3OYNA

Crystal structure of the pfv n224h mutant intasome bound to magnesium and the insti mk2048
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oynA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oynA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oynA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oynA03
2D5RA 2OA8A 1KSPA 4QAGA 5I42A 3G10A 4B9UA 1VSIA 4FLVA 4DFJA 3S9HA 2G8HA 5KCHA 4A4FA 4CF9A 5KCOA 3ZCMA 4AILC 1J53A 2VG7A 3HYFA 4NCGA 1RTDA 1NK9A 4FJMA 2HNYA 3DRRA 4JLHA 3NGIA 1JL2A 5DMRA 4HVJA 3IAYA 3QINA 1IH7A 4PQUA 1LW2A 4HTUA 4DQIA 3Q1JA 1FKOA 4DLEA 3K5OA 3CFRA 3MP1A 2R58A 1VSJA 1Q9YA 2HQXA 1A5WA 3QBYA 3QESA 3SD4A 2NLUA 4GVMA 2RJDA 1SKRA 1FKPA 2RI2A 4NCBA 4PLIA 1JLQA 2E6LA 4O0JA 5IN1A 1IKXA 2OPQA 4H4MA 3SYZA 2RKIA 1WSIA 3KD5E 1X9WA 3LP0A 1VRTA 4BDPA 4K8XA 2EQKA 4CEZA 2Z1JA 3SUPA 1TKTA 4FM0A 3K58A 1OI1A 1RT4A 1B9DA 3ALYA 4AHSA 4E0DA 3HJFA 1VK0A 1T7PA 4CF2A 4AHTA 5J2QA 3AVAA 3OYBA 2RJCA 4FXDA 4F2SA 2LRQA 3ZSWA 2WONA 4X34A 2PYJA 2G8UA 3LP2A 3K5MA 2HHSA 2LVMA 1A5XA 1HNVA 1NKBA 4N41A 3KLFA 2G3RA 3QETA 4IUVA 3V4IA 3MECA 5CZ2A 2ETJA 5J2NA 3VQ6A 1U47A 1RTIA 4CECA 5HRRA 3TR8A 3NGZA 1NKCA 4A4EA 3O4QA 4CHPA 5D6XA 3ZSOA 3PO4A 4RW8A 5SZTA 4UC4A 3ZEHA 1TKXA 3H6ZA 1NK6A 4E89A 3KUFA 3ZSXA 3CFOA 2B8AA 4CGFA 1ASWA 4CCHA 4L8RB 3S3OA 1DTTA 3VQQA 2P1JA 5HBMA 3TARA 4II1A 3SCXA 4C5GA 1TL3A 1B9FA 2X4XA 4AHUA 4DTNA 3LALA 3UWNA 1RBUA 4CK3A 3AVJA 3PUFA 3KLGA 4BE2A 1ZYQA 4W5RA 3AVGA 3T3FA 4I9QA 2VG6A 3SPZA 3DYAA 4BD3A 4W5TA 4CJTA 3GOXA 1C6VA 1MU2A 1BIZA 3PV8A 1U48A 4KREA 3ZT2A 2YNHA 2DFEA 3KKSA 4MFBA 1EP4A 4B3OA 3HP9A 5C42A 4BE1A 3RWUA 1YTUA 3OMGA 1BIUA 2RPIA 4PL6A 3TAMA 1W9HA 4DSIA 2OPSA 1WAFA 1WJQA 3P1GA 3RMAA 1RDBA 3CFPA 4DLGA 4EP5A 1RT7A 2Z1HA 2KW4A 4FJXA 5D3GA 5CIUA 4DSKA 3VA3A 1D5AA 4CFBA 3K5NA 4ICLA 3K59A 1UOCA 4OKJA 2KZMA 3CG7A 2BANA 4J2BA 4N4HA 4Z4EA 4CK1A 4IFVA 1QQCA 3H08A 4Z0UA 3AA5X 4IUPA 4QVZA 1RBVA 2BKDN 2DIQA 4OGEA 1XC9A 4EDUA 4E19A 3AVFA 1K6YA 2RJEA 4W5QA 4C8NA 2G8KA 4I2PA 3LANA 4FK0A 3TANA 3SNNA 2YKNA 3B6PA 3LH0A 2PZSA 2E6MA 3DM2A 3BGRA 4JRQA 4Z02A 2B6AA 4HCBA 4FJIA 1JXEA 1HYZA 4CEQA 3NDKA 2GF7A 1UA0A 4KHYA 1LWFA 4CJ5A 1B92A 1BQNA 4QQ6A 1Z25A 3AVBA 4C8OA 3V9ZA 2RHXA 1KCFA 3O8VA 3KLHA 1C1BA 2IDOA 1QE1A 2XY5A 2OPRA 4ZHRA 5T7BA 2P5OA 4KI6A 2X4WA 3MEDA 3HM9A 3C6TA 2FBYA 3DLKA 1S6QA 3VQ4A 3V9WA 3ZSQA 3SQ0A 1KVBA 2Y1JA 3I8DA 2QQSA 3LP1A 2DY4A 4PY5A 4WE1A 4KHQA 4NCAA 1SL2A 4FM1A 3CEYA 3MP8A 1KLMA 1SKSA 4CK2A 1BI4A 3QO9A 3OJSA 4CJUA 3NHGA 3PX0A 4A4HA 4C5IA 4DTUA 4M3TA 1HRHA 1QSSA 1J54A 4EP4A 2E4LA 4IBNA 1CZBA 3HPOA 2ZE2A 3HVTA 1QSYA 2RI5A 5HRPA 2A1SA 1J9AA 3DMJA 3TAFA 4FK4A 4RW6A 4DTOA 1L3SA 3LWLA 2EFIA 3L8BA 3LDSA 3PMTA 4FLZA 3LGFA 5D6YA 4CE9A 1RCHA 4RW4A 1A5VA 2E5QA 4FJ9A 4DQRA 1WSHA 3LZIA 1QHTA 1C1AA 3T19A 2DTUA 2HB5A 4RW7A 4DQPA 1BI4B 4DTSA 3ULDA 4FZXC 4N47A 4AHRA 3SZ2A 3SV4A 4OLBA 3KK3A 3ZT4A 1WSEA 3L3VA 1Y97A 4DU4A 3NGYA 1S1UA 3A2FA 2FBVA 3DLMA 4A4GA 3JYTA 4M3XA 4AHCA 3NF9A 2W42A 3SUNA 2F8SA 1RT6A 1CLQA 3ZT0A 1OYXA 4PA1A 3DLGA 3KD1E 1BISA 3SV3A 4FM2A 3VQ7A 4GW6A 4FK2A 3ZT1A 1U4BA 4IURA 3OYJA 4CHOA 1YT3A 3FC3A 2F5KA 3RTVA 4DWIA 3CQ8A 4DSFA 3B6OA 3AVLA 2JGUA 3LYIA 3ZSZA 1VSLA 2XRIA 1LAWA 4KI4A 2QKBA 4DS4A 5KRTA 1CXUA 4KHNA 1N27A 3LAMA 4F8RA 2A1RA 5JS2A 3M8SA 1BCMA 4ZTFA 4CJPA 3V1OA 4FJ5A 1F21A 2JZ2A 4CJ3A 1N5YA 3KK1A 3L2WA 1KLNA 1WAJA 4CESA 3DLHA 3DB4A 3LZJA 4DTJA 4HHTA 1C0UA 2IC3A 2IG0A 1RT5A 1N6QA 4ID1A 4DQSA 4B08A 2OZSA 1RT2A 3VQ5A 2HQEA 4W5OA 3CM5A 3JSMA 3M9QA 2X6NA 4O44A 3ZSYA 2G8FA 4XIUA 3QEVA 2P0KA 1MHNA 1NJXA 4LH4A 3E01A 2D0AA 3THVA 4DTPA 3K5LA 4CJ4A 1IKVA 5C6SA 4KAZA 4E7LA 1TKZA 2HNDA 2GBZA 4FW1A 1NKEA 2ZD1A 4I9LA 4FCYA 2BIVA 4Y1CA 3M8PA 2O4IA 3AVNA 2K3XA 3AA2A 1NK5A 4QW2A 4I2QA 4OLAA 4KHSA 3I0SA 3DRPA 1KFDA 3U6FA 1G5VA 2Z1IA 3HK2A 3OS2A 4Q5WA 4FJLA 3ZSRA 4B9LA 1J5OA 2HHTA 4MQ3A 2DAQA 1I3AA 1HPZA 4PUOA 2IAJA 2XO7A 3O3GA 5DK5A 1JLGA 2XDPA 1BGXT 1OZ2A 3MEUA 5M9OA 4FW2A 4OJRA 3IG1A 1QTMA 4CEBA 1TAUA 4KFBA 5KGXA 3V9XA 4OKEA 1I39A 2X74A 3AV9A 1X9MA 4CFDA 1O1WA 3QKJA 4CEOA 1L3UA 4NYFA 3HT3A 3IS9A 1RILA 3DLEA 2KTQA 3LPTA 3OYKA 3QNNA 4FLWA 3AVIA 4KRFA 2CKKA 1EX4A 2FC0A 4DS5A 4OGCA 3MEEA 1XHXA 4CRIA 3TWHA 3KK2A 1HYVA 1CXQA 4NZGA 3NAEA 5KE2A 3D0PA 5KTQA 3PX6A 3CYMA 1WJRA 3D45A 3U3YA 2G8WA 4B8AB 1RBRA 3OYAA 2PY5A 3ME9A 3L2UA 5FRNA 4FLYA 2ITGA 2RHUA 2EQJA 1BHLA 4CF8A 2LTOA 4C5HA 3KIOA 1XI1A 3ZT3A 4LD6A 1GOCA 4N5SA 1WSJA 3QIIA 4O55A 4BWMA 3QEXA 4C8KA 1DTQA 3PY8A 2DFFA 2X4YA 1BL3A 1SL0A 2XY7A 2XY8A 1S1WA 1Q9XA 3QEPA 4FU6A 3MAQA 2XY6A 3OJUA 2IOCA 4CIEA 3OYHA 4HCZA 4B9SA 2QK9A 4CJEA 1X1PA 3MP6A 3L42A 1FK9A 1T05A 1NJZA 4UQGA 1XHZA 3LLRA 1HQEA 4F3TA 3H8ZA 3TABA 2VYTA 1L3TA 4EZ9A 3RMCA 5J2PA 2FHDA 4JS4A 4CEDA 1WLJA 3G0ZA 4B9NA 2YV0X 5J39A 3O3FA 3S3NA 3PX4A 4IUUA 4ELTA 2VG5A 1RDDA 2ATQA 3OQ5A 3VQ9A 4FJ8A 3OYLA 3HO1A 3RMBA 4DSLA 4KB0A 2D0BA 4E1NA 1WGSA 5KI6A 3L2VA 1IG9A 1UA1A 3TAPA 1HYSA 3DI6A 4CF1A 4OPJA 1T8EA 1GOBA 3HXMA 3LPUA 4FJ7A 5KRSA 4DSJA 1HNIA 3SPYA 1DLOA 1SKWA 2GV9A 1LV5A 4M3YA 