3OYLA

Crystal structure of the pfv s217h mutant intasome bound to magnesium and the insti mk2048
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 111
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oylA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oylA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oylA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oylA03
3AA3A 1TAQA 3TABA 2OPSA 3LWLA 1NK9A 4M42A 1DTQA 3EZ5A 3JSMA 1U04A 4IG0A 1OYXA 3HO1A 4FJIA 1O1WA 5C24A 3DB3A 3TAMA 1L3TA 4CCHA 4A4EA 4FJ7A 5DMRA 1HQUA 4AILC 3SQ0A 2M16A 1EX4A 3IAYA 4FJ5A 1JLBA 2XO7A 4E7HA 2EHGA 3NDKA 4JS4A 2VG6A 3S3NA 3EAEA 1CZBA 3DM2A 5KRSA 3SUPA 1SL0A 1ASWA 2G8FA 4CGJA 2RKIA 3HPHA 2NLUA 4BWMA 3C4SA 2QK9A 3MEAA 2WACA 1NKBA 1MU2A 2XRIA 4RW7A 4J2DA 2G8VA 2HHQA 4F3TA 1C0UA 3VQ4A 1TK5A 4PL6A 3H6ZA 1WSHA 1NK8A 5C6SA 3NTIA 2FHDA 1WJRA 2QQSA 1HNVA 3WNFA 4DS5A 3SQ4A 1NK0A 4Q0BA 3SZ2A 5CY4A 3IS9A 1WSFA 4K8XA 2RI2A 4C8LA 3ZT4A 5SZTA 2Y1JA 3MEGA 1YTAA 1TAUA 4B9XA 4J2EA 2VG5A 1YT3A 2D0CA 2FBXA 3OYEA 3HPGA 4Z0UA 3ZSXA 3QIIA 4CJKA 4FJMA 2K3XA 3ZSWA 3AA2A 1B9DA 3OJUA 2QXFA 2G8KA 3S9HA 3VN5A 1TKZA 4DLGA 4F2RA 3CEYA 1S1TA 4B9UA 4C8OA 3DRRA 3Q1JA 3TARA 4B9TA 4KI6A 4AH9A 4JLHA 4C8KA 2YNIA 3QLHA 3K59A 1KHCA 1JLGA 4E19A 1TK0A 2GFUA 3OJSA 1Q8IA 2IOCA 3RTVA 2EFIA 3OMCA 4HCBA 4PUOA 4Z4IA 1QS4A 4Y1DA 3LH0A 3OYHA 4FLXA 1NKCA 2L89A 4QVZA 4M45A 4H4OA 4FW1A 5HRRA 3OYJA 5KI6A 4CHOA 1WN7A 3PO4A 4DSIA 2BKDN 4BE0A 3P5JA 1S1VA 4CK2A 3ZSVA 3M8SA 4DTSA 3TWHA 4BDPA 1HPZA 3LP0A 3PV8A 4C5IA 4QCLA 2RJFA 4A4HA 4BACA 1HYZA 1KLNA 1WGSA 4M3WA 4CIFA 3M8RA 1VSMA 2G8UA 3F70A 4CF0A 4CHQA 3VQ9A 1D9FA 5EU7A 1RTHA 4ZTJA 3KKSA 3AVMA 5C42A 1JLCA 3QERA 3O3HA 2Q3SA 1WSEA 1L5UA 4FU6A 4CJ5A 4BE1A 4KHWA 3HVRA 5FRMA 1X9MA 2I5JA 4DTMA 5J39A 4DQQA 2RI3A 3ZSZA 1Z26A 2A1SA 2R58A 2KQ2A 5JS2A 3RMCA 1RDBA 3AV9A 3LWMA 4B9SA 4AHRA 3WNHA 4F2SA 1WNSA 3MXJA 3MEUA 1FK9A 4FW2A 4FLUA 3ASMA 2O4GA 4AHTA 4ELUA 4L8RB 2GUIA 3V9WA 4B9WA 1BIZA 4Z4FA 1D8YA 4YFUA 1QHTA 4CEBA 4WE1A 1KVAA 2KFNA 4C5GA 5IAYA 3SPZA 1FXXA 1RDCA 2P0KA 3RR8A 5KE3A 3SUQA 3AVNA 2Z1JA 3ZT1A 4CEDA 3CQ8A 3FC3A 2YKNA 1RT5A 1YVUA 3OS2A 3L2RA 3QNOA 1B92A 2RHYA 5CZ2A 4IUPA 3U6FA 3SUNA 3RMAA 1NK5A 4FJKA 3RR7A 4DSJA 4N41A 4A4GA 4HVJA 2P1JA 3UIQA 4QQ6A 3E9GA 4CGGA 4IUVA 4ELTA 4MFBA 3V1QA 4IUQA 5J26A 1UWBA 1X9WA 2XK0A 1UAXA 3OYCA 3CFOA 2Z1HA 1GOBA 3MEDA 4KV8A 3NBPA 1TKTA 2PQWA 3SCXA 2GFAA 3VQPA 2OZSA 3OYAA 3BDLA 4F4KA 3QEPA 4FCYA 3SNNA 3MEWA 2KFZA 4PLIA 4FJLA 1RT6A 4KI4A 1TL1A 4LSLA 3HJFA 5D3GA 4IBNA 1W0HA 3ITHA 2HW3A 3PUFA 1H3ZA 3NH1A 5KGXA 2G8IA 1RBSA 2FBYA 1QE1A 3VQ5A 4AHSA 3DRPA 4Z4HA 3F73A 3LDSA 3LZIA 2Y1IA 1S1WA 1J5OA 4DTPA 3E9FA 1RBVA 1C1AA 3UT1A 4OKJA 4OKEA 3HM9A 3CFPA 1QSLA 1VSHA 4CFCA 1KCFA 4I2PA 4L59A 4M3XA 2P51A 2K3YA 3PMIA 2F5KA 2DFHA 3NGYA 1C6VA 5T7BA 5FDLA 4XIUA 1L3UA 4IFYA 4DSLA 3K5NA 1RTJA 3MP8A 3U3YA 1SUQA 3AVCA 3DMJA 3K5OA 4B08A 3DOLA 2MWPA 1VRUA 2RF2A 3O3FA 3M8QA 2RPIA 3KLGA 4O55A 1NK7A 4KREA 1LW2A 4ICLA 2HNDA 3NCIA 3ZSYA 4E7IA 3MP1A 4HHTA 4DTXA 4A4FA 4M3UA 4DTNA 4NCAA 4QQDA 1REVA 2Z1IA 1UA0A 4FXDA 4BD3A 5CYMA 3TAFA 3O4QA 3AO4A 2R5MA 4DTOA 2RJEA 1S1UA 2B4JA 4CJQA 4CF8A 4OPKA 1IH7A 1T05A 1XHZA 3OYFA 2IDOA 1Q9YA 3ZEHA 3DLEA 2X4YA 3AO2A 4FJ9A 2QQRA 4KKOA 5I42A 1S9EA 4BE2A 3AVAA 2O4XB 3ISNC 2OYQA 3H8ZA 4IUTA 5K14A 2M0OA 1HQEA 1VRTA 3TAGA 2DAQA 3AVFA 3QEVA 3DLBA 4FLVA 2RI5A 1GOCA 5KGWA 3DRSA 3TAQA 5KE2A 3AO1A 3SV4A 2PYLA 5J2PA 3QEXA 1WJQA 2YHBA 1KFSA 1NOYA 2F8TA 2PZSA 1RDDA 2LTOA 2E4LA 2KW4A 1ZBLA 1N6QA 2IS3A 2ETJA 2R5AA 2RJCA 2X74A 3VQQA 4CJPA 5C25A 3MAQA 2OZMA 4FJ8A 4FK4A 4B3OA 2LCCA 4F3OA 1FKPA 1NJWA 2ZQBA 4KHSA 1G15A 3IG1A 4CFDA 5I3UA 3THVA 4ZTFA 4CJWA 4DU1A 2EQMA 4FM1A 3LYIA 1ITGA 3KD1E 3DOKA 4RW6A 4FK2A 4C5HA 4O0JA 4AHUA 1EKEA 3ME9A 3QIOA 3KK1A 4DS4A 2VYTA 1A5VA 2IG0A 3PNWC 4NS5A 1RBUA 4KPYA 1VSEA 2HQEA 3M8PA 4DF8A 2HNZA 3LLRA 4II1A 4NCGA 3NGIA 4PQUA 3RMBA 5KCOA 3VQ8A 2JLEA 4FJGA 2DFEA 3QO9A 4B8CA 2B6AA 1BI4B 4ZHRA 4KHQA 2HHSA 4DG1A 1CZ9A 3QBYA 5M9OA 1BI4A 4Q5WA 4CK1A 1RCHA 1J9AA 3CG7A 3DLRA 3ZCMA 3NE6A 2BDPA 4HCZA 1TK8A 4E0DA 3RWUA 1RNHA 1LV5A 2LDMA 4ID1A 3T19A 3OQ5A 3FFIA 3HP6A 3MECA 3NGZA 1L3VA 4FZYA 1J53A 1DTTA 1HJRA 4FZXC 1I3AA 2YNHA 3NF7A 4NCBA 3ZSRA 1WAFA 3VQEA 3ZT2A 3U3GA 4E1NA 1SKWA 2G3RA 2RHZA 1SV5A 3A2FA 4KHNA 1LW0A 4OLAA 1S1XA 3VQ7A 1WLJA 4AHCA 5D6WA 3K5MA 3GOXA 3QINA 3PX6A 1QQCA 3OYDA 3P8DA 1KVBA 1VSFA 4EDUA 2VWKA 4IURA 3T1AA 1TV6A 1U48A 3ZSQA 2OPRA 3KLHA 3RRGA 3V81A 4K8ZA 4UQGA 4YNQA 2GBZA 1VSJA 4CF2A 1LWCA 2E6LA 4LH5A 4RG8A 4DMNA 3QESA 2W42A 2HHWA 1S9GA 1RTDA 1BIUA 5HP1A 3PX4A 3HYFA 4FLWA 2HMIA 2AJQA 1CXUA 1EXQA 4QAGA 3TAEA 1C0TA 4CJVA 4CFAA 3KJVA 2JGUA 1A5XA 3LALA 4CEQA 4FLTA 3L2VA 2DIQA 2A1RA 1ZBIA 1VSKA 1QSYA 3VQBA 1Q9XA 3NTKA 3L2WA 4IUUA 5FRNA 3QKJA 1KFDA 3SJJA 4CJEA 4BDZA 2IGIA 3NHGA 2YV0X 1DLOA 1LWEA 4CJUA 3OS1A 3KD5E 2VWJA 1J54A 4M41A 3VQDA 4HUFA 4KB1A 3K5LA 2O4XA 4DLEA 1T03A 2E6NA 1JXBA 2RHXA 3HT3A 3MXMA 3PX0A 4GY5A 3OY9A 2PY5A 2X35A 2YRVA 1Z25A 3NFAA 1IG9A 1JL2A 3T3FA 1RBRA 