3OYLA

Crystal structure of the pfv s217h mutant intasome bound to magnesium and the insti mk2048
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 111
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oylA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oylA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oylA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oylA03
1S9EA 2X6NA 1QS4A 3HP9A 3AV9A 1HQEA 3LPUA 1VSHA 2X6SA 4AHRA 4IFYA 2G8VA 1T8EA 5HBMA 2PY5A 2FC0A 3OVNA 3ZT3A 3E01A 3VQ4A 1NJWA 2Y1JA 3AVIA 3K5MA 3V9WA 1QTMA 3E9GA 1JLEA 2VG7A 2ZQBA 1BGXT 2MWOA 2OPRA 1D9FA 4RW7A 4CFCA 3KK1A 1N5YA 3AA4A 1HRHA 3LP1A 2XY7A 2RI3A 4N4HA 2IC3A 1HJRA 3LLRA 4E7LA 3OYCA 3SCXA 3O3FA 4DU4A 1TKXA 1EKEA 3AO3A 3T19A 2R5MA 3CFPA 3K59A 1HYSA 5JS1A 2RJDA 2DFHA 3T1AA 2RN2A 4X34A 3DRSA 1BQMA 3LYIA 1KFDA 4FVMA 4CEZA 4DSFA 5J2NA 4CJRA 1XI1A 1EP4A 4E1MA 3K5LA 1GOBA 3DOLA 4CECA 4DTMA 2X4WA 4OJRA 1KRPA 4J2AA 4LY7A 3ZSVA 3CFRA 4DS5A 5KGXA 2O4GA 4PQUA 3OYLA 5J2QA 2YNFA 1UA1A 4KKOA 2IG0A 3TANA 3DLKA 4CJQA 3S6WA 5HLFA 3ZSRA 3RWUA 4DTNA 3U3GA 3FLGA 1FXXA 3M8PA 3G10A 3TWHA 3SQ4A 3MXMA 1NKBA 4FJNA 3ZT0A 1ASWA 5SZTA 4M3WA 3NGYA 1DTTA 3EZ5A 3OYJA 3TI0A 3RR8A 2B5JA 4B9UA 1BCMA 3M8QA 4F3TA 2QQRA 2FBXA 4CHNA 4E7KA 5D6WA 1IKWA 5D6YA 5D3GA 3CFOA 3AVKA 4OLBA 3OYNA 1SUQA 3P8HA 4DFJA 3VQ5A 3QIIA 1NK4A 3VQDA 3LGFA 1EETA 4F8RA 4MFBA 4FW2A 2GV9A 1ZBIA 4KB0A 3PY8A 5HROA 4CGHA 4N56A 2E6MA 4FJXA 1S1UA 1VRTA 1BI4A 2HB5A 3VQQA 1OI1A 3MEWA 1I39A 2GFAA 4HUFA 4FLZA 3L3UA 2HHQA 4EP5A 3V9UA 1KLNA 2XY8A 3LZJA 4CJVA 2NLUA 4NYNA 4B9MA 4DTXA 1LWEA 5SWMA 1VSIA 1DLOA 1RDDA 4CEQA 4OKEA 1BQNA 4E19A 3LGLA 3SI6A 1TL1A 4R5PA 1L3SA 3KK3A 1MHNA 4DG1A 3C95A 1RBUA 1Y97A 4YNQA 3O4QA 4DQPA 4BACA 2LCCA 2QKBA 1HNVA 1BIUA 2GFUA 2EQKA 2HHXA 2G8HA 3BGRA 4HUEA 4FZYA 5CYMA 2ITGA 3QO9A 4C8NA 3SV3A 1FKPA 3ZT4A 2RI2A 3META 4DQQA 3Q1JA 4IBNA 2OZSA 4CHZA 2XDPA 2M1HA 3SZ2A 4BE1A 1GOCA 3I8DA 3DOKA 4HCZA 1S1VA 1U49A 3T3FA 2Z1JA 1ZBUA 4M42A 2RJCA 2YHAA 1C0UA 3HSTB 5HRNA 1KHCA 3MXJA 1C6VA 2RJEA 4FLTA 1RTIA 2ATQA 1IKXA 4CIGA 5KGWA 4DTSA 3OA6A 2R5AA 4E7HA 4FJ8A 2QK9A 4NCBA 1B9DA 1T7PA 3VQ9A 1T05A 2D0AA 4B3OA 3K5OA 2RHZA 1RDAA 1REVA 4BD3A 4E7JA 3NF8A 3IS9A 4CIFA 4KPYA 2RPIA 4W5OA 1U47A 3OMGA 1QSYA 1X9MA 1LW2A 3ISNC 5J2MA 1RT3A 3PO5A 1TKTA 4ZHRA 4EDUA 2L3RA 3V1OA 2YKNA 1RT7A 3OYFA 4FZZA 4NYFA 1JLCA 3AVNA 3ZSXA 4AHVA 3TAGA 2XRIA 3AO2A 5KRTA 4LSNA 4I9LA 3NH1A 1NJYA 3CM6A 4DSEA 1D5AA 3TAPA 1BCOA 4CJKA 3UT1A 1VRUA 3NH2A 4AHUA 3WNGA 4F2SA 1SV5A 4CJWA 3DLGA 2B4JA 3ZSYA 3ZT2A 4DWIA 3K2PA 4CJSA 1NKCA 3NTIA 4KTZA 1RT1A 1IKVA 3MAQA 1KTQA 1Q8IA 4CRIA 5D6XA 4O55A 2HHTA 3L2QA 3I0RA 1IKYA 1WSJA 1X9SA 1MU2A 1ZBHA 1SL2A 2DTUA 5I3UA 1BHLA 2G8WA 3MEVA 3V9ZA 2IAJA 2O4XA 1J5OA 4AILC 4B9XA 3OS1A 4FJIA 3LANA 1ZBLA 1U4BA 1D9DA 3VQ6A 3ALYA 4OLAA 1RT6A 3UIQA 1N27A 1NKEA 3VQCA 4DS4A 4GW6A 4OKJA 1A5WA 3ZT1A 1N6QA 4J2DA 1S9GA 4CK3A 3LDSA 1RI0A 4HTUA 4DLGA 1S1XA 3LP3A 1WAFA 4KO0A 1WSFA 3P5JA 4B9SA 3OY9A 4FJ9A 2G8KA 3O4NA 3JYTA 1KLMA 3ZCMA 4CK1A 4FZXC 3F73A 4LD6A 1RBRA 2KZZA 2HQXA 2YNIA 2IDOA 1OZ3A 3OYAA 3HPOA 1NJZA 5KCHA 4ELTA 2Z1GA 2E6LA 3QIOA 4H4MA 4BWJA 2HHSA 1A5XA 2BUDA 4C5EA 3M8SA 1RBSA 3A2FA 1FKOA 1KVCA 4PY5A 4FM2A 3K5NA 4C5GA 3KLHA 4C8KA 2VWKA 4OPKA 1L3TA 4FK4A 2FBVA 2E6NA 4K8XA 4CHPA 3OYMA 2JGUA 2E5QA 3F70A 2EX3A 2WONA 4JRPA 1HYZA 2K3XA 3MP8A 2HHUA 3RRGA 3NF7A 4QW2A 3HVTA 4LH4A 4Y1CA 1IG9A 3DLMA 3ZSQA 3SNNA 4B9LA 4W5RA 4W5TA 3MO8A 3PV8A 4I2QA 3RMCA 3OYGA 4DFPA 2F5KA 1NK6A 3V9SA 5CZ1A 4DTRA 2Y1IA 3RMDA 2LTOA 1SKWA 2HNZA 3RTVA 3TARA 4J2BA 3HP6A 3AO4A 4CF9A 3S3NA 1TK5A 4C8OA 1JXEA 5DK5A 4N76A 2K3YA 2R57A 1S6QA 3B6PA 1RT5A 3THVA 3HPGA 4NCGA 3VQEA 4J2EA 2W42A 2RHUA 4LSLA 4A4FA 4CF0A 2EFIA 3NNQA 2FBTA 3L2VA 2OZMA 3QBYA 4B8CA 4UC4A 3LP0A 4IKFA 4N5SA 3KK2A 3AVCA 2EQUA 1RT2A 5HRRA 1NK9A 1RTJA 3TAQA 3ME9A 1YTAA 4OGEA 1XNIA 1SL0A 4KHQA 4IDKA 4CJEA 2FBYA 2P5GA 3QEPA 5E41A 4KTQA 1IH7A 4FK2A 2A1RA 1VSJA 1WJQA 2G8IA 4B08A 2D0CA 3ASKA 3VQAA 1UAXA 1VSEA 1KFSA 3LZIA 3CM5A 2XHBA 4F3OA 1GOAA 3NAEA 4CJUA 2GF7A 4CEDA 2EKOA 3DRRA 1KVBA 1J9AA 4CIEA 3O8VA 4BWMA 3VA0A 3QETA 3KIOA 3QNOA 3L3VA 4CJTA 4DMNA 4KHSA 4DTOA 1WN7A 4QQ6A 3NBPA 3WNEA 1JLBA 3VN5A 4RW8A 3SYZA 4JLHA 1S5JA 1RBVA 3HK2A 4RW6A 4CGIA 1JLGA 3O3GA 3FDRA 4H4OA 3P8DA 1X9WA 3AO5A 4AHCA 1HNIA 3SJJA 4KHNA 2OPSA 3VQPA 4Q0BA 5FROA 1U45A 4PL6A 4B9NA 1KSPA 1G5VA 1IO2A 2M0OA 3GOXA 1Q9XA 4FJ5A 4W5NA 2XO7A 2ZD1A 2E4LA 4CF2A 4H8KA 4CEOA 3DLRA 4IUTA 1JL1A 3F9KA 4FW1A 2G8FA 2M16A 5IAYA 3K57A 2OA8A 4DQSA 3V6DA 3KUFA 4N47A 5I42A 1WJSA 3SUNA 1XHZA 1RBTA 3MP6A 3OYDA 1WSIA 1C0MA 1TV6A 4F2RA 4CJ4A 4RW9A 3BDPA 2P0KA 3I0SA 3MEEA 3LH0A 3SV4A 1BI4B 4AHSA 3L8BA 2Q3SA 1YVUA 4O5BA 3VQ8A 3H6ZA 5M9OA 4WE1A 3DB3A 4B9TA 4Z4GA 4MQ3A 2PQWA 3AVBA 4QQDA 1S1TA 1JLFA 1LWCA 3HO1A 1U48A 2P51A 2X35A 3KD1E 4FJJA 2RF2A 5J2PA 1JKHA 3OS2A 4EZ9A 1CZ9A 1TL3A 2B8AA 4DTJA 1ASVA 1TAUA 4OVLA 4CGFA 2ETJA 5KE2A 3BDLA 3MEDA 2EHGA 2RO0A 4IUVA 3OYHA 1YT3A 1TAQA 1CLQA 2X74A 1Z26A 3RMBA 4CHYA 3V9XA 3NHGA 3SUOA 1HMVA 