3NNQA

Crystal structure of the n-terminal domain of moloney murine leukemia virus integrase, northeast structural genomics consortium target or3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
95
Chain Sequence
HFHYTVTDIKDLTKLGAIYDKTKKYWVYQGKPVMPDQFTFELLDFLHQLTHLSFSKMKALLERSHSPYYMLNRDRTLKNITETCKACAQVNASKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-terminal domain of Moloney murine leukemia virus integrase
publication title X-ray crystal structure of the N-terminal region of Moloney murine leukemia virus integrase and its implications for viral DNA recognition.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Viral protein
total genus 29
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3nnqA00
4BDZA 4BDYA 3OS2A 3L2WA 4NZGA 4IKFA 3L2VA 4BE2A 3S3OA 3OYIA 4E7KA 3OY9A 5FRMA 4ZTJA 3OYBA 4E7LA 3OYDA 3L2UA 3OS0A 4BACA 3L2QA 4E7HA 3OYCA 3OYGA 3OYMA 4BE0A 3OYFA 5FRNA 3NNQA 3OYAA 3S3NA 3OYKA 3OYJA 4E7JA 3OYEA 5FROA 4E7IA 3S3MA 3OYLA 3OYHA 3L2RA 4BE1A 3OS1A 4ZTFA 3OYNA
chains in the Genus database with same CATH superfamily
4B23A 1N3AA 1XQPA 1NGNA 1LWVA 1LWYA 4E7KA 1YQMA 2JPSA 2ABKA 4ZTJA 3CWTA 4E7LA 1LMZA 3L2UA 1KG2A 1LWWA 3FHFA 1M3QA 3OYMA 3OYGA 4BE0A 4EVVA 2NOHA 1EBMA 3F10A 4YPRA 4B21A 5AN4A 3S3NA 1KO9A 5KN9A 3OYKA 4UOBA 4E7JA 1PVSA 3CVSA 4UNFA 1KEAA 3OYLA 2JHNA 4OFEA 4BE1A 4AIAA 1RRQA 1YQRA 1WEGA 3KTUA 3CW7A 4B22A 1P59A 3OH9A 1KG6A 3S3OA 4HSBA 2NOZA 4OFHA 5FRMA 1NKUA 3IH7A 1DIZA 4BACA 4DK9A 4PIIA 3VW4A 1RRSA 4E7HA 2W04A 2NOFA 2W03A 3OYFA 3D4VA 1VRLA 2NOBA 1N3CA 5FRNA 4AI5A 3OH6A 4B24A 4E9GA 3OYJA 2YG8A 4YPHA 3OYEA 5FROA 1KG7A 1KQJA 3FSPA 3S3MA 5KN8A 3OYHA 4YOQA 3CWUA 5DPKA 1PU7A 4OFAA 3OS2A 3L2WA 4NZGA 4EW4A 2I5WA 4EJZA 3L2VA 4EA4A 3CWAA 1WEFA 3OYIA 3OY9A 1KG4A 1KG3A 1PU8A 4AI4A 3OS0A 2NOEA 1MUNA 3L2QA 1FN7A 5CHZA 2OFKA 4EA5A 1ORNA 3CWSA 1XG7A 3IHOA 1HU0A 3KNTA 3NNQA 1WEIA 1N39A 1YQLA 2JHJA 3F0ZA 4EW0A 4E7IA 3CVTA 4E9HA 3N0UA 2NOLA 1MUYA 3L2RA 3N5NX 3OYNA 1YQKA 1P7MA 4BDZA 4BDYA 4IKFA 2YG9A 2V75A 2OFIA 4BE2A 1U84A 4EJYA 3LCNA 3OYBA 3OYDA 1KG5A 1MPGA 1M3HA 3OYCA 3OGDA 2H56A 3G0QA 1ORPA 3R2XC 4E9FA 4E9EA 2JG6A 3OYAA 1XQOA 3S6IA 1PU6A 2XHIA 2NOIA 3I0XA 4ZTFA 3OS1A 3I0WA 1MUDA 3FHGA
chains in the Genus database with same CATH topology
4BDZA 4BDYA 3OS2A 3L2WA 4NZGA 4IKFA 2V75A 3L2VA 4BE2A 3S3OA 3OYIA 4E7KA 3OY9A 2JPSA 3LCNA 5FRMA 4ZTJA 3OYBA 4E7LA 3OYDA 3L2UA 3OS0A 4BACA 3L2QA 3VW4A 4E7HA 2W04A 3OYCA 3OYMA 3OYGA 2W03A 4BE0A 3OYFA 5FRNA 3NNQA 3OYAA 3S3NA 3OYKA 3OYJA 4E7JA 3OYEA 5FROA 4E7IA 3S3MA 3OYLA 3OYHA 3L2RA 4BE1A 3OS1A 4ZTFA 3OYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDZ A;  4BDY A;  3OS2 A;  3L2W A;  4NZG A;  4IKF A;  3L2V A;  4BE2 A;  3S3O A;  3OYI A;  4E7K A;  3OY9 A;  5FRM A;  4ZTJ A;  3OYB A;  4E7L A;  3OYD A;  3L2U A;  3OS0 A;  4BAC A;  3L2Q A;  4E7H A;  3OYC A;  3OYG A;  3OYM A;  4BE0 A;  3OYF A;  5FRN A;  3NNQ A;  3OYA A;  3S3N A;  3OYK A;  3OYJ A;  4E7J A;  3OYE A;  5FRO A;  4E7I A;  3S3M A;  3OYL A;  3OYH A;  3L2R A;  4BE1 A;  3OS1 A;  4ZTF A;  3OYN A; 