1RT7A 4IFVA 3OYLA 2RHIA 3L42A 3M9QA 2DFFA 1IKYA 2IC3A 1N27A 3UWNA 3HP9A 2P5OA 3ALYA 2R57A 3ZSOA 3HXMA 3TANA 4N4HA 1EETA 4OKKA 2X4WA 1W9HA 5HROA 4FYDA 5J1EA 4DQIA 2RN2A 2CKKA 3KUFA 3QJ6A 4I7FA 4N47A 1YTUA 2RO0A 3AO3A 1KVCA 4DTJA 1U47A 1KLMA 1RT2A 3G10A 2BANA 3NF6A 4OGEA 3H08A 5CYQA 3S3MA 4CGIA 3PO5A 4J2BA 3VQ6A 3LANA 1S5JA 4CJRA 1BQNA 5HLFA 3META 1ASVA 3LX7A 1UOCA 4I2QA 4CEOA 1RDAA 3AVBA 3K57A 3LP1A 2XY5A 2XY6A 4BWJA 2LVMA 3P8HA 3WNEA 5HRPA 4HCCA 4O4GA 3ZT3A 2FC0A 3L3UA 3KLIA 3P1GA 1RT4A 1MHNA 4CEFA 1LAVA 4HUGA 5J2QA 1JLEA 2FBTA 1SL2A 3HK2A 1JL1A 2RJDA 1NJZA 2GF7A 3WNGA 1ZYQA 1SKSA 3RMDA 2F8SA 4LD6A 2EKOA 2JTFA 1BISA 3LP2A 4ID5A 4RW4A 5D6XA 1S6PA 4PA1A 4JRQA 3OS0A 5KCHA 3C6UA 1X1PA 4CF1A 1LWFA 2LSNA 4CESA 4CHNA 3KK2A 3KK3A 3L3VA 4Q5VA 1IKWA 2XHBA 4X34A 3V9SA 3G0ZA 2G8WA 4KRFA 1RTIA 2D9TA 1CLQA 3ULDA 2X6NA 4W5QA 4UC4A 3DLGA 1LAWA 4CRIA 4CHPA 1BHLA 1F21A 4M3RA 1CXQA 3OYIA 2MWOA 1BCMA 4O0IA 4DQRA 2HNYA 3MEEA 1QTMA 2L3RA 3OB9A 4IDKA 3CFRA 4N4IA 1OI1A 4EZ9A 2QKKA 3MP6A 4LSNA 5C0MA 3I8DA 1FKOA 3TI0A 4IG3A 5KH6A 4RG2A 1HYVA 2X4XA 3EYZA 3B6OA 3OYMA 4DQPA 1RT3A 1NK6A 4FZZA 2KTQA 1L3SA 5J2NA 1WAJA 4E7JA 1U45A 4CJLA 3C6TA 3I0SA 3DI6A 2D0AA 3CM5A 3VQAA 4KAZA 3LP3A 3AVLA 1ZBUA 4FK0A 4Z02A 1D9DA 3B6PA 4AHVA 1VSLA 5DK5A 4F8RA 3OA6A 3SYZA 4DU3A 3HPOA 4Z4EA 5FROA 1BL3A 2R7YA 3DLMA 1C0MA 1OZ3A 3DYAA 1RILA 3L2UA 4CJTA 1BGXT 5HRSA 3NH0A 2EQUA 3NH2A 1IKVA 2KZZA 3LPTA 4LY7A 1WSIA 3I0RA 4B9MA 2E5QA 2OPPA 2QKBA 3LGFA 2DY4A 4CGFA 3K2PA 1HNIA 3LGLA 4CF9A 2OPQA 1A5WA 3V9XA 4OVLA 4HTUA 1B9FA 3HSTB 1OZ2A 1TL3A 3LAKA 3TAPA 3AA5X 2BIVA 2PYJA 1HYSA 4E89A 5CZ1A 2HHVA 3L2QA 3AVIA 1K6YA 3QEWA 1NOZA 3D45A 2HVHA 4N5SA 4W5TA 3MO8A 1I39A 4G1QA 4RW9A 3V1RA 4DTUA 2BGGA 3AO5A 1GOAA 4KFBA 3OYBA 5D6YA 3F9KA 4CFBA 1QSSA 1XNIA 2NUBA 1HRHA 2YKMA 3PFSA 3QEIA 4B9VA 4B9LA 2IAJA 4N56A 3KLEA 1X9SA 4IKFA 1TKXA 4ELVA 3OYGA 3BDPA 1ASUA 4B8AB 1SKRA 4C8NA 4CHZA 4QW2A 2X6SA 3SQ1A 4KO0A 4R5PA 1TVRA 5KTQA 4N4GA 4DU4A 4FJNA 3SV3A 4O44A 4C8MA 2DIGA 3QNNA 4M3TA 4Z4GA 4H8KA 2HVIA 1SSFA 3HL8A 3P83D 1VSIA 4DSEA 3QETA 3VA0A 2B8AA 4OLBA 2E6MA 1RI0A 1IKXA 4GMJB 3E01A 3V9ZA 4DF4A 1KRPA 2P5GA 1R0AA 4JRPA 2G8HA 3PY8A 2D0BA 4W5NA 2B5JA 4OJRA 3TR8A 2XY7A 3DB4A 3KTQA 4E7LA 3S3OA 4JS5A 3V6DA 4FJHA 4DFJA 5HRNA 4DFPA 4EZ6A 3KKRA 3LZJA 2EQKA 2HHTA 4KB0A 1JLFA 4GW6A 4FL6A 4C5EA 3SPYA 3CYMA 4CJSA 3FLGA 3NTHA 4CJFA 4CECA 3CM6A 4Y1CA 4DFMA 3DLKA 1IO2A 1C1CA 3AVJA 4I9LA 4CE9A 2OA8A 4PY5A 1NKEA 2VG7A 4CHYA 1Y97A 3D0PA 4FM0A 2WOMA 3JYTA 3PMTA 4NYFA 3KLFA 3BGRA 1XI1A 4KHUA 5J2MA 4CGHA 1WSGA 1T8EA 1U49A 5E41A 1VK0A 4DFKA 2Z1GA 4EP4A 1BQMA 2ZD1A 2LRQA 3V4IA 1TKDA 1XHXA 3NF8A 3SD4A 4CGDA 4CEEA 4MQ3A 3V9UA 2GV9A 2X78A 2HQXA 1WSJA 3HVTA 1U4BA 2YNGA 1RT1A 4B9NA 2RHUA 1JLQA 4FVMA 1JKHA 2DTUA 2WONA 3AVGA 4E7KA 5KRTA 3AVHA 4E1MA 4QOZB 4DQSA 3ASKA 5CIUA 4KTZA 4FLYA 3NF9A 2KZMA 4DWIA 3O8VA 4LH4A 2D5RA 4CJ4A 2EQJA 3S6WA 4CEZA 1TGOA 4BDYA 1KSPA 4N76A 3IRXA 4RW8A 3L8BA 1NJYA 4M3YA 5SWMA 4OGCA 3NNQA 4H4MA 1G5VA 4CK3A 3FEOA 4W5RA 3SI6A 2M1HA 4DSKA 4LD0A 1VSDA 2ITGA 4M3ZA 4GVMA 1KTQA 2HB5A 2BE2A 5HBMA 3VQCA 4NZGA 3OVNA 2O4IA 2ATQA 3QIPA 3DLHA 2BUDA 4PLLA 3SUOA 4QQGA 2F96A 3AA4A 3OMGA 4NYNA 3O4NA 4Z4CA 3SQ2A 1ZBHA 4E3SA 3MEVA 2HHUA 3ZT0A 4KHYA 5IN1A 3OYNA 1S6QA 2FBVA 2XDPA 3C94A 3RRHA 4CJ3A 1C1BA 4O5BA 4TSXA 3AVKA 5JS1A 2XY8A 2ZE2A 1JLAA 2YNFA 3KIOA 3LAMA 1XC9A 4KTQA 4PWDA 4CERA 4OVAA 3V1OA 4DTRA 3MXIA 4CIEA 3NAEA 4I9QA 2YHAA 2EX3A 4FLZA 2L8DA 1D5AA 4W5OA 3VA3A 1WJSA 3C95A 1SL1A 1NJXA 4FJJA 3FDRA 1BCOA 4FM2A 1HMVA 1ZBFA 4CIGA 2HHXA 1NK4A 2JZ2A 1JXEA 3EY1A 4OPJA 3K58A 1XWLA 4KTWA 4CEAA 1N5YA 1RBTA 4HUEA 3O3GA 1EP4A 4EP5A 3OYKA 4DSFA 1UA1A 1T7PA 4J2AA 3LPUA 4FJXA
chains in the Genus database with same CATH superfamily
1TAQA 2CZ7B 1OFCX 4A69C 2XKOA 4C8QG 3SQ0A 2M16A 5FLXO 5KQ8A 2XRLA 3F8BA 4KA4A 1X3WB 4Y3OA 3C4SA 3RCOA 3E19A 1MU2A 5M5YJ 4XKVA 2QWQA 1K6OA 5LHHA 4X9CA 2ZJ2A 5IYBJ 4A3KJ 1OCZH 3G0QA 1B9DA 2IVNA 4C8OA 3A8MB 3EZWA 5FWCA 1MDMB 4I6ZA 3K59A 3K1MA 4XSZF 1PD1A 1MWMA 2IOCA 1QS4A 4A3MJ 3LDPA 1A6IA 2VXDA 4OFAA 4QPOA 1HPZA 4XRMA 2MABA 3BG7A 4OFEA 3VB2A 1WZ2A 3VQ9A 1D9FA 3SXYA 4JZ3A 1RTHA 4BE1A 3GFIA 3AHUA 3Q9SA 4A59A 4CZLA 1P2FA 3G7ZA 3AY9A 5HL7L 2F5CA 2LQNA 3OS5A 1U5TB 1MSFC 1MMDA 1A04A 3MN5A 4F7UB 2STWA 2ZSIB 5J26A 2JMCA 4PKIA 3MHXA 3KWGA 2ZGYA 3G1JA 2DL8A 2VOOA 4LSLA 1K8AO 1W0HA 2HW3A 2E1YA 1NZ9A 4QS8A 3JCMg 4J9GA 2AA4A 4M75A 4CFCA 3QB0A 4HG2A 3EG2A 2MI6A 3LFKA 3GW2A 1WJCA 4B08A 3M8QA 1M3HA 3GZ6A 2JUFA 3CCUT 4E7IA 5GMKh 3CC4A 1YITA 2KRFA 1ZA1B 1X1DA 2Q2RA 1D5YA 4UUSA 1IH7A 2VONA 1R77A 3CCEQ 3Q7CA 4BE2A 2NRWA 3W0LA 3J81Z 5K1YA 3GZ5A 3ZLJA 3I5UA 2D0PA 3AO1A 2IA1A 5F0FA 2UWMA 1N6QA 4F93B 4OMNA 2DE0X 1VQ5N 2NRXA 4MQVA 3N97A 2W7NA 5LD2C 2HBKA 1TW2A 1YG2A 3C2BA 5J40A 5FKNA 4DF8A 1BOBA 1YTYA 2FJ1A 5KCOA 2QQ8A 1ZLKA 1W2BP 1Y07A 1FSHA 4M3BA 2BDPA 4HCZA 1FEXA 2LDMA 1POGA 3S6IA 2E1CA 3K69A 3WG7H 4JBAA 2VQEK 1YRNA 4LF4K 2V9PA 3QQAA 3L1AA 2QI2A 5D6WA 1KVBA 2YUQA 2VWKA 3CCLI 3RRGA 4K8ZA 1LWCA 2HOEA 2W42A 2NXNB 