3OYLA

Crystal structure of the pfv s217h mutant intasome bound to magnesium and the insti mk2048
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 111
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oylA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oylA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oylA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oylA03
5C25A 2D5RA 1D9DA 3CM6A 2E5QA 1G15A 1TKXA 1WLJA 4KHWA 3H08A 1NK5A 3KD1E 3KLHA 4I9QA 4C5EA 2KW4A 1T05A 3C94A 2MWPA 4QQGA 1VSFA 1LV5A 5IN1A 3T3FA 2X4YA 2RJEA 1U4BA 1DTQA 2PQWA 1RBRA 1T8EA 3I0SA 3OA6A 1JLFA 1WN7A 2HQXA 1ZBHA 4CK1A 4N56A 1Q9YA 5HRSA 3CYMA 3EZ5A 3QJ6A 4CJWA 3FLGA 2RJCA 1ITGA 3CFPA 1ASWA 3MECA 4C8KA 4Z4IA 5C42A 2IC3A 4CE9A 1X9WA 3AO3A 3K5NA 4ZTFA 3EYZA 1SL1A 4CJ4A 3TAQA 3AVGA 3TAPA 3V1QA 4GW6A 1QE1A 3ZT1A 2BUDA 3LWLA 1U47A 4KTWA 1S6PA 1WSJA 3QLHA 2P5OA 4RG8A 4A4GA 3HPOA 5K14A 2OYQA 3F70A 4OPKA 3QINA 3QBYA 3QESA 4K8ZA 3LGFA 1XHXA 3O3GA 1VSJA 1TV6A 3OYLA 4XIUA 3MXJA 2DTUA 2JLEA 3D0PA 4FXDA 3OY9A 1IO2A 4DWIA 3B6PA 1HYZA 2RHYA 5J2MA 4FM2A 3OYHA 1SUQA 4CIGA 2GFUA 1YTUA 3DOKA 4CFDA 4EDUA 2B5JA 2F8TA 2BGGA 3V1OA 3K59A 4JRPA 2OA8A 1NJYA 1MU2A 4FVMA 3OVNA 4C5IA 3RMCA 4CGIA 4DTNA 4Q5WA 4CEBA 4B9XA 1UAXA 1B9FA 1L5UA 1XI1A 1BI4A 3KJVA 2X4XA 3ASKA 1WSIA 4DTUA 3DYAA 2Q3SA 1XNIA 4IFYA 4E7KA 3OYGA 2ITGA 4RW8A 3QO9A 4LY7A 1SKWA 3NTKA 4O4GA 3S3NA 4CJSA 1BQMA 4CJVA 3AVCA 4CJFA 3P83D 4KFBA 2FBTA 3IS9A 4YNQA 4W5NA 1NK6A 2RJDA 3KUFA 4E7LA 1VSLA 2E6NA 1HQUA 4KKOA 4DQIA 4Z4CA 5M9OA 1HPZA 3KTQA 4CHQA 2M0OA 2HNDA 3O4QA 3EAEA 1VSDA 3HXMA 1RTDA 1YT3A 4PLLA 4DU3A 3F9KA 2F5KA 4C8NA 1R0AA 2VWKA 1ZBLA 3QIPA 2ETJA 3VQPA 2X74A 1XWLA 4M3WA 3MP1A 3VN5A 2YNIA 3ZSOA 2XRIA 3SCXA 1IKYA 3V6DA 5E41A 1IKWA 4DS4A 2F8SA 4BWJA 1LWEA 3VQEA 4ELVA 2LTOA 1T7PA 3NDKA 2GBZA 3AVKA 4JRQA 4W5TA 3LPUA 4OKKA 4M45A 4K8XA 2G8WA 3RWUA 3LP1A 3NF9A 4OPJA 3K58A 4G1QA 1QSLA 4E7HA 4DU1A 5J2PA 2BE2A 4B9TA 1KHCA 4CF2A 1VK0A 4OLAA 1NJXA 3QNOA 3ZT2A 3S3OA 4KV8A 1NJZA 4KHQA 1JLGA 3LGLA 4EP5A 3SJJA 3OS2A 4II1A 5KCHA 1NK0A 4L59A 3KK3A 4ELTA 2HB5A 1Y97A 1NK8A 2X35A 4DF4A 1RDCA 1OZ2A 1TKZA 4J2DA 4CEOA 3NNQA 4C8LA 4FW1A 1S1TA 4KREA 2ZQBA 5FRNA 4BDYA 1RTJA 3O4NA 3ZT4A 2Y1JA 3OYCA 2RHUA 1S9GA 4CJUA 1JLCA 2DAQA 4NZGA 5C24A 2RI2A 3QNNA 5CY4A 3H8ZA 3PUFA 2YV0X 4CHPA 4IDKA 4TSXA 3OYIA 3KLIA 5CZ1A 2R5AA 1RTIA 1Z25A 3OMCA 2WOMA 3DOLA 3LANA 5I3UA 4Z4FA 4CGHA 1RILA 3KK2A 4CHOA 3RMDA 3LYIA 3Q1JA 4IFVA 1RDBA 1N6QA 4ELUA 1DLOA 4HUFA 3RRGA 2PYLA 5SZTA 2R5MA 4DFJA 5J2NA 3AVBA 3PX6A 4HCBA 4O0IA 2OZSA 4FLVA 4CF9A 2OPQA 2IS3A 3LAMA 3P8HA 3QIOA 3VQDA 3U6FA 4I2PA 3HT3A 4HCZA 4FJMA 1BHLA 1IKVA 3SPYA 4IUUA 5KGXA 4B9MA 2XY5A 4B9UA 3F73A 1RDDA 1RBSA 1JXBA 2HHQA 3CEYA 4KHYA 4FJ7A 2JGUA 2G3RA 3T19A 1Z26A 4J2AA 1U04A 2KTQA 4H4OA 3HK2A 3K5MA 3L2VA 4E19A 4I9LA 4DFMA 4DSJA 4N76A 1GOCA 1JLAA 4BDPA 4OGEA 2YRVA 4LSNA 3CM5A 3G10A 2KQ2A 1ZYQA 4FJIA 4FM0A 3VQ9A 2Y1IA 2HMIA 3K2PA 3AVNA 4FZZA 2EHGA 4FJLA 4CGFA 3V1RA 2WONA 5KRSA 2P51A 4ZHRA 3ITHA 3VA0A 4DQRA 2LDMA 4B9WA 1JLEA 1W0HA 3ZSYA 3C6TA 2R58A 3C6UA 3GOXA 4HTUA 4CGJA 4RW6A 3TAMA 4PQUA 1VSIA 4Z4GA 5HP1A 1C0TA 3KKSA 4ZTJA 5SWMA 4CK3A 3OMGA 1QTMA 4O5BA 5JS2A 2EQUA 3PX4A 3RTVA 4OKEA 2HNZA 1RT3A 4FLYA 3PMTA 4CFCA 1SSFA 5D6YA 4BACA 1Q9XA 3HP6A 2LCCA 1WJSA 2XK0A 4DFPA 4OKJA 4FJJA 4QOZB 2XHBA 1EETA 4PWDA 1REVA 1CLQA 1WJRA 2OPPA 2Z1HA 4W5QA 3MEAA 4CGGA 3NF6A 4DTSA 1LAVA 5IAYA 4FJXA 3SQ4A 4CJRA 4W5OA 2QKKA 2B8AA 4QVZA 4OVLA 3NHGA 5KTQA 4OLBA 3L2QA 2HNYA 3FEOA 1NKCA 1MHNA 3O3HA 3O8VA 4O44A 3FFIA 5DMRA 4M3UA 1BL3A 5HRRA 3V9WA 4M41A 1J54A 4RW9A 4QAGA 2IAJA 3V9UA 2KFZA 3LZIA 1S1UA 3VQ6A 2GUIA 4FLZA 1HNIA 3NFAA 2FBYA 4CECA 3B6OA 1S1VA 3HP9A 3DLEA 3META 1S6QA 1WGSA 4E1NA 4CK2A 3TWHA 3KD5E 2P5GA 5HROA 1OZ3A 3CFOA 3TR8A 4CEQA 3HM9A 1OYXA 4F8RA 3L2RA 4FJ9A 3K57A 1IG9A 4FJKA 1KFSA 2O4IA 4FJ8A 1EX4A 4KB0A 4EZ6A 4C5HA 3BDPA 3ISNC 3TABA 2JTFA 4YFUA 3AA2A 2EKOA 3NBPA 3NCIA 4FLXA 4CFBA 4Z4EA 4N4GA 4AHCA 2G8VA 2BANA 1NOZA 4HCCA 4FJHA 1DTTA 2PY5A 1X9SA 1HRHA 4FM1A 3NF8A 3SI6A 4NCAA 3ZSQA 2RPIA 4HUEA 4N4HA 3AVAA 3LZJA 3VQQA 3NH1A 1JLQA 3MP8A 2EQMA 3QKJA 2YHAA 2O4XA 3VQCA 3ZSVA 4CIFA 4KRFA 3ZEHA 3TARA 2OPRA 2K3YA 2XY6A 3MAQA 1KLNA 3OYJA 1HNVA 1HYSA 1KCFA 4CF1A 3V9XA 3OJUA 3VQ4A 3DRPA 4CEAA 4N41A 3UT1A 1KTQA 3C95A 3RMBA 3OYMA 1XHZA 3QEWA 2HHVA 3LP3A 3SUQA 1YVUA 3DRRA 4M3ZA 3PV8A 4DSLA 4FZXC 2O4GA 4IUPA 2B6AA 1RNHA 4GY5A 1J9AA 3LP0A 4CGDA 1LAWA 5KH6A 3SZ2A 4CCHA 4OVAA 3IG1A 1JL2A 4ID5A 4BE2A 2HVIA 2R57A 1JLBA 4O55A 3QERA 3DRSA 3LALA 3OYAA 1C1CA 1D5AA 3VQ7A 1A5WA 4DF8A 5KGWA 1TVRA 2DY4A 3M8RA 2JZ2A 4H4MA 1KLMA 4IUQA 4DFKA 1C6VA 5I42A 3L3VA 1RTHA 3ASMA 2VWJA 4DSEA 3L3UA 4KPYA 1ZBFA 3VQ5A 1YTAA 3AVMA 1LW0A 2HHWA 1QSYA 5D6XA 4R5PA 4F3OA 3LAKA 1VRTA 1BI4B 4DTOA 2M16A 2XO7A 4KHNA 2K3XA 1IH7A 1BQNA 1C1BA 1NKBA 3DI6A 1UWBA 3HL8A 2FC0A 1L3TA 4CFAA 4DTMA 2BKDN 4CJPA 1TAUA 1EP4A 4FU6A 1TK0A 5HRPA 4C8MA 3A2FA 4BWMA 1C0MA 3MP6A 3QETA 1VSKA 2HVHA 4BD3A 3NTIA 1TK5A 2HHSA 3TANA 5EU7A 4CHYA 3AA3A 4AHVA 2D9TA 