4Y1DA 3QJ6A 1W9HA 4IURA 2VG5A 3O3HA 3LPTA 3NTHA 1DTQA 4KRFA 4CJ5A 1Q9YA 4CJLA 1EX4A 3IRXA 4HCBA 4KI6A 2HW3A 2MWPA 2YKMA 1WNSA 4DLEA 4CJFA 3HJFA 1U04A 2HHWA 2HNYA 4II1A 4C8MA 5KCOA 2QQSA 3P1GA 3HM9A 3AA2A 2DIGA 1B92A 3EAEA 2X78A 3C94A 1TVRA 3SQ1A 1RDBA 4OKKA 1JL2A 3S3OA 4ID1A 4CEFA 3V1QA 2IS3A 2IOCA 4M45A 4GMJB 4CF8A 2BDPA 1NK5A 1O1WA 4FM1A 4A4EA 1LWFA 3NDKA 3DLEA 3DYAA 4KI4A 2F8SA 2EQJA 3HVRA 3M8RA 3CQ8A 1K6YA 4FL6A 4C5HA 3CEYA 2B6AA 3QEIA 1H3ZA 4CFAA 2X4YA 3LAKA 3MEUA 2HQEA 1FK9A 3OQ5A 2D0BA 2G3RA 4M3TA 3C6TA 4O44A 4FJ7A 1CXUA 1HPZA 4KV8A 3KLFA 4E1NA 3KLIA 1QSSA 2QXFA 4IG3A 5JS2A 3VA3A 3M9QA 3PMTA 3VQBA 5C6SA 3KTQA 3L2RA 3QEWA 5J26A 3MEGA 4FLVA 1XWLA 4BDYA 4IUQA 2HNDA 2IGIA 4FXDA 4N4IA 4A4GA 1W0HA 3WNHA 3LWLA 1VSMA 2PYLA 4M3YA 3U6FA 2PZSA 2FHDA 3LAMA 2RHIA 4QAGA 5KH6A 1NOZA 2OPPA 4FLYA 4HUGA 3K58A 4OPJA 4B8AB 2O4XB 3ZEHA 4JS4A 3PNWC 3TAMA 3MXIA 1JLAA 1D8YA 3HL8A 3UWNA 2DY4A 4K8ZA 5HRPA 4DQRA 2XY6A 3DMJA 2D5RA 1C1BA 2D9TA 2WACA 2YV0X 4AH9A 3OB9A 1S1WA 5DMRA 4PLLA 4TSXA 4KHUA 4C8LA 2BKDN 3QKJA 1J54A 4Z0UA 4FJKA 1RILA 4RW4A 4DTPA 3NTKA 3KKSA 5FDLA 5CYQA 3HPHA 4W5QA 2HVHA 3B6OA 1F21A 2JZ2A 1ITGA 4PA1A 4FJMA 5CIUA 4NZGA 2KQ2A 3ASMA 1SSFA 3SPZA 4FYDA 3S9HA 4G1QA 4I7FA 4CGGA 3AVMA 4OGCA 3TR8A 4Q5VA 4M3ZA 4KREA 3HYFA 4DSKA 3HXMA 3TAEA 4DF4A 4BDZA 1TGOA 1NK7A 4PWDA 1SKSA 4CHOA 1QHTA 4KHYA 2R58A 2KFZA 3CG7A 1SL1A 4DFMA 3OYEA 4N41A 3NF9A 1CXQA 1RTHA 2BIVA 1L5UA 2A1SA 1VSLA 1RDCA 2ZE2A 3SQ2A 1JXBA 1T03A 2VG6A 4JRQA 3D45A 2LVMA 3PMIA 3QINA 3CYMA 5KRSA 4FLXA 3ZSZA 4Z4FA 4E0DA 2DFEA 4DSJA 3AA5X 4L8RB 1LAVA 3MEAA 3IG1A 1XHXA 1C0TA 1LW0A 4IFVA 1L3UA 2VWJA 1RNHA 2PYJA 3SUQA 4C5IA 5C0MA 2O4IA 4CCHA 1WAJA 4ELVA 3ULDA 4BE2A 3PX0A 2KFNA 4B9WA 5J1EA 5T7BA 2KZMA 3FC3A 3LALA 1RCHA 2L89A 4DU1A 1WSGA 1ZYQA 3PX6A 1QE1A 2RHYA 4HHTA 3PFSA 3QIPA 2DFFA 3L2UA 2LRQA 2RJFA 4CESA 1L3VA 3AVGA 4Z4EA 3NH0A 4DQIA 4UQGA 3AVJA 3V1RA 4CJPA 4CJ3A 2KW4A 1X1PA 2RHXA 2CKKA 4Z02A 3RRHA 3QLHA 4CHQA 2Z1IA 1QSLA 1BIZA 3DLBA 2LDMA 4PLIA 3DRPA 2NUBA 4M41A 1J53A 1WLJA 3OJSA 4QVZA 4O0IA 4FCYA 2QKKA 1B9FA 3S3MA 4I9QA 3U3YA 5FRMA 4KFBA 3KLEA 3RMAA 4QQGA 4M3RA 4BE0A 3OYBA 1WGSA 1VSKA 2Z1HA 1EXQA 4F4KA 3DB4A 1VK0A 2P1JA 4EZ6A 1CZBA 2KTQA 1KVAA 3SPYA 3MP1A 1RTDA 1TKDA 1QQCA 3SD4A 3EYZA 2WOMA 2XK0A 1UWBA 4KTWA 3QEXA 4CK2A 4RG2A 3SQ0A 3P83D 4HCCA 4FJHA 4AHTA 3AVLA 3LP2A 2GBZA 3AVAA 4Z4IA 2P5OA 1KCFA 3QESA 2RKIA 1SKRA 3QEVA 3AVHA 4Z4HA 3WNFA 1TKZA 1I3AA 4ZTFA 4ID5A 4OVAA 3ZSOA 3NCIA 4DFKA 2AJQA 4NS5A 3LWMA 1Z25A 3V81A 4DSIA 3DLHA 5C42A 3NGIA 1ASUA 1BL3A 2X4XA 1TK0A 1YTUA 3PX4A 4RG8A 4PUOA 2F8TA 3DI6A 4NCAA 1HYVA 2BANA 3NGZA 3C4SA 4E3SA 4M3XA 3H8ZA 1VSDA 3PUFA 4O0JA 3IAYA 1XC9A 5HRSA 4ICLA 4A4HA 1ZBFA 3NF6A 1LAWA 4FJLA 4IG0A 2RI5A 1WSEA 5K14A 4GY5A 4FLWA 4KHWA 2R7YA 4CGDA 4QOZB 4CGJA 2G8UA 1TK8A 5KTQA 5HP1A 4CERA 1LV5A 2XY5A 5IN1A 1UOCA 4KB1A 3OMCA 1NK8A 3OJUA 3MECA 3L2WA 2DAQA 1C1CA 4DF8A 1NOYA 5C24A 3HT3A 1NK0A 3G0ZA 3QNNA 2LSNA 1BISA 3AO1A 4LH5A 1WJRA 4CEEA 1WSHA 4IUPA 1VSFA 3AA3A 3V4IA 1OZ2A 3NE6A 1R0AA 3OS0A 4FU6A 3ZSWA 2HMIA 3AVFA 5J39A 3TABA 4O4GA 5EU7A 4LD0A 3H08A 4ELUA 3KJVA 3JSMA 2YRVA 4XIUA 2JLEA 1HQUA 3FEOA 2BE2A 5KE3A 4L59A 3C6UA 1JLQA 4DSLA 2DIQA 2HVIA 2BGGA 4Q5WA 4N4GA 3PO4A 4FJGA 3KKRA 4JS5A 3TAFA 1C1AA 5CY4A 2F96A 4KAZA 3OYIA 1UA0A 2GUIA 3FFIA 4GVMA 2L8DA 4DTUA 4YFUA 3NFAA 3DM2A 2JTFA 3KD5E 2I5JA 3RR7A 3SUPA 4CFDA 2YHBA 2VYTA 1NJXA 3D0PA 1OYXA 4IUUA 2EQMA 5FRNA 4E89A 3E9FA 4E7IA 3KLGA 5C25A 4CFBA 1RT4A 3ITHA 2YNHA 4I2PA 5KI6A 4CF1A 3EY1A 5CZ2A 1S6PA 4QCLA 2OPQA 3OYKA 4FM0A 4DU3A 4CEBA 4M3UA 3L42A 4CEAA 4ZTJA 4Z4CA 3VQ7A 4BDPA 3QERA 4FLUA 4EP4A 1A5VA 4HVJA 2OYQA 3LX7A 4FK0A 4CE9A 2HHVA 2YNGA 1G15A 4B9VA
chains in the Genus database with same CATH superfamily
1S9EA 1S5LC 1B72B 4PCQA 1K6OA 1OKRA 2RDPA 1YX5A 5HK0A 3UDCA 1T8EA 1N32K 2H6CA 3PSFA 2PY5A 3LDPA 4M71A 4M4ZA 3X25B 1X2QA 2RD1A 3SEQA 4II2A 4G9YA 2IPOB 1ZSZC 3E9GA 1G59A 5D8LB 1VQ9T 1NLPC 2MWOA 4CFCA 1AEYA 4DV2K 5IT9E 1KFZA 4K43A 4BNCA 1AWJA 2HI3A 1HDPA 3QODA 3LP1A 3A2KA 4FWPA 2RI3A 2YUNA 4FOEA 4IOCL 1SEUA 3CPWP 1U1SA 3O3FA 1TKXA 4J00A 2FOWA 2MA3A 5H1SQ 1HYSA 2V1RA 2DU9A 2O9SA 2FMYA 2RJDA 2GEMA 2QSHX 3DRSA 3M1EA 2DPPB 3LYIA 1BQMA 1KFDA 3EFRA 3QICA 4DSFA 3CCUN 4HNUA 2Y31A 3HOUJ 3UA6A 5KAIC 3D1NI 4FSXA 1ORKA 3ZSVA 5K5QA 2O4GA 4YFNF 8ATCB 3A0IX 4KH5A 2HTJA 2L7FP 1UA1A 3CJTB 3OMYA 2IG0A 3TANA 2L3DA 1IDYA 2XKPA 3HOYJ 1OYWA 1HXDA 3U3GA 1EH8A 3FLGA 1WHUA 3MKLA 2D0QB 1DQUA 3IHOA 1IRGA 3THXA 3FXMA 1VYTA 2OU2A 1NKBA 3SDBA 1ASWA 5SZTA 1OFCX 1DTTA 3EZ5A 3HHGA 3WU1B 4B4CA 1KAZA 2BY3A 2JVHA 2I10A 1R5ID 2JPSA 3BY7A 3M8QA 2VQCA 2EYXA 2ZJ2A 1SFXA 5D6YA 1RUWA 1I8FA 5AIQA 2M7BA 2R7OA 3CPEA 3LSTA 1Y39A 3SLCA 4MQ9F 1SUQA 2BBYA 1OH6A 3QIIA 3WXLA 1YHQA 3AAQA 2C0TA 3TTCA 3EG1A 3T69A 1T3VA 3LFKA 2HOSA 1S8NA 2DX1A 2DLPA 3MK6A 1EETA 5HOOA 3CC4I 1ETVA 4RAFA 1VAZA 5KN8A 3I5RA 2GV9A 3TSUA 4PJ0C 4K42A 2ASMA 5LHHA 5C44J 4KB0A 2W7NA 3PY8A 2OCCH 4JHDA 3QWYA 4WCIA 1S1UA 1K73U 3CCSN 4GV9A 1GV2A 2DL8A 5GMKe 3GO5A 4JLGA 1JO8A 