3OYNA

Crystal structure of the pfv n224h mutant intasome bound to magnesium and the insti mk2048
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oynA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oynA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oynA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oynA03
3F9KA 2VG7A 1B9DA 4F3TA 3DLMA 4NCAA 4M3TA 4DSEA 3RMAA 5KE3A 2YNIA 4BWMA 3V81A 1HYZA 2O4GA 4ZHRA 2NUBA 1WSIA 4DSKA 4F3OA 2KZZA 3MEGA 4O55A 3KK3A 3V9XA 3AO5A 3MXIA 3ZEHA 1NK0A 1T7PA 3OY9A 3S3MA 3DRSA 3HPGA 1SL1A 4KHUA 3OYAA 1TK5A 3SV4A 3NH1A 3B6PA 4FLTA 3NF7A 2NLUA 4GW6A 4FLYA 1FXXA 3ZSOA 2FHDA 2RHUA 3AVGA 3O3FA 2B5JA 3E01A 3AO2A 3C6TA 3LPTA 3QNNA 2Y1IA 4R5PA 1KVBA 2M0OA 3TAGA 2B8AA 3QLHA 4CGIA 4C8NA 5KH6A 1UWBA 1NJYA 4KHNA 4KREA 3AVCA 4FK0A 1ASWA 1VSLA 3TANA 1REVA 2E6LA 4DTNA 4J2DA 3HJFA 1C1BA 3GOXA 1MU2A 4C5EA 4CJUA 5SZTA 4KAZA 3DLHA 5C42A 2P5OA 2ATQA 4BDZA 4CK3A 4MFBA 4FLWA 3TAQA 2IC3A 3K59A 2G8KA 4HCBA 3TABA 3JSMA 2E6MA 4CF8A 3NNQA 2OPSA 3M8QA 1T03A 1LW0A 5IAYA 4FYDA 2RHYA 4HUEA 4IDKA 2RPIA 3SPYA 2VWKA 4CGGA 2G8WA 4N4IA 3DLRA 1RCHA 1RT5A 3ZT1A 3CEYA 4FJ8A 4AH9A 4B9XA 2VWJA 1BIUA 2HHTA 4IUQA 3CYMA 3ZSQA 3LALA 3S3OA 3TWHA 4FK4A 2XDPA 4CJSA 1A5WA 2HHXA 2YHAA 5CZ1A 4Q0BA 3SQ4A 4M45A 1XWLA 4JLHA 4DF4A 5I3UA 4F2SA 4N47A 2HHWA 3AO3A 2MWOA 2LDMA 2F96A 5DK5A 4Z4IA 2RHZA 4CHZA 3AV9A 3M8RA 1FKPA 3C94A 3HP6A 1WNSA 3K5MA 2KTQA 1S1WA 2HNZA 4C8LA 1IKWA 4DS4A 3OYEA 5C6SA 1TGOA 2E5QA 3KKRA 1GOBA 4CHNA 4E19A 4CEDA 3AVLA 4IBNA 4FCYA 4N41A 3O4QA 4CJPA 4ID1A 5HROA 1QSLA 4M3XA 2OA8A 5HBMA 2RHXA 2RN2A 4ICLA 4FJMA 2FBTA 1RI0A 5JS1A 3MEEA 1F21A 1LWEA 1RTHA 3OS2A 1IKXA 2D0BA 3NF9A 4NYFA 1C1AA 2RI2A 1U04A 3LZJA 1IKVA 2Z1HA 4DQSA 4KI4A 2X78A 4ID5A 2IDOA 3HL8A 3OYMA 1Z26A 4DTSA 2VG5A 2RHIA 4OVAA 4LH4A 2FBYA 3VQBA 4IUUA 3SYZA 2YRVA 1L3UA 5HRRA 4CIFA 2DIQA 1HNVA 3NFAA 2KFZA 4FXDA 5DMRA 2Y1JA 3ISNC 2KQ2A 3LANA 5HRPA 3ZT2A 3KJVA 4O44A 2HQEA 3V1QA 4A4GA 1JL1A 2RF2A 1S1TA 1SL0A 1JLCA 1NK4A 2R5AA 3M8SA 2XO7A 2A1SA 4CHQA 3DMJA 3RWUA 2HHSA 3IAYA 4IKFA 2P51A 1VSDA 3KK1A 3PX0A 4J2BA 4CE9A 4DU3A 3QESA 3AA3A 3THVA 5FROA 3L2UA 3CFOA 3QBYA 5D6XA 1KVAA 2BE2A 1NOYA 1BCMA 4A4EA 3QIOA 3KLEA 5D6WA 1KRPA 5C25A 3HSTB 2X4XA 4FZZA 4C5IA 4CESA 4KO0A 4DU4A 3SI6A 4DWIA 3KLGA 3HVTA 4LD0A 1XI1A 1VSKA 3L2RA 4CGJA 4FJKA 4FJ7A 1BIZA 4HCZA 3TAFA 1WSHA 3OYDA 3V9UA 1YTUA 3OJUA 2D0CA 3RMCA 1C1CA 3LP3A 3BDLA 1RBSA 5KRTA 2EQMA 4B9WA 3CFPA 1T8EA 2X35A 4I2QA 5FDLA 1WAJA 3U6FA 3ASKA 3RMBA 1G5VA 4E1NA 4I9LA 4B3OA 1OZ3A 2LCCA 2X6SA 1GOCA 4X34A 4DU1A 1QSYA 1IKYA 1SV5A 2P1JA 3ITHA 4KV8A 3E9FA 4DTOA 