4KKOA 4RG2A 3OYMA 5HROA 3WNEA 2D9TA 2RHYA 1KTQA 3NH1A 1VSDA 3NNQA 2RJFA 4FZZA 3CM6A 1TL1A 1TV6A 3AVCA 4JS5A 1TKDA 4N4GA 4G1QA 1VSHA 3PMIA 3ISNC 4KTQA 5SWMA 4ELVA 4CFCA 3S6WA 1IO2A 3SQ4A 4F3OA 1BQMA 3L2QA 4CJFA 3OYIA 1JKHA 4CEFA 1Q8IA 2RHZA 4GY5A 4CGHA 3KTQA 1RI0A 2OZMA 3NTHA 4OKKA 5D6WA 3NE6A 3BDLA 4Q5VA 2L8DA 1RT3A 3LP3A 4DFMA 4CHZA 2RO0A 4QQGA 3V1QA 2RN2A 1RDCA 2BGGA 2X35A 5EU7A 1GOAA 3VQAA 3SUQA 2QQRA 3PO5A 2AJQA 5C0MA 2OYQA 4CJKA 4IUTA 1ZBLA 4B9MA 3KKRA 3K57A 2HHVA 1BCOA 3QLHA 1TK0A 3ITHA 3P83D 3MEWA 4W5NA 4O5BA 1U49A 1LWEA 4ELUA 4KHWA 2NUBA 3AO3A 4F4KA 1G15A 1NK8A 5HRNA 1TVRA 3OYGA 4E3SA 2IGIA 3NF8A 4FVMA 4CF0A 4KHUA 3TI0A 2VWJA 5CYMA 1RT1A 4B9VA 2B5JA 1EXQA 2IS3A 2JLEA 2XK0A 3NBPA 4CIGA 3OS1A 4ZTJA 5FDLA 2LDMA 3OYEA 1XWLA 4KO0A 2KFNA 1RNHA 3QEIA 3KLIA 2FBXA 4DFPA 2EQUA 5I3UA 3O4NA 3V9UA 1ZBHA 3V6DA 1WNSA 1VSFA 2HNZA 4B9WA 1LW0A 2HHWA 1SV5A 4B9TA 4YNQA 4C8LA 4M42A 3OA6A 3MEGA 5KH6A 5IAYA 4CGDA 1HJRA 2BE2A 3V81A 3SQ1A 5CYQA 4AH9A 5K14A 2HHUA 4ID5A 2R57A 4CJVA 1S5JA 3HPHA 4DQQA 3QIOA 4KTWA 2QXFA 3FLGA 3E9FA 4E1MA 2X6SA 1JLEA 4CJQA 3OB9A 2L3RA 1TK8A 3IRXA 2E6NA 1RTHA 3F9KA 1UWBA 3TAEA 3V9SA 4DU1A 1LAVA 4J2DA 4CHNA 2YRVA 2RHIA 1L3VA 2YNGA 3ZSVA 1YTAA 2R5MA 1S9GA 1KVCA 4FJGA 4BDZA 3QEWA 4LY7A 4N56A 3LX7A 5FROA 2Q3SA 5HLFA 4RW9A 1WJSA 1JLFA 3OYFA 1SL1A 3L3UA 3DLBA 4R5PA 1RDAA 4BDYA 1S1XA 3RR8A 5HRSA 4JRPA 4QQDA 4CHQA 1VSEA 4CGIA 2HW3A 4GMJB 3WNHA 4BACA 4IFYA 1YVUA 2BUDA 3M8QA 3RMDA 3HP6A 4KTZA 3VN5A 5C24A 3L2RA 2MWPA 3VQCA 1NK4A 1EKEA 4NS5A 5E41A 2GFUA 4TSXA 3C4SA 1X9SA 3DLRA 4AHVA 4H4OA 3C95A 4Q0BA 1TK5A 5C25A 2EHGA 2EKOA 4DFKA 3DRSA 4KPYA 4OVAA 3SJJA 4FJJA 3SI6A 2JTFA 1VSKA 4I7FA 4O0IA 3RRHA 3M8RA 2I5JA 4DSEA 1ITGA 4CEAA 3OYDA 5J1EA 3OY9A 1JLBA 4LD0A 1ZBIA 1ZBFA 3OYNA 4DF4A 4Y1DA 2GFAA 3UIQA 3C94A 3WNGA 1WSGA 4E7HA 1SUQA 3F73A 3AVMA 1T03A 1NOZA 1JLAA 4DTMA 4RG8A 3NTKA 3MXJA 3NF6A 4F2RA 4CJSA 2DIGA 2D0CA 3QJ6A 3O3HA 3FEOA 3PNWC 3K2PA 3VQEA 4E7JA 5KGWA 3NF7A 4Z4GA 4M3RA 2Y1IA 4M41A 3HSTB 4FZYA 1LWCA 4E7KA 4FLXA 2G8IA 4M45A 4DG1A 2GUIA 2LCCA 1JXBA 3MEAA 1REVA 3AO1A 3VQBA 4NYNA 3MEVA 1UAXA 1EETA 3FFIA 1S9EA 4Z4IA 4IG0A 4HUEA 3PFSA 4E7IA 3DOKA 4FL6A 1VRUA 1H3ZA 2B4JA 3EZ5A 3P5JA 2HHQA 3SQ2A 1NJYA 4IKFA 2VWKA 2PQWA 2M16A 4N76A 4FLTA 3BDPA 2HHXA 3UT1A 4B9XA 4B8CA 3NTIA 5JS1A 4CJLA 3HL8A 3AA3A 1QS4A 1JL1A 1D9FA 5J26A 3KLEA 4CHYA 5FRMA 2ZQBA 3HVRA 1R0AA 1HMVA 4HUGA 4CGJA 4LH5A 4HUFA 3EYZA 1IKWA 4QOZB 4M3UA 2FBTA 1ZBUA 3EY1A 1D8YA 3QNOA 3S3MA 2O4XA 1ASUA 4LSLA 3WNFA 3VA0A 2YHBA 3OYCA 2PYLA 3E9GA 1OZ3A 3V1RA 3I0RA 2YNIA 1S1VA 4PWDA 4DF8A 2HVHA 4O4GA 4YFUA 3DB3A 3META 1NK7A 2LSNA 3MO8A 3QIPA 2X78A 4CJRA 4FYDA 3FDRA 5HP1A 1ASVA 2Z1GA 2BDPA 3KJVA 1U45A 4Z4FA 2XHBA 5CY4A 2RF2A 3TAGA 4N4IA 4CEEA 1L5UA 4M3WA 4CERA 1NOYA 4DTRA 4C5EA 4EZ6A 3MXMA 5KE3A 2YKMA 4FJKA 3ASMA 1XNIA 1D9DA 3T1AA 2DFHA 1S1TA 3VQ8A 1S6PA 4DU3A 4DMNA 4QCLA 3HPGA 3OMCA 3RR7A 3NH0A 2M0OA 2F96A 4IDKA 1TGOA 4K8ZA 2O4XB 2P51A 4CFAA 1U04A 2M1HA 2P5GA 2KFZA 3OS0A 4KV8A 1IKYA 3AVHA 2KQ2A 3RRGA 3C6UA 1WSFA 3DOLA 3VQDA 3MXIA 3U3GA 4PLLA 2EQMA 5J2MA 2R7YA 2WOMA 4OVLA 3LAKA 4J2AA 2KZZA 1NJWA 3AO2A 1KRPA 1KHCA 3NCIA 1C1CA 2QKKA 4BE0A 3SUOA 2L89A 4J2EA 1C0MA 2WACA 2G8VA 3AO5A 3P8DA 4C8MA 1WN7A 4L59A 1RBSA 2HVIA 1RTJA 2MWOA 4HCCA 2YNFA 3QERA 3NFAA 4LSNA 3TAQA 1RBTA 3VQPA 1HQUA 1W0HA 1Z26A 4CJWA 2EX3A 3P8HA 4OPKA 1NK0A 3AO4A 5CZ1A 4CGGA 4Z4HA 4KB1A 1FXXA 1KFSA 4FJHA 2YHAA 4IUQA 1JLCA 3EAEA 3AA4A 3ASKA 2HMIA 2RI3A 1KVAA 2O4GA 4Z4CA 3AVKA 3NH2A 4CIFA 4H8KA 3OVNA 1CZ9A 4FLUA 3LGLA 1VSMA 3F70A 1QSLA 4DTXA 4FJNA 4IG3A 2K3YA 1SSFA 2OPPA 1C0TA 1TAQA 3LWMA 2F8TA 4BWJA 2R5AA 4M3ZA
chains in the Genus database with same CATH superfamily
3DKXA 1PU8A 2OA8A 2RD1A 1OLTA 2ZXJA 5LRRA 5A0GA 1VSIA 1MIJA 4I0AA 2DKGA 3PJRA 1ZGAA 3CMYA 4DFJA 2EFOA 2A6TA 2DA1A 5GAOm 1JE8A 1AWJA 4PJOG 2EZLA 4C2TA 3QDKA 4AILC 2CV0A 1J53A 3HYFA 5FPEA 2BE7D 2W4SA 4BRCA 2O9SA 2KFDA 3FB9A 1WHLA 3M0PA 1FOYA 4GDFA 1E17A 2HNYA 3DRRA 3JV3A 2PG4A 1EZZB 1Z0XA 1JL2A 3HHHA 2RGVA 2BHYA 3PL8A 4CZGA 1CQTA 3ENBA 2EQRA 2CFOA 1LW2A 4HTUA 3RNJA 4DQIA 1T6CA 2OTJQ 1QPIA 4DR5K 2H09A 2R58A 1RUNA 1Q81U 2GQQA 4OFHA 4JHDB 2NLUA 1U9NA 2O8DB 3IH2A 2JWTA 4RTWA 3UKRB 2W03A 3HRUA 3H0DA 1UFMA 2KRHA 4MQ9F 1DEJA 1N32K 4O0JA 1JKRC 3R0AA 4H4MA 3M9AA 5AQLA 2RKIA 1R22A 2JK3A 4DV6K 1AZEA 3DEWA 1VRTA 1MDMB 4F17A 2DEUA 5F2RA 4K8XA 3MN9A 3CMET 1Y39A 2GXAA 4XTYA 1B9DA 3ZRGA 1YRNB 3ALYA 4PKCC 1GXIE 4E0DA 5F0CA 1MJAA 2ZPEB 3JB9I 4JQFA 4BR5A 1MH3A 1EJ9A 4AHTA 4F52A 4RCHA 1Z9CA 3ABKH 2KEAA 4DQ8A 4CC3A 4CC7A 4PL7A 2LF8A 2LRQA 4LLNA 2G8UA 3GOIA 2JHNA 4DR1K 4E6RA 5C3EJ 2E2PA 3CO6C 1NKBA 1QVUA 1B3QA 3CMAA 3QETA 1JJ2M 1VQ8I 1KO9A 1Q18A 1GHCA 4IUVA 2F48A 1GXPA 3CC7I 2KI7A 2NZTA 4A2UA 2X1DA 4UY8I 5E84A 5BPDA 3F72A 3QG1A 1U47A 4A2AA 3TR8A 4P5NA 4A4EA 2AXTC 3O4QA 5F64A 3PIPL 5SZTA 1TKXA 1OV3A 4G9YA 1VQ9N 1W70A 5FU7C 2OZ6A 1SF9A 3HI0A 3ZSXA 1BW6A 3DWLA 1UGRB 5TGTA 4PJOC 1H1VA 3S3OA 2P1JA 5LGTA 1M1EB 3CPWS 4C5GA 3SCXA 5LGNA 1YCYA 4J9IA 4FYWB 2E1MC 