3OYNA

Crystal structure of the pfv n224h mutant intasome bound to magnesium and the insti mk2048
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oynA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oynA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oynA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oynA03
3B6PA 2KZMA 3L3VA 3HT3A 4CCHA 1DTTA 1KVCA 1BI4B 3C4SA 1RNHA 2HVIA 4HUGA 4CJFA 3ZSOA 3SQ0A 2XK0A 3MEEA 4O0IA 3M8RA 3OYEA 1HJRA 4M41A 3ZSZA 1CXUA 3V9SA 2F8TA 1N5YA 4Z4EA 4RW7A 2HNYA 2NUBA 1VRTA 4CEZA 4DSEA 4NCAA 3V1RA 3V9XA 4DSKA 5JS2A 4AILC 5K14A 4IKFA 2VG6A 3OYJA 4IDKA 3TAFA 3WNGA 1KCFA 2IAJA 3OYMA 2VWJA 5CIUA 1NJYA 1XWLA 4NZGA 4QQDA 4FJ9A 2F96A 1WSEA 1VK0A 4LH4A 5CY4A 4BE0A 4I9LA 3HP6A 4BWJA 2GUIA 3LALA 4I7FA 4CJUA 3SQ4A 2LTOA 1S1XA 2HNDA 3L8BA 3VA0A 2KFZA 4N4GA 3V1QA 3VQBA 4FJ8A 5JS1A 3LWMA 2X6SA 2RI2A 4BD3A 4FLXA 2P5OA 4C5IA 1LAVA 1YTUA 2EQJA 3SUOA 1WJRA 4B9TA 2HHXA 1BIUA 4CEEA 2OPRA 3L3UA 3MECA 3SJJA 4CEDA 4IBNA 2BDPA 1YVUA 1G15A 3TR8A 4A4FA 4CF2A 1IH7A 3AVFA 1HMVA 2IGIA 3OYBA 4KHNA 2G8UA 1YTAA 4C5EA 3FLGA 2D5RA 2X4WA 3QKJA 1OYXA 4Y1CA 5E41A 1FK9A 1Q9YA 3K5NA 1SL0A 2YKNA 3OYNA 2BIVA 3C6TA 1QS4A 4DU1A 3U6FA 1TKDA 3K5MA 2E6NA 1RT7A 1RBVA 4FJHA 1L3TA 1QTMA 4KPYA 1ASWA 2R58A 2DAQA 4E7JA 2HHQA 1ASVA 2O4XA 3M8PA 4QAGA 4AHSA 4FLUA 3OQ5A 1I39A 4PL6A 3O3FA 3H6ZA 1VSEA 4DQPA 3RRGA 2IC3A 4B9NA 1VRUA 4KRFA 5D6XA 4W5TA 5KCHA 4CE9A 4II1A 1JL2A 2B8AA 3HXMA 1U49A 3FFIA 2L8DA 3HPHA 4JRQA 1G5VA 3CFOA 2HVHA 4Z4FA 1C1CA 3OMCA 3SI6A 3S9HA 1NJXA 5KE3A 1B9DA 3OYIA 1GOAA 3HL8A 4WE1A 2JTFA 1WGSA 4N4HA 3DOLA 4G1QA 4FLZA 4PY5A 4W5NA 2GFUA 3AVIA 1N27A 3T3FA 4ZTJA 3LAKA 4FK4A 2GF7A 5D6YA 4B9MA 1C0MA 1MU2A 2D0AA 4C8LA 4M3RA 2M16A 1BQNA 2QXFA 2F5KA 2JZ2A 3TARA 1CZ9A 2GV9A 3I8DA 3MAQA 1JXEA 3AO5A 3ZT3A 4W5RA 3DLMA 5HLFA 3LGLA 3V6DA 4C8NA 2O4XB 5C25A 4N47A 2HHWA 1WN7A 4ICLA 2OZMA 1TAUA 4H4OA 1KVBA 4K8XA 3CFPA 4TSXA 3CEYA 3F70A 2RO0A 4FW1A 4CHPA 1RT3A 1C0UA 3SD4A 1S6PA 4LSLA 1C1BA 3PNWC 4JRPA 3RR7A 2G8IA 4OJRA 3RMCA 1H3ZA 3DI6A 4FZZA 3LPUA 3NTKA 4KTZA 3THVA 2LVMA 3T19A 1J5OA 4CJQA 1TV6A 4LH5A 3MEGA 4A4HA 4CECA 3P5JA 2R57A 4JS4A 3MEUA 1BHLA 1VSIA 2FBXA 4LD6A 1D9DA 3O3HA 2XO7A 2RI3A 1SL1A 4HUEA 2HQXA 3VQQA 4MQ3A 3ZSXA 2RKIA 4C8KA 3DLGA 1O1WA 2QK9A 1JLBA 3ZT1A 1S1WA 3QEPA 5CYMA 5KTQA 4CIFA 4CGIA 3AO2A 3V4IA 2P0KA 1TL3A 4RW8A 1XI1A 1C1AA 4OKKA 3DLBA 4JLHA 4FJGA 2FBYA 1FXXA 1F21A 1NOYA 3AVMA 4FCYA 2B6AA 4DQSA 3F9KA 4HCCA 1QSYA 1CZBA 3OYAA 5IN1A 3NF9A 3HJFA 1ZBHA 2R7YA 2IS3A 3DLHA 4IUQA 1I3AA 1JLAA 4PLLA 1BI4A 3META 4KHYA 5CZ2A 2IDOA 2E5QA 4JS5A 2A1RA 4DF4A 4FLWA 3TWHA 2EKOA 3KLGA 1KVAA 1WJSA 3M8SA 2YRVA 3LLRA 5HRSA 2PZSA 3C95A 2L89A 3MO8A 2QKBA 1Y97A 3FDRA 4MFBA 3PUFA 3LZIA 2W42A 4CF9A 2VG7A 4DFJA 4CEQA 1RCHA 1IKWA 3NGZA 3TAEA 4DTRA 5J39A 2XHBA 1SKSA 3V9ZA 2HHSA 1RBSA 3RMBA 2DIQA 1NK9A 4XIUA 4R5PA 4H8KA 3KK1A 2ZQBA 4CRIA 1S9GA 4CHNA 3BGRA 2X74A 2G3RA 1BGXT 2LSNA 2DFEA 1T05A 3LX7A 1D5AA 4OLAA 3UT1A 1C0TA 3QIOA 4PQUA 4DFKA 1NK0A 3SYZA 3DB3A 3DLRA 4Z4GA 4CJTA 4YNQA 4IUVA 5HP1A 4CGJA 3MXMA 2FHDA 3IG1A 4DSLA 3RTVA 1U45A 4M3UA 5CYQA 4DTXA 1RTIA 1WSFA 3L2WA 4KB1A 1S1TA 1FKPA 5KCOA 1S1UA 3NHGA 2B4JA 3HP9A 5HROA 2OZSA 3VQCA 2RJEA 3KLEA 3CG7A 4DTMA 2X6NA 3A2FA 3M8QA 4M3XA 2HHUA 5J26A 4Q0BA 1REVA 3EAEA 1VSLA 1K6YA 1JLEA 4PWDA 2HW3A 3LWLA 1RDDA 2WOMA 1FKOA 3NGIA 3BDPA 3E9GA 3KKRA 1X9WA 1IO2A 3NGYA 2ATQA 3NH2A 3SUQA 2M0OA 1WSGA 2RHXA 3VQ8A 3NDKA 4DSJA 1B92A 4CEBA 1RT4A 1R0AA 3H08A 4CFBA 1ZYQA 1ITGA 1S1VA 4FM2A 3VQ9A 4KHSA 1L3UA 5HBMA 4FJIA 2B5JA 1KHCA 3ZSWA 4O5BA 3HM9A 4KAZA 3NTIA 3KJVA 2LRQA 3MXIA 1QSSA 2QQRA 1VSFA 3DRPA 1VSHA 2RHZA 5SZTA 3FEOA 2E4LA 2YNFA 5J2NA 3S6WA 4C5HA 3DB4A 3RMDA 3RMAA 2R5AA 4DFPA 3NBPA 3TANA 4DSFA 4BE2A 3OB9A 3IAYA 4GVMA 1BIZA 4FXDA 4O44A 2KTQA 5D6WA 3LDSA 1A5XA 3LP0A 4CFDA 4W5QA 3V1OA 4CHZA 1Z25A 4FU6A 3VQEA 2RJFA 3DM2A 2P1JA 3QLHA 1HNVA 4RW4A 2IOCA 1WNSA 1J54A 4AHTA 1NK5A 2XY5A 4KI6A 4CK3A 4DTOA 3LZJA 3OA6A 2PY5A 4KB0A 4DTJA 1SL2A 4BACA 4KFBA 3MP6A 2CKKA 4AHRA 3NCIA 4ZHRA 3UWNA 4KHWA 4AHVA 4KTQA 4ID5A 3V9UA 4N56A 1UAXA 4DTSA 2FBVA 4RG8A 2JLEA 2KZZA 3OYGA 1RT5A 1NK4A 4J2DA 4CJKA 2KFNA 4X34A 4PLIA 2O4GA 2Y1IA 1TGOA 3ZSQA 1RBTA 4W5OA 1TVRA 1EETA 1L5UA 4LSNA 4IUPA 1NK6A 4CK2A 3OYKA 4KREA 4CHOA 4E0DA 3O8VA 1RTJA 4M3YA 1XC9A 4C8OA 4UQGA 4L8RB 2O4IA 5KI6A 2VYTA 3P83D 3HVRA 1RDCA 1IKYA 4N41A 4DQIA 3LP1A 4E1NA 2PQWA 4BDYA 2RHUA 1NKCA 3VQ7A 2Z1JA 3DMJA 4KKOA 4B9LA 1NKBA 4NCGA 1Q8IA 4IFYA 4DWIA 2EQKA 1A5WA 3K2PA 4OGCA 1JXBA 1RDAA 4FZXC 3OYLA 1Z26A 5FRNA 1WJQA 2X78A 4ELUA 3PFSA 1MHNA 4OKEA 3K5LA 1U47A 3WNHA 1RBRA 2ZE2A 1RI0A 3AVNA 4E3SA 4J2EA 3KUFA 4Z0UA 4FJKA 2MWPA 5KGWA 4FK2A 4BDPA 4B9XA 4ELVA 3Q1JA 4OVLA 3S3MA 1RT1A 2RPIA 3L2QA 4RG2A 3PY8A 4QVZA 4EZ9A 1KTQA 3PO5A 5KGXA 4IG3A 3DLKA 4HVJA 2E6LA 3CYMA 3OYHA 5J2QA 2OYQA 4BWMA 3VA3A 4CJ3A 3S3OA 1SV5A 4H4MA 4QW2A 3QERA 4FJ7A 4J2BA 4DFMA 3PX6A 4QQ6A 5DK5A 3VQ5A 2XY8A 4RW9A 2Q3SA 1TK8A 2K3YA 4CJWA 3AVLA 3VQ4A 1NJZA 2HHTA 4FLVA 2X4XA 1L3SA 1L3VA 4LD0A 