3OYNA

Crystal structure of the pfv n224h mutant intasome bound to magnesium and the insti mk2048
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oynA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oynA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oynA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oynA03
4E1MA 4CHNA 2YV0X 3AVJA 2L3RA 3VQ8A 3PX0A 1J53A 3OMGA 4OVAA 2E5QA 1LAVA 3SCXA 2OPSA 4RW8A 3S3MA 4E3SA 4M3XA 3NF8A 4KHWA 2VWKA 4QCLA 5HLFA 3CFPA 1KCFA 2XY8A 2KW4A 1TKTA 4B08A 3LANA 4RW4A 3T3FA 2BE2A 4QOZB 1JLQA 2PYLA 1BIZA 3ZT0A 3QEXA 3CM5A 1JLFA 4CHPA 3DMJA 4DSEA 4LH5A 4M45A 4N4HA 4FZZA 1MHNA 3HL8A 4FJIA 5IAYA 2QKBA 1XWLA 4DTNA 3NGYA 3T19A 3SD4A 4M41A 4NZGA 1S6PA 4N5SA 3QEPA 4KTQA 3FC3A 4RW7A 2IG0A 3RWUA 1XNIA 4E7IA 3LP2A 2XHBA 3U3YA 4E7HA 4AHSA 3V6DA 1EXQA 4CF2A 4DTOA 3DLMA 2IGIA 2HHVA 1XC9A 3AA3A 4E7JA 4CJTA 1IG9A 5IN1A 4CFDA 1VSMA 3V9WA 1TVRA 1KFDA 3SPZA 1L3VA 1GOCA 1UWBA 3K57A 4FLYA 3QKJA 4O55A 1S9EA 1S1UA 3QLHA 3M8PA 1LAWA 1U04A 1VSHA 5J1EA 5D6WA 2R5MA 1RT3A 2LVMA 4DQIA 5J2QA 2O4GA 1JLEA 2E6MA 1TAQA 2GV9A 5KGWA 4MFBA 3HK2A 1UA0A 4NS5A 4CHYA 5FRMA 2DTUA 2RF2A 1WNSA 3L3VA 4IUUA 3VQCA 3QEWA 3NGZA 2EX3A 4GW6A 1TKZA 1G5VA 1EETA 2FC0A 3OQ5A 3QERA 3AV9A 2RKIA 2L89A 3F9KA 3P1GA 4NCBA 3OYBA 4EZ9A 5T7BA 1NK5A 1S1TA 2RHUA 1A5WA 3DLHA 4CERA 1J54A 4FJ7A 1BHLA 3DB3A 2HB5A 4IUVA 3TAPA 3FFIA 3OYLA 2GUIA 4CEFA 3TARA 1UOCA 1WJSA 2F96A 4PY5A 3MXJA 5CZ2A 2HQEA 2FBXA 4AHUA 4Z4HA 3FLGA 1WSFA 3O3FA 1ZBLA 3MEDA 1BGXT 1MU2A 4B9TA 3DLEA 5J39A 2BUDA 3AA5X 4B9WA 1RTDA 1Z26A 4LY7A 3ZSXA 5KE3A 4OVLA 1VSFA 1XI1A 4XIUA 4OLBA 2D0CA 3V9XA 4GVMA 4QQ6A 3LZJA 4IFYA 1BQNA 1CLQA 1TL1A 2G8KA 2HNZA 1QE1A 4YNQA 4OKJA 4IUQA 2D0AA 3SUPA 3M8SA 3ASKA 4N76A 4O0JA 1CXQA 3QBYA 3DLGA 3LWLA 4FJHA 5E41A 2XK0A 4FJMA 3VQ7A 3DLKA 1SL0A 1RT5A 3OYKA 4HTUA 3K59A 4DSLA 1NJYA 2I5JA 3MECA 1HYSA 3U6FA 3DLBA 4PL6A 3LP3A 4X34A 2QQSA 3HVTA 4CJ5A 1SV5A 4IFVA 4DQQA 4RG8A 1X9MA 4G1QA 2L8DA 4JLHA 1CZBA 4CGJA 4EZ6A 3D45A 4CRIA 1JLBA 3LPTA 4BD3A 1HYVA 3M8QA 4F2RA 5KI6A 4CFBA 1WSJA 4DFPA 4NCGA 3AVNA 3WNFA 3CM6A 4CGGA 3OYGA 1C0MA 3K5NA 3NFAA 3KLFA 3ALYA 4DU3A 3V9ZA 2WACA 2BDPA 4KREA 3OA6A 2YNHA 3QNNA 3LDSA 4HCBA 3LX7A 4ELUA 1JL2A 4Y1CA 3VA0A 4CJ4A 3O8VA 2Y1JA 3ZSWA 4DQSA 2G8IA 4M3YA 3OS2A 3NBPA 3SJJA 1RT6A 3V9UA 3CFRA 2RHXA 1QSLA 4CJ3A 1YT3A 2P1JA 4I7FA 3UT1A 3PX6A 2X35A 2Z1IA 4BWJA 4M3UA 5J26A 2B4JA 3VN5A 1WSGA 1HRHA 3HPGA 4K8ZA 2HQXA 1J5OA 1LWEA 4KKOA 4BWMA 2HHTA 3TWHA 2F8SA 3NCIA 1O1WA 4CHOA 4KTZA 4W5OA 2YKNA 4DTRA 3HSTB 1D5AA 1HMVA 4FLVA 4O0IA 1TV6A 1FKPA 4DTPA 1DLOA 3MP6A 3V1OA 4CGIA 3NF6A 3H6ZA 3L42A 1WSIA 4KI6A 4IUTA 4CJVA 4KHYA 3KUFA 1KVBA 4IG0A 1T03A 3SQ0A 2HHWA 1TKDA 4E19A 2P0KA 1YTUA 4EP4A 3NTHA 2EQKA 4DQRA 5J2PA 4FLTA 3NF9A 2GF7A 4HUGA 3QO9A 2IDOA 1KLMA 3AVGA 4DS5A 2NUBA 2X6SA 4C5GA 1VSDA 4FVMA 3RRGA 1I39A 3HT3A 2IC3A 5HRPA 2XY6A 5M9OA 4O5BA 4FJJA 3LAKA 1BI4B 4DF8A 2HHUA 3C6UA 4A4EA 3F70A 3I8DA 3KIOA 1I3AA 3P5JA 3DOLA 2QKKA 5HROA 4OGCA 4DFJA 1IH7A 3DI6A 1D9DA 3QEVA 2LDMA 2WOMA 3FEOA 3O4NA 3WNGA 2G3RA 3AVCA 3LGFA 4CGDA 2OPPA 4JS4A 4B9LA 5KH6A 2NLUA 1RT7A 3IAYA 2K3XA 4R5PA 3IG1A 4Z4CA 4CF1A 2ZQBA 4AH9A 1BISA 4CIGA 3L8BA 3QJ6A 4DSFA 2G8VA 3HPOA 3SQ2A 3QNOA 1SSFA 3QIIA 2P5GA 2G8WA 1A5XA 4C8MA 2Z1GA 1KRPA 3SZ2A 1B9DA 1NK7A 1JXEA 1UAXA 2ZE2A 3VQEA 2XDPA 3KK1A 2OZMA 2GFUA 1S1WA 3NDKA 1BCMA 3OS1A 4B9XA 3MEEA 2OPRA 2LSNA 3VQAA 3BDPA 3K58A 4LSNA 2RHYA 3D0PA 4FL6A 2B5JA 3P83D 3MP8A 4FK4A 2HNYA 2P5OA 1RBRA 4MQ3A 1SL2A 1KSPA 3LPUA 4GY5A 4ID5A 3UIQA 4AHRA 1WN7A 4FZYA 4N41A 4DTXA 1VRUA 2VG6A 4OKKA 1FKOA 4CK3A 4AHCA 3HO1A 4N4IA 3KK3A 4DSKA 3ME9A 4DU4A 1Z25A 1LV5A 4I2PA 4NYNA 1W9HA 1RDDA 4RW9A 4FJXA 2EQUA 3MEWA 4C8LA 1CXUA 2VG7A 1D9FA 4I9QA 3AVBA 4CF0A 2RJDA 3OB9A 4M3ZA 1TGOA 3B6OA 4CJPA 1L3UA 5C0MA 3QETA 4FK2A 3I0SA 1REVA 2KTQA 3KKRA 2RJEA 3DLRA 4DWIA 3AO2A 3C95A 3HVRA 3NHGA 1X1PA 4CFCA 3PV8A 5KGXA 2G8FA 3RMAA 4I9LA 4CEDA 3PO4A 4BE0A 2BANA 4A4HA 1EKEA 4C8OA 4B3OA 3ASMA 4CCHA 4B8CA 4BACA 1WSHA 1J9AA 3H8ZA 3LH0A 4IG3A 3ZEHA 2BKDN 1HNIA 1SKRA 3KK2A 4OGEA 3ULDA 2PZSA 3K2PA 1RT4A 4N4GA 3DRSA 4C5HA 1ZYQA 4HCZA 3MEVA 1C1BA 4IUPA 1N5YA 2P51A 1RILA 1KFSA 2HMIA 4CFAA 2X78A 4H8KA 3QESA 4IURA 2O4XA 2BIVA 3PNWC 2RN2A 5FRNA 1UA1A 1YVUA 4CJEA 5KRSA 1W0HA 1S1XA 5FROA 4LH4A 2D5RA 5HRNA 1Q9XA 1D8YA 1DTTA 4AILC 3HJFA 2RPIA 4PLLA 3OYEA 3AA4A 3ZSYA 3ZSQA 4OPJA 4C5EA 3RR8A 4BDZA 2DY4A 2M1HA 1SUQA 4FJLA 2DIGA 1C1CA 1QSYA 3OYIA 3C6TA 3ZCMA 4LD6A 2OZSA 4CJUA 3OYJA 1HJRA 2PY5A 3ISNC 2EKOA 4KV8A 4Z02A 1L5UA 3O3GA 4FLZA 1RT2A 2F8TA 4CJRA 1QQCA 1Q9YA 4H4OA 3LAMA 1RTIA 4KB1A 3KLHA 2PYJA 2B6AA 3HXMA 3DRRA 1TKXA 4YFUA 4PLIA 2LRQA 3V1RA 1S1VA 3TAFA 4CGFA 2K3YA 4QW2A 1IKVA 4IDKA 3EYZA 3O4QA 2A1RA 2RHZA 4DF4A 1F21A 1QTMA 1OYXA 3NE6A 1WJRA 5HRSA 2IOCA 5CY4A 3SI6A 3KJVA 1XHZA 3P8DA 1JLAA 4Z4FA 4Y1DA 3AVKA 3PX4A 3AVAA 3MXMA 4OPKA 1ZBUA 3OYFA 4FXDA 3OS0A 3OYNA 3AVLA 3ZSOA 4LSLA 1KVCA 3SNNA 3HYFA 1NJZA 3OYMA 2W42A 2FBTA 2EQMA 1BL3A 3RR7A 3NNQA 4JS5A 1KLNA 2DFFA 4A4GA 4O4GA 