4HSBA

S. pombe 3-methyladenine dna glycosylase-like protein mag2 bound to damaged dna
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
SDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Probable DNA-3-methyladenine glycosylase 2
publication title Non-productive DNA damage binding by DNA glycosylase-like protein Mag2 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe 972h-
total genus 74
structure length 205
sequence length 205
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4hsbA02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4hsbA01
1MUNA 3FHGA 1YQKA 1YQMA 1LWVA 4EJYA 4AI4A 2NOIA 4EA4A 1KG2A 1N3AA 1HU0A 3IH7A 4UNFA 1WEFA 1XQPA 1KG5A 3D4VA 3CWTA 4EJZA 4PIIA 3I0XA 1LWWA 1XG7A 3OH9A 4B21A 2NOHA 4EVVA 3CWSA 3CWUA 4E9GA 2I5WA 3S6IA 2JG6A 4B23A 1ORNA 1PVSA 1YQLA 4EW4A 5AN4A 2YG8A 4AI5A 1ORPA 2YG9A 4E9FA 1FN7A 1MUDA 1RRSA 1KG7A 5KN9A 1MPGA 3CW7A 1MUYA 1RRQA 5KN8A 4E9EA 4OFAA 1YQRA 1WEGA 4AIAA 4YOQA 1PU8A 1DIZA 4UOBA 1XQOA 2NOEA 2NOLA 1KG4A 1N39A 3N5NX 3FSPA 3FHFA 1PU6A 2XHIA 1PU7A 2NOBA 3I0WA 1WEIA 2ABKA 1M3QA 3F10A 4E9HA 2OFKA 2H56A 4EA5A 4YPRA 3N0UA 1LMZA 4DK9A 1P7MA 3G0QA 1KEAA 1N3CA 3F0ZA 3OH6A 4OFHA 1KG6A 3KNTA 4B24A 1EBMA 3IHOA 1KQJA 3OGDA 1KO9A 5CHZA 5DPKA 1M3HA 2OFIA 1NKUA 1LWYA 3CVTA 1P59A 4EW0A 4OFEA 2JHJA 2NOFA 1NGNA 4YPHA 3CWAA 4B22A 2NOZA 3KTUA 1VRLA 2JHNA 3CVSA 4HSBA 1KG3A
chains in the Genus database with same CATH superfamily
1MUNA 3OYBA 3OYFA 2W03A 3FHGA 3OYJA 1U84A 1YQKA 3OS2A 1YQMA 1LWVA 4EJYA 4AI4A 2NOIA 3OYGA 4EA4A 1KG2A 1N3AA 1HU0A 3IH7A 5FRNA 4UNFA 1WEFA 1XQPA 1KG5A 3D4VA 3CWTA 4EJZA 3OYEA 4PIIA 3I0XA 1LWWA 1XG7A 3OH9A 4B21A 4BDZA 4BDYA 4ZTFA 3R2XC 4E7IA 2NOHA 4EVVA 3CWSA 4E7JA 3CWUA 4E9GA 2I5WA 3S6IA 2JG6A 3L2QA 4B23A 1ORNA 1PVSA 4E7HA 3LCNA 3OY9A 1YQLA 4EW4A 4BE2A 5AN4A 2YG8A 4AI5A 3S3OA 1ORPA 2YG9A 4E9FA 3S3MA 1FN7A 1MUDA 1RRSA 5FROA 1KG7A 4BE0A 5KN9A 1MPGA 2JPSA 3CW7A 3L2WA 1MUYA 1RRQA 2W04A 4IKFA 5KN8A 4E9EA 3OYKA 3OYLA 4OFAA 1YQRA 1WEGA 4AIAA 3S3NA 3OYMA 4YOQA 1PU8A 1DIZA 4UOBA 1XQOA 2NOEA 2NOLA 1KG4A 4ZTJA 4E7KA 1N39A 3N5NX 3FSPA 3FHFA 3OYAA 1PU6A 2XHIA 1PU7A 3NNQA 5FRMA 2NOBA 3I0WA 1WEIA 2ABKA 1M3QA 3F10A 4E9HA 2OFKA 2H56A 4EA5A 4YPRA 3N0UA 1LMZA 4DK9A 4BACA 1P7MA 3G0QA 3VW4A 1KEAA 3L2UA 3OS0A 3OYCA 1N3CA 3OYNA 3OYHA 3F0ZA 4NZGA 3OH6A 4OFHA 3L2RA 1KG6A 3OS1A 3KNTA 4B24A 1EBMA 3OYDA 3IHOA 3L2VA 1KQJA 3OGDA 1KO9A 5CHZA 5DPKA 1M3HA 2OFIA 4E7LA 1NKUA 1LWYA 3CVTA 3OYIA 1P59A 4EW0A 4OFEA 2JHJA 2NOFA 1NGNA 4YPHA 3CWAA 4B22A 2NOZA 3KTUA 2V75A 1VRLA 4BE1A 2JHNA 3CVSA 4HSBA 1KG3A