1W0HA 3ZT4A 2Z1GA 4NCBA 3OS1A 2G8HA 5J1EA 3TAMA 3DYAA 2HHVA 1SKRA 3G10A 4F8RA 3JYTA 4OKJA 4E19A 4CJSA 4FL6A 5C0MA 1RT6A 1LWFA 1S6QA 1HYZA 1TKTA 1QSLA 4QCLA 4FM1A 1S5JA 3HK2A 3LGFA 4DSIA 3TAQA 4ELTA 4GY5A 2ITGA 3QEXA 1HRHA 1T8EA 3QIIA 2RN2A 3H8ZA 3UIQA 1QHTA 2XRIA 3AO3A 3QESA 4OLBA 3DOKA 3ZSVA 3QETA 3KK3A 3E01A 4E7LA 2G8VA 3TABA 5IAYA 4FJJA 2RF2A 2PYLA 1BQMA 2P5GA 2OA8A 1NKEA 2GBZA 3ASKA 5T7BA 4CJRA 2PYJA 4DTUA 1WAJA 4Z4CA 4FJLA 3O3GA 2M1HA 2I5JA 4FJNA 4B9SA 5DMRA 1W9HA 2RHYA 3OVNA 5KE2A 1LAWA 2YHBA 1IG9A 4NS5A 3LYIA 4HUFA 2EHGA 5J2MA 3SPZA 2QKKA 3SZ2A 4FZYA 1B9FA 1T03A 4HCBA 2F8SA 3IRXA 4ZTFA 2VG5A 4FLTA 1VSKA 1A5VA 4Q5VA 5D3GA 2DFHA 4EDUA 4EP5A 3OYFA 2X4YA 1VSDA 2NLUA 3OMGA 1IKVA 4PA1A 4FVMA 1JL1A 3RR8A 4ID1A 4DU3A 4A4EA 1ZBFA 4BDZA 1RILA 3RWUA 3SQ1A 3ITHA 3ALYA 3AA3A 3OJUA 1UA1A 1HPZA 1NJWA 4KTWA 3NF7A 4B08A 4FJMA 3VQPA 4DG1A 1D8YA 3AVHA 1KSPA 3OS0A 4DU4A 2RI5A 5HRPA 4M3ZA 4CJEA 3LP2A 3O4QA 4CHYA 2RHIA 1GOCA 2BGGA 1DLOA 3KLHA 3E9FA 2XY6A 3NFAA 3AVCA 1JLGA 4O4GA 3KK2A 3AVJA 5KRSA 1JKHA 3DLEA 1NK8A 2K3XA 3HPGA 3ZEHA 4EZ6A 1QQCA 3ZSRA 1RBUA 3QBYA 1LW2A 2HQEA 2KQ2A 3PO4A 2VWKA 5I3UA 3AVKA 1ZBUA 2OPQA 2IG0A 5J2PA 3TAPA 4KV8A 3KLIA 3F73A 4QQGA 1OZ2A 3QINA 4CGDA 1WAFA 3D0PA 3L2RA 2LCCA 3QEWA 4FM0A 4HTUA 1RTHA 2YNGA 4E1MA 1TL1A 1C6VA 1X9SA 1KRPA 4AH9A 2WONA 4NYFA 5SWMA 1XNIA 3K57A 4Y1DA 4M45A 4O55A 4CGHA 4E7IA 1OI1A 1SUQA 4OPKA 4C5GA 3OY9A 3AVGA 2G8KA 4CJ5A 4CJVA 4B8CA 3K5OA 3CFRA 3LANA 3CQ8A 5C6SA 1YT3A 1RTDA 1WSJA 3AA4A 1UOCA 1JLCA 3OS2A 1EKEA 4CEAA 3VQDA 3ULDA 3SV3A 3B6OA 4CFCA 3SQ2A 3NTHA 4GMJB 3S3NA 1VSJA 3MEWA 1HYSA 3ZT0A 5KRTA 2BUDA 1UWBA 4AHCA 4B9UA 1VSMA 4QOZB 2Z1IA 4F3TA 3NE6A 1SKWA 4Q5WA 3KTQA 3TAGA 4M42A 4IFVA 4FYDA 3LPTA 1TKZA 2DIGA 4GW6A 3QNOA 3EYZA 1KLMA 2Z1HA 1UA0A 4N5SA 5FDLA 1U4BA 3NH1A 4LY7A 1NOZA 1OZ3A 3NH0A 4A4GA 2FC0A 3DRSA 3QO9A 2HNZA 4I9QA 1TAQA 3MP1A 1EXQA 3MXJA 4F4KA 4KHUA 2GFAA 3GOXA 1HYVA 1U48A 4BE1A 1N6QA 1Q9XA 3EZ5A 3FC3A 1LW0A 5CZ1A 2D0CA 4IUTA 4J2AA 3ZSYA 4CIGA 4I2PA 2YV0X 1LWCA 1DTQA 2BANA 4CEFA 2EQMA 1CLQA 1S9EA 3P8DA 4E7KA 2ZD1A 3LP3A 4EP4A 4FK0A 1RT2A 2RJCA 1BL3A 4E7HA 3G0ZA 1SSFA 3C94A 4F2SA 1RDBA 2EFIA 4NYNA 1KLNA 4UC4A 2E6MA 3WNFA 2R5MA 4M3WA 3SUPA 3SV4A 3TI0A 4CJ4A 4DS5A 4PUOA 1HNIA 2MWOA 2EX3A 4Z4IA 3VN5A 1X1PA 1JLQA 3BDLA 3AVBA 3ASMA 4CF0A 3K59A 4DTNA 2HMIA 1D9FA 4DTPA 3NF6A 4CJPA 3K58A 2HB5A 3NAEA 1NK7A 4B8AB 1WLJA 4CGFA 3ME9A 3O4NA 4FJXA 1KFSA 4CF1A 2EQUA 3IS9A 2L3RA 2ETJA 1TK0A 2QQSA 3MEVA 1WSHA 4E89A 4DQQA 3ISNC 3C6UA 4CF8A 3I0SA 1BISA 5KH6A 3KIOA 4FLYA 5HRNA 4KI4A 1J53A 1XHXA 2XY7A 4YFUA 2D9TA 4KO0A 1EP4A 1BCOA 3MEAA 4CJLA 4OVAA 2OPSA 3SNNA 4DF8A 4O0JA 3T1AA 1QE1A 3D45A 4IURA 1EX4A 4N4IA 3QEIA 2BE2A 3L2VA 3EY1A 2JGUA 3AA2A 2OPPA 4CERA 3QNNA 3ZCMA 1HQUA 3CM6A 3P1GA 3L42A 3HO1A 4OGEA 2WACA 2YHAA 3U3YA 3AO4A 3V81A 3AA5X 4KHQA 1J9AA 3OYDA 2P51A 3PX4A 1JLFA 2YNIA 4DLEA 5HRRA 3AO1A 2DY4A 4CFAA 2DTUA 4CIEA 4HCZA 3V9WA 3U3GA 1ZBLA 4DMNA 4CK1A 1ZBIA 5FROA 5FRMA 1XHZA 2D0BA 1TK5A 1IKXA 4IUUA 3LAMA 3PX0A 1KFDA 4FW2A 4I2QA 3JSMA 2YKMA 1TKXA 2FBTA 1LV5A 3MEDA 3PV8A 5M9OA 3QIPA 2A1SA 2G8FA 2DFFA 4AHUA 2G8WA 3NNQA 3KD1E 5EU7A 3MP8A 3PMTA 4Z02A 3SUNA 1HQEA 2BKDN 4DQRA 3KKSA 4OPJA 3OJSA 5I42A 2RJDA 4F3OA 3P8HA 1LWEA 1ASUA 4F2RA 3HPOA 2XDPA 4CHQA 3L2UA 5C42A 3QJ6A 3VQ6A 4CESA 3SPYA 3RRHA 3WNEA 3DRRA 3KD5E 3CM5A 4IG0A 2LDMA 1WSIA 3AVAA 2YNHA 4N76A 2AJQA 3HVTA 4B3OA 2KW4A 4FJ5A 3NF8A 1GOBA 4B9VA 2X35A 3HSTB 3AV9A 5C24A 1CXQA 3LH0A 4Z4HA 1BCMA 4CGGA 1T7PA 4M3TA 3KLFA 3QEVA 2Y1JA 3HYFA 4B9WA 4DS4A 3VQAA 1X9MA 4HHTA 3ZT2A 3OYCA 3I0RA 4C8MA 4K8ZA 3SCXA 4DLGA 4CEOA 4L59A 4RW6A 3M9QA 3PMIA 1U04A
chains in the Genus database with same CATH superfamily
3SQNA 3MK6A 3B6PA 5K7HA 3HT3A 3VS1A 4CCHA 4WXDA 4UVAA 4F16A 3ZMZA 1VQ4Q 1YW7A 3K2AA 1QVFS 2HPIA 2NOGA 4C92D 3GUDA 3GZ5A 3C12A 4JLGA 1FMWA 1NGAA 4ISGA 5J4VA 1KG2A 3V9SA 3DXKA 1XMQK 1N5YA 1BW5A 2DXBA 4HVUA 2HNYA 3O9SA 3MMYB 1GCQA 1C0FA 1VRTA 4JI2K 3ZQ7A 2DBMA 2LKXA 4G7OF 3LSIA 4NCAA 2J06A 5AIPA 3VPRA 5E8GA 2K57A 3PSFA 5LFAA 3M0TA 1KFZA 1Q86U 3PQJA 3IH2A 3TAFA 1Y0NA 2VWJA 3H0HA 2R7FA 2VJ5A 2Y75A 3GBGA 2YX6A 1BOTO 3QDKA 1XWLA 3R4KA 2ZWHA 3UA6A 1YS6A 1YJWN 3VW4A 1BG3A 1I81A 2WV0A 2V1RA 3CJNA 1Y07A 5ECAA 3F6OA 5LHHA 1R5HA 2ZJQL 2GUIA 3LALA 5TKWA 2GEMA 2LBFB 3LW5E 2LTOA 4MIMA 1G4DA 2VL8A 1DEJA 1HKTA 1UGPB 1AA7A 3GF2A 1KGSA 3BPXA 2JA2A 3VQBA 4ETSA 2MPXC 2GXBA 2O8EB 1Z1DA 3AG3H 4XLNF 4BD3A 2WY8Q 2P9NA 1VQ9I 1YE9A 3RIRA 3D6RA 2MFZA 1YTUA 2E3HA 4HNUA 1WJRA 1OEBA 4CEEA 2QBYB 2O2OA 2OPRA 1HDDC 4CEDA 2OZ6A 4IBNA 1G3WA 5DM7L 4EFHA 2XAQA 4M77F 4BY1J 1YJ9N 4ENMA 1ZX6A 4ZGJB 3ZMUA 1JEGA 3K10A 1Z6TA 4WQ5A 4DV2K 5J1YA 2GOMA 1I6HJ 3CUQC 1BN5A 1OQKA 2LQWA 2YU3A 1OYXA 5AQQA 5E41A 1Y7XA 3J80E 1E17A 5EGOA 4A62A 2HF4A 4L9VA 1V4RA 2YHTA 1QS4A 2VGNA 1A36A 4MZMA 1LFUP 2ZAEA 2E6NA 1VQNN 2HL3A 1RR8C 4GO1A 2DMNA 1U3EM 3GTGJ 5D5XB 4GGGA 4KPYA 2R58A 5KYUA 4S05A 4DJAA 3CQZJ 4FQGA 2ESWA 5TGTA 2OU2A 2HHQA 2O4XA 3HOZJ 3S17J 4UUVA 2K7AA 3OQ5A 1VQ5Q 3PO2J 1U2VB 1I39A 