4I7FA 4CEOA 4HUFA 2IGIA 3DLBA 3KTQA 4KTQA 1NJZA 1JXEA 4PQUA 4QQGA 4HVJA 3HP9A 1YT3A 3AA4A 4B9UA 4KRFA 4AHCA 4LD6A 2O4XA 2AJQA 4E7HA 5FRMA 4QQDA 1BQMA 4Y1CA 4JRPA 2YV0X 5HP1A 3QJ6A 1Y97A 5J26A 2X6NA 3DLKA 3MXJA 5HRNA 4DQRA 4B9LA 2ITGA 3NBPA 1Q9XA 1EP4A 3Q1JA 1U47A 1KHCA 3DB3A 1BGXT 3EAEA 1RILA 3ZT3A 4DLEA 4C5HA 1RT6A 1X1PA 2F8TA 1QTMA 1JLAA 2EQKA 4A4FA 3IS9A 1C0TA 3F70A 3NTKA 3QIIA 2GBZA 3AVMA 1BI4B 4M3ZA 3PV8A 4FJLA 1T05A 4Z4HA 1WSJA 2LSNA 2G8UA 3PO4A 4QQ6A 3VQ5A 3P8DA 1D9FA 1CZBA 1TKZA 2X4YA 5IN1A 1WSGA 3B6OA 4EP5A 1QS4A 1XNIA 4W5QA 1D8YA 3SZ2A 1JL2A 1LWCA 3KLHA 2OZSA 4OLBA 4O0IA 4Z4FA 1HYSA 3LH0A 4II1A 4CJFA 3MEDA 3VA0A 4BD3A 3SUOA 4CIGA 4PLIA 4E89A 1BQNA 3H8ZA 4JS4A 3SPZA 1C0UA 3NF6A 3ZSZA 1HRHA 4AILC 1JLEA 4HUGA 2OYQA 3FFIA 1RDCA 3LGLA 4DF8A 4LSNA 5KI6A 1I39A 3QKJA 3OYGA 1VSMA 4E0DA 3DLGA 2X4WA 4CEAA 2EQUA 3ZSRA 3VQ7A 1G15A 1CXUA 3CG7A 4BDYA 1TK8A 5J39A 4NS5A 2X74A 4KPYA 3LP0A 4RW8A 4FJNA 3JYTA 3PFSA 2HNYA 1RT2A 4NYNA 3LGFA 2RJCA 2XHBA 4Z4CA 5I42A 3L3VA 4CJ3A 3SV3A 2QQSA 3OMCA 4HTUA 1VSIA 1U4BA 2WOMA 4XIUA 3VN5A 3SUQA 3H6ZA 4BWJA 1OZ2A 2E4LA 2DTUA 4IFYA 1QHTA 4C8MA 4H4MA 4N4GA 2OZMA 1WJSA 2R5MA 3OYLA 2EX3A 1WN7A 2JGUA 4C5GA 4CF0A 1RDBA 2YNFA 4AHRA 3L8BA 2DAQA 3VQEA 1NOZA 4Q5WA 3O3HA 4DTMA 3SUPA 1NJXA 4KHSA 3HO1A 3L42A 4B9MA 1C0MA 4CRIA 1SSFA 1NKCA 2DFFA 3PO5A 4F8RA 1WJQA 2RJEA 3QO9A 4B08A 2PZSA 1WSEA 1A5VA 5C0MA 3HPHA 3KUFA 4OKJA 1XHXA 4CFCA 3PMTA 4CIEA 1DTQA 3HK2A 5M9OA 3MEUA 1B9FA 1VRTA 3MEVA 1Q8IA 3DLEA 3PNWC 3VQPA 1J5OA 1IG9A 3NH0A 1SKWA 2F8SA 4DFKA 5JS2A 3WNHA 4FJHA 3HM9A 3MO8A 2HHUA 4GMJB 3NE6A 1ZBIA 4FJIA 2A1RA 1S6PA 3M9QA 3G0ZA 3L2QA 3P5JA 4AHVA 2I5JA 2XY6A 4KI6A 1VSEA 4FLXA 3T3FA 1HYVA 2YNHA 5C24A 4CJKA 4FK2A 4KTZA 3RRHA 5J2NA 4CGDA 1N6QA 4DSFA 2G8FA 4FLUA 3FLGA 1RBUA 3META 3KD5E 3O4NA 1H3ZA 4M3RA 3SNNA 4C8KA 3LAKA 4FZXC 3OJSA 1VSJA 4OGCA 2PY5A 1WGSA 1RTJA 4FVMA 4H8KA 2R7YA 1VK0A 1TAQA 4DLGA 3TAPA 1KLNA 4KHYA 3ZT0A 3DYAA 4W5TA 1J54A 3SCXA 3C95A 3NGIA 4AHSA 4CK2A 3OYHA 1R0AA 1UA1A 4OKEA 4NZGA 3AVHA 2P5GA 1RBTA 2WACA 1TVRA 2O4XB 2JLEA 3CM5A 3OYCA 3FEOA 1ITGA 2XRIA 1HMVA 1MHNA 1JLGA 4E7JA 4CJEA 2K3XA 1TKDA 3IG1A 2JTFA 3QINA 3M8PA 4CJ5A 4CEZA 4NCBA 3QEPA 4AHTA 1N5YA 4CGHA 1S9GA 1X9MA 3LDSA 4FJXA 2PQWA 5HLFA 4PL6A 5KE2A 4RG2A 3E9GA 1ASUA 3VQDA 3PX4A 3MP1A 2HQXA 4E3SA 3PX6A 2PYJA 4DTJA 4QOZB 3OYBA 4FJ5A 4E7LA 2MWPA 1LW2A 4C8OA 4GY5A 4QW2A 2D9TA 2EFIA 1IH7A 4IFVA 4CEQA 3LAMA 2DFEA 3I0RA 1BCOA 2GUIA 3NDKA 1NK9A 2BIVA 1EETA 3CM6A 3ULDA 2XY5A 3AO4A 3HXMA 1S9EA 1ZYQA 1BI4A 3K5OA 2CKKA 1S6QA 3VQCA 3K5NA 4IG3A 4A4HA 1JXBA 3RMDA 1Q9YA 1KSPA 2RI3A 3TR8A 