3OYLA

Crystal structure of the pfv s217h mutant intasome bound to magnesium and the insti mk2048
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 111
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oylA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oylA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oylA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oylA03
3ZSOA 4DU4A 1EXQA 4B8CA 1WSEA 2OPSA 4Q5WA 3S6WA 3IRXA 3O3HA 3OJUA 4FLUA 4CEFA 2K3YA 3LPUA 4Z4GA 2RN2A 4CERA 4FJ7A 3VA0A 2HHTA 3OYCA 1CZBA 3C94A 2F5KA 3TAEA 2FBVA 4C8NA 4KKOA 3OYBA 4C5HA 1EP4A 1UOCA 3FDRA 2PYLA 1B9DA 2Y1JA 3PNWC 2RJDA 4OVLA 4Y1CA 2AJQA 3OYMA 1JL2A 4C8MA 3KK2A 3LZIA 3SQ4A 4CF1A 1MHNA 3P8DA 1VSFA 2P1JA 3K5OA 2I5JA 3L3UA 4WE1A 4W5OA 3DRSA 2X35A 1NK4A 1X9WA 3H08A 3ALYA 4FJLA 2RI3A 4IBNA 3MEEA 4KTWA 1YTAA 3BGRA 2LVMA 1BIZA 1S1UA 4EP5A 3O3FA 4Z4EA 2R5AA 3M9QA 1C0TA 2OZSA 2L89A 2X4YA 3NTHA 3OS0A 2DIGA 1JLBA 1FKOA 2EFIA 2VYTA 1WJRA 3NF9A 4F2SA 4BDYA 3TANA 4KPYA 1VSIA 4CJSA 3NF8A 1SL2A 5JS1A 2MWPA 4ID1A 3TR8A 4CJVA 1BCOA 4HUFA 3SZ2A 2P5GA 3QNOA 4IG3A 5CZ1A 1IKYA 1RBRA 2BDPA 1ZBUA 1QHTA 1CXUA 4OVAA 4BD3A 2FHDA 1S5JA 2B6AA 3IG1A 3F9KA 4J2BA 2FBYA 3AO2A 1JLAA 2HNZA 2EKOA 2IOCA 4QAGA 1XWLA 3AA5X 1RT2A 3LAKA 1N6QA 1XNIA 1B92A 2R57A 4DSEA 4B9TA 4N47A 1IKXA 2QK9A 3WNEA 4CEZA 2PZSA 4FLZA 3OYLA 3OA6A 2E6NA 1EKEA 4CGHA 4CJ4A 3ZT1A 4O0IA 2F8TA 2XDPA 2XK0A 4ZTJA 3LLRA 2YNFA 3DI6A 4DU3A 2HVHA 2DY4A 1NOYA 1L3TA 1K6YA 3KLIA 3LP1A 1J5OA 3OYDA 4KHUA 3QETA 1VSMA 3MXJA 2GFAA 2NLUA 4FZZA 2HW3A 5HP1A 5HBMA 4E89A 1RT7A 1JLQA 4ELTA 3V6DA 5CYQA 2F8SA 1TV6A 4KB0A 4PL6A 4Z4FA 4DS5A 4HCZA 2JTFA 1W0HA 3OVNA 3VQ8A 4CGDA 1HJRA 3KD1E 3AO5A 3MXIA 3ITHA 1G15A 3DRRA 4RW6A 4DQRA 1X9MA 4DTSA 4LD6A 3JSMA 4JRQA 4BDPA 2R5MA 3ZT2A 4CECA 4DFKA 4CRIA 3MP8A 2FC0A 3AVGA 5HRSA 4NYFA 2R58A 4BWMA 1FKPA 1VRUA 3V1QA 5KTQA 4JRPA 3U3YA 2HHVA 4M3XA 4IUVA 1LAVA 2GFUA 4G1QA 4GMJB 5HROA 3OYHA 1ASWA 2EQMA 2K3XA 3H8ZA 3U6FA 4C8OA 4Z4IA 2B5JA 4B08A 2Z1GA 1NK9A 3ZT4A 2G8HA 1KLNA 3RRGA 1TVRA 3OS2A 3PFSA 4A4EA 1A5WA 1VSDA 2DAQA 2NUBA 2P51A 2QXFA 1REVA 3C6UA 1WSHA 4KTQA 4KRFA 3OY9A 3AVLA 4M3RA 2BKDN 1RDDA 1RT5A 4N5SA 2X6NA 5KCOA 1O1WA 3ZEHA 2IC3A 3NGZA 2KFNA 4KTZA 3ZT3A 4CJKA 2D0BA 4OLBA 3CM6A 4FLXA 3SV4A 3K5MA 2R7YA 1RI0A 1WAJA 3QINA 3S3NA 2E5QA 4CHQA 4CJRA 4Z0UA 5HRPA 1U49A 3HYFA 3M8RA 3L2UA 1ITGA 3KKRA 4DS4A 2RJFA 2YNHA 3NH1A 3QEPA 4E3SA 2M1HA 1XHZA 3AVMA 3T3FA 4DSIA 4BE0A 2HB5A 3K5LA 4FJHA 1RBUA 4CEBA 5HRNA 1T8EA 3O3GA 4C5EA 1BCMA 3HPOA 1TKTA 2Z1IA 1H3ZA 4O55A 3DLGA 4CK2A 3HVRA 4KHQA 3OYKA 1J54A 4W5TA 1JL1A 4CGJA 5KGXA 4XIUA 2EQKA 4M3UA 2ZE2A 3F70A 3C95A 3PMTA 3CEYA 4QQGA 2RF2A 1X9SA 1NKBA 1SKWA 4FJ8A 3RMCA 4L8RB 3ASMA 3VQCA 5I3UA 4TSXA 1A5VA 4AHUA 3SUOA 4FW2A 2GBZA 3HSTB 4GW6A 4I2QA 4Z4CA 2RKIA 4LSNA 4FCYA 3AVHA 4AHCA 1U4BA 4ZHRA 2CKKA 2GF7A 1KLMA 4BACA 4C5GA 4NZGA 3DYAA 3ZSQA 4CF9A 3KJVA 3RMBA 1TK5A 1XHXA 2Q3SA 3DLRA 4RW7A 1D5AA 3LGLA 4KO0A 3VQDA 4AHRA 4CESA 3NDKA 2RHZA 3LP2A 2RO0A 4JS5A 2KTQA 4A4HA 2D0CA 4E7KA 4N56A 3AVCA 4DF8A 1C6VA 1S1XA 4CFDA 3E9GA 1KFDA 2G8KA 3T1AA 4ZTFA 3V81A 4HUGA 4FM2A 2YNIA 1IH7A 3OJSA 2HMIA 3ZSZA 4B9UA 2P0KA 4IG0A 1VSHA 4DSFA 1L3VA 3QNNA 2D9TA 4OGCA 3EYZA 4CGIA 4DTRA 4QVZA 4M42A 2OPQA 4N4HA 3KD5E 3UIQA 3DRPA 3EZ5A 3AVFA 2BIVA 4DF4A 4CFCA 1NJWA 3VQBA 1G5VA 4YNQA 1JLFA 4ID5A 3C4SA 2E6MA 4CF0A 4N76A 4OKJA 3DOLA 1NJYA 4FLYA 3VQAA 2JGUA 2YRVA 3WNFA 2W42A 3AV9A 2ITGA 3QERA 3MEVA 3S3MA 2X74A 4CK1A 4FJ5A 2GV9A 3FLGA 1CLQA 4PQUA 4CHYA 2P5OA 4F3TA 2VWKA 3OYGA 1S9EA 3RRHA 3PY8A 1TL3A 3NE6A 2HHUA 3AVKA 4CHPA 2A1RA 4R5PA 5CIUA 4CEDA 2KZMA 3B6PA 1BIUA 3NGYA 1Q9XA 3LAMA 3HXMA 3V9UA 1KVBA 1WSFA 1ZBFA 1UA0A 4QQDA 4CEOA 3LDSA 2LSNA 2WOMA 4I2PA 3LH0A 2XY7A 4IUPA 1BI4B 1WSGA 3SQ0A 1RTDA 3GOXA 4DLGA 1NK5A 1QTMA 4IUQA 4KHYA 4ELUA 3ISNC 2E4LA 2IDOA 2PQWA 3L42A 3QBYA 2ETJA 3HPGA 3VQPA 3HM9A 4NCGA 4CJPA 1DTTA 1BI4A 1BL3A 4E7IA 1QS4A 1WGSA 2BUDA 3C6TA 5J2QA 3B6OA 3LALA 3MEGA 4QOZB 1HYVA 1LW2A 4FJMA 4DFMA 3ULDA 1J9AA 1S1TA 2ATQA 2DIQA 3VQQA 4CHOA 1GOCA 3AA3A 3AO4A 2RI5A 4J2DA 3ZCMA 1RT6A 3Q1JA 3P8HA 3K57A 1KSPA 4CIEA 3BDPA 1SSFA 4IFVA 3SUQA 4IUUA 1L5UA 3OYJA 5KRTA 2EHGA 3KK3A 3PV8A 2M0OA 1C1AA 5C6SA 3D45A 4HTUA 3DB4A 3L2QA 2LRQA 1JKHA 3HJFA 2EQJA 1WSIA 4QW2A 4DQIA 1JLEA 1RTHA 3MECA 4CCHA 1HRHA 5KGWA 1RBSA 4H4MA 5FROA 1I39A 1NJZA 1VSEA 1HMVA 4MQ3A 1HQEA 3TAGA 4DTJA 4W5RA 4NYNA 3SCXA 1D9DA 3OYFA 3KLGA 4DQPA 2FBXA 2GUIA 3RMAA 3QJ6A 4EDUA 4E19A 4FZYA 3RR8A 4FM0A 2YHAA 2D5RA 4FJNA 1KHCA 2YKNA 1IO2A 3KLHA 1Q8IA 5IAYA 1HYZA 3VQ9A 2VG5A 3QIPA 3QLHA 1HNIA 4Z4HA 3VQ7A 4L59A 1KTQA 4H4OA 4RW8A 1MU2A 3THVA 5FRNA 2QQSA 4IUTA 1J53A 4IKFA 1CZ9A 3CG7A 2OA8A 4QCLA 2WACA 4E1NA 2G8IA 2YNGA 3ME9A 3AVBA 4CJQA 3LZJA 4II1A 4HHTA 3L3VA 3S9HA 2QKBA 4QQ6A 2D0AA 1CXQA 3ZSWA 1NK8A 5I42A 5D6YA 4Y1DA 3QEIA 4N4GA 2YV0X 2Z1HA 5SWMA 4CHNA 1YVUA 3QEVA 4E7JA 4GY5A 4C5IA 3G0ZA 2HHXA 5J39A 4DSJA 2VG7A 5D6XA 3NTIA 1QQCA 4X34A 5HRRA 2O4XA 1S6PA 4M45A 3HO1A 3E9FA 2ZQBA 4FJJA 1SKSA 1QSYA 2KFZA 2QQRA 4KREA 