3SPYA 4QCLA 4WYBA 4YPHA 2FMYA 3W2AA 2DYIA 1NGBA 2X4HA 2V9PA 2H8RA 5LHHA 2M4GA 1VOMA 4AHCA 1D9DA 3BR6A 2GQVA 4AF1A 1OVQA 1ZUKA 1AWCA 3ZQLA 3MXMA 3FMSA 4F7UF 2I5JA 2HKOA 1B59A 4XSZF 2M34A 2A3SA 3GTQJ 1VQ7T 3E6MA 2CP7A 3BY6A 4H0EA 2F4OB 2CSOA 4Y1CA 1RDAA 4CK2A 5IHKA 3LH5A 4DSKA 3EFOB 3A5OC 3TANA 4E6KG 5ICEA 5L23A 1M30A 3CPWS 2O5RA 4BJTA 3A98A 3TOBA 2F5VA 3TEDA 2Q0RA 3QLHA 4R79A 4XU3A 1KG5A 4UVAA 4KH4A 4DEYA 2IS3A 4M3TA 3CUOA 2W7NA 3J80O 5SWMA 2LC4A 5FGMA 5JS1A 5IT9O 4BQAA 2CGKA 2H6BA 4CC2A 3CCQQ 1XCBA 1AKHB 2IEKA 1S9HA 2CUBA 4XH5A 1NKBA 5DM6L 2FBTA 2JTMA 1PKTA 1W0TA 3CC2Q 5ED4A 1WJQA 3F8MA 1KG3A 4DKWA 3L6QA 4N4HA 1WPKA 5IT3A 7AT1B 1W0UA 2R7YA 5DM7F 4NL2A 4H0OA 4EHTA 3S9HA 4ICLA 2E3HA 4WWCA 3CJNA 3IG1A 4CHQA 1OISA 2F8TA 1IH7A 3GUDA 2TDXA 2DL3A 2JNGA 3O8VA 2QAZA 2E12A 3OS5A 3J7YJ 5CKBA 4M3FA 4I0BA 3FSPA 1RAHB 2BE7D 2RVCA 1USTA 4MMLA 3F21A 3B8AX 3TKYA 4XLAA 1VQLA 1JJ2M 1SL1A 4C8QC 3CFPA 4G6DA 2P9PB 3FF5A 4PL6A 4UXNA 2KNBB 4BACA 3SJHA 4DBHA 4A0XA 5HS9A 3KETA 4DSJA 2QBYB 3OMCA 3H46O 3R60A 4Y33A 5KE2A 2RHXA 5E20A 4KA4A 5GADJ 3LAMA 1VIEA 2PZ1A 4YNQA 2CP5A 3QAHA 1ZBJA 4I09A 3MN6A 4CZMA 4J83A 1RPWA 2OX7A 1BA1A 4BROA 4DS4A 1MHNA 2JZ2A 3PT9A 2K2VA 5DEQA 3QEWA 3ZP5A 4DBFA 2XGCA 3RMSA 5LRSA 4PKIA 3ZYYX 1GV5A 2V52B 4CYCB 2M02A 4BDPA 4W5NA 4ILJA 1PU7A 5J3LA 1V5GA 1HW1A 3THWA 4A5BA 1GLDG 2H8WA 4F3TA 3OL4A 3HIFA 3B6AA 1J2XA 4FU6A 2LJ0A 1NKUA 1BI4B 4M75E 1SAUA 1M1GA 4DYCA 4PGHA 3I9QA 2H1LA 2IGIA 2V1DA 1ZN2A 4CFDA 3HVTA 1ZR4A 1GLNA 2KAFA 3EGXB 3G6ET 1Q7YR 2YKMA 3H0IA 3CHWA 3O9UA 1H9GA 4B9SA 1HYOA 3E9GA 4Z94A 2V1XA 4ELYC 3M59A 3JAMK 4J2AA 2HQHA 3QZ5B 1RGIA 2IS4A 3I59B 1UMQA 3S93A 