4PA1A 4BDPA 4KI4A 2DFHA 4J2BA 4M3TA 4HHTA 2RJCA 4E7KA 4CESA 1WSEA 3S9HA 4KO0A 1WJQA 1HNVA 2HVHA 1TK5A 4L59A 4BDYA 3PO5A 4OJRA 4FM1A 2VWJA 1OZ3A 1RBTA 3BGRA 3FDRA 3DM2A 4DU1A 3NGIA 2LTOA 3NTKA 3QIOA 3T1AA 2X6NA 1NKCA 1H3ZA 3AO1A 2YHBA 4RG2A 2RI5A 1IKYA 4F3OA 5CZ1A 3S3NA 3RTVA 4KAZA 5HBMA 1FK9A 1JXBA 2R7YA 4FLWA 3LP0A 2QQRA 3S6WA 4B9SA 3OYHA 3M8RA 2G8HA 3QINA 4FW2A 3OY9A 1B92A 3L2UA 4HVJA 3I0RA 3VQDA 1L3SA 3AO4A 3PUFA 1X9WA 1C1AA 2JZ2A 2YRVA 1SKWA 4FYDA 4CHZA 2VYTA 3PMIA 3AO3A 4FK0A 1QS4A 5JS1A 3NH2A 3AA2A 5SWMA 4KHQA 2KQ2A 4FJ8A 1TK8A 3O3HA 1WLJA 5CIUA 1LW0A 1JKHA 1RTHA 3TI0A 4DTSA 4Q5VA 4B9MA 4J2EA 3G10A 2VG5A 1NKBA 1N27A 4DTMA 1Y97A 3HP9A 4F3TA 1HPZA 3SUNA 4FM0A 4TSXA 4ID1A 4JRPA 4CE9A 1ASVA 1EP4A 4M42A 3EZ5A 2FHDA 4DSJA 2JTFA 2JLEA 3AVIA 3V9SA 3ZT1A 4NCAA 1OI1A 2YKMA 3ZSRA 2Z1HA 3LZIA 4W5RA 1RTJA 4FM2A 2IAJA 2RO0A 3EY1A 2Q3SA 2HVIA 4QQGA 2RHIA 1KVAA 4CHQA 4FU6A 2XY5A 4CGHA 3NH1A 1RNHA 1Q8IA 3TAQA 1ZBHA 3LGLA 5HP1A 1WGSA 4BE1A 4FW1A 2M0OA 5FDLA 2IS3A 4LD0A 2E4LA 3E9GA 5C6SA 3NF7A 1ITGA 4ZTJA 3CEYA 4EP5A 2KZMA 3L2QA 3SYZA 3RMBA 4CF8A 4F2SA 2FBYA 1GOBA 3MEGA 3THVA 3F73A 4NYFA 4FJNA 3AO5A 5KCOA 4DFKA 2GFAA 3VQ5A 2M16A 2YHAA 1DTQA 3AVFA 1NJWA 1N6QA 3PMTA 4ICLA 3M9QA 1T8EA 4CIFA 5D3GA 3Q1JA 2F5KA 1U47A 3LYIA 4DLGA 1NK6A 2DFEA 3ZSZA 1HYZA 5KE2A 2OPQA 1S9GA 4O44A 5CYMA 4DTJA 3KLEA 2R57A 2YNGA 4KFBA 3NTIA 3HPHA 4AHVA 2HW3A 3KLGA 4ELVA 3DB4A 3VQBA 2X4XA 1WAJA 2PQWA 1VK0A 4CJFA 2ZD1A 2MWPA 1R0AA 1RBUA 1NKEA 2HNDA 4CK2A 3RRHA 3S3OA 2EHGA 4KHSA 4PQUA 4K8XA 3L2RA 2E6LA 4B9NA 2QK9A 1NOYA 3OMCA 3LALA 4E7LA 4C8NA 4EDUA 3RMCA 5K14A 1LW2A 1TAUA 3WNHA 4DS4A 4F4KA 4DG1A 3KD5E 4DLEA 2BGGA 4FLUA 1CZ9A 5I3UA 4KPYA 1RDAA 1QSSA 5CYQA 4FJ5A 3ZT2A 3V4IA 3LWMA 4FLXA 3MO8A 3VA3A 3LP1A 3QIPA 3CQ8A 2KZZA 4CF9A 1ZBIA 5DMRA 4I2QA 2OA8A 4A4FA 4Z0UA 1RT1A 1VSEA 1HQEA 1NK4A 2ETJA 1TK0A 4PUOA 3G0ZA 1RDCA 4OKEA 3HM9A 4E0DA 4CEQA 3AVMA 4W5NA 4N47A 1T05A 1G15A 2G8UA 4KHNA 5HRRA 4DSIA 3E01A 2R58A 3OJSA 2KFZA 4CEAA 1VSJA 5D6YA 2XY7A 1S5JA 2CKKA 3VQQA 3KTQA 1A5VA 4Z4GA 1RCHA 1RI0A 2D0BA 1JLGA 1K6YA 4DTUA 1YTAA 3DOKA 4Z4IA 3E9FA 2JGUA 1C0UA 1VSLA 3K5OA 5EU7A 3MXIA 2D9TA 1C6VA 4AHTA 1BIUA 3KLIA 4L8RB 3V1QA 4DMNA 3ZT3A 4KHUA 4OLAA 2XO7A 4E89A 1QHTA 4CJWA 2R5AA 4CJKA 4N56A 1B9FA 3GOXA 2O4IA 3WNEA 3ITHA 4CJSA 1NK0A 1VRTA 4ZTFA 4II1A 2ITGA 1EX4A 3TANA 3UWNA 2KFNA 1VSKA 4RW6A 3TAEA 2X74A 3RMDA 4F8RA 4H4MA 3SPYA 4FZXC 1U48A 1RDBA 4KTWA 5C42A 1BCOA 3DYAA 3VQ9A 1IKWA 3ZSVA 3B6PA 4FJ9A 1ASUA 2GBZA 3META 3VQ6A 1X9SA 4IKFA 1HQUA 4KB0A 5J2NA 4ELTA 4W5QA 3CFOA 4CEEA 2FBVA 2ATQA 1ASWA 2YNFA 1WAFA 4ZHRA 4PWDA 1U49A 1KTQA 3OYCA 1RBVA 4J2AA 1BI4A 1ZBFA 1U4BA 4QAGA 3SUOA 4CK1A 4GMJB 1IKXA 4Q5WA 3SQ4A 4B8AB 2RJFA 1NJXA 5JS2A 3PY8A 4UC4A 4CEZA 3SQ1A 3OYAA 3KD1E 2A1SA 5C24A 4HUFA 3OYDA 2HHSA 4BE2A 1LWFA 2QXFA 4HUEA 3K5MA 3MAQA 4WE1A 1JLCA 1IO2A 3MP1A 1C0TA 4J2DA 2DIQA 2O4XB 5D6XA 4CEOA 1L3TA 2X4WA 5J2MA 3U3GA 4CIEA 2X4YA 5C25A 2E6NA 2EQJA 3PFSA 3OJUA 4HCCA 4FJGA 2B8AA 3TR8A 2HHQA 2HHXA 1RBSA 4CECA 4W5TA 2MWOA 3KKSA 1NK8A 4Z4EA 3MEUA 3P8HA 3K5LA 4DQPA 4CJQA 4QQDA 1KHCA 3SV3A 2RI3A 3IS9A 3TAGA 1FXXA 5KRTA 2OYQA 3QEIA 4E1NA 3DRPA 5KCHA 1VSIA 4KRFA 3OVNA 5I42A 1SKSA 3BDLA 3HP6A 2YNIA 4M3RA 2WONA 3EAEA 1JL1A 1BQMA 1OZ2A 4CEBA 3A2FA 3TAMA 3CG7A 2AJQA 1T7PA 4QVZA 4Q0BA 3LLRA 2XRIA 2Z1JA 4IBNA 3H08A 1GOAA 2LCCA 3NAEA 3AVHA 3VQ4A 5DK5A 3ZT4A 4JRQA 3C4SA 4FJKA 3MEAA 2RI2A 1NOZA 1XHXA 4CJLA 4B9UA 4M3WA 3JYTA 5KTQA 2EFIA 2DAQA 1S6QA 3SV4A 3CYMA 3VQPA 3L2VA 4DFMA 5SZTA 2Y1IA 4FCYA 3SUQA 3NH0A 4UQGA 1SL1A 3V81A 3C94A 3IRXA 3L3UA 3L2WA 4C5IA 1NK9A 1LWCA 3JSMA 3TABA 4C8KA 4B9VA 1TL3A 1U45A
chains in the Genus database with same CATH superfamily
4K0KK 1Y07A 4HSTA 4Y4RA 4L9JA 4OVAA 2E5QA 1K7AA 1FZPB 4JNEA 1LAVA 1QQJA 4O3MA 4CZKA 2OPSA 4RW8A 4ON0A 2QA4A 4M3XA 5KVRA 1YITI 4KHWA 3R4KA 3BUZB 2VWKA 5EG0A 5AQNA 5HLFA 4YFNF 4O5FA 4CZHA 3CFPA 3SMPA 3T1YK 4DV3K 1TKTA 2LRDA 2R7OA 5D8LB 3T3FA 4JP0A 2X51A 4BEHB 2BE2A 4QOZB 2QWQA 1M1GA 4AG2C 1PC0A 3ZT0A 2XPWA 2NUTB 1NG2A 3E19A 2FPDA 1GLAG 2LT4A 3LDQA 2R7UA 5JLHA 3ABKH 4BHPA 4EV0A 2PG4A 1TYQB 1W36D 1K9AA 3E5XA 1OQYA 3DMJA 1LCUA 4XU2A 1KC8C 5AQVA 2L9SA 4A3KJ 6PAXA 2GNCA 4ZYAA 2F5TX 2AO9A 4U88A 2DRKA 3PIPL 4RGXA 5AQSA 1XWLA 4CI6A 2UU9K 4NZGA 1MSFC 3R8EA 1VQLN 5HY6A 3HRUA 3PVQA 2LH9A 2RN7A 1CSKA 1VQ6Q 2LLKA 2L9NA 5DM7F 3A8MB 1M1KU 4I99C 2NXNB 3RWUA 4HVWA 2CZ6B 2I7PA 3LP2A 3I55I 2KL4A 4B3AA 1EXQA 2K9MA 3ZQ7A 4CICA 3DLMA 3PM1A 1WJDA 3I9QA 5AFUA 4AD9A 1VQ5T 1LKXA 3CCSI 1O3TA 5GTIC 2DBKA 2GTDA 1IV6A 3FGUA 1KFDA 2L02A 3IH3A 3CMEI 4DIQA 4JJNK 4ESFA 2ZWHA 2NUPB 1UWBA 3K57A 4A0ZA 4RTUA 4BJTA 2PMZN 3BG6A 4BQZA 3DXMA 4A61A 5D5XB 4CI0C 2FO0A 3HOXJ 1Q82U 3BLYA 2Y75A 1ZREA 4B3XA 3G6EN 5D6WA 4ZDOA 2QA4N 1K8KB 2IW5A 1RRJA 1IJJA 1RT3A 2I2LA 3T8RA 4JRIA 3SYTA 2O4GA 1Z9ZA 2E6MA 4NS5A 1U2VA 5FRMA 5FLXO 2DQRA 5LHHA 1BW6A 3AFHA 5D5UB 3K9JA 4IUUA 3O4WA 4LDXA 3KFWX 3TO7A 3QPLA 4GW6A 5AZIB 5CO7A 3SAFA 2VXFA 4JKDA 3U9DA 3RKXA 2E2OA 3FF5A 3CC4A 1K78A 1CZAN 4HTLA 