4PLIA 3NH0A 2RJEA 3LYIA 5CZ2A 1N27A 1SUQA 2XY6A 2MWOA 2XO7A 1QSLA 4FJKA 3K58A 4DTPA 1TK8A 3QO9A 3PO5A 3RMDA 3MEDA 3T19A 4F3OA 4CGGA 4DFJA 5KRSA 3KLEA 4F2RA 3VA3A 3I0SA 4OJRA 4FJGA 1RDAA 5KH6A 5KI6A 1L3UA 3QKJA 2VG6A 1TL1A 3NF6A 3WNGA 4B9LA 3P83D 1WN7A 5M9OA 2DFFA 5C42A 1KFSA 3PMIA 1QE1A 5FDLA 4DSKA 1BHLA 1WLJA 4HCCA 4B9XA 2FBTA 1DLOA 2HHQA 1KCFA 4GVMA 2RHXA 1SL1A 2X4WA 3NH2A 4FW1A 4J2AA 3MP1A 1R0AA 3OQ5A 3ZSYA 4UQGA 3DM2A 4CJLA 1S1VA 1OYXA 3LP0A 3MAQA 4DTXA 2G8WA 3HP9A 4EZ9A 4F4KA 2EQUA 4FVMA 1JXBA 2O4IA 4DTMA 3DMJA 3L2VA 3AO1A 4CJWA 4DFPA 2HVIA 1I3AA 4PLLA 1TKXA 4Z02A 2X6SA 4RW9A 1RBTA 4A4GA 1HPZA 3TARA 1D8YA 4KAZA 4Q0BA 4CJEA 1VSLA 3NTKA 2KW4A 2OPRA 3CM5A 1C1BA 1VRTA 5DMRA 1ZYQA 2G8UA 4DG1A 1HYSA 4FLWA 2DFHA 2KQ2A 1RILA 1T7PA 1W9HA 4H8KA 1T03A 1TKDA 3ZT0A 3LWMA 3MP6A 2DTUA 4JLHA 4O44A 1F21A 4AILC 2XY5A 2RHUA 4O4GA 4FJXA 3DLBA 4M3ZA 3DOKA 1WAFA 3NF7A 3TAPA 5J26A 2IAJA 3SJJA 4N41A 4E7HA 3NGIA 3F73A 1IG9A 3IS9A 2RPIA 3OS1A 3AVJA 3HL8A 3AVNA 3V9XA 3QEXA 2IG0A 2F96A 4LD0A 1LWFA 1L3SA 3OMGA 2QKKA 1GOAA 4B3OA 3O4QA 1RBVA 1UAXA 3TAMA 4CIGA 4CFBA 2PYJA 2L3RA 4ELVA 3L2RA 2OZMA 4HCBA 4KHWA 1OI1A 5FRMA 3NBPA 2RHIA 3M8PA 3TWHA 3V1RA 3VQ4A 4FL6A 3LP3A 3FC3A 3O4NA 1BQMA 3I0RA 4M3TA 3P1GA 3PX4A 5C24A 1WSJA 4UC4A 1LWCA 1C1CA 2HNDA 4B9SA 3MEUA 4LH4A 4CJUA 3A2FA 3SPZA 1BQNA 4CHZA 4CE9A 2G8VA 4FK2A 3O8VA 2JZ2A 2XRIA 4FK4A 1NKEA 4AHSA 4O5BA 2Z1JA 4K8XA 4RG2A 5C0MA 4KV8A 4FU6A 4DMNA 3HT3A 1UA1A 4E0DA 1NJXA 4I9LA 1YT3A 4RW4A 3VN5A 2EX3A 3CFRA 1QSSA 4BDZA 3MO8A 3OMCA 2LCCA 4IDKA 3DLHA 3LX7A 1NK6A 4EP4A 2YHBA 1X1PA 4DTOA 4RG8A 1NK0A 4KHNA 5T7BA 1RCHA 1VSJA 3OYEA 2RHYA 3VQ5A 1KVAA 1ASVA 1LWEA 3KTQA 2HHSA 2HNYA 4CEAA 4CJTA 5J2PA 3CFOA 3UT1A 1VSKA 2RJCA 3NCIA 1SL0A 1U04A 3OB9A 1RTIA 1ASUA 4PUOA 3QEWA 3QIIA 1KVCA 4ICLA 2OYQA 3KUFA 1RT1A 1NKCA 1TGOA 4KB1A 1FK9A 2HQEA 4NS5A 1N5YA 2O4XB 5J2NA 3AA4A 3SV3A 1NK7A 3TAFA 4PA1A 4DQSA 4B9MA 1FXXA 4DSLA 4DU1A 4KI6A 4BE1A 4KFBA 1OZ2A 2O4GA 3HPHA 4HVJA 3SUPA 4EZ6A 3NAEA 1VK0A 5KE3A 2A1SA 1EX4A 3LGFA 4W5QA 3SI6A 2X4XA 1BGXT 3KIOA 4PWDA 4FLTA 2DFEA 1YTUA 2JLEA 3V1OA 1ZBHA 1C0MA 3LPTA 4CJFA 3MXMA 1SV5A 3CQ8A 4NCAA 2KZZA 1WNSA 3M8SA 5D6WA 2XHBA 4OKEA 3SNNA 4OLAA 2ZD1A 3PX6A 4FZXC 1TAUA 4DQQA 2HHWA 4B9VA 3SQ1A 4FLVA 3IAYA 3NHGA 5HLFA 1WJQA 1JLCA 5JS2A 1UWBA 4BWJA 2L8DA 2WONA 4I9QA 3OYNA 3ZSRA 1RT3A 2BANA 3K5NA 4DWIA 3HVTA 4OPKA 3RTVA 1S9GA 3MEWA 4FXDA 1T05A 1TKZA 3RR7A 2BGGA 3ZSXA 4M3YA 2B8AA 2LTOA 5CY4A 3PO4A 4J2EA 3DLKA 3TABA 4CEQA 3TAQA 1Q9YA 2IGIA 4LSLA 1BISA 3V4IA 3M8QA 3VQ6A 4A4FA 1U47A 3CFPA 4FM1A 3SQ2A 4K8ZA 1S1WA 3WNHA 1HQUA 2B4JA 5IN1A 4B8AB 3SYZA 2LDMA 1IKVA 1JLGA 3PUFA 4CJ3A 4DLEA 3AVIA 4DTUA 1U45A 1LW0A 3OYIA 5SZTA 4C8KA 3DLEA 4W5NA 4BE2A 3U3GA 1XC9A 3ZSVA 1TK0A 1D9FA 3SUNA 2E6LA 5DK5A 4KHSA 5D3GA 1Z26A 5K14A 4E7LA 1LAWA 3LWLA 3QESA 3RWUA 4O0JA 2IS3A 3AO3A 3EAEA 3QIOA 3SD4A 5E41A 3H6ZA 5J2MA 2VWJA 4IFYA 4CGFA 3MEAA 5KE2A 1HNVA 3DLMA 4CK3A 4FJIA 5CYMA 5KCHA 3FEOA 3JYTA 3L8BA 1JXEA 2BE2A 4AHTA 3E01A 4CEEA 1B9FA 3LANA 3FFIA 4DTNA 2PY5A 1RDCA 4CIFA 4CF2A 1RTJA 3EY1A 3UWNA 3V9ZA 4CJ5A 1LV5A 4FK0A 1Y97A 5J1EA 4Q5VA 4CF8A 4F8RA 2XY8A 4LH5A 3META 4M3WA 4OGEA 3HK2A 4FYDA 1S6QA 4OKKA 1XI1A 4PY5A 2M16A 3DB3A 2YKMA 4CFAA 4NCBA 1ZBLA 5EU7A 3G10A 1KRPA 3KKSA 2G8FA 3L2WA 1IKWA 1C0UA 3D0PA 1NOZA 3BDLA 3K2PA 4M41A 3KK1A 4E1MA 3ASKA 3NFAA 4JS4A 1TAQA 1WJSA 3I8DA 3K59A 4I7FA 2X78A 3VQEA 1Z25A 1RDBA 4OPJA 3AA2A 1DTQA 3CYMA 5C25A 3KLFA 4AH9A 4HUEA 4N4IA 3V9SA 2G3RA 3V9WA 2OPPA 3SPYA 2RI2A 3TI0A 1U48A 4KI4A 4FJ9A 1SKRA 1A5XA 1OZ3A 4YFUA 4B9WA 1EETA 3P5JA 4B9NA 4AHVA 4C8LA 1ZBIA 3NNQA 4LY7A 3OYAA 1RNHA 4MFBA 3S3OA 4IURA 3AVAA 3HP6A 1GOBA 2Y1IA 1RT4A 3PX0A 2HQXA
chains in the Genus database with same CATH superfamily
1R0CB 3M1FA 4KJZA 3BDUA 1HPMA 3ZN0A 3OYCA 2FBVA 4PJ0C 3MAJA 2M9HA 1KG1A 4B09A 1IBKK 3K5OA 5AT1B 4FJLA 3CW7A 2QEXN 3HI0A 5AZIA 1LOJA 2YUSA 3KZZA 3WTZA 3KP2A 3V7RA 4F2SA 3A5MC 4JK9A 1NH3A 2RAEA 2QQ9A 5F04A 2YHWA 4J2BA 4N4NB 3N0UA 2BTTA 3VYHB 3CVTA 4OB0B 1XNIA 5IXFA 3UKRB 3WNEA 4FLZA 1EKEA 4ZTJA 4JJBA 1T3VA 2IEKA 1VQ5I 3KLIA 4KHUA 4IDHA 3ZEUA 2O6GE 1D0ZA 5KPTA 2MLKA 3DJCA 4AIJA 4HCZA 2GOMA 1VQ9N 3PE0A 2Z16A 2F5FA 2CW0F 3HKZN 3U3YA 4EMHA 1MBHA 5JHUA 3VS6A 5GAN6 5HROA 2K3XA 3VF2A 4KT5C 1VQ9Q 4HX7A 1A5WA 4LUEA 3EG9A 3RNJA 2VYPA 2NRHA 2RQPA 3X24B 1O1WA 1OX8A 2KFNA 2DL3A 4OIRF 3ATUA 3MEXA 3NVMA 4OLBA 2MI6A 1KC8U 2HVIA 4FWKA 2E5QA 1B9NA 3VENA 1R4MB 1TNTA 4FJHA 4BE0A 4OMMA 4UUSB 5GPCA 5GMKi 3HPOA 1M8MA 3GZ6A 1LNWA 2DJZA 5KYXB 2EQKA 1MJAA 3F70A 2VXDA 4EJZA 3R0JA 1NLPC 4BR7A 5KYUA 1FYLA 4AHUA 3UA6A 4FW2A 4A62A 4BRNA 5JVGF 1U4BA 3PFIA 4L0YB 1KLMA 4LG0A 1XHXA 1PRLC 4XLPF 1KYWA 4A5NA 2E7WA 2DK3A 4OMOA 3P9IA 3ZOBA 2A3ZA 4HUGA 5GPAA 4MNUA 2QA4I 3ZSZA 4IG0A 2HCKA 1VSHA 3QNNA 4HF0A 1VQ9A 3DXKB 2OPQA 1DPUA 2FXUA 4M75D 1UB9A 1VQOT 2EW3A 3WEEA 2E6MA 2XICA 1V4TA 5KAIC 3QERA 4RCHA 2K9QA 4JKGB 4CYCA 2GV9A 2FB7A 1PU7A 1IG7A 1K0XA 2CG4A 1YRNB 2K02A 6PAXA 2DMQA 3DXKA 3MKWB 3RMQA 1UHSA 4EMKB 2P9PB 4I2PA 4WCIA 2F9WA 