1BHLA 1D5AA 2GF7A 2ETJA 2RJFA 2IS3A 4DTUA 1U45A 1L3TA 2BDPA 4DQPA 2YKMA 2QKKA 1WAFA 3QEXA 1NJWA 1RTDA 2HHVA 3NTHA 5J2MA 3QEWA 1EKEA 4I9QA 4KB1A 1HNIA 3RR8A 2YNGA 3I0SA 3CFRA 3K2PA 1RDAA 1HJRA 2OPPA 1TV6A 3AVKA 3OVNA 4O0JA 4CJWA 3V9WA 3OYFA 1EX4A 2RO0A 1RBVA 3QIPA 4CHOA 2M16A 4EZ6A 3LP2A 3VQ6A 3HT3A 4CJTA 3NHGA 4EZ9A 4N76A 1RTIA 1JKHA 4OGEA 4J2AA 3L2VA 1C6VA 1RDDA 1YVUA 4OPJA 3OYNA 3VA3A 2VYTA 2QKBA 1SL2A 3H08A 4B9SA 3P8HA 1W9HA 3ZCMA 3VQQA 5J1EA 5T7BA 3KK2A 4DFPA 4FJGA 4I2PA 5D3GA 4DTPA 1RT4A 1VSFA 3C6UA 2Q3SA 4FL6A 3ASMA 1TK0A 1QQCA 4PLLA 4H4OA 3ALYA 4DSJA 1S1VA 3OA6A 1QE1A 4B9TA 2LTOA 4B8AB 3KLFA 2PYLA 3AA5X 4IURA 4DSIA 2ZD1A 4HCCA 2P0KA 3AVBA 2HNDA 4KHWA 3OYKA 3S3NA 3UWNA 2BGGA 4BE0A 2R58A 3ZT4A 1X9SA 4FLZA 4N4HA 1TKXA 3SJJA 4QCLA 4ZTJA 1VRUA 4FZYA 3U3YA 1ASVA 3O3GA 4LSLA 2L89A 2R57A 4KFBA 4FM0A 3QEVA 3RRGA 3LZIA 4B9VA 4J2EA 1KTQA 3BDPA 4CJRA 1YTAA 5CIUA 3VQ8A 4RW9A 3MP8A 4CFAA 2ZE2A 3V9SA 1L3SA 4ELVA 2IG0A 2K3YA 2G8IA 4OLAA 3ME9A 1LAWA 5KGWA 4CEEA 4W5OA 4DQQA 4M3UA 2HHQA 4NCGA 2GFUA 3ZSYA 5D6YA 3P83D 3HPOA 2W42A 3LX7A 1L5UA 2FBXA 4N5SA 2GV9A 5CYQA 3F73A 2KFNA 2EKOA 1A5XA 1JLFA 4MQ3A 4RG8A 1NK6A 3FDRA 2L3RA 1VSHA 4OPKA 4UC4A 3TAMA 1TL1A 1BISA 4CFBA 5E41A 3OS1A 3VQAA 3LWLA 4ELUA 1FK9A 5CYMA 4F2RA 4TSXA 4CJVA 1ZBUA 4DMNA 1LV5A 4FM1A 3S6WA 1ZBFA 3LWMA 3I8DA 3D0PA 2HVIA 2OPRA 3OMGA 1S1XA 3MEAA 5CZ2A 4DFMA 2HMIA 4ELTA 1J9AA 1XHZA 3AVNA 4DSLA 3AA2A 3MXMA 3DOLA 1EXQA 3DRRA 5HRSA 4HHTA 1WLJA 1XC9A 1I3AA 4O4GA 3VQ9A 1U49A 2RI5A 4E7IA 3TARA 4FJJA 4CJLA 3G10A 1JLQA 3FC3A 1K6YA 4OKKA 2ZQBA 4W5RA 4PUOA 4PY5A 1ZBHA 4DFJA 3NGZA 3WNGA 3NGYA 4WE1A 1NKEA 1ZBLA 4AHUA 3T19A 3V1OA 3NTIA 2VG6A 3DM2A 1KCFA 4IUVA 4ZTFA 3SD4A 4KHQA 3LPUA 4DS5A 2D5RA 3QERA 3PMIA 4IUTA 3IRXA 5J2PA 4B9NA 3TI0A 1NKBA 3ZSVA 1LWFA 2F5KA 3LP1A 5CY4A 4M3WA 3DI6A 2G8HA 3WNEA 1L3VA 2WONA 1HQEA 3NCIA 1KFDA 2O4IA 4BE1A 4CF9A 3OYJA 1NK7A 4K8ZA 4BACA 2G3RA 3KIOA 2QK9A 1DLOA 2G8VA 1RT7A 2HVHA 4LY7A 1HPZA 1TL3A 5KTQA 5KCOA 3OB9A 3K57A 1UA0A 3MECA 2JZ2A 4O5BA 4PA1A 4Q5VA 3PY8A 1S1UA 3KLIA 4BDPA 3AVJA 5SWMA 4KB0A 3OS0A 1WJRA 1TKTA 1Z25A 1OI1A 4OJRA 5KRSA 3UT1A 3L2WA 2IOCA 1KFSA 1BL3A 3MAQA 3MP6A 2EQJA 1O1WA 1IO2A 1QSSA 3U3GA 2XY7A 3A2FA 2KW4A 3RR7A 2QQRA 4IUPA 4Y1DA 3UIQA 1CLQA 3MEWA 2KZMA 1RT3A 2DIGA 3AVIA 1CXQA 1W0HA 4E7KA 2B4JA 2XY8A 3EZ5A 3NAEA 3S9HA 4L8RB 4Z4GA 1U48A 1KVCA 1LAVA 3DRPA 3V9ZA 1NK8A 3AO1A 4FW1A 4CGFA 4Z4EA 4CCHA 2QXFA 4CF2A 4DTRA 4EDUA 1CZ9A 4RW7A 2BANA 2FBVA 4BE2A 4RW6A 2HB5A 3CQ8A 3D45A 2Z1GA 4QAGA 4FM2A 4GVMA 4DTXA 4M42A 1UAXA 4Z02A 4DG1A 4Z0UA 3V6DA 3NF8A 4LH5A 2Z1JA 3AVAA 4M41A 