4HSBA

S. pombe 3-methyladenine dna glycosylase-like protein mag2 bound to damaged dna
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
SDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable DNA-3-methyladenine glycosylase 2
publication title Non-productive DNA damage binding by DNA glycosylase-like protein Mag2 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe 972h-
molecule tags Hydrolase/dna
total genus 74
structure length 205
sequence length 205
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4hsbA02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4hsbA01
5CHZA 1M3QA 4B23A 1RRSA 1MUYA 2NOIA 4PIIA 1MUDA 4HSBA 1KG7A 1LWWA 1P59A 2JG6A 2OFIA 4UNFA 1N3AA 3N5NX 1XQPA 3S6IA 1PU6A 2YG8A 4UOBA 4EJYA 3I0XA 4AIAA 3G0QA 1NKUA 1KEAA 2NOBA 3CWAA 1DIZA 4E9GA 1RRQA 1YQLA 1WEFA 1KG4A 1PU7A 3F0ZA 4B24A 1KG2A 1EBMA 3IH7A 1PVSA 5KN9A 1KQJA 4EW0A 3IHOA 4DK9A 3CWTA 1N39A 2JHJA 1XQOA 3OGDA 4AI5A 4YPHA 1LWVA 3FHGA 4OFAA 4YOQA 3FSPA 4EW4A 4E9FA 3KNTA 1ORNA 1HU0A 1KG5A 1YQRA 1XG7A 2I5WA 1LWYA 1LMZA 3FHFA 2H56A 1ORPA 3D4VA 3F10A 2YG9A 4YPRA 3N0UA 1M3HA 1FN7A 4B22A 3I0WA 3CWSA 1NGNA 1KG3A 4EA5A 4OFEA 1MUNA 1WEGA 2NOZA 2NOLA 3CW7A 1KG6A 5AN4A 4OFHA 2XHIA 1KO9A 2JHNA 3OH6A 4AI4A 1MPGA 2ABKA 1YQKA 2NOHA 5DPKA 1WEIA 1VRLA 2OFKA 4EA4A 3CWUA 4B21A 2NOFA 1YQMA 3CVSA 1P7MA 4EVVA 1N3CA 3KTUA 3OH9A 2NOEA 4E9HA 5KN8A 1PU8A 4EJZA 3CVTA 4E9EA
chains in the Genus database with same CATH superfamily
3OYBA 5CHZA 2W03A 1M3QA 4B23A 1RRSA 3OS0A 1MUYA 2NOIA 4PIIA 1MUDA 4HSBA 1KG7A 1LWWA 1P59A 2JG6A 2V75A 2OFIA 4UNFA 3OY9A 1N3AA 3N5NX 1XQPA 4E7LA 3OYEA 3S6IA 1PU6A 3L2VA 2YG8A 4UOBA 4EJYA 3I0XA 4BE0A 4AIAA 3G0QA 1NKUA 3S3MA 1KEAA 2NOBA 3CWAA 4ZTFA 1DIZA 4E9GA 3OYDA 1RRQA 3OYNA 1YQLA 4ZTJA 1WEFA 4IKFA 1KG4A 3S3NA 1PU7A 4BDYA 3F0ZA 4B24A 1KG2A 3OYCA 3NNQA 3OYAA 1EBMA 3IH7A 1PVSA 4BDZA 4E7HA 4NZGA 5KN9A 2JPSA 3OYIA 3OYJA 1KQJA 3L2RA 4EW0A 3OYLA 3IHOA 4DK9A 3CWTA 1N39A 2JHJA 1XQOA 5FROA 3OGDA 4AI5A 4YPHA 1LWVA 3FHGA 4OFAA 4YOQA 3FSPA 4EW4A 4E9FA 3KNTA 1ORNA 1HU0A 1KG5A 4E7IA 1YQRA 1XG7A 3L2QA 2I5WA 1LWYA 1LMZA 3OYHA 3FHFA 4E7KA 3OS2A 2H56A 1ORPA 4BE2A 3D4VA 3F10A 3OYMA 2W04A 2YG9A 3LCNA 4YPRA 3N0UA 1M3HA 1FN7A 5FRMA 4B22A 3I0WA 3CWSA 1NGNA 1KG3A 4BACA 4EA5A 4OFEA 3OYKA 1MUNA 1WEGA 2NOZA 2NOLA 3CW7A 1KG6A 5AN4A 4OFHA 2XHIA 1KO9A 4BE1A 2JHNA 3OH6A 3L2UA 5FRNA 1U84A 4AI4A 3L2WA 1MPGA 2ABKA 4E7JA 1YQKA 2NOHA 3VW4A 3OYGA 5DPKA 1WEIA 1VRLA 2OFKA 4EA4A 3S3OA 3OYFA 3CWUA 4B21A 2NOFA 1YQMA 3CVSA 1P7MA 4EVVA 1N3CA 3KTUA 3OH9A 2NOEA 3OS1A 4E9HA 5KN8A 1PU8A 4EJZA 3R2XC 3CVTA 4E9EA