1ETYA 1YQMA 4FETA 4RCHA 1GFCA 2RKIA 1YW7A 2HNIA 3HGGA 4BB7A 2LY9A 4NCBA 3OYBA 2RHUA 5LJ5f 1A5WA 1ZGJA 3OOPA 2BZXA 2E2IJ 3DLHA 4FJ7A 3J80Z 3U23A 2HB5A 4JK7A 1ZG3A 2DQLA 1MDMA 4UUTA 5CKEA 2A6TA 2YSRA 2MAMA 2YDLA 1R6RA 1VQ6T 2G6FX 5IPAA 4M75B 5FPMA 2QYOA 4E7ZA 4MFEA 2O8DB 3ULEA 5ILVA 1PWTA 5HKCA 1LNXA 2YHYA 3GFIA 4PY5A 4PDKA 5CZ2A 2HQEA 3FLGA 1FSEA 3LFUA 1WIEA 1O75A 3D5RC 5GAMf 4WF2A 3HL2A 1W7PD 1DQUA 2ZB9A 2BUDA 1TUYA 4A5BA 1Z26A 1SZ2A 4KIFA 1ZXOA 4L5EA 2LQKA 1WPKA 1C0FA 3JW4A 1IUFA 4GV3A 3PFYA 4CCOA 3NAUA 3DTKA 3LA2A 4OLBA 2D0CA 3V9XA 4PZJA 5KYWA 4GVMA 4A57A 5A0DA 1RDUA 3LZJA 1X19A 2VQFK 1NEBA 1MMNA 2FJ1A 2CV1A 3ULQB 1LFUP 3KHYA 5GMKe 3MAJA 1H0MA 4OX9K 2YLCA 3KP7A 1WXBA 1T0FC 2VE9A 1QE1A 2XHKA 1M90U 4UUVA 3K1MA 1JB0E 2RD1A 4OKJA 4XR6A 1FSHA 1VQ9Q 4B4CA 4E9EA 3GNFB 4V19K 4BY1J 1UG0A 1OCPA 2ISZA 4BR5A 2GXBA 3QOEA 3WXIA 2DO3A 3HPWA 2CG4A 1AHJB 4IVNA 2XPUA 3CCJI 1AU7A 2A3ZA 4PJOC 3SXYA 3DLGA 8ATCB 2LTPA 2BHZA 5BR9A 4BUGA 2CYYA 5GAGJ 1M3CA 3DLKA 3JCMW 3KP5A 3CVSA 2PNIA 1BR2A 4E9FA 2VPRA 4DSLA 1VQ7A 3QPTA 1NJYA 2I5JA 1HYSA 3DLBA 4JHDB 2VJ5A 3G25A 2EZLA 5CPRB 1XMAA 2MYSA 4X34A 3HOTA 5AFUH 2W25A 1M1KO 1BI2A 1MNEA 4P55A 2NRAC 3QO3A 4IFVA 1K79A 4DYQA 1TNTA 3JRCA 1IO6A 3JSOA 1R36A 1KU2A 1PCXA 4MHGA 4M77C 1QKXA 2V51B 4MEYF 3GTMJ 4BNCA 5HODA 2Y9ZA 1W4MA 1LUJB 3VUZA 4BD3A 4F2RA 2NVTJ 2M02A 3D6RA 1WSJA 3UKRA 4WFNL 2D0QB 3SWNB 2VQCA 3P31A 2KK4A 3ZCOA 5BPLA 1K9MU 4C1NI 4WQ5C 3FXJA 3CCQI 3OYGA 1Q82O 3SBTA 3KLFA 3PNTA 1S72I 3IP4B 5LRRA 4WFAL 2WACA 4KREA 2NOJB 4B3SK 3OA6A 1FT9A 3ERMA 4B1YB 3KXTA 2C06A 4FM4B 2L7KA 1KU9A 2ECCA 3K0LA 3CZ6A 3GNGA 3HTRA 5GAOr 2EPFA 4XH1A 4JI6K 2Y1JA 1HBXG 2RQWA 1XG7A 2G8IA 2MLKA 3F22A 3OS2A 2M9UA 2ZGWA 4M7AA 3L4IA 2JSCA 3NBPA 2H56A 3CFRA 1MWMA 3E97A 5HDGA 2G7HA 5JVHL 5KN9A 3C65A 3A4CA 1YW8A 1NEGA 3HDDA 4CCNA 4JI4K 2X35A 2WAEA 2D8HA 2RQUA 2X4HA 1DKGD 2A42A 4MTDA 3I35A 3HPGA 4K8ZA 4DR5K 2MC4A 1N8RC 1WX6A 2JM9A 3EG2A 3TP0A 5LLQA 2F48A 2QBYA 2HQXA 3RBBB 3ZMTA 4U7DA 4BWMA 1KAZA 5IHIA 1VQ7N 3CO6C 2QUFA 1O1WA 4CHOA 4KTZA 4W5OA 4XH5A 4DTRA 4QTRA 1XJWB 3LWIA 1HMVA 4XU1A 4O0IA 3E6BA 2Z99A 4F7UE 2D0NA 4LUEA 3G71Q 4BRMA 3A5OC 3LQRA 4YRVA 2A08A 2R5YB 2W00A 1R77A 2CV0A 2ROLA 3EKSA 3JSPA 3J7YJ 4FWQA 1WSIA 3L4QA 4UVCA 3CC4Q 1RAEB 4CJVA 2BEOA 3T1HK 2ZNYA 3TL4X 5IYCJ 2WUSA 4IG0A 1X6OA 3DLLA 4A3GJ 2HHWA 2E65A 4XTZA 4B6MA 2VQGA 1VQPA 4A59A 1U3EM 1WZOA 2EQKA 2HHHK 5J2PA 4FLTA 2AKKA 3WG7H 1AWWA 1BI1A 5GINA 5AQOA 4CSWA 2H1KA 2M8EA 2O8XA 2YUNA 5M1OA 3KP4A 1M90O 2P5LC 1ZR2A 2DAOA 1VQMA 5CVJA 1SMTA 3NQOA 4FJJA 2HF4A 4A53A 3LAKA 2QEXQ 4A3MJ 5M5WJ 2VODA 4EJVA 3C6UA 2HHUA 3HOSA 3KIOA 1VAZA 3DOLA 1IRFA 2QKKA 3BY5A 1PU8A 4CZJA 4DFJA 3DI6A 4MO4A 1NKUA 1P7MA 1PUFA 3WNGA 2F4OB 2G3RA 3CCUI 5KN8A 1FBQA 1BK2A 3X25B 4OMNA 4M7DC 4XKCA 1RT7A 3DKYA 3J80O 3FIFA 3KZIC 4XRFA 1NYGA 4E70A 1KD1C 4CZMA 3GBTA 4Z4CA 1YITA 4CF1A 4AI5A 2DL7A 2W85A 4H0YB 3QJ6A 5IP9J 2RNAA 3H0IA 3UA6A 4CCLA 3HPOA 3SQ2A 2V9KA 2LG4A 3QNOA 1SSFA 1DPRA 2P5GA 3CC7I 2RF0A 2Z1GA 4J8OA 2ASMA 3M57A 4UB8C 1B9DA 1JXEA 1UAXA 3PO2J 1OPCA 3VQEA 3PIPA 1BJAA 3CC4T 2W84A 1NPRA 1NG7A 3V7RA 3KK1A 2GFUA 4FSSA 1S1WA 4A3BJ 4KNYA 3CCMQ 1WHMA 4I01A 1X9JA 1I5LA 2OPRA 3HI0A 1I6HJ 3ZQGA 2HI3A 3GDQA 2LSNA 3KWIA 4FOIA 5ADXA 2WBMA 4LSNA 4MLHA 2RHYA 4ZZDA 1I1GA 3OIOA 1VQPN 1IW7F 3PSFA 2QQAA 1K9MO 4C0ZA 2RHKA 1WRJA 1QVFM 2HNYA 3VGMA 3JAMZ 3QBXA 3ZRGA 1VQ4N 4NC6A 2NOEA 3TDZC 3EGDB 3SEZA 5FPEA 4EA5A 4FZYA 2JMCA 4DTXA 4I6ZA 2VG6A 4JKHA 4C9YA 1WI3A 2DA9A 4AHCA 4M77F 2DA3A 3HO1A 3BQZA 3G1JA 3JRIA 3HRSA 3I55A 2HDAA 3I56Q 3GFJA 2V7ZA 1Z25A 5KYXA 2ETHA 3WEEB 4S0HB 4EM2A 2FE3A 4FJXA 3CCSA 3MEWA 1IG8A 2VG7A 1D9FA 3I4NJ 1ZGWA 3OH6A 3CMEA 4M7AD 4A3IJ 2RB6A 5IY5H 4CF0A 4MQVA 1NGHA 4UVBA 5J1YA 4EJTA 3OSSC 2LFBA 3ZMZA 4DEXA 3T69A 1WNLA 1N5ZA 2P9PB 1WUAA 3KKRA 2RJEA 3DLRA 2QSHX 2QGGA 1FOKA 1UJ0A 1YITN 3I0TA 4BQNA 3WUHA 2P7CB 4WCEL 4RAGA 3HHGA 2PI0A 1M8MA 1X1PA 4CFCA 4E1JA 2G8FA 3RMAA 5AIPA 4I9LA 2ZXIA 2RN8A 3PO4A 2V75A 2DK3A 4XIDA 4I7HA 4H5TA 1NGJA 1MV3A 3ASMA 4CCHA 4U0WA 2DE0X 2GTJA 4FX0A 4BACA 1N3CA 1J9AA 2A5XA 3LH0A 4IG3A 1TW2A 2OTLN 1SAXA 1K4US 4AC0A 2ZGZA 5EG2A 2K3BA 3VWBA 1KSWA 4C5HA 1ZYQA 2LSOA 3GTLJ 2HQHA 4YOVA 4HCZA 4CZIA 1LVKA 2K57A 1C1BA 2HMIA 1LPQA 5E3NA 3WTYC 2X78A 3G4SN 2HZDA 4IWVA 2CFOA 4IURA 1YFNA 1SQKA 2ENMA 3CJAA 2V52B 3N0UA 5K5RA 2FF6A 1UA1A 5HDNA 2J7IA 3DCFA 3I55N 5KRSA 2QKLB 1S1XA 2L9RA 4Q4ZF 3QFUA 1Q9XA 2VVKA 1XX5A 3OYEA 2LBFB 1GXIE 1WH5A 4C5EA 4DR6K 4A4KA 1AHDP 4BXFA 4A3DJ 1C1CA 2J6FA 4XBFA 5AYFA 4ENJA 5A0LA 1AZEA 4LD6A 3ISNC 4KV8A 2E8AA 1WDXA 1L5UA 3O3GA 4FLZA 2RKHA 1R0BG 3M5RA 3CC2I 5HK3A 1QQCA 3VS0A 5KQDA 3ZETB 1ODDA 4XLPF 1OCTC 1PYVA 5DM7L 3L9FA 4GCVA 2PYJA 1BW5A 3ML6A 1TKXA 3KVGA 3ZQCA 3J80E 1IV8A 1WJBA 4YFUA 4WYBA 4PJMA 2EFPA 5ADXH 4KMUX 1S1VA 3HOYJ 1J75A 1K1ZA 1IKVA 4IDKA 1LJOA 4ABZA 2A1RA 4DF4A 3BDUA 1EBMA 1F21A 5K5OA 1QTMA 3CCJA 5CQYA 4YTLA 2AXLA 2NWMA 5HRSA 2QQ9A 2IOCA 1LCKA 5CY4A 1ULYA 1U78A 2Y31A 2EWNA 3J7AF 5FWCA 3SI6A 3A5MC 1KU7A 1RGIA 3KJVA 3P8DA 1V54H 2M30A 1KZHA 