3ZQQA 1IGUA 1Y96B 4RUGA 4LXCA 1IUFA 3TW7A 1P59A 3TDZC 2E6NA 3CJRB 4M75F 2YRVA 4CZZA 4FL9A 3R9PA 1B34B 1ZHFA 2ESHA 3U9GA 1IKYA 4ZYEA 3IP4B 2RK2A 2H3JA 2EK5A 4DW6A 4N4HA 1P4XA 1VAZA 3CCJI 4C8QB 4WQ5C 4N0AA 4LIUA 4IOCF 4BR7A 2DEQA 3KUFA 4I7FA 3QJ6A 3VUZA 3CCEN 2K79A 1TWCJ 3CP2A 4HQEA 2RVCA 2R7QA 3FDYA 3NF6A 1S5JA 1TNSA 2UYTA 3AVBA 3LP1A 1MV3A 1XMKA 3R0JA 2MMPA 2K3BA 1BR4A 4LD6A 4RW4A 1S6PA 2G8WA 4JX4A 4IHXA 3ULDA 2F5DA 1QSSA 4JI3K 2QKKA 4LSNA 1RR7A 1ERDA 4PFOA 3BZ6A 5DM6L 5GTHC 2KTQA 5M1FA 1SHFA 1OCPA 5EZHA 4DYRA 4RTTA 3I3LA 2D0AA 5E84A 3HRUA 2WA0A 3QWYA 3LP3A 3AVLA 3ULRB 4F8RA 2OTLI 5FROA 2ETHA 1RILA 4CJTA 1BC7C 3CWSA 4HEA2 4JUVA 4WWCA 4JJDA 3CUQA 3CQTA 5AQKA 5ED4A 3V9XA 3VS4A 2EZIA 3ZYYX 5GAOp 2KR3A 2R7VA 3D45A 1I39A 4G1QA 3D2EB 1TKXA 1TOVA 1W7AA 1P7IA 4AIDA 2FA5A 1S8NA 1U2VA 1YJWI 2QLZA 1HC8A 1UGRB 4C8MA 3VGLA 1SSFA 1RDUA 2F9TA 2E6MA 1ZK8A 2EFPA 3OV8A 2BH1A 3DBLB 2DXCA 3KTQA 4JKHA 2CT3A 3TEEA 4XSXF 4PGGA 3AAFA 4J19A 3JRBA 3T1YK 2CU7A 3DLKA 3GTGJ 3WQTA 1XI1A 4KGXB 3QDFA 4V2FA 5GAN7 4MLHA 2Z1GA 4DCHA 1FMKA 2PJRA 1UGQB 2IXSA 4XH4A 2XAHA 4KBMB 3AVGA 4E7KA 4QOZB 4F52A 4DQSA 3M1EA 3QOPA 4HBLA 4BKXA 4R55A 2KZMA 2PMUA 1TGOA 4IQ4A 2ZXWH 1VIFA 4W5RA 2BZ8A 3O9SA 4DSKA 2A6AA 3OR1C 4XICA 1X27A 2PVDB 2QG9B 2LDUA 5DCMB 1YWPA 4QTRA 4ZN1A 4G7ZF 4K41A 4E3SA 5E8GA 4BY6B 4NO7A 1YIOA 2FBVA 5KYUA 2ZE2A 4ISFA 1JLAA 3V7CA 4LDXA 3OL3A 2DTHA 4FJJA 3OYYA 3H0HA 1JJ2S 1ZA2B 1OPCA 5BR9A 2Y69H 3K58A 2CSIA 1Z9ZA 4DBHA 3FXQA 2W24A 4M73A 1QVFP 2EGAA 3ZX2A 3E6DA 3TAMA 3OW2A 1XG1A 3IAYA 4Y33A 3PQKA 1MUYA 3G4SA 3QDRB 2RKIA 4MO7A 1IO6A 4B23A 2JG6A 2CYZB 1X6GA 2KRMA 1C0UA 1K8KB 1WSHA 2HQHA 2QQSA 1YI2N 1RLQC 3H36A 2ISZA 5HS9A 3A8OB 2EIJH 3ZT4A 5SZTA 5FPEA 1B07A 4ZYAA 3I59A 1QCNA 4AVZA 1FN7A 2PFBA 5HODA 1NJIU 3SFZA 3S32A 2YU9J 4JLIA 1MMGA 5IOYA 2EFIA 1Q82R 1SG5A 4Z4IA 2NNYA 1M8MA 4BY7J 2NYSA 2LREA 3THXA 2QGGA 3BZCA 4BUGA 1HNWK 3J81E 1G2BA 4C0DC 3FMRA 2J6FA 2DJNA 3RERA 1OEBA 4BRAA 1JI8A 1GLNA 1IXDA 4IRGA 1GFDA 3KKSA 5AJ3K 3WU0A 2I5UA 2HXIA 3P9KA 5JS2A 2D1HA 5IHKA 5H20A 1FBQA 2J05A 1QZEA 3QYEA 3VTIA 4RGRA 2DEUA 3SEMA 4PJOD 1N3AA 3D2FB 1Z6TA 2HI3A 2P9PB 1T56A 3MKWB 2DYBA 5CKFA 3PSIA 4RM2A 3M07A 4B3SK 3L2RA 1B92A 3SUNA 3EUHA 3RR7A 1EBMA 1YUWA 3CFOA 2E2OA 3SCXA 1WOQA 4M7DF 4KMUX 4FJLA 2H27A 4IO9L 1YW9A 1TWFJ 3ITHA 4DB3A 5KGXA 3D0SA 3ZRGA 3LZIA 2Y1IA 1VQLQ 1B8IA 4M3FA 5HDKA 4PJOC 2KROA 2E71A 4M7AF 2F5KA 2K2MA 1RTJA 2L01A 1RAGB 4OB3B 2CSOA 1VRUA 4CHUA 3INZA 2P9NA 2LQ8A 2CGKA 4HHTA 2ZBKA 2YHTA 4RAYA 3HM8A 2FSNA 4CJQA 4ON0A 4OIOF 4Z6YA 3GPLA 4D8KA 3TAGA 5BR8K 2ATCB 2WUSA 2DL4A 3M0QA 2M02A 4WXCA 2CYYA 2YHBA 2E4LA 3MN2A 3GFJA 2IS3A 2TCTA 2RJCA 1VYUA 5LRSA 4KHSA 3ZMUA 4CYCB 1NYFA 3LYIA 3U1DA 3MDQA 4YFNF 5TGTA 1DJ7B 5A2QO 2RQUA 4CC4B 4NCGA 5DM6F 4KHQA 3QBYA 4V2GA 2P0QA 3E97A 1YFHA 2A40A 3FFIA 2EIKH 3PVLA 3VOVA 4KHNA 2YRDA 2VBZA 3OYDA 1K9MR 1IXCA 1KC8U 1YE9A 3DLAA 1TH7A 1UZCA 3JXUA 1S9GA 1RTDA 3PX4A 5JLXA 4CJVA 4Y0WA 2OTJN 1X1BA 1ZR4A 1WFXA 4FASD 1QVFM 1LWEA 3OS1A 2JSCA 4ZZDA 1ZUUA 2E8AA 3T69A 4OOIA 3NFAA 1N3CA 3DQVC 1AOYA 2ELKA 3ZN0A 4D5CA 4K43A 4OMLA 2P5OA 3ZSOA 1J2XA 2HVQA 3G4SI 4OKKA 1S22A 2A7YA 5J1EA 5H1SQ 1E3MA 2RN2A 4JI6K 2A5YB 4DR6K 1LFUP 2DYSH 2KIFA 3EE9A 4YHHK 1C0GA 3N05A 4CGIA 3S3MA 4E1JA 1FP1D 3META 1UOCA 3O6BB 3URGA 3ZT3A 5H6QA 5FU7B 1LAVA 1WHKA 1BL0A 1MDUB 1SL2A 3HK2A 5J1YA 3MN9A 3JCMX 1BISA 2EJ9A 2LSNA 1T3LA 4UVBA 2EQIA 4I09A 1Q18A 3KZYA 2LTPA 4V19K 4IDKA 5D5VB 1ORKA 3CCMI 3I8DA 1S7AA 2YHYA 1IRXA 2XDVA 4OMFB 3C6TA 4CCNA 1B9MA 3K0LA 4CDGA 2JRMA 4JI8K 1QVPA 2VXFA 3L2CA 3CPWA 2P6SA 1K4US 1KHIA 1LOTB 1HSJA 4QT7A 2OPQA 3U9DA 4CJ7A 1EO1A 3F23A 4JQFA 3VYUB 2YHXA 2O88A 5LJ3f 3W2AA 4H4KC 2A6TA 3EUHC 4W5TA 2X1DA 4RW9A 3IH3A 4CFBA 3QEIA 1HRHA 1Q81R 1OH7A 3LFUA 2RHKA 2FBHA 2STTA 2P5GA 3RR6A 4WF2A 2VJ4A 4BQLA 1X3ZB 2AZSA 4M78E 1A6QA 4EZ6A 1T39A 1ZG5A 4YORA 1UG1A 3CYMA 3CPWM 2YU3A 5D4SA 2OA8A 1VQNN 1I1JA 3M3ZA 4BRIA 2RN7A 1U49A 1MBJA 2ZD1A 5FLXZ 3C7NA 4PJ0C 3CCEI 4M75C 4B9NA 2VXEA 3BPXA 3S15J 1E4FT 4B22A 3FFKB 1RIOH 4UUVA 4LMYA 3DTEA 5BN9A 1CKBA 5LJ3h 3JTGA 5E3MA 5F1XA 1NJYA 1ODDA 4XU1A 3DLHA 2BUDA 1HQCA 1ZBHA 3PUBA 2JA2A 4AIAA 4B21A 2P9SB 3H41A 2YG9A 1W0UA 1FTTA 1TYQA 3LAMA 4DTRA 3BEXA 1G59A 3RUXA 1DIZA 1A0NB 5JVGL 2JZ2A 2ASMA 2ROTA 3T1HK 1XWLA 4BL0B 5E1ZB 1CKAA 1RBTA 3G3ZA 4BRQA 4EIKA 4KBOA 3TABA 2VE8A 2ENMA 2HBLA 3QWXX 2LKXA 2DILA 3T8RA 3C12A 1XMQK 3OSGA 3J80K 4BWMA 2QWRA 4AVPA 1M1FA 2XRIA 1ZGWA 3LSIA 4PDKA 2M4GA 2DOFA 4IRIA 2B86A 1BUPA 4C3JJ 5J4VA 3A5ZB 2Y1JA 4I02A 4ESRA 4A3FJ 4R79A 3KZIC 3HPGA 1IF1A 1XQSC 2KIUA 3F72A 4DLGA 2K85A 1P8ZA 1GLJO 4M74A 1AWWA 2YNIA 2OD5A 1WJFA 4MEXF 3F5TA 3RTVA 4PUOA 4HCBA 2P9KA 5H2FC 4CHOA 3HSRA 3V42A 4K42A 4H0TB 2DT5A 1X01A 1FW6A 1VOMA 1S3JA 5ICCA 2EJFA 1WA7A 2MC3A 4ZTJA 1JTYA 2RQTA 4NQWB 4DTMA 2DA6A 5F08A 2YWWA 2NYXA 3HKZN 4J6XA 5DM7F 1MBGA 4A5AA 2O4GA 3LA7A 1SF9A 3OBYA 2GUIA 2R5YB 4CZGA 2ZF5O 2P0KA 1IV0A 1HD3A 1FP2A 1BB9A 3H5AA 2ZFWA 2M5WA 4WF9L 2GOXB 3K2AA 5M5XJ 1JTXA 3LQQA 4MLOA 4IBNA 3CMET 1RBSA 4AHSA 2WV1A 5F0CA 