1C0UA 3VQAA 2HHTA 4FJGA 4AILC 3HPHA 3DM2A 1A5XA 5D6WA 4IG0A 4J2BA 5KE3A 2EQJA 3OYDA 5T7BA 2XY7A 3RR8A 4AH9A 5C6SA 3OB9A 3LP2A 4NYNA 2GV9A 4W5RA 1JL1A 4DQQA 4DQSA 3PO4A 3AVFA 3OYKA 1WSGA 1VSMA 2Z1IA 1J5OA 2RHXA 3NAEA 3NGZA 3E9GA 4CJ3A 2KZMA 4CJTA 2KZZA 3H6ZA 4B9SA 4A4FA 4LD6A 1LWFA 4KAZA 4IG3A 3RMAA 4X34A 2ZD1A 3OYBA 1X1PA 1N5YA 4BE0A 4CJEA 1ZBUA 2NUBA 4N47A 1Q8IA 3WNEA 4E7JA 4FK2A 4LD0A 1A5VA 3V9SA 4JS4A 3NF7A 5D3GA 4CESA 1QQCA 2E6LA 1IKXA 1LW2A 3U3GA 3QEXA 1RT1A 1D8YA 3M9QA 3NGIA 2IOCA 5CYQA 1WNSA 3AVHA 1NK9A 4Z0UA 3V9ZA 2PYJA 4PLIA 3PNWC 2A1SA 4E3SA 1TAQA 1TKTA 4KI4A 4CJ5A 1RT4A 4AHTA 1EKEA 3UIQA 1S1WA 3KK1A 3DB4A 2HHXA 4M42A 4PUOA 2VG5A 3WNHA 1CXUA 3HJFA 4Z4HA 1S9EA 2YKNA 3AO4A 2W42A 3ZSZA 1FXXA 2CKKA 1WAFA 4GMJB 3M8QA 3DB3A 2RKIA 3M8SA 1WAJA 1BISA 2E4LA 3SV3A 1L3SA 1NKEA 3SNNA 3NGYA 1KVCA 2QKBA 3NTHA 4DTPA 1S5JA 1CZ9A 1RI0A 4B9LA 3P8DA 4C8OA 3DLKA 2ATQA 5J1EA 3AV9A 3DLGA 4CEZA 3M8PA 1SV5A 4JS5A 4F2SA 4PL6A 4DMNA 2XDPA 1J53A 2E6MA 1RBVA 4CERA 1D9FA 2GFAA 3C4SA 3OS1A 4CEFA 1F21A 4N5SA 4KTZA 2KFNA 4DSIA 4KTQA 2YNFA 1B92A 4QW2A 4B9VA 3OYNA 3KIOA 3O3FA 1S1XA 4B8AB 3CQ8A 4CEEA 3SD4A 2G8IA 1RCHA 2D0AA 2Z1JA 2AJQA 5CYMA 3MEWA 4FYDA 4B08A 3LPTA 3OJSA 3HO1A 4CEDA 4L8RB 4Y1DA 5KRTA 4DTRA 4F4KA 4ICLA 4F3TA 3MO8A 1VSEA 1HMVA 2FBXA 1FKPA 2DIGA 4OJRA 3VQBA 1JKHA 4Q0BA 2X6SA 1BCMA 4DG1A 4HVJA 4CHZA 2X78A 4CJKA 3OS0A 2A1RA 4PA1A 2LSNA 3P1GA 1K6YA 4CF8A 3E9FA 3HVTA 4DSFA 3JYTA 4KHUA 3KLEA 3DLBA 4CRIA 3ZCMA 3OYEA 3DMJA 2WACA 4Q5VA 1SL2A 2Z1GA 3PO5A 3L42A 4RG2A 4DQPA 3L2UA 2QXFA 3VA3A 3UWNA 4LSLA 4E0DA 1UA0A 3SQ1A 3V81A 3IRXA 4FL6A 3SQ2A 4WE1A 2VG7A 4JLHA 3ZT3A 3OQ5A 1G5VA 1L3UA 1TL3A 3HYFA 2HHUA 3MEEA 3S9HA 3K5OA 1C1AA 2BDPA 4M3YA 4IKFA 5HBMA 4FJ5A 1EXQA 4OGCA 1KSPA 4KO0A 2VYTA 3D45A 2QQRA 2D0BA 2F96A 4I7FA 1NJWA 3SQ0A 3L2WA 5C0MA 2MWOA 1NK7A 1FKOA 3RRHA 2DFHA 4O0JA 1CZBA 3ULDA 1FK9A 1N27A 3E01A 3NE6A 4KB1A 4PY5A 4DTXA 5KE2A 1H3ZA 2X6NA 3LX7A 3SV4A 3FC3A 1U49A 1RBUA 4IUVA 2OZMA 3MEDA 1T03A 4E7IA 3SUNA 4QQDA 2BIVA 2EFIA 1WJQA 3QIIA 2YNHA 1TGOA 2FBVA 4BE1A 1GOAA 2M1HA 3PMIA 4B9NA 1B9DA 4NYFA 4FZYA 1GOBA 3AVJA 2RI5A 1TK8A 2PZSA 2HW3A 4MFBA 4IURA 5FRMA 3CG7A 4CHNA 4UC4A 1CXQA 3IAYA 2LVMA 5J2QA 2RO0A 2D0CA 4M3TA 3THVA 2DIQA 4QQ6A 5JS1A 2EQKA 4FJNA 4E1MA 1QS4A 2OPSA 4HUGA 3ME9A 1BIUA 3ZSWA 3SPZA 4DS5A 1U45A 1SKRA 1ZBIA 5HRNA 2YHBA 1WSEA 5J26A 2G8HA 4CF0A 2P0KA 4FK0A 1BIZA 3PY8A 4FCYA 3LDSA 1ASUA 4DTJA 3S6WA 2I5JA 2DFFA 3LH0A 2RF2A 1SL0A 4DU4A 4IUTA 1RT7A 3I0RA 2B4JA 1RT2A 2DFEA 4GVMA 4BDZA 2RHZA 1BGXT 4HHTA 3KLFA 1QSSA 2L89A 4EZ9A 3ZSXA 4FLUA 4FK4A 3L8BA 3AO1A 1TL1A 1UA1A 4B3OA 2QK9A 4A4HA 1VSHA 3TI0A 3MEUA 3MEVA 3AO5A 1L3VA 3WNGA 4NCGA 1SKSA 3ZSRA 1KFDA 2LRQA 1X9MA 2O4XB 1RT5A 3DLHA 3NH2A 3RR7A 3I8DA 3FDRA 1KVBA 1WSFA 2IG0A 4NCBA 4NS5A 4AHUA 2IDOA 3LLRA 1O1WA 4J2EA 5KI6A 1RT6A 2X4WA 1TKDA 4DLEA 2ZE2A 4CJLA 3SYZA 3G0ZA 3PX0A 2EX3A 4AHRA 3EY1A 3V4IA 3BDLA 3K5LA 2YKMA 1BCOA 4H8KA 1ASVA 3T1AA 3HSTB 4CJQA 4FLWA 3QEVA 4E89A 3HPGA 3S3MA 1KVAA 3U3YA 4I2QA 4RW7A 3PFSA 3JSMA 1W9HA 3TAFA 3QEPA 1RDAA 4B8CA 4QCLA 4AHSA 5CIUA 3KLGA 1NOYA 4M3RA 1OI1A 3WNFA 5HLFA 1I3AA 5FDLA 3AA4A 3AVLA 4M3XA 3QEIA 1HQEA 1WSHA 4FW2A 3HVRA 3CFRA 4UQGA 3NH0A 2HQEA 1HYVA 4Z02A 2YNGA 4LH4A 2G8KA 3MXIA 2RJFA 4C5GA 3LWMA 2G8UA 5J39A 4A4EA 4N4IA 2FHDA 4RW4A 3VQ8A 2RHIA 2L3RA 3OYFA 1XC9A 4IBNA 5CZ2A 2RI3A 4Y1CA 3SUPA 2IGIA 1JXEA 2P1JA 3AA5X 2L8DA 2VG6A 4FLTA 1RBTA 1VRUA 5KCOA 4CIEA 2G8FA 5FROA 2RN2A 1U48A 3KKRA 1NK4A 1QHTA 2XY8A 3P5JA 3AVIA 4KHSA 4ID1A 1LWCA 5DK5A 2GF7A 4DLGA 4LH5A 4KI6A 2R7YA 4DSKA 4EP4A 1I39A 1KRPA 3TAGA 1HJRA 2QQSA 3DLMA 4F2RA 3ZT0A 2NLUA 3TAEA 3ALYA 3SUOA 3MEGA 4MQ3A 3MXMA 3DLRA 3AO2A 3BGRA 1UOCA
chains in the Genus database with same CATH superfamily
1PNJA 5C25A 1HW2A 2E5QA 2CT3A 1T56A 1HDDC 2X48A 1NK5A 1WHMA 1JUPA 1IBKK 3FFKB 4C5EA 3CP2A 3FX3A 3A5MC 2DW4A 2MWPA 4QQGA 5CKEA 2AKLA 1BR1A 1DTQA 2ZPFB 3ERMA 1N36K 2CP6A 1RBRA 3SHFA 3KWIA 5LHGA 1TBXA 3OA6A 3F72A 3V8JA 4JJBA 3GTPJ 3ATUA 4FWOA 4OAYA 3MCZA 4N56A 4FWMA 1U6ZA 3EZ5A 1NHAA 3QJ6A 1Z05A 4CJWA 4F16A 1WSUA 2P9SA 2HMAA 5KQDA 3CFPA 1U3EM 4UUSB 1YITI 4XN3A 4W1UA 2EIJH 4C8KA 4Z4IA 2K9SA 3GWZA 3O9TA 5C2FA 1R0BG 1X9WA 4BH9A 2DTZA 4YELA 3EYZA 1SL1A 1WI7A 3AVGA 3TAPA 1NEGA 3CMEA 4RS8A 3KZBA 2QTXA 3ESWB 2VBYA 3M4YA 4WF9L 3R2XC 4RG8A 2VCPA 4M77E 3HPOA 5K14A 1V4SA 2E4HA 2Q0UA 4DCHA 4OPKA 3QPHA 2EFQA 2WB1N 5MLCQ 5M5XJ 1FC3A 5HK3A 3LGFA 3O3GA 2CSQA 1GXPA 2EB7A 1PD1A 1QVGA 1KYWA 1K73U 4UNOA 2D1KA 3MXJA 4XIUA 1KU3A 3D0PA 4N0AC 1GT0C 2O2OA 1IO2A 4HW0A 4QPOA 5J2MA 3GO5A 1OR7C 1XTAA 1EH8A 4BC3A 4XTUA 4XK8E 4XQ3A 4M3EA 4CFDA 2CJJA 2B5JA 4KN4X 4PJ0C 3ONQA 4EMKA 4B3XA 2OA8A 1QZYA 3ZBDA 2E20A 2LH9A 1N25A 4Q5WA 1UEBA 4C8QA 1KG2A 2O3FA 3CC7A 1ON1A 1UAXA 4HNUA 1EO1A 1ZBXA 1L5UA 4RGSA 3HC7A 4LLNA 5AONA 3KYDB 1K0SA 2QWLA 2IA1A 4HQMA 4XEIA 4IFYA 2MGQA 2XMFA 4E7KA 5LFAA 1Z3XA 2V79A 2ITGA 4EV0A 2EA2A 4XM3A 1SRMA 3GNGA 2NRHA 3S3NA 3VS4A 3VMFB 3JV3A 2L9NA 4CJSA 2LLKA 2K86A 4IO9F 4HNVA 3AVCA 3QWXX 3LH5A 2Z99A 1Z67A 