3D5SC 1NGEA 4BAYA 3AVAA 1Z6RA 2DA2A 5DLOA 1ZBUA 2WTEA 1L0OC 3RPUD 3WQUA 5F04A 3AVLA 2A3LA 1OV3A 4LSLA 2H6BA 3C1DA 4CCMA 2CP7A 1BOAA 1RKTA 2GIVA 2C0IA 2W42A 2FBTA 2EQMA 2FPEA 4KN7X 1Y0NA 1BL3A 2BE5F 4LK0F 1S8NA 3RR7A 5L3BA 2CP5A 3H5AA 3O8GA 1W2BA 2WC2A 3NNQA 2QTDA 2LP5A 4O4GA 2DDAA 3CCEI 3DLAA 4BDPA 2UXDK 1QVFP 2KI7A 1TC3C 4J6XA 1X43A 3ZPLA 3CCQA 1IN5A 4BEHA 2NRTA 1S72A 5ICGA 5F0HA 3THKA 3I59B 1HW1A 4BDYA 3PO5A 1RUNA 4FM1A 3HOZJ 3M0SA 5A2QK 2MCNA 1RBTA 5B1AH 1JUPA 1ZELA 1YJ9I 1HLUA 1TYQA 1VQMT 4RKUE 2VPLA 3NTKA 4OU0A 1UGSB 2LQ8A 2DW4A 2KDOA 3QIOA 2X6NA 4C8QE 1JTXA 4PJOB 3ZGKA 4IO9F 4LITA 3TCJA 3CCSQ 2F4MB 4A0YA 1XNQK 2O5RA 1VYTA 2EJGA 1IKYA 5CZ1A 3TO9A 3CCJN 4JX6A 2C0OA 3RTVA 2QASA 5HBMA 2BZ8A 4OFHA 2GLOA 2ZGYA 2R7YA 4B3TK 4BR0A 5DCMA 3I53A 3MN5A 4XRSG 3OYHA 3S2HJ 4KHPK 1NBEB 3M4YA 3F8NA 4M77B 3AO4A 4FIBA 1Q1VA 5FPDA 5CLSA 2NVYJ 2YRVA 4S04A 1KG1A 2O8BA 1WB9A 2VC0A 1YJNQ 2HPMA 2AP1A 1VQKQ 1OPLA 4GBQA 3AO3A 4L9VA 3AA2A 4KHQA 2JHNA 2KQ2A 2F4VK 3VF4A 4FJ8A 1IC8A 5TJJA 1XOVA 1GLBG 2KKZA 1TK8A 3RIRA 3HTUA 4DNCA 3A0IX 3LDOA 3TI0A 3VEPA 3G10A 4AFZC 3NWSA 1NKBA 1QVFS 1N27A 3SMSA 3CCQN 1TWCJ 4HZFA 3MPUB 1LQ1A 4PL8A 2JWTA 4F3TA 3SUNA 4FM0A 3QZ5B 3X2QH 3DBLB 4CE9A 4HLXA 1ASVA 4Y17A 5ED4A 2DZCA 1OQKA 3AVIA 4DSJA 3CUOA 4XLAA 3LZIA 2X9HA 3CCST 2DYSH 1X3WB 1LE8B 2L54A 4FU6A 3CMET 4CGHA 3NH1A 1M2OA 2VGMA 5HP1A 2Q36A 1WGSA 3ZQQA 4M75A 2M0OA 2KQRA 4LD0A 1OR7A 1ZGAA 1B7TA 2I0NA 1U1TA 4EJOA 3CCVI 1YHQQ 3CCUA 2QWWA 2ME6A 3PIOA 2OJ2A 5EJCA 2RK1A 4GLMA 1UECA 1ORNA 1WFXA 2KIMA 2HS5A 1HSQA 1ZUUA 3EG9B 3S2DJ 2KZMA 1KQ2A 3ZMUA 3VENA 3D4VA 1GOBA 1YJNT 4AMCA 1BI3A 1YIJI 4MGRA 4C1NK 1QZZA 3CC7A 3MMVA 4IOAF 4DFKA 2GFAA 3VQ5A 4HV5A 3HM5A 2VKEA 1IRGA 1OU8A 5KQ8A 3IC7A 1N75A 3AVFA 1QGPA 2GOMA 2KAFA 3PMTA 1T8EA 1RR8C 3D2EA 1PUEE 5D3GA 5LJWA 4K11A 2E88A 4F7UG 1SEMA 1T56A 3LYIA 1VQ9N 1QVGA 5AQWA 3HFOA 4AWXB 1FTZA 1B1BA 1WHHA 3BJAA 2EIJH 3FXUA 4HX8A 2F5DA 1G3WA 2XUBA 1MD0A 3ID6A 3ELKA 2OPQA 4J9GA 1S9GA 4D8KA 5CYMA 3GWZA 2YNGA 1XCBA 1XTDA 1S3XA 3DKXA 2HDWA 4ELVA 1XUPO 2VB6A 2ZPIB 2P9SB 1YLFA 3Q0WA 1UELB 4CJFA 3T5XA 3CMAI 1R0AA 2Y4YA 1YNZA 1NM7A 1ZG1A 4CK2A 3PFIA 1YWPA 4QS9A 4KHSA 1MSEC 5CJ9A 3O1WA 1NOYA 4M7DB 3L6QA 4C8NA 1M1KC 4JHDA 3B73A 4GY2B 4XRMA 5AZJB 2XGXA 1YHQT 1LW2A 3OSGA 3RSEB 2XRNA 1RI9A 2GCXA 1TT5B 4KH5A 4HNUA 3KD5E 1S72Q 2DT7B 3CCYA 2OI3A 5DM6F 4GV6A 4FLUA 1TUGB 5I3UA 1Q81C 3MKYB 2W4SA 4BQAA 4A93J 1KO9A 2D0OA 2IBDA 3JAME 1N6AA 2ISYA 1X3NA 1NYFA 4PFOA 3MO8A 3C12A 2JJ7A 9ATCB 4NQWA 4WXDA 3A8YA 1YRNB 4C92C 1JKRC 1BUPA 5LJ3h 1AEYA 3WGIA 2NS7A 1Q86O 1HKSA 3S8PA 1X6GA 4A4FA 1VSEA 3QPSA 5IT9K 4PKIA 3BOQA 4WX9A 2ETJA 1QVFA 1X4OA 4A3CJ 1MV0B 4D5CA 3HM9A 2A07F 4RAFA 1TWFJ 2IS4A 4A54A 4IOXA 1YQAA 1QPMA 3WT0A 4IL6C 2FF4A 1G15A 2G8UA 2NYSA 1FIPA 2STWA 2KJCA 3E01A 4LD5A 1OULA 3R1XA 4J9IA 3IUCA 2DZ9A 2YX7A 1BR4A 4R8HA 2HL5C 2QW9A 1KYZA 5TGTA 2HBLA 1UG2A 1A5VA 1T6SA 3IAS2 4Z4GA 1RCHA 3BP8A 4R55A 4U0VA 3UA7A 1D4XA 4RTYA 1JLGA 3HGYA 1G2HA 2X4JA 3B6AA 4JLIA 2XI9A 1U9OA 4DTUA 1UJYA 4CZEA 3K0SA 4Z4IA 2UXCK 3G71N 1FP1D 2JGUA 1VSLA 5EU7A 3HM8A 1S72T 4A2UA 4F52A 1BIUA 3KLIA 5TKYA 1WHKA 5FFXA 3J81O 3CC2A 1QHTA 4N56A 3WNEA 4CJSA 4CC7A 1XC5A 2BXYA 2LJ1A 2QF7A 4JI5K 3UWNA 4NL3A 4RW6A 2WSEE 1MGTA 2JTEA 4XLNF 2K2MA 4F8RA 4FZXC 2ZMEC 2P9UA 2EPDA 1BIBA 4KTWA 2W04A 3K4LA 1BCOA 2KPMA 1XQPA 3G2BA 4OMPA 3VQ9A 2P9KB 3DTIA 1T0HA 3B6PA 5ELZA 1ASUA 2GBZA 4IZZA 3H0HA 3IQLA 2M9HA 4KB0A 2BY0A 1OCOH 2VE8A 3VUBA 4RBOA 3A03A 1FMVA 2QEXN 1B72B 1UUEA 1WAFA 1D1CA 2YLBA 3M0RA 5CAIA 4PJJA 4A5NA 4HQMA 1WHJA 2ESNA 2QSGX 1RBVA 4H5WA 3CIPA 4A69C 1U4BA 4RB0A 3G1LA 1EFNA 2KZGA 3QPHA 2LD5A 4GMJB 4JK8A 1SRMA 3WTVC 4LFCK 4XTXA 3CF2A 2E2JJ 4UC4A 3UPUA 3Q9SA 1Z91A 1JE8A 3OYAA 3L2CA 4B3MK 2Z9OA 4BE2A 2BOLA 1Y1WJ 3M59A 4BI4A 3GF5A 4BRIA 4JRKA 1EZZB 2KRMA 4EVIA 3EO3A 1JCGA 2LY1A 1YI2I 2GQQA 5IWAK 3CCEA 2MH2A 2M0MA 3SBGA 1JLCA 1IO2A 4LG0A 4OINF 2DXIA 3CCMN 3QB0A 5D6XA 1L3TA 2X4WA 3JTGA 3U3GA 4AG1C 3IKVA 2X4YA 5C25A 2E6NA 4RAYA 5CE3A 3KP3A 3F8FA 2EQJA 2HYJA 3OJUA 2IA0A 3TR8A 3HEFA 3RYRA 3IH2A 1YJ9A 2OPTA 2K5LA 3ZBDA 1GCQA 4MIMA 1K9MC 4W5TA 1B8IB 3KKSA 4RAZA 5E1WA 2V79A 4OMQA 1SANA 3N4PA 4H5NA 5B3SH 1KHCA 3SV3A 2I5WA 3IS9A 3RMQA 1FXXA 4JI8K 5KRTA 2OYQA 3EGDA 3RPQA 1MMAA 1GLEG 3DRPA 3I56N 5KCHA 3CCUT 3EFRA 2EFQA 5F0XA 3R60A 2JWLA 1KQ1A 1QHGA 3P8BB 3BDLA 3HP6A 2YNIA 2WONA 2WSCE 1OZ2A 3FX3A 4AIDA 3R2XC 1JI8A 5M1QA 2KHOA 1T7PA 4J01A 3R0AA 1H9GA 4Q0BA 1SD7A 3CC7T 1HSTA 4OFAA 3H08A 4BG8A 1JKQC 2DNUA 1FOYA 3PTAA 2BW3A 1KG5A 4I0AA 2LYCA 3WXJA 5MLCQ 3JB9F 5AQXA 4FX4A 4FJKA 3MEAA 1NOZA 3EH1A 1G4DA 4CJLA 1YYVA 4M3WA 1VUBA 5KTQA 3I5SA 4AUXA 1O3SA 3OIPA 3M8FA 3CYMA 3SV4A 2KLAA 5SZTA 4RUGA 3M3YJ 3ABMH 1YP5A 1EO1A 3HIFA 4RGUA 1SL1A 1BJZA 3C94A 4XAXB 3IRXA 3L3UA 1UGQB 4OF1A 5AJ3K 3TSZA 3JSMA 4C8KA 4RTTA 4FL9A 3N97A 1T3VA 3HBTA 1FN7A 2XSDC 5EC7A 2HTSA 1HX1A 2MF2A 1Z21A 3VQ8A 3A0HC 5GANh 1GXQA 2KROA 2X48A 3GOIA 2DF6A 4B47A 2OV7A 2YUOA 1K0XA 4YPRA 4MNUA 4QCLA 4KA4A 1Y57A 3O6BB 2LCSA 2E2QA 4A2AA 2IGKA 