2HHQA 4XLCA 5GAN2 3J80Z 5E26A 2XRNA 2VXFA 1OCRH 1V55H 1KLNA 1RDUA 2XY8A 3KTUA 1RKWA 4NYNA 1MJBA 3F0ZA 1KAXA 5SWMA 4BRHA 4XLFA 1IREB 2HU9A 1GRIA 1SRMA 2GXBA 5EG0A 4Y0WA 2L2PA 2FSJA 5BOXA 4R5PA 1L3SA 3N05A 3E66A 4RAYA 5C2FA 4YNQA 2E34A 5DV5A 2QZ8A 2XAFA 4XNFA 4DQPA 5GAOp 3FHNA 3VRZA 2QKBA 1M8MA 2OTJI 3PVLA 1WQ7A 2KZVA 1ZREA 2QGGA 2VASA 2GFUA 3ZMUA 1M27C 2EQKA 3CXCM 5KVRA 2G8HA 4PJOE 1IW7F 2FB7A 3TO6A 4FZYA 4C0DC 2DFIA 2YSQA 2CJJA 1YITN 4BHPA 5FWBA 4RAGA 2RI2A 1WJBA 3NARA 4RLQA 4DV5K 5KYYA 5GAOl 2HMPA 3CCMN 3NWTA 2JSPA 4BE1A 5CKBA 1JQQA 2DE0X 5AQMA 1T2KA 3H1VX 4KDPA 4JQFA 5KYXB 4JKCA 2ZF5O 2EINH 4L9VA 4M75D 3JRFA 4MLOA 4M42A 4KBMB 3F21A 3BZCA 1C6VA 1K1ZA 3QZ9B 2RJEA 4FLTA 1B8IB 2K9QA 2LF8A 2K5IA 4KJZA 4YTLA 3IWFA 4XH1A 4CIGA 4JBAA 4GLKA 5M5XJ 2W1OA 1BIBA 5KGWA 3PNYA 4E7HA 3GZNB 4HVVA 2QK9A 2CP0A 1T7PA 3VQ9A 1T05A 1IV6A 5E8GA 4E7JA 4XONA 3ROUA 1QW1A 3IS9A 1K4US 4CIFA 2RREA 2QDLA 4KT6A 1XSDA 5DM7F 4KPYA 5GIOA 2ETHA 1OPLA 1I5LA 1OH8A 1C0WA 1TP4A 4FL9A 3H6EA 2FF6A 1NGJA 1R5HA 1POGA 4G8XA 4U67L 5AT1B 4I01A 1LW2A 2LQKA 1RAFB 4JJCA 5J2MA 3CC2N 1T8IA 3PUBA 1RT3A 3I55Q 1D1AA 2L3RA 4H0OA 3O1BA 3V42A 2YKNA 1IV0A 7AT1B 1RT7A 5EX5A 2FPDA 1C6VX 4MMKA 4HBLA 1VQPI 3TAGA 3C2GA 1S72Q 2LYCA 2F7TA 1R71A 5GJWB 1NJYA 3CM6A 2FEIA 4CZGA 3G25A 1RPWA 5BPLA 2BZXA 3TAPA 1K73R 2ABKA 1BCOA 1KGSA 1VQLA 2NNYA 2RF0A 3UT1A 3L09A 2FNAA 3HUGA 5IOZA 1FBUA 2ENMA 2FL7A 3ZQHA 2KBTA 2CSOA 5FO5A 2YS9A 3QMLA 4F2SA 1O3SA 2H3EB 1K9MC 3DLGA 4C23A 4DWIA 4ITVA 3K2PA 5AFUA 1NKCA 3NTIA 3ZQLA 2P84A 2EZIA 4OMZA 1LDDA 1Q7YO 1KTQA 2HDWA 4HLYA 2M0MA 2NNNA 1VHXA 4CZEA 1K8AU 1W36D 5D6XA 2HHTA 1D8KA 3AAFA 3DXKA 1XSVA 3EEQA 1GCPA 3H0DA 3VB2A 3QP5A 5CVIA 3MEVA 3V9ZA 4BRPA 1BN5A 4NBQA 4DR7K 1Q81U 4AIHA 3DWLA 4B9XA 5GP9A 1EJ9A 2K9MA 1OX9A 3OIPA 4PL7A 1U4BA 4M78C 1SSHA 3GZ6A 2HYJA 4BUPA 3VQ6A 5CPRB 3ALYA 2KT1A 3UIQA 3CD6A 1N27A 3CCVI 3QFUA 3DKXA 2IVMA 1TLHB 1YQKA 1KIKA 2CUZA 1W4MA 4OKJA 1A5WA 1VQ7I 1N6QA 2RH2A 4J2DA 2PVGB 2JMWA 2WC9A 3HM8A 3L0QA 4FWMA 1RI0A 4XQFA 3WTSC 2F4VK 4K25A 1OQKA 4C92A 2OUMA 3P5JA 4LDXA 5HCKA 4UNFA 3O4NA 3JYTA 2BVMA 2CUFA 4DEXA 3Q5FA 1Q82O 4M7DG 2W0ZA 3EE9A 1SG5A 1FSEA 3IMXA 2PLYA 2KZZA 4M6VA 2KKZA 1T3SA 3OWTA 4B3RK 2YU9J 3HPOA 5J3LA 4LD9K 2XKOC 4CC2A 4BWJA 2A5XA 1HC8A 3LL7A 3M8SA 2GWKA 5CAIA 2XAJA 2ID6A 3DLAA 1YW7A 4FM2A 3JCUC 5LJ5h 2FBVA 4NQWA 2A07F 5GAMe 5EG2A 3QBXA 4PGGA 1ENHA 2QBYA 4XORA 3F70A 3DLLA 1HYZA 2FUG2 3RIRA 2K3XA 5L3CA 2VXEA 2NRAC 2HHUA 5GAOq 5AQGA 3WVEB 3G6EI 4OF1A 3O9SA 3HVTA 3I53A 3TTDA 2HFHA 3PNTA 3Q0WA 2Y9YA 2LCLA 1MMDA 3MO8A 2QVOA 1XQPA 3TCJA 2EYQA 3KP5A 3FBIB 3G3ZA 3V9SA 2IAIA 3V8JA 4XTUA 3ZMDA 1SKWA 1Z91A 3MKYB 4J2BA 3H46O 5J1RA 3HP6A 4UUTA 2K86A 4CZZA 2QXLA 2E36A 4C8OA 3JSOA 4OIOF 2W48A 1UHMA 1YTYA 2K3YA 4GBQA 3G71Q 1SMYF 2RN7A 4NCGA 2E2HJ 1PSEA 4DBQA 2RHUA 4DBFA 4KBOA 5IHIA 3L2VA 4XLEA 1I50J 4J7IA 4UC4A 2R4GA 3JCMW 1JUPA 4N0AC 4EHTA 1SZ2A 4D9JA 4KIBA 1K8AR 3HOTA 3M8JA 3OIQA 1RTJA 4K2EA 1O3RA 4RTVA 1XNIA 3I9V2 2X1CA 3NMUA 2H1LA 4CJEA 2P5GA 1QGPA 4XKVA 5AJ3K 2JOYA 2J05A 1VQNN 1Q81R 2FVUA 2F2WA 3MKWB 2A1RA 1P9QC 4JZ4A 2GLOA 4IL6C 2P0WA 1N3CA 4F7UG 1KA8A 1YJ9T 1J59A 1UAXA 1VSEA 2B7EA 3MJXA 1Y0MA 4EJOA 5BPIA 2PJPA 1KFSA 4Y52J 1YI2A 3BJ6A 2F4MB 3CW7A 2DD5A 3LWFA 4IX7A 1D09B 1NWKA 2NUTB 3C7JA 4L18B 2GF7A 3DRRA 4EATA 1W7AA 3FMRA 3SBTA 1KYZA 3QETA 4PJOG 2CUBA 4DMNA 2YHTA 2H56A 4RS8A 1WN7A 1KONA 5EZGA 4EM1A 4M75A 2FNPA 5JVTA 3QYHB 3CCRA 3WNEA 4OMYA 2ED0A 3SYZA 4OIRF 1QHHD 3A8YA 3VYRB 1ACMB 4RW6A 4CGIA 2R7FA 4KN4X 5BR8K 4EQQA 4FETA 1HBXG 3CJ7A 3DXJF 4BJTA 2CQ7A 3K1PA 2Y69H 3FKIJ 3RYPA 4O3MA 4A2UA 1TUGB 1NGDA 2ZMEC 1YQMA 4HX4A 2PBDA 1Q7YC 1X19A 3FIWA 1OOTA 3K0SA 1MUNA 4Q0BA 2XPWA 3A5ZB 3TTFA 3EO3A 4IJAA 2RE2A 3DAWA 1KU7A 3X2QH 5GANd 3F6OA 2E5KA 5JLXA 3LL3A 1LWVA 2LKXA 4XBFA 1O57A 4HV5A 3N0UA 2VC0A 3BCBA 1VYVA 1N3AA 4W5NA 2YHYA 3SJMA 1REPC 2E4LA 3L2CA 4CF2A 2DA6A 3CCJQ 4MMLA 2MIOA 2IP2A 1S72T 2G8FA 2PJRB 2W84A 2JZYA 2A3SA 3CBPA 3QXEB 2PMUA 1M1FA 4N47A 1SVOA 2BVLA 5HDKA 4HCKA 4Z89A 4CCKA 1T44A 4OMLA 2NOZA 3MAJA 4M77D 3F8BA 2DMTA 1HNZK 1YF5L 3S6IA 1FP2A 2SEMA 1F1BB 3HHHA 1WSIA 1VQMI 1VQ4N 1Y56A 1VQLT 2DJZA 1QVGA 2KI7A 2AKLA 1Z05A 2LKPA 4ESRA 2E1YA 1Q82C 1GLJO 4B09A 4H03B 3SV4A 1BDGA 4EW4A 2P0QA 5M9OA 3JV3A 4WE1A 5EVZA 3GOIA 1NGGA 3CBOA 3EFOB 4LFUA 2KJCA 4X9DA 4MQ3A 3AG2H 1GCQC 1S1TA 4C0GA 3HSBA 4B3TK 4PHTX 4DOZA 1O9SA 1ABQA 3A0HC 4M74A 1XGNA 1NM7A 4LB5A 3OH9A 3EUKL 5LHIA 5J2PA 5CHZA 3T5XA 1M3QA 2B8AA 4DTJA 2R7XA 1ASVA 2E2OA 1TAUA 2V1NA 1W1FA 2XROA 5B66C 2OTJN 2DTOA 3BR2A 3VS1A 1UMQA 1UELB 3OYHA 1YT3A 4GRIA 2DA7A 2X74A 3RKQA 4HKEA 4G7OF 1W0TA 1IXCA 1FOWA 3TO7A 1R4NB 3IL2A 4S05A 4HX7A 2K4BA 3DPLC 2F9WA 3QJ6A 5CKFA 4IURA 4CCJA 3BCAA 2VG5A 2XDDA 1TXQA 1EO1A 1KD1U 2E71A 4MDWA 1VFCA 3I64A 4CJ5A 3O6BB 2IS2A 5LGUA 3KZBA 5LJWA 2E2IJ 4HCBA 2BHZA 1NLOC 4JZ3A 2HW3A 3F5TA 2MWPA 4C8QC 2YKMA 4B24A 3FMSA 4DLEA 3HJFA 1U04A 5ICGA 4II1A 3CCEQ 2NS0A 5KCOA 1NPPA 4IEJA 5HLIA 3I59B 2XIGA 4V19K 3CPWA 1IXSB 2WSCE 1P2FA 4BBRJ 1U1TA 3Q9VA 1CGPA 3EAEA 1XNQK 