3MKDA 4ELUA 5KHDA 3OR1C 2X6OA 4UOBA 4ITVA 2DTRA 2Q97A 4IZ9A 2DT6A 4JKGA 1Y39A 4CHOA 3M0RA 5EGOA 3E9OA 2P9KB 2VQGA 2QLZA 1GLDG 4XLEA 2QCOA 2M0OA 4D0PA 4EMKA 2HWVA 2WSCE 3OW2P 3WGHA 1VQ7T 3FZMA 3R8EA 4D9JA 1TWAJ 4JKAA 3UKUA 3SYTA 3SCXA 1F1BB 3QFPA 1BA1A 4HYEA 1FYNA 4H5NA 3BF3A 1YI2T 2D8JA 3I9QA 3DWLA 5IYDJ 1D0YA 3CC7Q 3PUBA 2ZXWH 3BG5A 3RUXA 1HXDA 5BRFA 3G0ZA 3ZGKA 2OTLN 3C2BA 1R4NB 4KDPA 2LKSA 3TDZC 1W5TA 3SWNA 4LLLA 3DU6A 2LLKA 1LE8A 3IC7A 3QO9A 4OJRA 1A04A 4F55A 5KH6A 1MBKA 2WB1N 4MEYF 1TL1A 5E20A 1BDGA 3K4KA 1WLJA 4CC3A 3HZ6A 1X3NA 4RLFA 4CVNE 4M7XA 2LP0A 4M75E 2E3IA 3MHXA 3GP8A 4YTLA 3QBWA 3TQNA 2E5LK 2OAWA 2E65A 2ZPIB 3QBXA 3GTGJ 4Z02A 3KP7A 1UGQB 2D6FA 2D0NA 1R49A 4M7DD 1W9HA 3ZT0A 4RS8A 1HKGA 2L0AA 2RH2A 4XKBA 3E5XA 3OS1A 2VQEK 4X6AJ 4AM6A 5LEJA 5K1YA 2E41A 3JSCA 3M07A 1XNRK 3CMAI 5FRMA 2RHIA 1YXQA 2R7VA 2YS9A 1I3QJ 5BQTA 3I0RA 3OOPA 2RHKA 3D5LA 1LWCA 2DTHA 3U1KA 1YHQT 4AHSA 5FU7C 3JS6A 2VUMJ 4M7AG 5M5WJ 3CFRA 3O9SA 5DCFA 3KP3A 4BY6B 1YW7A 4DBQA 1R0BG 2J06A 1M90U 4M3BA 1X6BA 2O9SA 3O9RA 3VQ5A 5IP9J 1LWEA 2Z3YA 3NCIA 1SL0A 3GFIA 3WGIA 1NKCA 3KFWX 2RK1A 1YITQ 4R55A 3R6SA 4ESRA 1VK0A 2A1SA 1EX4A 4HAMA 1JTYA 3GFJA 5ED4A 1SV5A 4NCAA 4GYGA 4A53A 1HA8A 2E1HA 4FZXC 3QOEA 5EXWA 1JCFA 2IVWA 1OQYA 3CCMT 5CKFA 3CCVT 1X1DA 1DP3A 3K4BA 5GMKh 2K9NA 2QASA 2ZO4A 4G6DA 5L3BA 4EHTA 1UTIA 4RTFD 3G1MA 3MMYB 2CZ0B 4A3KJ 2IS6A 2ZJQF 5GTIC 3PUFA 3R1XA 2VJJA 4C8KA 4FWMA 4JAXA 1TWGJ 3LSGA 4A3CJ 2E35A 1LDDA 4KHSA 4CZGA 4E7LA 1Y56A 4ENNA 1ETVA 2YHXA 3FE1A 2P9SA 1KD1O 4DTNA 2R5YA 1RTJA 1K73C 3LL3A 3FKJA 2KISA 4M3WA 2HDWA 4J5YA 3JW4A 1OYIA 4XH5A 2E1OA 5EG2A 3RIRA 1E4GT 3FK6A 2HSEB 3LCNA 3CLQA 4JQFA 1YHQI 5HK0A 4N4IA 1B9MA 1YIJT 3E3VA 5TRDA 1NGGA 3CCLQ 4JI3K 3CDHA 3ZSOA 4BC5A 2VT2A 2XF7A 2VT3A 3C3WA 2HHTA 3OYBA 3THYB 4FISA 4IEIA 2Y1JA 2E3HA 4BJTA 5GAN4 4BBSJ 1HKCA 1X58A 1O75A 2QA4A 1Y64A 1QBJA 2QGFB 3PVLA 3OV8A 3M9QA 1Q81O 3OS0A 3EO3A 2DIGA 1YCSB 2I5WA 3NF8A 1JXMA 4LF8K 3H1CA 2VKVA 1S5JA 1WXTA 1S5LC 2BV6A 1ZHIA 2EKOA 2GX9A 1XTDA 5A0GA 2ZMEB 3RPQA 1KQ1A 1YITT 2DY4A 4XSXF 2DERA 3DI6A 2O8BA 3VYRB 4F93B 1JJ2A 3GDQA 4YPHA 4C92A 1RKTA 2ED1A 1G2HA 1XDUA 1RT7A 1WQ7A 4U67L 4XU1A 1W0HA 3ITHA 2STTA 4YPRA 3OSSC 4NYFA 1OH7A 5C44J 1JB0E 3CETA 3U6FA 4Z4IA 2G8HA 1WJBA 4JYKA 3GTPJ 2C0OA 2L3PA 2I8DA 1REVA 2HEQA 2IGNA 2FEZA 1ZA2B 4JDSA 3FB9A 1ITGA 4P5NA 5GAEJ 1XB4A 3N05A 2NNWA 1EH6A 1M9SA 2E12A 3PIOF 3ASMA 1W97L 1MJ9A 2EKHA 3VYTB 3EFSA 5GADP 3BOQA 2WBMA 2OC6A 5L3CA 1DQUA 3LQRA 3N4PA 4P5OA 4CF9A 3ZPLA 1Z7LA 1RLQC 4CZZA 4M77G 3WVDB 5GAHP 2NNYA 1SF9A 2E70A 3AVCA 3GVAA 3E9GA 2O8EA 3ZCOA 2LCLA 3CESA 1P59A 3G6ET 3PO3J 2JUGA 1BI1A 2VJIA 1K7AA 5JVGL 3RBBB 3CC4Q 4J7IA 3THXA 3F10A 4N76A 1BIBA 2HZTA 3CPWA 1CF7A 3IWFA 2YRVA 3FXJA 4YDUA 5JICA 4BC3A 5AQFA 2DMNA 2JWTA 3OYGA 1S9EA 2HHUA 1D5VA 3A4CA 1EFNA 4PKIA 1N9RA 3F6OA 1NGCA 2LD5A 1M90O 2YUQA 1BI4B 2BY3A 3KWGA 4BQQA 2W10A 1WJEA 3HPGA 3VQPA 4BI4A 1YJNT 4LB6B 3BG7A 5C12A 2XAHA 3OSFA 4OU0A 4CSWA 1BC7C 4EA4A 4FJMA 5IWAK 1UEBA 3AO4A 5C0YA 2QWNA 2PZ1A 4WFNL 2DMUA 4D7MA 3OYJA 4BQLA 3GFMA 5IHKA 1XMAA 1IN7A 1FMWA 3O5BA 5A0LA 2NVQJ 3G73A 3TAGA 2L7FP 4EDUA 2FEIA 3I4PA 4FZYA 3UF4A 2FPFA 3TSQA 3AGKA 2VG5A 3RYPA 3O9QA 5DLOA 2UXCK 2O4IA 1QMCA 2LMJA 1HW2A 2VXZA 3VU3C 4CJQA 4ENKA 1QNTA 3S9HA 3BDDA 3WXMB 1WH5A 1P7MA 1YVUA 3M8FA 2ID3A 3J7ZO 4IZZA 2NRWA 1SKSA 2MAMA 1MGTA 1NWKA 3BLYA 5FLMJ 1YN8A 4JRKA 2JT4A 1KGSA 3OHRA 2AKLA 1KD1U 3KEOA 5LBQA 1J6ZA 1KFSA 1R7JA 4CYCB 3CD6Q 1DLOA 4GVMA 5HL7L 2K4JA 3M5AA 3DM2A 2CP3A 5IOZA 3MAQA 3L2VA 3MKLA 5DCMA 4PJOG 1PU8A 2P9UA 4XQFA 4FWPA 1IO6A 2FF6A 3EUHC 3MP6A 2X1CA 1TS9A 3BPVA 2CV1A 2HBWA 1W1FA 3J7YP 1IG9A 1P9QC 3CC4T 2F96A 2P6TA 1GOAA 2C6YA 3O4QA 4M71A 4Y15A 4C9YA 2GQIA 1WFXA 3TWHA 5M1KA 1QVPA 2L9VA 2BGCA 3JRBA 4BNCA 5LY3A 1H92A 4H0OA 5GAOq 2JZ2A 1IN6A 4M78E 2A42A 4RW4A 2K85A 2BZXA 1G83A 3DPLC 3FX3A 1FW6A 4MTDA 4IQ4A 3U9GA 1NK0A 3CO7C 4ZYAA 3CC7I 3PL8A 2RJCA 3FM5A 1J59A 1ZREA 3G71Q 3IL2A 2JVVA 1KVCA 2OYQA 5IY5H 4WF9L 1GVDA 2O4XB 1NK7A 4XKVA 4BE1A 3SUPA 4EZ6A 1X1BA 3NAEA 3REBB 1LE8B 1YJ9N 2ZCWA 2ZPBB 2ZWHA 4XNFA 4A0YA 4CCLA 4XMYA 3M8SA 4OLAA 1BR4A 2BBYA 3O9TA 3DEWA 2LDUA 1SFUA 3ERED 2RQWA 3M53A 3QQAA 2BANA 3K5NA 1MSEC 1KK7A 2KI7A 3T69A 2IXSA 3WU1B 2KXCA 3F8MA 2K7LA 4Y4RA 1ZN2A 4DB3A 2KT0A 1B8IB 3JB9J 2YWWA 1S22A 3QESA 3RI4A 4IEJA 4YY3K 2WB1A 4AHTA 1KA8A 4CBWA 3VEXA 4Q5VA 4F8RA 1U84A 3WODF 3LDQA 5BPMA 2NRXA 2QA4Q 4PFOA 2W1OA 3ABLH 4JS4A 4G7OF 3VQEA 3CHWA 3EUAA 3V9SA 4IHSA 1FSHA 3P5JA 3AKZA 4PJOD 4LOCA 4C8LA 1ZBIA 3DEEA 5ICFA 4IURA 2ESHA 4RCBA 1GOBA 2KR3A 1K4US 2PBDA 3V42A 2RA2A 2NLXA 3CPWP 3J80O 2RQRA 4FT2A 2RN2A 3CF5L 2DEQA 2FD5A 1Y0MA 2Y0SA 4OVLA 2M0MA 1EJ9A 2X1DA 4HCKA 3HRTA 4CF1A 4KUMA 2XIDA 4WCEL 3TCJA 4EJYA 4Y13A 2CREA 1N6AA 3ENHA 2GAUA 3ULRB 2VBXA 2BDPA 3DKXA 1Q82R 3ZMSA 2K86A 3J81K 4PJLA 2JM8A 1XG1A 2R57A 2V1RA 3UA7A 2HVHA 1XMKA 5LRRA 1KU3A 2HDAA 1NGDA 2YUPA 2O8FB 4DOZA 5EC7A 2HW3A 3DTKA 3M0QA 5HBMA 3PFYA 2MABA 1C0WA 4CW7B 2K9LA 1KG4A 2O9VA 3A0IX 4BY9C 1G15A 1VQ8A 1IBMK 4LD6A 3LSKA 