1S1WA 5GIPA 1C1AA 3UT1A 5HLGA 1HR0K 1HU0A 3RTRA 3TU5A 3CIPA 4C8QC 2DFHA 1SFKA 3NGYA 1L3UA 2DBMA 1HKTA 5CKHA 3MP8A 1FYLA 4PL8A 4C3HJ 3K5OA 5AQXA 4F92B 1IN6A 3QUIA 2RPIA 1LW2A 3C1DA 3CMEQ 3RDVA 3CUQC 4BD3A 4B09A 2JA5J 2LMJA 1KG7A 3TAFA 2UUAK 1RZ4A 3UE5A 1YJNQ 2QQRA 2PI0A 3PM1A 3MEXA 4B47A 4RLQA 1VQ8I 3AVFA 3TAQA 3JREA 4B24A 2O8EA 4U87A 3I56Q 1BN5A 2ETJA 4B3OA 2XKPA 2JA6J 2OPTA 4F3OA 1IREB 2C0OA 3KD1E 3EHQA 3M8FA 3DOKA 3EYIA 2P6TA 3M59A 3KP3A 1KQ8A 2A5XA 1K73U 4OB0B 1VSEA 1IBLK 1T0JA 1WQWA 2HHSA 3HTSB 5C10A 4DG1A 2LNBA 1FYNA 1J9AA 4P5OA 4X64K 5IPAA 1Q7YC 2CP3A 4S0HB 1PDNC 4B8XA 5LL6Z 4BRDA 4FZXC 5EYRA 3KFVA 5B3SH 2RNGA 3I56A 4UXNA 3KCCA 2DK5A 3PX6A 1QZYA 3CCMA 2UXXA 3P8DA 2VT2A 1VSFA 3V81A 1VSJA 3JCMe 1ESVA 3VESA 2SEMA 3O1BA 3CJQB 3TEDA 3LALA 3PNYA 2XAGA 3VQBA 5K7ZA 5BPMA 3REAB 2IVPA 4UV9A 1RI9A 2YRCA 3VQDA 3WTVC 2HBMA 3IKVA 3QYFA 4DLEA 1V4SA 2X35A 1XMAA 5KNLA 2WADA 3LNQA 5CE3A 2IC3A 4ABZA 2QWPA 3CMAN 4MGRA 3J80Z 3JRZA 8AT1B 3G10A 2JN6A 4FM4B 3PO5A 5HKCA 3CMEI 3NAUA 4HRIA 1X3UA 5L3FA 1LQ1A 4HCCA 1J5EK 1PRLC 5AQWA 3DF8A 1ACMB 1RKTA 2RJDA 2JT1A 3FWEA 2M7AA 5LGTA 1RTIA 5FGMA 4W5QA 3QZ9B 1QP3A 1QTMA 3FIFA 1NTCA 1YJ9T 5KK1A 1GXPA 4S05A 5BPNA 3THYA 3TI0A 4XIDA 3CWAA 1NK6A 2DVJA 4HDVA 4E7JA 4BBSJ 4KAZA 4FK0A 3GTJJ 4WXHA 1SC7A 4Z4EA 1UECA 1OZ3A 3DYAA 2DYIA 3R6SA 3GBQA 3LGFA 1JCGA 1N9SA 1VQ9T 2OZUA 3J80E 4L6V5 3L2QA 2Q0RA 4N5SA 4N0BA 2LC2A 2O8XA 3WTTC 3PFSA 4XRFA 4N56A 1X69A 3CCLN 3PVQA 2VC8A 3CCQA 1JXOA 2W03A 4Z8AA 2DIGA 3QETA 1VSIA 3QO3A 3WXIA 4M7DE 4GMJB 3E01A 2CUZA 4M78C 2JNGA 4NHJA 1IZ6A 2JPBA 1XDSA 3SPYA 2W25A 2VUMJ 2VKVA 2DL7A 1PUEE 4R1HA 5GAMg 3I56I 3PMTA 4KHUA 1K8AC 2MIOA 3COAC 1M9SA 5GANh 2EINH 3KP4A 2D8JA 1TWBA 2DBKA 3VTHA 2RQVA 4FLYA 1IUYA 1KJWA 2D5RA 3REOA 1H641 2XGCA 1ZG3A 1XCBA 3SI6A 2ZXHA 4E6KG 4JP0A 4CC7A 3UKUB 2NRVA 3QIPA 1LFBA 3AA4A 3VPZA 2VODA 4CBXA 4DK9A 3HOUJ 5H6RA 1C1BA 4N9HA 3EG1A 3V1OA 2W82A 3FKIJ 2XB5A 1W2BA 3TTCA 4YY3K 3C6AA 3DKXA 4DSFA 2JWTA 3TSUA 4XQFA 1FOWA 1DTQA 4JRKA 3HUGA 4UUSB 3QBWA 1UFFA 2DXBA 4XTWA 2RE2A 5KRSA 1SL0A 2VJ5A 4MIMA 1NKBA 4CD3A 1XQPA 1EZZB 2DRKA 4I0BA 3ENHA 5LEKA 1UHSA 1OU8A 4DR1K 4RAZA 3AL0C 4CJKA 2L2OA 3AAPA 3AA2A 2K3FA 3O5BA 3H3OB 2OQGA 1QMCA 2PVGB 5AQUA 4J9FA 5B66C 1WPYA 4KI6A 3NQOA 1S5LC 2XPUA 3X24B 3QP5A 3OMCA 1ZRCA 2X9DA 3H0GJ 3EGXA 4AFUC 3X28B 2OF7A 3VS1A 1K9AA 2NUZA 3CCRN 4BDPA 3ZEUA 1MBEA 1KQSS 1BI1A 2G8UA 3A8GB 3MMVA 4RCCA 1MPGA 1PG5B 2V4JC 1AWXA 4M72A 1HCRA 4FETA 5EY4A 1LWWA 2R58A 4B9SA 3G6EN 1RDBA 4F2SA 3HC7A 3N5NX 3QU3A 2QGFB 4L8RB 4EJOA 5F04A 3I53A 3C65A 2KFNA 1KVAA 3G1LA 1SQKA 1FXXA 3FX3A 4UNFA 3U6FA 1LWVA 2HSEB 3VS6A 4CGGA 3JCMb 2Z1HA 3QJYA 3TPQA 3VQPA 2HMAA 3BDLA 4FCYA 2CWEA 1IXSB 1W0TA 1NGAA 4HA8A 4ITVA 1H3ZA 2FBYA 3M0PA 1VIEA 3DRPA 4Z4HA 3H0FA 1ETVA 1UFMA 4ZDLA 2O7OA 2C06A 5MLCQ 2VPRA 4M3XA 4XIUA 2KAFA 2ZMEA 1RETA 3X2QH 1KQ0A 2P9KB 1WJAA 5CKTA 3VOEA 1NK7A 1WB9A 1O3RA 3GL1A 1H8AC 1IHWA 3J7AY 4L5JA 2YX6A 4FXDA 1FOXA 3AG2H 2CQXA 1IBKK 2HYGD 5FU7C 3JAMK 5FLVA 2PX9A 1HQEA 2DAQA 2JPSA 2L7KA 1M27C 4LG0B 2O8BA 2DOAA 5AQHA 2DPDA 1ULYA 2PZSA 1BWFO 3EEQA 3ZXSA 3EH2A 3BP8A 4BVOA 5D5WB 4FK4A 3H46O 1UB4A 1OU9A 2KZVA 2LCCA 4LUDA 3JRCA 5AZIB 1NJWA 3FISA 2M4KA 4ZTFA 4DU1A 1XG7A 4EJTA 3U21A 2KT0A 4BB7A 4HF2A 4KPYA 4NS5A 4PJMA 4L5IA 1LVAA 3QO9A 4ZHRA 2QA4A 4M63C 1RNHA 5C2FA 3ZT2A 4E1NA 2HOAA 1ZR2A 1M3AA 1IRFA 3DLLF 1KG2A 1WLJA 3G25A 4EDUA 4IO8A 2O8DA 2E6LA 3QESA 3E6CC 5JHFA 3VF2A 1I1SA 3JRIA 4M7DD 4C2MJ 1IV6A 5EGOB 5EOYA 1QZZA 4C3IJ 3HOSA 4BDZA 4M78D 1STZA 3GZNB 1U1SA 4BHBA 4M41A 3CC4Q 4IIOA 2CH4A 3HSFA 4H0PA 3OY9A 2ZJQL 1HDDC 4RGSA 4A93J 3OYLA 4MZPA 3L42A 1QLYA 2FU4A 3UWNA 3DXJF 2O8KA 1WH7A 3A98A 2FL7A 1VUBA 1R71A 3G71T 2IGOA 4M7DA 2DLPA 2RREA 4N47A 5EXWA 4DTJA 5E20A 1RT2A 4W97A 1NGNA 3SBGA 3LANA 2NZTA 2JTMA 4I2QA 3LX7A 3E2UA 3VGKA 5EJCA 3R6NA 4BWJA 1IGNA 2FC0A 3KLIA 4EJUA 1MHNA 4A2AA 1MGTA 4OU0A 4OMMA 4NDLA 1NKUA 1D0YA 4LLGF 4KRFA 1M90O 3IHUA 1VQ8T 4P55A 1SHGA 4NL3A 4DV1K 4O0IA 2P8TA 2H8WA 1KQ9A 5LJ5f 3F8MA 1M3QA 2DNUA 1YQAA 2R7WA 3KHYA 1Z7UA 4BGBA 3S2DJ 1I5ZA 4LNPA 5FU6B 1LCUA 3R3LA 3VETA 3O6WA 3FGUA 1P7JA 2P7VB 2AP1A 3I4MJ 4J83A 3CCEA 5BNGA 5DPKA 5GAN8 2OZ6A 5JLFA 1MJ9A 4EMGA 2HF4A 4EMKB 5DY9A 2BHZA 5HDGA 4JZ4A 3EO3A 3JS6A 3DBHB 5E79C 4IZ9A 3F22A 4RLFA 4R5PA 5KCMA 4O44A 3Q0VA 1PUFA 3QNNA 3M0TA 3PGGA 2Q97A 5IT9K 1EA3A 2CUBA 1KIKA 2G8HA 2Y4YA 2XY7A 3S3OA 1YITI 3WTXC 4DFJA 5HRNA 4HVUA 3BF1A 4KB0A 4OMPA 2HL5C 2H3GX 4CJFA 3ISPA 3BLYA 4OPHA 5M1NA 4PY5A 3AVJA 4ZYHA 1U6ZA 3PIOL 3D0PA 2WOMA 3JYTA 3O5ZA 4EJWA 4A12A 1T8EA 4EP4A 1AT1B 4CGDA 3HVTA 5ERIA 2WAEA 1KU2A 4NXMK 5HVQC 2DTUA 1OX9A 3F0CA 2RF0A 3PLAA 3B6CA 5CIUA 4LH4A 3ESWB 4RW8A 3TP0A 3Q5FA 4CK3A 1VNDA 1VSDA 5AIPA 2OU2A 4JV5K 2LP5A 2E5ZA 2XICA 2KVQG 4M77B 2F96A 2HHUA 2EFOA 3M53A 2R0QC 2XDPA 2VYPA 2M87A 2DMUA 2X51A 2VQFK 4MDAA 3CCQN 2RDPA 3HG9A 2Y4XA 3VA3A 3U1KA 2LCSA 1T0HA 3CCQI 3DWLA 1ZBFA 2VJJA 4MTEA 3CC4N 3HOWJ 4HUEA 2HBJA 2QSFX 1EP4A 3IUCA 4HNVA 1HK9A 2ZCWA 3OBWA 1U04A 2PBDA 1VQ9I 2GGRA 4LB6B 1U2WA 5ECAA 