2QEXI 4JN4A 1RDBA 1ZYRF 2FXAA 2LSOA 3S3OA 1NGAA 4M7AE 4CEFA 2KYMA 3V1QA 2IS3A 1S29A 1VQ6Q 2K9LA 3U2RA 1J0RA 2E6ZA 1NK5A 5DD8A 3DV8A 1O1WA 3FXJA 3L1PA 4O8UA 2ZNZA 1JKQC 4L3QA 3DLEA 3PM1A 1BL0A 3VSKA 4UUVA 1WI7A 1SD7A 2EQJA 4AFSC 3H0GJ 3KFVA 3LA7A 2V1DA 1J5EK 3KNTA 3TP3A 3ZR8X 3DBRB 2DCEA 2X4YA 4Y4RA 4M6XA 2K5LA 3THWB 1ATRA 2G3RA 3G4SA 1B3QA 4C0ZA 3C6TA 4J83A 4O44A 3GTLJ 3RZDJ 1IC8A 2VJ4A 2ZPHB 2COWA 4E9HA 1N9SA 1CXUA 1HPZA 3VENA 2O88A 3VEVA 1E0EA 1YIJN 2K5FA 1BG3A 5F0CA 2F5FA 2RA2A 2FSNA 1Y6IA 2O31A 1R4MB 1ON1A 2IJLA 3VA3A 2HBPA 5CVRA 3I0WA 3TU4K 3KTQA 5BPMA 3FSPA 2RQVA 2HCKA 4UY8I 2VKNA 3QEWA 3S32A 2VQGA 4FT2A 3MEGA 1Y7XA 2HQRA 2RNGA 1QCOA 4H0TB 4IEEA 2BE7D 1XWLA 3CC7I 2PTKA 3RBBB 2IGIA 2GQIA 2ZJRL 1LOJA 3G1LA 4FXDA 4I2OA 4JDSA 2P6SA 4VUBA 4A3CJ 3HRSA 4XQ3A 2IA1A 2PZSA 3LAMA 2NS8A 3ZLJA 2COZA 3DF8A 3FHZA 1WIEA 5ILSA 2EGAA 5CHIA 3KZIC 3K10A 3RTRA 3ZMVA 1VRLA 3GFIA 3FFKB 1NOZA 4XLPF 2OPPA 3E9OA 5E17F 4AVPA 5GAGJ 3K58A 4OPJA 1OPKA 2O4XB 3S8PA 1WEIA 3T1HK 1QP2A 2OTLT 1FNNA 2FZGB 1WDXA 1JLAA 1F1ZA 3E6DA 3HL8A 5A0GA 4DQRA 1XTDA 1YI2T 1KD1R 2COMA 4HSBA 2K79A 1S1WA 1PKSA 4J9DA 1LE8A 2KHOA 1R59O 2O7OA 3LWIA 3QKJA 4LC9B 2ZGZA 4FQGA 4FJKA 2VUMJ 1RILA 4LF4K 5CYQA 1FX7A 4W5QA 1HW5A 2O9LA 4B1ZA 3B6OA 1KU2A 4DIQA 1AKHA 3G1MA 4D7NA 4ZDOA 3ASMA 3CCRT 2JHJA 1SSFA 4A3MJ 4AYBA 2E3IA 4G7ZF 4DUZK 2CZ7B 4ZDLA 4CGGA 2A6HF 1QA6A 5AQZA 1MJAA 3EQLF 3VYTB 5LBQA 2RMOA 1VQ8A 3MWTA 4Q5VA 1T56A 4ASNA 3OS5A 1YXQA 2KKOA 1DT9A 1TC3C 1TGOA 2DA4A 4F17A 1X2NA 2OBPA 2Y75A 1NMDA 1NNEA 4DFMA 3G7ZA 3OYEA 5C2DA 1NTCA 3NF9A 1QVGM 4XKWA 1GVDA 4GKKK 4IHYA 1G3TA 1VSLA 1RDCA 3FJPA 2UZKA 2WB1N 1JXBA 3M0PA 1T03A 4JRQA 3D45A 5F08A 1X9JA 5AQOA 1QCNA 1QPMA 3CYMA 2CGKA 4FLXA 3ZRGA 5FD5A 3O8MA 5AZIB 2LY2A 2DFEA 1ON2A 3AA5X 3RNJA 1LQ1A 1MH3A 2PVOB 1XHXA 2X1EA 2FSKA 3GBGA 5CQEA 1LW0A 5GAHJ 3S2DJ 4IFVA 3IWZA 4XOPA 3QPTA 1J9IA 4FHTA 2PYJA 1X3WB 5K7FA 2NRRA 2O4IA 4CCHA 1XQOA 1WAJA 4EHUA 3ULDA 4M77A 1GV5A 2F9TA 2KFNA 4XL9A 1W2BS 4JKBA 5T7BA 3FC3A 1TWGJ 3TSZA 1RCHA 4FT4A 2L89A 5K7ZA 1WSGA 5LJ5e 1QE1A 4N9IA 4XLHA 3SFIA 2NRHA 1OH7A 1U5SA 2RB6A 2DFFA 1QMCA 2IA2A 4U0WA 3M4YA 2EJRA 4NDLA 4EM0B 3ECOA 5E3MA 2FRYA 3ZETA 2HHHK 4IQ4A 1WJCA 3JSCA 4CESA 3BQYA 4IHXA 1L3VA 2IS1A 1W5TA 5FFXA 4YPHA 3NH0A 4DQIA 4M78G 1AVZC 3GTQJ 4CJPA 2OPTA 4CJ3A 3K1NA 2KW4A 1YHQQ 2CREA 5GMKl 1ATSA 4HNTA 4Z02A 3RRHA 1IF1A 2Z1IA 1Z21A 1BIZA 2K2MA 3DLBA 2KDOA 1X2MA 1JT0A 2YHXA 3K70C 3HZJA 1XMXA 1LFPA 3WEEA 2XF5A 1P4AA 1EIFA 3ENOA 3QB0A 1MH4A 3U3YA 4BI3A 3IRQA 2WV1A 2XIDA 2G0EA 4QQGA 4YFKF 4JX6A 4M3RA 3CQZJ 2VL8A 4XN3A 2Z1HA 3VETA 1VK0A 1VQKA 2NOFA 3A8LB 1CZBA 4H5NA 1AA7A 4DR4K 3K9TA 2KSSA 2D6FA 3SPYA 1XOVA 3JB9F 1RTDA 1R8OB 3R6OA 1K9MU 4XTZA 4JKAA 3EGDB 4BRNA 4CZHA 2HS5A 2QQ9A 4YOQA 2HZTA 3TVTA 1LWWA 3TW7A 2F2XA 3QFPA 4K0KK 3ZETB 2QTDA 3PQJA 1VQ5Q 4AVZA 3JXUA 3VGLA 4KTWA 3EUHA 3HBLA 2VQEK 5HKCA 1G3SA 3HRTA 1WZ2A 3U4LA 2JMAA 3LH5A 5GMKj 1YG2A 5GAN8 3UKUB 4AHTA 4G94A 3G1JA 2DOAA 2R7TA 2MCNA 1PYVA 2GBZA 2F2VA 3P7NA 4P9UA 2P5OA 3UPUA 1VIEA 2CFXA 3QESA 4KUMA 3IHUA 4A0ZA 2Z9OA 1YJNA 1FMWA 1TKZA 5ED4A 2QI2A 4A5AA 1SFKA 4ZTFA 1NMNA 1SKUB 3HFOA 4D8DA 1QVFS 3I55N 3NCIA 4PZJA 2P9PA 5ICFA 4CZJA 1T98A 2DN0A 1Z25A 4U88A 4BY6B 1XSXA 3NGIA 1ASUA 1ZTRA 3NAUA 1I1GA 5E84A 2QM3A 3UATA 1WSUA 2X4XA 4JI5K 4E6KG 1TK0A 3UKRB 2DL3A 1I6HJ 1BI3A 2F8TA 4NCAA 3RQ4A 3NGZA 1TOVA 2GTDA 2K4YA 4XEIA 4E3SA 4IJNA 2W04A 4HSTA 4MZMA 1WBBA 4P5NA 3ASNH 5IT3A 2QF7A 1XC9A 1PU7A 5CVUA 4A4HA 4IRHA 3I0XA 2FOKA 1Y8QB 1U3EM 1JE8A 1WA7A 2M0CA 5LJ5f 2X9HA 3CC4A 4QIWN 2VC8A 2D45A 3H5AA 2DQRA 4ISEA 1WSEA 1XGSA 4KHWA 5TJJA 3EL2A 2L9VA 2R7YA 4LG0B 3VEXA 2F69A 2L4MA 4CGJA 3FIFA 2DTIA 3TQ7P 4EM2A 4IEIA 5KTQA 4RGUA 1LV5A 2QDYB 4KB1A 3OMCA 3P39A 2LJ0A 2UXBK 5JLFA 1K79A 3HKZA 4P5OA 2PAVA 2HAXA 4JOMA 4Q48A 3OJUA 4IDHA 3R8EA 4HVWA 2IIMA 4C92F 4B44A 1DPRA 1M90U 5J40A 1YQRA 1C1CA 4DF8A 3NVKA 5EYRA 3HT3A 3K6GA 4TVRA 3QNNA 3FZFA 2OAZA 3C65A 1H0MA 1WI3A 5ECAA 2L02A 3BP8A 3NEUA 3I5UA 2MFZA 3PO3J 2MC4A 3CCLQ 5BQTA 5TKWA 2VOOA 3V4IA 5DS9A 3I58A 3TQNA 3I4PA 4CBUA 3DTEA 2JHNA 5EU7A 4C92C 5D8KB 3L1AA 1IGUA 3VS4A 1QRYA 2KDZA 3EYYA 2F5CA 2KY9A 1M1KC 1B07A 2YRVA 4JV5K 4L5IA 1K9MR 3MQ0A 1JBMA 3LAJA 5FB2A 1UFMA 4DR3K 4EW0A 2DIQA 1XNRK 4BQOA 2BY0A 2LQNA 4KAZA 3K4KA 4HXJA 5BPDA 4CXFA 1GVJA 3CESA 3CCQQ 5CK9A 3FFIA 1WJFA 1BR2A 4RB1A 2P9NB 4UV8A 2L8DA 2CUJA 1XC3A 3CWSA 3NFAA 3T7ZA 1KSWA 4JD2A 2I5JA 3OA9A 4DZPA 1VQ8T 5JVHL 2ED1A 1KQSS 5FLVA 4N9HA 2M4KA 2YHBA 2JN0A 3NPFA 3CD6Q 1YS6A 2DAOA 2K4JA 1ARKA 4DEYA 2ZXIA 2B9SA 1BW6A 5AFUH 5DTDA 5FRNA 4E89A 3HTSB 3OYYA 4X66K 3CETA 4E7IA 5C25A 4KNYA 4PKIA 2Q2EB 4G6TB 2YNHA 2M8GX 3R6SA 4B1WB 4BEHB 5KI6A 4XU0A 3SZPA 1AU7A 3M1CA 2OJED 4QVCA 2OPQA 5JHFA 3VEWA 4FM0A 4DU3A 1FOYA 2VWBA 1X27A 2X6OA 3L42A 3CMAA 1SVLA 3G71N 1WZOA 3VQ7A 4RA2A 1EZZB 4A5BA 2KAFA 3JAMO 1GXIE 3QERA 1NG2A 4EP4A 3C12A 3AL0B 4FWKA 2M34A 2WY8Q 3CVTA 2ZWHA 1S7OA 2OYQA 4HWIA 3AFHA 5I22A 2HHVA 2L3QA 4B9VA 4JI8K 3AG1H 2HL3A 1QS4A 3HP9A 2HKNA 4U0VA 2CP2A 1WFWA 1ATNA 4AHRA 