4HT8A 2JPCA 5EOYA 4CRIA 5HRSA 2R58A 1FKPA 3V1QA 3HM5A 2J05A 3CD6I 4QS7A 1WRJA 3G1OA 4KTQA 4JUVA 1X69A 4J9CA 4HX8A 4QTRA 4Z94A 4CHQA 1UG2A 4CJRA 2QKLB 4DS4A 3QYFA 3M4YA 2M1HA 3AVMA 3T3FA 1T56A 3A8HB 1RBUA 3J7AF 1J54A 5KGXA 2DD5A 3PMTA 4FIBA 1SKWA 5F0HA 5I2MA 5I3UA 3CCST 4XOTA 3TOBA 1X2QA 1MSFC 1TWBA 4BRLA 4HV6A 1K79A 4AHCA 1R1UA 2OU2A 4ZHRA 1Y71A 2AIRB 3MKYB 2CUZA 4M77D 3NDKA 3G6EA 2O88A 4DF8A 1NM7A 5FWCA 3A01A 1D8KA 2CQQA 2DODA 3QDRB 2D9TA 1WHUA 3O8HA 3DRPA 3VTIA 2GWJA 2E60A 3VQBA 3I4MJ 3OW2M 5C10A 3SQNA 3CF2A 3M7GA 4CK1A 2OFKA 4Z8AA 2H6BA 5LGUA 3F8BA 5B3SH 4OMFB 3RRHA 2DA6A 3FXLA 4R5PA 2KZMA 4N0AC 3I33A 2YRCA 3HXMA 3ID6A 3BG3A 2A5XA 4CEOA 3LDSA 1WBDA 1K78B 2ETJA 1G59A 1Q95G 1KIKA 4CJPA 3BCBA 4WTOB 2X48A 1SD6A 1TLHB 3VQQA 1NGEA 4O6JA 4CZMA 4ATOA 4E9GA 2D1HA 2JA5J 3KK3A 3D45A 1YI2A 1NJZA 2QWQA 3CCQN 5C2DA 1ZRDA 3LA3A 5FLXE 2EJRA 2A07F 2OTLA 4OMLA 2D5RA 4FJNA 1IHVA 2OANA 1B4AA 2LNVA 3KZIC 4Z4HA 4Q5SF 2LVSA 4IUTA 1N3AA 4H5TA 4OFHA 2RREA 2ZF5O 2RK2A 4DYQA 3ZSWA 3CERA 2BH1A 2DPPB 4BBRJ 4E7JA 4GY5A 2J6OA 4FJJA 2RF0A 1TTHB 2DU9A 1QSLA 2AZVA 1KQ0A 4A4KA 4DR1K 3I0SA 5LD2C 2AKKA 2LK2A 4YELA 1KCFA 1MMSA 2NNNA 4FWLA 2BZYA 3VETA 5J47A 2VIXA 4EZ9A 1HNXK 3K9TA 3AO1A 1PNJA 5HLHA 3TARA 1VSLA 2KW4A 5FFZA 1J09A 3T1BA 4LDWA 5DTDA 4AI5A 2LT1A 3G1JA 3BY6A 2D4WA 1WQWA 2VJ4A 3INZA 3AVJA 3LWFA 2AHJB 1STZA 1K9MU 2CU7A 1HSTA 4AC0A 1T0JA 4YOTA 3FC3A 3P1GA 1C1CA 1DDNA 4JI4K 3M4OJ 5EDNA 1BQNA 3MQ0A 2ZMEA 4IO9L 3BCAA 2DJIA 4RWTA 2DTIA 1UHCA 2JMAA 1QSSA 5E1WA 3ZL7C 3CCMA 1VQKQ 1N3CA 2EFQA 3QP5A 4RB0A 1AWJA 3EKSA 1LVAA 1VFCA 1LCKA 1YUWA 2LBFA 4XRSA 3I55Q 1TGOA 1QO0D 2FLOA 3AARA 4B9MA 2P9IA 5GAOm 2TDXA 4KFBA 4MZMA 3JCUC 2GIZA 2KFDA 3LPTA 3CQ8A 1SAXA 4XU2A 3CCVA 1VA7A 1IN5A 2HVSA 4YG2F 4KIGA 1Q86C 3TSZA 3EFRA 2KSSA 3QG1A 3Q7BA 3AG4H 3F0CA 3TAQA 1SMTA 1BISA 1OJLA 4FM1A 3G1LA 3BEXA 1XQPA 3U3GA 2ZNZA 1YJNA 4E6RA 5CQXA 4JI0K 3BT9A 3GL1A 2V6EA 5E41A 2VWJA 2PFUA 4IFYA 5C3EJ 3MEAA 3D5SC 3LM2A 2NZTA 1KQ8A 5CK9A 4H4KC 5J1EA 2Q36A 5GANh 1SVOA 2EPDA 2LBFB 2ABKA 5H6QA 1ZBLA 2P8TA 5GAMe 4RM3A 4E6KG 4B1YB 1Z6TA 2NXNB 1PC0A 3ASKA 4VUBA 3CD6A 2X78A 5BN9A 4XM3A 3UR3C 3TI0A 3SPYA 2ESNA 4U88A 3K10A 1M1GA 2XAJA 1T6DA 1R58A 3HTVA 3E6CC 4OMQA 3TU5A 4FTHA 1ON2A 3OJUA 4OIQF 5AQQA 1KONA 3VB2A 3MFKA 4FJ7A 2ZJRL 1CZBA 4C8NA 3FBNB 2RJDA 2M45A 2V8IA 1JHHA 1Q82U 4A93J 3IUCA 4IBNA 4RGSA 4EGZA 3R61A 2E1YA 3H41A 2QA4T 1WJRA 1ETOA 1PSEA 2EGEA 4A61A 1X4OA 2AT1B 5CZ1A 3BQYA 3IKTA 5GJWB 1AHDP 2HYGD 4PJMA 3H35A 1D3BA 2YNFA 2KKOA 3KYLA 1NOYA 1K6YA 3LP1A 3OYDA 2UXDK 1ONVA 2GFAA 1WSUA 2NLUA 3KLNA 4UNOA 1X2MA 5FD5A 4FSVA 4JX4A 1IF1A 1XQOA 4RW6A 1JXOA 5IT9E 2R5MA 1YS6A 1YOVB 1NK9A 2CGLA 2COZA 2K40A 2HBLA 1G3WA 2X85A 1VQOA 4DV1K 3EN9A 3CM6A 3PO2J 4FLXA 4K8XA 2FX0A 1W2BM 2K57A 3L2UA 4NNJA 1XHZA 4E3SA 1HKSA 3A0BC 5HRNA 2HF3A 4O55A 4CK2A 2EWSA 3JCMP 1I8FA 2WAQN 4XIUA 1YJ9T 2F5DA 2DBMA 1MA9B 4XTUA 2R93J 4ZYDA 2XSJC 3QPSA 2KHOA 3I64A 4C3HJ 1HKTA 4I2QA 4LSNA 3JCMW 1P7JA 2GF7A 2OTJN 2AZSA 1WVRA 3G4SI 2M2EA 4KO0A 1VQMN 2RO0A 4W1UA 3WTTC 4BR5A 4J9EA 4II2A 3UATA 1KFDA 1HNWK 4RGXA 1HDDC 4DTRA 4WCGA 2NS7A 1VQMQ 2P5VA 5FGMA 4KHPK 1ILYA 1G5VA 1JLFA 3HOYJ 3B73A 5J6XA 2QXLA 4A3MJ 2O01E 2MSYA 3RQIA 4UV9A 1F36A 4HVWA 4KN4X 3NE6A 2C0TA 5J1YA 4CEDA 1Q1VA 1U6ZA 3GG4A 3V9UA 1FOKA 5KNLA 4EPCA 2ADUA 4IUPA 2ZAEA 2QZ8A 2W04A 3R6MA 2KMTA 2E4LA 1LB2A 4NCGA 4LFCK 1DTTA 4WQ4C 2BUDA 2CZ1B 4EW4A 3P9CA 3P8HA 3K57A 3QWYA 1WBBA 5BS6A 3AY9A 2P6SA 2D1VA 3T7ZA 1F43A 1PSFA 2E2PA 2HI3A 1D9DA 4DQPA 2L4AA 2BW3B 3S41A 3P8BB 2ZXHA 5ICEA 1QA6A 3HFNA 1Q8IA 5IAYA 5GAOp 1IJWC 3KP5A 3K2AA 3CG7A 4IKFA 5HDNA 3QU6A 1Y1WJ 2V7YA 3FZHA 1U0JA 1CXQA 4BRGA 3CCUA 4AYBA 3QEVA 5J39A 2XF5A 5HRRA 4X34A 1S6PA 2EFPA 5AQYA 2Z99A 1J0RA 4F3OA 4BR2A 3RMDA 3QWLA 2DD4A 4CH7A 4ZH4F 4AG2C 3P83D 5M9OA 2F4VK 3U9DA 1NBEB 4B9XA 5F1RA 1X9JA 1BN5A 2RHXA 1SL1A 3OA9A 4WXDA 5F27A 1N8RC 4F4KA 2E1NA 1QCOA 2NS0A 4DFPA 3ROUA 3CD6N 5M5XJ 3NTKA 1VRTA 2EA4A 2XUBA 4NXMK 1B72A 1TKDA 1IZ1A 5GJVB 2XV4S 3TAPA 2BY2A 4F52A 4M77F 4GFBA 4BQOA 1DP7P 3I71A 3WUHA 2R7FA 1RBVA 3TAMA 2XB5A 2XF6A 4PJOC 1WSJA 4ETSA 5KYWA 1Q82O 4L9JA 4B1ZA 4BGAA 4A2UA 4CJUA 4CHZA 3I3LA 2OF7A 1ZK8A 1R23A 4HX4A 1UHWA 2EX3A 1ZUUA 4BJ5C 2DDAA 2P9NB 3VS7A 4B9QA 2CS7A 1YITA 3J80Z 1YYVA 2MC4A 3LA2A 3ELKA 2UYTA 1N5YA 3RVCA 4DQSA 4DSLA 3C12A 4MO5A 2ZGZA 4W5QA 2CJJA 2E20A 3V1OA 4UXNA 1I1SA 1D0XA 4FM4B 3A1PA 4LE9A 1QZ6A 3MWMA 3CI5A 2DRKA 3G3ZA 3FXRA 4FQGA 3LSPA 2HHWA 2G6FX 1K8KB 3IAYA 1GCQA 3LWIA 3VSLA 3KWIA 3HVTA 2HBPA 1IXDA 2O8XA 1Q81C 9ANTA 3TABA 5L3EA 2YXYA 4KMFA 3OSVA 2B4JA 2DYRH 3FM3A 4DLEA 4OMZA 5SZTA 2QTXA 1TK0A 3G6EI 2E6LA 5LJ3j 3VPZA 2XGDA 1WXUA 2E5NA 3QICA 1T44A 2DPDA 4OOIA 3T1HK 3GF2A 1X27A 1Z9ZA 1Q86R 3QYBA 3CWUA 2XY8A 4DR2K 2Q1NA 3THXB 2QEXI 1BBZA 1QQJA 1EIFA 1YWOA 2WAEA 2R3SA 1OEBA 4AIKA 4BAYA 5JHFA 2WSFE 2QKMB 1QPMA 1QZYA 2Q0OA 2ID6A 2P9LA 1UAAA 3N4QA 1G2BA 4KYWA 4R8HA 5F64A 1XX5A 2DX1A 2NOLA 3FDRA 1R71A 5H20A 2LJ0A 2AJQA 2E5KA 2FU4A 3KK2A 2GTOA 1VQ7Q 1S1NA 2I5JA 2KT8A 1MBFA 3I55T 3CMYA 