2J5OA 2W0ZA 1H89C 4FSVA 5EDNA 1SSHA 4LN2A 5HCKA 3KLGA 4W5RA 1OQKA 4RTZA 3CMEI 3RSEA 3BE3A 3M1CA 3Q3SA 5GINA 1T95A 1XMKA 4W5TA 3V8LA 3OH6A 2ZZDA 1X6OA 1BIZA 2DL3A 1RKWA 4KREA 3IL2A 3QYGB 3SWNC 1AWCA 4A62A 2KY9A 3CC7N 3G25A 3ZGKA 2L2PA 3UDCA 1Q86C 4KIFA 5C42A 3F0CA 5LBQA 2VLAA 4QWQA 3CF5L 5CVRA 2LBFA 2DXCA 4RTVA 1ZG1A 4XN0A 3EG1A 2RPIA 1NGEA 4EA4A 3ASNH 3MN6A 2AA4A 1WAFA 1I1SA 1RL2A 1M8VA 3GLXA 3FSPA 2YRDA 2FQ3A 4EP5A 4C8QC 1RT7A 1VQ6Q 4BQLA 1KAZA 3OR2C 5F27A 3O8HA 1IC8A 3H5RA 1HXDA 2LZ6B 4LDYA 1JBMA 4DSKA 1UECA 3NWSA 2P5KA 3LAPA 2CFXA 5LJ5f 1GFDA 3DF8A 1XTDA 2ELHA 2QQBA 3CBPA 4DV7K 1MV3A 2KZMA 3CG7A 5IXFA 3G3ZA 2NUPB 4Z4EA 4XKBA 2QWNA 2GIZA 4CK1A 3DPTA 3D2FB 4F7ZA 1QQCA 4IFVA 1YQAA 3H08A 3GTQJ 2VKHA 3CUQA 4LB6B 3OWTA 2A41A 2Y2ZA 4F14A 3MVPA 3AA5X 3J81K 2YDLA 1IDZA 2VVKA 4QVZA 3BROA 2BKDN 3A1YA 3AGKA 4OGEA 1XC9A 4EDUA 5AQMA 4QS9A 3DPUA 4EIKA 2G8KA 3OBYA 3GL1A 3LSJA 3IKTA 3WTZA 2HCKA 3LANA 1PKSA 4FK0A 5CVJA 2VC8A 2YKNA 3NRVA 4DR6K 4B1YB 5FFZA 2V51B 4K25A 1NJIR 3TREA 3RYPA 3SQNA 4HCBA 4BGDA 1AVZC 3THXB 5ADXA 4CEQA 2NS0A 4QS7A 3BDUA 3QFPA 4FYYB 1DGRM 3N97A 4J9GA 2K7LA 2DTOA 1VHXA 3F23A 4ZYHA 3ENHA 3RMQA 1IXCA 2DVEA 5IXBA 1QWEA 4PKGA 1UA0A 4KHYA 2P9KA 1FJLA 3A98A 1BQNA 2AIRB 4ZDPA 2HS5A 4Z89A 1WH7A 1U6ZA 3VS4A 3AVBA 3D6RA 5BRFA 2RHXA 2YXYA 1P2FA 3KLHA 3SEQA 4UXNA 1OKRA 1YW7A 3CCRQ 2XY5A 4HQMA 3KEQA 3G7ZA 2EGCA 2EFNA 2MD0A 5B1AH 1X2KA 5AIQA 2CUEA 2P7VB 3EG2A 2ZXHA 3LFUA 2CZ0B 2LY2A 4OMFB 3JRIA 2CGJA 4UY8O 1PRMC 1QVFM 2AZVA 4HF2A 4EGZA 1K1ZA 1WJCA 2KBTA 3VQ4A 5GANj 3GTKJ 8ATCB 3SQ0A 4CGZA 4M7AG 2V9PA 4I76A 2QQSA 3LP1A 2DY4A 2QKLB 4BRFA 1KFZA 5F1XA 4KHQA 4PY5A 2ZAEA 2F5DA 4PFPA 1PD0A 3MP8A 2V9KA 3CHWA 4CK2A 5E18F 1OU8A 3I0TA 5GAOq 2DU9A 4FHTA 2VKVA 4YIFA 4FX0A 1D4XA 4CJUA 4DBFA 4A4HA 3IUCA 2JSPA 5KYYB 1HRHA 2P7CB 2ZE2A 3HSBA 2KLAA 2EV6A 3HVTA 4F55A 1U5TB 3GNGA 1I6HJ 5HRPA 2A1SA 2VT2A 2E3HA 2GA1A 2OTLT 4C30A 3AL0C 5HNFA 4UOBA 4RW6A 2NOGA 5DM7L 4IIMA 2Q97A 4A61A 4JV5K 1U1TA 2KJBA 1MGQA 3ABTA 2ZCWA 3U9GA 3LGFA 4A6DA 1GLLO 2EIJH 1WJ5A 4C3HJ 1A5VA 1BW5A 2E5QA 2TCTA 2IGKA 4FJ9A 3FKJA 1SMYF 4DQRA 3EGXA 3MZYA 1JXMA 4AIHA 1YX3A 3LZIA 3OOPA 2ZJPF 3T19A 2HGCA 2DTUA 1D0ZA 1NKUA 1FOXA 5IY5H 3ATUA 4EM1A 1JJ2S 1BI4B 1VQOI 1I6XA 1EIFA 3BC8A 2A08A 4HDVA 5LL6S 3D2EA 2JPBA 4XLNF 4XH1A 3KK3A 3ZT4A 4MO4A 2QM3A 3SZPA 4M78E 3NGYA 3JAME 1VQ5A 2M2EA 3T1HK 4FTHA 2VXDA 4Y91A 3DLMA 4A4GA 4CICA 1IG8A 1JB0E 5GAMf 3IWFA 2EIFA 3VEYA 3NF9A 2D1XA 1QZ6A 2W42A 3CCRA 3DCFA 1GV2A 3BPXA 4DKWA 2UYTA 4JI7K 2WA0A 3IQLA 4B24A 3FM3A 2HVQA 2DMUA 1FW6A 1R59O 4D7NA 3KD1E 4TVRA 2O8FA 1QVTA 2IVMA 2H8RA 4JHDA 3IKVA 4PIIA 3SV3A 3VQ7A 3DBLB 5IOZA 1RAAB 3VS5A 3BG3A 3A5ZB 3ZT1A 4Z2YA 2GZWA 1U4BA 1IRFA 2LOOA 5EOYA 3FC3A 1PUEE 2H3EB 2NAZA 2JWKA 4M78F 4DSFA 3B6OA 1YRNA 4B44A 5HLIA 2P6SA 4H0EA 1VSLA 4JX6A 1VAZA 4M74A 1QCFA 4KI4A 2QKBA 2YR2A 3F21A 1O9SA 1TUYA 3BP8A 4KUIA 1E3HA 3QODA 3M8SA 3WU1B 2K4JA 1BA1A 1B9NA 2H6BA 1W6XA 4FJ5A 4F7UG 4M7DE 3PIOL 1VQLI 3ZQIA 2QTXA 1B4AA 2OTLQ 4NC7A 3KK1A 1VQKN 1KK7A 1Q86R 3L2WA 4M75C 3WT0A 2FPDA 1LCKA 1ZARA 4BRPA 1IZ6A 4A69C 4DNCA 3BDDA 3REOA 2WFBA 3FHGA 2O31A 1RT5A 2QEXT 3JCMX 3DXMB 1M4ZA 1ETWA 2FNAA 4C8QF 4DQSA 1RT2A 2HQEA 2QZ8A 3A0IX 3QUIA 2JA8J 5BPIA 1Q1VA 4G7OF 3ZFJA 3JSMA 3JCMf 3O4WA 1YJNQ 3G4SN 2Z1DA 2Y0SA 4IX7A 4CCLA 1RLPC 3KYDB 3H45C 1KG5A 3QEVA 3BOQA 2QYZA 1GLFO 4LH4A 3HSCA 5E1WA 4BRIA 3WQUA 2GQIA 9ANTA 1LDKB 3GZ5A 1ZUKA 4WCGA 2BZYA 4J9DA 1YI2Q 4M72A 3K5LA 2V1DA 4M7DF 1MWMA 1G3SA 1S72A 1T33A 4KAZA 1NTCA 4ZYEA 2Z99A 2PUOB 3QXEB 3OL3A 1ZQ1A 2GBZA 1NKEA 2ZD1A 3O3KA 5J6XA 2D8HA 2DQLA 2ZFUA 2WSEE 2BIVA 2EQIA 2KE9A 1MPGA 2ZFWA 1ZELA 3AVNA 3CBMA 1HYOA 5M1NA 2CUZA 1CKBA 1Z7UA 1AD5A 3JCMW 2HAXA 3V7RA 3CC4Q 2Q1ZB 4OLAA 3K70D 3BY7A 4MQVA 4KHSA 3U6FA 2NOFA 2HBPA 3OS2A 4FJLA 1J5OA 5HS7A 5FLMJ 1NU0A 3MZHA 4BC3A 1D0XA 2V8IA 3WXIA 2O8EB 2DXTA 2NRRA 3O3GA 5DK5A 3T7ZA 1XOVA 3O8MA 1Q81O 3TOAA 4U88A 3RPUD 1OZ2A 5DEQA 1MBHA 1HNXK 1IRGA 2O8BA 3U1KA 1VQPN 1QVFS 2JM9A 5B5EC 3CCMT 3BLYA 5HDKA 3GG4A 4PJOD 4B8XA 2RQUA 2HNHA 2XGDA 4XL9A 1D5VA 3VF6A 4DB3A 4RB1A 1PP7U 3CCEN 1QKXA 2PQ8A 3C6HA 3FXRA 5E3OA 1SFEA 3IRRA 1X9MA 1JXSA 1O1WA 3D2FA 3QKJA 4CEOA 2ZPHB 4NYFA 2XGCA 4CD3A 3HT3A 3DLEA 2KTQA 4KBMB 3CCJT 3H35A 1EX4A 1RAFB 4EJVA 2RKHA 1BI2A 1XHXA 4CRIA 3TWHA 4QTRA 2DL7A 3KK2A 1J59A 1KG2A 2MMPA 4XOPA 1HYVA 1CXQA 1D3BB 1ZBSA 2K6DA 2H1KA 3FHNA 3ZMDA 1NE8A 2MC3A 5LGUA 5F08A 4OWRB 2LC4A 3X26B 3NQOA 2LLKA 5L3EA 4M73A 3VETA 1UGSB 3JB9J 3H1VX 5B8HA 3THXA 4GXOA 2K9LA 2DX1A 2PY5A 2PX9A 3L2UA 1ZLKA 4JX5A 1YI2A 4OINF 3HJEA 4LF7K 1UG0A 2VN2A 4J7FA 4A3EJ 2P9PA 4ILHA 2UXNA 3HZJA 1BHLA 5D4RA 2Q31A 1XI1A 3KK7A 4N5SA 5EVZA 4OX9K 1FT9A 2E4HA 1K8AO 3QIIA 4O55A 5EYRA 2RF0A 4C8KA 3H9GA 1JTXA 3FXLA 2CS7A 5AQSA 1SL0A 4ZN3A 4WWCA 4KYWA 1S1WA 2XY8A 3CCMI 1QVGM 3HM8A 2JUFA 4FU6A 2HDCA 2P9NB 3OJUA 4M77E 2ELKA 1K6OA 3FMSA 3OYHA 2K4YA 5FWBA 1I4K1 4B9SA 4LUDA 3WXMB 1WVRA 3C7NA 1LFPA 2QK9A 4ESFA 2XHCA 1X1PA 3L42A 1T44A 2AXLA 3LA3A 1GLDG 2Q8KA 1YIJT 3R3LA 1B6AA 4UQGA 2OFIA 3CCJI 