1D9DA 4FW2A 3DB4A 4CJQA 3K58A 3LLRA 2E6NA 4KTWA 1RNHA 4OVLA 1X9WA 5KCHA 2XK0A 2RKIA 1HQUA 5J2QA 5K14A 3O8VA 2EHGA 1J53A 3SQ2A 4YFUA 3SQ0A 1UOCA 2OPQA 4JS5A 4CFDA 4CEBA 3EYZA 2RJDA 3P1GA 1N27A 3K5LA 4W5NA 2LRQA 4CJ4A 3L3UA 1RT1A 4CHPA 3KD1E 4CEFA 4B8CA 3SUNA 4G1QA 3ZSXA 3HYFA 1SKRA 1KLMA 3EY1A 3NH2A 2L8DA 3BGRA 2LVMA 4CK1A 1JLBA 1WSFA 4CERA 1OYXA 2M1HA 3HVRA 5EU7A 4CF1A 4FLVA 3V4IA 2GFAA 2B6AA 3OQ5A 3SQ1A 1TAUA 3QEIA 1B92A 4RW4A 1NK5A 3T1AA 2DFHA 3VQ4A 3QNOA 4E1MA 3TAEA 5KGXA 2DY4A 3ZSWA 4DQIA 3C4SA 2YKNA 4K8XA 4PWDA 4L59A 1DTTA 4UQGA 4FU6A 1S5JA 2YHBA 3WNFA 4EP4A 2IAJA 4JRQA 3AVFA 3DOKA 3QETA 1SKSA 4FJ9A 4KKOA 4YNQA 4IG0A 1GOAA 3RTVA 1FKOA 2BUDA 4F4KA 4CECA 4M3YA 2D0AA 2HW3A 2Z1IA 3OYIA 1SUQA 5FRNA 2FC0A 2BKDN 4QVZA 4CHYA 3LYIA 3PUFA 1RBRA 4N56A 3V1RA 3KKSA
chains in the Genus database with same CATH superfamily
3F9KA 1B9DA 3O6BB 2F2WA 2NUBA 5E26A 3GF5A 5EGOA 3VF4A 3ZSOA 3CCQQ 2ZO4A 2NRRA 4C8NA 1XDSA 2GEMA 3CCUQ 4J19A 3CMEI 1YWOA 3VYHB 4AFZC 3C2HA 3IKMA 1M5Q1 1KYZA 4EW0A 3OSSC 4IHSA 3R2XC 4CK3A 4HCBA 4WXCA 5EEHA 3VS3A 3K4MA 2ITMA 1Z6RA 3MN7A 2DDBA 3TO9A 2VWKA 4YOYA 1GCPA 4J9FA 3PSIA 3CF5L 3BR2A 5AQJA 1VF9A 1HKSA 2R7ZJ 5DEQA 3G71T 5BR8K 4DS4A 5FU7B 4BGBA 1LE8B 2JOYA 3UKUA 4ESBA 4C92E 3L6QA 2OA8A 5HBMA 1YQMA 2IA1A 1YI2T 2V6CA 3OS2A 2D0BA 4RAGA 2GQIA 2QENA 3LDNA 3FXRA 3KYDB 1J5EK 4OVAA 4CH7A 4CIFA 1UGPB 2OZ6A 2Z33A 1WJ5A 4FXDA 4FE4A 4LK0F 2KDZA 3ZT2A 3ZQCA 3QFUA 1JTYA 5ED4A 1N8RR 4BI4A 3CDIA 1SRMA 3CCEI 2A1SA 2LREA 3CJQB 2E7WA 3WEEA 3FB9A 3QBYA 4C92D 4KO0A 3SI6A 5BN8A 4UUSB 4EAHD 4MLOA 4I0AA 4LFCK 3BDLA 5FDLA 3EUKL 5JLHA 4EJZA 2MLGA 2P9NA 1JJ6C 5FD6A 2BV6A 2NRHA 4HUFA 2E1ZA 4M9ZA 2OCCH 1G3WA 2HVRA 1S29A 3BCAA 2CUEA 3FMSA 4RMOA 4X0GA 3QJ6A 2LBFA 5HRNA 2PMHA 1U47A 2ZPGB 3VODA 2OA4A 2A68F 1C0TA 1BI4B 5K1YA 2LT4A 3H9JA 2LSNA 3DKMA 2COBA 3CETA 3CJ7A 1QS4A 3ZPLA 2ZAEA 3R6NA 3D2EB 1Q86C 3VA0A 3EGDB 2HQRA 2YXYA 1SAXA 1DPUA 5BPNA 1C0UA 4AILC 4HUGA 5DM6L 4B09A 3E1YA 5E17F 3M54A 1I39A 3H35A 1GVJA 4OIQF 2N8GA 1AWXA 1S72T 4FSSA 4MDBA 3DLLA 4HYEA 1SRLA 2NWMA 3JYTA 1M3CA 1RT2A 2P9LB 2LC4A 3VN5A 4A3EJ 1ZREA 1FP2A 4H5WA 2ESHA 4M77C 1U78A 2YUNA 1IZ1A 1GRIA 1NJXA 4GYIA 2EBIA 4C8QG 1NKCA 3INZA 2QKMB 2JG6A 1TUYA 4CIEA 2R5ZB 5C0MA 2I7PA 1TT5B 5LJ3g 2C6YA 1OCZH 2P4TA 3PNWC 4HX4A 5JS2A 3WNHA 1S6PA 3V7SA 2LQ8A 3F9MA 3MJXA 1MW7A 1ZA2B 5GAOr 2G8FA 2BZ8A 2FSKA 1KA8A 2XAHA 2L5QA 4EFHA 4S04A 1YITI 1YQRA 2EIMH 5EG0B 1DDNA 1HD3A 2ED1A 2XD0A 3JCMf 4AVZA 1T0FC 4MO7A 3MN5A 4G12A 2ZXHA 1ZSGA 4QOZB 2O8EB 2KLOA 2WB1N 3O9UA 4CVNE 2EFIA 2FYKA 3KCCA 2O8CA 3WU2C 4IO9F 2DFEA 2EJFA 1ZYQA 3CCUA 1ZRCA 