1KCFA 3DWLA 4CZLA 4B08A 1LB2A 2HQNA 2E5KA 1R9TJ 4RW4A 4M3BA 3FZVA 1Y64A 1BIZA 4XEIA 3MWMA 1G3SA 3CCVA 1RETA 2VXZA 4DV4K 4NO7A 5AQZA 3SJHA 2SEMA 4C8QG 3CC2Q 3C0BA 2RREA 4IHTA 1DEJA 2LBFA 2V1QA 3ZYYX 4LH5A 4M45A 2KFDA 4FZZA 1CQTA 2JWKA 5FJ8J 5A2QZ 1YIJA 1MUDA 1M3BA 2F6CA 5CQGA 3F10A 1QVTA 1M5Q1 3FZHA 1K73O 4DTNA 3NGYA 1J5YA 3SD4A 4M41A 3RESA 1S6PA 3D2FA 4N5SA 4IO9L 3FZLA 5IHNA 2FSKA 1VYUA 3VYTB 1S7EA 3JCMP 3GL1A 2XHBA 2NRWA 3BR2A 4E7HA 2X0LA 2M0YA 4OPAA 4NXMK 3AARA 2K9NA 5D6EA 4FSVA 3WTWC 3LNQA 1R4MB 1IG9A 3S32A 5B5EC 1PDNC 4RTVA 4LF9K 5LMUK 3SDZA 3SPZA 2K40A 4IFEA 1GOCA 4E2FB 4FLYA 2MGQA 1A36A 4F7UB 4YDUC 1UGVA 3VDXA 3DF8A 5HLIA 3J7AP 1LAWA 4OB1B 1PVSA 1WJFA 1VSHA 1X4PA 2R5MA 3CMAA 4BVPA 4FHTA 4X1EA 5LBQA 3JXUA 4LIUA 1H9TA 2GV9A 1W1FA 2HTJA 4QVDA 1T6CA 4CHYA 3WU0A 1MJBA 2W57A 3MFKA 5GAN6 2IA1A 1QZ6A 3ZP5A 4HG2A 4BL0B 3SEMA 3L3VA 1VF9A 3DXKB 3NGZA 1BG3A 1JRIA 1EETA 2DMUA 4HEA2 3CC2T 3KFVA 4HV6A 2AKLA 2ME0A 4H0PA 3OQ5A 3JCMc 3F0CA 3QERA 3AV9A 3O2PE 2IS2A 4ZZLA 4HVUA 3F9KA 2E7XA 5F64A 3P1GA 2EYYA 4EZ9A 5T7BA 1F1BB 4JBAA 2HU9A 3IKMA 4DQ8A 2LX7A 1B9NA 4XSXF 1BHLA 1NGAA 1ENHA 4ENKA 2IA2A 4IUVA 2W03A 4FT8A 2O8EB 1ZUKA 2YX4A 2XB5A 1BC7C 2CP2A 4GNIA 4CH7A 1UAAA 3JCMg 2NVXJ 5AIQA 1QLYA 2ECBA 1QQNA 1SHFA 3I59A 4C3JJ 3HKZA 3MXJA 4AHUA 3KP6A 1WSFA 1OOTA 2J06A 3MEDA 3CP8A 1TSFA 2UXXA 4OOIA 1BGXT 1MU2A 5AT1B 3DLEA 2K79A 2NLXA 5J39A 2HBJA 3VU3C 1RTDA 3I0XA 2LKPA 4P1WA 3WG9A 4LY7A 4PJOA 1APLC 2V8KA 2GZWA 3PJRA 1NPPA 5HS7A 4OVLA 3IH4A 2D2WA 1ZYRF 2NVUB 1VSFA 1XI1A 3AT1B 3CPWM 2B7EA 1GL5A 4NXNK 4EAHD 1OH8A 1WCMJ 4KT0E 1I1SA 1VHXA 4IO8A 1IBMK 1KQSM 3RCOA 2CREA 4JKAA 2HNZA 2CQQA 3FJPA 1USTA 4YNQA 4M77A 1U5TC 4BQOA 5KPTA 1VQKN 2E2HJ 2D0AA 1SVMA 2ZM6K 3M07A 4Q47A 1XPXA 2YRDA 3QODA 4IHXA 2FBIA 3V8JA 1NK2P 4C23A 1CXQA 3CWTA 3QU6A 1A6IA 2KYMA 1REPC 1DJ7B 2BH1A 3BR6A 3LWLA 2VLAA 1J59A 4WQ5A 3HZ6A 3DLLF 1SL0A 4C92B 1R23A 3K59A 5EXWA 3E6CC 1GLDG 5IP7J 4FWMA 3CQZJ 1G99A 3MECA 4PL6A 3LP3A 3TPQA 1PJRA 2QQSA 4CJ5A 1SV5A 2NOLA 1YN8A 5ERIA 2DFUA 3HKZN 4V2GA 4RG8A 1X9MA 4MFDA 4G1QA 2JT1A 5JLFA 1TW3A 5DD4A 2NOHA 2UV1A 4UVAA 1CZBA 5KAIC 4EZ6A 2K7LA 4CRIA 3CCVQ 4NC8A 3I64A 1JLBA 3PE0A 4FASD 3PQJA 5DM6L 1KG7A 3RNJA 3O8HA 3OW2M 4CFBA 1P4WA 4EMKC 2PX9A 1OH5A 1LE8A 4NCGA 4CBUA 3DP7A 1YIJQ 4C3IJ 1HOMA 3CETA 1IXCA 1C0MA 2H1LA 3P4IA 3NFAA 3H5NA 1ITYA 3U8XA 4IIMA 3ALYA 1WI7A 1Q7YC 2K5IA 4J8FA 3CCLQ 2BDPA 1W36C 3H46O 5J8FA 1WEIA 3MZ8A 1LOTB 2RMOA 4BH9A 3VS4A 1DU6A 2QVOA 4ZGEB 5L3CA 3BCAA 3EG9A 1JL2A 3SHFA 1BKBA 3RTRA 3VA0A 4UV9A 2JHJA 2JMWA 2GXGA 1QHAA 3ZSWA 3UNGC 3HTVA 1YI2A 2WTUA 2HBKA 1I1JA 1XGNA 2EV6A 4J5YA 5IT9Z 1J0RA 4E9GA 1K61A 4KFCA 3MCPA 4CJ3A 2PMHA 1YT3A 3LDNA 1PSFA 4X9CA 5KYYA 3M7GA 1KA8A 1WSGA 2ZMEB 2YUPA 4M6VA 2PLYA 5A2QO 3N05A 3TWHA 2F8SA 4LD9K 4GRIA 4M78F 3X26B 2Y4XA 2CQ7A 5F1JA 2HGCA 4IOCF 4PL7A 3CUQC 2XG8D 2O61A 1JUMA 1TV6A 1KONA 2R5ZB 4DTPA 2IAIA 1GXPA 1NLVA 3CCVT 5EYRA 3H1VX 3S1NJ 3H6ZA 5AR0A 1ZH5A 4DV5K 2XGEA 2BHYA 4IQJA 4F93B 1T33A 4L3QA 1XGMA 1KVBA 2A0FB 4FWRA 5J4VA 2K4JA 4OMLA 2AQEA 1VQLI 1YIJT 3FZKA 3F3XA 1TKDA 1YTUA 1KQJA 3WTZA 2FOKA 2V7YA 2MMPA 1Q7YR 4OAZA 2DERA 1S22A 2H8HA 2HD0A 3RSEA 4A62A 4EPCA 2NNNA 2IDOA 5CK9A 1KLMA 4G9ZA 2X6SA 3PL8A 4FVMA 4A3FJ 1I39A 4RCCA 2A40A 2IC3A 4LMYA 2CGJA 2XY6A 1W0UA 2JA8J 5M9OA 1HC8A 3BROA 1BI4B 1OKRA 4DF8A 4UV8A 1SD4A 3P5JA 2TCTA 3SQNA 4BI8B 4BC5A 3G6EI 4D0PA 2FLOA 3Q5FA 1Q86C 2AQFA 4ZN1A 3JCMe 1YRNA 2LDMA 2FF3B 1PHTA 3FEOA 3CPWP 3O4NA 4H4KC 2DL5A 2KT0A 3LGFA 1OVYA 4CGDA 4DR7K 4EGZA 3A8OB 1WJCA 4B9LA 3D5LA 2NLUA 5FKLA 2K3XA 4M74A 3VEZA 4BJ6C 1KQSP 1TU0B 1Z9CA 4IHVA 4RB3C 5E8IA 3QYGB 3REAB 5BN9A 3HOWJ 5IH2A 4C8MA 1JHHA 3M54A 4IHYA 4K43A 1Q1HA 3SZ2A 2VQEK 4HX7A 1J2XA 4M78E 4AM6A 4RB2C 2LKSA 2CH0A 3GW2A 1P7JA 1K8AC 5HS9A 5BPNA 5C4XJ 2A28A 5ICCA 1BCMA 4J6WA 4NLCA 2FRWA 1WA7A 1E3PA 1MUYA 1X3UA 5KHDA 2DPPB 4HF2A 3K58A 3BDPA 2VT3A 3COAC 4JKEA 2QWLA 2EKHA 5GIPA 3D0PA 1ZA1B 2B5JA 2RM4A 4GKKK 4JUVA 1XD7A 2EBPA 1KSPA 2MG4A 3F6VA 3LPUA 3FDYA 3HUGA 4LIVA 3JR9A 3OYYA 4A3JJ 4C8QB 3U1KA 3E0JB 4RB1A 1LFBA 1WN7A 1WHUA 2P0QA 5FLMJ 3NVKA 2Z1DA 2BXZA 1FKOA 2CW8A 4BC2A 1B6AA 1XN7A 2YHTA 4UXNA 2DVEA 4DSKA 2LOOA 2DVJA 2MK5A 4I2PA 2E70A 1W9HA 1H1VA 1RDDA 4AIHA 1PP8F 3JB9I 1SEUA 3MKLA 4XTVA 4ISEA 3OW2P 1ORKA 2WV1A 3LSRA 3JCMJ 3TU4K 4HKEA 2WA0A 9ANTA 3MCZA 3TSPA 3OB9A 3TKYA 1Y96A 3CXCM 4JV5K 5EX5A 3NWTA 3JRHA 5C0MA 3CPWS 3U1DA 3FHFA 2DK8A 2F1LA 1REVA 1RPWA 3CO7C 1UJ8A 4DV1K 3R3LA 1ZARA 3H1CA 1I94K 5LJ5h 3ZL7C 1KQSS 2P9IA 2Q31A 2HOAA 2PN6A 5I2SA 5FO5A 3HVRA 4HAMA 1VQNI 1GDTA 4KUDK 3ROUA 3NHGA 1QQMA 2L7ZA 5DCFA 3PV8A 1YI2Q 5KGXA 1MMSA 3AHUA 4P5NA 5CHZA 4BE0A 2PEXA 4BJ5C 4Q5SF 2BANA 1K8AR 4A4HA 1UTIA 3E3VA 1NJIC 4FSXA 4C8QD 4U0YA 4B8CA 3ABLH 4RCBA 1ZRCA 4BUPA 5HNHA 1WSHA 4ENMA 2BKDN 3KK2A 4OGEA 3W3CA 5GAMh 4I6MB 3K2PA 4JX4A 5J6XA 2BUPA 3DRSA 2VIXA 3CQTA 4D8DA 2JS0A 2DTZA 2J05A 1X1CA 3W2VA 5C3EJ 4IUPA 3TREA 3AAQA 3AG2H 1N5YA 5D4RA 3OGDA 1RILA 3S6IA 2JNGA 1C0GA 4IQ4A 1OEBA 4GV9A 3N4MA 2BIVA 3JCMQ 2XB0X 4NC7A 