5GANf 4DBHA 2YHYA 4EHUA 2LNBA 1MMAA 3FDYA 2R93J 3H8ZA 2W25A 1TH7A 3CCUT 1EWRA 4BHCA 1WLJA 1N8RC 2VJ4A 1OX9A 2XAGA 4H0PA 3CCVA 1BC8C 1YW8A 4BJTA 1HNZK 3DLLF 3GTLJ 4YPRA 1KQ1A 4M9SA 2JMCA 2VG5A 3GFIA 5IWAK 4M77F 1UJYA 3K2ZA 4MDBA 4HZFA 2NRWA 3FZFA 5HLTA 4AVZA 2HMAA 3EKUA 3DJCA 2QTDA 5BPNA 1FSHA 4QVCA 1N34K 2EINH 2NOLA 1GOBA 3HXMA 3LPUA 4FJ7A 4CW7B 4MO5A 1FOKA 1HNIA 2A40A 4GV6A 3V8KA 2VE9A 5ERIA 1DLOA 1NZ9A 1DGWY 3IKMA 1SKWA 3VESA 1LV5A 5GPAA 3PNYA 3H0FA 1I50J 3F9MA 2FXAA 3CCQA 2AZSA 5HROA 1DPUA 1SEMA 2D9TA 2YG8A 5EZHA 3AG3H 1EWQA 4PJOB 3NNQA 4X6AJ 1KD1R 5GAN6 3CM6A 1UB9A 1XG1A 1SHFA 4OB3B 3IUOA 2W7NA 4JS5A 1TKDA 3VYHB 3I59A 2NUTB 3UA7A 3BJ6A 3ISNC 1N6AA 4M75F 1MUNA 4CFCA 2DL4A 3L2ZA 1HJOA 3SQ4A 3L2QA 2X4JA 3VEOA 4DV5K 4CEFA 4DYQA 5EG2A 4CGHA 3SBTA 2ID3A 3SWNB 1VRLA 4Y3OA 3CMAI 2OZMA 3GTJJ 4OKKA 5D6WA 4NL2A 3NEUA 2EV5A 3K4JA 5GP9A 2Q2RA 2P9IA 3I4PA 2JSCA 4WF2A 3BDLA 1RT3A 3LP3A 5JHFA 4IFEA 4DFMA 4CH7A 2A69F 1U1SA 3HRTA 2LX9A 2O5RA 3RUXA 5AQYA 4QQGA 1UHWA 2ROTA 2RN2A 1GOAA 4A3GJ 3VQAA 2LKSA 4E9EA 3DPLC 4KGZB 1HKQA 4D8KA 2DM1A 2XRNA 2AJQA 2LNHB 2W6LA 3P4IA 1XPXA 5KYUA 3HHGA 2RPNA 5F0FA 3M3YJ 4MZTA 2LTPA 2EPDA 4IHVA 1N77A 3CCUQ 4B9MA 3KKRA 2NVTJ 2EA4A 4PGGA 2K9MA 3M57A 4C92D 4HAMA 2HQNA 2DT6A 3MEWA 3O5ZA 1YFNA 1VI0A 2NS8A 1U49A 5DD4A 1EF4A 4RAFA 3AG1H 5CYVA 5D5XB 3GTGJ 2KGTA 3VS0A 1P92A 1G15A 5HRNA 3MHXA 5GMKj 2DO3A 3C2GA 2IGIA 4FVMA 2LRDA 4UB8C 5FLXO 2JPCA 3CJ1A 2JVHA 1USTA 2OU2A 4ZTJA 4ITVA 4M7AD 2H1LA 4DZJA 1K7AA 2FPEA 3KLIA 2M45A 1HX1A 2FBXA 5I3UA 1IRZA 2LG4A 1D1AA 2PMZN 3V6DA 1WNSA 1H9GA 3JB9F 1VSFA 3K9KA 4YORA 1W7PB 3UPUA 4R1HA 4RCBA 3VOEA 3OA6A 3QJYA 4M78G 5GAMe 3V81A 1QQNA 5BN8A 4BQQA 4AIKA 4CJVA 3G71A 2HZYA 2J05A 4DUZK 3EYYA 5KVRA 3QIOA 2QXFA 1F4KA 3T5XA 3JXUA 4YOTA 5IP9J 1JLEA 4AIAA 1YBYA 1E3OC 3SK3A 2LP0A 4KITB 4CJQA 2D0PA 4XN3A 1TK8A 2IVOA 1TQIA 4H5TA 3G73A 5E1ZB 1X69A 2OTJN 4K0KK 2M7BA 3ZMVA 4P5OA 1KU2A 4B6MA 4UV8A 1T3SA 5AN4A 1M90C 1RKTA 4DU1A 2HBMA 3KTUA 4BJ6C 4N0AA 4JJNK 2YNGA 3QPTA 2O8EA 3H3NO 1W36C 3BQYA 2R5MA 4PSXA 3VJPA 4NC6A 4K2EA 1QVGS 3HOUJ 2CUJA 1LVKA 5TRDA 4R8HA 4N56A 4IQ4A 1SG5A 1IF1A 3LX7A 1XX5A 1OR7C 1NLVA 1QVPA 5FROA 2E19A 4PJLA 4RW9A 1RAIB 2EB7A 5M5WJ 2WY7Q 2XDDA 1KC8U 2MYSA 4W1UA 2ECCA 3PGGA 3BR3A 4ZGEB 1SL1A 4HTLA 3DLBA 1T56A 4UVAA 4CA0A 4EHTA 3AL0B 4JRPA 1SD5A 5IOYA 5LL6Z 1VSEA 2HW3A 4JZ4A 4GMJB 2VQEK 2L9NA 3PNTA 3EFOB 1SRMA 5LJ5d 2STTA 3UATA 5GPCA 2FQ4A 4IFYA 1Y0NA 1YVUA 2K4BA 2BUDA 1OX8A 3M8QA 5DD8A 1PUFB 5C24A 1ZSZB 2PJPA 2YHTA 2MLKA 3L0QA 3VQCA 1YS7A 2AP1A 4CJ7A 4TSXA 4OO1J 1YO5C 1OPLA 3UB5A 4AHVA 1N8RR 1OFCX 1E3PA 3C95A 2E2JJ 2V8JA 2OAZA 5JLFA 2F5EA 2EHGA 5D6FA 1H0MA 2K57A 5AT1B 2QGGA 4GLMA 1L0OC 2ABLA 3TKYA 1EQYA 1E6GA 3MQ0A 1OCPA 4O0IA 4KMUX 1WJEA 5BPLA 1F9NA 5TJJA 1K9AA 3AG2H 4JDSA 4CUGA 3HC7A 4BI8B 1IGQA 4JI1K 1VQ7A 3OYDA 5J1EA 4LD0A 3GZ6A 1YJWA 3LOCA 2JW4A 2DK8A 1ZHIA 4PKIA 5C10A 3UIQA 1BIAA 2KT0A 3ZX3A 1Q95G 2V7YA 1WBDA 1U06A 4E7HA 2XPVA 3F73A 1RI7A 3FBIB 1KEAA 3CQZJ 4X62K 2O88A 5CQGA 5GAN2 4B3TK 1SAXA 3CXCP 4C2MJ 4M7AB 3MDQA 4UVCA 1UG1A 4NDLA 3CC2Q 2F2XA 1K78B 1ZBJA 3RBBB 4F2RA 1X6GA 2ZGWA 4Z4GA 3UNGC 2D1KA 3QPHA 1FEXA 3HSTB 4FZYA 3URGA 4DGWB 2XI9A 2IT0A 4ISGA 2E2HJ 1S3XA 4CCKA 2LCCA 2DBKA 3MEAA 3OW2M 3TW6A 1VQ6N 4RTXA 2KLOA 2KIQA 2FBIA 3HSFA 4DR7K 1B34B 2A28A 3QYHB 1OH5A 4BH9A 1F43A 1VRUA 4QIWN 4RCCA 4EEFG 1VQ5I 3S1QJ 1JCEA 2CG4A 5M1OA 2ZJPL 2PQWA 5FB2A 2VGNA 3QP6A 1EH8A 3CCRI 1XSXA 3UT1A 5E26A 3M5AA 1QS4A 4O5FA 3DBHB 3FWEA 1P7JA 4CHYA 1R49A 1YWOA 4B1RA 3HVRA 3I55T 4HUGA 4CGJA 4LH5A 1WJDA 3M6GA 3F22A 3TDZC 2C6YA 4A4KA 1K61A 3FZHA 3VOVA 2LT4A 1KGSA 2CP0A 3CCLA 2EYQA 2AQEA 4M3UA 2VI6A 1QWFA 1D8YA 3E7LA 3I56A 1LDDA 1ZA1B 4Y33A 2RC4A 2GWJA 3WNFA 2W48A 3VA0A 1FX7A 4O3MA 3W3CA 3HPWA 1HF0A 4G6DA 1K9MC 5K7HA 5AZIB 5C2FA 5HOOA 2CYZB 4KT0E 5A0LA 4MTEA 3I0RA 2YNIA 4EVIA 3CJBA 1DDNA 4BXFA 3ID8A 4DF8A 2HVHA 2VODA 4ELZC 3KP6A 4YFUA 3DB3A 3META 3LDOA 4IZ9A 5BPMA 4JI0K 1RI9A 3FXMA 5AQWA 5GAGJ 3BCAA 1ORPA 1JUSA 2X78A 3BJOA 3SWNA 5HP1A 3CCRN 2BDPA 3HYIA 3TAGA 3CP2A 3I54A 1WI7A 2GA2A 1K73O 5E3NA 4J00A 1W4SA 4CEEA 4M3WA 2C0IA 1NOYA 3I3LA 5FKLA 3ASMA 1XNIA 1VZ0A 1OMIA 3VQ8A 1S1TA 4E6KG 1KQ0A 4XTVA 4QCLA 1R23A 1XGNA 4C8QA 3R2XC 3CDIA 1LWVA 3GP8A 3LL3A 1LCUA 4JOMA 3RR7A 2BY1A 3E5UA 3FZLA 1VQNT 2P51A 4CFAA 5DS9A 2P5GA 3HGYA 3E66A 4BQAA 2OC6A 1XS9A 5GTIC 2E5LK 3M4YA 3HG9A 3IC7A 2ZJQL 2FRHA 4I6MB 3BTLA 4JJDA 1S72I 4F7UB 3REAB 2D0QB 1YJ9A 4M7DA 4OVLA 3L4QA 2KZZA 4YOXA 5I2SA 1OULA 1XJWB 4RB2C 2LR8A 1KRPA 1KHCA 1NMDA 1OCCH 3JW4A 1BOBA 1C1CA 1N39A 2L89A 4NUBA 5ICEA 4NB5A 1UHFA 3ZCOA 2R3SA 4L59A 1RBSA 1AEYA 2MWOA 1NGAA 3C7JA 1Q82O 1Q7YU 4AQYK 5M1PA 2JVGA 5LJ3j 2EWSA 3NFAA 3HOTA 3R60A 1Z26A 3I55Q 4MLHA 2ATCB 5ICGA 1SS6A 1O57A 4XQFA 4RLQA 1U2WA 4OPKA 5GAOp 2WB1A 3E9OA 4Z4HA 5LLQA 3N4MA 3FHZA 2NRXA 1FXXA 1T0JA 3I5SA 2R7SA 4IUQA 2KAFA 4EMSA 3AA4A 3ASKA 3WGGA 3JREA 3M8JA 3F8NA 3JSPA 1FMVA 5E17F 4ZNXA 2QA4A 3H0GJ 2RI3A 1SD4A 1OVQA 1M3CA 4Z4CA 3AVKA 3J7YJ 1T0FC 2J6OA 2RA2A 2KROA 4H8KA 