2GNCA 3LDOA 3IAM2 1XG7A 4AF1A 2FOWA 2R5AA 1C0TA 3FXMA 1YAGA 2LY1A 1FKOA 2CZ7B 3C6AA 4HUFA 1VQKT 1IKYA 1RBRA 1ZBUA 3WE2A 4L9VA 4ZN1A 1DU6A 1QKWA 4XTYA 4CJ4A 5LJ5h 3X25B 4E1JA 3LMMA 1HSJA 2HSPA 3TO6A 3ZQIA 2K7AA 5CKEA 3CBMA 1QHHD 2Z9OA 4QPOA 3DPTA 3IAS2 1TV6A 4KB0A 2R7SA 4KMUX 3SDBA 3M0UA 2XDBA 4LF7K 2FYKA 1I5LA 3WHCA 3EGDB 1Q7YU 3M54A 4KITB 2VI6A 1CQTA 2FQ3A 3MP8A 1LAVA 4KULA 2PAVA 2WY8Q 3CCVQ 4AIDA 3HM8A 2DAQA 4MFDA 1W4SA 3A2KA 3NVKA 1I0CA 2IC3A 3ZT3A 4GBQA 2JSPA 3NMZC 1WAJA 3S3NA 4Z0UA 4CICA 1UCRA 4B3MK 2QF7A 2V1XA 1TP4A 3IQLA 4W5TA 3IUOA 4F91B 5EZHA 3CEYA 1IW7F 3V8JA 1AOYA 2O8KA 3VQCA 4ASNA 1GVJA 2JA2A 2EBIA 2RKIA 1XS9A 1JI8A 2D5VA 3OH9A 2RQUA 3J8AA 1KD1C 1K4SA 2HZYA 4UUSA 1PP8F 3VGKA 3GTOJ 3GO5A 2NRVA 3LP2A 1NG9A 1AT1B 5GAMg 4UVAA 1PJRA 3FMSA 1NMNA 1U5SA 1YQAA 1R1TA 1KQSS 1HQCA 2E71A 3S17J 4ISGA 5DY9A 4A5BA 1YIJQ 2PVOB 4RCCA 1X6OA 3CCRA 2IGOA 4EVVA 1LVKA 1SD5A 3CO6C 2BIVA 1VQPA 2YU9J 3HDDA 3JB9D 5F0XA 2CUFA 4KFCA 4LFUA 2VGNA 2PJPA 2DOEA 1PCXA 4B1RA 1I5ZA 2JJ7A 4M73A 2JVGA 1V55H 3CUQB 4IO8A 2RMOA 1Z9QA 1FJLA 4OB2B 2MF2A 3LH0A 2LG4A 4XBFA 4RM2A 4JJNK 3HM9A 3D7EO 1T39A 1HBXG 1BL3A 2HQNA 2TCTA 4ZC3A 4G8XA 1FOWA 1LUJB 2CW8A 3SHWA 4BKXA 3CDLA 5HODA 2XI9A 1KSPA 1Z6RA 2QAZA 1ZUKA 4HNVA 3M1CA 2DBBA 2FZGB 5EX5A 4F7UE 4HTUA 5CKBA 3DB4A 4DQIA 5K5QA 4CZFA 2M5WA 1UHFA 4W5RA 3GNGA 1U5TC 1W5SA 1NU0A 1ACMB 5AQPA 1G3YA 3G4SA 2Q8KA 1RDUA 4HHTA 1FPQA 3U8XA 3FIFA 1NK8A 1QQMA 2OPTA 1KQSM 4U7DA 1R5ID 4HSTA 1ZBXA 2M4GA 2VJ5A 4RKUE 2E64A 4LD5A 2ZQBA 3LAJA 4XIDA 4KREA 1ZG3A 3GTLJ 2MC3A 1HU0A 1SUQA 2LKXA 4C2MJ 4C92D 3DTIA 1S72T 4B22A 3TU4K 3DEUA 1N5ZA 3F2KA 4HCCA 3MP1A 4DBRA 4LK1F 2A3LA 5EJCA 4I0AA 5D4RA 1D8JA 2EQUA 2XGXA 1EQYA 4O8UA 2Z33A 2DXBA 4AI4A 2LSOA 4Y52J 4A4GA 2CSOA 4G6QA 4CZCA 2DFHA 1WZ2A 2IVPA 2IS1A 4JLHA 3FWEA 3CXCP 4D5FA 5ERIA 3F73A 4IO9F 1YQKA 2NUTB 2ZXIA 4GLMA 2GLOA 1Q82C 1REPC 1OCZH 5H6RA 1OI1A 1Q7YC 2EIKH 4D8KA 1BI2A 1BQMA 1IAWA 1O3RA 4Y17A 2XSDC 1ZLJA 4DV4K 2F2EA 1VYUA 4O5BA 2I5UA 3G7ZA 3HT3A 2P81A 1NJXA 5D8LB 1J5EK 2PTKA 3MO8A 3D0SA 1NEBA 1S3JA 3E6MA 1VQMT 1ASUA 3ZQGA 2BYVE 1GRIA 4WXHA 5J3BA 3ML6A 4JKDA 2V9VA 4HXJA 2CH5A 4YOWA 1RADB 3CC2Q 4BGBA 4IRIA 2ED0A 4AM7A 2M9UA 2CSQA 3QHSA 3KIOA 4M3DA 3Q3SA 4BY7J 3C18A 4I99C 5D6WA 5HS8A 3PX6A 2Y30A 4DQQA 1KAZA 2V1DA 1GBRA 2R7UA 3PM1A 2NUTA 3HSEA 1S9GA 5AQUA 1TKZA 4M3YA 3DLKA 2V51B 2MOXA 3MCAB 3V4IA 1S1WA 3WNHA 4FX0A 2DL4A 2CRGA 4HSBA 4CJ3A 1IV0A 4Q4ZF 4KGXB 3OYIA 4W5NA 2CQNA 1XC9A 4OPHA 3SUNA 4X1VA 5DK5A 1Z0XA 3F23A 1OYYA 3VYSB 2PEXA 2LTPA 2FPEA 4DCHA 1SQKA 5KE2A 2R4GA 4CEEA 3ZEUB 3CCQT 3UWNA 1VQ4N 1PVSA 3JCMb 2DT5A 4DQ8A 5GAN5 4FWRA 3HRGA 3BPXA 2W7NA 1SG5A 1AZEA 1FX7A 3AA2A 5C25A 4N4OB 3V4GA 4KI4A 2X0LA 5EF6A 4AFSC 2BTFA 4Q47A 3DLLA 3HP6A 2PFBA 3S6WA 2CT3A 4RA2A 3F0ZA 3JREA 3GBTA 1JKOC 2PBIA 1O3QA 4IVNA 4PJOA 3KK7A 4AVZA 3LZIA 2QI2A 4C8MA 1S72A 4C8QC 1IREB 5FKLA 1J9IA 2DXCA 4IHTA 4KTWA 2QTVA 1S1UA 4Z4EA 3KXTA 2KK4A 2EFIA 1SD7A 5AQHA 3WE3A 2MD0A 1TWCJ 2D1KA 3JV3A 2GTJA 2ZJ2A 2P5GA 1H641 2DPNA 4IOCF 4W97A 2MYSA 2F2WA 4HSRA 2F4OB 3OA6A 4LG3A 1UGVA 2NOIA 1L3TA 3NPFA 1C0FA 3QETA 1X2NA 3BTIA 1QLYA 3OVNA 3RR6A 2K9SA 4M72A 3DRRA 5DPKA 1ULYA 2F5CA 2ROLA 3LSIA 3ZQHA 2WV1A 1LMZA 1ASWA 3H8ZA 4XLHA 1GL5A 1H0MA 3CCJT 4CZJA 5KVRA 2QSHX 3G6EQ 2F69A 5GANj 2GCXA 4BQZA 5GAN2 5JMVA 2JVHA 1ZYRF 4BREA 1WPKA 2KAFA 2Y4XA 5AQIA 1AU7A 1OR7C 5FPEA 4II3A 4KHQA 1LWWA 1KC8C 1NHAA 3K1NA 2RF2A 1X9SA 4YIIA 3RMCA 2JS2A 1X4PA 4YOUA 5F08A 3CMEQ 2M3AA 5J1UA 3C7NB 5ILSA 1I81A 1IV8A 1R9TJ 4QT7A 5E1ZB 2VOOA 3RDIA 2FE3A 1SD4A 4XL9A 2YHTA 3KJVA 4X0GA 1RI7A 2Y31A 4C5GA 3W6KB 2L9RA 3VS2A 5HDGA 2I7PA 2EPFA 3HKZA 1C6VA 4H0TB 2G8KA 2F5TX 2IT0A 2HOEA 1RABB 3EYZA 4OPAA 2QM1A 2XAFA 2JHNA 3RPUD 3S32A 1RLPC 5AQLA 3C4SA 5E18F 1U3EM 2OAZA 2P7VB 1M2OA 2DL8A 3WNFA 1R5GA 2L2PA 1O57A 3R6OA 3HBLA 4PQUA 4FHTA 1TL3A 2A1RA 3QRFF 5CIUA 3L0QA 1WHJA 3NGYA 3K6GA 3O5ZA 2EA2A 5AQKA 1Z7UA 1TUGB 1RTDA 4KHYA 2KRHA 1NK5A 3D1NI 4BI8B 2DMPA 4LIVA 2NYXA 2FPDA 1ZKGA 1GOCA 3A8GB 3I5SA 4DYRA 5KK1A 2YG8A 2FA5A 4WWCA 2DZCA 1JBMA 3TQ7P 1A6IA 5J40A 3FJ5A 2EQJA 1B8IA 4OB1B 1HMVA 4MQ3A 3PO5A 2JN0A 1TYQB 4NYNA 1IUFA 2DQRA 3EFOA 1WOQA 5CJ9A 3RR8A 2YKNA 3VQ7A 4RW8A 4H4OA 1JKRC 1CZ9A 1IN4A 3UB5A 1E3MA 3FF5A 3OBWA 3ER0A 3EGXA 5I22A 1J2XA 3HGYA 1FN7A 3CLOA 5GAOr 2X3XD 3GLLA 4PLIA 5MLCQ 1PWTA 3BUZB 2BHZA 5KRSA 5GAN8 5CE3A 4UB8C 2R7XA 4JI1K 1O3SA 1UJ8A 3TO7A 3CQXA 2BE5F 3FSPA 5BRDA 1R0AA 2OTJT 3LP0A 1LJ9A 4RW9A 4KAZA 1HLVA 4Q0BA 5H1SQ 5AQOA 1I94K 2Y9ZA 2P7CB 4ZGJB 4B23A 2KQ2A 4PZJA 4DK9A 3QYHB 5IHNA 2BY1A 2UZKA 1YJWI 4AWXB 2RHUA 1WJFA 4FX4A 1RAGB 1BIAA 2E1ZA 4E7HA 3IS9A 3L9FA 3OOUA 3HL8A 3CCMN 4RGRA 3ZMTA 4XTVA 4M75B 3H9GA 1EWRA 4MQ9F 5AQGA 4YEJA 1VQNI 4M3TA 1XN7A 3PX4A 2W82A 3F22A 3CCMQ 2WADA 2V4JC 4I09A 1NPRA 3MEUA 4LH4A 4M78C 3A2FA 4WQ5A 2OI3A 2CUEA 5DD8A 1FBSA 5C4XJ 2Z1JA 4FWOA 3EUHA 1RKWA 3CMAN 4RAGA 4M7DF 2G7UA 4BDZA 2EJ9A 3SEZA 1MH3A 3AAQA 3OYEA 2WA0A 5BMZA 1TQMA 1KVAA 3JB9G 2V1UA 2KYBA 4AD9A 1FEXA 4E9HA 4K25A 1UG0A 4HZFA 1RT1A 4C92F 3DTEA 