#chains in the Genus database with same CATH topology
 4B23 A;  1N3A A;  1XQP A;  1NGN A;  1LWV A;  1LWY A;  4E7K A;  1YQM A;  2JPS A;  2ABK A;  4ZTJ A;  3CWT A;  4E7L A;  1LMZ A;  3L2U A;  1KG2 A;  1LWW A;  3FHF A;  1M3Q A;  3OYM A;  3OYG A;  4BE0 A;  4EVV A;  2NOH A;  1EBM A;  3F10 A;  4YPR A;  4B21 A;  5AN4 A;  3S3N A;  1KO9 A;  5KN9 A;  3OYK A;  4UOB A;  4E7J A;  1PVS A;  3CVS A;  4UNF A;  1KEA A;  3OYL A;  2JHN A;  4OFE A;  4BE1 A;  4AIA A;  1RRQ A;  1YQR A;  1WEG A;  3KTU A;  3CW7 A;  4B22 A;  1P59 A;  3OH9 A;  1KG6 A;  3S3O A;  4HSB A;  2NOZ A;  4OFH A;  5FRM A;  1NKU A;  3IH7 A;  1DIZ A;  4BAC A;  4DK9 A;  4PII A;  3VW4 A;  1RRS A;  4E7H A;  2W04 A;  2NOF A;  2W03 A;  3OYF A;  3D4V A;  1VRL A;  2NOB A;  1N3C A;  5FRN A;  4AI5 A;  3OH6 A;  4B24 A;  4E9G A;  3OYJ A;  2YG8 A;  4YPH A;  3OYE A;  5FRO A;  1KG7 A;  1KQJ A;  3FSP A;  3S3M A;  5KN8 A;  3OYH A;  4YOQ A;  3CWU A;  5DPK A;  1PU7 A;  4OFA A;  3OS2 A;  3L2W A;  4NZG A;  4EW4 A;  2I5W A;  4EJZ A;  3L2V A;  4EA4 A;  3CWA A;  1WEF A;  3OYI A;  3OY9 A;  1KG4 A;  1KG3 A;  1PU8 A;  4AI4 A;  3OS0 A;  2NOE A;  1MUN A;  3L2Q A;  1FN7 A;  5CHZ A;  2OFK A;  4EA5 A;  1ORN A;  3CWS A;  1XG7 A;  3IHO A;  1HU0 A;  3KNT A;  3NNQ A;  1WEI A;  1N39 A;  1YQL A;  2JHJ A;  3F0Z A;  4EW0 A;  4E7I A;  3CVT A;  4E9H A;  3N0U A;  2NOL A;  1MUY A;  3L2R A;  3N5N X;  3OYN A;  1YQK A;  1P7M A;  4BDZ A;  4BDY A;  4IKF A;  2YG9 A;  2V75 A;  2OFI A;  4BE2 A;  1U84 A;  4EJY A;  3LCN A;  3OYB A;  3OYD A;  1KG5 A;  1MPG A;  1M3H A;  3OYC A;  3OGD A;  2H56 A;  3G0Q A;  1ORP A;  3R2X C;  4E9F A;  4E9E A;  2JG6 A;  3OYA A;  1XQO A;  3S6I A;  1PU6 A;  2XHI A;  2NOI A;  3I0X A;  4ZTF A;  3OS1 A;  3I0W A;  1MUD A;  3FHG A; 
#chains in the Genus database with same CATH homology
 4BDZ A;  4BDY A;  3OS2 A;  3L2W A;  4NZG A;  4IKF A;  2V75 A;  3L2V A;  4BE2 A;  3S3O A;  3OYI A;  4E7K A;  3OY9 A;  2JPS A;  3LCN A;  5FRM A;  4ZTJ A;  3OYB A;  4E7L A;  3OYD A;  3L2U A;  3OS0 A;  4BAC A;  3L2Q A;  3VW4 A;  4E7H A;  2W04 A;  3OYC A;  3OYM A;  3OYG A;  2W03 A;  4BE0 A;  3OYF A;  5FRN A;  3NNQ A;  3OYA A;  3S3N A;  3OYK A;  3OYJ A;  4E7J A;  3OYE A;  5FRO A;  4E7I A;  3S3M A;  3OYL A;  3OYH A;  3L2R A;  4BE1 A;  3OS1 A;  4ZTF A;  3OYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...