4BRDA 4FLUA 5E3MA 4CHUA 4UUSA 1AWWA 1BKBA 4DTXA 1QSLA 4ETSA 1WQ7A 3K10A 2WAQN 3MKDA 1C0TA 2LH9A 1PD1A 4JN4A 4EAHD 2F8TA 2K9NA 1K76A 4BWJA 4A3LJ 2R5AA 3F6VA 1GBRA 3W6VA 2D0OA 2MD5A 3DBRB 2IIMA 3PIOA 4F9OA 3CCVT 3QZ5B 4FWPA 3RCOA 4QAGA 3G10A 5ILSA 4R56A 4FLVA 4ESBA 5LJ5h 5AQUA 1GFCA 2G8HA 1VQNQ 5KCHA 1LEBA 3QWXX 4A4FA 5KCOA 3ZCMA 2SRCA 1RTDA 1O3SA 3RZOJ 1YI2I 1NK9A 3JB9G 3JRZA 1IDYA 2Q2EA 1NGGA 1Z21A 4A3MJ 2VE8A 1NGHA 3VB2A 1P6RA 3H5AA 4JLHA 3LSGA 5DMRA 1RUWA 4HVJA 3IAYA 1YG2A 1NHAA 2KHOA 4HLXA 2F9TA 3S1RJ 3VU3C 3EUHC 3QBWA 1Z6TA 1OPKA 3Q1JA 5E8IA 2JTMA 3THYA 1U78A 1R7JA 3CCQT 3OW2S 2OTLN 5ILUA 3C18A 4RB0A 3J80O 2HQXA 1WLPB 5CKFA 3H1CA 3NWTA 2HFHA 1D8JA 4GVMA 2RV8A 2VKEA 3RVCA 1SKRA 4NCBA 1JLQA 3A03A 1C0WA 5IN1A 1IV6A 4PNOA 4DV1K 1J6ZA 2FE3A 3SYZA 1X9WA 4BI3A 5J1UA 1YJNN 5CKDA 4IHSA 2ZPIB 4LG0B 4CEZA 2J7IA 2PI0A 4FM0A 2MF2A 2EYWA 4AHSA 4BGAA 2FYKA 1OOTA 4J9EA 3D4VA 1ONVA 2M4GA 3CCVI 4CF2A 3E6MA 3EGDB 1YI2N 4MFDA 2Z9OA 1WI3A 3AVAA 1FN7A 2DJQA 4L6V5 4CXFA 3LA7A 1ZR4A 3DLLA 4DJAA 2FL7A 3ZSWA 2AS5F 2WONA 2PYJA 3S6IA 2HHSA 2DLPA 2LVMA 4M77A 4YOQA 2ZMEC 2YCHA 1M90U 2EJRA 3ZBDA 4HXJA 3WTWC 3M0TA 4XTUA 3O2PE 4QLCU 2L3QA 2X3XD 5LMUK 4IQJA 2P9SB 2R5YB 5CZ2A 3CC4N 2MH2A 1B9MA 3KP3A 3VQ6A 3BQZA 2ITMA 3D5RC 4PUSA 3O6BB 3ZQFA 5HRRA 3ZETA 4CHPA 2NNYA 2SEMA 5FLXE 1PYVA 4ZYGA 2XF7A 3ZEHA 3CCQI 1HDDC 3H6ZA 4I01A 1LJ9A 2I7PA 4KUMA 2JRMA 5EG0A 4L9TA 5FO5A 1K9MR 2B8AA 3J7AY 5L3FA 1ASWA 4CCHA 4CZHA 2NOBA 2PBDA 4EM2A 2M0MA 4II1A 1NLPC 5EY4A 2XAFA 2X4XA 4AHUA 3A02A 3QYFA 4DTNA 4M78D 2DNUA 1RBUA 1BC7C 3AVJA 2O9VA 3PUFA 4NQWB 2L9VA 3Q9SA 3AVGA 2HOTA 5HKCA 3VMFB 2VG6A 3R61A 4M75A 1M1KC 1QO0D 1Z7LA 4E1JA 4BD3A 1BUPA 1C6VA 4IRIA 3PV8A 1EBMA 4FWLA 4JI4K 2P9LB 1P9QC 2DFEA 4MFBA 4Y13A 4XSXF 3WEEA 1EP4A 3RWUA 1PSFA 4YFKF 5DLQE 5GAGP 1R5GA 4BRNA 2AT1B 1W9HA 1I81A 4IOAF 1QU3A 2YT6A 3EUKL 4ILGB 2HKQB 2HMPA 1WJQA 2OF7A 4MEXF 3C6AA 3P1GA 3EUAA 2QASA 2RK2A 1RDBA 2AO9A 5LJVA 2K79A 2YRCA 4MIMA 1WSUA 2F9WA 3N4PA 5JVTA 3VTIA 1BI0A 2KW4A 2IGMA 4FJXA 4GBQA 3P8BB 2FSKA 1VQ4Q 4JP0A 3IP4B 3W2VA 4FT4A 4PCQA 4HSTA 1ACMB 3K5NA 4ICLA 4Y28E 4KMFA 4OKJA 1X3MA 4M7DD 2CQQA 4CSWA 4L3QA 2ACJA 4FSXA 3REBB 2E2QA 4QPOA 1KAXA 2PLYA 2RQQA 3GFJA 4BL0B 2OPTA 2VWBA 4IUPA 3MMVA 1RBVA 3MN5A 1W0TA 7AT1B 2YWWA 4FQGA 4HPQA 4C8NA 2FB7A 1G6NA 3BR5A 2QQ8A 4C1NI 3SNNA 5CK9A 4XEIA 3B6PA 2XF5A 1MJBA 3KP7A 2E6MA 3G6EQ 3U2RA 5AFUH 4B3RK 2DYRH 4IO9F 2DQRA 4LC9B 1VQ9A 4JRQA 2YJFA 2B6AA 2IPOB 1HYZA 5GMKl 3CQYA 3S1NJ 3ZLJA 2L4MA 2OQGA 4PDKA 2R7UA 5FLVA 1TTYA 3ZQHA 2Y9ZA 1X27A 3LSHA 3S2WA 5F6FA 2YHWA 5HVQC 1LWFA 3DWLE 3HOYJ 4ORZA 2DRMA 4CI6A 3VW4A 4KICA 2V8KA 3O8VA 4II3A 1E4FT 3G71I 2O2OA 5GAOl 3T8RA 2WY8Q 4ZHRA 4CCJA 2P5OA 2DZCA 3I33A 2MAMA 4ZC3A 2YPRA 2A6AA 3J7YP 3INZA 3HM9A 5ELZA 1H8AC 1KG4A 1E2XA 2YX7A 3FRNA 2EILH 4KISA 1WHMA 2Y4XA 3IH4A 4JI6K 4MO7A 4IDHA 3PSFA 5LJ3f 5D4SA 2IEKA 1Y0MA 3BG5A 2OUMA 4A3BJ 1SL2A 1NH3A 1E4GT 4AFSC 2XMFA 1NGFA 3ZN0A 2RK1A 3QAHA 1FBSA 1SKSA 4M78B 1ZR2A 3GW2A 2NRTA 2ESWA 3BTIA 2JJ9A 2PFBA 3U4LA 1YHQT 3QO9A 3OJSA 1YJWT 3NHGA 1I1GA 5JR3A 4C5IA 2OQRA 1T6SA 4M3TA 2DRKA 2V52B 3OYYA 2BW3B 2E4LA 1CZBA 2E3IA 3CETA 3D5SC 3TTFA 2NYSA 1WCMJ 2RI5A 5J40A 5C4XJ 3O1WA 4DV4K 3SMPA 5KYWA 2M7AA 5DDGA 1IUYA 4HT8A 1SHGA 3D5LA 3TAFA 1LFUP 4H0YB 3HFNA 1NMNA 3OV8A 2GOMA 3OGDA 4OMZA 4DTOA 1L3SA 2I0NA 1SD6A 3SAHA 1KQ2A 3CTAA 5HNHA 3KFVA 1G3WA 2DA2A 5GAN5 1M2VB 4NL3A 1YQMA 5D6YA 3CMMA 3T1YK 4FWSA 2VIXA 2X6OA 3VRYA 4IPAA 1IBMK 1WSHA 2XAQA 1HSJA 3G6EA 2Y69H 1X1BA 3UKUA 5K5RA 5GAHJ 1C1AA 1QHTA 5LJ5g 2CMPA 4LUEA 3ENOA 4DTSA 2A42A 2EJ9A 1HQCA 4KBOA 1HSQA 4PL8A 2DE0X 4WXHA 3QWYA 3SV4A 3CCUN 2KYBA 4BY7J 1WSEA 1Q1HA 3BZKA 2H27A 1LB2A 1Y97A 5JMVA 4DU4A 1S1UA 2QQAA 2OJ2A 3VSLA 1XMXA 2FBVA 1UGVA 2D1VA 1VQ7I 4AFUC 3A1PA 2CQ7A 3SUNA 2XVCA 1YJWI 4M77D 3EDPA 1CF7A 3ZT0A 1OYXA 2QM1A 3CCST 2NOEA 3FXQA 4HV6A 4PA1A 5J47A 5AQPA 2MA3A 2FUG2 3I9V2 2D4WA 3I56T 5CLSA 3CD6Q 1XQPA 1ZKGA 1YVNA 1PJRA 4GW6A 5AQNA 2L7MP 5KHDA 5L8RE 4IURA 3X20B 4CHOA 4FETA 1WXUA 1YT3A 2F5KA 4BY6B 4IWVA 1TNTA 4DWIA 1Q81C 1X75C 2EH3A 3AVLA 2JGUA 3B8AX 3LYIA 4IJAA 3ZSZA 4TV7A 2A7YA 3KEYA 1BR1A 4AIJA 4LK0F 4M3DA 1U3EM 1MMSA 1CXUA 5KRTA 3LAMA 1M1KR 2A1RA 4JUVA 1T3LA 2VPRA 2MABA 3V1OA 1WZ2A 4RA2A 5AQRA 4MEYF 4Q5SF 1QHHD 4CJ3A 2GTOA 4ATOA 4OPHA 3R8EA 5LJWA 1RRSA 4H03B 1KLNA 5HK0A 1N9RA 2DO7A 1WQWA 3K4MA 3DB4A 5FLXK 4MMLA 1LDJA 2G7HA 2FSWA 5AIPA 2ZSIB 5GANh 3TMOA 4BEHA 1B8IA 4B08A 3VS2A 4I02A 1YITQ 3VQ5A 2IS6A 4W5OA 4KN7X 4Y7NJ 4V2FA 3KZIC 4UHTA 1XCBA 2Y48A 2K9GA 4ENJA 5DM6F 2ROLA 4O44A 1NG9A 1FWZA 3ZSYA 1NJIO 4XIUA 2D0AA 3CCLI 3FZKA 3VODA 1YJ9T 2HF4A 4II2A 3I56I 3NVMA 4BRGA 4XLCA 1TW3A 4M6XA 1SVOA 3ZN1A 4KRTA 5EGOA 2HNDA 1J0RA 3VYGA 3FZMA 3G1MA 4I9LA 5FKKA 3RYRA 1IN7A 4HW0A 5GAEP 4FCYA 3ERMA 4XRSG 1XQOA 2CW8A 2BTFA 1K8AC 3MKZA 3U8XA 2COYA 1MDUB 5JI6A 2P9LA 3EFRA 4YOYA 2RMOA 3AA2A 3CCSQ 1OYYA 2EVRA 3VTHA 3DRPA 1XSDA 1G5VA 2E1ZA 3O1BA 1WHKA 3HK2A 1I8FA 3ZSRA 3LSPA 5FD6A 1X1AA 2KRFA 1TL8A 5CCAA 1I3AA 2DAQA 2GXGA 2ENMA 5KPRA 