2CKKA 1KSPA 4RTTA 1X43A 2K2MA 1T39A 2YKMA 3LFUA 2AZVA 3I4NJ 1NG9A 4K0KK 4ANJA 3CWTA 4KFCA 2F2XA 2VYPA 4OMZA 1P90A 1FX7A 3G1MA 1NYFA 4J2AA 4BAYA 4QWQA 1QQMA 4E4HA 3H08A 1W9HA 2XGXA 2Q3SA 2E2OA 4ESRA 2PYLA 4IURA 3FDYA 1KK7A 2UUCK 3VYSB 3S3NA 4H0TB 4LG3A 4C8QB 4II3A 1X6GA 3U3YA 2V7YA 3Q9VA 4RW9A 3VFZA 4CZHA 4Z94A 1Y8RB 1TW3A 3QP6A 3CERA 4ISEA 1K73O 5IT3A 3LX7A 2W03A 3TTFA 2VL8A 1EA3A 2DILA 2JUGA 3VS1A 3I9V2 4YTLA 3D0PA 3E19A 5AZJA 3J7AY 5I2SA 1WJDA 3K4KA 3I0TA 4Y33A 2J06A 3EHQA 4JLGA 3GZNB 3RR6A 2RI5A 4E7IA 4FJJA 4HLYA 1V54H 2BXYA 4AM6A 2DL4A 4FM4B 3ZYYX 3NTIA 4ZTFA 2UXBK 3RKQA 3ZGKA 4LMYA 4RGXA 2RGVA 5E1ZB 3OH9A 2DAOA 1KSWA 2O4IA 2DA5A 1YYVA 1VQ9I 1ETWA 2L3SA 4B3SK 3I35A 3AAQA 4BDPA 3S17J 4HTLA 3M8JA 4DHYA 1VQLI 2EQJA 5GIOA 1YITT 2YWWA 2NOEA 2DBKA 2QYOA 3OS5A 3K9KA 1RT3A 1XMOK 1VHXA 4Z4GA 4L8RB 4IQJA 4CZMA 3WGHA 1LEAA 2ZBKA 1S22A 1FWZA 5JI6A 3GNFB 4Z02A 3I0XA 1IRZA 1BU6O 1D9DA 4FW2A 4CJQA 2E6NA 1RNHA 2FOKA 3SQ2A 3EYZA 3KD1E 3JS6A 1CF7B 3NH2A 1D5VA 4FPBA 1GLNA 4YPHA 4JI7K 4PJOE 1SHGA 5LGTA 1TAUA 5BOXA 3I33A 4BL0B 1B92A 3ENBA 2Z0WA 2Z1DA 4BRGA 2GBQA 3DOKA 1IRFA 2MSYA 4Y15A 2AZSA 2E1OA 3QQAA 1AWJA 5BQTA 2VI6A 4YOQA 4A5AA 5FRNA 2FC0A 3LYIA 4UVAA 3KKSA 2P4WA 4M3TA 3CWUA 1VQMN 1XX5A 4W97A 2WY8Q 2OC6A 1VQ5N 2KRHA 1KQ8A 1FXXA 3RQIA 3QNNA 2ZGZA 3A5MC 2B8AA 3KLNA 1HK9A 3W2VA 3QPHA 2K27A 4QIWN 3GOXA 1VNDA 1KHIA 2KP6A 4GV9A 4M75G 4OMLA 2QA4N 4NBQA 4FYDA 2HYFA 2RPIA 1ODDA 3OA9A 3IWFA 3P8BB 2KJCA 1RCHA 1Z67A 3RMQA 4B9XA 1BIUA 1WBBA 3ZSQA 4GVEA 3FXMA 1E3HA 4IJAA 1T95A 2AK5A 2MAMA 2A42A 2MMPA 2DQRA 2DQLA 5CE3A 2WY7Q 4M75F 2RHZA 3WE2A 3VTHA 1IKWA 2FEZA 1J59A 4CJPA 3RJPA 5CHIA 2IIRA 3WXJA 4BRDA 3HFOA 2DXBA 4DQSA 5GP9A 2IGOA 3FXJA 3OYMA 1E0EA 1XGSA 1P7MA 4DTSA 1O3SA 2QTXA 1N75A 5HRRA 1R1VA 5AQYA 1MJ9A 1R36A 2OF7A 1VQLT 4HQEA 1SL0A 1MUNA 2LCSA 5GTIC 2FRWA 2P51A 1FBSA 1K76A 2AXTC 3K2ZA 2NS7A 5FLMJ 2YU3A 1MH4A 5F6FA 5EYRA 5IP9J 2GELA 4C5IA 3HVTA 1OPKA 3CC4Q 3O80A 4FJKA 2P4RA 2BTFA 1RBSA 5A0DA 3MWMA 2R7RA 3ASKA 3RMBA 1G5VA 3RUXA 4MEXF 1YHQN 2ZC2A 3OL4A 1QVTA 3VDXA 1YT3A 1HOMA 3ZCOA 2MD0A 1WXTA 4M78E 2O4XA 5FRMA 3VOEA 2K2VA 2V51B 5FLXO 2QWOA 1X1PA 2FOWA 4A4FA 1QHHD 4MDAA 2E5NA 2RD1A 3PO4A 2FF4A 2D1VA 3TDUC 3EGXB 5LJ5j 1WSGA 5B8HA 5GAN6 3S1NJ 4WTOB 1VQ7I 3I54A 1WEGA 3PVQA 4OIRF 2PG4A 1R4MB 1MBFA 3UPUA 1KYWA 4EVVA 4QTRA 5D8KB 3QKJA 1JUPA 1JKOC 1GT0C 2EQUA 4HOBA 4IVNA 1M3HA 4ZGJB 2X74A 4KUDK 4DV1K 5E3NA 2HNYA 4M75E 1XMXA 3G1JA 2IP2A 2RREA 3PQJA 1KEAA 5FU6B 2Y90A 3SPYA 1WN7A 1V4SA 1OR7A 2EKHA 4A61A 1Z7UA 2NOZA 2CREA 1ETXA 3T1HK 3CC7Q 3H1VX 1GLJO 1VQ9Q 3PNTA 4CFCA 1ZK8A 1DTQA 2FRYA 