5KPZA 3J81O 3IHOA 4YDUC 4BRKA 2GQQA 1MUZA 2NUPB 1ZBHA 3CC4A 2DYBA 1ZXOA 1N8RO 5CKHA 1NGBA 1BOBA 1NLOC 3SAHA 1JJ2M 4IWVA 1IGQA 5D8KB 2KYMA 2L8DA 2XKOA 2WONA 3U21A 4JV5K 4JJCA 3RERA 3KZBA 5CY4A 1XCVA 4J2EA 3RJPA 3G4ST 3PIPF 2CGHA 2PUKB 1HQUA 3A5LC 4Y92A 2HXOA 1NMDA 1OOTA 1AOJA 2OD5A 3AO3A 2UXXA 4E4HA 1XMXA 3A8LB 4CGFA 2NRAC 1OLTA 2CP5A 3K1PA 2DEUA 5DM7L 5IHIA 4I01A 3C0CA 3IFRA 1R36A 3FHZA 1S6QA 1XI1A 3DB3A 1FZPB 4FASD 3L2WA 1NOZA 3KYDB 2GTDA 4EHUA 4XEIA 2P9SB 1DTQA 3HSCA 2DOAA 2RI2A 1QCNA 1WB9A 3FHNA 4YFUA 1H88C 4AHVA 2A41A 3EQLF 1RNHA 1VQPQ 3KVGA 3NQOA 2JHJA 3NEUA 1VQ7N 2XASA 4FLUA 2IVNA 3M4GA 1W2BS 2PYLA 2VODA 1UOCA 4FL9A 3MN5A 3CMAT 3DPUA 1A0NB 4Y1CA 1U8BA 3OYMA 3D7SB 2NOHA 1VSFA 3L3UA 5FLVA 4F14A 1EZZB 1EH7A 1MUDA 1S72Q 2RI3A 3VRZA 1TW3A 1TUYA 2ZJRF 5AIQA 4FSXA 1YJNI 1YBYA 2ASPA 3VFZA 5JS1A 4NUBA 2PLYA 1S7OA 4ON0A 2HNHA 4JLIA 4I6MB 2GEMA 2IOCA 4EMGA 3BZCA 2A36A 4M75A 1WI9A 2PZSA 1OH8A 4A3LJ 2EJFA 3H3ZA 4PL7A 5BN8A 1ZR2A 1VSMA 2ELHA 5B1AH 4K11A 1U5TB 2KDSA 2ISYA 3AO5A 4DQRA 3K4MA 3F5TA 2QDLA 1E3HA 2VC0A 1AKHA 1M1KO 3TL4X 3X28B 1O4XA 2P51A 1GXQA 2O03A 1RT5A 4Z2YA 5KCOA 4IFEA 3EYIA 4C2TA 1AHJB 2OAUA 5LMNK 3B8AX 5AQXA 2HMIA 1U49A 5I2SA 1F5TA 3THYA 3O3GA 1TKTA 4ENMA 5D5VB 2EIJH 4KBOA 3JAMO 1NKBA 6AT1B 1SFXA 4GLKA 1LOTB 4D1QA 2RNJA 5B5EC 4IJAA 1USTA 5CLSA 5CYVA 1VQ8T 3VQDA 1WLPB 4CD1A 1D09B 2RNAA 2JPBA 2O3FA 1S1XA 3I55I 1P4AA 4FM2A 2NWMA 1I50J 2CZ6B 2KQRA 4B9UA 2P0KA 4G12A 1Q81U 4CGZA 4WK8F 4M9XA 3SFZA 1TYQA 2EGAA 1U2VB 2OJED 2EINH 4B24A 3DOLA 5LHHA 4FLYA 1ABOA 1VQ4I 1TG0A 3S3MA 4FJ5A 3JRZA 2L0KA 4CHYA 4M78G 3HRSA 1NG2A 2IVMA 2AXLA 4BROA 1WSFA 4P9FA 3SQ0A 4IUQA 3ISNC 2PQWA 2WV0A 1SEUA 1UJ0A 3RDVA 3HZJA 3WG9A 1WI3A 1J5YA 4ABZA 4QOZB 1HYVA 2E2NA 2CGKA 1J9AA 2QSGX 2L7KA 2LOOA 3I59A 4NL3A 4J9FA 2MMPA 1TWHJ 2FRHA 1YTYA 3Q0VA 1VQNA 1L3LA 3SAGA 2LRQA 3E1YA 2P84A 5FJ8J 1VQ5N 5FROA 5L8RE 3KLOA 5E17F 4CC4B 3O8MA 2ZKZA 4UUTA 3KLGA 3RMAA 3QJ6A 4U87A 1V5EA 2VBYA 3MKZA 4QVDA 1WHHA 2W84A 3ZMUA 3GTQJ 1WGXA 2H56A 2TRTA 3ZQFA 3EG3A 1HLUA 3HB9A 4N4GA 2QWMA 3QEIA 3VMFB 2YHYA 1TH7A 3HO1A 2P5LC 4OAYA 2O4XA 1Q81R 1ETKA 3GX4X 1TTYA 2YX6A 2X6WA 3LYIA 1DT9A 1TK8A 3O2PE 4IRGA 3GEZA 3M3ZA 4MMKA 1Q18A 3KHYA 3PMIA 2VN2A 4AT1B 1WUAA 3AGRA 4EJTA 3NH2A 4J2AA 1U2VA 3VERA 1S1VA 3GF5A 3PT9A 1SKUB 3CCUI 3DMJA 4BL0B 5BOXA 4OO1J 4M77B 3BROA 3GBQA 1VQ8Q 4CJEA 1ZYQA 4LC9B 1WEFA 1OVQA 3BF1A 4M75C 1A35A 4O4GA 4CCJA 2IJLA 4IIOA 3VUZA 2QKKA 1WDXA 4I7HA 4CIGA 4HCBA 2EIFA 1ZH5A 1PDNC 4CA0A 3D4VA 1T98A 4F7UF 2UXNA 4AFZC 2HVRA 2HNDA 4B9SA 1HW1A 3LSHA 3GW2A 4XKCA 3TO9A 3O8VA 1JU5C 4ZYGA 1M3AA 5C0MA 2E1MC 4ORZA 1Y8RB 2IS2A 2DMTA 4JLGA 5C4JJ 2M34A 3H9JA 4PGHA 3PQKA 4PUOA 2CP6A 1M1FA 4CZKA 4CUGA 3HOZJ 3VPRA 5L3FA 1XQSC 5JI6A 2L3DA 4CZHA 4DV7K 3SI6A 2X4XA 2JLEA 2FO0A 5LJ5d 2HKNA 4CJFA 4EV0A 3NWTA 2HOTA 3DKWA 4A3BJ 2HMPA 4XH1A 5AQVA 3VWBA 1ZGAA 3K0SA 2DZ9A 3U23A 1VQ5A 1UWBA 1JT0A 4LFBK 5I9EB 4DWIA 3HSRA 2J7IA 1BOTO 3GBGA 4K8ZA 3JCMc 1MGQA 1ZR4A 2HBKA 4C8QB 1FT9A 3MPUB 3BJ6A 2OTLI 4EJUA 4GO1A 2W4SA 4XLAA 1OPKA 3EAEA 1BR1A 1UFMA 1BB9A 4EIAA 5KCMA 4B21A 5KCHA 4FVUA 1KC8R 3FFIA 2YSQA 2W40A 4UVBA 1LV5A 3JAMK 2EZLA 3WQTA 3JSPA 3M0TA 1YFHA 5BPDA 1ERDA 3BC8A 3GZ5A 1IKWA 4LMYA 1YQMA 3I8DA 1R5HA 2PMZN 1IBLK 2G3RA 2PVDB 4AM3A 4FJ9A 1SKRA 1A5XA 1OZ3A 2FSWA 2CP0A 3FISA 3S3OA 3AVAA 3ASOH 4M9SA 3CJ9A 2UWMA 2UUCK 2Y1IA 2ECZA 5A2QE 4NC7A 4D5CA 5DM6F 1JJ6C 5FFXA 1FIPA 4ZYEA 3TAEA 1QVFM 3IH3A 4C5HA 1SVMA 2LJ3A 2Q1ZB 1YFNA 3H0IA 1MZBA 4W5OA 2NYSA 1WI7A 4BC2A 2O8DB 5K7FA 3KZYA 3I54A 1D4XA 2K79A 5GANe 2ASMA 1XCBA 3NARA 4BDYA 1VQKN 2H1KA 2XMFA 1K9MR 3A02A 1K76A 4DYCA 4B3OA 4BD3A 4QAGA 2HNZA 4OMPA 4PKGA 2FF3B 4B9TA 1GCQC 1OH5A 1DGWY 3CCLT 2EIMH 4O0IA 3ZT1A 1V29B 3GOIA 4DU3A 1RI9A 3J80E 3CDIA 2MPXC 3CMMA 2R5ZB 5HP1A 4ELTA 1WA7A 3V6DA 5CYQA 4XAXB 4NB4A 5E84A 3IKMA 3TPQA 1M2VB 1RUOA 2COBA 4LLNA 3A8YA 4JRPA 2OTJI 4IHWA 3S16J 2NUBA 2XDDA 1GLEG 4N5SA 2M8GX 2X6NA 1PRMC 4BRIA 4PFZA 1AZGB 1NLVA 2QQBA 5HRPA 3OS5A 4UNFA 1YJ9A 3A8MB 2VQCA 4JNEA 3M8EA 2VUBA 4BYYA 3K4JA 2RPNA 1FWZA 2OQGA 1ETXA 1MNMC 3BFMA 1SEMA 4HT9A 2FMYA 5FW9A 3SFIA 3TMOA 5I21A 1JGSA 3VGMA 4JI7K 4DR4K 1YP5A 4H0XB 1MBGA 4MHGA 2OBPA 3ZX2A 4KHNA 3H3UA 2CP7A 3CCRT 2D0CA 1SAZA 3F9MA 4QLCU 1W1WE 3SDGA 3I0TA 1RDWX 2Q2RA 1L3VA 5GAHJ 3A03A 4Z6YA 2JPSA 1T33A 3C2GA 1MMGA 3PSFA 4YORA 2X51A 2QEXT 3AVFA 3VQAA 2W42A 5ILVA 1Z1DA 2F2VA 3MEVA 1OCOH 1CLQA 2P5OA 3OL4A 2Z5UA 3PY8A 3E19A 2DQLA 2JRTA 2CP2A 1R59O 2I2LA 2CGJA 2IVOA 1TUUA 3VJPA 1S6LA 2ITMA 2QM3A 2Q2EA 1XC5A 2QWWA 2VQLA 4OIOF 3CJ1A 3ZFJA 2E2QA 2UUZA 1ZQ3P 2HTSA 4C0FA 4J2DA 1UGPB 3R9PA 4LK0F 2EH3A 2EHGA 2LX7A 1RFQA 1C1AA 4X9CA 3JCMQ 1RTHA 4CCHA 2AQFA 4RTXA 2F4IA 2FBXA 2HMAA 4BRAA 2KDZA 2P5KA 4EGYA 2KIMA 2YHAA 3KLHA 3ZP5A 3PTAA 3VQ9A 3OH6A 4ZN3A 4J6XA 3W0LA 3CCLI 3AVBA 3CCQI 3L3VA 1T8IA 2QKBA 4V2SA 4M7AB 3NFCA 3JSOA 3MVPA 4H03B 3G0QA 3BR0A 2R7OA 2OV7A 2XO7A 1WQ2A 2J6KA 4DFJA 2KMUA 3VA3A 3QFUA 1RDAA 1YIJA 2D0OA 4F7ZA 4L6V5 5EYRA 3FGUA 3IRRA 3SDZA 2DO7A 2UUAK 4BQNA 5TGTA 4C3JJ 1YI2Q 4H0VB 