4UOBA 1RLQC 4MDBA 2BY1A 1HQUA 1Z3YA 5GAGJ 1K73O 3HM5A 5M9OA 2ZF5O 4R0KA 1KQ9A 3VRZA 3IH4A 3FF5A 3ZRGA 1PU6A 1FOYA 1O3RA 3G4ST 3ZCOA 1PRMC 1BB9A 1OCOH 1U9NA 1G83A 3AGKA 3O4QA 5TRDA 3IH7A 4BRAA 5GJVB 3HXMA 1RTDA 2XPVA 4PLLA 2K2VA 2NUTB 3ROUA 3NRVA 3CCSI 5IOYA 3QIPA 4LE9A 3IKVA 2NOLA 4MO7A 1XD7A 1OKRA 4X66K 3H5AA 1KU2A 2VJ4A 1ZGJA 4M3WA 2Q2EB 4XORA 2YNIA 4QS9A 1O7LA 3CDHA 2DTHA 1LWWA 3G4SN 5E41A 3F0CA 2LF7A 1LWEA 1YFHA 4EHTA 3M0QA 1D3YA 4WTOB 3NDKA 2VGNA 4EAHD 4C0ZA 3LFUA 4AYBN 5DV5A 4HT8A 2WAQA 4W5TA 1M5Q1 4YOYA 4IPAA 4MZTA 3FMQA 5GMKi 2E5ZA 2P4WA 3CF2A 3Q9VA 1GRIA 4FT2A 3NF9A 2DM1A 4OPJA 3K58A 3H3OB 1N33K 1T08B 3I33A 1VRLA 3I0TA 5LJ3j 1WEIA 2QG9B 3PGGA 4EMGA 3D6RA 2EIMH 1Y0UA 3A8MB 4ELYC 2ED0A 3P39A 3ZT2A 4KHQA 1UGQB 3EG3A 3SJJA 2DN0A 5DM6F 2IS2A 4II1A 1NK0A 2AHQA 1MBEA 1W5CC 1K6OA 3VOVA 3F8BA 1NMNA 2X35A 2MIOA 1VIFA 1TKZA 4J2DA 4CEOA 1N8RR 1KEAA 4LDVA 3G7ZA 2XB0X 4YOTA 2CMPA 1WI9A 1LCKA 1KK7A 1NTCA 5FRNA 4BDYA 3O4NA 2NXNB 1BBZA 2LC4A 3EDPA 3BG9A 3HUGA 4HXJA 1MBKA 4YOWA 4JYAK 3OOUA 2CO5A 3E3VA 3H3VK 3QNNA 2YV0X 2HVRA 2OI3A 1WHJA 1MZBA 4XQFA 1DKGD 4C2TA 3HGGA 3CUOA 1D09B 4DUYK 2FF4A 4BRGA 2M87A 1QW1A 4CW7B 2ASOA 4NB4A 2FF3B 2HBJA 2IIRA 1RRJA 4L5GA 3VYRB 1PD0A 1ZRFA 3CCRT 4CHOA 3LYIA 2E34A 4B1RA 2QKLB 4IFVA 4EJWA 5GAOr 5CKTA 4ELUA 4PJMA 4WFNL 1M3CA 1EBMA 2DL8A 1B8IB 1QKXA 2J6OA 3A5NC 2ASPA 4HUFA 3RRGA 3KFVA 4GV9A 2V7ZA 4M7AF 3H41A 1IN8A 3AVBA 4QS7A 4WFBL 3ZOBA 4WXDA 3G3ZA 2EPFA 4JKEA 3ZQFA 1AWOA 1SF9A 2F48A 5K5OA 3LAMA 5J1RA 3P8HA 5FLXE 2KP6A 5J47A 2DMQA 1KQ2A 4EA4A 3TO7A 1JBMA 4JI0K 3HT3A 3K7AJ 2HQNA 1IKVA 3A0BC 5KK1A 3CCRN 1OMIA 4IUUA 4QVDA 3VPZA 2RMOA 1N39A 3UA6A 3F6VA 3G71T 1DT9A 2EYWA 3WG9A 2YLCA 3T19A 3CC2T 3W2AA 4OIOF 1TNSA 2E1ZA 4FYYB 4A5MA 1NM7A 2H09A 3L2VA 4E19A 3DXKB 1ZREA 1XSVA 1WHLA 2KROA 2VJIA 3H92A 5LJ3h 4B09A 1WH5A 5CQYA 3NPFA 1GOCA 2PBDA 3CQZJ 1PVSA 2ZPBB 1H1VA 3KP6A 4FJIA 3G71N 3K2PA 3AVNA 5EX5A 3OBWA 3V1RA 1HU0A 4ZHRA 1XNRK 3MD2A 3ITHA 2W03A 3VA0A 5KYWA 3CC2N 4RGXA 5LL6Z 4HG2A 2CQ7A 1JXSA 3JSOA 1TUGB 1FIAA 5LJVA 5CQEA 1W0HA 4U88A 5LGTA 3ZSYA 1J5EK 1XMAA 2H3EB 1VQ6Q 1YJWT 3CCET 1GFCA 4JUVA 1Y1VJ 5KHDA 2IBDA 1PUEE 4J9EA 5AR0A 2YT6A 3GOXA 3FXOA 1MMDA 4FASD 4RUGA 2GGRA 1W1WE 1XNQK 5J1YA 4BROA 2WSCE 4CSWA 5HP1A 3H3ZA 1AZEA 1C0TA 5KYUB 3DLLF 4ZTJA 1CKBA 4BY9C 5LJ5g 1FBQA 3L09A 3VF4A 1ZBJA 2JT1A 4LD9K 4LC9B 2OA4A 3RZOJ 4YFKF 2EQUA 4I0AA 2EIFA 4OKEA 2IW5A 1OH6A 4GXOA 4DA4A 1VQ4Q 1RT3A 4LN2A 1BC7C 1SSFA 3DXMB 1YJWN 3CCEN 2OJED 2V26A 4BACA 3VS5A 1KFZA 4C1NK 1UTIA 2MBFA 5GAN6 3GFMA 2V1UA 1Q9XA 3C12A 3ZLJA 3Q7CA 5JVHL 2XAHA 2WV0A 3HP6A 1GVJA 1ETWA 2LCCA 4B3SK 2OC6A 1RAFB 3CI5A 3SEQA 1REVA 3BY5A 3TO6A 3ID6A 3MEAA 1BI2A 4CGGA 5ADXA 4MFEA 1LAVA 4FJXA 3SQ4A 4CJRA 2B8AA 1R00A 3C18A 3QHSA 1MWKA 2DA5A 3U2RA 3JRFA 4N0AA 3SDZA 2R7FA 2B7EA 1NKCA 2DAOA 1OR7A 3D2FA 3AG2H 2G7UA 3O8VA 5AFUH 1NGIA 2IS1A 4CA0A 5K7FA 4X1EA 3DU5A 5FLXO 1BL3A 5HRRA 2QVOA 3JRHA 4M41A 3SLCA 2MC3A 3V4GA 1S8NA 1TQPA 3PFYA 4EATA 4ESJA 1LOTB 2KFZA 1OU9A 2X3WD 4FLZA 3ABMH 3VUZA 2J06A 2F6CA 3GTKJ 3JR9A 4M7AG 4CECA 3B6OA 4KH1B 3L1AA 5LEJA 1S1VA 4BYYA 3AG1H 5AN4A 1WZOA 1DJ7B 1S6QA 2JA5J 3TW6A 3H0FA 2BGCA 3WT0A 2E2JJ 4XKCA 2KDZA 4CC4B 4OAZA 1GLJO 1NGBA 3CVSA 4N0BA 3Q7BA 1VQ9I 4CEQA 2DK5A 3WGGA 1OYXA 2VQHA 1C6VX 4A3BJ 2QLZA 4IX7A 3PO3J 3FK6A 4CZMA 3MMVA 2KDSA 1Q7YR 2IGNA 1UGRB 3BT9A 4JP0A 4M75C 2DNUA 2KHOA 4BHBA 5IYCJ 3TABA 2JTFA 3AA2A 3NCIA 4CYCA 4CFBA 4A0XA 3CCQI 5EG0B 4ILHA 1YHQI 5LMUK 1RUNA 4HCCA 1N78A 5LEKA 4H5NA 1N8RC 1IN6A 2L7KA 1VQOI 1FTTA 1HRHA 4EFHA 2P9PB 1UECA 3NF8A 2E6ZA 3RKYA 1IV8A 5A2QE 3DLLL 5BPDA 2RPIA 1Y7XA 1CF7A 3HDDA 3RCOA 2DL4A 2VBXA 4I99C 2YHYA 1WFXA 4FYXB 4FWLA 1ZARA 4QPQA 2EFPA 2H1LA 3HXLA 2BBYA 1X3WB 3CMYA 1ZKGA 3A01A 1IXDA 3VQCA 2K02A 3OL3A 4GV3A 3ZEHA 2I2LA 5HDKA 1JJ8C 1VQKI 1CSKA 2L7FP 2JMWA 2W00A 5C3EJ 2XY6A 2F5TX 4M9SA 3ZMDA 3PNYA 2VPRA 1YS7A 1I1SA 1XHZA 2GTOA 4JHDA 1Z6TA 2YU9J 4M9XA 1N6AA 3HL2A 1ZH5A 1EH7A 2JNGA 2EINH 4H03B 3LP3A 5E3MA 1YVUA 3I4NJ 5FU7C 1P7MA 2FO0A 3CMET 2M7BA 3DP7A 4C3IJ 2R7DA 1O75A 4IUPA 3L0QA 1RNHA 4GY5A 1J9AA 3G6EA 1DGWY 2GXAA 2C0TA 2EFNA 2GTDA 2JPSA 3H6EA 1LDJA 1UGSB 3SZ2A 1N32K 3PQJA 1JL2A 2STWA 1HSQA 1RZ4A 1J5YA 1JLBA 2KAFA 1UJ0A 5DDGA 1AKHB 3H0IA 3F8MA 5KVRA 2PN6A 5C4XJ 4EMSA 3QERA 1ETYA 4BRMA 1MV0B 4DF8A 4XH4A 3CMEN 2JZ2A 2X6YA 4IUQA 3K1MA 2CYZB 1SMTA 2KIQA 2A7YA 4XLHA 4ZDLA 4HYEA 1YIJI 3ASNH 4FHTA 4EW4A 1P92A 4BR4A 1ZAOA 1YRNA 3BUZB 3EPZA 3CERA 2HHWA 2D2WA 4H5VA 3CCLQ 4DQ8A 3CC7T 3HSRA 2Q8KA 4YPHA 4EJTA 3ZQLA 2NUZA 4JZ4A 1BI4B 4DTOA 2M16A 5F2RA 1XPXA 3UKRA 3DI6A 3EG1A 4Y15A 2ZGWA 2LFBA 3S1NJ 1ITYA 5LJ3d 4DTMA 5F64A 2XRLA 2NOJB 4DB3A 5IP7J 2FRWA 1EP4A 4BJTA 3MHXA 5I9EB 1YQAA 1T44A 5AQQA 3D5RC 1C0MA 4IHTA 5KYNA 1MNMC 2OTLI 3REAB 2DQLA 3QETA 1SANA 2JJ7A 1W2BS 3CC7N 2ZNYA 1K7AA 3H35A 2B0LA 3DAWA 1E2XA 3R4KA 4CICA 3FHZA 4J9HA 5A2QO 4FJGA 4BHCA 4UUVA 3VENA 3E5QA 1HOMA 2RQPA 3LSMA 3DEWA 3JRZA 1NZ9A 1WPYA 2KDOA 3RR8A 4AH9A 2A05A 2BE7D 3E0JB 3OB9A 3FBNB 2O31A 1NJIR 1FYLA 1VQ7I 2K3PA 3MN9A 4CD1A 