4PUOA 3LDPA 1A35A 2XDPA 2A36A 3FJPA 1J7KA 4Q4ZF 5KN8A 3RR6A 2KSSA 3DFGA 3P31A 3MEUA 2YUPA 3JB9D 3V9XA 2QWPA 1G3TA 1OYIA 1FP2A 3FXKA 2JQ7A 5GJWB 4CYCA 1T2KA 1L3UA 1RILA 2C0OA 3LPTA 2GBQA 1KA8A 1U5TC 3RQIA 1OCTC 2PJRA 2JUCA 2B9SA 1JQQA 3EG9A 1VQKA 5KYXB 4EA5A 2A3ZA 2XSDC 3AVIA 3M58A 1VIFA 2KT1A 5H6QA 3KYLA 4DS5A 4OGCA 4M9ZA 1LMZA 4JI3K 1V5FA 4OMOA 3D0PA 1UMQA 1UTIA 3CC2N 2F2VA 2DJIA 4KH1B 3G4SA 3J80E 2F5VA 2G8WA 2VXZA 2QBYA 5EC7A 4X66K 3AAFA 3EO3A 2QGFB 5AQQA 1WHHA 2F5TX 3PVQA 2KXDA 3LA2A 4ILJA 2RHUA 1WHJA 2XKOC 2EQJA 4E9FA 1S6LA 4FE7A 3CWAA 5D8KB 2RVCA 4CF8A 2ZXWH 3KIOA 4C5HA 2AQFA 3BPVA 3ZT3A 2QA4I 1E7OA 2J6FA 5CE3A 1VQMQ 3H0IA 3HSRA 4BWMA 4A0ZA 3PY8A 3GYHX 5FKNA 1O75A 1BL3A 2XY7A 2CH5A 1Q9XA 3FMQA 4HV5A 5L23A 2XU8A 4CZEA 3H1QA 2HKXA 3KHYA 3ECOA 2XY6A 1V54H 3MAQA 1Y71A 2M9UA 4IRGA 3JCMg 1PP8F 4M9XA 8AT1B 4HCZA 4X1VA 3EHRA 4CJEA 4A5AA 3WG7H 1P59A 1FK9A 2LNVA 1DGKN 4BB7A 1XHZA 3TSWA 4FYVB 4GKKK 3LLRA 2VBWA 2HBJA 3LDLA 3TABA 3A8MB 4F16A 2PU9B 5J8FA 1L3TA 5AQJA 4IXAA 2D0NA 5LHHA 3J80Z 3A8LB 3G0ZA 3F3XA 2GGRA 1VQPA 4PFZA 2YV0X 4HX4A 4A3FJ 3AARA 1AKHB 4XR6A 2EFQA 4CCMA 3UR3C 5GAHP 1MBGA 3CCEA 1GLEG 3VQ9A 3TW7A 3LSRA 4AM3A 4DSLA 1M1FA 2ZMEB 2D0BA 1BN5A 3WVDB 2ZB9A 5KI6A 1WWXA 4DV3K 3L2VA 3M53A 3U9ZA 3MAJA 4WQ5C 4BRLA 1HYSA 1Q86O 2LY9A 4XMYA 1M2VA 4CF1A 4EVVA 4OPJA 2X4HA 1T8EA 1VNDA 1PDNC 2NVUB 3WTVC 1BOAA 3WXKA 1B7TA 1W2BA 2Y9YA 1M3HA 2QENA 4UNFA 2GV9A 1ZG3A 2DAOA 1DU0A 3NFCA 1TT5B 3AKZA 1M3QA 1Q81R 5GAOr 1U2VA 1IBKK 4HQEA 2RHYA 2IS2A 5FFXA 2M9HA 2ISYA 1KTQA 3U1DA 2Q0RA 3HOZJ 2I10A 5IYBJ 2YX6A 1TL1A 1N75A 1QZZA 3NHNA 4DK9A 3E9PA 3FKIJ 5LRSA 2V79A 2LCLA 2LJ0A 4CVNE 1W7AA 4LF4K 2JA2A 3RDIA 1A6QA 3T8TA 1IBLK 3S6WA 4D0PA 4E70A 5D5VB 4L5GA 2ABKA 4F3OA 2K40A 1UG2A 1T6DA 3MFKA 4CJFA 4C0GA 1JKHA 2KL4A 2KJCA 4GY5A 4LMYA 3KTQA 2QSFX 4DV2K 1SPKA 2EJFA 1IN6A 4AIDA 1FLIA 2HBWA 3GCMA 4RDUA 1X19A 4EJUA 1X2MA 2E10A 2BXZA 3NE6A 3E6DA 3BG6A 1Y96A 2L8DA 4NLBA 3MCZA 4A93J 1YIOA 1I1JA 3GX4X 4CHZA 5C44J 2KDSA 3M56A 2X35A 3X28B 3G0QA 5IPAA 4RMNA 3I55N 2QK0A 2OYQA 4CJKA 4MFEA 4I99C 4IUTA 4HEA2 3K9TA 1MV0B 1HJDA 4A5NA 3ITHA 5E3LA 3SB2A 1SEUA 4GKJK 2IBDA 1A6IA 5JVHL 5K5QA 2ECZA 1ERDA 4LDVA 4ELUA 2NUBA 3AO3A 4ZJZA 4U0YA 4JK8A 3OYGA 4E3SA 2DYBA 3L1AA 4JK9A 3P9CA 3JSCA 1PRLC 3JCUC 5GANg 5CYMA 2HL3A 3CI5A 2B5JA 3PVLA 1EXQA 2IS3A 3A01A 3RESA 2R7QA 1ETYA 1IXDA 3OS1A 3L2CA 3OS5A 2D6FA 2GM4A 5FKMA 1XWLA 3NAUA 1U6GA 3N05A 2IA2A 3ZOBA 4MHGA 2EWNA 2STWA 4DFPA 3MKYB 1ULYA 2EZHA 2P0WA 2FNPA 4X9CA 5IT9E 4DOZA 1WXTA 2OCEA 2OZUA 1WEFA 4I09A 4M3BA 4B9TA 1G8XA 3MEGA 5KH6A 1MBJA 1VQNN 1CZAN 4CGDA 4IOCF 4LF5K 4BRAA 5GTHC 5CYQA 4AH9A 2GX9A 2RNJA 5K14A 2HU9A 2Z2SB 4ZN1A 2BTTA 1VQ8T 3AAPA 4XLFA 3PFYA 1S5JA 3W0LA 3VF4A 1JJ6C 5CVIA 5GAMj 4D1QA 3LM9A 2MSYA 1Z67A 3CC7T 2QVOA 4F93B 4XORA 2Y4YA 4E1MA 4FM4B 1TP4A 3IAM2 1W5TA 3WTUC 1P4AA 2L3RA 5JVGL 1BU6O 3F8MA 2CGLA 3DLAA 3F9KA 2ICWG 1AWOA 2XIGA 3LFKA 2A0FB 2GWRA 2L5QA 2YG9A 3CLQA 4BY1J 1L3VA 2KIFA 4HOBA 3BW1A 3ERED 4JKBA 4B1ZA 2GUPA 3DTKA 1V4RA 5A2QO 3ZMTA 3CPWA 4P96A 3ESWB 4FJGA 3BG7A 5CQXA 1X58A 3QEWA 1VQ9I 4LY7A 2CV1A 4G7ZF 4M7XA 2BH1A 4CZZA 4DEYA 3PT9A 2P9UA 4BC5A 4DW6A 4ZH4F 2VT3A 4FISA 3X2QH 3QFUA 3CESA 2Q3SA 6PAXA 1Y6IA 3ISPA 5CKEA 1M1GA 1WJSA 3FBNB 3ABLH 3TEDA 1X2QA 4KFCA 1T0FA 3OYFA 3PQJA 3L3UA 5FGMA 4R5PA 3RR8A 2FSNA 5HRSA 2JS0A 3JRAA 4XBFA 4XTZA 3P38A 4XK8E 2AHQA 1STZA 2M02A 3CJAA 2FZGB 1KG1A 3HOWJ 3K70C 3J80K 3RMDA 4HF1A 3O9UA 3VN5A 3SHWA 3ML6A 1QA6A 2IVNA 2A3SA 4KNYA 1V29B 3C4SA 1YOVB 4X1EA 1HKTA 4JPBW 3LH5A 9ATCB 4M71A 4BQNA 3EZWA 1LWWA 1J75A 2JUGA 2VOPA 3CVSA 3WTTC 4CZIA 2HEOA 2V6EA 5C25A 2PMZA 3EPZA 1OYWA 1KD1O 4MGRA 4DUYK 4OVAA 3SJJA 3LWHA 3O08A 4FJJA 1LNXA 3LSTA 3TDUC 1Z91A 2LQWA 4UNOA 1R58A 1K8AU 4I7FA 3DU5A 2BEOA 2E12A 2JA7J 1ZHFA 2DCEA 3RRHA 3M8RA 3CXCM 3QU3A 1VQ4I 2NWMA 2ZGYA 1SFUA 1WEIA 1ITGA 4FT8A 2P8TA 3DKYA 3O6WA 3O80A 1JLBA 3EUHA 2VUBA 1ZBIA 1VQ8Q 3JCMQ 3Q7CA 4IIOA 2CSIA 3OYNA 2VJIA 3TL4X 5GMKh 3H3ZA 2CO5A 2UUCK 2E1NA 2ZPGB 4R0KA 3G1LA 2VBXA 2KNBB 1DJ7B 2YUNA 3WXLA 2DXIA 3S8PA 2OTJA 4RG8A 4AI5A 4JD2A 2MLGA 1KXPA 1GT0C 2XRLA 3NTKA 3THWA 3MXJA 3IH7A 1R1TA 1MMNA 2O8KA 4RAGA 2D0CA 3FEOA 2FMYA 3PNWC 1A0NB 3K1MA 5KGWA 1D0YA 2NUZA 3G6EI 2NRHA 4M41A 2BGCA 1ABOA 5DUIA 2R5ZA 3K69A 3MMYB 4QS8A 2GUIA 3CJRB 1HDPA 1R1UA 3VEVA 2E2NA 1LUJB 3AO1A 1YWPA 1ZX6A 4NYNA 2M34A 5IP7J 3MEVA 1UAXA 4MNUA 2MBFA 3CMEQ 2TRTA 2LT1A 5LJ3d 3DEUA 4E7IA 3DOKA 1VQ4N 2RQTA 2CP7A 4FL6A 3TTCA 3EZ5A 2ZMEA 1ATNA 4NLCA 3P5JA 1RAEB 1JUMA 3SFIA 2HHQA 3LQRA 1WGXA 2DILA 1NJYA 1Y57A 4HVUA 3RSNA 1KIKA 4IKFA 2VWKA 5LD2C 5DLOA 3A8HB 2V9VA 3VENA 2HHXA 4RGXA 3A5OC 5JS1A 4BJ5C 1DPRA 2CS3A 1F5TA 1JL1A 2UV1A 5J26A 3KLEA 3B73A 1OEBA 2ZQBA 3IRQA 1R0AA 1HMVA 4HUFA 5FU6C 3EYZA 2F5CA 1IKWA 1RZ4A 1AU7A 2YHXA 3P9IA 2E8AA 2EK5A 3G6EN 3LQQA 4A12A 1DP3A 1HK9A 3S3MA 1ASUA 3CPEA 2DT5A 2BV6A 1I5LA 2PYLA 4NHJA 3HTRA 4RAYA 2HD0A 2W00A 3Q0WA 5K5OA 3PIPF 1S1VA 3DAWA 1E0EA 4P55A 2E6ZA 4C92G 5HK3A 4YPHA 1NK7A 2LSNA 5DCMA 3MO8A 2VQLA 4N9IA 4CJRA 