1YF5L 4C2TA 2V1QA 5GAMe 2LR8A 1YJ9T 4UY8O 2MA3A 2IC3A 4B9NA 3RDVA 2A68F 3QSUA 1HW1A 4W5TA 1G3YA 1YX5A 5KCHA 4B6MA 3ZQHA 4AM3A 4DUZK 3CQTA 1J75A 3JCMg 3E3VA 3J7ZI 4J83A 4II1A 1JL2A 1C6VX 2MSYA 3HXMA 4QIWN 3KFWX 1G5VA 1N9RA 4ORZA 1OCPA 1C1CA 4OB0B 1VQNT 3K4MA 1EFNA 1YJWA 3REOA 2DD4A 2QEXN 2NXNB 4GLMA 3D2FA 3ZMTA 4WE1A 5GAOr 4NDLA 3ZMSA 4J8FA 5AQSA 4G1QA 1M90C 4MEXF 2YHXA 3M5AA 2HWVA 1WJCA 1XTDA 4LD9K 3BR6A 2E10A 2KNBB 2Y4YA 1TT5B 3T3FA 4QS9A 3LAKA 1VQ8N 4FK4A 4FOIA 2MK5A 2E35A 5E8IA 1LFBA 4M3RA 3ZXSA 1BQNA 2XPWA 4A2BA 3J7YP 3OS5A 2L02A 4V2SA 5AQXA 3DP7A 3TARA 3ABMH 1HKCA 3ZT3A 2XPVA 3DLMA 3Q7BA 4FYWB 1YJNA 1KQ0A 3K4LA 2O6GE 4I76A 4M3DA 1ZBXA 2O4XB 2QEXT 2CS7A 4BG8A 3CCLT 2MC3A 3DLLF 1LQ1A 3CWTA 3EG0A 1NJIR 2CJJA 4TSXA 1U84A 3CCRQ 5C4XJ 1X27A 1IZ1A 1RT3A 3SD4A 4QWQA 3QFUA 1JTYA 1Y57A 1VQNA 3RR7A 2XDVA 1HF0A 1VQ8T 2DEQA 4BRLA 3G7ZA 4BEHB 4FZZA 2NRAC 1M1GA 2LVMA 1J5OA 4LE9A 4LH5A 3KZYA 4PK4A 1E6HA 1NMNA 3DXJF 1VRLA 2R57A 3W6JB 2QWMA 3GBQA 2Q97A 4XTYA 4Q5SF 1F4KA 2HPMA 3M07A 3B8AX 3I5SA 2XO7A 1FPQA 1YITN 2I10A 1R23A 2RI3A 5HS7A 4HUEA 1PD0A 2VUMJ 4M75G 1RKWA 1YCSB 5FPNA 1JLBA 1S1WA 3E97A 4YORA 5CYMA 1USSA 2IPQX 4M7YA 4CIFA 2GTOA 2M7AA 3J80O 1K73C 3WVDB 1HPMA 4RCBA 1C1AA 1X6GA 3DLBA 4YFXF 1YIJQ 3I33A 4E70A 2FBYA 1Q81O 2NOHA 2XF5A 5MLCQ 5AQPA 2W00A 2V7ZA 3JRHA 2EIKH 3FXQA 5CJ9A 3R6OA 4FCYA 2VQLA 4DQSA 3BQYA 4HCCA 1M8MA 3OYAA 4Y13A 3BF3A 2IAIA 3NAUA 3AFHA 4QS8A 1QO0D 4X1EA 1JCFA 1ORKA 3K9KA 2XG8D 3AT1B 4B47A 2OTJQ 1KYZA 4B1ZA 5I11A 3DLHA 2WC2A 1VQ8A 2X48A 1K0XA 1BI4A 1NGCA 4F14A 2YG9A 3AY9A 1B9NA 1M1EB 3VJPA 4QVCA 2LX9A 3DKXA 4JK9A 4JS5A 2CZ1B 4MFDA 3KLGA 1KVAA 3ZN1A 2YRVA 1HD3A 1WSUA 2PUOB 2UXXA 5HRSA 1X2QA 5LGUA 5HVQC 4M71A 1KJWA 3MO8A 1TU0B 3CJAA 3M5RA 1F1ZA 3FDRA 4F92B 4BGAA 3PVQA 1JKPC 4OWRB 2V51B 1ZQ3P 1E3HA 4BRFA 3R0JA 3J7ZO 1QVTA 3F21A 1ZK8A 1X6BA 1VQMQ 1SKSA 2HHSA 5C15A 2D1HA 3JCUC 2XSDC 2DIQA 3WT0A 1NK9A 4H8KA 2XGXA 1VQON 3FZFA 2YUSA 1BC7C 3CC7I 1FOYA 4ON0A 3FX3A 2DMTA 2E2PA 3VGKA 4M6VA 2K4BA 4M78A 4JYKA 2XF6A 3VETA 4BQNA 4I6MB 2JRTA 4IXAA 3CCQQ 4LUDA 2CGPA 3LX7A 1PJRA 1OU8A 4NBQA 2BZTA 4M7AC 3QIOA 4PQUA 1ZN2A 3U1DA 4DFKA 3HRSA 1YITA 4HEA2 4BHPA 4AFSC 1SQKA 1OKJA 5E3LA 2LMJA 4CUGA 4RAZA 3MXMA 2FHDA 3ENOA 1S3JA 3O1WA 5GAN4 3K4JA 1JJ2S 1NK2P 3CTAA 5AIQA 4RGRA 2LNBA 4FSXA 4A3BJ 2DYIA 1K8AU 1P4AA 5BPMA 4F93B 1U45A 2XV4S 4DTXA 1WHMA 1F36A 1TNSA 3ROUA 1JJ2P 5IP9J 1ZRDA 4XU3A 4CI6A 2E2QA 2P4RA 2B4JA 3VQCA 2RJEA 2GELA 2AHJB 1YHQQ 1QA6A 1VQOT 3A2FA 3M8QA 1OVYA 1XQSC 4M3XA 2HHUA 4QTRA 1VSLA 4PWDA 2HW3A 1DPRA 3BDPA 1H641 3CPEA 5EEGA 5M5YJ 2EWSA 2QKMB 3FRNA 3NGYA 4MFEA 2IVWA 4XOPA 2KKZA 4EA5A 2FMLA 5FKLA 3NH2A 3MVPA 1FP2A 2AZSA 1AWXA 2MAMA 3BG5A 3VB2A 1B92A 4DSJA 2YJFA 1R0AA 5KAFC 3H08A 1R4MB 1IRZA 1J7KA 1DGWY 2JVGA 2F2VA 4B1VA 1Y71A 1KHCA 5CKBA 2EFOA 3P39A 1VHXA 3ZSWA 2WWYA 4O5BA 3S32A 1MUYA 4KAZA 3MCPA 1PU8A 1GLCG 2LKSA 4JX6A 1VSFA 3DRPA 4M78B 3F5TA 3TTFA 2UV1A 2XF7A 2MCNA 2E4LA 2CU7A 2E41A 4XLEA 2JTEA 3E19A 2FSNA 2J05A 4GCVA 4ITVA 5J2NA 4MMLA 3S6WA 3CD6I 1Q7YC 1AOJA 4Q48A 3HKZA 1K8KA 2K9SA 4ZDLA 3RMAA 2E1MB 2LCLA 4M77C 1ON2A 4DYQA 2QK0A 1UEBA 2HVRA 5BN9A 3GG4A 3WXMB 1GXPA 4B1XB 4JZ3A 5E18F 5JLFA 3A1YA 4BE2A 3E5QA 1VQOA 1PUFA 1R8OB 4RDUA 1BIZA 4PDKA 4IDHA 2WY7Q 1REPC 2CO5A 3ZRGA 3W2WA 2TCTA 2EWNA 3NVKA 1LE8B 2MH9A 3FZKA 2PBIA 3H41A 4CFDA 2XC7A 2D0QB 1UGVA 2P9LB 2Y30A 2FF4A 3K2ZA 2JMCA 2KT8A 4F7UE 4H5NA 4Z88A 3N5BB 1HKSA 3S8PA 4CHZA 4OINF 1Z25A 2K9QA 3R6SA 2H1KA 4GVEA 3BWGA 2RJFA 4J6YA 2P1JA 1HNVA 3LSMA 3GO5A 4CC7A 2JSCA 1U5TB 4JKDA 1B34A 3EGUA 4HBLA 3ZCOA 1YI2N 2L4AA 4DTOA 4JN4A 2W6LA 2DL4A 2O9LA 3E7LA 2AA4A 1U5SA 4Q47A 2DPUA 1SL2A 2RN7A 2A5XA 1YQLA 4KFBA 4C8QA 1K9MO 3MP6A 3MAJA 5F1JA 4FASD 4AHRA 3H36A 3KNTA 4IFEA 4ISFA 1K6OA 2D8JA 4ZHRA 2DO7A 3UWNA 3H5AA 2EK5A 4OU0A 3JCMQ 3H1CA 2L0KA 3MMVA 1HCRA 4N56A 3BTJA 4LFAK 3DV8A 5ICGA 2KRSA 1L3LA 3TCJA 1IXSB 2FBKA 3R60A 3KFVA 3PFIA 4G7ZF 2DI3A 2LJ3A 2KFNA 4X34A 1WXUA 2NRWA 1X3MA 2GTJA 3ZSQA 5FFXA 2DTIA 1EETA 4IUPA 2W48A 1NK6A 2BGCA 1TTHB 1YI2T 4CHOA 2GM4A 1NPPA 1VQ6T 1QQMA 4B4CA 2CZ6B 1HX1A 2B63J 4UXNA 2KXDA 2BW3B 5EG2A 5AT1B 4L8RB 2O4IA 5KI6A 3P83D 3HVRA 4N41A 4DQIA 3LP1A 4RAGA 2PQWA 3DTEA 4BDYA 1GBRA 4ASNA 3DWLE 4A61A 1P90A 2KR3A 2Z1JA 1T2KA 2HD0A 3SHWA 1EF4A 1APLC 4BUGA 2LJ1A 4BGDA 1A5WA 3QBWA 4BC5A 1NM7A 1M4ZA 3WGHA 2RQPA 4ZGDB 2AKKA 5DCMA 1B34B 1IHVA 2P81A 2G6FX 4OKEA 4ELZC 3K5LA 1U47A 3WNHA 1RBRA 5AQGA 2JM9A 4RGXA 3I5RA 2E2NA 2QGUA 2WUSA 2EIMH 4Z0UA 2OTJI 1MMGA 4R56A 5KGWA 2VIXA 2HQ5A 3SDBA 2LRDA 4OF1A 4ELVA 4B9XA 3Q1JA 1V4SA 5JHUA 4J9GA 1SAZA 1F5TA 4RB2C 3MWMA 4HQEA 4ZYEA 3AG2H 2R92J 4DA4A 3NQOA 4YEJA 2COBA 4HDVA 4JI6K 1QU3A 4QVZA 2EA4A 3NWTA 4NL3A 3RSEA 4EZ9A 1KTQA 1N3CA 3BPVA 3TO6A 4RS8A 4J00A 2R7ZJ 3PO5A 3MZ8A 1NHAA 5KGXA 3DLKA 1YI2A 4P9FA 3CMEQ 4CHUA 1OPKA 1JHHA 5FGMA 5E17F 4IIMA 4R79A 4BWMA 2YRDA 3S3OA 4M7DC 4IOCF 1R0BG 3SEZA 4QQ6A 1FY7A 3VQ5A 5LJ3f 3J81Z 4AQYK 4GY2B 4OO1J 3CCUQ 2FRWA 3RKWA 3SEQA 2Q3SA 1P8ZA 1TK8A 3CDIA 5BPDA 2K3YA 2I5UA 1U3OA 3VQ4A 