4E7HA 3NDKA 2FF6A 5I21A 1CZBA 2O2OA 2KRNA 1WUAA 4BAYA 4ENMA 5AFUA 4A54A 2LK2A 1R4MB 2CG4A 2FHDA 2CRGA 2HCKA 1WIEA 2LY2A 4K8XA 3D7SB 5A0GA 1XGOA 2UXDK 3DU5A 2K3XA 2WC2A 1AOJA 3DPTA 4AUXA 2VKDA 3F6OA 1IN7A 3QXEB 1Y1WJ 3CD6Q 2RQQA 3CETA 5CO7A 1B6AA 4HSRA 1OYYA 4LLLA 1P4AA 1KYWA 3OYHA 2L89A 4FW1A 2K9SA 4MEYF 4KN7X 2QWNA 2VWBA 3HGGA 4G94A 4QCLA 3HTVA 2O01E 4D1QA 5DEQA 3I56N 3OIOA 2E3HA 3TQ7P 2QQBA 1XSVA 3WGHA 5C42A 1LFPA 1T8IA 3DXMA 1L5UA 3HHGA 5HS8A 4Q48A 1AU7A 1TUYA 2FPEA 4IL6C 3CMAA 1F1ZA 2FLOA 2DT6A 1ON1A 2ZXIA 5TRDA 3CC7T 3ZT1A 2GTOA 2LQKA 2P1JA 3O1WA 2X1EA 3HFNA 2UXBK 2CZ1B 3OYCA 3HSBA 2PQWA 1TSFA 4OP0A 4M3DA 5D3GA 3E5UA 3P4IA 1V55H 2CV2A 2DVEA 3NH1A 2Y30A 1ACIA 1RRJA 4HNTA 3CCMN 4CCKA 4IF4A 1C6VA 1BA0A 1PSFA 2PJPA 2DD5A 3DMJA 4HDUA 4EHTA 3NCIA 3UATA 3S1NJ 1USTA 5GMKj 2J06A 1TWGJ 1S9HA 4IIMA 2W41A 3RSEA 5E3NA 1S9EA 3KETA 1NK3P 1WGXA 2ECCA 2LBFB 2BY1A 3FMQA 1OYIA 1KFSA 3OW2S 3CC2I 4ELZC 1ZBLA 1A36A 2Y0MA 3VKIA 1IG7A 4XM3A 3CZ6A 5J3BA 3FM5A 1A5VA 3WEEB 3HKZA 3JCMQ 4E47A 5KYYB 5IWAK 4PQUA 4FYVB 1BIBA 2E1MC 2XAJA 2F5TX 5M9OA 1TW3A 1ETOA 3EQLF 1VQMQ 1UG2A 2VQGA 4FWMA 2KI7A 3ASNH 1T38A 4CCJA 3CCRI 3CUOA 1X1CA 1NGGA 1HLUA 2K3PA 2DA5A 2MOXA 2F4OB 1TV6A 3MKYB 4WX9A 2A08A 2FG0A 4UQGA 4BBRJ 3ROUA 3M4GA 3IUOA 1WKMA 2PQ8A 4XKCA 3S14J 2K7LA 3SQNA 1ZAOA 1M2VA 1D0XA 1AHJB 2YSRA 2IGIA 1JKOC 3MWPA 3A5NC 2W04A 1T03A 1DP7P 3FXRA 2RHXA 3HT3A 3MX2A 3H1CA 3DPLC 4E9FA 3EG9B 3CDIA 4XNFA 3T3FA 1SS6A 1XNQK 5FKKA 5J8CA 4K11A 4OPAA 1QKXA 3HXMA 3HB9A 1UHMA 3MJXA 2P9IA 1ZARA 5AQTA 3RJPA 1B1BA 4EQQA 4DR5K 1MNEA 3JB9D 2FF3B 3TBIA 1RT4A 1MUZA 4JKDA 4DOZA 1EIFA 2EGEA 2Y0SN 4XTZA 4CESA 2HNHA 3HSEA 4CHPA 3BOQA 2IIMA 1APLC 4H0OA 4DQRA 5BPIA 4GNIA 2AKKA 4DQ2A 4DQPA 4GY2B 2HSTA 2R4GA 1O3TA 3A03A 2F6CA 1M1KO 3EYYA 1T33A 5EEGA 2FPDA 1VSLA 5L3DA 4Z2YA 2NS8A 4E7SA 1WJBA 4BY1J 1C6VX 2UU9K 1XX5A 1MNMC 4CGFA 1ETXA 1YQKA 1WEFA 3LGLA 4M78G 2UV1A 3OA9A 4L18B 3G71I 3WTUC 1B34A 3OIPA 5IHIA 4ASNA 4O6JA 3ULEA 2HNIA 4CSWA 3AA5X 4CBUA 1JJ6C 2HVHA 2M0MA 4FYWB 5BPLA 2MG4A 3OYBA 4BVPA 4LJZF 3W6VA 4B9VA 3N4QA 1X9SA 2FXAA 4ZYGA 1IRGA 1AWJA 4CHZA 1UB9A 3QZ5B 1ZRFA 2E35A 1BC8C 4BEHB 2K27A 1KSWA 2HVIA 3PTAA 1F9NA 2H8RA 2B8AA 1GLBG 4ZYDA 2H94A 2HFHA 2EPFA 2Z99A 4N4NB 1UEBA 4J9CA 3NTHA 4CD1A 3CM6A 3SDGA 2EIFA 1H1VA 1QQIA 2OQRA 3EG9A 1QHAA 4J8FA 1FTZA 2DBBA 5AQPA 2EZLA 1LWYA 3V8LA 2LRQA 1TKDA 1OCRH 2OAUA 5K5RA 1YLFA 2E65A 2YX4A 2X78A 3O80A 1JGSA 4EMHA 3I55T 2OTLA 1OCTC 1DU6A 1G83A 5L8RE 3R8EA 5FD5A 2KIQA 1EF4A 4CEZA 3FEOA 1OYWA 1XD7A 1Q7YU 5J1RA 3HHTB 3LL7A 1O3QA 1KZHA 1R1VA 3ML6A 1ABQA 5BOXA 3LSPA 2I2LA 2OV7A 3AVKA 3ZETA 4KTQA 1RAFB 5AQOA 3NAEA 4I9QA 2GQQA 4OB1B 4BY6C 1WJSA 3M1FA 1AEYA 3D4VA 4EVVA 2XPWA 2YUNA 4CC2A 2K5CA 3CJ1A 3D7EO 2OJ2A 4ME7A 5D8KB 2QAZA 3CCQQ 1VQ4Q 4CI0C 4GRIA 3L7WA 3DM2A 3E7LA 2ESNA 4FWSA 4HZFA 4J2DA 1N36K 4HW0A 1IG8A 4FWLA 4M77E 3H6ZA 4M3YA 4BRNA 1NK0A 1ORPA 5AQJA 5CY4A 2QKLB 1RAHB 2CH5A 3LSJA 2F2VA 4BR9A 4O8UA 3HI0A 2XAFA 2CW0F 2DW4A 5A0DA 5LLQA 2D8HA 2NVXJ 2MCNA 1M90R 5AQIA 2GAUA 3VU3C 2GX9A 5AZJA 1OULA 3QLHA 4CZJA 2GFUA 5BRHA 4KNYA 2ID6A 4I0AA 2P5VA 2Z0WA 1NK2P 2NAZA 4KIGA 1U06A 3LP0A 2DTZA 2O6GE 1VSMA 2V8KA 5EU7A 4R56A 4IHYA 4KYWA 1RRSA 1WSEA 4M75D 2X6XA 4KHWA 3HBTA 1WI3A 2I5JA 3BY7A 5J39A 2RI3A 4XLPF 1TZLA 2A1SA 4JJNK 4DA4A 3AV9A 2DMNA 1WNSA 3AGKA 4FW2A 2BGCA 1RAIB 5LL6S 4XEIA 4TVRA 1U3OA 4BJ5C 1VQ7A 2Z1JA 2JMAA 3J7AO 3AGRA 1U9NA 4RTFD 1T98A 1NJIO 1B3QA 2P5LC 2XPVA 4M3UA 1TKTA 4IPAA 2OZSA 4F4KA 4B4CA 2OTJA 4RTZA 3CO7C 1BBZA 4PLIA 5DD4A 1XNRK 4XLHA 1TQPA 3CCUQ 1Y57A 4OMZA 4CC3A 3CWTA 1E3OC 1X19A 2K3YA 2VQLA 3AVCA 3CMYA 3H35A 4PJOB 4UOBA 1REVA 2A41A 4DTOA 2QXLA 2B63J 1T05A 2Z9OA 2IDOA 3FK6A 4RTUA 1V54H 4OMQA 2A69F 5IXBA 4M6XA 2XGXA 1YQLA 4LG0A 2O8BB 3LWHA 1SANA 4M3EA 4J9HA 4RA2A 3CF5L 2VB6A 2UZKA 1NGJA 4BXFA 1T2KA 4XTYA 5AQYA 2A5WA 5HS7A 1D1CA 2B7EA 2FX0A 2HQEA 2VGMA 1RESA 3M8PA 4DIQA 1H8KA 2V7FA 4JOMA 4IDHA 2AHJB 1GL5A 1RCHA 3DLRA 3QBXA 1V3FA 1SVOA 1RUNA 1LV5A 5C2DA 1LKXA 3NF7A 3VQEA 2CP6A 4G9YA 4OLAA 2J6OA 1GCQC 3EETA 3CMMA 3SFIA 2KMTA 3KLHA 1JGGA 3ZQGA 1C0TA 4CFAA 4WYBA 1WWXA 2A1RA 4B3AA 5M1KA 4IUUA 1KFDA 1UJ8A 2Q1NA 2RK1A 2GOMA 1J54A 4YOVA 2NUTB 5LHIA 5LJ3d 4A3JJ 2H6BA 1O7FA 2LT4A 1JB0E 2X48A 5ILVA 3TSWA 3HP9A 3QOEA 4B48A 4FYYB 1W9HA 5GTIC 3DXKB 1ZH5A 3G4SN 3NVKA 2RO0A 3D2EA 5BRDA 4FVUA 1JU5C 4FQGA 4CJRA 2GQIA 3VYRB 2QA4N 1QWEA 1U78A 3CCRT 1V5FA 3SYTA 4ID5A 2FSWA 4PA1A 4C92C 2CS3A 2V7YA 3I5RA 3G0ZA 1R58A 3CF2A 5D4RA 1CXQA 1YCSB 1G3SA 5LY3A 1HA8A 2A05A 2DN0A 3BCAA 1KG3A 2XKOC 4RG2A 3EYZA 3OYMA 1WBBA 3CCRQ 3TO9A 2PJRB 2G6FX 1YI2A 4Z02A 3SBTA 3LSGA 3DLMA 2KGTA 4DV7K 3ABMH 1MDMA 2D2WA 3I55I 5KPRA 3L09A 3WHBA 2DXTA 2YDLA 2GTDA 3LAKA 1LE8A 2HKQB 2BGGA 4Y17A 5D6YA 2IAJA 1HXDA 3OYGA 4B43A 2O61A 3KVGA 1BW5A 4DU4A 4NOYA 3GEZA 1ZSZA 3UB5A 2J6KA 2CP0A 3JRGA 1UDLA 1NGHA 4M3TA 5C3EJ 2LNVA 4Z4GA 1IKXA 1V4RA 4EA5A 1R0AA 1SFOJ 1OMIA 4U0YA 4HSBA 1NNEA 4PJOG 2Y31A 4YOYA 2AXTC 1KU7A 1WXUA 3P31A 1PHTA 3BR1A 2VN2A 2L9VA 1IO2A 2X6WA 3K1NA 4Z88A 2XHKA 