4G6QA 3E9FA 5FPNA 3RR8A 1Q9YA 2MSYA 4Q0BA 2OAUA 5HOOA 3MEAA 3DXJF 5LJ5f 4HX7A 4XOTA 4RAYA 5JLHA 1RRSA 1PHTA 5FRNA 5HDKA 1HSQA 3A1PA 1NGAA 5C10A 3MEWA 3NVKA 2LP5A 3NCIA 3EG1A 1MKMA 4M6XA 1NNEA 3QDKA 3MZ8A 1NK7A 3QPLA 4DBQA 1PM3A 3LWHA 2O2OA 3WE3A 2RKIA 4M3XA 4J9FA 4GY5A 3F6OA 4DJAA 4ZZLA 2R3SA 2KZZA 1VQ6T 2FXUA 4JUVA 2LY1A 3O5BA 2XKPA 4RKUE 2VWKA 4FLXA 4B1VA 3HXLA 3SUNA 1FK9A 2LOOA 1W2BP 3V7SA 3BLYA 4PL7A 4XNFA 2IPOB 2F5KA 5IP9J 3CCEQ 4LF8K 2E5NA 1K6OA 3CF5F 2VQCA 1JO8A 4WFNL 5GANd 3F8BA 4JX5A 2JA8J 4JS4A 4IHXA 5GMKi 2YNFA 3QIIA 3CJ9A 4OAZA 2VBXA 4HQEA 4JK8A 1FIPA 3G4ST 3NGIA 3T69A 4A5MA 3VEVA 4PJOA 4OPAA 1WI7A 1D8JA 3SQ4A 2E41A 4ON0A 1F1BB 3CCYA 1I4K1 3MCZA 1KD1U 4CIGA 2P9PA 4J19A 1VNDA 1ZUUA 1HKSA 1MNMC 4CRIA 1Y64A 4S05A 1JJ2P 2JSPA 3FE1A 2H94A 4FO0A 3FJPA 2KIQA 4ZC3A 3B6CA 4DR2K 2WSEE 1Q86O 4DTSA 4M77G 2FA5A 1UG1A 3QYEA 3BCAA 3L4IA 2IVWA 3MN2A 4B1WB 1KIKA 1D0ZA 1OU8A 5J2NA 3F8FA 3EN9A 2X4JA 1YHQQ 4A59A 4HV6A 1G6NA 1YJNN 4FJXA 2JQ7A 4EVIA 2R5ZB 2IVNA 4ZYGA 4DV6K 4IJAA 1J5EK 1D0YA 1ZGWA 1D4XA 1ASUA 3K57A 1IRFA 5FB2A 3FHZA 2PG4A 1E3HA 1Q95G 5HS8A 1FZPB 3HRGA 2ESNA 1LMZA 3J81E 1FMKA 2XB5A 1OZ2A 4B3OA 2K7LA 4NHJA 1RTHA 3QRFF 2HNHA 5HLIA 1I6HJ 4GNIA 2F4IA 4KHUA 1NZ9A 1VQPN 4RBOA 1SMTA 1I8FA 2E2IJ 3V9WA 4H5TA 5ICGA 1U49A 2EWNA 2VT3A 4DLEA 1H3ZA 2MCNA 4S0HB 2JWLA 2X3WD 2EFWA 3EGXA 1SEUA 3JB9H 3SEQA 5JLWA 2QWNA 4PJOF 2QA4Q 4DB3A 5HRPA 2P6TA 2PU9B 1GOBA 4CE9A 3M0PA 4OB2B 2KDSA 2DFEA 3EKUA 2EFPA 4KICA 2K9GA 4Y4RA 5DDGA 3BDLA 1PKSA 3UE5A 2BXYA 1XG7A 3CBMA 1QVGM 2XHKA 2P9NA 2C0OA 2FQ3A 3PE0A 2UUCK 1IJWC 2OTJI 2OANA 2Q2RA 5BN9A 3CCVT 2ZM6K 2Z1DA 4BXFA 1R71A 5F0HA 3CJRB 