2LK2A 1T0FA 3RPUD 1L3VA 1ODDA 4LD0A 1IV6A 1IHWA 3ZT4A 3EHRA 1MNMC 4R55A 2CGLA 1M3AA 2IXSA 4OPHA 2YR2A 1R71A 2Q2EA 5BRHA 4ZYGA 3G6EN 2YXYA 3TP0A 2BHYA 1Y96B 2DVEA 1OYIA 5KCMA 1ZG3A 2MGQA 1JQQA 4N0BA 4LUEA 1RT6A 5AZIA 4XQ3A 3H92A 3BTIA 4CBUA 1QSLA 1C0GA 3CCQI 2QDLA 4FM1A 4D7MA 5GAMd 3HK2A 3LGFA 2D5VA 2H3EB 4OMMA 3F8FA 3L2CA 1JHFA 1GHCA 4IOXA 2CH0A 4GY5A 4UV8A 2ITGA 1M90U 4QPQA 4JJDA 3QRFF 1T8EA 3QIIA 4P96A 2VE9A 2HQNA 4OLBA 3DOKA 3WQUA 2IS2A 5CQYA 3Q0WA 5CR2A 5BPNA 4RLQA 4E7LA 1YCYA 4FJJA 4PFOA 3HOXJ 2PYLA 4IOAF 3JB9H 3ZEUA 3GIBA 1LEAA 2DLLA 5IHKA 2OA8A 1W2BM 1NKEA 4I0AA 1YHQI 4BRQA 3WG9A 4HPQA 3K70D 2OFKA 1S9HA 3G6ET 3DBRB 1CQTA 2DMOA 4M78F 4JLIA 1SANA 4Z4CA 4FJLA 3TREA 4ZYDA 4HYEA 5IYBJ 1BW6A 5LMNK 4B9SA 3H5RA 3IKTA 1W9HA 2PBDA 1H8KA 3R0AA 2M8EA 1WYXA 3WTWC 1VQLN 3I71A 1IG9A 2YHBA 3A5OC 5KN8A 3HDDA 3R6MA 2EHGA 3QOPA 5J2MA 1Q86O 1PVEA 1NEGA 3C0BA 3SLCA 3DTIA 4FZYA 2DVJA 1IBLK 1ZKGA 1QCOA 4HCBA 2F8SA 1NJIO 3IRXA 1R58A 4ZTFA 2HZYA 1VSKA 1GLLO 2E5NA 2P7CB 4O3MA 5D3GA 4M9SA 1M2VA 2RE2A 1WKMA 3BLYA 1GCQC 1P7IA 3VEZA 2HEOA 4PKCC 1IV0A 4FWSA 2O8CA 4A4EA 3PSIA 2JQ7A 2ESHA 1T6CA 3QMLA 4HQMA 2DA6A 2V8JA 5FLXK 3AA3A 3OJUA 3H3NO 1DUXC 2JOYA 1VQLT 3O80A 4LFBK 4XK8E 1O3TA 1D8YA 4FJMA 3AVHA 2A05A 2LTPA 3E1SA 4DU4A 2EINH 4F7UG 2XVCA 1QWFA 1WX6A 3DU5A 3EG1A 3MN2A 3PGGA 3G6EA 5H20A 3NWSA 4PJOD 4IRIA 5D4RA 3RQIA 5KVRA 2EPDA 3JCMW 4CHYA 2J5OA 3KLHA 1LCUA 3WU2C 1BIAA 1SFEA 3RTRA 4OB3B 3DEUA 5AQRA 2XY6A 1FNNA 1JLGA 3CWSA 3KK2A 3BR2A 2V1XA 5KRSA 1V29B 3HTVA 1FSEA 3IWFA 4XONA 3FZMA 3CLOA 3TSUA 2FF3B 1CZAN 3IH3A 4Y33A 4PGGA 2EFPA 3GZNB 2EVRA 4Y28E 3PNYA 3ZSRA 3CC4N 4FTHA 2CT3A 3KWGA 3QBYA 4HXJA 3F6VA 4O5VA 2KQ2A 4NC8A 2NOLA 3PO4A 2FVUA 2ETHA 2FO0A 2OPQA 1LVKA 2DF6A 2IG0A 5J2PA 4NC7A 3SHFA 5IOYA 3QINA 3J81E 1VQLA 3VEWA 2CYZB 1YO5C 3G1JA 4AH9A 2WONA 4NYFA 1BO5O 3DAWA 1WPKA 1UELB 3CCSN 3V7CA 4IZ9A 4CGHA 1OI1A 1YJ9Q 2R5YB 1JO8A 4F52A 4JI4K 4C5GA 3V42A 4UVCA 3W6VA 2LP0A 2A6TA 1YN8A 5DUKA 1VUBA 2ZMEB 4H0YB 1M90R 3CC4T 3KP7A 1W7AA 3PIPA 3VS4A 1YT3A 2CUBA 1S72Q 1JLCA 1EKEA 4FPAA 2YS9A 3B6OA 4CFCA 3KP6A 4KUIA 2ATCB 5L3FA 1HYOA 4L3QA 1H8AC 4JQFA 4GRIA 1BI1A 2KK4A 1R0CB 5K5RA 3ZT0A 1XD7A 4KUDK 4A6DA 5KRTA 2BUDA 1M3BA 1BM9A 1R5GA 2OBPA 2MG4A 1UWBA 5K1YA 4B9UA 1LKXA 1VSMA 2DJNA 3ZQGA 4E7ZA 3WU1B 2M0MA 3UKUA 3CCST 1KG5A 5KK1A 1I0CA 1SKWA 2L9RA 1QZZA 2ME6A 3KTQA 1XNQK 1Y1VJ 3L1AA 4IFVA 4WCEL 4G9ZA 3LPTA 2VLAA 1TKZA 2DIGA 2M9HA 2JN6A 4AIDA 4K11A 4XQFA 4OB1B 3NH1A 4LY7A 1NH3A 3VOEA 2EGAA 3NH0A 2HSPA 1XX5A 1NYGA 2QEXQ 2FC0A 2W84A 3CCLQ 4H0PA 4JDSA 3CMEI 3PIOL 4DR3K 2CH5A 3CC4A 1TBXA 3C6HA 3F0CA 3ID6A 3MXJA 4F4KA 3E2UA 3GTKJ 3CF5F 2LNHB 1Z9ZA 2HL5C 4H0TB 2YSQA 3X20B 1CF7A 5AFUA 5AQIA 3T1HK 3EZ5A 4BJTA 1IN5A 3UNGC 2KLOA 3AGKA 3CCUI 2O5RA 4J2AA 1TWGJ 2JVHA 1LWCA 1PVSA 2GCXA 2K27A 4RBOA 3E6MA 5HKCA 2ZM6K 1DTQA 4CEFA 1K73R 4AFUC 2XUBA 2YCHA 2RNGA 1CLQA 1FP1D 3IWZA 3GP8A 3T1BA 1TWCJ 5K5QA 3CCSA 1HK9A 3P8DA 1OH6A 3F0ZA 5FWCA 1FOXA 4YELA 1UCRA 2JN0A 3SDGA 2I7PA 2RJCA 2CGJA 3PO3J 1ZC6A 4DQ2A 1OH5A 1BL3A 2IVPA 2H1LA 3C94A 2FOWA 4NYNA 1KLNA 5I9EB 1EIFA 4UC4A 2LF7A 1BBZA 3LDPA 4LIVA 4DGWB 2P0PA 2CT4A 3WNFA 3MKLA 4XOTA 2LJ0A 1VQ7N 1M8VA 2HKNA 2LREA 2MWOA 4I2OA 2EX3A 8ATCB 2W40A 1RZ4A 3ASMA 4Z6YA 2ZJQF 3HZJA 1MUDA 2KQRA 4ZN3A 3J81O 4DTPA 2G7UA 4YOVA 1TWFJ 5ICFA 3UE5A 4B8AB 2QGFB 3JRAA 4IVNA 4CF1A 2EQUA 1DP3A 4HOBA 3BEXA 1W70A 3QPLA 3A2KA 2IW5A 1QVPA 2DETA 2VV5A 5DD4A 4CF8A 4M7XA 2UXCK 4IEJA 3WTUC 4PFPA 1IB8A 2RQVA 1ZHFA 5HRNA 3CQXA 5IH2A 5GINA 1J53A 2XY7A 1ULYA 5DM7F 4CCNA 1X2MA 4XICA 1QPMA 1HKGA 1SEUA 2L9SA 4OVAA 2QGGA 4D6WA 1N32K 1VQ7T 1HOMA 2OPSA 3THWB 3MZHA 3D2EB 3T1AA 1VQ9T 3D45A 3EE9A 5F0XA 2OPTA 4RTTA 3X2QH 4CD1A 4A3CJ 4FIBA 1O3RA 3M53A 1IC8A 4IZZA 5GAOm 2FRHA 3HSFA 2LSOA 3CERA 2WA0A 2QQAA 1HQUA 1WFWA 4KN4X 2DILA 5AN4A 3CCYA 4LLNA 2WACA 4LF8K 2YHAA 3AO4A 5AQWA 1N33K 5J1UA 5I21A 2IGNA 3OTOK 4HRIA 3OYDA 2DYRH 3DFGA 3FJ5A 4XKVA 1YOVB 1TTYA 3JAME 2YNIA 4DLEA 5HRRA 2WB1N 2HDCA 1HW2A 3F8MA 3T0YA 3BR5A 2ID6A 2DY4A 4NOYA 4HSBA 2UYTA 2A3SA 1K8AO 2HOSA 2OAZA 2DTUA 2X6YA 4YFKF 4C0DC 2JWTA 1IUYA 3U3GA 3D5RC 3C3WA 2PMHA 5AONA 3UKRA 5FLMJ 1ZBIA 2D0BA 1KU2A 1IG8A 4M78C 1Y0MA 1FMVA 3VMFB 2IRFG 4C0ZA 4FW2A 2FOKA 5LJ3h 2FQ4A 3VFZA 3SB2A 4ZGEB 2FBTA 1MDUB 3VGMA 3MEDA 2AS5F 3PV8A 4KNYA 2R5ZA 5M9OA 3QIPA 2A1SA 1VQ7A 2DFFA 1NU0A 5EU7A 1YAGA 3PMTA 3ZP5A 5L3DA 2V9VA 1UGSB 1IV8A 3KKSA 4OPJA 5I42A 2OZUA 5M1KA 4F3OA 3P8HA 4BR0A 1HA8A 3CCMI 4XLPF 4CD3A 4XTZA 4CHQA 1YVNA 3L2UA 5CVUA 1N77A 5C42A 4HSRA 2H27A 1UGQB 3O9QA 3SPYA 3RRHA 1HSTA 1HNZK 2R7UA 3SWNB 2Z3YA 4IXCA 2LDMA 1WSIA 1CKAA 2AP1A 1MV0B 4EJVA 1MGQA 1IXCA 3MKZA 3SYTA 2EYQA 3NF8A 2WFBA 1Q7YR 5HDNA 2R7RA 2ZCWA 5C24A 5AQZA 3O08A 4Y4RA 2IA1A 4CBXA 2WTUA 3KLFA 2Y1JA 2NUPA 3VQAA 4HHTA 3KEOA 1B9MA 3SAHA 3I8BA 5KPTA 4ESBA 2IIMA 3DKMA 4K8ZA 3TEEA 2ZPFB 4CZHA 2HVQA 5A0GA 4CEOA 3CCJQ 3PMIA 5GJVB 1RDWX 1U04A 1SSHA 4R0KA 4KGXB 3O2PE 4MEYF 2ADUA 4JHDB 1KVCA 1K76A 3C4SA 2DFIA 4ZJZA 4RUGA 5GAMg 1MDMA 4CJFA 4M3EA 4CZEA 1R00A 