1JL1A 1Q86R 4DBFA 4DQSA 1SHGA 2D5VA 2DD5A 4OMQA 5EY4A 3OYKA 1WSGA 4ZDOA 3JRCA 3SMPA 1VSMA 3BR5A 2DPNA 1VZ0A 1XG1A 4M77C 2RHXA 1R58A 5B66C 2DI3A 2QA4I 3QJYA 4C8QD 2L2OA 1Y1WJ 4CJTA 2ESHA 4BGAA 4B9SA 3TGNA 4NQWA 4LD6A 2VKNA 3RKXA 1BDGA 2E60A 1QWEA 2M9HA 4X34A 2WSFE 2ZD1A 3OYBA 3OW2A 3CXCM 4XIDA 3IH3A 1KSWA 2R92J 1N5YA 2R7XA 4DJAA 4S05A 3THKA 2CZ6B 3WNEA 1S1NA 4BRLA 4BY1J 1A5VA 2LY2A 4G6TB 4D0PA 4JS4A 1KZHA 4CESA 2ZJQL 4U67L 2E6LA 1KQ1A 3ZQIA 4XICA 3S6IA 1ZX6A 3U3GA 2W10A 1IRFA 4L9VA 2PEXA 2LJ0A 2W41A 2FZCB 3QOPA 1OVYA 3NGIA 1YX3A 5FLXK 2E2HJ 4RTYA 5CKHA 1GUUA 4Z0UA 2P7VB 3PNWC 4E3SA 4WCIA 4JX4A 2VUMJ 4DOWA 4KIBA 2YWWA 4DR4K 3FZMA 3H9QA 1RT4A 2UXXA 4AHTA 2M51A 1S1WA 4LG0A 3RMQA 3L4QA 2E12A 4M42A 3CO7C 1Q7YC 2ROTA 1X3MA 2VLAA 1U1SA 1QHHD 1I50J 3I56A 4NBQA 4NNJA 3M8QA 2CZ0B 1T95A 1S3XA 3CJNA 1BA5A 2DCEA 1WAJA 1ZXOA 3ZPLA 3BTIA 2HQ5A 3KP2A 1M8VA 1NKEA 1WLPB 1I0CA 1ZGAA 5M1QA 1BKBA 4DTPA 3OHRA 1X75C 3QP6A 4B9LA 4C8OA 4LB6B 3RVCA 1Y6IA 5J1EA 3AG4H 2HBMA 2COBA 2JS0A 2DODA 2CYYA 4HPQA 3MX5A 3BR2A 1SV5A 2OANA 1BIBA 4DMNA 4RB3C 3P31A 1GLEG 2HXIA 2E6MA 2DDAA 1RBVA 1KO9A 3O8GA 3IV5A 1UB4A 3BOQA 1CKAA 1IJJA 3FZKA 1H8AC 1D8JA 3CJ1A 2ZPIB 4XRSA 4BNCA 5BMZA 1SS6A 9ANTA 2D6FA 2KFNA 1V1CA 2DK8A 2ZPEB 1VQ5Q 3RPQA 1X58A 5AQGA 4B9VA 1WB9A 3CCJI 3RESA 4BR7A 3ZQHA 4DZJA 3E19A 2KBTA 3CQ8A 1M3HA 1SKUB 4M7DE 3N4QA 2D0AA 2RQTA 4L5IA 3P9KA 1SC7A 2ZB9A 1SRLA 3IKTA 2QEXQ 5J4VA 4YDUC 2AJQA 4BXFA 4FYDA 1VQNA 4EHUA 2ID3A 1XMKA 3W2VA 4NL2A 3QYBA 2NUPA 4M75A 5KRTA 4F4KA 1S5LC 3AY9A 4F3TA 1HMVA 2FBXA 4OINF 1JKHA 3IQLA 3N0UA 3MEXA 3O5BA 2JJ9A 1QQMA 3BG7A 3OS0A 3DBLB 1YAGA 1MBFA 1UHSA 4E7ZA 2EFOA 4UXNA 4CF8A 4CCLA 3DLBA 3CD6I 3ZCMA 5AQJA 3C7NA 4PJOE 1Q82R 1ZUYA 4F7UA 4Q5VA 4I0BA 2R5YA 1Z6RA 2F5EA 3L42A 2KSSA 2JT4A 4ESBA 2ZXJA 4L6V5 4U0YA 3VA3A 2RPNA 4LSLA 4C23A 4E0DA 2OTJA 5EOYA 1X2QA 3SQ1A 3KFWX 2HEQA 3IRXA 1IUYA 2FVUA 2E2NA 4FL6A 1Y8QB 1KQSS 5ILSA 3OQ5A 3QQAA 3HYFA 4Y28E 4AWXB 5GAMj 2MI6A 2HHUA 4PGGA 4Y52J 2HQHA 4AIDA 2VWBA 3BCAA 2BDPA 1Q81R 4XLCA 2QDYB 5HBMA 4GYIA 1MBJA 3GXOA 2YHTA 4OGCA 2FNPA 1H9GA 1LWVA 2NRRA 4OB3B 4BVOA 4L9TA 3RZDJ 3CCMQ 3EG2A 3M58A 4I7FA 3VTIA 1NJWA 2R5ZB 1NK7A 3IAS2 3RRHA 2R7QA 3CUQB 4EVIA 2K5FA 4H4KC 1FK9A 4J5YA 1N27A 2EGCA 4ASNA 4DTXA 2KISA 5KE2A 1BO5O 2VT2A 1P59A 3MJXA 5KNLA 3AHUA 5DM7L 1G3SA 3SV4A 4LF4K 2MH2A 3ML6A 4BR2A 1ZC6A 2OZMA 4BRHA 3MEDA 1HLVA 4GO1A 4NL3A 4QQDA 2DT5A 3FM3A 3SFZA 3QIIA 2YNHA 1LWYA 1R36A 4CDGA 1NJIC 3S1RJ 3CC4Q 3DJCA 1G3YA 2CGKA 3SEZA 2E7WA 2NOBA 2RVCA 3D5LA 5A2QK 5LL6S 2PVGB 3VS7A 1Q86C 4NYFA 2HWVA 3AVJA 4DEXA 1KXPA 2F9WA 2EWNA 2GA1A 7AT1B 1LEBA 5M1NA 2O8KA 4E4HA 2YRCA 2O8EA 4MFBA 2FMLA 3C2BA 3C0CA 4ZYGA 3M3ZA 1K78B 4V2GA 3QBWA 3M55A 2RGVA 1TNTA 3MWPA 3TDZC 3K69A 1TH7A 4QQ6A 5JS1A 3QSUA 3O08A 3SPZA 4BI8B 5HLGA 4LF8K 4MO5A 1I94K 4ZN3A 5B3SH 2FXUA 3TQNA 3THXA 2HYFA 1NGJA 1QNTA 3DBRB 2RHKA 5GTIC 2OAUA 1QWFA 2FPEA 3PY8A 3QICA 4FCYA 1QU3A 5IYDJ 2MW8A 1HCRA 1PM3A 1OISA 2M8GX 4A3CJ 2YSRA 5K7HA 2I5JA 2RF2A 1NNEA 1SL0A 3VYTB 1RT7A 2OPTA 1YE9A 1ORNA 1W2BP 4C92B 1RT2A 2P9IA 4M78F 4GVMA 3WHCA 4BDZA 2RHZA 1DPRA 4XLEA 2YJEA 1U8BA 2A61A 2A40A 2CP3A 4HHTA 3RSNA 3MKWB 2HQAA 5GANg 3ZSXA 1VQ8T 4U0VA 4FK4A 2MPXC 2EWSA 3L8BA 2LTPA 1NGGA 5J40A 5GAMh 2BZ8A 3OOPA 2K9LA 4BEHB 1W2BA 3TSZA 1MUNA 5GAOp 1IN7A 2HSTA 4A4HA 1VSHA 1SZ2A 2ZBKA 5E1XA 3ZSRA 2XV4S 3MN6A 3THWA 3S15J 1MJAA 2G7HA 5H1SQ 5E18F 2L02A 5GAGP 3HTRA 5D5WB 2F4OB 2LRQA 2NLXA 3VTHA 3VEYA 1R1VA 5FU6C 4M77A 2O4XB 5FPNA 1RT5A 3SWNC 1NLPC 2VKHA 4FM4B 1KVBA 1WSFA 2LNBA 4HVWA 4LGWA 2W4SA 5AZIB 2YUOA 3ZN0A 4NCBA 2JWTA 1ZSZC 2BHZA 2K5CA 2F5CA 1QZZA 1GVDA 2Q0RA 2IS6A 1AWXA 1TKDA 1RAEB 3GIBA 4X62K 2LD5A 3JCMX 4BQNA 3HKZA 3SYZA 1UHMA 4KT0E 2DOAA 4ABZA 2YG8A 4RDUA 3V4IA 1GLNA 2LY9A 3K5LA 2YKMA 1BCOA 4H8KA 1ASVA 3T1AA 4FPBA 5HDGA 3G6ET 1MBHA 2EBPA 2DMPA 4FLWA 2DTRA 4EMHA 2LCSA 3HPGA 2CQXA 4J9DA 3S3MA 1D3BA 1T38A 3BY6A 5HS8A 4I2QA 1X1DA 3EGXA 3JSMA 4F92B 2H6BA 2IRFG 3EKUA 2M0CA 3TAFA 2V52B 3F22A 1RFQA 4B8CA 3VB2A 1I6HJ 1M3QA 1XC3A 2DJQA 3KLGA 4ELZC 5EYRA 3QDKA 1S72I 1LB2A 3ID8A 2D0PA 5JICA 4OOIA 4M3RA 3WNFA 3LDNA 3N97A 1E6HA 5FDLA 3AA4A 2UXDK 4A12A 2QWQA 1NGFA 4G7HF 1XG7A 4FW2A 3G6EN 3CFRA 2DF6A 1J2XA 4GRIA 3D2EA 4Z02A 2FSJA 3FGUA 1DU0A 3SAFA 2RJFA 4RTFD 1X6BA 4M73A 2G8UA 1WRJA 2NS8A 3WTYC 4BQLA 1PUFA 2NRVA 3JCMg 3LOCA 3ZL7C 3HM8A 4IQ4A 2JOYA 3GTGJ 1XC9A 3KYLA 3DKXA 4XONA 2RI3A 1WZ2A 4Y1CA 2JQ7A 3DEUA 4L5JA 2QWWA 3TEEA 2IGIA 4DYCA 1JXEA 2P1JA 4BRQA 1Q82C 2HVSA 1WQ2A 5GMKj 3PJRA 2RN7A 2VODA 3QYHB 5FROA 2G8FA 5L3EA 2Y90A 4FYWB 5FWCA 1NK4A 3BEXA 3CCUT 3P5JA 2ECCA 1MBGA 5DD8A 3A8LB 1X2KA 5DK5A 2GF7A 2EYQA 4XAXB 5HL7L 2BZYA 4KI6A 2GOXB 2X9DA 2R7YA 4DSKA 1M90R 4EP4A 2RQQA 1I39A 2VJJA 3TAGA 3DLMA 4OMZA 5EZGA 2EAYA 1VQ4I 4M78G 1IREB 4OPHA 4YDUA 1PC0A 2GCXA 4MQ3A 4E9GA 3DLRA 2XKPA 1UOCA 2XO7A 2KT0A 1D9DA 1ZHFA 1ORPA 3CM6A 3O6BB 2QXLA 3B6AA 4FOIA 1TKXA 4EGZA 2GNCA 2KI7A 2RNAA 2NOZA 4IOAF 2K9NA 3ZX2A 1T3SA 2P9KA 1A04A 2KW4A 5HNHA 1OCRH 4QLCU 3HG9A 3VPRA 1VSFA 2EKHA 1LV5A 