4EVVA 2G7HA 5HBMA 4DR1K 4HCZA 1LW0A 2LY9A 3HYIA 3K5OA 4HF0A 1GBQA 1W70A 2UV1A 2HVIA 1X9MA 2L9RA 1AA7A 2DJQA 4YFXF 3W0LA 3ZMZA 5AZJA 4V19K 3ZQCA 1O9SA 5ILSA 4XM3A 4RW7A 3W2VA 5EJCA 2QKKA 3V1QA 5D8LB 4C8QB 1PP8F 5I22A 4YFUA 1IC8A 3CJCA 3FR0A 1SRLA 5J3BA 2EILH 5EEAA 4JOMA 1AWOA 4D7MA 1ABQA 4OKEA 4CD3A 3S8PA 4A3FJ 3UDCA 2MPXC 1SUQA 3WNFA 3MP6A 3JB9G 2KRHA 4JQFA 3JTHA 1P4AA 2CQXA 1ETVA 2EIKH 5FWCA 1P9QC 1YIJI 3WXLA 3PSFA 1VQKT 3LSJA 3PIOF 4PDKA 4FWOA 2G8UA 4UUTA 3GTJJ 2FHDA 1X4PA 1VQLN 3K1NA 3J7ZO 2DTHA 4JD2A 4OPJA 1B8IB 5D5WB 1D09B 5D6XA 3CD6I 2EPDA 2GWJA 2LVSA 2HL3A 1RILA 4XTXA 4LF5K 1WRJA 2F4VK 4JYKA 2LRQA 2KLOA 4FM2A 4UVCA 2QI2A 4B6MA 2H6CA 3LANA 4BRCA 2K79A 2D8JA 2DTIA 4ELVA 2QGGA 4B3XA 3GFLA 1OR7C 4XSXF 3DLLL 4J5YA 5CQYA 4HVJA 3I55A 2FSNA 3J80E 2Z1HA 2QEXT 3K59A 2R7FA 3CC7A 1X6OA 3FZMA 5J40A 5IT9E 3ALYA 1IKWA 1W6XA 4CDGA 1U45A 1XS9A 5L3CA 1W7AA 3FZLA 3SV4A 5DM7L 1QMCA 3FM5A 3MCAB 2K9MA 2D0PA 3Q3SA 2Y9ZA 4N76A 5E79C 3HZ6A 1B34B 3L2UA 4FX4A 1I5LA 1PWTA 2OAZA 2CUZA 5J1RA 3I4NJ 3NARA 2YUOA 1MU2A 3WTSC 2PZSA 4BY9C 1WJ5A 1U8BA 4Z4HA 5FLMJ 3CCQT 5KPRA 4IURA 4IPAA 1KXPA 3A8HB 4LY7A 1C0UA 4IX7A 3CC2T 2O8CB 1VQLQ 2X9DA 1ZH5A 5JR3A 3H6ZA 1Y1WJ 3ZLJA 2MW8A 3MJXA 2ISYA 3HHGA 1ZHFA 2J4RA 2NOLA 3NVMA 5BPMA 4C0FA 3MEGA 3ZSXA 4OGEA 3LP1A 3HKZA 2BY2A 1QVGP 3GPLA 4N56A 4ZYDA 2ZB9A 1WPYA 1IDZA 3RPQA 4E0DA 3DKXA 3CXCA 1U2WA 2KQWA 3KP7A 2HWVA 2M8GX 2QYZA 4XL9A 1DU0A 2R7UA 3D5SC 5AONA 3SDBA 4E9EA 3PQJA 2HOAA 2VJ5A 5M3FJ 2Z0WA 3EG9A 1GOAA 1X3WB 2HF4A 1GDTA 3FHNA 1VQ4A 3C7JA 2F5DA 2KJCA 1A04A 3DLBA 2MH2A 4ZDPA 3JCMQ 4C8QA 3LSHA 4IO9F 1A5JA 3C4SA 2QSHX 3TREA 4HX8A 4M45A 1H89C 1ABOA 