1UFMA 2ZXWH 1WXTA 3HOTA 1YLFA 4JKGB 3I56N 4M41A 2HKQB 4BXUA 3DBLB 1CXUA 5ADXA 2F8TA 1WJFA 1MBFA 1RRSA 3BTCA 3KEYA 2X4HA 4U67L 3ID8A 3UPUA 1OU9A 1H0MA 4CEZA 5B1BH 4J6WA 4DSEA 3HJEA 4AT1B 2IVOA 4D8DA 4LF9K 4DSKA 1W7PA 5JS2A 4PJ0C 2W03A 4DW6A 3P7NA 4IKFA 2K5IA 2GQQA 3OYJA 3SFZA 1EH6A 2ELKA 4C8QD 2IAJA 1ZGAA 3CPWA 3FLCO 4LFUA 3VF4A 1VQ4N 4LITA 5D8KB 1MSFC 4NZGA 3K0SA 2KIUA 1WXBA 2F96A 2QF7A 3GTOJ 3AHUA 1UJ0A 1VK0A 3E1YA 5C4JJ 2Z5UA 3OSGA 4I9LA 5AQVA 2DK3A 3HP6A 1DQUA 4DZPA 4BWJA 3WGGA 4I7FA 2KT0A 3FHZA 3SQ4A 4LJZF 1S1XA 4ZZLA 3EFRA 2UUCK 3L8BA 1SKUB 2P9KB 3FXJA 3VA0A 1SHGA 2WADA 1WI7A 3G71I 5FPDA 2X6SA 5GAGJ 5GAEP 4G6DA 3AL0C 4IO8A 4LF6K 1F43A 3NVMA 4C5IA 1BR1A 1LAVA 3IUCA 2EQJA 3SUOA 2HHXA 5HLIA 1FMKA 5KYXB 3L3UA 3MECA 3HRTA 3ULEB 1E3PA 3FKIJ 1VQ6Q 3GW2A 2X0LA 4CF2A 2OC6A 4AD9A 2EH3A 1OISA 4ZN1A 2P4WA 1IAWA 2UUAK 4XKCA 1O13A 1HMVA 1U8RA 1ZR2A 2IGIA 4KHNA 1H92A 2HDDA 1YTAA 3HOWJ 4C5EA 3T69A 1GFDA 3ZL7C 2JTVA 4C92A 5GIPA 2OJ2A 5J3BA 3QKJA 1IXDA 4HVWA 3RKXA 1Q9YA 3ABLH 3K5NA 1SL0A 1STZA 3P38A 3JW4A 4JRKA 2E20A 2Q0UA 1KU7A 5D4SA 2HTJA 3C6TA 1W2BS 1Y8QB 3U6FA 1V5EA 3WGIA 3K5MA 4JI3K 2KBTA 1RT7A 2K40A 5LJ5g 1K9MC 1L3TA 2D2WA 3CC2A 2WSEE 1QTMA 1NGHA 3VYHB 2GBQA 1W2BP 1RLPC 3FK7A 1X3UA 2EJFA 2KY9A 1ASWA 2HBWA 4OFEA 2ZJRL 3PQKA 1WI9A 2DMUA 1MMDA 2GQIA 4QAGA 3I56A 3P8BB 1UTIA 3ENHA 3HFOA 5DY9A 4DNCA 2XAUA 4PL6A 3NEUA 2DD5A 4DQPA 3RRGA 3MKYB 5CHIA 2ZC2A 4IHVA 1UHFA 3EEQA 3D7EO 2HYJA 4XMYA 1VRUA 2JJ9A 2KVQG 5D6XA 4CE9A 3CC7T 2JZYA 1QNTA 2XGDA 2NNWA 3LFKA 4RM2A 1RUNA 1EO1A 2B8AA 2RQUA 4EM0B 2RK1A 3VTHA 3H46O 1QWEA 1G8XA 1N9SA 2HVHA 4Z4FA 1Y0UA 3N0UA 1CKBA 1VQ4A 3KZBA 4EATA 2WSCE 1R77A 3L0QA 3BG9A 3S9HA 2TDXA 2ACJA 2EGEA 2CP2A 3M0QA 4LG3A 4A5AA 4I6ZA 1ACIA 4ELYC 1MMAA 1VQ5N 4JD2A 4J19A 2JTFA 4N4HA 4BC4A 2DCEA 2Z16A 4JZ4A 1LDDA 3F23A 2CRGA 3FMQA 5KPRA 1ZSGA 3CCEI 3VGLA 3A01A 5LMUK 3OA9A 2K5CA 1M90O 2BXZA 3C18A 1SPKA 3GFIA 1T0FC 1YS7A 2P9UA 1EV7A 4B9MA 1C0MA 5CKHA 2RM4A 2P9IA 2ED0A 3THYA 7AT1B 3CD6N 1CZ9A 1JXEA 3T9NA 3MAQA 2L7FP 4M7DD 2FUG2 2CQXA 1HJOA 4BBRJ 1GLEG 5C25A 4N47A 3BG3A 1QVFM 3TQNA 1SD6A 1YNZA 1VQKQ 1TAUA 4H4OA 5F0HA 2NOIA 1KVBA 5BMZA 1M2OA 2VQGA 4K8XA 3D1NI 1RKTA 1P4XA 2EYXA 4V2GA 3VS0A 4A93J 5HNFA 3CEYA 2D0PA 2QA4I 2EIFA 4M7AE 4FW1A 4CHPA 3F3XA 1HKBA 3IRQA 4B23A 1RRQA 1C0UA 3EYYA 5GADP 2HKXA 4XORA 3G4SI 3GPLA 1K78A 3PNWC 4JRPA 2O8DA 3I55Q 4BROA 4A5BA 2VJIA 1IF1A 5C0YA 2FJ1A 2QTDA 1KAYA 5CVJA 2R7TA 1X2KA 3A0HC 4EMHA 2GGRA 1H3ZA 2C6YA 1RIOH 4KTZA 1GVDA 2KHMA 3CVSA 3I9QA 4GDFA 3ECHA 3CD6T 5E20A 1MW7A 1NYFA 2ITMA 4BC3A 2YX4A 2ENMA 2F5TX 3CUQB 1VSIA 2D0OA 2PU9B 3CCRN 3BY7A 1D9DA 3EFOB 4A3FJ 2Q36A 4MQ3A 2DTOA 3FJPA 4AM6A 3A01B 1N5ZA 1KD1U 2O01E 3AO2A 2P0KA 1TL3A 5EVZA 4C3IJ 4P9UA 3ASOH 4YTLA 4BR2A 1HC8A 1NGJA 2P9IB 4KN7X 1ZLJA 1KO9A 3TOBA 4BRGA 1VQ5A 5IOZA 2DRMA 3LAPA 2WBNA 3K4KA 2FLOA 4KUMA 1M9SA 4K2EA 3CCJI 3AAPA 4I0BA 4M4ZA 5FPEA 2K3PA 1AKHA 1A6QA 1RI9A 1TUGB 3BC8A 4JAXA 3FE1A 2XHKA 1ZYRF 3GLXA 2VONA 1PG5B 3META 5KYWA 1LWWA 2O9VA 1K0SA 2IDOA 3TGNA 4M77E 4DF4A 4FLWA 2EKOA 3A8LB 3HYIA 2VXZA 2BEOA 4PSXA 1Q86C 1KAXA 5KN9A 3H0DA 4A3LJ 2YU9J 1D5YA 2PZSA 2FZKB 1AWOA 1SD7A 2VODA 3CXCA 3EYIA 3C95A 3GMEA 5FLXZ 2L89A 1LOTB 2FU4A 1FC3A 2OTJN 3U9DA 2QKBA 3PUFA 3M1EA 3VEYA 2DQLA 3VENA 2ZBKA 4CF9A 5FKKA 3HTUA 2VG7A 4CEQA 2DXUA 1E4FT 5CCAA 4AI5A 3N97A 3PIOA 2RN8A 3NGZA 3HGYA 4DTRA 1SS6A 2XHBA 1LJ9A 1RBSA 1W1WE 2J6OA 3UF4A 2FXUA 2EBIA 1QQOA 3KK1A 4N9HA 4C2UA 2A7YA 3MN9A 2QSHX 3HOUJ 2I0NA 4C0FA 3BGRA 2X74A 1BGXT 1P9QC 4L0YB 1WJBA 3CCRA 3LM9A 3FM5A 2NRTA 1NG7A 4PUSA 4YNQA 1G6NA 4J7IA 3D5SC 3WU0A 2OTJT 2PAVA 2HBKA 2YT6A 1P4WA 5JVHL 1WHJA 1VQMN 5C44J 3N4PA 1BI3A 4HVVA 3P9CA 5CYQA 3VV0A 1ZREA 2A6AA 2L7KA 3JR9A 5CQGA 1S1UA 4AFQC 2LVSA 3ZBDA 1RESA 1ZUKA 5AQLA 1W0UA 3I59A 2W4SA 4BQZA 3CCQN 2X6NA 4J8OA 4KFCA 1N34K 1TW3A 2NLXA 1REVA 1JLEA 4M6YA 1RDDA 2STWA 2HSTA 1E0EA 4WK8F 3ESWB 2RREA 3KKRA 1WJEA 2VT3A 3BZKA 1UHSA 1IO2A 2ATQA 3W2AA 3SUQA 2HXIA 2M0OA 4WXHA 3BG7A 4IHSA 3SMPA 1LOJA 5ICEA 2R7QA 2P6TA 1RT4A 3CJTB 5IT3A 1YIJA 1KQ8A 1ZYQA 2MYSA 2Q31A 2HKOA 3KP3A 1MJAA 2BY3A 2DAOA 4M3BA 5HBMA 2A5YB 4XRFA 2Y4XA 4F7ZA 1YHQN 2UXDK 4C92F 3ER0A 1Z7LA 2G7HA 4BI3A 3HM9A 1JU5C 1BKBA 2KP6A 4YG2F 5LRSA 3NTIA 2XKOA 2PN6A 1KC8U 2OTJA 4GLKA 3CCQT 1EH7A 5SZTA 3FEOA 1ZUYA 2A07F 2EFWA 1NBEB 2GBYA 2D1VA 2L5QA 4CZCA 2YNFA 2PNIA 4BI4A 5H6RA 2KZGA 4C5HA 3DB4A 3EKSA 2W25A 5KAIC 3RMDA 1VIFA 5LJ3j 4AG1C 4DSFA 3RSNA 2W0ZA 4M7DE 3QWYA 4UOBA 3OB9A 3SZPA 1S22A 1HR0K 3CJ9A 3T8RA 4M3FA 4O44A 1V5GA 5DUIA 1XN7A 5D6WA 3C0CA 4CZIA 1W36C 4ZZDA 5EZHA 1YHQT 3I0WA 1MJBA 1NE8A 5EEHA 1XC5A 1AT1B 1TXQA 3MFKA 2YJEA 1D3BB 3LA2A 1Z05A 3VQEA 3DF8A 1WBBA 1QVGP 1OR7C 1S29A 1KQSA 4X0GA 4RW4A 2OCCH 1DP7P 1VQPI 1TYQA 1QQNA 4MQVA 5GP9A 4M75D 5EXWA 3AGRA 1WNSA 1VQMA 4AHTA 2XY5A 4CA0A 1FEXA 1FIPA 4WFAL 1T56A 4HWIA 3JTGA 3QYEA 3KBGA 1T6SA 4F17A 5FKNA 2JRMA 2PMUA 2YUPA 1RAGB 4A5MA 2CKKA 3FFKB 2KZVA 1NG6A 1X3NA 4OIQF 3NCIA 1ETWA 5FLXE 1LDKB 1PDNC 2H3GX 5EOYA 4DYRA 1TSFA 4HT8A 1OX9A 