5IN1A 1WHHA 4DYQA 3T3FA 3K70C 2DTOA 3CBOA 2FSKA 2QWNA 1PWTA 4RCBA 1QHGA 2O6GE 5AQTA 4B43A 3LM9A 3BDDA 1WN7A 4VUBA 4Y13A 5GANf 4AM7A 2HQXA 1ZBHA 5C0YA 1WIEA 1A31A 1TU0B 2GBQA 1ITGA 4E6RA 3I71A 1F36A 2YG9A 4J6YA 1IRGA 5LHIA 2LT1A 3PNTA 1Y8RB 2PNIA 1LNWA 3HFOA 3VDXA 3WQUA 2I7NA 2VV5A 3AO3A 3K5NA 4ZTFA 1KQSP 4IRGA 1KA8A 3A1YA 1OULA 1TW2A 1YITQ 3CMAQ 2UXNA 1JHHA 3ZX3A 1HKGA 3RERA 3ZT1A 2BUDA 3LWLA 3V7RA 3CPWA 3LSRA 1OH8A 2M7AA 2ME6A 3ASOH 4WQ4A 1WSJA 2YU3A 1IRZA 1VQMT 2P9LA 1U5TA 3VW4A 3I55Q 4J9IA 3QINA 3QBYA 3QESA 5HLIA 2HBKA 3I56T 2CUFA 2UUZA 4CCMA 2WWYA 2HOTA 2DRMA 1HW5A 3CPFA 1HJOA 4DWIA 1OPLA 3B6PA 1HPMA 5JVGL 1EFNA 4FM2A 1J7KA 1M3BA 3BWGA 1TW3A 4LIUA 2GFUA 4A3JJ 5TKYA 3QG1A 4LDUA 3VESA 4MGRA 2DD4A 1IHVA 2F8TA 2BGGA 3M0PA 4XKVA 4JRPA 3K59A 3EFOA 4X9CA 4PKGA 1NJYA 2IVNA 1MU2A 3JB9F 3OVNA 4CJ7A 3WHBA 1TYQA 2LR8A 2LJ3A 3OTOK 4DR5K 1NK3P 2GTJA 3VSLA 3GTJJ 1PU7A 1X1BA 3EYIA 3I56N 4B9XA 4RTWA 3DBHB 2CW0F 1B9FA 2XROA 3SZTA 2FEIA 1M1KR 1XI1A 2O8BB 5DY9A 4ZH4F 3ASKA 2AXLA 4H0TB 4F9OA 1YP5A 1P2FA 5GAMd 4E9FA 1PSEA 2V9KA 4RW8A 2O9SA 4II3A 2NRWA 1YF5L 3WVDB 1SKWA 4D1QA 3W6VA 4O4GA 2OUMA 3L00A 5GAN2 4Q4ZF 1WNLA 1FZPB 3JCMf 2PUOB 4IOAL 1VQ9A 4CJFA 3PO2J 2FBTA 3D4VA 4EW0A 4E7LA 1NK2P 4AU7A 2UUCK 5BRDA 2Z0WA 1VQNT 4Z4CA 5D5XB 3QYEA 5KN9A 1SEUA 4F3QA 2EVRA 2GQVA 3M54A 4TVRA 3CCQA 3EEQA 2WC2A 1YHQA 4H0VB 3ER0A 3LQQA 2AA4A 1QVFM 1YT3A 4GDFA 2PMZA 1WJDA 3H3UA 4CGZA 1M1GA 5AQNA 1VQOA 2EILH 4C8NA 1MNEA 1X6OA 3JCMW 1R0AA 2VWKA 1ZBLA 2KRFA 4A3MJ 5C10A 1RI9A 3OS5A 4H0EA 4PJLA 1VQNN 4CC3A 2NVTJ 1N9RA 1OYWA 3CCSQ 1JJ6C 2V8JA 2V1QA 5EG2A 3V6DA 1IKWA 1B1BA 3KHYA 2V8KA 1IW7F 1U8RA 3EE9A 4RAFA 2DE0X 4BR5A 1HNZK 3GFJA 2OTJT 1T7PA 4CI0C 4I7HA 4Q47A 2GBZA 3SWNA 1HD3A 3AVKA 3LPUA 3CCLI 4OKKA 3HOSA 3EHRA 3HEFA 4N9IA 4M72A 3LP1A 1QZ5A 1Y57A 2ACJA 2XRNA 3TTFA 4CCOA 5CHIA 2V1DA 5JLHA 3RSEB 3C65A 4HAMA 4B9TA 3M0RA 2IAIA 4I2OA 4CF2A 5GMKe 3QNOA 4KV8A 3LGLA 4EP5A 2YUNA 3F21A 4L59A 2OTJN 3JREA 2KIMA 4ZJZA 2XSDC 1Y97A 3E2UA 2FD5A 3T0YA 3L6QA 5DLOA 3NNQA 4C8LA 2L2PA 1M1EB 1S1TA 3G25A 2R3SA 4KREA 4JD2A 1M90C 3RKQA 2ZQBA 3FZLA 3MN2A 2QQAA 1XCBA 2CH4W 1RTJA 4K43A 5TGTA 1KGSA 1ARKA 4ATOA 2RHUA 5FB2A 2F4IA 3MN7A 3PIOF 3KE2A 3JAMO 4JZ3A 1E6GA 3G1OA 2W40A 2EQIA 5KPTA 4BB7A 2A37A 4FSSA 5CZ1A 1BIAA 4LITA 3CCVA 1YIJA 1YQLA 1Z25A 1TLHB 3MX2A 3SFMA 3LANA 1SAZA 2BOLA 2YI1A 2HSPA 1K8KB 3P4IA 2Y4XA 4RB2C 2QBYB 4U7BA 3JB9G 4Z4FA 4CGHA 2ECBA 3GBGA 4WCGA 1KQ0A 4AFZC 4DGWB 3WU1B 2CSIA 4BRIA 2D45A 2NRAC 1QKWA 1N6QA 1RDBA 1JJ2S 2L3PA 1SG5A 3TO9A 2I5WA 1DLOA 1XQSC 3IKMA 1I3QJ 1YCSB 5LJ5j 2PYLA 2K3FA 5CHZA 2R5MA 4UB6C 2QK0A 3NVKA 4PJOC 3R8EA 1G3TA 4YTLA 4OU0A 2OZSA 4FLVA 2OPQA 2IS3A 3LSHA 2ZCFB 1MH3A 1ON2A 2Y31A 1IN4A 3WXIA 2DT7B 4HCZA 4MLOA 1JU5C 2DYSH 1E4GT 3EZWA 1YQRA 5FU6B 5FD6A 3CWUA 4HX4A 1RDDA 1FSHA 4MQVA 3ZQGA 2ZZDA 2LKXA 4KHYA 2Y4YA 4FJ7A 2LSOA 1QHAA 2JGUA 1Z26A 1ZSZB 2O61A 2OU2A 4RGUA 3O9UA 5KYYA 3ULEA 2KTQA 2X6OA 2ZFUA 2LX7A 2OJ2A 2NZTA 2IA0A 1M2VA 3HK2A 3K5MA 5IT9E 3UKUB 1LE8B 3X26B 1GCQC 1FBSA 3I0XA 1H8KA 4OGEA 5CKDA 4OIQF 4O8KA 4FM0A 3CWAA 3UE5A 2QA4A 2Y1IA 2JUGA 2OF7A 4KT5C 2P0QA 5L3CA 4FJLA 4CGFA 2P51A 2JPBA 2PJPA 2V1NA 3GZ6A 4B9WA 3GUDA 1P8ZA 3HSCA 3J7ZI 1V5FA 2V6EA 2KXCA 3R6OA 1YJNQ 2VN2A 3H5NA 3EH1A 4CZZA 1KQSM 5L3GA 4HTUA 5M3FJ 3WTSC 4PQUA 1K8AR 1YJ9Q 1Z7UA 2HU9A 2M2EA 3MWMA 3WU2C 2GWRA 4Z4GA 2GIVA 4M7AB 1MPGA 3LSKA 1M1KC 5ICCA 3KKSA 4GYGA 2HPIA 2E65A 1OPCA 5F6FA 4HVUA 1KIKA 3PIOL 2BW3A 1VHXA 3FJ5A 5SWMA 4CK3A 4OIRF 1QTMA 5EZHA 2MOXA 3CESA 3FE1A 2L3QA 3RTVA 2FX0A 2HNZA 1TWFJ 1X27A 4OFEA 4FLYA 1VQ5I 4IHSA 2A6HF 5AZJB 3QXEB 5D6YA 4A69C 3V8LA 3QBXA 1RADB 3JB9H 4XH5A 1M27C 1ZHIA 2CUJA 2XHCA 2ESNA 1HNWK 3LL3A 4I6MA 1YVNA 3O2PE 1FMKA 1WJSA 3HKZN 2L7MP 2OX7A 4FJJA 5LJ5h 4DEYA 3FJPA 2QEXI 2QGUA 2QUFA 2A5YB 2E7XA 1OJLA 3PSFA 2ZAEA 5GMKl 1VFCA 1M30A 4IEEA 3THYA 1KG1A 5B1BH 5JVTA 1YXQA 1UHFA 3QU6A 2UV1A 3LA2A 4LF5K 1MDMB 2ME0A 4PZJA 2E35A 1M1FA 4M77D 4OLBA 3L2QA 1RAGB 3MPUB 4XTZA 1N34K 4YG2F 2NNYA 1MHNA 2NYXA 3LWFA 1PG5B 4CZGA 1K0XA 1V29B 2IXSA 3OIOA 2PI0A 4MDAA 3FFIA 5DMRA 4M3UA 1P7IA 1M8MA 4JK8A 2Y0SA 1NGDA 4QAGA 3G0QA 4M3BA 1S1UA 1RIOH 2J05A 2JTMA 1YWPA 3VF2A 1TG0A 2EZIA 4E70A 3I5UA 1I5LA 2X1DA 1I5OB 2GXGA 3HP9A 1FOWA 1QBJA 4BBSJ 3ZETA 3META 3CJ7A 1WGSA 3CCJA 5GAHJ 3CJAA 1FOKA 1NWKA 3I4MJ 1TXQA 2KGTA 4IQJA 4LK0F 3CFOA 5IT9O 1ACMB 1NG6A 1K83J 2ZJPF 4J8OA 4A63B 3ZMSA 5ILUA 3O3KA 5CJ9A 4A3KJ 3KZYA 3BDPA 1WUAA 3L4IA 3KZIC 4N4GA 1LOJA 3J81Z 3DEEA 3E97A 2MD5A 3B6CA 3CJCA 3KP7A 2BANA 4RM3A 1DTTA 5EEGA 3LAJA 3K6GA 4OMNA 4EJOA 2P6SA 2O8FB 3MZHA 3PIPA 2Q97A 4JKCA 3KCCA 5AQZA 3PE0A 4FWQA 2V9PA 1GXQA 4BI3A 2X0LA 1MSFC 1Z21A 5HK0A 4NCAA 2EJ9A 4HUEA 3DQVC 1LPLA 2DL7A 5DD4A 1U06A 3G73A 5CQXA 5GAEJ 2YUSA 4BXUA 3VQQA 4FOEA 1JLQA 3J80Z 4JEPA 4FQGA 3QFUA 2EYZA 3MAJA 1WXUA 2EYYA 1G2BA 1UG1A 2YHAA 3CC4I 4B1ZA 4C8QF 1MMGA 3ZSVA 3SJMA 4KRFA 1BR4A 3VEOA 2FL7A 3TARA 2JG6A 1FSEA 4HDVA 2RF0A 3JAMK 5HS9A 3MAQA 2UUAK 3OYJA 4B1VA 1TQMA 1YUWA 1HYSA 1KCFA 1DIZA 4CF1A 3OJUA 3R9PA 