3GFMA 2ADUA 2V4JC 3ZQCA 3MWTA 3AT1B 3VERA 3KJVA 1U45A 4JYAK 3Q5FA 2XHBA 3RKQA 4N4IA 3SDZA 1JU5C 2IIRA 2IJLA 4DTRA 1GVJA 1VFCA 3MXMA 5KE3A 4FJKA 1FC3A 2C0TA 3H36A 3E0JB 2FA5A 2VV5A 4LLLA 1VQOT 1S6PA 4DU3A 2R92J 4DMNA 2HKNA 2E70A 1WA7A 3W3DA 1G83A 5JLWA 3NH0A 1UHMA 3SXYA 1LE8A 4K8ZA 2O4XB 2A07F 1FSEA 2B0LA 4FYXB 2M1HA 3VEWA 5DTDA 2FLOA 2GEMA 2Q36A 2KZGA 4DIQA 3M54A 2EIKH 4UV9A 2P5LC 4OP0A 4WFNL 3CF5F 3AVHA 3RRGA 2A5YB 2LY1A 3W2WA 1WSFA 3DOLA 1VQ6A 3VQDA 1JHHA 2NVQJ 4ASNA 3U3GA 2EQMA 1VQKT 2H8WA 2JTEA 3QDFA 4J2AA 2JN6A 1I0CA 5M3FJ 2M5WA 1BA5A 5BRDA 1KG6A 1D1CA 2NVYJ 1VA7A 3NCIA 1A36A 3SUOA 2ZSHB 3DXKA 2FZKB 3QQAA 2WACA 1ODDA 2RDPA 1ACIA 4H0XB 3AO5A 5AQOA 1WN7A 4E2FB 4HDUA 4MMKA 3G4ST 2HTSA 4HCCA 3A2KA 1GL5A 4WCIA 3OMYA 2DFIA 2DJNA 2LF7A 2O01E 2X9DA 2ZNYA 2CP5A 4ANJA 2GTDA 1NM7A 1NK2P 3TAQA 3VQPA 1W0HA 3ULRB 4C2UA 1ZSZC 2EX3A 4XONA 3HOVJ 4BNCA 5M3MJ 1N8RO 4L5JA 2XSJC 3S17J 1NK0A 1XNRK 2O9LA 1VYTA 2X51A 4BBRJ 1HW1A 3KXTA 2DL8A 3EH1A 1S7OA 1KFSA 3H3UA 4ZYAA 1JLCA 4AVPA 1VQLT 4PJ0C 5EEAA 1B72B 3OIPA 4C92C 1KVAA 2E1YA 3T9NA 3KNTA 1T3VA 1OU9A 3B02A 3MK6A 3K0SA 2P4TA 5LFAA 4OIRF 1S8NA 1HLUA 1DP7P 3EE8A 3BEXA 1CZ9A 4XKVA 2M4KA 1VSMA 3F70A 2LP5A 1SANA 1Z3XA 1FYKA 1VQKI 1SSFA 3PO3J 1OJLA 4JX4A 4A54A 3CXCS 3LWMA 4YIRX 1TTHB 2J06A 2E2IJ 2L3DA 4K42A 1OISA 2O8DA 5EXWA 2OI3A 4AG1C 2HVSA 2ESHA 3UKRA 5AQTA 4M7AC 3CD6N 4FVUA 1UB4A 3D1NI 1KQSP 4PJOF 2YLCA 1VQOQ 5I42A 1G2HA 2DF6A 3DKWA 3LSKA 1IGNA 3G4SI 1K4SA 1XGSA 1MDMA 1IW7F 2O7OA 1OH6A 4JKDA 4LF9K 3E6BA 4C8QE 1REPC 3PUBA 4CF9A 1W97L 2VG7A 3T1BA 1FBUA 3R9PA 2EJGA 3O9SA 1R8OB 1RACB 4YELA 2FBKA 2RN7A 1YHQN 4FJMA 5CKTA 1MUDA 3QWLA 3QINA 2CUBA 1L3LA 1I3QJ 4QPQA 2CW7A 2R7TA 1GBQA 2K3PA 2ZJRL 2DPPB 2XG8D 1FKOA 3JAMZ 3MD2A 3CFRA 1KC8C 2DPUA 2W41A 1YAGA 1VSJA 1Q9YA 1UGQB 1A5WA 1GV5A 3QESA 1WKMA 1GCQA 2JPSA 4A59A 2F4IA 3M5RA 4D5FA 1FKPA 3JCMV 3DP7A 5J1YA 2EFWA 1RDWX 3ATVA 2M1BA 4RGSA 2UXDK 1YITN 5DM7F 1OCRH 2EPFA 2V1UA 4KH4A 1LFBA 1QVFA 4B22A 1WSIA 3KD5E 3LP0A 5DM7R 4BDPA 2EQKA 2Z1JA 3SUPA 3X25B 1TKTA 3K58A 3VGKA 4L5EA 2PNIA 1VK0A 1VQPI 1QP3A 4IHYA 1T7PA 3NARA 4CCOA 5J2QA 1RUOA 1VQLQ 4OAYA 5ICCA 3OYBA 3N5NX 3TPQA 4CCNA 4FXDA 4F2SA 1PHTA 3EHQA 3CCEI 2DODA 2HF3A 2FEIA 2O8CB 3LSMA 2VQGA 2KQWA 1HNVA 3QO3A 2M8EA 1P8ZA 4N41A 4VUBA 3K6GA 1UEBA 5CHZA 1XD7A 4BRQA 3K2AA 2WAQA 3MECA 1WI9A 3FJ5A 5LJ3h 1MSEC 3CCSN 4CECA 2IGNA 2QWWA 1NWKA 5F0HA 1BK2A 1W4MA 3ZSOA 3PO4A 5I9EB 3C2BA 1B1BA 2FEZA 1HKSA 4UC4A 3SFMA 3WXJA 3S14J 2M87A 3FGUA 1QZ5A 4E89A 3EL2A 3KUFA 1MNDA 1IUFA 3IHUA 2TDXA 4CGFA 3FLCO 3I8BA 5KQDA 5AQVA 4L8RB 1U9OA 2PFUA 1DTTA 2QKMB 5HBMA 3TARA 3ZQ7A 1B9FA 1RAHB 3LALA 3WGIA 2P4WA 1A04A 2IA1A 2K2VA 2R7DA 2OAUA 1ZYQA 1ZH5A 1PC0A 4DQ2A 2DN0A 3T3FA 3H92A 4I9QA 5E20A 3AG4H 2AKLA 4ELYC 2NUPA 3DYAA 1X1DA 4FOEA 2BZ8A 2YX4A 1M3AA 3E19A 3GOXA 1U48A 2IXSA 3VV0A 3I4MJ 3ZT2A 3M0SA 2NRZA 2OTLA 3MZ8A 3KKSA 4CBUA 1WFXA 2HZTA 4B3OA 2VBZA 3HP9A 1YTUA 3ELKA 1BIUA 3IFRA 3PIOF 2UZKA 3TAMA 2V7FA 2KRMA 4DSIA 3WTYC 3S1MJ 2QEXQ 1QMCA 1LJOA 1D1BA 3RMAA 1QHAA 3CFPA 1YJNA 1O13A 1BIBA 3DXJF 3UE5A 2O6GE 5D3GA 2HOSA 4XU3A 5EZGA 3C3WA 5A2QE 5CKBA 1BWFO 3K59A 3TSQA 1UOCA 2R7FA 4LE9A 2M30A 2BANA 3RSEB 3J7AF 2E7WA 3NPFA 3H3VK 3JB9H 3X24B 3BR1A 1VQMN 1K73U 1WRJA 2NLXA 2MOXA 1K8KB 3EGUA 3HKZN 2DIQA 1UHCA 3PLAA 1K6YA 3HTUA 2RJEA 4I2PA 3CC4A 2QI2A 3QSUA 3HFOA 3TANA 3OIOA 3RPQA 4J19A 3LH0A 3DM2A 1OCOH 3FXOA 1ZREA 3BGRA 4FWRA 2OANA 4WXCA 3HRGA 3CW7A 5DCFA 2QCOA 1X43A 1ZK8A 4Z02A 4V2SA 5GIPA 1JXEA 3ULEB 2CP6A 3NDKA 3VPZA 3GLLA 2PZ1A 2BE9B 2XDVA 1S7AA 2CGKA 3A4CA 5KYYA 1B92A 3HKSA 1PU6A 1NG2A 1Z25A 2XC7A 1SRLA 5IT3A 3CCMQ 3EEQA 3CMAT 4C8OA 2JWLA 1R4MB 2Y75A 3LWFA 3VEPA 1B07A 1KCFA 1U5TA 3V9ZA 2IDOA 4IHWA 2JS2A 3CDHA 1QE1A 2QDLA 3CUQB 3H41A 4JKHA 2OPRA 3SZTA 3BZCA 2KK4A 2H6CA 4D9JA 4KI6A 1Q82U 5H2FC 2V7ZA 1XNQK 2X4WA 3J7AP 2WAFA 3MEDA 4IF4A 3FXJA 4M75E 3C6TA 3J81E 1WFWA 3CCJQ 4XTXA 2RHKA 3DLKA 4U7DA 1S6QA 2JA5J 2VPLA 4ENKA 1U84A 2R7VA 3I8DA 2QEXA 5ICFA 1UJ0A 1SZ2A 4ZYDA 4A3IJ 3JRHA 4WE1A 4NCAA 2E5ZA 1YUWA 4CDGA 3BZ6A 4YOUA 1WPKA 1Q7YC 2K9QA 1BI4A 4B43A 3PX0A 2P5VA 3JAMK 3JCMb 4DTUA 2P9KB 1F1ZA 2CV2A 5H1SQ 1GVDA 2NYXA 3FHFA 1VYVA 3A0BC 1QSYA 3NGPA 4J8OA 2QF7A 4LIVA 5CR2A 2W6KA 3TTDA 4LDWA 3JTGA 1NK3P 2Z0WA 2GOXB 4A3JJ 1KC8R 4FK4A 3M1FA 2WV0A 3LWLA 3GIBA 4J6YA 4N9HA 3TEEA 3WUHA 4WTOB 1EV7A 1WJAA 3L8BA 3LDSA 3PMTA 4FLZA 3ZPLA 4CZLA 2JA6J 4KGXB 1TT0A 3CLOA 5LY3A 4CE9A 4EJZA 2F4MB 2EBPA 1RCHA 3DQVC 1RPWA 2CQKA 4RW4A 3O9TA 4M63C 2XPWA 2KKOA 3EFSA 4XH4A 1ZGWA 3J7ZI 4BUPA 2HB5A 4S0HB 5C0YA 1K9MO 1YIJQ 1MJ9A 4JAXA 1ZN2A 3K0LA 3ULDA 1R0CB 4FZXC 1ZUYA 4HVVA 1RR8C 2YUOA 3SZ2A 4NB4A 2R7XA 4OLBA 4O8KA 2HOAA 3TOBA 3L3VA 2WC9A 2QTVA 2F7TA 1ZGJA 1Z1DA 3A2FA 4R55A 3RKWA 1YQLA 4UUVA 3ABUA 3RIRA 3CMAQ 4AHCA 4WQ5A 4F7UE 1AHDP 2ETHA 2P0PA 2F8SA 1RT6A 4BREA 1CLQA 4DR3K 5AQZA 3HOSA 3U9DA 3TCJA 5JLHA 4KH6A 1GLCG 2V1NA 3DLGA 4AUXA 3F10A 2EBIA 2O3FA 4Y92A 2DPNA 1QLYA 3SLCA 2OTJI 1S29A 3DXMA 5FU6B 1QVGA 3EGXB 2WTEA 4FK2A 3OYJA 1YQKA 3A5LC 2X6YA 1T8IA 