4IFYA 1UGRB 2V26A 1VUBA 4KRTA 5J8CA 3QU6A 5HBMA 1SANA 1UCRA 2ELKA 1LFUP 2I5UA 1K78A 2V1XA 2WA0A 2Y1JA 3AVIA 1V5GA 2VJ5A 1T0FA 4BJ6C 1P7IA 4BREA 5AZJB 4J9CA 2VG7A 1BGXT 4FPAA 1STZA 4E9EA 1J2XA 4LIUA 1D9FA 4EIAA 4RW7A 4AC0A 1M90R 3VYHB 2E1NA 4BVPA 1JKPC 3C6HA 5ILUA 5GAMj 1TL8A 4ZDPA 1FOKA 2FF4A 3E2UA 3Q3SA 3LLRA 4E7LA 2QWQA 4ENMA 4GV6A 3J80K 4BRFA 3SCXA 2ZNYA 1EKEA 3T19A 4C8QG 3EH2A 1LKXA 2K3BA 3GNGA 2DFHA 3H45C 5JS1A 3T1AA 4DK9A 3HTUA 1P90A 3VPZA 2ZJPF 2I0NA 4FVMA 2DT5A 5HL7L 1WJAA 1ZAOA 4V2SA 2CW0F 3GFLA 1K73O 1IN6A 2W25A 3VOEA 1XI1A 1VQKT 4E1MA 4OWRB 3J7ZO 1RRQA 3BQZA 3CCVA 4M75C 4H5VA 3GBQA 3MCPA 3ABUA 4DS5A 1TW2A 5KGXA 2I8DA 2RK1A 4HSRA 4H5WA 5L3FA 1HW1A 3WUHA 1TBXA 2AQFA 1Z3XA 2VIXA 3ZGKA 1YJ9I 5J2QA 4G12A 3DLKA 1V4RA 4KIGA 1VA7A 1E3HA 2LT4A 2VJJA 2Y2ZA 3S2WA 1KQ8A 3G10A 1DKGD 3SQ4A 2V52B 2JUFA 3VF2A 2WSFE 4L6V5 4FJNA 1I5ZA 3TOAA 4M3WA 2V9KA 5AQPA 5AONA 1ZLKA 3CHWA 1X3ZB 4BB7A 2B5JA 5AQIA 4IVNA 3O4WA 2FG0A 4B9UA 1BCMA 3ZMTA 1YJNT 2UXXA 2UXDK 1ZG1A 4CHNA 4U87A 4E7KA 1IKWA 2OC6A 1F4KA 2BOLA 4I09A 3MPUB 3CCJN 1NZ9A 1H88C 3CCUA 3LNQA 3FISA 2ZJQF 3F10A 3ZP5A 5LD2C 3CFOA 3MX5A 2A0FB 2CGHA 4OLBA 3OTOK 1FIPA 5EXWA 5D7UA 3P8HA 4LLGF 3JRAA 2OQGA 3JAMK 3WTZA 5AYFA 3VQDA 2E2QA 2P81A 2GOMA 2VKEA 2I2LA 4ATOA 3S1MJ 3NQOA 3PQKA 4YOTA 3N5BB 4LJZF 3FHFA 4XOTA 4Q47A 5CJ9A 6PAXA 2EH3A 2O8DB 4MZTA 3E0JB 3CDHA 5M1KA 5K7HA 3OSGA 1OULA 3JCMf 2A6EF 2Y9ZA 1VRTA 4C3JJ 1W2BP 3DXMA 2NOJB 3MEWA 5FKNA 3LAPA 1I39A 3TSPA 2G7HA 4OINF 3F23A 1UGQB 4FLZA 3FBNB 2OZUA 2ZGYA 3PSIA 5BRDA 1MD0A 1PVEA 4ISGA 4FX4A 1TYQA 1UHWA 2JWTA 3AAPA 3S1NJ 2X9DA 4KISA 2NLUA 2ZZDA 2ZGWA 4B9MA 3MN6A 1RDDA 2E60A 4OKEA 1BQNA 5I9EB 4E19A 3LGLA 1MBKA 3RKXA 1NGEA 4H4KC 1IJWC 1TWCJ 3WQUA 1TL1A 2KL4A 1WHHA 3U21A 4DW6A 3VWBA 2JA7J 2EGCA 1MHNA 2CP7A 4LLNA 1G83A 3FWEA 2G7UA 3T1BA 3O4QA 4BACA 5D5UB 2LCCA 3RERA 2HD0A 1VQLI 1BM9A 3BG7A 3O80A 4B3XA 1BIUA 3KX2A 4DOWA 3TDUC 2KT0A 2F2EA 1AD5A 2K85A 1KU3A 2MLKA 3CO6C 3CCSA 2ITGA 1OX8A 5CYMA 3BTCA 3QPHA 1TUCA 3ULEA 1FW6A 3BR1A 4FYYB 1TU0B 3RSNA 1FKPA 3BF1A 2PNIA 3META 4IBNA 1X3UA 3CCEN 3SQNA 3SXYA 1ZK8A 4HCZA 4BH9A 1V4TA 4Z2YA 3AG4H 2CO5A 4OX9K 3QO3A 3CCQT 1MUYA 2DOEA 1YOVB 4DR2K 1ZA2B 4JX5A 1K8AO 3SMPA 5FKOA 2ID3A 2JA6J 2DODA 4A69C 4AIDA 2ATQA 4MDXA 2LC2A 3ATUA 2QWLA 2HTSA 1MV3A 3U9DA 2YT6A 1Z6RA 4DTSA 3OA6A 4IQJA 4YORA 2KPMA 1A35A 1ZRCA 4M73A 1Q81O 1B9DA 1BI2A 3HI0A 4QVDA 4EJUA 1REVA 1DGKN 3D2FA 4IHVA 1OKJA 3K4CA 2PMZN 2QSGX 2X6YA 3GX4X 1BW5A 4LDUA 1J09A 2RPIA 3ZQ7A 1QVFP 1U47A 2W00A 1O7LA 2K5CA 2YLBA 3H92A 2CZ6B 1ULYA 3MDQA 3VTIA 3THYA 4FWRA 1EFNA 1NLVA 3JCMd 1YITQ 3CQYA 5MLCQ 1G99A 1V76A 2EWNA 2AZSA 4UB8C 2Z16A 4ABZA 3KEOA 3EG9B 3FGUA 1TSFA 3CCMQ 3DBLB 2DERA 4NYFA 1JLCA 1WH5A 3C2BA 3ZSXA 2O9VA 3CMAT 2JRTA 2F5EA 3ERED 1A31A 3P31A 3ID8A 1DU0A 3HZ6A 4IXCA 4I9LA 4B3SK 4FIBA 5AQYA 2QA4Q 1K73C 4DSEA 3U9ZA 5IYDJ 1D5AA 4KICA 2RNAA 1YAGA 3J7AP 1I94K 4WXCA 1BUPA 5DEQA 2VE9A 4XTWA 4A3BJ 4CZIA 4FSSA 2O8EA 2EK5A 4E7ZA 2B4JA 2FA5A 5GAEJ 2DJQA 2ACJA 5CE3A 2CP5A 2W6LA 4NUBA 4GO1A 3WGHA 2Q0OA 4CJSA 1RT1A 2MMPA 1VQMA 3MAQA 4J6WA 3JRHA 1Q8IA 2EZHA 3IKTA 4CRIA 1NJIU 3GMEA 4CHUA 1Z0XA 3RCOA 3CC2A 4O55A 3GPLA 5I11A 1WSJA 4I0BA 3E19A 3CMEQ 1ZBHA 1SL2A 3VEZA 1D3BB 2YWWA 5I3UA 1ZELA 3G4SQ 1GDTA 2P9IA 2IAJA 4KH0B 2DVJA 1Y57A 3LANA 1ZBLA 2GTJA 2AZVA 2X0LA 1NE8A 1SF9A 3LDLA 3VS0A 3FMQA 3BJAA 4ZZDA 5IT9O 1XD7A 2BW3B 2J5OA 1RT6A 5GPAA 3IAM2 2LX7A 4BR0A 2EIKH 3GF2A 3J81E 2B0LA 1W5CC 1FLIA 1VQOT 3DU6A 1S1XA 1A6IA 1WAFA 3I56A 3W3CA 4B9SA 4FJ9A 4GYGA 2ME6A 1KLMA 1UJYA 3HSEA 4RTXA 1I27A 1MUDA 2XHKA 3F73A 3C7NB 3M3YJ 1RBRA 4UVAA 5CKDA 4MTEA 1Y96A 2HQXA 3O2PE 2OTLI 1EWQA 5M3FJ 2R7RA 4NC7A 5HS8A 3G0QA 2BUDA 1YI2I 1RBSA 2EFWA 2ROTA 5IP6A 2NOHA 3EPZA 2R7UA 1V54H 2RQTA 4PY5A 3P9IA 4M3BA 1BBYA 4GNIA 4OPKA 1L3TA 4FK4A 3ERMA 1XJWB 4K8XA 2EKHA 4CHPA 1IDZA 2WONA 3MP8A 2QW9A 3RRGA 2XHIA 5AQTA 3NF7A 3CCRI 2E12A 3CCUT 5CQYA 3P9KA 1P8ZA 3PV8A 3RMCA 4PFZA 3EG3A 4ILJA 3LSPA 3VW4A 3K4MA 4L0YB 4DTRA 2IGKA 4XU3A 2AP1A 4PKGA 3RMDA 3IH3A 3ENHA 3D7EO 2HNZA 3C18A 4F14A 2XPVA 1RETA 3AO4A 3S3NA 4M77C 1R00A 2KLOA 1JXEA 2M45A 2GELA 2KEAA 3CXCS 2R0QC 5DK5A 2MSYA 1OMIA 4F93B 2ZJPL 4KH1B 2AA4A 2A6AA 3WXKA 3B6PA 1RT5A 4MO4A 2Q8KA 4CH7A 1B34A 3HPGA 5A0LA 4HDUA 5HDNA 2DMOA 2J6FA 4BRKA 3CJAA 2NS7A 1FIAA 3FX3A 2VKHA 3LP0A 1R9TJ 1YHQN 1K8AC 3DKWA 2XAHA 4IKFA 4N5SA 1BOBA 4B23A 5BREA 1NJIR 1BIAA 1W7PB 2H94A 5HRRA 3MN9A 4RB0A 1HX1A 4MZPA 5LHGA 4XTVA 1H9TA 5HS9A 3CIPA 1UGSB 3VS2A 1N33K 3HL2A 1SL0A 2WY7Q 5AN4A 2DZCA 2ZBKA 2FBYA 3ZL7C 3QEPA 5E41A 4PNOA 1BJZA 1D1BA 2D8JA 3KCCA 1ORNA 3HRGA 3VYSB 5IHNA 3CJ9A 5M1NA 4B08A 4J9IA 3VQAA 1IG8A 5EEGA 3COAC 5E1XA 1Q18A 4PGHA 1FYNA 2UXCK 4M7AA 1K0SA 2V9PA 1KQSM 2ZJQL 2KIMA 1J75A 3CCST 3NAEA 4V2GA 5BR9A 4ZGJB 4IZZA 4LK1F 2EKOA 1KVBA 3AKZA 1BJAA 2CU7A 1VQ5N 2XGEA 3KIOA 3QNOA 3AGRA 3RUXA 3LDNA 2JXBA 3PIOF 3L3VA 4CJTA 1JGSA 2GA1A 2HVQA 3EUHC 1ORPA 2O8BA 3HOSA 4KULA 2XG8D 1RUNA 2MI6A 1VQ9A 1YX3A 3VN5A 2HQHA 1JHFA 5KQDA 4NO7A 1S5JA 5LJ5j 1RBVA 1MMAA 2BE5F 