5IHIA 4LF6K 3RIRA 4CEAA 3UT1A 1R5HA 3E1SA 3CC2I 3M07A 5I22A 3IAM2 3QEWA 3GYHX 5J8FA 1VQKQ 3EGUA 2OFIA 5GP9A 3I59A 2HHVA 3SFIA 3H36A 4RLQA 4KUIA 3BR3A 3RJPA 4M3ZA 3JW4A 1W7PA 1VQLQ 1K61A 2DYBA 2CH6A 4XTWA 2QI2A 2HDWA 3CHWA 2XF6A 3LP0A 3N5BB 2C06A 5D6EA 3NMZC 3N5NX 4XSXF 5KH6A 1BK2A 3BZCA 2LQ8A 3G1MA 4CCHA 3QUIA 1X4PA 4OVAA 1V3FA 2JA8J 4DR7K 5GPAA 4HV6A 2P9UA 2R57A 4PKCC 1ODDA 2F5DA 1HQCA 2FLOA 2DVJA 1B72B 1YI2Q 1D5VA 3DRSA 5M1OA 3KLOA 5HOOA 5E79C 3OYAA 3VQ7A 1YJWI 3CCEI 3KPHA 4M7DA 2ABKA 3KK7A 5KGWA 1TVRA 3S32A 1IBLK 4HVVA 1RAIB 1TOVA 2XHKA 1IZ6A 2V6CA 4UHTA 4WYBA 3S1MJ 1AOJA 4GFBA 1LW0A 4YORA 1W0UA 1QSYA 2CFOA 1LEAA 2NOIA 8ATCB 4R5PA 2ZJPL 5EVZA 4EM1A 1WQWA 1FBUA 4AIAA 1IH7A 1QZ6A 3PLAA 1C1BA 2VJ5A 4HEA2 2EGAA 3K4KA 4MMLA 2GQQA 4YIIA 4MEXF 3E9LA 1OKJA 2FC0A 3GG4A 3BFMA 4YOUA 5B1AH 2A6TA 2KFDA 1TAUA 3EG9A 1JQQA 2IJLA 4LXCA 1JJ2P 4BQQA 4FU6A 1TK0A 5HRPA 3EUKL 2PLYA 2W48A 4YFXF 1K8AC 3A2FA 5E26A 4RAYA 1VQ9T 4BWMA 2F69A 4RTTA 3MP6A 2TDXA 4PJOA 1K9MU 5AQXA 1VSKA 2HVHA 5E1ZB 4BD3A 3NTIA 4U0WA 1ACIA 2A6EF 1KG7A 5HKCA 2HHSA 3A8GB 5FW9A 2XIDA 4JJDA 5EU7A 3FK7A 3AA3A 5FKMA 1C0UA 4A0ZA 3HOXJ 4AILC 3CCQT 4JV5K 4KA4A 1A5XA 1YHQT 5AT1B 2OCCH 4NXNK 4QSHA 2OTLQ 3HTVA 3A2KA 2AT1B 2R0QC 3VFZA 2WY8Q 2EQJA 2XY7A 1VQOT 5C6SA 1NGEA 2RKHA 3FKIJ 2P5KA 3TOBA 3LP2A 5FPDA 4M75E 4NYNA 2K2MA 3A8YA 1VQ9N 2NOFA 3DWLA 2FRYA 1B7TA 2MF2A 1RAAB 3KX2A 1KC8R 1Z7LA 3FXQA 3F9MA 4PFOA 1SEMA 2HQRA 5I21A 5D8KB 1VAZA 3NAEA 4BY7J 1NKUA 1GCQA 4ON0A 1MGQA 1X9JA 3CCQN 1YHQN 1VQ7Q 2CGPA 1ZRCA 3H6ZA 1Y0NA 3GTMJ 5LJ3g 2PMZN 3RMAA 4FE4A 1E3PA 2JXBA 4C8QG 1VQON 2V1RA 1O7FA 1Z9CA 3PVQA 5LJ5d 4BE0A 1UMQA 1VQMQ 1ZBUA 1RPWA 3S41A 4UV8A 1ETXA 1YOVB 3O1BA 3X24B 3P8BB 3VEZA 2DZCA 4FK2A 3M4GA 2K4JA 4AMCA 4CZFA 4C92E 4UUSA 1LW2A 1RT1A 2QZ8A 1OCZH 1R5ID 2LP5A 3M9QA 4PDKA 3S14J 5CYQA 2LCLA 3UR3C 5E17F 2KRNA 4PLIA 5BRFA 4E9EA 1ABOA 1PDNC 1BU6O 1TKTA 4H0YB 2DA6A 4JKGB 1LPQA 4CJ5A 3JCMQ 3K9TA 1FX7A 1OH5A 5HDNA 4B24A 1D4XA 4PFZA 4JKFA 3SHWA 2HZYA 2DBBA 1V4TA 1QPMA 3T1BA 1S9EA 2YKNA 2W42A 3FXUA 1FXXA 2CKKA 3EYYA 4WX9A 4GMJB 1N8RU 3FXLA 3DB3A 5IT9K 2RKIA 3QWYA 3M8SA 2JPCA 4ZGEB 3CCVT 1YIJT 1BISA 5CK9A 2XDVA 4UB8C 2E4LA 1HF0A 1F1BB 3BR6A 1KVCA 4DW6A 4JLGA 2M1BA 3HSBA 3DLKA 1RRQA 2ATQA 2D0NA 1R59O 2GX9A 4CEZA 2Q1ZB 2Y9ZA 2VUBA 3FBIB 1UJ8A 2AHJB 2OBPA 2XDDA 2RK2A 3BF1A 1IRXA 3FB9A 5AIQA 1J53A 2VYPA 1EIFA 3NHNA 1EV7A 2LG4A 2DXUA 3MKYB 2KLAA 4YOXA 3CCVN 1YIJN 4IHXA 1V76A 3C4SA 1ILYA 1D1BA 4CEFA 3BZKA 1VQ6A 2CSOA 3E6BA 4DSIA 4KTQA 2YNFA 1B92A 3J7AY 1RETA 4AFUC 1BR2A 4G9ZA 4OO1J 5J3LA 1X2MA 4IHWA 3TP0A 1SFOJ 5M5YJ 1S1XA 4B8AB 3BROA 4XR6A 4JI5K 2G8IA 2NOGA 1RCHA 4BR9A 9ATCB 4JI1K 2CT4A 4XOTA 4ETSA 1N8RO 3LA7A 5CYMA 3CCJQ 5A0LA 1RL2A 2PQ8A 1JEGA 3RQIA 1VQ4A 3LPTA 3CXCS 3EL2A 2KK4A 4L8RB 5ED4A 1ZLMA 4Y1DA 3CPEA 4P96A 3WQTA 2JVVA 3CMAI 1B3QA 4OMLA 2QF7A 1TS9A 2NUTA 1B34B 2ELHA 1ABQA 2VE8A 5DPKA 4UNFA 1AVZC 4JLIA 3I55I 4AQYK 4JKDA 4DG1A 1AHDP 2X78A 2QA4T 4CJKA 3HZJA 3K4MA 1RACB 2RC4A 2LSNA 5IXBA 2VB6A 1K6YA 3HVTA 2Q2EA 3WEEB 3JYTA 3T69A 1IAWA 2N8GA 1Y96B 2Z1GA 2VL8A 2O8CB 1IGUA 1A6QA 2E2IJ 4RLFA 1SD4A 2Y0MA 1WQ7A 3HRUA 4RG2A 2CQNA 4Z2YA 1NBEB 4UY8I 1P4XA 3L2UA 4B22A 3UWNA 4BU2A 2E3HA 1SD5A 5FKLA 1ZR4A 1UA0A 3N4MA 3V81A 3CD6Q 3F10A 4II2A 5FD5A 2QA4N 2KNBB 3SQ2A 4WE1A 4YOQA 2B9SA 1G5VA 1L3UA 4MHGA 4MIMA 4P5NA 3O9RA 1L3LA 1MMSA 2O9VA 2CP0A 1PYVA 3NEUA 2O88A 5LJ3f 4M3YA 4C3HJ 5F04A 1G4DA 1EXQA 4G12A 2M8EA 4KO0A 2JUCA 4DHYA 5J3BA 2PAVA 3ZX0A 4XTVA 2G0EA 2XI9A 1X1CA 2LOOA 2VC8A 2QQRA 1U3OA 5CPRB 5KCMA 2BHYA 1FKOA 1ENHA 2GWKA 2A3LA 4FSXA 3ENBA 4X65K 1BJZA 4KB1A 3CWTA 5GANj 2ISZA 3S1QJ 2KPMA 3BR1A 2E5NA 3IH2A 3LSTA 2K5LA 1MV3A 4OF1A 1P4AA 1R23A 1T03A 1QRYA 4HX8A 3SUNA 2V8IA 3M0TA 5H6RA 1TGOA 2JWLA 3H3NO 2F2VA 4A3DJ 4CZKA 4O3MA 3A5ZB 2MABA 4DR6K 2F5VA 1X43A 4B9NA 2XAFA 1KC8C 2E1MB 4N9HA 3K70D 1QQJA 1T3VA 3F8NA 1JJ2M 2HW3A 3O9QA 4HQEA 3BR0A 3DKYA 5FRMA 2I8DA 3DU6A 1GV2A 1KAYA 3CG7A 4K41A 3FHFA 4QKUA 4UC4A 1YW9A 3EQLF 4OFHA 4EPCA 3W3CA 1OYYA 1W36C 2QCOA 3THVA 2HD0A 1SVOA 2XHIA 1GV5A 3IWFA 1POGA 3TPQA 4A53A 2XAJA 4ISFA 4KUMA 1IXRC 1B8IA 4HSRA 2E5KA 5D5VB 3WXJA 2MYSA 3BY7A 1V55H 2VC1A 2L9RA 5HY6A 2DA2A 5B5EC 1U2VB 2V75A 2OQGA 2G8HA 1JGGA 2Y0SN 4FTHA 4CF0A 2HYGD 3E1YA 4X0GA 2RQRA 4GLKA 4DK9A 5CYVA 2GIZA 3S6WA 2LNHB 4XH1A 3M9AA 4A5BA 4D6WA 4IDHA 2QTVA 1BA1A 2TRTA 2GEMA 2MLGA 3NARA 4D5FA 4RWTA 2VBZA 3I0RA 4RB0A 4BC4A 2GAUA 5B8HA 4PHTX 1D5YA 3BJAA 3LNQA 2DFEA 4JX6A 2EW3A 1WEGA 4IO8A 3CCJN 4OP0A 1I4K1 4KYWA 2HNIA 3KLFA 1LQ1A 2L89A 4EZ9A 3OGDA 2R7OA 1Q7YU 4P9UA 3GEZA 1K9AA 2MK5A 5E3OA 3DXKA 4IXAA 3AO1A 3GCMA 1TL1A 1ZLKA 1DGRM 3M1FA 3TI0A 3MEUA 3AO5A 1L3VA 1A6IA 1SKSA 4H5WA 1SPKA 3I53A 2BZXA 5C2DA 5BRHA 3EGDB 3LAPA 4ZDPA 4B3MK 2H3GX 3FLCO 3R1XA 3NH2A 3RR7A 3S16J 3FDRA 5D6FA 1MA9B 4ZYAA 1FPQA 1XN7A 4CC7A 1ULYA 2KJBA 4Y17A 4AHUA 2IDOA 5KAFC 1GBRA 3CCLA 4OB1B 4FIBA 4M4ZA 4C9YA 1JKPC 2PX9A 1IBMK 4FO0A 4IL6C 3GP8A 1RUOA 2CP5A 3JTGA 1RT6A 2AXTC 4XMYA 5K5RA 2X4WA 3M5AA 1IGNA 3M56A 2QENA 1BW5A 4DLEA 4XU2A 