2CGHA 2BXYA 4YEJA 2X0LA 5CKBA 1K4TA 1R7JA 4I6MB 2WTUA 2HXOA 3BY6A 1Q82U 3BJAA 1U4BA 3G6EA 3HDDA 5GAOm 4G6TB 2VKEA 3JCMc 3JW4A 2FXUA 2L4MA 3LM9A 5FKLA 3TGNA 4DWIA 3O8VA 3GP8A 1WBDA 4C92G 5DLOA 2R7XA 4PIIA 3CC2Q 1KSPA 1GFCA 2M3AA 1SEUA 5SWMA 3CCRA 3M8EA 4M77A 1ATNA 2EV6A 3I0TA 2CGPA 3LW5E 3KXTA 2LZ6B 2YNFA 3K2ZA 4CCLA 1GT0C 2E34A 4J8OA 2QENA 3C95A 1YNZA 3FDRA 1BCOA 4UVCA 2K5FA 1W5SA 1W7PA 4RB2C 1LJOA 4A2BA 1I5OB 2BUPA 2G7UA 1OH8A 4QVCA 1L3TA 3PIOF 3ZN1A 1HQUA 3QWLA 1I4K1 4OAZA 3TTFA 4RW7A 1TU0B 4PL6A 5C6SA 1HNVA 4DS5A 3SQ4A 1SAXA 1LEAA 3LSHA 3G71N 2V1DA 1NH3A 2RN8A 4YRVA 1YT3A 1Z3YA 2G8KA 2QK0A 3HM5A 3IH2A 1IAWA 2NOIA 1UG0A 2XD0A 3M4YA 1TK0A 2TRTA 5CVRA 1W5TA 4BRHA 1WH5A 2DAOA 2L7MP 4PJLA 2YT6A 2CFXA 5ADXA 2GWJA 4GDFA 4OMYA 1NHAA 2E36A 3PV8A 4HF1A 4M3WA 4F7UG 5CVIA 4CF0A 3Q0UA 5K7HA 2RH2A 3B6AA 2OAZA 1NJIR 3BUZB 1UJ0A 3R6OA 4GV6A 1ZBJA 3M9AA 2M8GX 3LWMA 3WNHA 4DV6K 1IDYA 1LNXA 4Y28E 1ZRDA 4NC7A 2KXDA 2W4SA 5IAYA 4CZFA 1PYVA 1QZ6A 5C15A 1Y8RB 3OS2A 1VQ5A 2E5KA 4A4GA 3KYDB 1X58A 2YPRA 1WHJA 4BROA 2ACJA 2OUMA 3UKUA 1QP2A 4JKBA 1U3EM 4AT1B 5CJ9A 1I5LA 2OFIA 4LUEA 5ICEA 1ON2A 4XOPA 5AFUH 2GXBA 4GBQA 2IVOA 3QFUA 2V1NA 1Y64A 1PC0A 3CCLA 2LOOA 2XIDA 5FDLA 5B1AH 5CHIA 4CZKA 3KLGA 2SRCA 1TT5B 2XROA 1ILYA 4MHGA 3CCVQ 1Z9QA 4OPKA 3ZEHA 2X4YA 2KDZA 4XRSA 5JMVA 4B6MA 1JJ2P 4Y15A 5EG0A 3VSLA 5KGWA 4XK8E 5KE2A 3NWSA 2K4BA 3HKSA 1NOYA 9ANTA 3TREA 2HPMA 3RMSA 4M7XA 1TWHJ 2OZMA 5EVZA 2ZMEC 4EAHD 4IQJA 4CJWA 3ZOBA 4FM1A 1HUXA 4O0JA 3QPTA 2P0PA 4KGZB 1GLFO 1RBUA 2VBWA 2KRHA 4DR3K 4CK1A 3FKJA 1Y8QB 4PK4A 3NE6A 1ZGJA 4IZZA 4HT8A 1HJRA 3ZSRA 4XTXA 4TV7A 1T0FA 2DMTA 3K70D 3VF4A 5AQGA 1BJZA 2QBYB 3ZGKA 3BW1A 3N5BB 1U48A 2AJQA 3KJVA 2ZB9A 2HDWA 1A35A 4CEQA 2VV5A 3ENBA 2RQRA 2YV0X 4JD2B 2L3DA 2E2NA 1FIPA 5IXFA 5FPNA 2HDCA 2PY5A 2GLOA 3I9QA 2RHIA 1WI9A 5DCMA 2NUPA 2HSPA 5HROA 1ETWA 1UGPB 1YTUA 4YIFA 3CCET 2KT8A 4BI3A 1HYOA 4J2BA 4M75B 1BU1A 1UELB 2KT1A 2DODA 2R7TA 3BR6A 3LDLA 1OH5A 2HD0A 2FBTA 3EUKL 1ZYQA 5AN4A 3D5LA 4JRQA 1Q9YA 1Q82O 2FF4A 3LSRA 2DXIA 4X34A 3DLGA 1ORNA 3J7AF 2W00A 5A0LA 2E5LK 2RGVA 1ZLJA 1BCMA 3MEEA 1H0MA 2IGMA 4RTWA 5TJJA 1PVEA 4AG1C 4Q4ZF 4CJLA 1MUDA 2CO5A 4AHVA 4N9IA 3SMPA 4BI4A 3ZMDA 5AZIA 1T3VA 2X1CA 2ZKZA 3M0UA 2D0QB 3OSVA 3TDUC 3WT0A 2HHVA 5EEHA 3MO8A 3QDKA 4O5FA 3JRAA 1RRQA 1TNTA 3AO5A 2VLAA 3KLEA 3L2ZA 4H5VA 4UNOA 2QSHX 1PRMC 1PSEA 1R36A 3L1PA 1NM7A 3P83D 2JA7J 2ECZA 4F91B 5I9EB 1VFCA 3M7GA 1NG7A 3DB4A 3E9OA 4DFPA 3VEPA 2E2PA 4XH1A 1Y0MA 3VS5A 2EIMH 1TS9A 3M56A 1VQ5I 2K9NA 4I9LA 3BGRA 1H92A 5E41A 3RKQA 4E70A 3GE1A 1YFNA 4DFKA 1I07A 2QQ9A 4C0GA 3W6KB 2YNGA 2HQNA 2CH0A 5LEJA 5KRTA 1KXPA 5FB2A 4Q47A 4JYKA 3NF9A 5F0XA 2P5KA 1T6CA 2EYQA 1UGVA 2R7OA 4KH4A 2O3FA 4M7AG 2GM4A 2PUKB 5LRRA 1O9SA 3BROA 1GHCA 2FSKA 1JJ8C 2FD5A 1BW6A 1HLVA 3OYNA 1Q95G 3BTCA 2ZGZA 4LG3A 2PFUA 5JS1A 2ZM6K 2GWRA 2PZ1A 4GYGA 4W5OA 3MCZA 4B3XA 2BW3A 1OCCH 3WHCA 3FJPA 3DEWA 2QTXA 1YW8A 1SVLA 5CAIA 3CC7I 3EHRA 3DWLE 3ZQCA 4WQ4C 4OO1J 3BPVA 4EM0B 5GAOl 4FOEA 3JSMA 4E9GA 3T5XA 2DM1A 3S3NA 1OR7A 5FJ8J 2NRRA 3IKMA 3MN6A 3BR2A 1LOJA 1NLPC 1WHHA 2O8CA 1XOVA 4IHWA 2RI2A 3U8XA 4A6DA 2GA1A 2DETA 5KHDA 2YHWA 1GVDA 4G7OF 2LCLA 4B44A 4BR5A 3CEYA 5AZJB 3GUDA 3RNJA 3HXLA 5LJVA 1K78A 1JLGA 2R3SA 1QQOA 4OX9K 3HTRA 3BG3A 5B1BH 2RD1A 4BRPA 1MBFA 4F55A 3LDQA 1S1VA 3J80O 4DTSA 1XJWB 3TWHA 5FKOA 1UE9A 2DD4A 1YYVA 1AHDP 3WQUA 4CIFA 3M8RA 2Z1DA 2DQLA 3F70A 4CHQA 3RZOJ 1JLCA 1MMAA 4NQWA 3S16J 4BNCA 4CJ5A 2DXUA 2CJJA 2L4AA 3AAQA 3EPZA 1N8RO 2MSYA 4AHTA 3CMAI 4PJNA 2VL8A 3J7ZI 1VQNA 3SWNA 2LFBA 2P84A 4AFSC 1FBSA 4XBFA 2JW4A 3I64A 1EH6A 1S6LA 2FRYA 1UAXA 4C0ZA 3SDBA 2K9MA 2CQQA 3I0WA 1HSQA 2GWKA 3K4KA 4OIPF 3H3VK 4UUTA 1YO5C 3F73A 3T0YA 2JK3A 4OKEA 3C7JA 1OCOH 3CQZJ 1HSTA 2F48A 3QRFF 4HSTA 4MLEA 3HEFA 3O3FA 4RDUA 1LEBA 3LMMA 2LP0A 2GIVA 4BR4A 3WVDB 2F2EA 5GMKm 1D3BB 5CYMA 5JHUA 1N9RA 4CF8A 3H3NO 3R60A 4NLBA 1C0WA 2AIRB 2XU8A 2O4XB 5LJ5j 2OYQA 2EAYA 3JCUC 3QEVA 3DLBA 2L3SA 5LJ5d 4XN3A 1O3SA 3FBIB 1N75A 1WJQA 3CP8A 2KHMA 5HLIA 1SSHA 3VPRA 1HKSA 3FZVA 4CJPA 4FJ8A 1U1TA 1FMVA 2NLXA 1FKPA 2E20A 2QEXA 1G15A 4LLNA 2EQMA 2MF2A 3TO7A 4C5HA 2QEXT 3WXLA 1EKEA 1OQKA 3ENOA 4DEXA 1R9TJ 1FOYA 2G7HA 3LLRA 4Y7NJ 4LDWA 1BI2A 3ABUA 3P39A 2DFEA 4YIRX 1CZ9A 4M7AA 2XG8D 4LF8K 2P0WA 2IA2A 3M58A 4U7BA 4F16A 1KU3A 1KA8A 3GOXA 3X25B 1VQ9N 3ABTA 2VIXA 5L3BA 2OX7A 4PL7A 4Z94A 1VQPN 4LH5A 2BHYA 3UR3C 4JKGA 4H5WA 4EM1A 2F69A 3PJRA 3OL4A 1NM1A 1Q9XA 3JRFA 3L2WA 2YG8A 3H45C 3SWNB 4KB1A 3K5LA 3PX0A 1O7LA 3SAGA 4MQ9F 3RDIA 4LFCK 1Q86R 3BWGA 1RGIA 4MMKA 3G2BA 1EETA 2CS7A 3ECOA 3DKMA 3H08A 3W3DA 2HHHK 2AS5F 4XLNF 3UKGA 1SRLA 5J2QA 4JKCA 3VYTB 4B1RA 3CC4I 1VQ5Q 3WNGA 3RMDA 2EKOA 2P9NB 3R61A 3OS0A 3C6UA 3OOUA 3V9SA 4KULA 3K4BA 3J8AA 3GTLJ 4CRIA 3CCJN 3MP6A 4D0PA 4P96A 1FKOA 1RKWA 3I4NJ 3MKLA 5J2NA 4JLGA 2UUZA 2GA2A 2CREA 3JSCA 1T3SA 3CJCA 3B6PA 1D1AA 4I98B 4Q5SF 3LSTA 1Q86U 2R93J 3MKDA 2QTVA 1BA1A 1MH3A 1JRIA 1O57A 5FU6C 3BE3A 3VEXA 2YS9A 4AFQC 2HEQA 4E4HA 3IWFA 1B9FA 5KYYA 1OZ2A 1TL3A 3HSTB 2HDDA 4JI2K 