2P9KA 3ZQHA 3L09A 4FJHA 3ZBDA 3H0GJ 1VQ6I 3PFIA 4QS9A 4Y3OA 1BB9A 2FPDA 4X66K 4CGDA 2L4MA 5LJ3h 4W1UA 3SCXA 2XDDA 2DD4A 4J6YA 3FISA 2JLEA 2JMWA 5E8GA 4CJEA 4NCBA 2JT1A 2KNBB 4CEZA 1N5YA 5LJ5g 5I9EB 1X9MA 1M2VB 4PL6A 2HHWA 3QAHA 3S8PA 3JCMX 3HOVJ 3QDRB 4QW2A 1WJEA 1UGRB 4XEIA 4JKDA 3I0RA 4OFEA 3CM6A 1GLCG 3PIOA 3VQCA 2V8IA 1IUYA 2RJFA 1U45A 5FPNA 2VWBA 3LSHA 3OVNA 3B73A 4BQLA 4CHOA 2HMAA 2AHQA 4FIBA 4ON0A 4N76A 3FK7A 2QASA 1XCBA 3CCVN 2L7KA 1W2BS 1T44A 2ZZDA 3LWFA 1RFQA 4RTFD 4CYCB 1XMKA 4A3BJ 2JWKA 3HHTB 4F93B 4F16A 3C7JA 3NPFA 4BRNA 1ON2A 3KLFA 2OTLN 1OH7A 4DSIA 1TXQA 2H56A 5JR3A 4AIDA 3SAGA 4RTUA 4LSLA 1VQ7T 2P7CB 2JM9A 1KTQA 3M53A 1X58A 4FJIA 4B23A 3M4GA 3KXTA 3M3ZA 2VB6A 5AQFA 3I55T 2GA2A 4E9HA 3HPOA 4KN7X 1ZBXA 1TYQB 2LSOA 4MQ3A 3SEZA 2KIFA 1VSHA 5ELZA 1O7LA 2IRFG 4KNYA 4OX9K 3LWMA 1R0BG 3ZQ7A 3M0SA 3HIFA 1NG7A 4UUSA 2CUDA 2YU9J 3E5QA 3G10A 4OKKA 4HW0A 1DUXC 2D0OA 2YRCA 1ZBLA 2JPBA 1YTYA 4F7ZA 4HSTA 3VERA 1F5TA 5L8RE 4XLAA 4LD5A 4ASNA 1I6HJ 2DK5A 2F5KA 5J8FA 4JI2K 3OYJA 2LLKA 1JXSA 2IEKA 4S0HB 3OS0A 1WJRA 5KRSA 3L2WA 2LMJA 1IHVA 1YNZA 2BXZA 2ICWG 2QQBA 4BQOA 1VUBA 5CJ9A 1C0FA 3ZN0A 3BROA 4DTRA 2HTJA 1VQPI 4OB1B 3CPWP 3ZX0A 3QOEA 4GVMA 4DG1A 4JX6A 4X9DA 4M7AE 1BWFO 3LLRA 1HU0A 2QSHX 2VC1A 3O8VA 2PFUA 1D0ZA 4K43A 2M51A 2D6FA 3COAC 5DM7R 1JTXA 5J8CA 1GV5A 5B66C 2K5IA 2YT6A 1FMKA 2L8DA 3H9QA 1VQ6Q 1VQ5I 1RAAB 3J81E 4Q48A 4XKVA 2JTVA 4JD2A 4M71A 5KGXA 3TAEA 4M7AD 2JA5J 4PWDA 3CMEN 3CC7I 3HPWA 4D5CA 4A3GJ 1HKCA 1VQ7A 1L0OC 1VQOQ 4CZCA 1K7AA 1SUQA 1X2NA 1VQPA 5HS9A 4UUVA 4M75C 3RIRA 4J9HA 3V4GA 5ICEA 3TPQA 4BG9A 3OY9A 3DRSA 4OLAA 2VKEA 2GWJA 4UVCA 1UAAA 3O3FA 2FHDA 3G1OA 2XKOA 3E01A 3ABUA 5JICA 5KH6A 2YLBA 1ASWA 1D1CA 4G6QA 4CJUA 2ZMEB 4YFKF 2LTPA 1H9TA 5C2FA 2AIRB 2E36A 5E79C 4IHXA 5ADXH 1ZGWA 2G8WA 4N4IA 1LNXA 4CA0A 4WXHA 2WAEA 3CYMA 2HHXA 3V42A 3CCEN 4A6EA 1RABB 3CPWS 3O8GA 3DTIA 2CP6A 1ARKA 2MK5A 1GOBA 3OOPA 3MEEA 1CZAN 1IKXA 2KJBA 3HL8A 2WAQN 2QQ8A 4CZIA 3C1DA 3LANA 2E19A 2MH9A 2FXAA 4B1UB 2KSSA 1D1AA 3M8SA 4IKFA 2E34A 4CJ7A 2X4HA 3QWYA 1GBRA 1E3MA 1OX8A 3GFLA 2B9SA 1RL2A 1NLPC 2CW0F 3BTLA 2V8JA 2QSFX 3RESA 4BJ6C 1EF4A 2LNVA 3OJUA 3ATUA 2C0IA 2OU2A 4I9LA 2LKPA 1XTDA 1ZELA 3FF5A 2EV0A 3H3ZA 2RF0A 2PJRB 3HYIA 4H0PA 4HVJA 1YJNN 1U5SA 2WBMA 3M58A 4DQRA 2KI7A 4F9OA 1BW6A 1KHCA 1QTMA 1IG7A 4B48A 4FX0A 3PV8A 2QWMA 4FJLA 1DQUA 1NJIR 2DT5A 4JI6K 2LX7A 4AF1A 4C92G 1XGNA 1TKZA 1KG6A 1B1BA 1JL2A 1LWCA 1SAUA 3M3YJ 1KU7A 5B1BH 1X1DA 1GDTA 3TQNA 2EYXA 1YXQA 4A0ZA 2PX9A 4C92F 4WFAL 2M0MA 3DU6A 1DT9A 1IHWA 2P9UA 1AHJB 1SVLA 2XHBA 1NK3P 3L3VA 1ZUKA 3OMCA 3SWNC 