2FNAA 2AKKA 5KYUA 3T9NA 2VVKA 3JB9D 3BCBA 3G0ZA 3PX0A 2UU9K 2EX3A 5AQUA 2KY9A 3WVEB 3FWEA 5BREA 4IIOA 2E1HA 4J9GA 3J7YJ 1JKOC 3X20B 1UAAA 5F1JA 1KVAA 2YCHA 1Q7YO 4XTYA 1XX5A 3WTWC 3DXMA 2JVGA 4LFCK 3PFSA 2KRMA 3ZMZA 4QT7A 4KMUX 3QEPA 4M78B 1VA7A 2I5UA 1C0GA 2COZA 3BG3A 3I35A 1NOYA 2R7WA 1W5SA 1G3WA 1EH6A 1XOVA 3GE1A 2L9VA 3QZ5B 1Q1VA 2DFIA 3AVLA 4E7SA 3RNJA 4M3XA 3QEIA 1HQEA 5HS7A 4BJ5C 3TEDA 2ZMEB 2P81A 3K9JA 3FIWA 3NH0A 4LH4A 4IXCA 2G8KA 3MXIA 3TDUC 3A8OB 1S72Q 1QP3A 4A4EA 2NRZA 3FR0A 4RW4A 3VQ8A 1O13A 2L3RA 3TSUA 3OYFA 4JI3K 5CE3A 5CZ2A 5GAN3 5IP9J 2BXYA 5BS6A 2QW9A 5D4RA 2K79A 1V4RA 3AA5X 2X1CA 4PUSA 3QPTA 5CCAA 4LD5A 2E70A 5ADXH 2NNNA 3DKWA 4JOMA 4L9NA 4ZYDA 1IZ1A 2RN2A 1YJNI 1U48A 1GLAG 1O4XA 1FMVA 3KKRA 2IA2A 3VODA 4P55A 3LSGA 1YJ9I 3QAHA 5IHKA 4CZHA 1UFFA 1LWCA 5GTHC 2Y75A 2R93J 4LH5A 1D0ZA 2RREA 4NB5A 4R56A 1Z91A 4M6VA 2CFXA 2A0FB 3U8XA 3DFGA 2QQSA 4KULA 4JI2K 4F2RA 5FKOA 2FA5A 2DDBA 3D5SC 3PUBA 5AQWA 1TUUA 3CDIA 4CUGA 1S9HA 5LLQA 1Y07A 4DUZK 3MEGA 4M7DD 2LP0A 3ENOA 5CR4A 5EG0A 5E84A 1YCYA 5CVUA 1HYOA 3A4CA 3HRSA 2I10A 3LQRA 2CU7A 3IDHA 3CXCP 1G15A 2ZCWA 3FMRA 2P9PA 4KHWA 3H08A 3MN5A 5GANe 3KD1E 4ANJA 4UV9A 3IHOA 4I9QA 1TUDA 4F04B 4PK4A 1NJIU 2F1LA 4ZGDB 1E3OC 2O5RA 2K6DA 1Q86U 2XGEA 1EWQA 2RJEA 3CXCA 4IVNA 2HDDA 3GVAA 4KMFA 3ZGKA 1YQKA 1T8EA 3H9NA 4XL9A 1SMYF 1JLFA 1DP7P 1XJWB 1AHJB 1ZG1A 2HDCA 2NAZA 4CC2A 1VIEA 3TW7A 4MTDA 3IHUA 3MQ0A 1NEBA 1Q9YA 2ZXWH 4B4CA 3HZ6A 4N4NB 5HRSA 1USTA 5JHFA 4PJOD 1ASWA 2WBMA 4G9YA 3K1PA 3WGHA 4C3JJ 3MECA 4CZIA 2QAZA 5E8GA 3M1CA 2W6LA 3ZMTA 3E6CC 5C42A 4AIHA 1TC3C 3UB5A 3J7AO 1VQ8I 3CMMA 1UGPB 4GV6A 1R5GA 4CJ4A 1VQ5A 2L3SA 1P4WA 4H0OA 2DK3A 5L3FA 2BZTA 3CUQC 4GW6A 2BVMA 4KITB 3BE3A 1OYIA 2KRSA 1IDYA 3DPLC 1U47A 2QM3A 2B63J 4KTWA 4M6XA 2E8AA 2O7OA 2OAWA 1S6PA 3AL0B 3HOYJ 2LRDA 4M75F 2DRKA 3HRGA 3F70A 2QEXA 1NJIO 2DQRA 1HKCA 3C2GA 1XQOA 3LSPA 1XHXA 1AKHA 1Q86O 3OYLA 2LK2A 2DTUA 2QKMB 2DU9A 4FXDA 1X1AA 3M8FA 2CH0A 1JO8A 1WPKA 3UKGA 2COYA 1HYZA 3RDIA 2L0AA 4CBUA 4NUBA 3OYHA 5HCKA 3QYFA 1SUQA 4CIGA 1TUCA 1YTUA 3DOKA 2D4WA 4P1WA 1D1AA 2BYVE 4ZGJB 3QRFF 4DV6K 1QVGS 3VGMA 4F7UF 2DXIA 4FVMA 1G8XA 1B9MA 1XB4A 4C5IA 2A08A 2Q31A 3RMCA 2JN0A 1BI3A 4ORZA 1R0CB 4DTNA 2HKNA 2L5QA 2FXAA 3JCMe 4HF0A 1KAZA 3O80A 4XK4A 4KGVB 3BP8A 1BI4A 3KJVA 2X4XA 1WX6A 2FSWA 3B73A 1VQ6T 4DTUA 1UELB 3F6OA 1IGQA 3DYAA 2Q3SA 2FRHA 4A3FJ 1LCUA 1LUJB 3T8TA 3QO9A 3TOAA 1X3UA 4FSVA 2KIUA 4LY7A 2MC4A 5ILVA 3URGA 3T5XA 3FHNA 3NTKA 1ZG3A 5FO5A 2YHWA 4CJVA 1UE9A 3P83D 2DBKA 1KD1R 2P8TA 4KGXB 4AUXA 1M4ZA 2K9GA 4A5NA 1NK6A 2XKOC 2RJDA 5GAOn 2XVCA 2EZHA 1VSLA 2E6NA 1OU8A 4ESFA 4EJZA 4KN7X 4RCCA 4C92C 1VQ4T 3KTQA 1R1TA 1QLYA 1VQ6N 4C8QC 2L4AA 1VQLI 2HNDA 4XLAA 4BHPA 1PSFA 1VYUA 1X2NA 1MD0A 3CCMA 3QYGB 4J6XA 2EV0A 4B3RK 2C0IA 3GPLA 3MKLA 5GAHP 2KZGA 2WADA 3RQ4A 4ENJA 3MWTA 2ETJA 2IVWA 2AQEA 2ZGZA 1XWLA 2CP7A 2XAQA 1YI2I 3A5LC 4B3TK 2XC7A 2E5LK 3MP1A 1VQPQ 2P4RA 3VN5A 1HDPA 1VQ4N 1Y39A 3ZSOA 1JTXA 3SCXA 1IKYA 4BQAA 2V7FA 2ZM6K 2DA9A 1I81A 5CKBA 3L7WA 4BWJA 3CC4A 3CCUI 5GAMg 4RMNA 2DETA 1T0HA 4J9BA 2LTOA 2ZJQF 3GMEA 1HA8A 4JRQA 2LY1A 4M45A 1Q82U 4K8XA 3RWUA 4XRSG 4G7ZF 1RUWA 3Q0UA 3ZXSA 5L23A 5AQIA 4CH7A 3RUXA 4QIWN 1EQYA 4E7HA 5GAEP 2BE2A 1KHCA 3HGYA 4JAXA 4RAZA 1HX1A 4OLAA 2YX6A 1N77A 5DLQE 1NJZA 2UUBK 5FKKA 1S29A 1JLGA 4BI4A 1TP4A 3OS2A 1XMOK 2GLOA 4LDXA 3UA7A 4ELTA 1P6RA 2XIGA 1NK8A 3OR1C 2Q1NA 4DF4A 3SEMA 2KYBA 1ZELA 3HSEA 2KKOA 1R8OB 1PP7U 1R6RA 2KT8A 4BGBA 4FW1A 2M4KA 2P9NB 1Z9ZA 3BF3A 4M75G 3C7JA 2PJRB 2LX9A 3QO3A 1FTZA 1MJBA 5L3DA 3R3LA 1T2KA 3ZT4A 5GAN7 3IRQA 3HPWA 2KRHA 1VYVA 2DAQA 4GCVA 4F55A 3W6JB 2FOKA 1IF1A 3H8ZA 3SZGA 4TSXA 1BJAA 3PT9A 2R5AA 2O0YA 3H9GA 3FMSA 5DEQA 5CLSA 3OMCA 4M3DA 5CVJA 5FJ8J 4M77F 1Q82O 3Q0VA 4F7UG 5I3UA 1VYTA 2XGCA 3A1PA 3BTCA 1RILA 2QQ8A 2VONA 3KK2A 3JCMJ 4C2MJ 4FT4A 3RMDA 5DCMB 1RLPC 1UG0A 2D8JA 1IXCA 5K1YA 3OWTA 2MH9A 2KHMA 5ERIA 1QVFS 4HF1A 5SZTA 2BY3A 3T1HK 2B86A 4G94A 1B59A 2RQUA 4HCBA 2ZGYA 4O0IA 1VQMI 1AZGB 4CF9A 1G2HA 4KICA 4KH6A 2KQRA 2WUSA 3QIOA 3BG5A 3KTUA 3I56I 3VQDA 4I2PA 4J6WA 2M45A 3LDLA 4FJMA 1BHLA 1MDUB 2A5WA 4KHPK 4B9MA 2HL5C 2XY5A 4B9UA 3H5RA 1N5ZA 2R7ZJ 1RBSA 4BRCA 3OBYA 3QZ9B 1WH7A 2SRCA 5GIOA 2O8DB 2X6XA 2G3RA 3WUHA 4WF2A 3BPVA 2KEAA 3WTXC 2Q0OA 3RKWA 4H4OA 2K57A 3HOWJ 3K4JA 2NRXA 4I9LA 4DFMA 3FZFA 1BW6A 1IC8A 4AVZA 5DS9A 2MLKA 3ERED 1JLAA 4BDPA 2YRVA 4LSNA 3CM5A 2LBFB 2KQ2A 1JHFA 1ZYQA 2WAQN 3CBPA 3I0WA 2VE9A 3VQ9A 2HMIA 2CUBA 4FZZA 2EHGA 2MMPA 3I9QA 2W82A 1SVLA 1BU1A 5M1KA 1QVPA 1ESVA 4Y0WA 1JLEA 2D1HA 1IUFA 3C6TA 2R58A 3CCLT 3D1NI 3D7EO 3C6UA 3NWSA 2E2PA 1S3JA 3TAMA 1XS9A 1VQNI 4A62A 5HVQC 3SDGA 5E8IA 3IP4B 4HKEA 4BC5A 5ICGA 3FKJA 3HHHA 4F93B 5KYXB 3QPLA 5GAN8 4NC7A 4O5BA 5BR9A 2JA6J 5GAMf 3T7ZA 4KT6A 3NVMA 2FZGB 1FP1D 1S7EA 3JRAA 3PMTA 4L0ZB 1QQOA 3K2AA 4PFPA 3V7SA 5DM7F 3CCLN 3G4SQ 2OQRA 3SDBA 3OR2C 1A5JA 4EGYA 1KD1C 2R5ZA 4KDPA 2JTEA 2PZ1A 4DBHA 4XKBA 4MQ9F 3CUQA 1Y71A 1R22A 1MUZA 1NLVA 2P6TA 1JE8A 4OKJA 4HA8A 2QWPA 4EJYA 1EETA 4RA2A 5F0FA 