3NNQA

Crystal structure of the n-terminal domain of moloney murine leukemia virus integrase, northeast structural genomics consortium target or3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
95
Chain Sequence
HFHYTVTDIKDLTKLGAIYDKTKKYWVYQGKPVMPDQFTFELLDFLHQLTHLSFSKMKALLERSHSPYYMLNRDRTLKNITETCKACAQVNASKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-terminal domain of Moloney murine leukemia virus integrase
publication title X-ray crystal structure of the N-terminal region of Moloney murine leukemia virus integrase and its implications for viral DNA recognition.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Viral protein
total genus 29
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3nnqA00
3OYMA 3OYKA 3OY9A 4BE0A 3OYIA 5FRNA 4BDZA 5FROA 3OYAA 3OYBA 4E7IA 4ZTFA 3OYLA 3OYJA 3L2WA 3NNQA 4E7HA 4E7LA 3L2VA 4BE2A 3OS2A 3OYDA 3L2RA 4BDYA 4NZGA 5FRMA 4BE1A 3L2QA 3OYCA 3OYEA 3S3MA 4ZTJA 3OYGA 3OYFA 4E7KA 4BACA 3OYNA 3OYHA 3S3OA 3OS0A 3S3NA 3OS1A 3L2UA 4E7JA 4IKFA
chains in the Genus database with same CATH superfamily
3OYMA 4UOBA 5FRNA 4BDZA 3R2XC 2XHIA 5FROA 1KG6A 1KG7A 4E7IA 1P59A 3LCNA 1XQPA 3NNQA 4OFAA 3FSPA 1DIZA 3I0XA 4BE2A 3FHGA 3I0WA 3OH9A 1RRQA 5FRMA 3L2QA 3OYCA 1KG5A 2JG6A 1KG3A 3IHOA 3S3MA 3N5NX 1ORNA 3CVTA 1KG2A 2W04A 1YQMA 4AI5A 4OFEA 4EVVA 4AIAA 4AI4A 2ABKA 5CHZA 3CWSA 3OY9A 2JHNA 2W03A 3IH7A 4EA5A 3OYAA 2NOEA 4EJYA 3CVSA 3D4VA 3OYLA 3OYJA 4E7HA 1WEGA 4E7LA 3OH6A 1EBMA 4YOQA 3L2RA 1P7MA 1KO9A 3VW4A 4UNFA 3CW7A 1LWWA 1WEFA 3KNTA 2NOBA 3F10A 4ZTJA 4B21A 4YPHA 1NKUA 3OYNA 2H56A 4PIIA 4E9EA 3F0ZA 3S3NA 3S3OA 4E7JA 1XG7A 4B24A 1YQKA 3OYKA 1FN7A 1MUNA 4E9GA 5KN9A 1WEIA 2YG8A 4YPRA 4B23A 1KG4A 3OYBA 3CWTA 3S6IA 3CWUA 3N0UA 5AN4A 3OS2A 1M3QA 4BDYA 1NGNA 2NOHA 1N3AA 2V75A 4BE1A 4E9HA 3FHFA 3OYGA 1N3CA 1XQOA 4BACA 2NOLA 1YQLA 3OGDA 1MUYA 4E9FA 1MPGA 1PU6A 1HU0A 3OS0A 3KTUA 1VRLA 2I5WA 3L2UA 3CWAA 1RRSA 4IKFA 1M3HA 2NOFA 4EW0A 1LMZA 4BE0A 3OYIA 5DPKA 2NOZA 4ZTFA 4OFHA 1U84A 1ORPA 3L2WA 1LWYA 1PU7A 3L2VA 2NOIA 3OYDA 1KEAA 4EW4A 2JPSA 4NZGA 1KQJA 2OFKA 1PU8A 4DK9A 4EJZA 3OYEA 3OYFA 4E7KA 1N39A 4B22A 3G0QA 1LWVA 4HSBA 3OYHA 2OFIA 1YQRA 1PVSA 1MUDA 2JHJA 4EA4A 3OS1A 5KN8A 2YG9A
chains in the Genus database with same CATH topology
3OYMA 3OYKA 3OY9A 4BE0A 3OYIA 5FRNA 4BDZA 2W03A 5FROA 3OYAA 3OYBA 4E7IA 4ZTFA 3OYLA 3OYJA 3L2WA 3LCNA 3NNQA 4E7HA 4E7LA 3L2VA 4BE2A 3OS2A 3OYDA 3L2RA 4BDYA 2JPSA 4NZGA 2V75A 5FRMA 4BE1A 3L2QA 3OYCA 3OYEA 3S3MA 4ZTJA 3OYGA 3OYFA 2W04A 4E7KA 4BACA 3OYNA 3OYHA 3S3OA 3OS0A 3S3NA 3OS1A 3L2UA 4E7JA 4IKFA 3VW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYM A;  3OYK A;  3OY9 A;  4BE0 A;  3OYI A;  5FRN A;  4BDZ A;  5FRO A;  3OYA A;  3OYB A;  4E7I A;  4ZTF A;  3OYL A;  3OYJ A;  3L2W A;  3NNQ A;  4E7H A;  4E7L A;  3L2V A;  4BE2 A;  3OS2 A;  3OYD A;  3L2R A;  4BDY A;  4NZG A;  5FRM A;  4BE1 A;  3L2Q A;  3OYC A;  3OYE A;  3S3M A;  4ZTJ A;  3OYG A;  3OYF A;  4E7K A;  4BAC A;  3OYN A;  3OYH A;  3S3O A;  3OS0 A;  3S3N A;  3OS1 A;  3L2U A;  4E7J A;  4IKF A; 