4M7AB 4KTQA 4ID5A 5AQTA 3SJMA 3I55I 1UAXA 2H6CA 3TQ7P 1N25A 5HL7L 2KZZA 2JLEA 3OYGA 1RT5A 1NK4A 2P7VB 1AWJA 3RBBB 3KE2A 5DPKA 2XRLA 5H1SQ 1JB0E 3PM1A 1B4AA 1SHFA 4BRCA 3ZPLA 2ELJA 1XSDA 4HDUA 1ENHA 2ZCFB 4JI5K 2DXTA 1YHQA 3WUHA 2M7BA 1XC9A 4C8OA 4V19K 2YRCA 4GV9A 4OP0A 1MMNA 2VYTA 1VQ9Q 1ATNA 3D7SB 2D0NA 2K4JA 5I2MA 2W1OA 3FDYA 4Y3OA 4Y7NJ 2DK5A 4NCGA 3HOYJ 4U0YA 3PNVA 2ZXJA 4OGCA 3L2ZA 2PVOB 3MZYA 5D5UB 4JI8K 4FZXC 4HTLA 3M1CA 5FRNA 2R4GA 4RAFA 2X78A 4ELUA 2O8FA 4I7HA 3PFSA 1FX7A 1T3SA 2MLGA 3KYDB 1JCEA 5IY5H 4RKUE 4OMQA 1S8NA 2NVUB 4M77G 3AVNA 4BRNA 1MZBA 4E3SA 2E36A 5J3LA 3KUFA 4FISA 3QU6A 1B72A 2V4JC 1DU0A 4X66K 4BDPA 2PX9A 4LK1F 2P9PB 4A2AA 4E4HA 2IP2A 4XH4A 2FSJA 5EJCA 1RT1A 1XOVA 1S7AA 1JUMA 1GLDG 2RPIA 3NMUA 3HHGA 3L2QA 2DA2A 4IHXA 2JSPA 3M0PA 3I58A 3ATVA 2PJRA 1UHMA 3NHNA 2LG4A 3S2HJ 1R36A 4CVNE 2E6LA 3CYMA 3S1MJ 3OYHA 3VYGA 3ATUA 5M1FA 4CJ3A 4NQWB 1SFUA 1M3HA 1JKRC 4JYAK 2A28A 4H4MA 3L9FA 3WHBA 2L01A 3AARA 4CZLA 2CUEA 4BRAA 5AQUA 2XB0X 2HOTA 1FOWA 2AQFA 3FHNA 3K9TA 2A5WA 3AVLA 3CMMA 2VQCA 2HHTA 2X4XA 1L3SA 3H9GA 2UUZA 3J7AY 3A0BC 1D1AA 1A0NB 3OS1A 1UG1A 1KA8A 4TVRA 4HX8A 3TAMA 2CP3A 2VVKA 3CMEN 3JRCA 4Z94A 1NLOC 4AF1A 1YFNA 3C2GA 2P0WA 2FG0A 1UHWA 3IV5A 4E19A 3JCMe 1TP4A 3EH2A 4FL6A 5C0MA 1LWFA 3X28B 2WTEA 1WCMJ 5A2QK 1S5JA 3THXA 3OIQA 3HKSA 4DSIA 1K8AC 4ELTA 3CCUN 5BRDA 4DR6K 1AD5A 2K4YA 2P0QA 2DJQA 4PFZA 3D4VA 1QW1A 3H8ZA 3UIQA 4FWQA 1QHTA 3AO3A 1T0HA 4CDGA 1BI2A 4LC9B 2AT1B 3PIOF 5FLXO 3QETA 4L5IA 1IBKK 5BNGA 1RADB 3IKMA 4YOQA 1PSEA 4LD5A 1D09B 2RKHA 4DCHA 1ONVA 2NOZA 1BK2A 4OMNA 1YWOA 1YJWI 1BQMA 4PL7A 3R1XA 4B3MK 4ZYHA 3CMET 3O9UA 4CJRA 3VKIA 4IHYA 4EJWA 4B1UB 3UDCA 4KH4A 3WE3A 3EETA 1Y8RB 1QP3A 2M1HA 2I5JA 5FU6C 2RHYA 1ETQA 3OVNA 1QGPA 5KE2A 1NGBA 4CH7A 1YQAA 2FSWA 1NGDA 1KEAA 3SFIA 2PUKB 1P92A 4QKUA 2HEQA 2DQRA 4KISA 3H9NA 3SZ2A 1JXOA 3CCUT 1B9FA 2J5PA 4MHGA 5EX5A 4Y52J 1XSVA 3J80K 1Z0XA 4F3QA 2VG5A 2M2EA 3QO3A 4UY8I 2M45A 4FLTA 5JLXA 3LH5A 2DXIA 2HDWA 4U87A 2HBLA 5EG0A 3ZQCA 4EDUA 4GKJK 2DYSH 3JB9D 1YJNI 5KPZA 1NBWA 1VSDA 3JCMf 3RPUA 4A53A 1BA0A 1DGKN 4MO5A 4WCIA 3OMGA 5HDKA 1TH7A 4A3GJ 1LFPA 3RR8A 4DU3A 3S2DJ 5AQJA 2Y9YA 4CYCB 3SQ1A 1M1KU 3ALYA 2X3WD 3GFLA 4M7DG 3I4MJ 3F2KA 3A1PA 3KX2A 2GOXB 3LWIA 3VQPA 4MO7A 1O4XA 1YQRA 4XNFA 1WZ2A 2QUFA 4XRSG 5J47A 2D1XA 2CP7A 1B8IA 5CVVA 4BYYA 4RTUA 3RMSA 4JKEA 1B3QA 4DV1K 2O8BB 2O88A 5D8LB 3CMEA 3EPZA 3HSEA 3ZOBA 4KGZB 1YRNB 3O4QA 3JXUA 1GOCA 2BGGA 1DLOA 2NUTB 3A5MC 2CW8A 4I09A 3G73A 2H8HA 2CSOA 1EQYA 5TKYA 3NFAA 5CVIA 3C1DA 4IO9F 4XAXB 3WE2A 3QP5A 4CCOA 1PKTA 2NZTA 1GV2A 3AVJA 5E84A 1K9MR 2BH1A 2YWWA 3CMAA 3O4WA 2W85A 3HRUA 1XMXA 1M1FA 2VXEA 1ORPA 1Q95G 3S14J 3OHRA 4RWTA 2VQFK 4EPCA 1QVFP 4NO7A 1LW2A 5HK0A 4HX7A 1I1JA 4X65K 5LGTA 1DGRM 2VWKA 1IDZA 1N8RU 2C0IA 5IXBA 3VS3A 1TOVA 3AVKA 4C92C 1ZBUA 5F27A 3OW2M 5KYYB 3TAPA 1A35A 2QM3A 4ISEA 4KV8A 2E1ZA 3F73A 2W57A 2LQNA 2VQEK 3JSPA 1TG0A 3R6NA 3SMSA 2L3DA 5D7UA 4UNFA 2YNGA 3EUHC 4E1MA 2BY1A 2F2WA 3EFSA 4BR9A 1P7MA 3F8NA 2P9SB 4LDYA 3K57A 2IPOB 1D1BA 1ZSZB 1LDJA 3HUGA 1J5EK 3BTLA 2RMOA 3ULQB 4UUTA 4M3GA 3CC7Q 3DXMB 3CCMN 3HOVJ 1O9SA 4B8CA 3ZETB 3CQ8A 2X1EA 5C6SA 1RTDA 5GANe 5E1WA 1UOCA 4QPOA 3OS2A 2XRNA 3ULDA 3SQ2A 3I4NJ 1VSJA 2K3BA 1AEYA 2WSFE 4PJOA 4HT9A 1ABQA 1WDXA 1J9IA 3MN7A 2CV0A 3OSVA 2DA1A 2DL8A 2VB6A 5CKDA 1XB4A 3H9JA 3O8GA 2FPEA 1D4XA 3NE6A 3DXKB 4DOWA 2A69F 4Q5WA 4FSVA 5DDGA 2QAZA 2KI7A 2Z2SB 4M42A 3BCBA 1LCKA 2TRTA 1S72N 2CDTA 1IGQA 4FYDA 5IPAA 3CCMT 2K02A 4EMGA 5K7FA 5DM7R 4L5JA 2HI3A 4N5SA 2FBHA 1JKOC 5M5WJ 4A3MJ 3ZQFA 3LSRA 1U4BA 1YITI 2HNIA 3TTDA 5F2RA 1ARKA 1POGA 1S7OA 1WHUA 1NOZA 4B24A 3SAFA 5F0CA 5LGNA 1KG6A 2OTLQ 3RYRA 2XMFA 4I9QA 1WJAA 3VSKA 4PL8A 3N4MA 1PP7U 3KWIA 4FHTA 3FMRA 3MP1A 5GAN8 1EXQA 2CUZA 2GFAA 3M3YJ 1D5VA 2CSQA 2K2VA 2Y48A 4M78E 4X62K 2ID3A 3S6IA 1Q9XA 5GANf 5CZ1A 1U6GA 2JXBA 3CCVQ 1E3OC 2A42A 5L3GA 2YV0X 1S72T 1JT6A 3VODA 4GNIA 2P9NB 1W4SA 3C7NA 2NVXJ 2BANA 4PGHA 3CD6Q 2EQMA 1Z9QA 1GV5A 1KD1O 5J4YA 3CCLN 4PJOB 1IXRC 5CKTA 3TSWA 2PQ8A 2KRFA 4E7KA 2ZD1A 4L0ZB 1G99A 4FK0A 3LSKA 1RT2A 2RAEA 4IF4A 3GCMA 5AZJA 3CWAA 3G0ZA 1SSFA 4FYXB 4Q4ZF 2KROA 1RDBA 5GAN7 2EFIA 3M4GA 2H8WA 4RB1A 3OV8A 2JA7J 4LDVA 3VYTB 1WEGA 4EVVA 1VYVA 3JB9I 5EGOB 2ZGWA 1D0ZA 2MIOA 3VEXA 2RB6A 1IW7F 2VKEA 2KRCA 3CHWA 4IJNA 4M3WA 3TI0A 4AIJA 3C7JA 4CJ4A 4DS5A 4PUOA 2ZZDA 4Z4IA 2PLYA 3VN5A 1X1PA 2GA1A 5EYRA 3GTQJ 5BN8A 4D8KA 1IN8A 4DUYK 3CJ7A 5KYUB 4CJPA 4GBQA 1YJ9A 2GLOA 1ZQ1A 1Q86R 1Z91A 1MWKA 4U0VA 3H9QA 3IUOA 3IH7A 2L3RA 3WEEA 5GAHJ 5JVTA 2LD5A 4NLCA 5CE3A 4EJTA 4C0GA 1Y64A 1VQOI 1WSHA 2E64A 4DQQA 3ISNC 1S72A 3TO9A 3I0SA 1RAIB 3HRGA 2KXCA 3DQVC 3BR0A 1USTA 1WEFA 4FLYA 2QWOA 1TUCA 3HSBA 1KG1A 4YFUA 2DEUA 4H0VB 2FEZA 1MD0A 4KO0A 1MBGA 3MEAA 5EC7A 3G71T 3TW6A 3CETA 3OL4A 3M8FA 4DF8A 4O0JA 2KIQA 2ZPHB 1GFCA 3L4QA 2BZ8A 4BQAA 3D2FB 2ZPIB 1UG2A 3QB0A 3U23A 4B3RK 3JS6A 4CERA 5M1QA 1PU7A 5GAN2 1TW2A 3PIPL 4L9JA 1X69A 3U3YA 3EG9A 2FPDA 2MOXA 4RTVA 4NB5A 4BXFA 2CSIA 2JK3A 3AA5X 4OAZA 4KHQA 4B44A 