4PWDA 2L01A 1SVMA 2XGXA 1CLQA 1WJRA 2OPPA 2Z1HA 2JRTA 4ITVA 3HKSA 2E2OA 4X6AJ 2EH3A 2JHNA 1V54H 2QKKA 2CUDA 2OTJI 2VOOA 1M3AA 2QSFX 3GOIA 4QVZA 4OVLA 2QQ9A 4E6KG 5KTQA 1EA3A 2HKOA 2KJCA 3GZ5A 4B1XB 5ICEA 3FEOA 2A28A 2XDBA 5EGOB 3DTIA 2UWMA 1MH4A 4QTRA 4M77G 3A02A 3R60A 3LWHA 2DXBA 1QVTA 3K10A 2QDLA 1SQKA 1FT9A 2VQGA 4O44A 4CCKA 1LVAA 5IOZA 5GAN5 2QQBA 3U23A 1K78A 2OZ6A 2IAJA 3V9UA 4AI5A 1QVGP 3LZIA 1XUPO 3SZPA 4JQFA 3LFKA 3VQ6A 1RR7A 2QGGA 2J5OA 4E1JA 2OV7A 5EDNA 5TKWA 2WAEA 2FBYA 3ECHA 4JKAA 4LF7K 1FIPA 3FXJA 3M59A 2MSYA 1U5SA 3DLEA 4IF4A 5LRSA 4CK2A 3TWHA 4HLXA 3KD5E 2ZO4A 2P5GA 1OZ3A 5DUKA 3TR8A 4A2UA 1J59A 5EEAA 1KQ8A 2VKDA 4MNUA 1GDTA 3EN9A 4C1NI 3HM9A 5AQRA 3TBIA 2AIRB 2MG4A 2R7UA 4BS9A 1IG9A 3M0SA 2DMOA 3M4OJ 1ZUUA 4ILGB 2O4IA 2NVYJ 3SAGA 3IWZA 2OD5A 4UVCA 2BV6A 1IB8A 2XKOA 3TREA 4YFUA 4Y91A 3J7AF 4C92A 1H9TA 1ONVA 1YITA 4FPAA 3CMAA 2CDTA 3ZEUB 2H27A 1X69A 2G8VA 2KL4A 1M90U 4M7YA 3CCYA 2H56A 4EEFG 4FJHA 5C12A 1REPC 1X9SA 1XDSA 4FM1A 2CP2A 3DWLE 4CO8A 1OCTC 3I55A 1K9MR 3F5TA 2KRCA 4BEHA 2HL3A 2STTA 3ZSQA 2QSHX 1ZUKA 4N4HA 3AVAA 3LZJA 2O8XA 1O3SA 2A69F 2IP2A 5FPMA 4BUPA 3CCRQ 4NO7A 1WJBA 2F4MB 2VXFA 2O4XA 1UGVA 4V2SA 2OPRA 3M53A 1BC8C 2COMA 1Y64A 2K3YA 5E3NA 5F1XA 5GIPA 5AZIA 1KLNA 1HNVA 4BL0B 4GKJK 3BDUA 1TWHJ 2FU4A 5E3LA 2P9SB 3V9XA 2DA1A 3DRPA 3MVPA 2V1XA 1ATNA 4W97A 4IZ9A 4N41A 3RMBA 5IHNA 4XLFA 3HSFA 1ZLJA 3TQ7P 1KU9A 3WE3A 5F1RA 1T3LA 2M0MA 4J83A 1VQ5T 3SUQA 4GBQA 3G71Q 4EA5A 2JS2A 5A0DA 4FZXC 1R1UA 5M5WJ 1M90O 1Q18A 3KEYA 4HRIA 4CGDA 3CC2Q 2DJZA 4F17A 3U9ZA 2ESWA 2QEXT 1LVKA 3IG1A 5IP6A 3E5UA 1YLFA 2EIKH 4GVEA 2A36A 4K11A 4O55A 4UVBA 3UATA 3C6HA 4JI8K 1VQ5N 2F9TA 1D5AA 1A5WA 2D1XA 4KNYA 2DY4A 3M8RA 2LVSA 4H4MA 1NG7A 1KLMA 3A8HB 1C6VA 1W0TA 4EMKB 4DYRA 4ILJA 3ASMA 4FT8A 4KPYA 3ZYYX 1YTAA 3AVMA 2QEXN 4B1WB 3CF5F 1YJWQ 4LFUA 3CCEQ 2EGEA 4KBOA 2Z33A 4MMKA 4C8QB 3PTAA 4F3OA 4CZLA 1J75A 1VRTA 3CCSA 3AFHA 3L2ZA 3EKSA 1BQNA 2F7TA 2MAMA 1LJ9A 1BA0A 1UWBA 3HL8A 4MTEA 3WE2A 4CFAA 4F52A 2W6KA 4CJPA 4OIPF 3CBMA 4MDWA 4HX7A 1RDWX 1M1KU 1A35A 2IGOA 4ESRA 4Z6YA 3TSQA 2DERA 5DUIA 2FPDA 2Y30A 1QVFP 2P84A 4IFEA 4HBLA 3VEPA 1FNNA 5EJCA 5KPZA 3QOEA 1UHCA 1TK5A 2XICA 4B44A 2BTTA 3TANA 3O5ZA 2CREA 4CHYA 4AHVA 3OSSC 2HHTA 1IXSB 4A61A 1XQPA 3KEOA 1KHIA 3TTCA 4IO9L 2E19A 3PVLA 1QVFA 5AQMA 3CCMT 3W6KB 4IG0A 3TL4X 4J2BA 1HJDA 1T33A 2LF8A 2YDLA 1SD6A 3ZMVA 3MDQA 3OYDA 4GLMA 2M30A 2DXTA 5T7BA 3UF4A 4M71A 2DA3A 2K9QA 2GV9A 1XSXA 2Z16A 4W5RA 4K2EA 3FSPA 3CP8A 2YR2A 4LJZF 2AS5F 4LFAK 1EJ9A 3COAC 1QPIA 4LOCA 3AVFA 2CH5A 2JWKA 4KIFA 3UPUA 3WTVC 3S2HJ 3I4PA 2Z1IA 2VASA 2G9WA 3NGZA 4IOXA 4JBAA 1BWFO 2HF3A 4CJ3A 4V19K 4DV5K 2KZMA 3CC4T 2Y69H 1EF4A 4YOVA 3CCMN 5EC7A 1WVRA 4K42A 4IG3A 1F4KA 2MFZA 2HTJA 1ATRA 5FLXZ 2HTSA 1FEXA 1VOMA 3BQYA 4KUDK 1M1KO 1X1PA 3H1CA 1W36D 1R9TJ 1HNXK 4N47A 4M7AC 2VI6A 4E7JA 1T8IA 2YSQA 2Z1DA 3M8JA 1MSEC 2BE5F 3NF7A 3DPTA 3LA3A 5D3GA 1W70A 4A2AA 1QQCA 3OW2S 3CLQA 1I1GA 1H88C 5LGNA 3CC4N 2UXCK 1D8YA 1SAUA 3M1EA 5JLWA 3ENHA 3U1DA 3G2BA 4IHVA 1NGNA 2O01E 1WNSA 2ITMA 1NK9A 2PYJA 2A1SA 3CTAA 5IY5H 3SK3A 1TAQA 5GMKm 4YHHK 4KI4A 1K73R 2HCKA 3CF5L 3UIQA 3KK1A 2HHXA 4FWNA 5AQVA 5DM6L 1UDLA 3X25B 5JVGF 2AQFA 4YY3K 3VWBA 3WNHA 1F43A 4KISA 1CXUA 3HUGB 2HOAA 3W0LA 2YXYA 3AO4A 4H5RA 4FVUA 2YX4A 1CQTA 1WAFA 1RR8C 4X64K 1DQUA 4NC6A 3VYGA 1NLOC 4CXFA 1JCGA 1QVGM 1J0RA 3SV3A 1L3SA 3J7YP 1YS6A 2MD0A 3SNNA 5CAIA 4RTXA 3MCPA 3MFKA 5BOXA 1LFPA 2A5XA 1Q81C 1CZ9A 4J8FA 1K9MC 1I8FA 3IMXA 2RN8A 1TSFA 2LMDA 4EM0B 2JSPA 1OEBA 1USSA 1WJ5A 1WJAA 4PL7A 4J19A 1OFCX 3M8PA 2D0OA 2PBIA 4CYDA 4JS5A 4BY6B 2HZTA 4NC8A 2C0OA 3DTEA 1T6CA 2O8BA 1RGIA 2FF6A 4MO4A 1D9FA 3REBB 2RAEA 2GFAA 2KYMA 3CJBA 4XKWA 3OS1A 5CVVA 4H0PA 2J7IA 2DTIA 3INZA 1YJNA 1F21A 4M78E 2H94A 2HSEB 3KIOA 4Y92A 3CMEQ 1YJ9A 2VXEA 3SMSA 1GLDG 5GADJ 1WBDA 4NLCA 4KIGA 2ZKZA 2R7TA 5F08A 3U9GA 2R7RA 2RDPA 1RABB 1P7JA 4RBOA 2Z1JA 3H0HA 4B3AA 3MEWA 1E0EA 1S7OA 4KFCA 4B08A 2W04A 3PM1A 2X4HA 2ELJA 3ATVA 2IPQX 3OJSA 4CEDA 4Z88A 3A98A 4OWRB 3TP3A 4DTRA 4DQ2A 2V7YA 1VSEA 2Y48A 4D7NA 3VV0A 1FKPA 1MKMA 2EZLA 5EEHA 4AIKA 4IOCF 4OJRA 3VQBA 1LMZA 4BVPA 2E64A 3F8CA 3R6NA 1OX8A 3CLOA 3WTZA 4FWKA 2A1RA 4PA1A 2QWOA 1F5TA 2CZ1B 2DFUA 4HF2A 4OB0B 2MA3A 3CO6C 4G7OF 3E9FA 3CC7Q 1FWZA 2VOPA 5KYWB 1RI7A 3Q0WA 4Y3OA 4KHUA 2Q2RA 3KLEA 1KG6A 4C0DC 4CRIA 5D5UB 2W85A 3OYEA 3DMJA 1KQSA 4BC2A 4RAGA 5GMKh 5AQPA 4QVCA 1N9SA 1SHFA 3WTUC 5L8RE 1NG9A 1GLCG 5C15A 5LJ3e 2DOFA 4DQPA 2QXFA 2WFBA 1DDNA 1B9NA 5BNGA 1DEJA 2W57A 4PIIA 4JLHA 3NGPA 1M2OA 2VQEK 1GBQA 2IEKA 3GW2A 4V2FA 1WJCA 4JK7A 3K5OA 1C1AA 1K8AU 3RSEA 1VQ8A 4FJ5A 4FWSA 3QDFA 2HFHA 2KZVA 1XTDA 2L9SA 3VEXA 1HXDA 4A6DA 4UVAA 1BL0A 5AFUA 2XUBA 1JT6A 5EXWA 2D0BA 2F96A 1U84A 5A2QZ 3L2WA 5C0MA 3SQ0A 1WHGA 5CVRA 4A5AA 4O0JA 2Z5UA 3E01A 1P90A 3NE6A 2X6WA 3FXRA 2X6NA 3GBQA 2BVLA 1KYZA 4C2UA 3D7SB 4A0YA 3MMYB 4ZN1A 1BG3A 3FC3A 1H92A 4IUVA 2GWJA 4RMOA 3PIPF 4YRVA 2FYKA 2EFIA 2ZPHB 2FBVA 4E47A 2HNHA 5DM7R 2M1HA 1B9DA 1WYXA 4IEIA 4DBQA 1GOBA 4FZYA 3H45C 3D2FB 2RI5A