chains in the Genus database with same CATH topology
5CHZA 1M3QA 4B23A 1RRSA 1MUYA 2NOIA 4PIIA 1MUDA 4HSBA 1KG7A 1LWWA 1P59A 2JG6A 2OFIA 4UNFA 1N3AA 3N5NX 1XQPA 3S6IA 1PU6A 2YG8A 4UOBA 4EJYA 3I0XA 4AIAA 3G0QA 1NKUA 1KEAA 2NOBA 3CWAA 1DIZA 4E9GA 1RRQA 1YQLA 1WEFA 1KG4A 1PU7A 3F0ZA 4B24A 1KG2A 1EBMA 3IH7A 1PVSA 5KN9A 1KQJA 4EW0A 3IHOA 4DK9A 3CWTA 1N39A 2JHJA 1XQOA 3OGDA 4AI5A 4YPHA 1LWVA 3FHGA 4OFAA 4YOQA 3FSPA 4EW4A 4E9FA 3KNTA 1ORNA 1HU0A 1KG5A 1YQRA 1XG7A 2I5WA 1LWYA 1LMZA 3FHFA 2H56A 1ORPA 3D4VA 3F10A 2YG9A 4YPRA 3N0UA 1M3HA 1FN7A 4B22A 3I0WA 3CWSA 1NGNA 1KG3A 4EA5A 4OFEA 1MUNA 1WEGA 2NOZA 2NOLA 3CW7A 1KG6A 5AN4A 4OFHA 2XHIA 1KO9A 2JHNA 3OH6A 4AI4A 1MPGA 2ABKA 1YQKA 2NOHA 5DPKA 1WEIA 1VRLA 2OFKA 4EA4A 3CWUA 4B21A 2NOFA 1YQMA 3CVSA 1P7MA 4EVVA 1N3CA 3KTUA 3OH9A 2NOEA 4E9HA 5KN8A 1PU8A 4EJZA 3CVTA 4E9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHZ A;  1M3Q A;  4B23 A;  1RRS A;  1MUY A;  2NOI A;  4PII A;  1MUD A;  4HSB A;  1KG7 A;  1LWW A;  1P59 A;  2JG6 A;  2OFI A;  4UNF A;  1N3A A;  3N5N X;  1XQP A;  3S6I A;  1PU6 A;  2YG8 A;  4UOB A;  4EJY A;  3I0X A;  4AIA A;  3G0Q A;  1NKU A;  1KEA A;  2NOB A;  3CWA A;  1DIZ A;  4E9G A;  1RRQ A;  1YQL A;  1WEF A;  1KG4 A;  1PU7 A;  3F0Z A;  4B24 A;  1KG2 A;  1EBM A;  3IH7 A;  1PVS A;  5KN9 A;  1KQJ A;  4EW0 A;  3IHO A;  4DK9 A;  3CWT A;  1N39 A;  2JHJ A;  1XQO A;  3OGD A;  4AI5 A;  4YPH A;  1LWV A;  3FHG A;  4OFA A;  4YOQ A;  3FSP A;  4EW4 A;  4E9F A;  3KNT A;  1ORN A;  1HU0 A;  1KG5 A;  1YQR A;  1XG7 A;  2I5W A;  1LWY A;  1LMZ A;  3FHF A;  2H56 A;  1ORP A;  3D4V A;  3F10 A;  2YG9 A;  4YPR A;  3N0U A;  1M3H A;  1FN7 A;  4B22 A;  3I0W A;  3CWS A;  1NGN A;  1KG3 A;  4EA5 A;  4OFE A;  1MUN A;  1WEG A;  2NOZ A;  2NOL A;  3CW7 A;  1KG6 A;  5AN4 A;  4OFH A;  2XHI A;  1KO9 A;  2JHN A;  3OH6 A;  4AI4 A;  1MPG A;  2ABK A;  1YQK A;  2NOH A;  5DPK A;  1WEI A;  1VRL A;  2OFK A;  4EA4 A;  3CWU A;  4B21 A;  2NOF A;  1YQM A;  3CVS A;  1P7M A;  4EVV A;  1N3C A;  3KTU A;  3OH9 A;  2NOE A;  4E9H A;  5KN8 A;  1PU8 A;  4EJZ A;  3CVT A;  4E9E A; 
#chains in the Genus database with same CATH topology
 3OYB A;  5CHZ A;  2W03 A;  1M3Q A;  4B23 A;  1RRS A;  3OS0 A;  1MUY A;  2NOI A;  4PII A;  1MUD A;  4HSB A;  1KG7 A;  1LWW A;  1P59 A;  2JG6 A;  2V75 A;  2OFI A;  4UNF A;  3OY9 A;  1N3A A;  3N5N X;  1XQP A;  4E7L A;  3OYE A;  3S6I A;  1PU6 A;  3L2V A;  2YG8 A;  4UOB A;  4EJY A;  3I0X A;  4BE0 A;  4AIA A;  3G0Q A;  1NKU A;  3S3M A;  1KEA A;  2NOB A;  3CWA A;  4ZTF A;  1DIZ A;  4E9G A;  3OYD A;  