3NNQA

Crystal structure of the n-terminal domain of moloney murine leukemia virus integrase, northeast structural genomics consortium target or3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
95
Chain Sequence
HFHYTVTDIKDLTKLGAIYDKTKKYWVYQGKPVMPDQFTFELLDFLHQLTHLSFSKMKALLERSHSPYYMLNRDRTLKNITETCKACAQVNASKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords N-terminal domain of Moloney murine leukemia virus integrase
publication title X-ray crystal structure of the N-terminal region of Moloney murine leukemia virus integrase and its implications for viral DNA recognition.
pubmed doi rcsb
source organism Moloney murine leukemia virus
total genus 29
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3nnqA00
3OYIA 3S3NA 4BACA 3S3MA 5FRMA 4BDYA 3S3OA 4E7LA 4NZGA 3L2RA 4BE1A 3OYHA 3OS0A 3OS1A 5FRNA 4ZTFA 4ZTJA 3OYEA 3OYNA 3OS2A 3L2VA 4E7HA 4E7IA 5FROA 3OYKA 3OYMA 4IKFA 4BE2A 3OY9A 3L2QA 3L2UA 4BDZA 4BE0A 3OYDA 4E7JA 3OYBA 3OYAA 4E7KA 3NNQA 3OYLA 3OYFA 3L2WA 3OYCA 3OYJA 3OYGA
chains in the Genus database with same CATH superfamily
3FHGA 3KNTA 4B22A 4B23A 3S3MA 4EJYA 2V75A 4BE1A 1KG4A 3OYHA 2YG9A 3OS0A 4EA4A 3OH9A 2OFKA 1MUYA 4AIAA 3OYEA 2ABKA 3LCNA 5AN4A 3OS2A 4UNFA 2NOBA 1WEFA 4HSBA 1PU7A 1XG7A 3OYKA 3I0XA 2NOHA 4OFEA 1LMZA 4AI4A 1FN7A 3L2WA 1MPGA 3KTUA 1HU0A 1KO9A 2W04A 4BACA 5FRMA 3S3OA 4E7LA 1LWWA 1DIZA 3CW7A 3L2RA 4UOBA 1KEAA 1PU8A 3S6IA 1ORNA 1N39A 1PVSA 3D4VA 3CWTA 1LWVA 3OYMA 1NGNA 4IKFA 2JHNA 1YQMA 1LWYA 3L2UA 4BE0A 3IHOA 4E9FA 3OGDA 1KG7A 1XQOA 3NNQA 4YPRA 3I0WA 1N3CA 2JPSA 3CWAA 3CWSA 3OYCA 3OYIA 5DPKA 2NOFA 4OFHA 1WEIA 1XQPA 4EW4A 1RRQA 1NKUA 3N0UA 3OS1A 3OH6A 3CWUA 5FRNA 1ORPA 1M3HA 2JHJA 4B21A 3R2XC 4E9GA 3CVSA 4E7HA 4E7IA 1VRLA 3VW4A 4YOQA 2NOZA 4B24A 2NOEA 2I5WA 1KG6A 4DK9A 3F0ZA 1KG3A 5KN9A 3FHFA 4PIIA 3OY9A 3L2QA 4BDZA 2H56A 2YG8A 3OYDA 4E9HA 4EVVA 3OYBA 4EJZA 3IH7A 3OYAA 4EA5A 3F10A 1P59A 3N5NX 4OFAA 1RRSA 4EW0A 3OYJA 3OYGA 1M3QA 3CVTA 2NOIA 3S3NA 1P7MA 2W03A 4BDYA 4YPHA 1KG2A 4NZGA 1YQKA 5CHZA 4AI5A 4ZTFA 4E9EA 2XHIA 4ZTJA 1EBMA 3OYNA 2NOLA 1MUDA 2OFIA 3L2VA 1WEGA 2JG6A 5FROA 1KG5A 3G0QA 1PU6A 3FSPA 1KQJA 5KN8A 4E7JA 1YQRA 1MUNA 1U84A 4E7KA 1N3AA 3OYLA 3OYFA 4BE2A 1YQLA
chains in the Genus database with same CATH topology
3OYIA 3S3NA 4BACA 2W03A 3S3MA 5FRMA 4BDYA 2V75A 4E7LA 4NZGA 3S3OA 3L2RA 4BE1A 3OYHA 3OS0A 3OS1A 5FRNA 4ZTFA 4ZTJA 3OYEA 3OYNA 3LCNA 3OS2A 3L2VA 4E7HA 4E7IA 3VW4A 5FROA 3OYGA 3OYKA 3OYMA 4IKFA 4BE2A 3OY9A 3L2QA 3L2UA 4BDZA 4BE0A 3OYDA 4E7JA 3OYBA 3OYAA 4E7KA 3NNQA 3OYLA 3OYFA 2JPSA 3L2WA 3OYCA 3OYJA 2W04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYI A;  3S3N A;  4BAC A;  3S3M A;  5FRM A;  4BDY A;  3S3O A;  4E7L A;  4NZG A;  3L2R A;  4BE1 A;  3OYH A;  3OS0 A;  3OS1 A;  5FRN A;  4ZTF A;  4ZTJ A;  3OYE A;  3OYN A;  3OS2 A;  3L2V A;  4E7H A;  4E7I A;  5FRO A;  3OYK A;  3OYM A;  4IKF A;  4BE2 A;  3OY9 A;  3L2Q A;  3L2U A;  4BDZ A;  4BE0 A;  3OYD A;  4E7J A;  3OYB A;  3OYA A;  4E7K A;  3NNQ A;  3OYL A;  3OYF A;  3L2W A;  3OYC A;  3OYJ A;  3OYG A; 