4OWRB 1WYXA 5GJWB 3AVIA 2CT4A 2YJEA 3DKWA 4DEYA 1GOAA 1UTIA 4KUIA 1MWKA 4ELVA 1I6HJ 1K8AR 3W2WA 3LAPA 2X6SA 3QYGB 4WFAL 1M90U 3DAWA 2NNWA 4DSEA 1EV7A 5KYNA 4I99C 3UKRB 4OJRA 2P4WA 1XTDA 2PMZN 1KQJA 3ZQLA 3J81O 1F4KA 4CE9A 4CHYA 2V1QA 3AG4H 1HJOA 2WV0A 2KKOA 3V4IA 1UJYA 1BQMA 3V9UA 2EZKA 2GV9A 1X2MA 1E3HA 3GXOA 2LLKA 4HPQA 4HX7A 3KLOA 5CQEA 4UB8C 4OIRF 5BQTA 5FD6A 1LMZA 2HKNA 1USSA 1TLHB 3QPSA 4MTDA 3RKWA 5I2MA 4QPQA 4LD0A 1DPUA 1A31A 1U6GA 2HB5A 3E5QA 3BR5A 1JT6A 3WTSC 4NZGA 2O4IA 4P1WA 3A5OC 4QQGA 5GAEP 3HOYJ 3TL4X 2XY8A 5GMKi 4JN4A 4FISA 5DUKA 3WU1B 4CIGA 1W7PB 4KRTA 3GTKJ 3CLQA 2IP2A 2D1KA 4KTWA 2XHCA 3O3GA 2IPQX 5A2QZ 3RZDJ 3EZ5A 3GCMA 2ZWHA 4IG0A 4A3EJ 2M30A 3QYHB 1NBWA 5DMRA 5M1QA 4AILC 4F7ZA 1NGDA 1SMTA 1YS6A 3M5AA 2XO7A 3G4SQ 3SUPA 1K83J 2G8FA 1VA7A 1E7OA 5JFRA 2VPLA 5TISC 3K9TA 3WNFA 3SEQA 5ELZA 2V1XA 4FIBA 3T1BA 3E1YA 4V19S 4A3LJ 1OKJA 1GLCG 5AR0A 4DBFA 4Z0UA 5FLXE 4MNUA 5KYUB 1VQ6A 5L3EA 3JRDA 2PU9B 2CFOA 2A3SA 5CVJA 1QRYA 3O08A 2KJBA 4C8KA 3CCJQ 3E1SA 3JRHA 2Z33A 3BTIA 5ICFA 2BZYA 5L3GA 4KT6A 4H4OA 4OFHA 2BKDN 3LWIA 3CVSA 3O8MA 2MGQA 3JCMd 3FJ5A 1F5TA 2GZWA 1I50J 4EEFG 2CP2A 1U2VB 4DV4K 1OV3A 4C0DB 2KHOA 2QGUA 3ZSZA 1VQMN 4G7HF 5LJWA 1W5CC 4AHRA 1RDWX 3MXJA 3LA3A 1S72N 3CHWA 3EFOA 3MWMA 3VENA 4Z89A 3I59B 3GIBA 3WTZA 2ELHA 4C1NI 4HLYA 1RDCA 1X2NA 4FX4A 5GIOA 1Q1VA 1KG1A 2WC9A 2K02A 4LK1F 5AT1B 2EB7A 5C44J 1JUPA 3UIQA 3E9GA 4G6QA 3CCVA 3REBB 1TQIA 3SEZA 3MEDA 2BY0A 5K5QA 1WLPB 1RT6A 3NMZC 3PNVA 4JPBW 3I58A 3PUFA 2D6FA 3ZETB 3HRMA 5C12A 1S1NA 3H3ZA 2F2XA 2RA2A 3FMSA 5KYXB 3EGDA 1VI0A 3CC2A 4DSLA 3K5NA 1KGSA 2E19A 1ZN2A 4ANJA 4HKEA 3DEEA 2RF2A 1U5SA 1Y0UA 4Y13A 2IRFG 1X4PA 1W97L 4NCAA 4XU0A 2YR2A 3CCMQ 2DX1A 3AO4A 4XLEA 2HOTA 3ISNC 5K14A 4N0AC 4NC8A 3CMAT 1GOCA 1NLVA 2DPUA 3CCYA 3UA6A 2X3XD 3F21A 2KW4A 4B1UB 2JN0A 1F1BB 4PFZA 1I1GA 1F36A 1P90A 4YELA 2MH9A 3ATVA 5LGNA 2FYKA 2WTEA 3CMAQ 2ZNZA 3PNWC 3M6GA 3CCSN 1W1WE 1CF7A 3RSNA 1LJ9A 3KP7A 3CG7A 5DCFA 2CV1A 2ZJPL 3MECA 1MBHA 2YNHA 4AM7A 4D9JA 2OTJQ 2LJ3A 2KY9A 1LW0A 1YP5A 1GRIA 1YITQ 3A5LC 3T7ZA 3F6VA 4KN4X 3HZJA 1DKGD 1S72T 2HMIA 3NHNA 1EXQA 3MK6A 2JGUA 1A5XA 4GV9A 3QODA 3JB9G 4BY9C 1W36C 3BJ6A 2EH3A 5GADJ 2R5YA 1M4ZA 4BR2A 3JB9I 4LD9K 2A6EF 3VJPA 1JXBA 3MXMA 1JUMA 2G0EA 1IB8A 1TP4A 1M1KU 4A62A 3MVPA 1TUDA 1S72Q 1HPMA 1LB2A 1ZQ3P 1UCRA 4DQIA 2L0AA 1JXMA 2DQRA 3GMEA 1NGIA 1IGQA 3OTOK 4MFDA 4WQ4A 2QA4I 3PNTA 3P8HA 4MZTA 5HRPA 3A01A 4JAXA 5GAOn 2FRWA 3EH1A 1ZREA 2RB6A 2GF7A 3EFRA 4CF1A 1ZELA 3KK2A 1IKWA 2XHBA 1CLQA 1QGPA 2X6NA 4ZC3A 2NOJB 5IYCJ 1MMSA 1YBYA 3JAME 4CZIA 2ZCFB 2HVRA 2ZPIB 1BM9A 3P38A 2LD5A 2X4XA 3VFZA 3IV5A 5HNHA 3FK7A 5DD8A 4OMOA 2XC7A 3JV3A 1YI2I 4DV2K 1D9DA 3TO6A 4M77F 3OA6A 5F27A 3L2UA 3PIOA 1OISA 3NH0A 5CCAA 2LMDA 3A8LB 4C92A 4CF9A 3U4LA 2DFUA 2E3IA 4OVLA 4EMKA 3FHFA 1YITN 2DMOA 4YDUC 1D8JA 2NVQJ 3EGXB 3I8BA 1TQMA 1GLDG 3QG1A 3QEWA 1VQ4N 3ZEUB 5GAN5 4M7AE 4B8AB 4GLMA 5ADXH 1HW1A 2VT3A 5B5EC 1IW7F 1Q7YO 3ER0A 3SQ1A 4FJNA 3E9PA 3A4CA 4H8KA 4F3QA 3O9RA 1R59O 4IX7A 1I6XA 4YG2F 4JRPA 4M6YA 1VQOI 2CV0A 1S72I 5J8FA 1KK7A 1WJEA 1R00A 1QVUA 2YSQA 2ED1A 2ISYA 4L9NA 2VG7A 1Y97A 4M75E 1KD1R 2HMPA 2CUDA 4MQ3A 1YN8A 4II2A 4LF9K 4MO5A 4QIWN 3PQJA 1JKHA 1M8VA 3IAM2 1QVFS 1RL2A 3JB9J 5F64A 1K0SA 3DJCA 4DUYK 4DBQA 1B7TA 4CI6A 4PNOA 1I27A 2IJLA 1E6HA 1S7EA 3OSFA 4NYNA 3SQ2A 2JRTA 2G9WA 5LJ3e 4JDSA 4O5BA 4F9OA 1XC9A 3KIOA 4YOQA 4EJZA 2QYZA 4P9FA 4J7FA 3SZGA 3OW2M 3MCPA 5LMNK 4FOIA 1JKRC 4UY8O 2GBYA 1PKTA 5CVVA 3CQXA 5CR4A 4JHDA 2OPSA 4F14A 3HOVJ 2XF7A 1K8AU 3C0CA 3HPWA 1WJ5A 1JLBA 3R0AA 4PJJA 2VG6A 3RMQA 4BYYA 3I4PA 2WACA 4F3TA 3DKYA 2K2VA 2P4RA 1WJRA 2EYYA 1YJWQ 4ORZA 1W6XA 5HOOA 4CBWA 2BZTA 2VG5A 4FJMA 3ZSXA 2AKLA 3C3WA 4F2RA 4JJCA 5E26A 1BOTO 1H88C 2W0ZA 3L6QA 2KRCA 4CZMA 3E66A 2CGJA 3NVMA 1QCOA 2NWMA 4M45A 5HRRA 1Y96A 4YFXF 4LF5K 4CK2A 2M1BA 2ASOA 1WXTA 4KH1B 3NWTA 3THWA 2O9LA 4L0YB 1ZBXA 4PSXA 3CI5A 1VQPI 3K4JA 4XORA 1OKRA 2QW9A 2AT1B 2VI6A 1YQMA 3IFRA 3IMXA 1N25A 4HLXA 4CH7A 2LR8A 4JEPA 2EWSA 4EGYA 1VQON 4C5GA 2WBNA 4JD2A 5KE3A 3U23A 2K9GA 1NKEA 1KQ2A 4GVEA 2A61A 1WHMA 3RMAA 4DSJA 2V51B 2NVYJ 3FLCO 3E0JB 5CQXA 4ELTA 4A3GJ 1JT0A 2DF6A 1UWBA 1AKHA 4KHPK 4RTXA 3OYAA 3SWNC 1RLPC 5KN9A 1QZ5A 2EBIA 3GO5A 5D7UA 1KAYA 1YX5A 2DL5A 1QSLA 4M9ZA 1X75C 3PMIA 1Z67A 3RQ4A 2K86A 5AQLA 4C8QE 2RNAA 2RQPA 3KP6A 1X1AA 3H9NA 3ZSYA 3CCUN 4M7AD 1YJWN 3P8BB 4BQNA 3GBTA 2P9SA 1R23A 4PFPA 5GMKe 1Q82C 1XSXA 3CUQB 1N8RC 4IUTA 2K6DA 1JKQC 5F6FA 4FLVA 3QPLA 3K4NA 3C2HA 4JI4K 4A61A 3MWTA 2L7FP 2CGLA 3I71A 4WCIA 4HF0A 4BC5A 1Z21A 1V29B 3G6EQ 4F7UE 1EJ9A 2ZJPF 2KFZA 5D8LB 1LPQA 4M7AB 2OCEA 4RM3A 1L3VA 1NPPA 4FZYA 2L54A 3RESA 1Y71A 2ED0A 2EBPA 2RHZA 2HTJA 2Z16A 4M71A 3CD6A 2HKOA 2E2HJ 3VERA 3ZSQA 3H0IA 4CO8A 3OMYA 2O8EB 1VQKT 3CD6I 1YJNA 4JKAA 1NMNA 5IP6A 5KAIC 2ZZDA 4EATA 4E9EA 2O5RA 3A8HB 3PE0A 2HWVA 4KFCA 1BO5O 4KISA 4GY5A 2XB0X 4M9SA 1Y1VJ 2XASA 2QWMA 3M9QA 4X65K 3C2GA 5GAGJ 4XRSG 1BJAA 1RABB 4AIJA 5HK3A 4KJZA 4PKHA 5CPRB 1E0EA 1BYMA 2CUEA 3S41A 1YIJN 1W70A 1G3TA 