chains in the Genus database with same CATH topology
1MUNA 3FHGA 1YQKA 1YQMA 1LWVA 4EJYA 4AI4A 2NOIA 4EA4A 1KG2A 1N3AA 1HU0A 3IH7A 4UNFA 1WEFA 1XQPA 1KG5A 3D4VA 3CWTA 4EJZA 4PIIA 3I0XA 1LWWA 1XG7A 3OH9A 4B21A 2NOHA 4EVVA 3CWSA 3CWUA 4E9GA 2I5WA 3S6IA 2JG6A 4B23A 1ORNA 1PVSA 1YQLA 4EW4A 5AN4A 2YG8A 4AI5A 1ORPA 2YG9A 4E9FA 1FN7A 1MUDA 1RRSA 1KG7A 5KN9A 1MPGA 3CW7A 1MUYA 1RRQA 5KN8A 4E9EA 4OFAA 1YQRA 1WEGA 4AIAA 4YOQA 1PU8A 1DIZA 4UOBA 1XQOA 2NOEA 2NOLA 1KG4A 1N39A 3N5NX 3FSPA 3FHFA 1PU6A 2XHIA 1PU7A 2NOBA 3I0WA 1WEIA 2ABKA 1M3QA 3F10A 4E9HA 2OFKA 2H56A 4EA5A 4YPRA 3N0UA 1LMZA 4DK9A 1P7MA 3G0QA 1KEAA 1N3CA 3F0ZA 3OH6A 4OFHA 1KG6A 3KNTA 4B24A 1EBMA 3IHOA 1KQJA 3OGDA 1KO9A 5CHZA 5DPKA 1M3HA 2OFIA 1NKUA 1LWYA 3CVTA 1P59A 4EW0A 4OFEA 2JHJA 2NOFA 1NGNA 4YPHA 3CWAA 4B22A 2NOZA 3KTUA 1VRLA 2JHNA 3CVSA 4HSBA 1KG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUN A;  3FHG A;  1YQK A;  1YQM A;  1LWV A;  4EJY A;  4AI4 A;  2NOI A;  4EA4 A;  1KG2 A;  1N3A A;  1HU0 A;  3IH7 A;  4UNF A;  1WEF A;  1XQP A;  1KG5 A;  3D4V A;  3CWT A;  4EJZ A;  4PII A;  3I0X A;  1LWW A;  1XG7 A;  3OH9 A;  4B21 A;  2NOH A;  4EVV A;  3CWS A;  3CWU A;  4E9G A;  2I5W A;  3S6I A;  2JG6 A;  4B23 A;  1ORN A;  1PVS A;  1YQL A;  4EW4 A;  5AN4 A;  2YG8 A;  4AI5 A;  1ORP A;  2YG9 A;  4E9F A;  1FN7 A;  1MUD A;  1RRS A;  1KG7 A;  5KN9 A;  1MPG A;  3CW7 A;  1MUY A;  1RRQ A;  5KN8 A;  4E9E A;  4OFA A;  1YQR A;  1WEG A;  4AIA A;  4YOQ A;  1PU8 A;  1DIZ A;  4UOB A;  1XQO A;  2NOE A;  2NOL A;  1KG4 A;  1N39 A;  3N5N X;  3FSP A;  3FHF A;  1PU6 A;  2XHI A;  1PU7 A;  2NOB A;  3I0W A;  1WEI A;  2ABK A;  1M3Q A;  3F10 A;  4E9H A;  2OFK A;  2H56 A;  4EA5 A;  4YPR A;  3N0U A;  1LMZ A;  4DK9 A;  1P7M A;  3G0Q A;  1KEA A;  1N3C A;  3F0Z A;  3OH6 A;  4OFH A;  1KG6 A;  3KNT A;  4B24 A;  1EBM A;  3IHO A;  1KQJ A;  3OGD A;  1KO9 A;  5CHZ A;  5DPK A;  1M3H A;  2OFI A;  1NKU A;  1LWY A;  3CVT A;  1P59 A;  4EW0 A;  4OFE A;  2JHJ A;  2NOF A;  1NGN A;  4YPH A;  3CWA A;  4B22 A;  2NOZ A;  3KTU A;  1VRL A;  2JHN A;  3CVS A;  4HSB A;  1KG3 A; 
#chains in the Genus database with same CATH topology
 1MUN A;  3OYB A;  3OYF A;  2W03 A;  3FHG A;  3OYJ A;  1U84 A;  1YQK A;  3OS2 A;  1YQM A;  1LWV A;  4EJY A;  4AI4 A;  2NOI A;  3OYG A;  4EA4 A;  1KG2 A;  1N3A A;  1HU0 A;  3IH7 A;  5FRN A;  4UNF A;  1WEF A;  1XQP A;  1KG5 A;  3D4V A;  3CWT A;  4EJZ A;  3OYE A;  4PII A;  3I0X A;  1LWW A;  1XG7 A;  3OH9 A;  4B21 A;  4BDZ A;  4BDY A;  4ZTF A;  3R2X C;  4E7I A;  2NOH A;  4EVV A;  3CWS A;  4E7J A;  3CWU A;  