2KLOA 4I76A 2F69A 2Q8KA 1W0HA 1L3LA 3VTIA 4LH4A 2OTJQ 3ZEUB 2D5RA 5HRNA 3QDRB 5B66C 3HJFA 2MLGA 2RPIA 4PLLA 4PK4A 2QGFB 5IT9O 3DEUA 1FMWA 2O88A 1B8IA 2F2XA 2FQ4A 1YBYA 3OW2S 1LEAA 3K4JA 1QQOA 3K4KA 3SWNC 1Z7UA 4KT5C 5EGOB 1QSYA 3C6TA 2KSSA 2Z2SB 3THWB 4JJBA 4XK4A 2ABLA 3RJPA 1HJRA 3JB9G 2YU9J 1S1NA 4KRTA 2HQRA 2JA5J 5E26A 4C2MJ 2FG0A 4BHCA 1D1BA 4X6AJ 3A5LC 1QKWA 3LAMA 1OMIA 2VC1A 4HX4A 3CJ1A 4EIAA 2WAQA 3JCMd 5C2DA 2V6CA 3KLHA 2DBBA 2QQ8A 1YFHA 2PJRB 4YHHK 1YI2T 1A0NB 2YX6A 4M9SA 5TISC 4PJNA 2IT0A 2LRQA 1NJIR 4YELA 3M0UA 2WB1A 3F5TA 1LPLA 3H5RA 1EV7A 3KNTA 1WGXA 4XOPA 2FVUA 3O9QA 2VBZA 2B9SA 4QVCA 3VEXA 3HTSB 4YOYA 2KT1A 2VBYA 2ZPFB 3HZJA 3ABTA 4XNFA 3KYDB 1XHZA 4XN3A 1JLAA 2W6LA 3EE9A 2KIQA 4FXDA 1G3TA 4IDHA 3OS0A 2QKMB 1BU1A 4EA4A 2KQWA 1FC3A 5KYUB 1QWFA 4H5VA 1N9RA 1KVCA 4G94A 1WQWA 1SS6A 4OIRF 4TV7A 1D3BB 4Q48A 3DU5A 1AKHB 2PJPA 3O9SA 5EEHA 4IJNA 2KY9A 1UGPB 1RZ4A 3TDUC 1WSUA 1KLNA 4CD3A 4A4GA 1P90A 1WZ2A 2DXTA 5CKTA 3CPWA 4KI4A 5M3FJ 2FZKB 4V19S 2COBA 4MDAA 3EE8A 4YG2F 1VZ0A 2VJ4A 3I4MJ 2HVHA 1MA9B 2OZUA 1JKOC 4FYVB 2RDPA 4L59A 3QWXX 4OJRA 2FRHA 1U5TB 2EZKA 3FDRA 3TSWA 1CKBA 3DM2A 1NGNA 4DU1A 2VKHA 2NYXA 5GAMg 5H1SQ 2R7RA 3M1CA 1RC9A 4GYIA 1G8XA 5LHIA 2F2WA 1H3ZA 1K73C 3SDBA 2HQ5A 3KPHA 1AZGB 5GADJ 4RG2A 4FPBA 3AAFA 2OFKA 1TWHJ 4F3OA 1U8BA 2DD5A 2DOEA 4A6EA 3CXCP 1ZLMA 1I5ZA 2EB7A 4LGWA 3T9NA 3J7YP 3K6GA 1RUWA 1C0WA 1AD5A 1S3JA 4RGSA 1I6XA 3S6WA 2XROA 5DM7R 2G8HA 3HG9A 3OY9A 1B92A 4YIIA 1P4AA 3WU2C 4M7AC 3PUFA 4HT8A 3GXOA 1C1AA 1TNSA 2OQRA 1G59A 4CW7B 1W1WE 2I10A 1Y39A 3HRTA 2GAUA 2K2VA 4CHZA 3PMIA 1QS4A 5E84A 3CJTB 4H0XB 1FYMA 1ETKA 4DR1K 3MK6A 5E20A 1X1BA 4LN2A 1VQ4I 3MKZA 3AAPA 1WLJA 3FXQA 2DJNA 2UUZA 4DR2K 3Q0VA 1VQLA 4B9MA 5EVZA 4HDUA 5IT9E 5DPKA 4KUMA 1V55H 3K10A 2JVVA 2A05A 2QENA 4W97A 4BBSJ 4DTMA 3KCCA 1Y97A 4PGHA 2CV2A 4DV0K 5I9EB 2VC8A 4P9UA 3VB2A 3EH2A 2GQIA 1VQOQ 4M42A 3BG9A 2JTMA 3EGXA 4M75E 3VSLA 2OCEA 3X28B 2JLEA 2CH4W 1A5JA 3BZ6A 1M9SA 4LUDA 1VQ5Q 4DV2K 5GAN3 4EMSA 3I3LA 4GO1A 4XQFA 4M7AG 4JD2B 2Q3SA 4AVPA 2PMZA 2HVIA 2J4RA 3CPEA 5FKKA 1RNHA 2OBPA 3LGLA 4FW1A 3G6EA 3C2HA 2YHWA 3EFOB 2H3EB 3E9GA 3CXCS 2EQIA 1OKJA 2DI3A 1ITGA 1OPKA 5LGTA 1YX3A 2O31A 3CUQB 4W1UA 4LF8K 4XK8E 1YIOA 4EP5A 2L3PA 2FBYA 3BG5A 1Z7LA 3EUHC 3GPLA 3GZNB 1OISA 3V4GA 1UHMA 1Y1VJ 2YWWA 2CZ7B 3DEEA 1D3YA 3FXKA 3F73A 2CGPA 4NYFA 1W0TA 5KCOA 2OTLI 3RI4A 3SZGA 4J9CA 3SAHA 4YOUA 5LEKA 1DTQA 1BU6O 1HDDC 2K9LA 2A41A 1UCRA 2HSPA 3M9QA 4ZH4F 5HDKA 4CIFA 4D7NA 3G4SI 3RKYA 3MDQA 4KT6A 5HL7L 3H3VK 2E34A 5EOYA 2Q2EB 1HYZA 2JRMA 3OBYA 4A63B 4RLQA 1VQOT 4O44A 5FLXK 4IOCL 4DTJA 1JGSA 2R57A 4WQ4C 4AHVA 2X3WD 2HW3A 4KBMB 4BRHA 2D1KA 3VQBA 2X4XA 3GYHX 4X1VA 1NG9A 1KAYA 1YG2A 5GJWB 3G0QA 2DPDA 2EYXA 3DPUA 1NKEA 2W48A 4DQ2A 1IBKK 4C0GA 3S3OA 4N4NB 4NBQA 2XKPA 4PQUA 3L2RA 2E6LA 1JQQA 4K8XA 4B9NA 2QK9A 1QVUA 3RVCA 1ZX6A 1WVRA 3OMCA 3QDFA 1Q18A 3VS5A 3LALA 4EDUA 3M0PA 1W7PB 2EGEA 4F3QA 1N78A 3L09A 3BC8A 3UE5A 3MWTA 2LVSA 2B0LA 2L0AA 5J1RA 2IVOA 3CWSA 4KITB 4V2FA 1H8KA 1FEXA 1NU0A 1X1DA 3GTGJ 2E5NA 1M3HA 1CZ9A 2DJQA 3BTJA 4B21A 1RDAA 5CYQA 4FJ5A 4EM1A 1AOJA 1VQNA 3ZT2A 3V4IA 2RNGA 1Q95G 4Z6YA 2PVGB 1KC8R 4J9FA 3VEOA 4HNTA 3CCLN 1VTNC 2ROTA 2LX9A 4BY7J 2F5FA 3LP1A 2A6AA 1X75C 4KJZA 4XSZF 5AONA 2OA8A 4YOQA 1TUCA 4JYKA 2R92J 2M4GA 1YTYA 1NK4A 2L0KA 3IHOA 4LFAK 3BPVA 4E0DA 4CEQA 4AT1B 2P4WA 3IUOA 2IIMA 1SFUA 1Y0MA 2BZYA 4W5NA 2RC4A 4N47A 1T05A 4QS7A 2E5LK 1XC3A 1DDNA 4DSIA 1HNXK 3A5ZB 1XSVA 3D0SA 2XY7A 4BGDA 2A6EF 2I7NA 1KJWA 2ZMEA 2XIGA 1W2BM 5GAEJ 4HBLA 3FSPA 3K1NA 3NARA 2D0BA 5C12A 1YS6A 2KRCA 3CXCA 2NRRA 1VQLQ 4I98B 4NL2A 2VGNA 3K5OA 2JJ9A 3MXIA 2D9TA 3WTXC 2WBNA 1AT1B 4FQGA 1VQ8Q 3R0JA 2O9LA 4ISGA 4X65K 4KMFA 1RR7A 4OLAA 2XO7A 4Z88A 1X6BA 4CJKA 4N0AA 1B9FA 4E47A 1OCZH 1PG5B 2XAHA 1MNMC 1VRTA 4ZTFA 4II1A 1DP7P 3CJ9A 4LDWA 1VQNN 3KZBA 1DGWY 3DXMB 4ZC3A 1EX4A 5I11A 2KFNA 2E1MC 1K83J 2X74A 3RMDA 5DD8A 1RDBA 3W6VA 4LF6K 4OAYA 2DMTA 3VPZA 2BYVE 2PUOB 1VRLA 2ID3A 1J09A 1IKWA 5DEQA 4KN4X 5BNGA 3G6EQ 1Y71A 2QA4Q 3META 5M1KA 1HQUA 2COYA 3FK7A 1JKPC 2HCKA 3ZFJA 2NOIA 2ZJPL 3CD6N 1UB4A 4QLCU 1HPMA 2G7UA 1CF7A 2ATQA 3IL2A 1ASWA 1Y56A 2YNFA 2F7TA 3JB9J 4ZHRA 4PWDA 3Q7BA 5LMNK 2COZA 4M63C 1LWVA 5K5QA 1BI4A 2V8JA 3MX2A 1KXPA 2X9DA 3CJ7A 2NAZA 4IEJA 4CK1A 5ICEA 1LNWA 1IKXA 1IRXA 2HVRA 4Q5WA 3SQ4A 4KULA 2RJFA 3JB9H 4B8AB 2IGOA 4CVNE 1NJXA 2FUG2 1OU9A 2QGUA 1TXQA 5D8KB 1D0YA 1EH6A 5JS2A 3E9OA 4BRFA 3SQ1A 4A6DA 1X01A 1N8RU 3KD1E 1YO5C 3DKMA 2A1SA 1MDMB 4B1ZA 1O3QA 3MZYA 5AQHA 2DL3A 4LXCA 3VOEA 2XGDA 3RSNA 4XLHA 4AIKA 1VQLT 3ULEB 2W7NA 3H45C 5CVVA 3K5MA 5LL6S 5GPCA 1FIAA 3WVDB 1XGOA 3JB9D 3MP1A 1C0TA 1VQ8T 2DIQA 1N25A 4AI4A 3C7NB 4CEOA 4H0TB 4HPQA 1WXUA 4CIEA 4BROA 3URGA 1TBXA 3JCMb 4HCCA 3VYHB 1N34K 2VWBA 2JN6A 4BRLA 1P59A 5CKDA 2XAGA 2GBQA 4LLGF 4PIIA 2XPVA 2V7FA 3LWHA 4CECA 5KYWB 3MWPA 4HF0A 2KRNA 1NK8A 4Z4EA 3MEUA 4DQPA 3VYRB 1A04A 2ZKZA 2D4WA 2J5OA 2QTXA 3G6ET 5FKOA 1IGNA 2QA4T 2Q0RA 3K7AJ 5GAOq 1RDWX 4KRFA 2RE2A 3K9TA 3P38A 4N9HA 5C4JJ 