4LDXA 4OLAA 1DP3A 2JXBA 2P4RA 5C42A 4MEXF 4L0ZB 5I11A 4HTLA 5AZIB 3HM5A 1ZQ3P 3VS7A 3TOAA 1BHLA 2VUBA 4IHSA 4LSNA 2HQRA 3E6BA 2IVOA 2XAFA 4N0BA 1XMQK 2HQXA 4ZDOA 4EW0A 2IIRA 3QO9A 3WU2C 2MMPA 4NC6A 4YDUA 2BGGA 3OYNA 4OMNA 2WTEA 4EQQA 3CCMA 4FVUA 3EY1A 3UKGA 2AO9A 2ZAEA 3FZKA 1SVLA 1B8IA 2DFHA 2P7CB 4F93B 2ZCWA 3M4OJ 2IJLA 1ITYA 3UR3C 4LG0B 3SHFA 1S5LC 4KIGA 1ETWA 3V8JA 3JRHA 3BR2A 1K9MR 3EETA 2I8DA 2GQIA 1NM1A 2DOAA 4MLEA 2DL7A 1S7AA 3O08A 1K4SA 2DJIA 1S72A 2VG7A 3SJMA 3OA6A 3TI0A 3VYHB 3I0RA 5BR8K 5HLFA 1DIZA 2ZPGB 4Z4IA 4BXUA 2PFUA 1YJ9A 5CQGA 4CYDA 2TCTA 3AY9A 3QNOA 2C0TA 3CF5L 5FO5A 4RUGA 4PKGA 5EOYA 1XSDA 5JLXA 4C8LA 1UDLA 1Z0XA 1V54H 3VTIA 4FYVB 2IXSA 4CZLA 4U88A 4AI5A 1EH6A 3WTUC 5AQGA 3SWNA 5F6FA 5FU6C 3BWGA 2YJEA 1IRZA 1HW5A 4ZGDB 4GKKK 3CMAA 2HMPA 2DPNA 2YHBA 1KO9A 4Q47A 2OFIA 1I6XA 3IWFA 3S3NA 2ASMA 5LHIA 4NOYA 5C25A 2RPIA 1H92A 4BRGA 3HPOA 2CJJA 4HVVA 1TU0B 1LNWA 5L8RE 3O4QA 2RREA 1YFNA 2EAYA 4KN7X 4XQFA 2STTA 3T8TA 3ZQFA 1WI3A 3EH1A 4C5HA 4ZJZA 3VPRA 3NNQA 1CXQA 2R7DA 3VEPA 2CUJA 2E7WA 4PNOA 1N25A 4JKDA 2HAXA 2B9SA 3H0GJ 2KVQG 5J8CA 3R2XC 1OQKA 1WN7A 3CZ6A 2HSEB 4WXCA 3Q7BA 3OYDA 4CBUA 3NAEA 3AVCA 2RKHA 4PZJA 5GAMj 1ZRFA 2DQLA 3C1DA 1JTXA 4YOUA 2KTQA 5HROA 3JW4A 3L2RA 4DWIA 2COMA 2P81A 2J6FA 3HJEA 1LQ1A 1HW2A 1Y71A 2E5LK 1LE8A 3K0LA 1H8KA 1LW2A 2FSJA 2B4JA 3HM8A 3DBHB 4FJKA 3H1VX 4BGBA 4GRIA 2YSRA 5C3EJ 3M4YA 3OS2A 2D45A 2JN0A 4E6RA 5KGWA 1O13A 5JS2A 3VUZA 2GX9A 5BPDA 2A42A 4U87A 1S1UA 3CTAA 4P55A 4J9CA 3ZQ7A 4GYIA 2KP6A 1VQMI 2R57A 4B8CA 1ZYRF 5AZIA 4BI8B 2DOFA 4X9DA 2FC0A 3TO9A 3HPWA 2YJFA 3EUHC 2DT6A 3FZHA 2M0CA 2ECCA 3ULQB 3VS1A 2XGDA 4IDHA