4JKFA 3LQRA 5LMUK 4BWJA 4BB7A 4IFYA 1QHTA 1XQOA 4DR6K 4KBMB 4DEYA 2WAQA 2A6EF 1HW1A 1YF5L 2PZSA 1WSEA 2OTJA 1XMAA 1B9FA 1VRTA 2YS9A 1XCVA 2A1RA 3RBBB 4JK1X 2R4GA 5JVHL 3FLGA 4KT6A 4M78D 2Y2ZA 5KYUA 1PCXA 2L9VA 3KEYA 4KUMA 3CC7N 2BBYA 3CM5A 4OP0A 3HJEA 3MK6A 4RUGA 1RAIB 1HCRA 1R5HA 3E9GA 2CGKA 1BK2A 3VEPA 1P4AA 3WT0A 2MWPA 2HZTA 1ZRDA 4GY5A 5LY3A 1VIFA 3EG3A 4HSBA 3WGGA 1PD0A 1S9EA 4A3CJ 1PHTA 1S6QA 2HSTA 1TH7A 3RSEB 3KBGA 1KG3A 4Y4RA 4LFAK 1QHAA 3KP3A 2HPMA 3U9DA 1ZHIA 5GANh 4BRAA 1DU0A 2AKLA 1Y57A 2OPPA 1XOVA 1B34B 1NK9A 4CJWA 1EX4A 3F2KA 3VQ6A 2EQIA 3C12A 1JKHA 2W25A 4XKBA 3KK2A 1O4XA 4FJGA 3GIBA 5LL6S 2FBHA 3I4PA 1D0YA 1FIAA 1YQLA 1QVGM 2CGJA 3CBOA 2M3AA 2JQ7A 3OYKA 5CO7A 4PZJA 1VRUA 2JWTA 1PVEA 1ASVA 4XH5A 1KQSP 3LZIA 1K8KB 1ONVA 4ZYDA 2K5LA 2Z9OA 1JRIA 4RB0A 3MKYB 1ATRA 3K4CA 4D1QA 4C92B 3ZQFA 1GLFO 3Q9SA 2OD5A 1H0MA 4RG8A 1MMAA 1BISA 1M9SA 3VQAA 4DMNA 5BPDA 4M77F 1S1XA 4KICA 4JRKA 1A35A 4H5TA 2DBMA 4DSLA 5HDKA 1NEGA 5HRSA 2QM3A 2VKVA 4YOVA 1WHGA 3NGZA 4JX4A 2F2VA 5LBQA 3FBNB 4DS5A 3PMIA 4XTXA 3B6CA 1FMVA 3QYBA 2G8HA 4F04B 4K8ZA 3GDQA 3A0HC 1XJWB 3OB9A 5KPZA 2HL5C 2FL7A 1KFSA 1YRNA 3U3GA 2P0WA 1YITA 1WJBA 3DBRB 4CCLA 2E7XA 3T8RA 3U1DA 2VVKA 2NS0A 2QWNA 4JHDA 1VZ0A 1SKUB 1LAVA 1KQ0A 4B6MA 2VBYA 1RC9A 2OBPA 4MFEA 3OSGA 4BE2A 2DOEA 4FM2A 3GW2A 2YG9A 2FE3A 4A2BA 3H41A 4J01A 4KH4A 3CCJI 1HQUA 2RJDA 2CW8A 1MBHA 3MMYB 1LVKA 2CMPA 1B8IA 3RYPA 1B9NA 2AS5F 2O8BA 4XSXF 1FYNA 5EZGA 5M3MJ 1KO9A 3EDPA 1K9MU 2K6DA 4M75D 3TSZA 4FU6A 3RERA 3AVFA 5FPEA 3CCSN 4FJ9A 2LFBA 2YJEA 4YNQA 2E88A 2JSCA 3TCJA 3D2FB 2VQLA 4DV6K 4N56A 2MIOA 3FXUA 5LL6Z 3I9QA 3QZ5B 5GANe 5E3OA 4A59A 1HYZA 4X65K 2KZGA 1B6AA 3AO5A 1VOMA 3BT9A 1TK5A 3B6PA 4EQQA 1HSJA 3BG7A 3C6TA 1USTA 2MABA 1JKQC 2F5EA 1JE8A 5AQTA 1ILYA 2G7HA 4DTNA 1FOYA 1EH7A 3KK7A 3J7ZO 2P5OA 1BOBA 3DPUA 2COYA 5DCMA 2IT0A 3DPLC 4WF9L 1VQNT 4AH9A 2AHJB 2IS1A 1SFUA 3CCJN 2K5CA 1XG7A 1OH6A 3E97A 4PGHA 4YELA 3AV9A 1MWKA 3EFOB 2OFIA 3JCMP 4JZ4A 4XIDA 1TGOA 5C6SA 1MGTA 1QSLA 1OU9A 4C8QD 3H0HA 1C1AA 2IDOA 3DLLL 4LH4A 3BY6A 2LP5A 2YRVA 3PM1A 2WV0A 2CS7A 4DYQA 4A3IJ 3CCEQ 1RESA 3DFGA 3QYEA 5C4JJ 5IYBJ 1S1TA 1LDDA 1HLVA 2KR3A 2IW5A 2X9HA 3IAYA 1KQ9A 2YX7A 2E1MB 3L2UA 3T7ZA 5D6WA 1QVGA 1M2VA 2CH4W 4PKGA 3LWHA 2D45A 3Q3SA 2DLLA 4B9WA 2JW4A 5EGOB 5E18F 2ZNZA 3OW2P 3GMEA 5CKDA 4BROA 5HK0A 4BRMA 4LLGF 3KP5A 2X6YA 4L0ZB 1ZQ1A 5LMNK 4LD6A 4BXUA 3QWXX 4OB2B 4IOCL 1XSXA 5GAMf 3I55Q 1WZOA 3F21A 1UZCA 3BDUA 1ZTRA 2K86A 5F08A 3FXKA 1BO5O 1PUFB 2V7FA 2OZSA 1B8IB 4CCJA 4L9TA 1IXSB 4YY3K 4F92B 3CMEQ 4A3FJ 3O9RA 2KLAA 1LDKB 1BQNA 3GZ5A 3MKWB 2DE0X 1D8KA 