4BY9C 3ISPA 3EAEA 1JL1A 4CEBA 2HVQA 4CO8A 4DW6A 1LDDA 3TAMA 1H3HA 3A1PA 2JG6A 3WQTA 1NHAA 3S2WA 2UXBK 2XRIA 2LJ3A 4XTWA 5DYMA 3SB2A 3ZMDA 1ERDA 1K4TA 5FW9A 2LCCA 4M6YA 3AVHA 1N33K 2O8CA 4ENNA 2DX1A 4RS8A 1VQ9I 2CGLA 3C4SA 3HKSA 2CS3A 2D0PA 1KAXA 1XHXA 1IBLK 2M7BA 1KD1U 1QVGM 1D09B 1VQ4A 1G6NA 1P7IA 4J9BA 2E1YA 1EWQA 1S6QA 2TRTA 4DFMA 3RUXA 4FCYA 3SUQA 1D1AA 4FYYB 1QNTA 4UQGA 2QSFX 4BI3A 3WU1B 4CYDA 3L2WA 3GTKJ 4EW4A 1LWCA 3NEUA 2GGRA 4CD1A 4O6JA 1XTAA 3DWLE 3M9AA 1OH6A 1ON1A 3UKRB 3VTHA 2W82A 3AVJA 2L3RA 3PX0A 4I02A 4KGXB 3ID8A 1S7AA 3OMGA 1A35A 2OJED 4IJAA 3LAJA 3JCMf 1W2BP 2JA2A 3TTCA 4E3SA 2W24A 3A8LB 2JA6J 4FWSA 2RK2A 1N8RR 5JLXA 2VV5A 4JI0K 1ONVA 2NS0A 1KK7A 3TGNA 3CCRN 2P6SA 3LANA 3DXJF 1VYVA 2PYLA 2OTJN 1BI0A 3H9JA 3KZZA 2ZFUA 1NLOC 1UHWA 4M7AB 3JV3A 3CM5A 3ECHA 2FMLA 1QO0D 4CHPA 2EIKH 2DBMA 3ZEUA 1GFDA 1W5CC 4F7ZA 4PFZA 3I8BA 4BRPA 2FSWA 4HF1A 4DSEA 1P2FA 2FMYA 3H0DA 1MHNA 3J7AY 4FJIA 4YDUA 4A3EJ 2CUFA 1D8KA 3TW7A 2L5QA 3OWTA 1FYLA 2P84A 4PJOF 1EIFA 3T19A 2OTLA 2QBYB 4Y3OA 1N8RO 3QEPA 1ZRDA 1HXDA 4KTQA 2AT1B 2MH9A 4M78A 4RW7A 3TOBA 4JEPA 3EHQA 1WJEA 2IG0A 1XNIA 3EFSA 4XH4A 1RRQA 5GAOp 4AHSA 2ZAEA 1VQ7Q 1T39A 2R7WA 1HYOA 3REBB 4CF2A 4UUSB 2X6XA 4DTOA 2KGTA 1MJ9A 3G4SA 2IGIA 3E66A 2HHVA 3AA3A 4E7JA 3DKWA 4CJTA 1DP3A 5IN1A 3DPLC 4CFDA 1VSMA 3V9WA 4CJ7A 1HNWK 4P9FA 4F17A 1TVRA 4RTWA 1JUSA 4UY8I 1P92A 2Z3YA 1L3VA 4ZYEA 2N8GA 2QWOA 3G1OA 3QKJA 2PFUA 3G7ZA 2FXAA 5LD2C 2HZYA 4II3A 2ZJRL 2E19A 3QLHA 3CLQA 4OPHA 1R1TA 5IYDJ 2EH3A 1U04A 4L5GA 2DOAA 1ESVA 1U2WA 3G71I 4U67L 2LVMA 4DQIA 3BTLA 1QBJA 1W2BS 1S7OA 1TAQA 2EJ9A 1UA0A 4ZNXA 3UDCA 3CC4I 1W4SA 2DTUA 3P9CA 2RF2A 2ICWG 3O8MA 1KD1R 2LY2A 2C0TA 4M75G 5KYNA 1WFWA 2FYKA 4BRNA 3HHTB 3CJCA 5I22A 3VQCA 1TKZA 4JK9A 1KQ8A 1G5VA 4PHTX 1R5HA 2OA4A 1ZHIA 1RADB 1DUXC 5CVRA 2HPIA 1RL2A 2PUKB 2RQVA 4BHBA 3WGGA 2L89A 3GEZA 3BR5A 1NK5A 4XORA 1AKHA 4PJLA 4CERA 1HW5A 3HRGA 1J54A 4B23A 3BE3A 1RKWA 3VSKA 3TAPA 3FFIA 3OYLA 4L18B 1AWJA 2E2NA 1YJWN 2ZCFB 3J7AO 2GTOA 3V42A 3SLCA 1X2MA 4CEFA 2RQPA 2QEXI 4PJOE 1TUDA 1VQ7T 3UB5A 4PUSA 1UOCA 2CYZB 1K6OA 1HKQA 2F96A 4Y0WA 2FBXA 1BB9A 3O3FA 1OYIA 4RWTA 1M1EB 1ZBLA 1P4XA 1R59O 3E1SA 4UHTA 1SRLA 4DBHA 2R7SA 2IPOB 3M56A 2E1CA 4KUIA 4FT4A 5GMKh 4B9WA 2IGMA 3HSFA 1YF5L 1UHFA 2LKXA 3ZSXA 1SVOA 2X1CA 2UXNA 5J1UA 3IWZA 4M77E 4XIUA 3FMSA 1HU0A 2M45A 1N9SA 2HFHA 4B44A 4IFYA 3KEQA 1HW2A 2HYFA 4TVRA 1BQNA 1VQPQ 4DHYA 3GTOJ 3H1QA 1V5FA 2ITMA 1QVGP 1BYMA 1TL1A 5L8RE 3FISA 3CCMI 1VQ4Q 1VNDA 4YY3K 3THXB 4DR4K 4IUQA 5F2RA 3SUPA 2R7VA 3ASKA 4R79A 5C10A 2XHIA 5F0CA 2ZZDA 4IXAA 1VQMQ 2RAEA 5BS6A 1JBMA 1W97L 4ANJA 1QQIA 4EMKA 1LFPA 3QBYA 2LREA 3GTQJ 5CYVA 3KEYA 2XDBA 4FJHA 2QM1A 1ZQ1A 2XK0A 5FLXZ 2ZF5O 3K2AA 1ETWA 3OYKA 5CQEA 5BPDA 4RTXA 1X2NA 3I56I 3INZA 5K1YA 1E3OC 3K2ZA 3U6FA 4M7DF 4M7YA 3A8GB 3CPFA 4D7MA 5H6RA 3HVTA 3UKUA 1JXSA 4IHWA 1VOMA 3F8BA 3PQKA 2XRLA 1VQ5N 2X1EA 2DD4A 2QK0A 1GT0C 3VEVA 1YITQ 3D45A 1UMQA 4M78D 2EQRA 2CJJA 4B1VA 3QHSA 3LPTA 5GAN7 3M53A 4Y13A 5KI6A 3FIWA 2XMFA 3VRZA 3GFLA 1BIAA 1M3QA 2M3AA 3M8JA 2BE7D 1S29A 4B48A 4XLEA 4DFPA 2K5CA 1IZ6A 3O9UA 5ILSA 2E36A 1FJGK 2Y90A 3DAWA 1MBFA 3BZKA 5JVTA 2Y0SN 3EN9A 3ENHA 3BF3A 3T8TA 3EG0A 2OTLQ 2HOSA 3EFOA 3AG4H 4H0EA 1VQPT 1AWOA 1R22A 2JMAA 2VJIA 4Y28E 3QNNA 4F16A 3LDSA 1VQ4T 1VI0A 1P6RA 3LH5A 3LX7A 3EQLF 4Y1CA 1YOVB 2DL8A 1QVGS 4HNVA 3O8VA 1O9SA 2DA4A 5D4SA 2H94A 2CW7A 1Y8QB 4YEJA 1LJ9A 2NUTA 3G4SQ 3R9PA 3BTCA 5L3DA 4M3YA 4FOEA 3SJJA 3CDIA 4BGAA 3L2ZA 3OSFA 2CMPA 3I55Q 1P9QC 1QSLA 2VUMJ 3FB9A 3EUAA 3UT1A 5H2FC 2G0EA 2Z1IA 2YR2A 2E1MB 3OL3A 4M3UA 5DUKA 1BA1A 2PBDA 3H3ZA 1F43A 4BRGA 1XNRK 3VN5A 4EMHA 2R3SA 5M5XJ 3VEWA 3SHWA 2Q1NA 1HA8A 2HVSA 1VQ6N 2E5ZA 4FWNA 1J5OA 3CMEQ 2HHTA 4LDUA 4RM2A 3NCIA 1GLCG 3WHBA 2YKNA 2K27A 2XAFA 4OP0A 1D5AA 1ON2A 1HKGA 2LMJA 3JAMO 1DLOA 1YITT 3FMRA 1NZ9A 4JLGA 5BMZA 1ZQ3P 4V2SA 3NF6A 4M7DE 1V5EA 1N32K 2V6EA 3OTOK 3W2WA 3ATUA 3RQIA 2E10A 2PVDB 1WHLA 4HDVA 3KLOA 1ZR4A 4KHYA 3KUFA 2NUPA 2WV0A 3LW5E 3THYB 1I50J 3VF2A 1MBKA 2BE9B 3KP2A 1Z05A 1YQKA 1KQ9A 2YHXA 4E19A 1JT0A 2P0KA 4BR7A 3ZQFA 3KEOA 4EP4A 5AQLA 2XC7A 3U9ZA 3NTHA 2OTLT 3QOPA 2CSOA 2YCHA 1K8KA 5AQTA 3MQ0A 2F4IA 2UZKA 4HUGA 5FKMA 1FJLA 3QO9A 2X3XD 1RAAB 3IRQA 4XKWA 3WTSC 3AVGA 1VQ9A 3HSBA 2NUBA 4C5GA 1VSDA 4FPAA 4BR4A 1I4K1 1R5GA 2VBXA 3G4ST 3HT3A 5AQUA 2ZPHB 3ZOBA 5HRPA 5AZIA 3W6KB 4G6QA 4F55A 3TMOA 4O5BA 2EGAA 3C2BA 3UR3C 1T0JA 4QWQA 3I55T 3CQYA 2GBYA 2BGCA 3F70A 3I8DA 2KEAA 1Z1DA 1GLJO 1MW7A 2KIFA 5HROA 2LMDA 3KX2A 3QEVA 1D0XA 1H641 3FWEA 2FEZA 4EGYA 2WOMA 4MEXF 2XHCA 3K4BA 1QCNA 3JCMV 2MD5A 5KH6A 4Z89A 1JJ6C 3VS6A 1R5ID 1XMKA 2OQGA 2NRVA 2O8DA 1O57A 4AH9A 3L8BA 4DSFA 3GTJJ 5D6FA 2G8VA 2W6KA 5BRHA 1FOXA 3QIIA 1HD3A 1A5XA 1KRPA 2HKQB 1AOYA 1FBSA 2L01A 1NK7A 3ESWB 2ZE2A 3LMMA 3VGKA 2ASOA 4HA8A 4KH0B 5CR4A 2YUQA 3ULRB 3FHNA 4HYEA 2OZMA 2OCCH 3NDKA 2KRHA 3D1NI 1BM9A 3BCBA 3OS1A 4B9XA 3MEEA 2R93J 5LY3A 2A36A 4PKCC 3VQAA 1JXMA 2IVMA 2Q97A 4FL6A 4DV7K 2CW0F 1XSDA 3MP8A 4FK4A 4CXFA 2DEQA 1NBWA 1RACB 2P5OA 