#chains in the Genus database with same CATH topology
 3FHG A;  3KNT A;  4B22 A;  4B23 A;  3S3M A;  4EJY A;  2V75 A;  4BE1 A;  1KG4 A;  3OYH A;  2YG9 A;  3OS0 A;  4EA4 A;  3OH9 A;  2OFK A;  1MUY A;  4AIA A;  3OYE A;  2ABK A;  3LCN A;  5AN4 A;  3OS2 A;  4UNF A;  2NOB A;  1WEF A;  4HSB A;  1PU7 A;  1XG7 A;  3OYK A;  3I0X A;  2NOH A;  4OFE A;  1LMZ A;  4AI4 A;  1FN7 A;  3L2W A;  1MPG A;  3KTU A;  1HU0 A;  1KO9 A;  2W04 A;  4BAC A;  5FRM A;  3S3O A;  4E7L A;  1LWW A;  1DIZ A;  3CW7 A;  3L2R A;  4UOB A;  1KEA A;  1PU8 A;  3S6I A;  1ORN A;  1N39 A;  1PVS A;  3D4V A;  3CWT A;  1LWV A;  3OYM A;  1NGN A;  4IKF A;  2JHN A;  1YQM A;  1LWY A;  3L2U A;  4BE0 A;  3IHO A;  4E9F A;  3OGD A;  1KG7 A;  1XQO A;  3NNQ A;  4YPR A;  3I0W A;  1N3C A;  2JPS A;  3CWA A;  3CWS A;  3OYC A;  3OYI A;  5DPK A;  2NOF A;  4OFH A;  1WEI A;  1XQP A;  4EW4 A;  1RRQ A;  1NKU A;  3N0U A;  3OS1 A;  3OH6 A;  3CWU A;  5FRN A;  1ORP A;  1M3H A;  2JHJ A;  4B21 A;  3R2X C;  4E9G A;  3CVS A;  4E7H A;  4E7I A;  1VRL A;  3VW4 A;  4YOQ A;  2NOZ A;  4B24 A;  2NOE A;  2I5W A;  1KG6 A;  4DK9 A;  3F0Z A;  1KG3 A;  5KN9 A;  3FHF A;  4PII A;  3OY9 A;  3L2Q A;  4BDZ A;  2H56 A;  2YG8 A;  3OYD A;  4E9H A;  4EVV A;  3OYB A;  4EJZ A;  3IH7 A;  3OYA A;  4EA5 A;  3F10 A;  1P59 A;  3N5N X;  4OFA A;  1RRS A;  4EW0 A;  3OYJ A;  3OYG A;  1M3Q A;  3CVT A;  2NOI A;  3S3N A;  1P7M A;  2W03 A;  4BDY A;  4YPH A;  1KG2 A;  4NZG A;  1YQK A;  5CHZ A;  4AI5 A;  4ZTF A;  4E9E A;  2XHI A;  4ZTJ A;  1EBM A;  3OYN A;  2NOL A;  1MUD A;  2OFI A;  3L2V A;  1WEG A;  2JG6 A;  5FRO A;  1KG5 A;  3G0Q A;  1PU6 A;  3FSP A;  1KQJ A;  5KN8 A;  4E7J A;  1YQR A;  1MUN A;  1U84 A;  4E7K A;  1N3A A;  3OYL A;  3OYF A;  4BE2 A;  1YQL A; 
#chains in the Genus database with same CATH homology
 3OYI A;  3S3N A;  4BAC A;  2W03 A;  3S3M A;  5FRM A;  4BDY A;  2V75 A;  4E7L A;  4NZG A;  3S3O A;  3L2R A;  4BE1 A;  3OYH A;  3OS0 A;  3OS1 A;  5FRN A;  4ZTF A;  4ZTJ A;  3OYE A;  3OYN A;  3LCN A;  3OS2 A;  3L2V A;  4E7H A;  4E7I A;  3VW4 A;  5FRO A;  3OYG A;  3OYK A;  3OYM A;  4IKF A;  4BE2 A;  3OY9 A;  3L2Q A;  3L2U A;  4BDZ A;  4BE0 A;  3OYD A;  4E7J A;  3OYB A;  3OYA A;  4E7K A;  3NNQ A;  3OYL A;  3OYF A;  2JPS A;  3L2W A;  3OYC A;  3OYJ A;  2W04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...