#chains in the Genus database with same CATH topology
 3OYM A;  4UOB A;  5FRN A;  4BDZ A;  3R2X C;  2XHI A;  5FRO A;  1KG6 A;  1KG7 A;  4E7I A;  1P59 A;  3LCN A;  1XQP A;  3NNQ A;  4OFA A;  3FSP A;  1DIZ A;  3I0X A;  4BE2 A;  3FHG A;  3I0W A;  3OH9 A;  1RRQ A;  5FRM A;  3L2Q A;  3OYC A;  1KG5 A;  2JG6 A;  1KG3 A;  3IHO A;  3S3M A;  3N5N X;  1ORN A;  3CVT A;  1KG2 A;  2W04 A;  1YQM A;  4AI5 A;  4OFE A;  4EVV A;  4AIA A;  4AI4 A;  2ABK A;  5CHZ A;  3CWS A;  3OY9 A;  2JHN A;  2W03 A;  3IH7 A;  4EA5 A;  3OYA A;  2NOE A;  4EJY A;  3CVS A;  3D4V A;  3OYL A;  3OYJ A;  4E7H A;  1WEG A;  4E7L A;  3OH6 A;  1EBM A;  4YOQ A;  3L2R A;  1P7M A;  1KO9 A;  3VW4 A;  4UNF A;  3CW7 A;  1LWW A;  1WEF A;  3KNT A;  2NOB A;  3F10 A;  4ZTJ A;  4B21 A;  4YPH A;  1NKU A;  3OYN A;  2H56 A;  4PII A;  4E9E A;  3F0Z A;  3S3N A;  3S3O A;  4E7J A;  1XG7 A;  4B24 A;  1YQK A;  3OYK A;  1FN7 A;  1MUN A;  4E9G A;  5KN9 A;  1WEI A;  2YG8 A;  4YPR A;  4B23 A;  1KG4 A;  3OYB A;  3CWT A;  3S6I A;  3CWU A;  3N0U A;  5AN4 A;  3OS2 A;  1M3Q A;  4BDY A;  1NGN A;  2NOH A;  1N3A A;  2V75 A;  4BE1 A;  4E9H A;  3FHF A;  3OYG A;  1N3C A;  1XQO A;  4BAC A;  2NOL A;  1YQL A;  3OGD A;  1MUY A;  4E9F A;  1MPG A;  1PU6 A;  1HU0 A;  3OS0 A;  3KTU A;  1VRL A;  2I5W A;  3L2U A;  3CWA A;  1RRS A;  4IKF A;  1M3H A;  2NOF A;  4EW0 A;  1LMZ A;  4BE0 A;  3OYI A;  5DPK A;  2NOZ A;  4ZTF A;  4OFH A;  1U84 A;  1ORP A;  3L2W A;  1LWY A;  1PU7 A;  3L2V A;  2NOI A;  3OYD A;  1KEA A;  4EW4 A;  2JPS A;  4NZG A;  1KQJ A;  2OFK A;  1PU8 A;  4DK9 A;  4EJZ A;  3OYE A;  3OYF A;  4E7K A;  1N39 A;  4B22 A;  3G0Q A;  1LWV A;  4HSB A;  3OYH A;  2OFI A;  1YQR A;  1PVS A;  1MUD A;  2JHJ A;  4EA4 A;  3OS1 A;  5KN8 A;  2YG9 A; 
#chains in the Genus database with same CATH homology
 3OYM A;  3OYK A;  3OY9 A;  4BE0 A;  3OYI A;  5FRN A;  4BDZ A;  2W03 A;  5FRO A;  3OYA A;  3OYB A;  4E7I A;  4ZTF A;  3OYL A;  3OYJ A;  3L2W A;  3LCN A;  3NNQ A;  4E7H A;  4E7L A;  3L2V A;  4BE2 A;  3OS2 A;  3OYD A;  3L2R A;  4BDY A;  2JPS A;  4NZG A;  2V75 A;  5FRM A;  4BE1 A;  3L2Q A;  3OYC A;  3OYE A;  3S3M A;  4ZTJ A;  3OYG A;  3OYF A;  2W04 A;  4E7K A;  4BAC A;  3OYN A;  3OYH A;  3S3O A;  3OS0 A;  3S3N A;  3OS1 A;  3L2U A;  4E7J A;  4IKF A;  3VW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...