5IP9J 1TWBA 4J8FA 2CS7A 3K4JA 1X9WA 4I6ZA 1O4XA 4MFEA 3SJJA 1E2XA 1G2HA 4EJYA 4LLLA 1N8RU 3WHBA 4KHNA 2OPSA 4UUSB 1RI9A 2K9NA 2FMLA 1FOXA 5BMZA 3MMVA 3SWNA 4HNVA 5GAN7 5M1OA 1WEFA 1OU9A 2KROA 4PL6A 1U45A 4B9NA 1HD3A 1AOYA 3M1FA 1M8VA 1G5VA 4DUYK 4AI5A 1IO2A 3IC7A 3GOXA 2BUPA 3TEDA 1FY7A 2QWMA 2ZD1A 2L0KA 4RMOA 2XI9A 2W03A 3ZX0A 2Y0MA 2HEQA 4M7DF 5AQKA 5KQ8A 3N4MA 1JKOC 1Y1VJ 2DXUA 3EGXB 1QBJA 2FF3B 2QQAA 1MMSA 4XLNF 2HPMA 1N39A 3KUFA 4CC4B 5I42A 1YJWA 3BJOA 2LBFB 5LJ3h 3I4MJ 2E5NA 5C4XJ 4UOBA 1RBTA 5D4SA 5FLXE 2JUCA 1MW7A 1MSEC 1JKRC 1WUAA 1RACB 3WG9A 1TV6A 5CVVA 4R0KA 3SJHA 2XGXA 3ABLH 3BR0A 4J9HA 4RB2C 1U5TB 4CJ4A 2HXIA 4RW9A 3BDPA 2P0KA 3I0SA 5J4YA 3GWZA 3RQIA 5B3SH 2M1BA 3MEEA 3LH0A 1BI4B 1NGFA 4AHSA 2ZMEA 1R77A 1VIFA 1YVUA 3VQ8A 2R7WA 3EUAA 2IIRA 4Z4GA 3LDQA 3RI4A 4CJ7A 3AVBA 4L9TA 1JLFA 1K8KB 1Y0NA 4RTYA 2LTPA 4Z6YA 3CC2T 4CYCB 3CUQB 4P9FA 3H3ZA 2HSEB 1LNWA 5GIPA 2RF2A 3FM3A 3D6RA 3OS2A 4EZ9A 1CZ9A 3IKVA 4JP0A 5JVGF 2GWJA 2ZAEA 1PD0A 3CCLN 4BC4A 4CGFA 5BNGA 1HJDA 1I0CA 3HSFA 5IH2A 3MEDA 2EHGA 2RO0A 1UG2A 4BRCA 4IUVA 4WCEL 4M75G 3IH4A 3FM5A 3H1QA 3SUOA 4PSWA 4CZFA 3CC4Q 4LFBK 5M3MJ 3R3LA 2J6OA 1VQ4A 1W9HA 3WU2C 2X3WD 4XK8E 3LFUA 3O3HA 3LPTA 1TT5B 2RN8A 4A3JJ 4KRFA 4J01A 1ZKGA 2L54A 3O8GA 4KYWA 1HKTA 2Y48A 4HX8A 1QVTA 2DA2A 1QZYA 4Y7NJ 1CQTA 2J4RA 4AG1C 1YLFA 4C8MA 1OCPA 2QQSA 4IHSA 3RJPA 5GANg 1B92A 1M2VB 4S0HB 3WGGA 1USTA 1YW9A 1B6AA 3CD6N 4EV0A 4P1WA 2Y30A 3K2ZA 3SQ1A 4M77E 4OKKA 2QTXA 4BRAA 2Z1DA 2EWSA 4ID1A 1X3MA 2VXZA 4GMJB 2AIRB 2HBKA 2LCSA 5FU7C 1N8RR 2CT3A 2NNWA 5F27A 3MN2A 3BG9A 5CR2A 2PFBA 3VTHA 1G2BA 4FM1A 2OTJQ 4RTTA 5A0DA 3FXKA 5M5WJ 4IIMA 3MKZA 2F5DA 3OSFA 4KI4A 2F8SA 4M7DB 4XU1A 3M8RA 3TEEA 2DOFA 2L4AA 2YUQA 6AT1B 4PJOF 1M1KR 2NYXA 1XDUA 4C5HA 2B6AA 4UHTA 1H3ZA 3QWXX 3L7WA 2LK2A 3WVDB 2M5WA 1AHJB 3EETA 2CH5A 2VBXA 1FK9A 3HM5A 1JCGA 2D0BA 2LP0A 3A01B 1VQ8I 2OJ2A 4WXDA 2X3XD 1PD1A 5L8RE 2L9SA 4IHTA 2WSEE 3NGPA 4FJ7A 3BROA 2GA2A 4KV8A 5LGTA 4WFAL 3KLFA 3VF6A 1E6GA 2CGLA 1QSSA 3RDIA 1HUXA 2NXNB 4DV0K 1B72A 2ITMA 5JFRA 3M9QA 5KYWB 3VMFB 1C0GA 3INZA 2KFDA 3VQBA 3RYRA 5C6SA 2J5PA 4J7FA 1XG1A 5J1YA 1ZG3A 1M3BA 3DJCA 5GAN4 5J26A 1U6ZA 2JVVA 3CJ1A 4WQ5A 4C30A 4IUQA 4JLIA 1WHLA 5EGOB 1RAGB 3SB2A 1T0FC 5I21A 1VI0A 3LSMA 5DUKA 3LWLA 2FO0A 3U6FA 2FHDA 5GAGP 2RHIA 4M7YA 1N25A 1MNDA 1YWPA 2FZCB 3WXJA 2XICA 5IXBA 5E8IA 4BXXJ 1GL5A 2YG8A 4J19A 2UU9K 4B1RA 2EJ9A 1EA3A 1TQPA 4HUGA 1IGQA 1X69A 2EFNA 1G8XA 1RESA 1IJJA 3ZEHA 3EKUA 4JS4A 3A5OC 2BE9B 1YIJA 3TAMA 4Y13A 2Z3YA 2LH9A 4NLBA 1MIJA 2EB7A 3BDDA 3UWNA 4PL8A 1VQPQ 3L00A 1KD1C 2L3PA 1DPUA 3DMJA 2ZPEB 2D5RA 2D9TA 2YV0X 4AH9A 2IEKA 3GIBA 4J6XA 1M2OA 4JI2K 4PLLA 4KHUA 2NRWA 4C8LA 1HR0K 5EDNA 5GAOm 3EKSA 4Z94A 4H0XB 1JU5C 1PKTA 4DTPA 3F8MA 2VC1A 2WBNA 1RRSA 3NTKA 5FDLA 3V4GA 2EA2A 2PBIA 2P5LC 2KXDA 2HVHA 1AZEA 2QWPA 4F7UB 2KQ2A 1JGGA 3LSGA 3JCMQ 3SPZA 2ME0A 3S9HA 3GXOA 2W24A 2A5WA 2HSPA 4W1UA 2IW5A 1SD6A 4OGCA 5AQSA 5AQLA 4RAZA 1A0NB 1VQNT 1WB9A 4M3ZA 4UXNA 1JJ8C 3P38A 1LDKB 3TAEA 1S3XA 3ENBA 2H8WA 5F0HA 1VQKI 1BU6O 3BF3A 3HPWA 4PWDA 1BI1A 5K1YA 1EH7A 1XMAA 1SL1A 1X6GA 1CXQA 3BEXA 3WQTA 4JKGB 2UWMA 2BIVA 4EMGA 2A1SA 4DV7K 2ZE2A 2OX7A 3IH2A 3SQ2A 2DKGA 2NOIA 2PX9A 3PIPA 3J7AF 3Q7BA 2CUEA 4CZLA 2EPDA 3CMMA 2PI0A 4Y92A 1ITYA 5GAHP 4CYDA 3CCVQ 4J5YA 2AXLA 2K2VA 1MV0B 3ASOH 4DSJA 3A0BC 4JKDA 1VQ7Q 2JM9A 2P9SB 1IAWA 4JKFA 1K9MO 2GQVA 1N9RA 2AK5A 2PN6A 3K69A 3TO9A 3I5SA 1Z6TA 4NL3A 2A5YB 5J8FA 4HDVA 2RVCA 1RNHA 1MDMB 5C0MA 1YJNI 1YJWT 3A5MC 3E5XA 3VSLA 3PX0A 3CVSA 2HR3A 3CXCP 3IUCA 3KP2A 2QWNA 3LALA 3B73A 2JRMA 4ZYHA 1ZYQA 1M3HA 5C10A 1T33A 4IO9F 2Q1NA 3QIPA 4IRIA 3PIOL 5IYCJ 3F8CA 3L2UA 3G2BA 2PMHA 1MMNA 1S1NA 4RCCA 4F91B 4I76A 3AVGA 4Z4EA 4WX9A 2DYRH 3UR3C 2QTVA 5DCFA 2RHXA 3JREA 3J81Z 4F92B 5EEHA 3QLHA 3F8FA 2FJ1A 2DETA 4CHQA 2L7KA 3G6EQ 2YG9A 2BXZA 4WF9L 3S17J 1WQWA 1J53A 1WLJA 1PHTA 1ZSZB 4QVZA 1PSFA 2NAZA 4EJZA 2P8TA 1SPKA 2DJNA 2H8HA 4KFBA 4RKUE 1KZHA 1X6OA 3PE0A 1U8BA 3M9AA 3OYBA 5AQXA 1VQ4T 3M56A 4BUGA 1O13A 3DB4A 2P1JA 4EZ6A 3DCFA 1KVAA 2JJ7A 2DZ9A 5KYXA 1R22A 1WHJA 1B4AA 5F0FA 2DD4A 3OW2A 3WTXC 1TKDA 3JTHA 2JN6A 2ZXHA 3F72A 2GBQA 3GYHX 4X9CA 1QQCA 1QHGA 3SD4A 1BC8C 5CR4A 3CBMA 3KYCB 2M0YA 2XK0A 3A5NC 1B8IA 4UY8O 1IHVA 1CKAA 3SQ0A 2NOEA 3P83D 1ZGWA 2EV5A 2DXIA 2DBMA 2LNVA 4IFEA 1M90O 2O3FA 2DF6A 1YJ9A 3CDIA 2OTJT 2NVTJ 5B1BH 4C0FA 2ESNA 3GZ5A 3I35A 1SKRA 1GT0C 5F6FA 3JCMJ 3M0RA 4Z4HA 1YN8A 3WTTC 1UB4A 3U23A 1WWXA 2H3GX 2HPIA 4BC5A 3H9GA 3R61A 4OVAA 2EV6A 2W41A 3CUOA 2JNGA 3CCQI 5M1PA 1AWOA 1IN8A 4LN2A 4R8HA 4QPOA 4M77G 4ZH4F 2VPRA 3M4OJ 5KK1A 4DSIA 3W6VA 2W82A 3O5ZA 3DLHA 3H41A 4JI4K 3LCNA 2XASA 1I3QJ 5D6FA 5JVGL 1QCFA 1QKWA 3PX4A 1YTUA 4MLEA 1MPGA 2RPNA 3M57A 4CD3A 1HYVA 4YIRX 2QA4N 3C4SA 4EJWA 1D8JA 2C6YA 1WOQA 5AQJA 1IRFA 4DV1K 1GXQA 1O3QA 4FX0A 4M9ZA 1UJ8A 1VSDA 2AXTC 3AGKA 3RSEB 1X4PA 4EA4A 2KRNA 4XTYA 1FZPB 1SMTA 3NF6A 1LAWA 3PJRA 3IKMA 1QNTA 3JAMZ 2DXTA 2H1KA 4M9XA 3A03A 5E79C 1RL2A 3ZFJA 2RI5A 5AQUA 4JKHA 4OB0B 5K14A 3FF5A 4LF5K 1HW2A 3CJCA 