1SVMA 2EGCA 1MUNA 1E6GA 2QM1A 2JW4A 2DPNA 2ZJRF 1FWZA 5HLTA 2P4TA 3FXLA 1M3QA 2D6FA 1H9GA 2EZLA 2M30A 4KH0B 2QEXA 5M5XJ 5FO5A 3CCLA 3ZX2A 4FOEA 2B0LA 2BV6A 3G1LA 3TL4X 1TLHB 2RA2A 1Q82U 4IX7A 4BVPA 1VAZA 3AAFA 2PTKA 2K3FA 2VBYA 4M73A 1ZBLA 3JCMV 4DMNA 4CK1A 4A12A 2E8AA 5FROA 1XHZA 1TK5A 3RZDJ 1IKXA 4IUUA 2YPRA 3OSFA 4A63B 4R1HA 3PX0A 1KFDA 2DKGA 3WTVC 4A6EA 2WAFA 2V9PA 3BG6A 1V1CA 1LV5A 1N3AA 5J40A 4BJ6C 2KRHA 2QG9B 4AHUA 2X51A 3ZR8X 3H1QA 4C3JJ 2K86A 3KD1E 2KQWA 2EKHA 4NNJA 5DYMA 4Z02A 3SUNA 1HQEA 5AYFA 4J9CA 3E9OA 4DQRA 2FL7A 5LY3A 3P31A 3JCMc 4D5FA 3H0FA 3N5NX 2NRVA 4EJZA 3HPOA 2VKHA 2O31A 2L2PA 3W2VA 3PE0A 2HGCA 3QJ6A 3VQ6A 2J6KA 1ESVA 3HM5A 3DRRA 2IGOA 4IG0A 4XR6A 4FYVB 3E66A 2P84A 4B1RA 3HBLA 4KDPA 1KC8O 1NTCA 3JRIA 2YNHA 3GTPJ 2L2OA 3CCET 2KW4A 3M1FA 4FJ5A 4K25A 3H35A 1IO6A 2X35A 4FE4A 1U1TA 4KH5A 2E7XA 3JRDA 3HSTB 3BUZB 1TZLA 1CXQA 1RAEB 2NRXA 4G9YA 4CGGA 3QEVA 3QDRB 2OD5A 3LSHA 1JJ2A 4B9WA 2DA5A 2M0YA 2E4HA 3CLQA 1Q81U 2M1BA 2NS0A 1HLUA 3OYCA 1U6ZA 1I27A 3I0RA 3V8KA 1FOKA 1JT0A 4MMKA 3ENBA 3G3ZA 2XKOC 4RW6A 4HV6A 4DK9A 4LG0A 2WC9A 2N8GA 2O8XA 3E5UA 2CUFA 1BI4B 2O3FA 2DTHA 3H45C 3LCNA 2HVIA 4HUGA 1GLFO 3ZSOA 3SQ0A 2XK0A 3G4ST 4O0IA 2IEKA 1I3QJ 2I5WA 3LA7A 1HJRA 3M8RA 2F5VA 4N0AA 4RW7A 2QENA 3EGDA 1ZHIA 3JCMh 2NRRA 2NUBA 3HC7A 4KULA 5M3FJ 3JCMd 2QSFX 4MLHA 3V9XA 2LYCA 3K4NA 3CCJN 3T5XA 4EMKA 4AILC 4PJOF 4JX5A 5GAN5 2VG6A 4IDKA 3BP8A 2M02A 4M78G 1QP2A 3WNGA 5B3SH 2XROA 2OJED 2QWWA 4RGSA 3M56A 2OTLI 3GZ6A 4QQDA 1DIZA 3JCMJ 4FJ9A 3ERMA 1WSEA 5B5EC 2CYYA 3UB5A 4LH4A 2M8GX 2M34A 4CJUA 3BFMA 4C0DB 3FISA 5IHNA 2ECZA 5FW9A 2HNDA 3CCVI 2KFZA 4N4GA 3IH4A 5JS1A 4LLGF 3IFRA 2IVNA 2RGVA 3GYHX 4ZDPA 1JUPA 2NRZA 1SFOJ 2NUZA 3CCJT 4G6TB 3K9JA 4KBOA 4BRIA 1BIUA 3C65A 4R8HA 1ZA2B 2JWLA 2NNNA 4EEFG 2BDPA 4JKAA 4A4FA 1IH7A 1LPLA 3FBNB 2E88A 3PJRA 1I5ZA 4BRPA 1X3ZB 1XC3A 2G9WA 3HGGA 2YX7A 2ZXIA 3FLGA 2D5RA 1VFCA 2X4WA 4HZFA 4Y1CA 1FK9A 2H3JA 1FJLA 4H5WA 3OYNA 3LAJA 2BIVA 1EZZB 5ELZA 1MBKA 1T0JA 1HXDA 3REAB 3ECOA 2LF8A 3RR6A 2PEXA 3JB9G 1OJLA 2F2EA 2BE7D 2V79A 2JJ7A 4FJHA 3KLOA 3T1YK 1VQ6N 4DBQA 4E9FA 2AXLA 4BREA 2VPRA 4I01A 3CDLA 4A4KA 1ASVA 3GWZA 5F08A 3ZX0A 1MKMA 3CP2A 4AHSA 2RQWA 2QQ8A 1JCGA 3O3FA 3WXLA 3H6ZA 3MJXA 4WFNL 1BU1A 4M77A 1KG4A 5JLWA 4ZYAA 4QT7A 5DD8A 3BDDA 3VRYA 3RMQA 3KXTA 4KRFA 1X19A 5DTDA 3CCJA 2ZJ2A 2CW7A 2OA4A 3JSOA 2XAJA 2R0QC 4MZPA 4PJMA 1OLTA 4X9CA 4MDBA 1U49A 3OOPA 4G8XA 2VE8A 2L8DA 4JRQA 1OCCH 1K4TA 4IEIA 3SI6A 4JI0K 1NJXA 1K8KB 5KE3A 2JA8J 1GUUA 4P5NA 1RABB 3VF2A 4HSTA 3OYIA 1BOBA 3HL8A 1GOAA 3HI0A 4G6QA 1WGSA 2SRCA 3TEDA 3DOLA 1PUFB 4MTDA 5LJ3e 2K79A 1IJWC 4W5NA 1XNRK 2GFUA 5AQNA 1K8AR 2MF2A 3AVIA 2ASMA 4KT0E 1HSJA 3K1MA 1U78A 3VS6A 1T8IA 1X4OA 8AT1B 1WJ5A 1VQLI 2VC0A 4B21A 1RFQA 5DV5A 3A5LC 2X6OA 4DR2K 3OH6A 2AXTC 5D6YA 4C8LA 2D0AA 2RNJA 3IL2A 5HK3A 2QXFA 2F5KA 2CH6A 2JZ2A 1SVLA 2VOPA 4NC6A 2YG8A 2BZXA 2GV9A 3BR1A 3FXOA 4JKFA 3AO5A 1ZBSA 1QKWA 1T3LA 3V6DA 2H94A 4C8NA 1PSFA 2HHWA 1WN7A 4C8QB 4ICLA 5GANh 2OZMA 2E70A 1WPYA 2ZXHA 4OMFB 2CQQA 1WH5A 1JTXA 2V7FA 5LEKA 5GANd 2RO0A 2PFUA 2GWKA 5BR8K 3AL0B 3QYBA 1S6PA 4LSLA 3OW2S 1C1BA 3VS2A 3HL2A 1AU7A 4EA4A 3JRZA 2WAQN 4MNUA 2G8IA 1ZA1B 4OJRA 2JUCA 2Y0MA 4I98B 4U0WA 1VQPN 1U1SA 1VQ6A 3DI6A 4DR1K 3LPUA 3OW2P 3NTKA 4DV6K 5FFZA 4CJQA 1TV6A 1WGXA 2Y31A 4B1YB 4A4HA 5A2QZ 4IRHA 4UUSA 4JJBA 4BKXA 2L0AA 5LD2C 1VQKN 1C0WA 2KMTA 2F5FA 1BHLA 2E19A 4AYBN 1QHHD 3O3HA 2E5ZA 1SL1A 3J7AO 3VQQA 4BC2A 1S1NA 3ZSXA 1YYVA 2R7DA 2RPNA 3DLGA 2VBWA 1SMYF 4DOZA 2QK9A 5E79C 1J59A 3K4BA 4DEYA 3I55N 5CKFA 5KTQA 2E1CA 4FT8A 5C2DA 4CXFA 2Z33A 3V4IA 4DV3K 4YPHA 4RW8A 2DN0A 1IUFA 3J81K 4OKKA 1XDSA 3A8GB 3OSSC 1RPWA 5DCMB 2FB7A 5DS9A 1ILYA 1QZ6A 1VQPT 1NOYA 2FRYA 3R3LA 1X75C 1GT0C 4OOIA 4RLFA 2K9NA 3A8YA 5CR4A 4F9OA 1QSYA 5EZGA 5B1AH 1R49A 2DFUA 5LBQA 4RB0A 5HS9A 1GXQA 2HTSA 1VQKT 3NF9A 4M7DA 1ZBHA 2R7YA 5CQEA 4AMCA 1GLJO 2L3PA 2IGKA 1ATRA 2XI9A 1I3AA 1ZSZC 2V1DA 2JMWA 3HXLA 5CZ2A 1BBYA 2DPPB 1O57A 2P5KA 3I55T 4DZJA 4IQJA 2DM1A 3RSEB 3BY6A 3TWHA 3X24B 3QODA 3RESA 1K83J 1WJSA 3M8SA 1CSKA 4BY7J 1WRJA 3LLRA 3IHUA 2BXYA 2X3XD 5A0DA 5CQXA 1N8RO 5GTIC 5JLHA 4L6V5 2KGTA 2SEMA 1OVQA 5BREA 2DBBA 4S04A 4MFBA 2FMYA 3RQ4A 3LZIA 2W42A 2FZGB 4LDXA 4E9GA 4FWPA 2FPFA 5JI6A 4DFJA 3QZ5B 1RCHA 3QAHA 1TL8A 9ATCB 1IKWA 2O9SA 2NAZA 5LEJA 1DPUA 2WAQA 4C1NI 1MGTA 3V9ZA 3GVAA 2LQ8A 2BTFA 3RMBA 1J0RA 4BHCA 2Q2EB 2DRKA 1T39A 1UJYA 4R5PA 4XSXF 2QYOA 2LBFA 2DBKA 2ISYA 4XH1A 5AR0A 1S9GA 4NUBA 1HW5A 2OCEA 4BUPA 5AZIB 1VQKA 2IS6A 1S3XA 2HR3A 1P6RA 4Y17A 5L23A 4J7FA 3GEZA 1R1VA 3M3ZA 2A3LA 3B02A 1D5AA 4OLAA 1XCBA 3UT1A 2O8EA 2K5FA 4AYBA 1C0TA 5ED4A 3K69A 4D5CA 2O61A 3MN6A 3DB3A 3SYZA 4Z4GA 3JRFA 4CJTA 1XJWB 5HP1A 4CGJA 1BR4A 2QBYA 2OFIA 4BR7A 2AZVA 1NMDA 1XMOK 3JV3A 5AQFA 3HOSA 3AG4H 4DSLA 2L9NA 4M3UA 4EM2A 2DOFA 1RTIA 1WSFA 2IA0A 3DEEA 1BU6O 2V1NA 3ZEUB 3GDQA 1B6AA 4MDAA 4AVPA 5KCOA 3NHGA 2HQHA 2V52B 4EHTA 5HROA 2OZSA 1D1CA 4QS7A 3O6WA 5L8RE 1Y39A 4KYWA 1LVAA 3TO7A 5E3OA 3VPZA 4DTMA 2KDZA 3FZHA 3EAEA 