1D5YA 4BG8A 4AI4A 3BUZB 3ASOH 4RMOA 3RTVA 3I0WA 2QAZA 3QRFF 1WEGA 4WX9A 3MWPA 1M30A 1PNJA 1KHIA 1RR7A 3D2EB 4CZJA 5FWCA 2LFBA 3BJAA 2JVVA 2XRIA 4HNTA 4F7UF 1KU7A 2DI3A 1XGMA 2BHZA 3FZVA 1N27A 1USSA 2ZCFB 5CPRB 1N3CA 1QCOA 1SMTA 1S9HA 4F3QA 2O8CA 4CJPA 2H3JA 2QGUA 2E5KA 4LF8K 1W1WE 2LYCA 1F21A 1M2OA 3A8OB 2JZ2A 4OMPA 2KDZA 1N5YA 4BU2A 1M3BA 5JICA 1ZXOA 2E1OA 5J3BA 1ZUUA 1WAJA 4CESA 3DLHA 5K1YA 4RTUA 2DA5A 4OMQA 2B86A 5LJ3g 3LZJA 2O8FB 1SAZA 2IC3A 2DA3A 2IG0A 4A63B 2YS9A 1RRJA 5IHNA 4HX8A 1JEGA 3CM5A 2DYSH 2ED0A 1YYVA 1VQ6T 4PZJA 3PO2J 2G8FA 1R5HA 4C8QG 4H5VA 2LQNA 4FO0A 2LMJA 1YIJA 1Y8RB 1LOJA 3DEEA 4DTPA 1R36A 4Z94A 4F91B 4XLPF 3I5RA 1KU3A 1YE9A 3CCUA 4E7LA 4OU0A 1QCNA 1NGJA 1O3TA 2IAIA 2CZ1B 3PIPA 4M7DG 4Y1CA 5M5XJ 1ETXA 1NBEB 3MX5A 2WC2A 4WQ4A 1UDLA 4YFXF 2VQHA 2WBNA 1C0GA 1M8MA 3H0HA 1Y1WJ 3HSEA 4QW2A 4IRHA 1N5ZA 2ZPFB 2A68F 2HDDA 1XMQK 1D3BA 3J7ZO 5L3DA 2CGHA 3VS7A 2IAJA 4KT6A 4OF1A 3K1NA 5A2QK 1Z9QA 3I9QA 3CQXA 2XO7A 2EYXA 3KPHA 2F4VK 1Y07A 4V2GA 2JXBA 2EIMH 2K5IA 3GVAA 4FOIA 1NGDA 1VQ5T 1MBEA 4MDXA 2QWOA 5M9OA 4FW2A 4OJRA 1RAGB 1QTMA 4KA4A 4C92B 4CEBA 4KFBA 1UHSA 4M78C 5KGXA 4OKEA 1VQ6I 2W40A 2GBYA 5HL7L 3CCRT 2BVLA 4FT2A 3T0YA 3EETA 2JM8A 2JT1A 2LDUA 1AOYA 2ZM6K 4L5IA 2HOEA 1K8KA 4BR9A 1VQ8N 3JCMc 3K4BA 3OYKA 3QNNA 2XHKA 4FLWA 2ISZA 4AU7A 4C0ZA 5C2DA 1SFKA 2P9NA 3OH9A 5BREA 2CKKA 4KRFA 2RAEA 2O61A 3MEEA 1MNEA 1ZBXA 1XTAA 2I7NA 5D5WB 2E20A 3NAEA 5KE2A 2BBYA 3PM1A 1KQSA 3HM5A 5KTQA 3G1JA 3BF3A 3CYMA 1WJRA 1Q7YR 4G7HF 3NVKA 2ED1A 4CC2A 3D45A 1YF5L 1NYGA 1RGIA 3U3YA 3ULEA 2PTKA 3OYAA 2O8BB 2MPXC 3ME9A 1W5SA 1QRYA 4FLYA 3LCNA 1TWHJ 1MNMC 4GLKA 2A3LA 2LTOA 2YSQA 4M4ZA 4LD6A 1GOCA 4AF1A 3HRSA 1V4TA 3CMEN 5CQYA 2HI3A 4M7DC 4U67L 1IJJA 4KH0B 4BROA 1DTQA 3E3VA 2X4YA 4AYBN 1ZQ3P 1WIEA 3QEPA 1TWAJ 1V5GA 1Y7XA 4HWIA 4CZFA 3FIFA 4BXXJ 2IOCA 4KIBA 4CIEA 3VS3A 4Y52J 3CZ6A 2IS1A 2YU9J 4A53A 5I21A 2BE5F 3ZEUB 4S05A 3QICA 1X3UA 2FD5A 1RNLA 4DHYA 1T05A 3KP2A 2JOYA 1ETKA 1NJZA 2M0CA 3RPUA 3JRBA 2EYZA 4O6JA 2VWFA 3OSSC 2VYTA 1S72T 4A0YA 5J2PA 4BRKA 4R79A 5B66C 2FHDA 4JS4A 4PJOA 1J09A 1TWFJ 2M8GX 4BY6C 2VB6A 3VYSB 2P9PB 5FD5A 3PX4A 4LF6K 3OA9A 3K4LA 2RQRA 1VQ5Q 4HF0A 2KZVA 4IUUA 2NUTA 2ZXIA 1J9IA 1U0JA 2MGQA 3OQ5A 4RLFA 1M1KO 4RBOA 3K9JA 4FJ8A 3OYLA 1KQ8A 3HO1A 2X6WA 4PJMA 1KQ9A 4E1NA 1WGSA 1IN4A 3KX2A 4EJOA 1IG9A 1UA1A 3AFHA 2K3BA 3TAPA 4M77G 3DI6A 2E65A 5GAOn 5AFUA 4NBQA 2HPIA 3QZ9B 2VCPA 4RGRA 3KBGA 5GADJ 4CZMA 3C7NB 1KYZA 5KRSA 1IJWC 3CBOA 3KWGA 3SPYA 3WG9A 3PQKA 3MJXA 3CC2A 3F8BA 5KPZA 5GAMd 1BBZA 1GLBG 3GBTA 2DETA 3NH1A 1MKMA 2VUMJ 3UKGA 1IXRC 4HRIA 3KYCB 2RJFA 4FZZA 2EYYA 4UUTA 1LPQA 4ENNA 3R6MA 1TV6A 4K11A 2KIUA 4H0TB 5GIOA 4KDPA 4LOCA 1TQPA 1WJFA 1HU0A 2LVSA 3DKMA 5CKHA 1XUPO 4KTQA 4ELVA 4PK4A 1WB9A 1QKWA 2LC2A 5IYDJ 1IO2A 1X3NA 4E9HA 3MKWB 1Q8IA 1S7EA 1UGPB 2Y0MA 2RHZA 3BR6A 1RI0A 2DTIA 3ZQLA 4M75G 1MUYA 1V1CA 3TO7A 4FIBA 4G8XA 3NTHA 2A5XA 2FXUA 4YRVA 1M90R 3GFLA 4XLEA 3BTJA 2DK5A 1YJNT 1NGBA 4Q5VA 3SYTA 2MC4A 4H0VB 4IHTA 3ZYYX 2RO0A 2VOOA 6AT1B 3OR1C 3SDGA 4EQQA 2DFUA 3V1QA 1W0UA 2BGGA 2O03A 5BS6A 1MD0A 5EU7A 1UZCA 1YI2T 1ATSA 2QQRA 3M7GA 3IV5A 4KULA 5C0MA 2VQFK 2C06A 3N4QA 3BY5A 4JKEA 1S72Q 3GMEA 2Z3YA 3A8YA 1FJGK 2E35A 4C3JJ 2FF6A 3I59B 4CBWA 1W7PA 4EJYA 4OIOF 4BVPA 1TQMA 3VKIA 1BCOA 1A31A 1DT9A 3QLHA 1TK0A 3P83D 3HGGA 5DYMA 1FIAA 4FWNA 2L3SA 2XDBA 3SHFA 2VJ5A 3JCMd 1O7LA 1ZAOA 4M7YA 3OW2A 3CC4T 2E5NA 4KHWA 2A05A 4M77C 5KYNA 1NK8A 5IH2A 2YU3A 5D7UA 3HBTA 4ZGDB 1Y8QB 3NF8A 4CF0A 1UCRA 1BA0A 2P9IB 2F69A 4P9FA 3L4IA 4V19S 2D2WA 2OTLI 1RT1A 4XAXB 1YFHA 2FRYA 2KMUA 5MLCQ 3R4KA 2JLEA 3LDQA 2XK0A 2DMQA 1H3HA 3NBPA 1NJIU 2IVWA 1G99A 2QSGX 4CIGA 2K3FA 3B6CA 5FDLA 2ZBKA 2LDMA 3CJTB 4G12A 1U3OA 1R5ID 2UWMA 2KFNA 1RNHA 3GTOJ 2MH9A 4HKEA 3RERA 2EQUA 5KYUB 3TQNA 1QW1A 3V9UA 1VQON 5HS8A 4RM3A 2XF6A 1YJNI 2KXCA 2R7RA 5HDNA 2FF3B 4B9WA 1JGSA 1LW0A 1SV5A 2HHWA 3HEFA 4FX4A 2P81A 4ZGJB 1KD1C 2HQ5A 4DBQA 3CJ9A 4M42A 4I7HA 5IAYA 2HYJA 3R0JA 4M6YA 2JG6A 2PMUA 2EAYA 1IV8A 5KCMA 4ID5A 3KVGA 2R57A 1XN7A 2L02A 3BT9A 3H9QA 4IL6C 3HPHA 2DTHA 2ME0A 3GNFB 3ZX2A 2MG4A 1GCPA 4MLOA 3DTEA 1JKQC 2QW9A 2YJEA 2X6SA 1V3FA 3VYRB 2ZJQF 1LNWA 3EFOA 3OB9A 5K7ZA 4RGUA 1G4DA 5GAN3 5F0XA 4QSHA 1RTHA 1M5Q1 5BN9A 1R00A 2VKNA 1PUFA 1UWBA 3TAEA 2L4AA 3V9SA 4PGHA 4J01A 1ZSZA 3CC4I 3U23A 4J2DA 4CHNA 2RHIA 3I58A 2WSFE 1CKAA 3A5NC 1YTAA 4EATA 4E47A 4XSZF 1S9GA 5CJ9A 3I55A 2Y31A 4BDZA 5GMKi 2NRAC 3LWIA 3MKLA 2IA0A 1ZLJA 4C92A 1GXQA 2MCNA 2CQNA 3QOPA 3ZQGA 2ELJA 2QYOA 4L0YB 1JI8A 4FE4A 2QUFA 1HBXG 2MIOA 3VPRA 1BJAA 1RDAA 4JBAA 2K5LA 1VQLN 4BDYA 1S1XA 2RQVA 4ZZLA 3LSIA 4QQDA 3W6JB 2PVGB 4CHQA 3RDVA 4U0WA 4NXNK 2K85A 3S32A 2KHMA 1H92A 4J6XA 2G9WA 1JKOC 3TU5A 2I2LA 3SEMA 1XCVA 4M7AA 1HW2A 3WVEB 1NK4A 4NS5A 1W5CC 1K78A 4XRMA 3BWGA 3DLLL 3EE9A 1YN8A 2XGXA 5KK1A 1X9SA 4LLGF 2KIMA 1IRXA 3DLRA 2L3PA 1W2BP 3WODF 2LD5A 4H4OA 2QEXI 4J9CA 4Z6YA 5LEKA 3VYTB 2QLZA 5CVVA 1TK5A 2GAUA 3CCVQ 3M0RA 2W1OA 2FX0A 2K5FA 3IWZA 2EKOA 4DFKA 3L00A 3DRSA 1JT0A 2UXCK 4UVBA