2M51A 4B47A 3KWIA 4QOZB 1E3PA 1NGIA 1D5VA 3W0LA 4BXUA 2G8UA 2LY1A 1SAZA 2DTZA 3CMEN 3ZPLA 4CERA 1PNJA 4EAHD 4R1HA 3G4SN 1UOCA 3CMAI 2BZ8A 3ZQIA 3M5RA 2VONA 1S72A 3L2WA 3F8NA 2DAQA 2HBJA 5C24A 2JQ7A 2E8AA 1NK0A 4YOUA 2EZLA 2P9LB 4XM3A 4M7XA 5CYVA 1N34K 1BISA 5LJ3e 2IVNA 4LFCK 2C06A 2EYWA 3LSHA 2M02A 4BRDA 1YIJT 1OPCA 3AA3A 2KRSA 2VODA 4FASD 1SRLA 3DBHB 1QVGS 4ESFA 3AVFA 4LD0A 3TABA 4O4GA 2HZYA 3H08A 4ETSA 3KJVA 4DYRA 3RMQA 3JSMA 3J7YP 3JRCA 5BRFA 4FYVB 3RESA 2JLEA 2HYFA 2DL4A 1HQUA 3FEOA 1SFEA 1Y0UA 2BE2A 4MO7A 2GIZA 3O1WA 1VQMQ 1JXOA 3VS5A 4C0DB 4OIPF 4AG2C 1VNDA 4M78F 1JLQA 4DSLA 1OCZH 3FK6A 2HVIA 3PO4A 3VEPA 4JS5A 1MBHA 3HIFA 1C1AA 2BTFA 2F96A 3OYIA 2HZDA 3E5UA 3DTIA 4V2FA 2YU3A 4X62K 1ZARA 5TKYA 4RBOA 4GVMA 5GADJ 4YFUA 2UUCK 2JTMA 1IN7A 1KXPA 2R3SA 3I71A 3RR7A 1YCYA 1MSFC 4CFDA 3W3DA 4A93J 5IWAK 4QTRA 1VQOI 2IXSA 1HF0A 1NJXA 1KU9A 2BEOA 3QOPA 4DR6K 1ACIA 1RNLA 1Q1VA 3HB9A 2RQRA 2EQMA 3E5QA 3LQQA 1J3TA 2ZO4A 5FW9A 4EIKA 1RT4A 3ITHA 1KHIA 2RQQA 3RKWA 3ZX3A 3EY1A 2P9KB 4YOYA 2V7YA 1LB2A 1FPQA 3ESWB 1SHFA 1R36A 1XN7A 3HGYA 3OSVA 5KYNA 4CO8A 1YE9A 3VYUB 3J80E 3C0BA 1GLLO 4BXFA 4A2AA 4IOAF 5J6XA 1NGNA 1UECA 4XAXB 2DK8A 1TTHB 1X01A 1UG0A 1IZ6A 3VGMA 3O6WA 5TRDA 3CCUI 4FK0A 2DPUA 1V5EA 3N97A 2SRCA 3HPHA 2HNYA 2DILA 4GLMA 4BI4A 1HQEA 2QEXQ 2X6SA 1X4OA 3FZVA 1B7TA 2V75A 2DA1A 2G8VA 2AQEA 2MAMA 2FC0A 4M7AF 3OW2M 1JJ2A 3E01A 1R6RA 1M90C 2YHWA 3KK1A 5DCMB 4JK9A 3WU0A 4OB2B 4F16A 3G71A 4N4HA 4X65K 5EJCA 1IUYA 2VBWA 1E7OA 1HJRA 2YX6A 4A6DA 3JRBA 1DP7P 2GOXB 1W6XA 2DL7A 3FDYA 3OYCA 4DU4A 4MFDA 4M7AC 3AO3A 2NUTA 4IOCF 2R5MA 3CFPA 2V9VA 1UUEA 2RN2A 4OMOA 1YQAA 3OBWA 2RQUA 3DPUA 2NOBA 4M78B 5J2NA 1OR7A 3NRVA 1LMZA 4M3GA 3SZGA 1EP4A 1HSTA 4CD1A 1LPQA 1GOBA 3DOLA 3MWMA 2KR3A 2VT3A 1I81A 3BZ6A 4RLFA 4KGVB 5E1WA 1JT6A 4OJRA 4AFQC 3MZ8A 1KRPA 2I5WA 2HSTA 4LY7A 3RZOJ 2NLXA 1IBLK 2ASPA 4PQUA 2E1MC 2JJ9A 1D1CA 4L5GA 3RPUD 2MW8A 4BQAA 1QQJA 1NGCA 3CC7Q 4LF7K 4ZZLA 5L3BA 2YNFA 4KKOA 2YPRA 3L4IA 4CJQA 3S6WA 2RV8A 4HLXA 4DTNA 2R5ZB 3SEMA 5FU6C 3ZMSA 1RUOA 3CCSI 1XGMA 4DGWB 3MXMA 4IO9L 3LW5E 3NGYA 4KUDK 1SFUA 4EGYA 1JJ6C 3OYJA 2OTLA 3SWNC 4H0PA 3HTRA 3PVQA 3LSRA 3TBIA 2QQRA 4HF0A 5HODA 2LY9A 1JCFA 5LGNA 5D6WA 3FZLA 3FXRA 1FSHA 3DP7A 2VB6A 3CMYA 2HQAA 3KHYA 3BWGA 2WAQA 3DKYA 2UUBK 1WXUA 2BZTA 4NNJA 5CQGA 4HQEA 3M58A 1XQSC 2YRCA 2EBPA 3VQ5A 2LF7A 2E1OA 2PJRA 5A2QE 2GUPA 1NK4A 4LFAK 3HEFA 1PCXA 2V51B 2DA3A 2M9HA 1YO5C 1U9NA 2CMPA 4FW2A 1TWFJ 4DQ8A 1YJNN 3ELKA 3AHUA 3QYBA 2DDBA 4F7ZA 4FJXA 1WXBA 3DFGA 3MEXA 4OO1J 1OI1A 3EHRA 5FKMA 5GAMf 2GFAA 2HGCA 3L6QA 3EFOA 2W6KA 1JUSA 3PT9A 3BUZB 4EP5A 1NBEB 3V9UA 1NHAA 1MNEA 5GPCA 3LZJA 4M3FA 4JK8A 1J5YA 1QVUA 3QYEA 3I55T 4DTXA 3RDVA 1VSIA 1DLOA 4JJDA 4CEQA 3EG0A 4X64K 1WYXA 1TNTA 1NG9A 2E2JJ 3QG1A 3FKJA 4CICA 4BHBA 1OH5A 3KK3A 4AM7A 1Y1WJ 1AT1B 3M0SA 4DG1A 3C95A 5GANh 5FFZA 1T6CA 3M8FA 1ZRFA 5FPDA 1HNVA 5CO7A 2CW8A 3TGNA 3FE1A 4CSWA 3U1KA 3CC4N 1Z7LA 3JRZA 2DK3A 4JYKA 1Q1HA 1XDSA 3BGRA 2P4RA 4HUEA 2YX7A 3FK7A 3VS6A 4BR5A 4BQQA 2P4WA 1G6NA 1GBQA 5JI6A 5IT9Z 3I8BA 5FJ8J 1ERDA 1WKMA 3F0CA 2ELJA 3CC2I 4DQQA 3EG2A 3Q1JA 2OZSA 2DDAA 1LCKA 3ECHA 1PG5B 1ZGJA 1KG4A 4CHZA 4WXHA 2M1HA 3HKZN 4QLCU 1XG7A 1GOCA 2FBIA 1N5ZA 3E9LA 2EIJH 2JM8A 1S1VA 4H5TA 3HKSA 3I59A 1U49A 2EBIA 3T3FA 5LMNK 5F64A 1W97L 4YRVA 2RJCA 2YHAA 5LMUK 1Z3YA 3OL3A 4IHWA 3HSTB 5HRNA 4EMKB 2FSWA 2O03A 2OANA 4B1XB 1NJIO 3SFMA 3HHTB 2CV1A 4PFOA 5GTHC 1IKXA 4CGZA 1RDWX 1XUPO 4A3GJ 4NB5A 3EZWA 3IUOA 4FJ8A 4C8QF 4NCBA 1FYLA 2D0AA 4B3OA 3CJRB 5DM7L 3I56I 4XRSA 1W5SA 2DI3A 2NOGA 3UA7A 3FXUA 1D5YA 1DIZA 1K76A 3KEYA 2KVQG 1CSKA 2CH0A 1X9MA 4BR2A 3THWA 3TOBA 3E97A 5AQVA 2HVRA 2MG4A 3PO5A 2RC4A 4WF2A 3REBB 3NHNA 1JJ2M 3QDRB 4CC7A 3A8MB 5LEJA 3V1OA 4QS8A 2XD0A 4FZZA 4NHJA 4X6AJ 4ZJZA 5GAMd 3AVNA 2KRMA 4AHVA 1WI9A 1LWYA 1P6RA 2DBBA 2XF6A 4Q4ZF 2QASA 2NUZA 5KRTA 4LSNA 1VQ6A 5GAEP 1ESVA 1UDLA 4E6RA 2E35A 1CZAN 4A59A 4KH6A 2IBDA 2MF2A 3PO2J 1YUWA 2F4OB 4AT1B 1FT9A 4B3AA 4WQ5C 2M3AA 3NH2A 1Y64A 2IT0A 4BL0B 2DA5A 4BS9A 1SV5A 4CJWA 2IVWA 4MEXF 1X1DA 3K7AJ 1UAAA 5EY4A 4ZGDB 2XGCA 3QOEA 4BG9A 5DY9A 1KC8U 1VYUA 1OQYA 1IKVA 4DR5K 5B5EC 2HBWA 2QK0A 4LITA 4A54A 3QPLA 2YDLA 3I0RA 1IBMK 2NYSA 2L7MP 3CDLA 2RQPA 1BHLA 2G8WA 1M1GA 5GMKm 1ZN2A 1ZBSA 2FZKB 4JAXA 3ZEUB 2O4XA 4JKEA 2FBKA 4AILC 4BHCA 2DMPA 3OS1A 2VPLA 2DFUA 1LNXA 3BDUA 2ZPBB 1VQPN 1GLDG 3G71T 1D9DA 2K27A 3G73A 3JB9D 4OLAA 3URGA 2OAWA 1NKEA 2AHJB 3AARA 2WWYA 2PVDB 2P9UB 2R93J 4DS4A 4GW6A 4S04A 3H0HA 4RM3A 3ZT1A 3DEUA 4CK3A 3LDSA 3BW1A 1QVGP 1YWOA 4HTUA 4DLGA 2R5YA 4F52A 3M5AA 5AQHA 4KO0A 3CLQA 2WUSA 2BYVE 1WSFA 3D5SC 1QKXA 3GTOJ 1E6HA 1MZBA 4Y3OA 5GJVB 2KIQA 3GTPJ 2EILH 3ZCMA 3W2WA 1P4XA 2K7AA 2E3HA 3RPUA 2PUKB 3PIPF 4LD6A 3MX2A 1FBQA 4ZC3A 1X2KA 3R6MA 2O5RA 3VGKA 2IDOA 4BQZA 4ELTA 3D0SA 2Z1GA 4C8QB 2O8XA 4UB6C 3VERA 3D7SB 5KN9A 2OV7A 4LD5A 1HKSA 1TNSA 2PFUA 4XKBA 1HLUA 3JCMg 4PKHA 2LMJA 4CZMA 3KLHA 3CQXA 5EF6A 4EA5A 4J9EA 3KLOA 5C0YA 2F5TX 2E6NA 1XB4A 2DK5A 3CCVN 2E5QA 4JRPA 1WPKA 3OV8A 5AZIA 1VQ7N 