1ZAOA 2X9HA 3CCEQ 1R22A 4KH1B 2JOYA 4PLLA 2FBHA 3CPWS 1WJAA 1PYVA 2DVJA 1VQON 1P6RA 3VDXA 1Z05A 3CJNA 5TKWA 4DV0K 1LNXA 3JRAA 1NKUA 1LFUP 2XGCA 1YI2I 1VQOQ 4CFBA 2L3RA 3CCJA 3RESA 1QVGA 5KYWB 4S05A 5GAMf 2JQ7A 1KU9A 2XAGA 4Z88A 3BJAA 1TQIA 2KIFA 1OCPA 4LJZF 2V1QA 4B1VA 5CR2A 1S72N 1T6CA 2GOXB 3OMYA 4JD2A 4KH6A 5CR4A 3ERMA 2PUOB 2PMHA 3CMEI 2LCCA 3CJCA 1X1PA 5TKYA 2D1XA 1LPLA 2YRDA 1RCHA 4JBAA 2HKXA 3L2CA 4XRFA 2HHSA 5KYYA 2HF4A 2B9SA 5IYCJ 3WXKA 1RTIA 5D7UA 1VIEA 2Y90A 1WCMJ 3GMEA 4DR7K 4RB2C 2HPIA 4NS5A 3U9ZA 2AQEA 3HHHA 3HPHA 4B3AA 4J9GA 1NG7A 3QUIA 4YOYA 2EQRA 1VQ6Q 2L9NA 1GLLO 5GIOA 3ULQB 1TC3C 4J8FA 1OYWA 1K8AU 2EJGA 3SNNA 3H45C 4XORA 4G6TB 1IXRC 4E47A 2ZBKA 5FLXK 3TOAA 3EG1A 5LHGA 4B4CA 4FXDA 1JJ2S 1QHAA 2BGGA 1Q9YA 4RTVA 3QDKA 3SYZA 2EYZA 2L2OA 2MLGA 4B48A 2KRNA 3I56A 1ORPA 1JKPC 4R1HA 1P92A 3CVSA 3SD4A 5LHIA 3UKRA 1HNVA 4E7SA 4HWIA 4OFAA 2B7EA 2DTOA 4CIFA 3EY1A 1CZAN 2JTVA 2B63J 3VESA 1JUMA 1TT0A 2CW7A 4LH5A 4FYXB 4NCBA 4BEHA 1KRPA 1XTAA 4LFAK 4M41A 4AYBN 1VQPN 3K59A 1RR7A 4XQ3A 1Z25A 1RDBA 4LF6K 3CYMA 1D3YA 4I76A 2WC9A 5CKTA 4LY7A 2VXFA 3DFGA 4MFBA 3ZQQA 4G9ZA 1YJNQ 2KJCA 3HSFA 4K41A 1VF9A 1OFCX 3WTUC 1ZBSA 2RKHA 4ZGEB 4DGWB 1LFPA 1K8AR 1ETYA 4C0DB 5EVZA 3CCRI 4O3MA 2BXYA 2ZCFB 3GYHX 2HQ5A 3MEEA 1KG6A 2ZGYA 1YTAA 2LVMA 1T95A 2WTEA 4NC6A 1BW6A 2VYTA 3TANA 4B1UB 3D5RC 3G2BA 1CXUA 5EEHA 4RUGA 2P4TA 3LAKA 2M87A 1BYMA 3BR2A 1MBJA 4CGHA 4WF2A 2DNUA 4UUVA 1X19A 2A6HF 5A0DA 2KNBB 5ICGA 3MXJA 1JE8A 2A6AA 4JK8A 3CCEI 3EH1A 1BU6O 3OW2S 4BQAA 2EV0A 1LJOA 3QMLA 2JA6J 4UVCA 4CECA 1G99A 4YOVA 2GFUA 3CC4I 2FG0A 1ETWA 3K4LA 3OGDA 1R1VA 2CH4A 3LFUA 3OY9A 1IRXA 4KRFA 4M3RA 2FF4A 4I2OA 1WZOA 4CHUA 3MD2A 3LA7A 1MMNA 3CCVN 3T0YA 3F6VA 3QEPA 3HOSA 1ZBJA 1C6VX 2HB5A 2BEOA 4EMKC 5GANg 2JWKA 3HVRA 4C0GA 1XMOK 5M1OA 5GAMj 1FY7A 2PU9B 1MIJA 1ABQA 1U78A 4BJ6C 4L8RB 1HDPA 1WKMA 1KD1R 2A3SA 4LDVA 3LNQA 2GBZA 2EZIA 4GW6A 2XHIA 1G3TA 5K7HA 1QVGM 2CKKA 4BACA 3ZSQA 5EEAA 1ZX6A 1YQLA 3K9KA 5HDKA 4B8XA 2Q3SA 1S9HA 1RESA 4F92B 4AHRA 4E7KA 4CFDA 4OP0A 4ZTFA 3D2EA 2LT4A 2Y4YA 2HXIA 1B1BA 3VODA 1NJIU 2D8HA 1BA0A 4CF0A 4OKJA 1NJYA 2NOZA 2O8BB 1W4MA 1YIJN 3SMSA 3URGA 1I1GA 4DOWA 3LSMA 3OIQA 4PCQA 2VWKA 4BEHB 5EEGA 4M7DB 2O7OA 1UB4A 3TBIA 1H9TA 1ZBFA 4WFBL 1I6HJ 4RTYA 3JCMf 1VQLI 3S2WA 1PVEA 5IP7J 3F3XA 3L42A 1UDLA 1ETQA 3GTMJ 3EPZA 1YVNA 2RV8A 1VI0A 2L7ZA 3RKQA 3ZLJA 4DV2K 3TSPA 2WSEE 3ZCMA 1ODDA 2IA0A 5EG0B 1E3PA 3R60A 3MZ8A 3L4QA 1L5UA 2K9GA 1YIOA 2KRMA 2ISZA 2COWA 2I10A 3LOCA 3HJFA 1JKHA 5E8IA 4D6WA 1OCCH 3MECA 4B1XB 1QP2A 3VV0A 3OYFA 2FRWA 5FKKA 1KHCA 1T3LA 3D2FB 4U0YA 5HLGA 4L59A 3E9PA 2Y69H 1MU2A 2OA8A 2P9NA 1UHMA 2YNGA 2VE8A 3LZJA 2ZJPL 2FJ1A 1EV7A 5I42A 3LH5A 3BG6A 1NEGA 4CHNA 3W2AA 2A37A 3W6VA 2GWRA 5D6XA 3NTIA 3DXMA 2KFZA 5GAOl 2X1EA 1IRGA 3FRNA 4U0VA 2YUOA 2HFHA 3THWB 2A7YA 1RAEB 2JS0A 4F2RA 2NRRA 2A69F 2QWLA 1N9SA 4MDXA 4C8QG 2DFFA 4LLGF 1CF7B 5HCKA 2X4WA 5IXBA 4FW1A 2LP5A 4XLCA 4CJLA 3LWHA 3H3OB 1K9AA 4DTMA 4DBHA 1U45A 2CGPA 2DA9A 2O8EB 3GZNB 3G71T 1WIEA 4MEXF 4M3ZA 1ZLMA 2K9MA 5BR9A 4N41A 1QW1A 2VKDA 2RPIA 2XB0X 4CCMA 2P9UB 3L2RA 3M59A 3NBPA 4FL6A 4Y0WA 1XGSA 4PIIA 2V8JA 2ROTA 1IZ6A 4EA5A 2XRIA 1YF5L 4LUDA 3HG9A 4I9LA 3TW7A 2HL5C 2IIRA 2M51A 1W7PA 4IHXA 4IDKA 4C92B 2PMUA 2QWOA 3VEVA 2V7ZA 5DM7R 3HTSB 1ZARA 3JCMh 4ICLA 3WXLA 2EFNA 2DT7B 5HNHA 3SV3A 4PA1A 4KI6A 2R7DA 5M1QA 1ZRCA 2KROA 1KJWA 9ATCB 5LL6Z 2DFEA 1R8OB 4DJAA 5GAN3 1A6QA 3UDCA 3CCQQ 5LJVA 2KHMA 1SS6A 4OF1A 4X64K 3NHGA 3NGPA 1WJQA 2L3QA 1P4WA 3VSKA 4CCOA 3MN7A 3ZSRA 4DIQA 3RR7A 3DLLL 3F21A 3CP8A 5E79C 5LJ3d 4K0KK 3J7AY 5KYUB 4A4FA 2QTDA 1MUYA 4FYYB 3SQ2A 4M78A 4HKEA 2YUNA 5KYXA 1LW0A 4M6VA 4JHDA 2KDOA 4BRQA 4LF9K 3WU0A 4A0ZA 1QZ5A 3ZQLA 1U3OA 3QIOA 1Z77A 4KH4A 3JYTA 1Y6IA 3L8BA 3E01A 3JXUA 1RDCA 4F04B 2ZZDA 2LQNA 1IHWA 1Y97A 4PJNA 5F2RA 3HOTA 2YKMA 4CFAA 1VQNT 3G10A 3BTLA 3BDLA 3CCLN 3KK1A 4V19S 1WJSA 1KYZA 4OPJA 1MDUB 3AHUA 5KYYB 4JYAK 1T0FC 3BY5A 1ATNA 1VHXA 4O5FA 1RT4A 3MX5A 1KAYA 2M7BA 3CJBA 2X6XA 1XGOA 4BG8A 3E1SA 2EV5A 1B9DA 5IH2A 3I4NJ 1GV5A 2X9DA 2RC4A 2P1JA 1M3QA 3P38A 2JN6A 2L5QA 2AP1A 4JI5K 1O7LA 2OZSA 2X4YA 2NOEA 4F7UB 3UKUB 4PJJA 1VSIA 1SL2A 3TR8A 3OL3A 2HOSA 2V75A 1QVUA 3H1VX 2LQ8A 3KKRA 4M7DG 2FBYA 3KTUA 5TJJA 2IPOB 3AA5X 2VKEA 1N6QA 4DSEA 2XK0A 3QU3A 4RBOA 2R7WA 4DEXA 5A2QZ 4BXFA 4FZZA 4EM0B 4E89A 2LC4A 1SVLA 3CCSQ 3MWPA 1K0SA 2O61A 3WTVC 2VASA 4JRQA 1E4FT 5L23A 1HCRA 3CC2A 3H3VK 2XVCA 2EYYA 4BWMA 2MIOA 1WX6A 4G1QA 5LJ5j 3LL7A 4B08A 3CCSN 3P7NA 1TVRA 2GELA 1WSHA 3OIPA 4BH9A 3CCRQ 3BG9A 4JOMA 2DXIA 2D0BA 3T1YK 3SV4A 3AG1H 2WWYA 4GV9A 1Y96A 1TZLA 4M78D 3HYFA 4HPQA 1NYFA 2XDVA 2CV0A 3DLGA 1G4DA 5F1XA 3SMPA 1IC8A 5JVHL 4FPAA 3ASNH 5GTHC 3ABTA 2UU9K 3RSEA 3SUOA 3QAHA 2FOKA 4K42A 3BQZA 2CFXA 4Z4CA 4L0ZB 3AVHA 5KYNA 3R3LA 1B7TA 1YJ9I 4BRDA 3DBRB 2EYQA 2L02A 4JP0A 5HS9A 3C1DA 1X3ZB 2R5YB 1TUCA 3KEQA 3S93A 3JRHA 4OGCA 4WQ4A 4J8OA 4HOBA 5IPAA 4GCVA 2NOJB 4J9HA 2DLLA 4IOAF 4CC7A 3CCJN 3AV9A 4BRFA 2X74A 3FLGA 4F3TA 4J9DA 3VF6A 3LAMA 3EG2A 1QZZA 1OX9A 