4XQ3A 1RBRA 3BF1A 4MQ3A 3CCJQ 1VQ8N 4GY5A 2K3PA 5DCMB 5HNFA 5LJ3j 1PNJA 2HXIA 1FPQA 3UIQA 3EHRA 4AHRA 3UF4A 4N41A 1HKTA 1VRUA 4J00A 4CK3A 1Q81U 4N4IA 1PRMC 1IJWC 3KK3A 1S5LC 1WQ2A 4LK1F 2E3IA 1X3MA 3MMYB 3MKDA 2OF7A 2O8BB 1LV5A 1WWXA 1R00A 1TWBA 2R0QC 2HSTA 2Y48A 3VKIA 2W40A 3K9KA 4RW9A 4DYRA 3GF2A 3R61A 3I5RA 2EQUA 3U4LA 4LNPA 1CXUA 1U3OA 2QM3A 1SF9A 1TGOA 3FXOA 2P5VA 2OANA 3SAGA 2X85A 1WHGA 1XQSC 3B6OA 4CJPA 3M1EA 3QETA 2P0WA 3CHWA 3I0SA 2KTQA 3LQQA 1YJNI 5ECAA 1UE9A 1VQKI 3G71A 3VGLA 1ZK8A 1ETOA 3C95A 3AO2A 4XLCA 1YCSB 3CCQQ 1PU6A 4FT2A 1Z67A 2D5VA 1RAFB 2GA1A 4CEDA 3JCUC 2A69F 3CESA 1MBHA 2XGCA 1LDKB 1EKEA 1R58A 5H6QA 4C8OA 4NDLA 1U1SA 1Z3YA 3OIQA 2PBIA 4B3OA 1I27A 2R7DA 1E3MA 4HSRA 3TU5A 4DBFA 4HVVA 1ACIA 3SWNA 1YUWA 3K1PA 1Q82C 2ZO4A 5GAOm 4N4GA 2JUFA 5GJVB 3CCJT 2JZYA 2NOGA 4ZYGA 2L4MA 3BG7A 3MEVA 3ZN1A 4XOTA 3QQAA 2DMOA 3S14J 2P51A 1KFSA 3ZN0A 3EKUA 2DO7A 4H8KA 3EG1A 1FYKA 3QESA 1FY7A 3C7NA 3VYGA 3PNWC 3CF5F 3S1MJ 2QEXA 3WTTC 2IPQX 4ZJZA 4CJEA 3E9LA 4K42A 3K70D 2K7AA 5FROA 3AG1H 4K2EA 3RR6A 1D8YA 1DTTA 4AILC 1YCYA 3AA4A 3ZSQA 1D8JA 2WAFA 1YHQI 1BWFO 3J81K 4JAXA 2EILH 3MVPA 4GKJK 4BDZA 3PO3J 2XF7A 3FXRA 1WEGA 3M3ZA 3BR0A 2LC2A 3D2EB 5HK0A 4HXJA 2ELHA 3NPFA 2OZSA 2PY5A 3ZQHA 1IXDA 7AT1B 4H0VB 1M1KR 1UHCA 3O80A 4B1XB 1DGRM 5GAHJ 1RT2A 5DS9A 4MO5A 4CJRA 1AVZC 4MMKA 5D7UA 5AQJA 1Q9YA 1JJ8C 3JRZA 3CCQT 3SFMA 3OS5A 4KB1A 3J7ZI 4MLEA 3DPTA 1USSA 4EJZA 2B6AA 3CCMA 3HXMA 3JREA 3CC4N 4JKCA 4DBRA 4ASNA 4M75D 4KBOA 2R5YA 2EW3A 2LC4A 5JR3A 5AQFA 2DMNA 1Q81R 2MBFA 4A5AA 3IDHA 4PLIA 2YXYA 1SVLA 4BGBA 2XDDA 3TAFA 4CGFA 4BRQA 2JM8A 2K3YA 3FKIJ 3K4NA 5DDGA 3QAHA 2LJ0A 4KH6A 3EYZA 4DBQA 4Z8AA 3O4QA 1GLLO 4DOVA 1MMGA 2YJEA 2XD0A 1Q82R 1OYXA 4F7UF 3NE6A 1WJRA 4LF4K 4OB3B 1MGQA 1V4SA 2FXUA 3H0FA 1QP2A 3BJ6A 4D6WA 2FA5A 1UB9A 5BRFA 4DKWA 3GFMA 1XMOK 3FJ5A 2DTIA 4P96A 3S93A 3PT9A 3I56A 3PX4A 4ESRA 5IHKA 4OPKA 1M90C 3CCUQ 1AWCA 4OMMA 2VN2A 3OYNA 2DL4A 2ABKA 4FWLA 2M7AA 2Y30A 1Q81O 3ZSOA 2E35A 1OYYA 2KT8A 3SNNA 2Q2RA 4J7IA 2VXEA 2W41A 3KBGA 1X3ZB 4NQWB 3CC7Q 2AZSA 2YI1A 3FZFA 2DFIA 4JI7K 2F9TA 1BDGA 4PJOG 3IFRA 3H9QA 4PA1A 1N39A 4DV6K 3J8AA 4HHTA 2KHMA 2ESWA 2K3FA 4CESA 4YFKF 3DTEA 3CERA 2W10A 1WSEA 4B1UB 4KO0A 1HK9A 1WJQA 1HNVA 4K25A 4JOMA 1VQ9T 1XQOA 3WXKA 4PKGA 3LSMA 1HSJA 2VWJA 1QZYA 2LNVA 5AQQA 4ITVA 1X1AA 3HRMA 3NGIA 5FLXE 4A0XA 1IB8A 3RDIA 2R4GA 3ENBA 2QWRA 3I5UA 4M77G 1PM3A 3T1AA 1NKCA 1YQRA 2ZFWA 5LJ3g 2GWJA 1R4NB 2NNWA 2EYQA 2YHBA 3V8LA 4BR9A 3A2KA 1MKMA 3S3NA 1O13A 3SZPA 2HL3A 5GANj 1LWWA 3QP5A 4R1HA 1NGIA 2RQRA 3G3ZA 3RKWA 1JXBA 2CP3A 1IHVA 3O5ZA 4LLNA 3LP0A 2QQRA 3P9KA 2J6OA 5FGMA 4UUSA 3FLCO 3M8RA 1R49A 4C3HJ 1M90R 4FW2A 1U9NA 2KRFA 3VQDA 2Z33A 1L3SA 2P5KA 1X9WA 3CI5A 3L0QA 2JZ2A 3BR1A 2HBPA 1YE9A 1JXOA 3BY7A 1N77A 2FU4A 4OMYA 1OCCH 3IKTA 1S6LA 3WEEA 3CMMA 5GPAA 2E2PA 1ZA2B 3AL0B 3EUKL 3JRBA 1T95A 2DM1A 2P9UB 2EGCA 4XKBA 3I54A 4KYWA 2QLZA 2EJFA 5HS8A 4H0OA 4M3DA 1ZBJA 5LL6Z 4KH4A 4QKUA 4B09A 4C92F 3KE2A 2XIDA 4DTSA 4Q5VA 3O6WA 3A1YA 4DB3A 2P9PA 3OH9A 3HP9A 4C8QC 1HPZA 1OFCX 3AGKA 3OA9A 2E1HA 4BBRJ 2KKOA 4MTEA 4WTOB 3EUHA 1JT6A 4TSXA 3SEQA 4ID1A 4JRPA 1VIEA 1EP4A 2KXCA 5K7FA 4O8UA 2KVQG 1YVNA 3EZ5A 4CUGA 3LWFA 3FRNA 4LB5A 3GLXA 3ZSRA 4AM3A 2YKMA 3CP2A 4RM3A 1RTJA 4FM2A 1LVAA 2XV4S 2IAJA 2VQLA 2DXUA 3EY1A 3EL2A 1QRYA 2F2EA 1QHHD 2JQ7A 4QQGA 4G12A 2RHIA 4CHQA 3RERA 3BEXA 3Q3SA 1U8RA 1K9MR 2DTHA 1RAHB 3A01B 4BE1A 5FDLA 1NGGA 2IS3A 1A6QA 1K4SA 5JLWA 4BQQA 1MWKA 4NB4A 1JJ2M 1SFXA 3BTIA 3NF7A 5F1RA 1AA7A 4AQYK 5CKFA 2MA3A 2XU8A 4LG0B 3G71T 4ZTJA 3K4MA 4I09A 2EIMH 1NE8A 3PIOL 2DCEA 3L2QA 3RMBA 3O5BA 1J9IA 4F2SA 1NM1A 4WQ4A 4NUBA 1X58A 4M9XA 2BTTA 4XN0A 4J9HA 3JRGA 3BJOA 4FJNA 1PSEA 2DU9A 2YHAA 3HSEA 3LDPA 1GV2A 1NMDA 4BG9A 4GXOA 3RPUA 1N6QA 3GUDA 5M1NA 4ILJA 4S05A 5EEAA 2MW8A 3Q1JA 2F5KA 3D7EO 1U47A 4CZZA 1TZLA 1KEAA 2L7FP 2X6WA 4M7DG 5E8GA 3THXA 3ZSZA 2GUPA 2MPXC 1VQMN 3AKZA 4C92E 3ZETA 5FU6C 5DTDA 2QEXT 1OYWA 3SDGA 2E41A 3FZMA 3IAM2 3HPHA 1SAUA 1KG3A 3NTIA 3KLGA 2V1NA 4B43A 1QA6A 1WAJA 2ZD1A 2MWPA 1A31A 2HKOA 4FYXB 3NFCA 3RRHA 2BW3B 2EHGA 2NRHA 3TSUA 2CH4A 3PGGA 2JUCA 1Z77A 3C7JA 2BY3A 3Q9VA 1M30A 3PSIA 4WXCA 2O03A 3P9IA 4E7LA 2HOEA 2BVMA 1NWKA 2DMPA 4BRDA 1OX8A 3QICA 3KZYA 2GELA 4YOXA 1V1CA 2F2VA 4DS4A 5C44J 3QDKA 4LF7K 1GVDA 2BY1A 2A37A 2OD5A 4XONA 5BREA 3H92A 1YJNA 3LSIA 3SFIA 1IREB 3CCEQ 1VQKA 1BBYA 3CCMT 1RI7A 1QSSA 3ZX3A 3C2GA 1DGKN 3QZ9B 4M73A 5FB2A 3O9TA 2ECZA 3GLLA 1KG4A 3CWAA 4FLXA 5L3GA 2X6OA 2K9QA 1TH7A 2RGVA 2XASA 4JK1X 1KIKA 1XG1A 3X20B 1YJ9Q 3QIPA 2PAVA 3ERED 2KZZA 1HQCA 3CVTA 3C6HA 4CF9A 5DMRA 5JFRA 2R7XA 2BBYA 2P4TA 1POGA 4KIBA 4F9OA 1HQEA 1IF1A 3OR2C 4M6XA 2EZIA 3LCNA 4PUOA 4L6V5 3G0ZA 1VA7A 1RDCA 4OKEA 2O9SA 3I56T 5AQGA 4QSHA 3EYYA 2EZHA 1XS9A 3H3NO 1T0FA 2ZC2A 1ZBXA 3ZR8X 2DXCA 1TQIA 3GTPJ 2DPUA 3L00A 5LJ3e 3CJNA 4LFUA 3CMYA 2CU7A 1U06A 4QIWN 1IN8A 4DK9A 4KHNA 2DKGA 2I5UA 4AU7A 1TG0A 4OMFB 3I4PA 4EATA 5GANg 3GBQA 3OJSA 2I8DA 3CCSN 1MNDA 3VFZA 1ZAOA 1TOVA 4C2UA 2K6DA 2HF3A 2CFXA