4E9G A;  2I5W A;  3S6I A;  2JG6 A;  3L2Q A;  4B23 A;  1ORN A;  1PVS A;  4E7H A;  3LCN A;  3OY9 A;  1YQL A;  4EW4 A;  4BE2 A;  5AN4 A;  2YG8 A;  4AI5 A;  3S3O A;  1ORP A;  2YG9 A;  4E9F A;  3S3M A;  1FN7 A;  1MUD A;  1RRS A;  5FRO A;  1KG7 A;  4BE0 A;  5KN9 A;  1MPG A;  2JPS A;  3CW7 A;  3L2W A;  1MUY A;  1RRQ A;  2W04 A;  4IKF A;  5KN8 A;  4E9E A;  3OYK A;  3OYL A;  4OFA A;  1YQR A;  1WEG A;  4AIA A;  3S3N A;  3OYM A;  4YOQ A;  1PU8 A;  1DIZ A;  4UOB A;  1XQO A;  2NOE A;  2NOL A;  1KG4 A;  4ZTJ A;  4E7K A;  1N39 A;  3N5N X;  3FSP A;  3FHF A;  3OYA A;  1PU6 A;  2XHI A;  1PU7 A;  3NNQ A;  5FRM A;  2NOB A;  3I0W A;  1WEI A;  2ABK A;  1M3Q A;  3F10 A;  4E9H A;  2OFK A;  2H56 A;  4EA5 A;  4YPR A;  3N0U A;  1LMZ A;  4DK9 A;  4BAC A;  1P7M A;  3G0Q A;  3VW4 A;  1KEA A;  3L2U A;  3OS0 A;  3OYC A;  1N3C A;  3OYN A;  3OYH A;  3F0Z A;  4NZG A;  3OH6 A;  4OFH A;  3L2R A;  1KG6 A;  3OS1 A;  3KNT A;  4B24 A;  1EBM A;  3OYD A;  3IHO A;  3L2V A;  1KQJ A;  3OGD A;  1KO9 A;  5CHZ A;  5DPK A;  1M3H A;  2OFI A;  4E7L A;  1NKU A;  1LWY A;  3CVT A;  3OYI A;  1P59 A;  4EW0 A;  4OFE A;  2JHJ A;  2NOF A;  1NGN A;  4YPH A;  3CWA A;  4B22 A;  2NOZ A;  3KTU A;  2V75 A;  1VRL A;  4BE1 A;  2JHN A;  3CVS A;  4HSB A;  1KG3 A; 
#chains in the Genus database with same CATH homology
 1MUN A;  3FHG A;  1YQK A;  1YQM A;  1LWV A;  4EJY A;  4AI4 A;  2NOI A;  4EA4 A;  1KG2 A;  1N3A A;  1HU0 A;  3IH7 A;  4UNF A;  1WEF A;  1XQP A;  1KG5 A;  3D4V A;  3CWT A;  4EJZ A;  4PII A;  3I0X A;  1LWW A;  1XG7 A;  3OH9 A;  4B21 A;  2NOH A;  4EVV A;  3CWS A;  3CWU A;  4E9G A;  2I5W A;  3S6I A;  2JG6 A;  4B23 A;  1ORN A;  1PVS A;  1YQL A;  4EW4 A;  5AN4 A;  2YG8 A;  4AI5 A;  1ORP A;  2YG9 A;  4E9F A;  1FN7 A;  1MUD A;  1RRS A;  1KG7 A;  5KN9 A;  1MPG A;  3CW7 A;  1MUY A;  1RRQ A;  5KN8 A;  4E9E A;  4OFA A;  1YQR A;  1WEG A;  4AIA A;  4YOQ A;  1PU8 A;  1DIZ A;  4UOB A;  1XQO A;  2NOE A;  2NOL A;  1KG4 A;  1N39 A;  3N5N X;  3FSP A;  3FHF A;  1PU6 A;  2XHI A;  1PU7 A;  2NOB A;  3I0W A;  1WEI A;  2ABK A;  1M3Q A;  3F10 A;  4E9H A;  2OFK A;  2H56 A;  4EA5 A;  4YPR A;  3N0U A;  1LMZ A;  4DK9 A;  1P7M A;  3G0Q A;  1KEA A;  1N3C A;  3F0Z A;  3OH6 A;  4OFH A;  1KG6 A;  3KNT A;  4B24 A;  1EBM A;  3IHO A;  1KQJ A;  3OGD A;  1KO9 A;  5CHZ A;  5DPK A;  1M3H A;  2OFI A;  1NKU A;  1LWY A;  3CVT A;  1P59 A;  4EW0 A;  4OFE A;  2JHJ A;  2NOF A;  1NGN A;  4YPH A;  3CWA A;  4B22 A;  2NOZ A;  3KTU A;  1VRL A;  2JHN A;  3CVS A;  4HSB A;  1KG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...