1WSGA 3DXMB 1M5Q1 3VS5A 2Y48A 1OV3A 3M0SA 4E7IA 1QS4A 5J2QA 1EO1A 4L18B 1JCEA 3K70C 4EJVA 4WFAL 3SXYA 5BREA 3PIOL 1ZSZB 3MCZA 4BB7A 2VE9A 4NHJA 2JT1A 1YJ9Q 1TL8A 4QW2A 4KIFA 1YHQN 4ISEA 2DDBA 2JK3A 4YIFA 4HBLA 3BE3A 5M3MJ 2DA1A 2X6YA 2LZ6B 1FNNA 3FR0A 1MWKA 3NRVA 3UNGC 1MJBA 3ULEA 3DP7A 4DEYA 1IO2A 4KIBA 3HOWJ 4NOYA 1UECA 5CKDA 1M30A 3THVA 1WXBA 2HR3A 2QQ8A 3K1MA 2GGRA 5LL6S 2D0AA 2L7MP 2VONA 1YJWN 3A01B 3S2DJ 2DVEA 2VG7A 4M45A 1LPQA 1BA5A 1M3CA 5CZ2A 4LF4K 2XY6A 2VWBA 5LJWA 3T19A 4G94A 4AUXA 1M2VA 1IDZA 4FJGA 5KI6A 3VS0A 2ESWA 3LQQA 1BHLA 1LQ1A 2HHQA 2I7NA 3EG0A 1HSQA 4DTXA 3HP9A 5AR0A 1OKRA 4JZ3A 2O9LA 1J7KA 3JCMd 1HPZA 2OTLT 2MGQA 1JRIA 4FLWA 2YI1A 4JK7A 5FU6B 3H9QA 3HOUJ 3AG2H 3DOKA 1WAFA 4PFPA 2IAJA 4HF1A 3L7WA 1XJWB 4LD0A 3OMGA 2EQIA 1X43A 4MTEA 4ELVA 2EZKA 3W2VA 4M3EA 1HJDA 2V1NA 2ZPGB 1LEBA 4UC4A 2QW9A 1LCUA 3PVQA 1DU0A 1S7AA 4CXFA 1Q7YR 1W36C 2NVYJ 1UA1A 2LJ1A 2GUPA 4C1NI 2CQ7A 4A69C 5GMKm 2MA3A 3QWXX 1PD1A 3F8NA 1FC3A 2RHYA 1O13A 4S04A 4ENJA 2HSTA 3VYUB 4CEAA 4CJTA 1RRSA 5J2PA 4A3FJ 2C06A 3K0LA 5GAMh 1E2XA 3FMRA 2ZSIB 1APLC 1R77A 5BPNA 3THWA 4XU0A 4H0PA 3ZETA 3REAB 1VQ9I 2M02A 2KZZA 5ADXA 4NB5A 5FU7B 1VQ6T 3H6EA 4EJWA 2L54A 4LF5K 3M56A 3I56T 1RACB 3EE8A 1IRFA 2SEMA 2VCPA 1TW2A 3ZMZA 4DTUA 3Q0UA 5E8GA 2GM4A 4XKWA 3ZSVA 4BUGA 2Z2SB 3ZMVA 5FPDA 2LNBA 3HC7A 3LWLA 3RWUA 4C1NK 3HJEA 3H6ZA 3JCMe 1OR7A 4CK3A 2K4YA 1VQLT 4EFHA 3EGDA 2D0PA 1W7AA 1KG2A 4C23A 1JHFA 3CQTA 2VWFA 4NO7A 1H8KA 3TSWA 2LF8A 4X9DA 2OUMA 4OKKA 3ABKH 2M16A 4DA4A 5KQDA 5KPRA 3OIOA 1X3WB 3M1EA 3O4WA 4D7NA 1YJNN 3VRYA 4UY8O 3QZ5B 1FMKA 4BY6C 5B8HA 1TSFA 4A63B 1GLBG 3ZETB 4EMSA 2QA4N 4FOIA 1SC7A 2PQ8A 2A5YB 3Q7CA 3ZX3A 1QQIA 3J81Z 2KTQA 2OPSA 4Q5WA 4CEFA 3EKUA 3MMVA 3P31A 3C94A 3H0DA 1EP4A 2K27A 2DRMA 4G9YA 4XONA 5FPMA 2GA2A 1AWCA 3P8DA 1I1JA 3H08A 3AL0B 3ALYA 3QJYA 3O3FA 1VQNQ 4XN0A 4C0ZA 2BHYA 3TVTA 4CD3A 4X65K 5AQMA 1OPCA 4CJVA 2K4BA 2JNGA 2UUBK 1YW9A 5AQTA 2B6AA 2RD1A 3H5AA 1JLAA 2RB6A 1JEGA 3OYLA 2G7HA 1T6SA 3HUGB 4H5VA 3FHGA 3DU5A 3HUGA 2F8SA 4Z4FA 3C0BA 4FE7A 3QO3A 3EZWA 3CCUQ 4IQJA 5KAFC 5E26A 3GLXA 4CJ7A 1GLAG 5F0CA 5J4VA 3JRCA 1VTNC 4ZDPA 4A4EA 2CDTA 2BKDN 2X4HA 4CJKA 2J5OA 3B6CA 2DPUA 3H36A 2J5PA 1YJWT 1YX5A 3BR6A 1RI0A 2R7YA 4DFMA 3BZKA 2WTUA 2E7XA 1VRLA 1YITI 4DZJA 4J00A 1E3OC 2CSIA 4PJOB 4CEBA 1ORKA 1T8EA 1JL1A 1AWXA 1K9MO 4BS9A 1GHCA 3I56I 3HL2A 2RQVA 4BHCA 5EGOB 1PM3A 4TSXA 1A5VA 2DILA 2WFBA 2E8AA 4FWNA 2Y0SN 1JO8A 2V9KA 1I6XA 3IHUA 3RMBA 1HK9A 4BXXJ 1RGIA 4RW7A 2ENMA 1D5AA 4JS5A 4CESA 2YDLA 1UGSB 4BR9A 3E6BA 3CD6T 1MH4A 2DA7A 1ZELA 4RMNA 3OJSA 1AVZC 1JTXA 3O8GA 2K2MA 5HKCA 5CAIA 4NLCA 2F6CA 1P8ZA 2KRSA 1NBWA 2Y0MA 2QG9B 2NS8A 4CCNA 4XH4A 3CJ7A 1P2FA 2GXGA 3LDLA 1M90C 2E2OA 3S1QJ 2EWNA 1DEJA 1QTMA 5GAGP 2NRTA 4FWSA 3QODA 2E4HA 3NHNA 4MLHA 3LALA 1FTZA 4HG2A 2DIQA 2CH4W 3BDPA 5E3NA 2IA1A 4AIAA 1V4RA 2JM9A 1DPRA 3HHTB 3M9AA 2XPVA 1IG8A 3E0JB 3WTXC 1UGRB 3CJQB 2R92J 2J6FA 4E19A 4KT6A 4FM0A 3VYGA 1WJ5A 3CCUN 1KU7A 1G8XA 1SMYF 1B07A 2XHCA 2KIUA 2BVLA 2OCCH 2DETA 2VOPA 1VQ4T 3CXCA 2JMWA 1QSYA 4MO4A 1YS7A 2YX7A 3CC7N 1QZEA 1PKSA 1FYMA 1N27A 3K58A 3LM9A 4JKEA 2H8RA 1S3XA 3OBYA 2L9SA 4J01A 4M78F 3CZ6A 3WNGA 5C42A 2RQTA 2EYXA 3Q9SA 3GFLA 4BVOA 1NGJA 1VQ8N 3FXKA 3OQ5A 1V3FA 1OYXA 1D1CA 1OMIA 3VEOA 3CCSI 4A2BA 1RBTA 4OINF 3CCLA 4C8QA 3FZKA 5EY4A 5KQ8A 3GIBA 1EA3A 2DOFA 2BE7D 1DIZA 2NVXJ 3SJJA 5EG0A 4KN7X 2HEOA 5GP9A 5AQWA 5DS9A 4Y28E 1UAXA 2CT4A 2HAXA 2JMCA 3V8LA 3M3YJ 1W2BP 4FE4A 3L1AA 1A5JA 3DKMA 3T9NA 3PQJA 2G8VA 2KXDA 1NKEA 3IMXA 4RG2A 4E0DA 1PKTA 1YT3A 4R56A 3D6RA 1GCPA 3FXUA 4EW0A 4AFQC 3CP2A 5LLQA 2R5ZA 4B3TK 2HTJA 2IW5A 5B66C 4XK8E 1KXPA 4KUDK 3G4SQ 4I6MA 4I0BA 3CXCM 3QSUA 4KB1A 3NWSA 5E3OA 4HF2A 4XSZF 4M77C 4RTWA 3A0HC 3G4SN 4GNIA 1BGXT 4XICA 3FHFA 3KNTA 1CSKA 4P55A 4B43A 5AQNA 1NGNA 1QWEA 3FBIB 2HDDA 3HXLA 4BWJA 2VXEA 4I9QA 4KNYA 3CCEA 2JA8J 3EGXB 4OMNA 4L9NA 3ZSXA 3RKXA 4FYVB 1WWXA 1Z9CA 2P0PA 1IKVA 1JLGA 4FT8A 1P7IA 4ME7A 4M7AD 2KT1A 2YCHA 2QGGA 1M3BA 1VQ4Q 5CHZA 2KJBA 4AVPA 4DQ2A 4LXCA 1SRLA 3DXJF 1QHGA 3QPLA 2FL7A 4R79A 1IXCA 1JXEA 2XAQA 4IHYA 1WHMA 3A8OB 4RAFA 2JTEA 4KA4A 1KG5A 2V7FA 3HK2A 4OGEA 4PGGA 3K9JA 3O3KA 4C2UA 4PL8A 1KHIA 3G25A 4I7FA 2RE2A 3KLFA 4HUEA 4AQYK 3EHQA 4KICA 4E2FB 4B3RK 2GIVA 1MMDA 1JGGA 2YJFA 2LYCA 4ELZC 2STWA 4C8QF 1E7OA 2K3YA 4Y3OA 2EB7A 1DUXC 3CJTB 5JR3A 1WHLA 3PNWC 1BJZA 4DNCA 2EYWA 1KU2A 3SQ4A 2Y9YA 2CUBA 2E36A 4L5EA 1X9WA 1P4XA 4RAZA 2F9TA 2VBWA 3OW2A 3LDPA 1W6XA 1NJIC 1BIZA 1OKJA 3NTHA 3RSNA 1RNLA 4UV8A 1IXSB 1B59A 4CJSA 3W3DA 4ID1A 3ZX0A 3VTHA 1N8RU 2F5VA 1GFDA 3N5BB 2HPMA 1RT2A 4PKCC 1UG1A 4N47A 4X66K 4IOXA 2W0ZA 1GXPA 2EZHA 2JRMA 2F8TA 1RL2A 3E9LA 2W85A 3CC2N 1NGIA 2OX7A 4LITA 4PL6A 3LSJA 3ZMDA 1OULA 2HHHK 4A5MA 5FU6C 3IH4A 3RZOJ 1LEAA 3KD1E 4IOAL 4LD9K 2F2XA 2CYYA 4XRSG 3R2XC 4A6EA 4H5WA 2HGCA 4IUVA 4ELYC 2LCSA 4C8OA 2AK5A 4IHVA 2B5JA 4F7UG 5FPNA 2VC1A 5DUIA 1KLNA 1I27A 1ZQ1A 3TREA 5AN4A 1CKBA 1XNQK 4FOEA 3H1QA 2M0YA 3KCCA 1RDDA 5FO5A 1N75A 2NAZA 4KTZA 3L1PA 1IN8A 3HKSA 5FLXO 1W0UA