2JT4A 3S93A 1SEMA 4CCOA 3DEWA 4Y1CA 1VQ9I 1IG9A 3DLMA 4W5RA 4W5TA 4LDWA 5C12A 3CP8A 3OYGA 4DFPA 1ZC6A 2M30A 2R5YB 1KQ1A 2V8IA 5CZ1A 1VQNI 2Y1IA 4ANJA 2LTOA 2TCTA 2NUPB 3TARA 1T95A 4IO8A 3D2EB 2YX4A 4ZGEB 1M1EB 3R0AA 4MLHA 1YNZA 5KPTA 3EN9A 2LNBA 2EFOA 4J9GA 3GFMA 4ENJA 5GAOn 1DDNA 4N76A 5HLHA 2R57A 4M7DE 2F48A 1S6QA 1DUXC 4LK0F 4RMNA 2LR8A 2R7SA 4AWXB 2W42A 3MZHA 4A4FA 2EFIA 1IBKK 1K61A 2FBTA 3QBYA 4C92D 1Q86U 4AM3A 2NOLA 1RR8C 2Z0WA 1N8RO 4A4KA 1KC8R 4E70A 1NJIC 3KK7A 3QUIA 3KK2A 3AVCA 2EQUA 2E65A 3CCJT 1QZ5A 4LE9A 3FJ5A 3G6EN 3F2KA 2JSCA 1RLPC 1YS7A 4OGEA 1YJWI 2ATCB 1WJDA 4KHQA 4HZFA 4IDKA 3D5RC 3TSWA 2UUAK 2AT1B 1A6QA 4MQVA 3OHRA 1M1KO 2XHCA 2GX9A 2JTEA 1H92A 1TUDA 2ZC2A 1IH7A 3HRMA 3SBGA 4FK2A 3HYIA 2K3FA 2LQWA 3CTAA 2FYKA 3ER0A 1VSJA 1WJQA 1FEXA 3ASKA 1UJ0A 1G3YA 1P59A 3TL4X 3F6VA 3VUZA 3KLNA 3LWHA 5DLQE 4E7SA 2IVOA 1XC5A 1GOAA 2KRCA 4F3OA 2RGVA 3ZCOA 3EGDA 1J9AA 1XCBA 2PZ1A 2DEUA 4CIEA 3O8VA 4D8KA 4BWMA 1RAHB 2WAEA 4LF6K 3IFRA 1ONVA 2FQ3A 1GLCG 3GUDA 3QZ5B 5H6RA 4LIVA 2FEZA 2A36A 1D0ZA 2HKQB 4DTOA 3FZKA 1OYYA 4WCGA 2GTOA 3UKUA 1H641 3NBPA 1JLBA 2L0AA 4KN7X 2W4SA 2VBYA 4X1EA 4WYBA 4UVCA 3SDZA 4FOIA 3HK2A 1BI0A 4PUSA 5E20A 2GZWA 1R23A 3CPWM 1ZHFA 3FDRA 4H4OA 5CLSA 1VQ4I 3MWPA 1Y71A 2CUDA 2FXUA 3M4GA 3THXB 1XMKA 2J6KA 3O9TA 1U9OA 3VQPA 1MA9B 1NPRA 1ETYA 2KYBA 4ESJA 1PUEE 3VEOA 1NGHA 5AQQA 4F7UE 1OVYA 3ZQGA 3O3KA 2M0OA 3UKRA 1UFFA 1Q9XA 4FJ5A 2VKDA 3H9NA 4R55A 2XO7A 1VQ5A 4BRGA 3OBYA 2BXYA 4H8KA 4CEOA 3QPSA 3CCET 3DLRA 1IV8A 1BR4A 4KIFA 4RWTA 3OR1C 4JYAK 3F9KA 1ZRDA 4FW1A 2EYYA 1QO0D 2M16A 5IAYA 4AFZC 2JT1A 1CKBA 1TQMA 1R1TA 5F1RA 2OA8A 4DQSA 4A63B 1Q95G 1XHZA 1AZGB 4BR9A 3QAHA 2D0PA 3HTVA 1VQ6T 1M3CA 1PC0A 3MP6A 3SAGA 1YJ9Q 3OYDA 4C1NK 4H0YB 4LG0A 4QS9A 1C0MA 2X85A 1W4SA 4JHDB 4ME7A 2AO9A 5F0XA 5JICA 4OPAA 1C0FA 1XMOK 3IP4B 2LLKA 5FPMA 1Q86R 4BR4A 3L8BA 2Q3SA 2WV0A 1T3LA 1ZUKA 2DMNA 5L3EA 4G6DA 4D7MA 4BQLA 4B1VA 4DV6K 5J3BA 1LWCA 2EA4A 4M7AG 1U48A 2X35A 4GKJK 3TSQA 4ENNA 3MVPA 3GTGJ 4Y28E 2IGMA 1VTNC 1M5Q1 1JKHA 3HDDA 4BRIA 5EG0B 5BPNA 3WG7H 4NC6A 2K57A 1U2VA 4OVLA 3O5BA 1F36A 2DQLA 3BTIA 5KE2A 3I0TA 3BDLA 2BTTA 3C0CA 2NWMA 3H9JA 1CLQA 3UF4A 4O5FA 1VF9A 5DM6F 1Z26A 3RMBA 1NG6A 3CJNA 2CT4A 4EJVA 3QHSA 4F04B 1VQMN 5LRRA 4CW7B 3RKYA 3O9QA 1DTQA 2O8KA 3QYFA 2DYBA 4XTXA 1Q9YA 1BO5O 3IRXA 2DM1A 2LKSA 3QWLA 1WNSA 4XN0A 4P55A 4CJFA 1XTAA 4LB6B 1H89C 3H3VK 5KYYB 3J81O 2MABA 1N75A 2O2OA 3A1YA 4CBXA 3TPQA 3C3WA 4A53A 2P9NA 2K6DA 3P1GA 2V79A 3CZ6A 1T39A 1WJ5A 5GANe 4ZYGA 2YCHA 2DIGA 2DTHA 1TUUA 1YIJI 4KGXB 4A62A 3RR6A 4YIIA 3GVAA 2XSDC 2X78A 1XCVA 3CCLA 4DQ2A 4I98B 5A2QZ 5HS7A 4IZ9A 5LJ3g 3LSIA 2IOCA 1N8RC 1Z9CA 4FYXB 4CF8A 1LEAA 1U2VB 2KXCA 3JSPA 2LP5A 1JTYA 2Q2EA 2AHQA 1VQLQ 3I56N 1MGQA 4A4EA 4BQNA 4BEHA 5GMKi 1LWFA 3NDKA 1S9HA 3H0FA 3J8AA 3M3ZA 3DYAA 4JI6K 4MO5A 1FYMA 4CUGA 1BA5A 1HK9A 4BJ5C 4CI6A 4EMHA 2WBMA 2E41A 4HQMA 3CEYA 3QEIA 2Q97A 2XDBA 1A5JA 5LJ3j 3H3NO 3LAKA 4MHGA 3MEUA 2H8RA 3CCQA 3OQ5A 3IV5A 3DLLF 2ZFUA 2M87A 2JA5J 2A08A 2Y0SA 1YBYA 1PP7U 3VU3C 2W10A 3SZTA 4E1NA 4RTUA 2JWLA 3A8HB 1ZSGA 3GTJJ 1O75A 1V4SA 3IAS2 1K7AA 3TW6A 2X4HA 2EAYA 3DKMA 4GYIA 2QEXN 3A8OB 4XMYA 1OVQA 5C4JJ 3K9KA 3VEYA 4A3EJ 4ILGB 2P5VA 4AI4A 4JRKA 1RR7A 4RUGA 3HUGB 4BDYA 3HRUA 2HNDA 4B1YB 2YXYA 4NXMK 3GLXA 5AZJA 3PIPL 1W0HA 2ECZA 1LEBA 2ZJRF 4PJJA 2PYLA 1YVNA 4NXNK 4M3YA 2ESWA 4OAZA 1H1VA 4QSHA 4QAGA 4KITB 1X1CA 4FWNA 1JRIA 2MH2A 4P96A 2CV2A 5LJ5d 4JNEA 1Y8RB 5LLQA 1KG2A 1JB0E 3DXKB 4HEA2 2FPFA 3PFYA 2JG6A 2J06A 3R60A 4WFNL 4FLYA 4EJTA 2R7DA 2NZTA 4PK4A 4IWVA 5KCMA 4XLAA 2JWKA 4B6MA 2KISA 1LVAA 2RM4A 2ZSHB 2CP3A 1KG1A 1OR7C 1GFCA 2L2OA 5HRPA 1U06A 3W2VA 2WACA 3OB9A 3J81K 1QWEA 4TSXA 1IUFA 1GLNA 1J54A 4Z0UA 1OEBA 3CC7N 4B43A 3JRIA 4E4HA 5F1XA 4RW4A 1YHQT 3KKSA 4C92B 1S7AA 3BG5A 5GANf 1F21A 5LJVA 4PA1A 4QWQA 4FJMA 5L3GA 5CIUA 4NZGA 2FPEA 2KK4A 5DPKA 4BAYA 2EFQA 1K0XA 5LFAA 3D4VA 1F43A 2OI3A 3I3LA 3MHXA 5AQRA 1U0JA 3TR8A 4LMYA 4DSKA 3HXMA 4M75F 1OCCH 4DF4A 2HVSA 3LOCA 2Z99A 4XK4A 2A7YA 1NK7A 3JW4A 3K4LA 1SKSA 3HOZJ 2KFZA 3KYDB 2E5ZA 3Q7CA 5HNFA 4DCHA 1BOAA 1L5UA 4QT7A 4NQWB 1VQOA 4JI3K 2VG6A 3B6AA 2LVMA 2QBYB 3D5LA 3QINA 4J6YA 5KRSA 1VQ9N 1O7FA 3ZSZA 3KXTA 4Z4FA 1VQ5T 3K9JA 4OPHA 4L8RB 1LAVA 4RDUA 4J9FA 1JEGA 3ID6A 1C0TA 4HOBA 1NM1A 4HT9A 2O8DA 1RLQC 4IRGA 2VWJA 1ZLMA 3SUQA 4C5IA 4GCVA 1QQIA 4ELVA 1SS6A 4BE2A 5K5RA 2VQLA 2MC3A 4B9WA 2PUOB 3BPVA 5J1EA 3JCMb 5DDGA 2OTLQ 1ZLJA 5BRHA 2RHYA 4L5JA 1OJLA 5FLXO 1KK7A 4EMKC 1YI2Q 2RJFA 1W7PD 2XMFA 3EGUA 3BY5A 4B1UB 1XPXA 1MWMA 3KP3A 2R7ZJ 3PL8A 4HTLA 5EC7A 1EQYA 2D1KA 5AIPA 1ZQ1A 2VT2A 4UQGA 1NGBA 1RI7A 1X1PA 4GGGA 2W57A 2O01E 1YJWN 2LX9A 3GNFB 3OIOA 4YY3K 4I99C 3CCRQ 2LDMA 3S15J 3EE8A 2LVSA 4PLIA 2NUBA 4M41A 3ZN1A 4A2BA 5HVQC 2D1VA 3OSSC 2M7AA 3I9QA 3AG3H 4HF2A 4O0IA 3O8HA 4FCYA 3MZYA 4LG3A 1TUYA 4EPCA 1SD5A 1RADB 3R6NA 5FRMA 4YDUA 4OB1B 3I55I 3KLEA 2Q31A 2EV0A 5IOYA 4BE0A 1X3NA 1WGSA 2OF7A 5GAN5 1MWKA 2LDUA 1IO6A 4ESBA 3MP1A 4A3KJ 4RTWA 1M4ZA 2VQFK 1S72I 1W36C 5CQXA 5IPAA 1UEBA 3SHFA