4OGEA 2PEXA 4J5YA 2LYCA 2JVGA 1YIJI 4PKGA 4CEOA 9ATCB 1ZG1A 2R7UA 1JLEA 4I2OA 1JQQA 3IKTA 2WBMA 4KICA 4E0DA 1GLLO 1BI3A 3KTUA 1KD1C 3DTIA 1LAWA 1BHLA 2MWOA 1VQOT 4EZ9A 5LJ3g 3ZMVA 3PIPL 4AG2C 5EF6A 2QEXI 5C0MA 1WI7A 2GIZA 4U67L 3KEYA 1G99A 2HKXA 4NB5A 1WRJA 2JM9A 1FZPB 2R7YA 1SFUA 2L02A 2EGCA 4QWQA 1BGXT 2LKSA 3EN9A 2DKGA 2W84A 1MZBA 2M34A 3VSKA 2QKBA 2DY4A 3TU4K 4CA0A 2NNNA 4DQ8A 1A5WA 1WEIA 3ULEB 1S3XA 2BIVA 2K9LA 1VQPQ 1X6OA 4A2UA 4K2EA 3BDPA 1EWRA 1X3NA 1W2BM 1Q86C 5JICA 1TVRA 4G12A 4X9DA 3TQNA 4XKBA 1YQRA 2WAQA 4WTOB 3CDHA 4E7LA 2QM3A 4KMFA 3JCMh 4BU2A 4GW6A 1SEMA 4ILHA 2AQEA 1JKPC 3CXCP 2FNPA 1YWOA 3CC7A 1J7KA 4IEEA 1VQMI 2E60A 1JXSA 2F4VK 3L9FA 2L0KA 1YI2T 4JNEA 3H92A 4JK7A 3F3XA 3D6RA 5LJ3j 1K73R 4CEEA 3O8HA 1O4XA 2HQXA 3ABLH 5IT9E 4AIHA 4RMOA 5DLQE 4AC0A 4KUDK 4D6WA 4QLCU 1ATRA 3MKZA 4N76A 3S6WA 4B3RK 2JJ7A 1YI2Q 2ITGA 4B3TK 1OVQA 2OJED 4HVVA 5GAOr 1YXQA 4AYBN 1ZSGA 3VYHB 3ZT0A 4KHYA 5IN1A 1S6QA 3PSFA 2MK5A 4CERA 4OVAA 1XC5A 3IQLA 3MXIA 4XU3A 2ZGWA 4PCQA 4FLZA 2O03A 1W36D 1I0CA 1VQ6T 1SL1A 4ENKA 2HHXA 3NPFA 2YUPA 3LQRA 1BK2A 1RC9A 1T7PA 4C8QD 3LWLA 1P6RA 4M42A 4FJIA 4LF7K 4CXFA 3DB3A 2ZFUA 1NYGA 1EX4A 4FJ5A 2ZXJA 5L3CA 2WB1A 3FXJA 4FSVA 2YXYA 2NLUA 1GXIE 4HV6A 1TK5A 2DJIA 3U9ZA 2DA9A 3IS9A 4H0EA 4WFBL 4C8QA 4HV5A 1MD0A 2P9LB 2GXGA 3TARA 4B9TA 4AH9A 3EGUA 3AL0B 3R2XC 2BVLA 4DHYA 1TUCA 5AQNA 3OJSA 4XH5A 2LJ0A 1XSDA 2IS2A 3LWFA 2VASA 1XC3A 4JI1K 3PO4A 2ADUA 1MJBA 2E88A 3BF3A 4MO4A 1KLNA 1RR8C 1BA5A 5CKEA 4LIVA 2XGEA 2IGKA 6AT1B 3QERA 2JHJA 3O3HA 4FU6A 1Q1HA 3H3UA 1R49A 4EGZA 3A5MC 3RMCA 2XMFA 3PL8A 3BZKA 2O9VA 4ELUA 2ASPA 4BRGA 5GAGP 1ZKGA 3TOAA 2R7RA 2GELA 1BIZA 4Z4FA 2FB7A 1QHTA 4CEBA 2NOFA 3O9UA 4BQZA 2DDBA 5J2PA 4QVDA 1FNNA 3BTJA 3HOZJ 1EH8A 3WXJA 5E1XA 2HAXA 3CPWP 5JLWA 4QQ6A 4PUSA 5J4YA 3W6JB 3B8AX 1VZ0A 5A2QK 3SZTA 1GUUA 3EL2A 3HJFA 2W6LA 1XPXA 4IJAA 2QSGX 4ZGEB 2MC4A 2FVUA 3PFYA 1SFXA 1PUFB 3X20B 2ITMA 3EGDB 5T7BA 5DS9A 2HZTA 3WEEA 2F9WA 2FOWA 3GYHX 1U8RA 2E7XA 5F0HA 1XN7A 4ICLA 3KE2A 3MMYB 2R7DA 3MP1A 2VVKA 3P7NA 2NOBA 2Z5UA 2RJEA 4YOUA 1LDKB 1Z9CA 1G4DA 3CD6T 3DLEA 4C92D 3KYLA 1RPWA 5FLMJ 1TXQA 4F7UA 3DLLA 1WCMJ 4LK0F 2NS7A 2RI5A 3VWBA 3SAHA 4X66K 2F5VA 1J9IA 1E4GT 4IOXA 2DA4A 2JPCA 1M2VB 5IOZA 4XONA 4ESFA 2X74A 2DTIA 2F2WA 2X4JA 3OW2P 1NJIC 4Y91A 3VEVA 5ILSA 1OJLA 3ME9A 4DS4A 2K5IA 4M7YA 2ZMEB 1V5EA 2HNZA 1VQ4I 3WGIA 3NGIA 2E1OA 3WE2A 5IYDJ 3RKXA 3VS2A 1MIJA 1BI4A 3BDDA 2JA8J 3T19A 3OQ5A 5GMKl 4MFEA 3HP6A 2D4WA 1J53A 2ZPEB 2QDYB 4HOBA 2E4HA 3K5MA 3E9LA 3CCSQ 4DR7K 2HYJA 5GAN2 3HOXJ 4AIKA 1ZGAA 1B4AA 3H9QA 1LNWA 3FXKA 3HYFA 3CPFA 3EE8A 4N4OB 4J9IA 1VSKA 5J3LA 3NTKA 2COWA 1LVKA 2O8FB 4WK8F 4F04B 3NHGA 1QA6A 4CJUA 4AD9A 1KC8O 4M9XA 2W10A 4CZCA 1SAZA 4IO9F 1GXQA 3MQ0A 1N27A 3ALYA 1S29A 1IXRC 3DU6A 2E7WA 1MJAA 1U47A 4YPHA 1HOMA 2CQNA 4BXUA 1AA7A 1N33K 2O8DB 1YX3A 3RYPA 4E6RA 1DGWY 3K4LA 3L3UA 1VYVA 1JL1A 1SKSA 1T6SA 4DBRA 1K1ZA 2KISA 5I2SA 1R5HA 2D9TA 3ZL7C 5LJ5e 3I55N 2KP6A 4FSXA 2L3PA 3KP5A 2MBFA 4FWRA 1F21A 4FT2A 1Z1DA 1WVRA 1IZ1A 4N4IA 1M2OA 1KYZA 1MH4A 1JO8A 4DOWA 2A3LA 4FZZA 1Q7YR 2JM8A 1VQMT 3CXCM 2L9RA 3I0SA 3VQAA 3A8YA 5KYWB 2HOSA 3GBGA 2MYSA 2NVTJ 2MH2A 1EQYA 3HPOA 2CP5A 2EYWA 5GAMd 1YIJA 1WSIA 2W40A 4C2UA 5AQVA 2DPNA 1M3BA 1NG6A 2X85A 5JVTA 1PD0A 3F0ZA 1LE8B 2F4MB 5AQSA 4PJOE 2GCXA 5CZ1A 3C7NB 3ZPLA 4H0YB 3CCSI 4DV0K 3ZQHA 4BGDA 3CC2T 2K57A 2CUJA 2GBQA 2LY1A 4D8DA 4IKFA 4EMKC 2EILH 4RCBA 4L5GA 1SD4A 5IP9J 1DT9A 1SZ2A 1AD5A 1YJNN 4ESBA 1K73C 2M51A 3DV8A 3V9ZA 4DF4A 2YJFA 1H9TA 3ID6A 1N39A 2V1UA 4W5NA 4JS5A 3LZJA 3HJEA 1YRNB 3CCMT 4AWXB 1KONA 4M7DG 5IT3A 4CJSA 5GANj 3S1MJ 2KK4A 4HCKA 4Y1CA 4DFMA 2VQHA 4LN2A 3OH6A 4HX8A 5LMUK 4NYFA 1M90C 4CGHA 3J7YP 2BVMA 1I94K 1I8FA 3SD4A 2JT4A 5IHNA 2PBIA 1JLQA 4FVMA 5KN8A 2HGCA 1KQSM 1WEGA 1VQ8N 2HDAA 4BDYA 4A57A 3IRXA 4PJOF 4YOXA 2GTJA 3B73A 5GAEJ 3VQCA 1TTYA 2LC4A 2FZGB 4II3A 2MFZA 3HTUA 2FZKB 4QS9A 4I7HA 1VQ8Q 2CP7A 1ZUKA 1JCFA 5E8IA 5GAN4 4CIEA 3NGPA 2JWLA 1NJXA 1HMVA 1YITT 3EY1A 4JKGB 3TTDA 4CEAA 1N5YA 1Z7LA 4CUGA 1RUWA 4BHPA 2AHQA 4U7DA 2E10A 3FSPA 3BG9A 2XHIA 1O1WA 4CCHA 2JOYA 5GAN3 3WG9A 4RB0A 2JUGA 3O4WA 1WNLA 3CBMA 2QK9A 5K5OA 2BTFA 2OTJI 5B8HA 3NTIA 6PAXA 3GWZA 3H5NA 2MAMA 5LJ5h 1FC3A 3EUAA 2FOKA 3OWTA 4B9XA 4V2SA 4L9TA 4JKEA 2KZZA 2CDTA 1FX7A 5AQRA 2NRTA 3S9HA 4CYCA 3OOPA 2V9VA 3WE3A 3GVAA 1IN4A 4KT0E 1W4SA 2HR3A 1KHCA 4BR0A 1GLEG 4BEHA 4CZEA 4NUBA 3CJ9A 1XMOK 2PNIA 1NGCA 4ISEA 4DJAA 4XQ3A 2OANA 5KI6A 3GOIA 1WN7A 2BZXA 3P5JA 3FXUA 3ZFJA 5I22A 4H5NA 5IY5H 2IVMA 1YJ9A 2X6YA 2XGDA 3FB9A 3AARA 3AVMA 3HVRA 1X9MA 5DTDA 1QPIA 1N32K 4HXJA 3K9JA 2KQ2A 2A6HF 2FNAA 4FLUA 1OR7C 2HZDA 5GAHJ 3MX5A 3CVTA 2D1VA 1Y39A 1D3YA 1OH6A 4YFUA 4BQOA 5J47A 3FC3A 1H89C 1YVUA 2F7TA 3LAJA 2IEKA 2XDDA 4RB1A 4P9UA 1AKHB 4RWTA 2KKZA 3QEPA 1HKBA 2RM4A 1VQ4T 2DO7A 1TWAJ 5AONA 1SVMA 2KQRA 5DUIA 2EA4A 4OKJA 5JLHA 1VSHA 3TSPA 2KLAA 3IH7A 3KEOA 3K9KA 1LDJA 3ULQB 3HYIA 3J7ZO 4BS9A 1CGPA 3L00A 4KREA 4DTXA 3LDNA 1VQLN 1S1UA 2WFBA 1TT0A 3K6GA 3QU6A 1WQ2A 5EG0B 3F8NA 2QA4T