1RRQ A;  3OYN A;  1YQL A;  4ZTJ A;  1WEF A;  4IKF A;  1KG4 A;  3S3N A;  1PU7 A;  4BDY A;  3F0Z A;  4B24 A;  1KG2 A;  3OYC A;  3NNQ A;  3OYA A;  1EBM A;  3IH7 A;  1PVS A;  4BDZ A;  4E7H A;  4NZG A;  5KN9 A;  2JPS A;  3OYI A;  3OYJ A;  1KQJ A;  3L2R A;  4EW0 A;  3OYL A;  3IHO A;  4DK9 A;  3CWT A;  1N39 A;  2JHJ A;  1XQO A;  5FRO A;  3OGD A;  4AI5 A;  4YPH A;  1LWV A;  3FHG A;  4OFA A;  4YOQ A;  3FSP A;  4EW4 A;  4E9F A;  3KNT A;  1ORN A;  1HU0 A;  1KG5 A;  4E7I A;  1YQR A;  1XG7 A;  3L2Q A;  2I5W A;  1LWY A;  1LMZ A;  3OYH A;  3FHF A;  4E7K A;  3OS2 A;  2H56 A;  1ORP A;  4BE2 A;  3D4V A;  3F10 A;  3OYM A;  2W04 A;  2YG9 A;  3LCN A;  4YPR A;  3N0U A;  1M3H A;  1FN7 A;  5FRM A;  4B22 A;  3I0W A;  3CWS A;  1NGN A;  1KG3 A;  4BAC A;  4EA5 A;  4OFE A;  3OYK A;  1MUN A;  1WEG A;  2NOZ A;  2NOL A;  3CW7 A;  1KG6 A;  5AN4 A;  4OFH A;  2XHI A;  1KO9 A;  4BE1 A;  2JHN A;  3OH6 A;  3L2U A;  5FRN A;  1U84 A;  4AI4 A;  3L2W A;  1MPG A;  2ABK A;  4E7J A;  1YQK A;  2NOH A;  3VW4 A;  3OYG A;  5DPK A;  1WEI A;  1VRL A;  2OFK A;  4EA4 A;  3S3O A;  3OYF A;  3CWU A;  4B21 A;  2NOF A;  1YQM A;  3CVS A;  1P7M A;  4EVV A;  1N3C A;  3KTU A;  3OH9 A;  2NOE A;  3OS1 A;  4E9H A;  5KN8 A;  1PU8 A;  4EJZ A;  3R2X C;  3CVT A;  4E9E A; 
#chains in the Genus database with same CATH homology
 5CHZ A;  1M3Q A;  4B23 A;  1RRS A;  1MUY A;  2NOI A;  4PII A;  1MUD A;  4HSB A;  1KG7 A;  1LWW A;  1P59 A;  2JG6 A;  2OFI A;  4UNF A;  1N3A A;  3N5N X;  1XQP A;  3S6I A;  1PU6 A;  2YG8 A;  4UOB A;  4EJY A;  3I0X A;  4AIA A;  3G0Q A;  1NKU A;  1KEA A;  2NOB A;  3CWA A;  1DIZ A;  4E9G A;  1RRQ A;  1YQL A;  1WEF A;  1KG4 A;  1PU7 A;  3F0Z A;  4B24 A;  1KG2 A;  1EBM A;  3IH7 A;  1PVS A;  5KN9 A;  1KQJ A;  4EW0 A;  3IHO A;  4DK9 A;  3CWT A;  1N39 A;  2JHJ A;  1XQO A;  3OGD A;  4AI5 A;  4YPH A;  1LWV A;  3FHG A;  4OFA A;  4YOQ A;  3FSP A;  4EW4 A;  4E9F A;  3KNT A;  1ORN A;  1HU0 A;  1KG5 A;  1YQR A;  1XG7 A;  2I5W A;  1LWY A;  1LMZ A;  3FHF A;  2H56 A;  1ORP A;  3D4V A;  3F10 A;  2YG9 A;  4YPR A;  3N0U A;  1M3H A;  1FN7 A;  4B22 A;  3I0W A;  3CWS A;  1NGN A;  1KG3 A;  4EA5 A;  4OFE A;  1MUN A;  1WEG A;  2NOZ A;  2NOL A;  3CW7 A;  1KG6 A;  5AN4 A;  4OFH A;  2XHI A;  1KO9 A;  2JHN A;  3OH6 A;  4AI4 A;  1MPG A;  2ABK A;  1YQK A;  2NOH A;  5DPK A;  1WEI A;  1VRL A;  2OFK A;  4EA4 A;  3CWU A;  4B21 A;  2NOF A;  1YQM A;  3CVS A;  1P7M A;  4EVV A;  1N3C A;  3KTU A;  3OH9 A;  2NOE A;  4E9H A;  5KN8 A;  1PU8 A;  4EJZ A;  3CVT A;  4E9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...