2A37A 4BH9A 4PJOC 4H5TA 2HBPA 1FKOA 2HQRA 3OWTA 3OIOA 4PIIA 4MLOA 1WSGA 4N9IA 4HF1A 2BVMA 3VQ8A 2BY0A 4WQ5C 2DK8A 4CEBA 3X25B 4XU2A 3RERA 1NJIU 2EA2A 3CCMQ 4BG9A 1M2VB 1ITGA 1U2VA 4KHSA 5A2QE 1L3UA 2F9TA 3I5UA 3ZQIA 3A5NC 3MPUB 2O8CB 1XQOA 2LRQA 1N78A 3SJHA 1QSSA 2JM8A 3NMZC 3GFJA 3E9PA 3VS7A 5IP7J 5HDGA 1E3MA 1RETA 4JK7A 4W97A 1VQ7I 2ZFWA 3URGA 3H0GJ 2KYMA 1K61A 3Q9SA 2R93J 3RDIA 4ILGB 3VS5A 2V75A 4M9ZA 5AQKA 5GAOn 1SRLA 5GMKe 4BRKA 3MN5A 4ENKA 2DZ9A 4C8QF 4RM3A 4DFPA 5JVGF 3NBPA 3ASNH 3HEFA 1ZUUA 3M55A 5JICA 1W0TA 1YJNN 1YQMA 1RL2A 2Y69H 3IAYA 4D7NA 3KPHA 5GAN6 3QWLA 1YJWT 2DJZA 1XQHA 4JOMA 1V5FA 4C2MJ 3LP0A 4BRMA 3LWFA 2Q2RA 4MLEA 2HZTA 1SZ2A 3MX5A 4W5QA 5E3MA 3VF6A 1LNWA 5DLQE 4AI4A 4FU6A 4OMOA 4XSZF 2ZFUA 4YOXA 3QLHA 4CCLA 4FPBA 5M3MJ 2LNVA 1JGSA 2IOCA 1J54A 3VERA 1NK5A 1B7TA 4KI6A 4CK3A 2DJIA 2DA4A 3M0SA 2MI6A 3LZJA 2KDOA 3JAMK 2ROTA 2PY5A 4KB0A 3IC7A 3R2XC 4DTJA 2DNUA 4OFAA 1RNLA 3V8LA 2CH4A 2C0TA 4OPAA 2BTTA 4GFBA 4U7BA 4IWVA 4BGBA 4HA8A 4XTUA 2DL5A 1YJNT 2UXBK 1EBMA 1FIAA 3D0SA 2Q8KA 2LP5A 3RZOJ 5HODA 2B7EA 2CQKA 2X1CA 5C3EJ 3V9UA 1ZG1A 5D5VB 2E2OA 2YUNA 4RG8A 4J9FA 4CJKA 2X1DA 5FKOA 3QWXX 4LF7K 2UXNA 5BPIA 1XG7A 4LNPA 3FF5A 4BEHA 2Y1IA 1TQMA 4EGYA 1RBTA 1JUSA 1QBJA 3S2WA 3HZ6A 1TVRA 4W5OA 1IGNA 2F5DA 1L5UA 2DX1A 4LSNA 5EDNA 1Z7UA 2BVLA 1HNWK 4D1QA 2VC1A 2QASA 1R59O 5DLOA 1W1FA 2FA5A 3ONQA 4Y91A 2KYBA 2GIZA 2HCKA 3WTYC 3O8VA 1KD1C 3ABUA 3G71Q 1HLVA 3IP4B 4XH5A 1AHJB 1H3HA 2F48A 1RDCA 2DYBA 3ISPA 1MSEC 3QU3A 4O5FA 1KQJA 4FWRA 3U4LA 2RHUA 1NKCA 3VQ7A 2AHQA 1MH3A 4B9LA 2LCSA 3WXKA 1NKBA 2GWRA 1Q8IA 1RACB 4IFYA 4DWIA 3VTIA 4LDWA 2EQKA 2G0EA 5ERIA 1ITYA 2NOEA 2JT4A 1JXBA 4A57A 3TPQA 5LHIA 3UKUB 3VEOA 1Q82O 2XAHA 1WJQA 2QLZA 3R9PA 1KK7A 4BI8B 2Y9ZA 3P9IA 2QKLB 1GLNA 3THKA 4M75A 1HJDA 4J2EA 4H5RA 1VQ9N 5GPAA 4AIHA 5GAMf 1D0XA 1SG5A 5BS6A 2MWPA 4FJKA 4FK2A 3TBIA 5A2QO 5GAOq 4LGWA 2QSGX 1NGFA 1YTYA 1D3YA 3LNQA 4CBWA 2QCOA 3BT9A 2H56A 2YI1A 1UECA 4RG2A 4RB3C 5FJ8J 5ILVA 3PY8A 2DA9A 4EHUA 4CICA 2E1NA 2E34A 4WXCA 4IG3A 2KJCA 2YUOA 1J2XA 4HVJA 4F55A 4BBSJ 3IQLA 5J2QA 1JRIA 5DCFA 1ACMB 3VA3A 5BQTA 1SV5A 1ZBJA 2HMPA 1CF7B 1J5YA 4LOCA 3SZGA 5LJ5e 4QW2A 3QERA 4FJ7A 4J2BA 2VGMA 4DFMA 2DW4A 1EH8A 4YOUA 5DK5A 4M7DF 3FGUA 2XDDA 1HU0A 3CUOA 5BPLA 1B07A 4IO9L 1ZGJA 2E1OA 2EV6A 1BOAA 4CJWA 2QWRA 3U9ZA 4IHTA 4DBFA 4FWMA 2R7SA 4FLVA 1EWQA 4DV0K 3A8MB 1I1SA 3CC2I 2G8HA 3FSPA 4CZFA 2HS5A 1NZ9A 2JS2A 3J7AF 2R7XA 4GV3A 1SKRA 3AG1H 3G10A 4BY9C 4F8RA 3JYTA 4OKJA 3I56I 4FE7A 1ETVA 4C92E 2A40A 1S6QA 1HYZA 4ENJA 1TKTA 1X1BA 4QCLA 3CCEQ 4I6MA 3AKZA 1TWBA 1WZOA 2EYZA 4CCKA 2AIRB 4M75B 3ZGKA 2RN2A 3KP5A 1Q1HA 3W0LA 3PT9A 3ZSVA 3F10A 3T8TA 3QYHB 3OOUA 1AWCA 3E01A 3MCZA 5LLQA 2R7VA 4P55A 4XN0A 1YITT 3TABA 1VQ4I 4FYYB 3WVEB 1HNXK 3CIPA 5E3NA 4YIFA 3REBB 4DV7K 2CP0A 3BROA 5AJ3K 2GBZA 1B1BA 3ASKA 1X2NA 5T7BA 3EN9A 1T33A 2K6DA 2EQRA 5LRRA 3C2HA 4DTUA 1WAJA 1ZH5A 3F9MA 4MTEA 3O3GA 5LJ5f 4WYBA 2QA4Q 5LJ3d 3DPLC 5DMRA 3CW7A 1PM3A 1VQ9A 4BB7A 4NS5A 1IN6A 3G4SQ 1RC9A 1TWAJ 4ANJA 3LYIA 3HG9A 2QKKA 1OCZH 3CWUA 3TOAA 1T03A 4LB6B 4JK1X 3DJCA 3O5ZA 3E9LA 4B48A 5GANg 1A5VA 4N0AC 2ABKA 1KG3A 3HKZN 3RVCA 1KC8C 2DFHA 5FLVA 5GTHC 3M4OJ 3EH1A 3ZQQA 4G12A 4M7AD 2X4YA 4CCMA 1M5Q1 1CGPA 3FB9A 3EKUA 4CW7B 2XICA 4OIRF 4PA1A 2PJPA 2YHYA 5L3BA 1JL1A 1ZBFA 1RILA 3FK6A 2K2MA 3SZTA 4EMKC 1NWKA 2EW3A 5AQHA 3DTKA 3FXRA 3FIFA 5LL6Z 3BQZA 1HPZA 1SFXA 1NJWA 3OIPA 2QTXA 2BBYA 2KSSA 1DKGD 4KTWA 3NF7A 3HIFA 5JR3A 4DG1A 4XBFA 3NPFA 3PL8A 1KSPA 1Z9CA 4CZGA 2QWLA 5GANj 3GNGA 3BZ6A 2RI5A 4M3ZA 2VXFA 3LL7A 2VWFA 3WTSC 1Z67A 3S1QJ 4CJEA 2F4IA 2MW8A 2XD0A 1SC7A 3RNJA 3UKRB 3LSTA 3VU3C 3IKVA 4PZJA 4FWOA 1LE8A 3CZ6A 3E9FA 3KTUA 4KIGA 4G7HF 3VWBA 2P9LA 1MNDA 1IN7A 2A3ZA 3EGXA 2R5ZB 4JX4A 3DLEA 4KT6A 3I4PA 1X1CA 1D8KA 4EV0A 2WB1A 3G25A 1NK8A 3CF2A 5AFUH 1R7JA 1UB4A 2RQQA 4K42A 3HPGA 1U5TA 3LDQA 1OCOH 1OPCA 4EZ6A 2LT4A 2COZA 3PIPF 2HQEA 3ZX3A 2IS4A 1XUPO 3VYRB 3JRBA 4YRVA 1XTAA 5I3UA 3U2RA 1VQ5I 4OIPF 3LFUA 2A6EF 1F1BB 2ZNYA 3QXEB 2HBJA 3KLIA 4XIDA 4A3EJ 1OZ2A 1O7LA 4QSHA 4CGDA 5CYVA 1QCNA 4WF2A 3D0PA 4U88A 2STTA 2JMAA 4M77D 2DPDA 4WX9A 1K4SA 4DBHA 1C6VA 4H0XB 1X9SA 1U8BA 4JV5K 1DT9A 4E7SA 4YIRX 1I4K1 1XNIA 2RK2A 4Y1DA 2JG6A 4O55A 3MHXA 3ZMDA 2W41A 4OPKA 1U9NA 4BVOA 1ORNA 2Y2ZA 2LKPA 4C8QC 3INZA 3OY9A 3AVGA 1X1AA 2EQIA 1G3SA 2FSKA 2G8KA 2NUPB 2VXDA 2W10A 3CFRA 1FLIA 1VTNC 3LANA 4MQ9F 4N4NB 3TU4K 2MLKA 1T98A 1MUZA 2MD0A 4JP0A 3M58A 3AA4A 1MA9B 3VQDA 2BW3A 3SV3A 2QW9A 4NB4A 3NTHA 3C2BA 1RGIA 1T38A 2VCPA 3CJQB 4M6XA 5FU6B 2VJJA 2W7NA 3QHSA 3MEWA 1MBEA 4DOVA 1PYVA 5H6QA 3RUXA 1E2XA 4RTYA 3EGXB 4AHCA 2K85A 4YOTA 1W2BA 3KVGA 2Y0SN 2QYZA 1MDMB 1FZPB 1K7AA 4BY6B 1YQKA 4G94A 1OULA 1GBQA 2Z1IA 3CC7N 5CKEA 2CW0F 3KP2A 4FWKA 3QG1A 3PTAA 2RF0A 3CJBA 1IGUA 1W7PB 1YP5A 3QNOA 3EYZA 4EGZA 3GNFB 2QWPA 1UA0A 4YFNF 2CFOA 3CCRI 2M3AA 1I5OB 4E6RA 1ZAOA 4CCJA 3MWTA 1FW6A 4OFHA 4HF2A 2BUPA 1OZ3A 2JS0A 1J3TA 4EQQA 1A31A 2HNZA 4E9EA 2JA5J 3ML6A 3FIWA 1Q18A 1TAQA 3D5LA 3GOXA 1HYVA 3FHGA 1RI7A