4HT8A 3FFIA 3LGLA 3CCJT 4DYCA 1FSEA 5DM7L 3DLGA 2CUJA 4PKIA 5CK9A 1NBWA 1YW7A 4LB5A 1YWPA 4NYNA 1RUNA 2ZJPF 2WOMA 3SUQA 2ASPA 1OZ2A 3NGPA 1Y96B 4N4GA 4FOEA 4EIAA 4XTUA 2VKDA 1SSFA 2E2QA 4B08A 2BUPA 2RQUA 3CBMA 4EM2A 1Q8IA 3MO8A 1LWWA 4H0YB 1YFHA 1HKBA 3M9QA 3CMAT 2XY6A 4E9EA 4BEHA 1K8AU 5JLXA 3RRHA 1GXIE 1RBUA 4OFAA 4FWKA 3WHBA 2PY5A 1UHCA 2R7YA 4DV7K 4DLGA 2AQFA 1XSDA 1V5FA 4B1XB 1TLHB 2VPRA 1J54A 3SXYA 1IDZA 3FEOA 4C9YA 4E7JA 1B3QA 2FZKB 2A6TA 4XH4A 3BWGA 2Z99A 3LDSA 1QQOA 1YJ9T 5F1RA 3MP1A 1NJIU 2XASA 2B0LA 2ZMEC 2UYTA 4CEQA 1KQ1A 1VQKI 2DEUA 1XQHA 4ZH4F 2GUIA 1DGWY 4LFBK 2IVOA 4AIAA 2YSQA 4DQPA 1BJZA 4NB5A 2QKKA 4RCHA 1RRSA 4AM3A 3QEWA 1ABQA 3Q7BA 5CYVA 1HNIA 2PNIA 1LEBA 4MDWA 4ME7A 2O0YA 3T1BA 1RTIA 3JW4A 3X20B 2V9VA 1JJ2M 2O8KA 3EE8A 4DFPA 1KAZA 4YOTA 2K5FA 1TTHB 4PLLA 3REBB 2VOPA 3MFKA 1R0CB 5GAN2 2MD5A 1I6XA 1PP8F 2OCEA 4A6DA 2A7YA 2VN2A 3F6OA 3IRQA 2ECZA 1S72Q 3CUQB 2D2WA 3BZKA 4DIQA 1LPLA 2QQ9A 1YJWA 1CSKA 1K8AR 4ETSA 4LE9A 2QEXI 4O6JA 2RK2A 4BVOA 3P83D 4XTVA 3KLOA 1RI7A 3GTGJ 1IC8A 3K0LA 3CCLT 2E2IJ 1IB8A 1GHCA 4CJVA 1YN8A 2E41A 3LSKA 3WVEB 2HMIA 3ER0A 1JT6A 5F0FA 2ZPHB 3DXKA 4IOCF 3O6WA 2IVMA 4B22A 3VQ9A 3D5SC 2ED0A 1AWWA 1T6SA 4MQVA 4W5RA 1SFOJ 1LWVA 4KHQA 2D5RA 3ID8A 3C2BA 3DF8A 4BQZA 2YSRA 4KDPA 2R7QA 3F3XA 5GAOp 2EV6A 2J4RA 1I50J 2EJ9A 1RT7A 1K79A 4FWRA 4P96A 2NUTA 4DV0K 2LNHB 4YDUA 3O9TA 5FLXZ 1LKXA 3SZGA 4IUPA 1CLQA 4M77B 1WSUA 2P84A 4JOMA 4DKWA 3EN9A 3CCLI 1GFDA 3G6EI 1E7OA 4Z4EA 4RW7A 2FBVA 3CQ8A 1Y0UA 3DP7A 4RTWA 1I0CA 5LJ3j 1GLEG 4YPRA 3QOPA 1QCNA 5FPMA 4M41A 4M73A 2K3PA 1LDJA 4YFUA 3K9JA 4BREA 3I53A 2JUFA 5J3LA 3O8HA 3EZWA 1KLMA 2JK3A 2NUPB 1OYXA 3JAMZ 1HC8A 1MMGA 2XKPA 5KN8A 3T1AA 1FTTA 1QP3A 1AOJA 2YHYA 3WNFA 1ZH5A 4PJJA 2CP3A 1PDNC 5CQGA 5I2MA 4GCVA 4M3YA 1SF9A 2EILH 4XTWA 5A2QO 3M6GA 1K0SA 5GAMj 2BKDN 5AQOA 4CHYA 2DYBA 4CJSA 5GINA 3V8JA 5DUIA 2GA1A 1V29B 1V5GA 2ZSHB 2VGMA 2PTKA 1BUPA 5ECAA 2KY9A 1Q82O 4E47A 3VS6A 3MXIA 1RR7A 1MSFC 2XAJA 1VRLA 3CC2I 4R5PA 3TAGA 1Y71A 3FFKB 2Y0SA 3CCSQ 1JGSA 4FK0A 1VQKA 4KH5A 1K0XA 2KDOA 3CHWA 4J7FA 3UA6A 4FX4A 1A0NB 1VAZA 2VODA 2IC3A 2R3SA 4IOAL 2NVTJ 1TUUA 4DUZK 2KXDA 1Y1VJ 3BZ6A 4C8QC 5K7FA 4FK4A 3C3WA 4RGRA 2HWVA 2XIGA 5FW9A 4D8DA 1MNEA 3CPFA 3SLCA 1Y8QB 3VEXA 4PIIA 4LD9K 1NGJA 3K5MA 3ZN1A 3GFJA 4EM1A 2HNZA 2CT3A 4M7DF 1SSHA 5M1NA 4EHTA 4BS9A 4C30A 4CZLA 3VQBA 1VQMI 3I5SA 3NARA 1IF1A 2XF6A 1IV8A 2JA2A 3P38A 4O44A 4F3QA 3ERMA 3CCRA 3U4LA 5M5XJ 5IOYA 5BNGA 1YJNT 4N0AC 2DKGA 3DXMA 2VBWA 3UE5A 3KLGA 4FJ7A 1VSKA 3TAFA 3SFIA 1DGKN 3SYTA 1C1CA 4J9GA 4RB2C 4XQFA 4OOIA 2NVYJ 4L5GA 1SV5A 4DTOA 4B3MK 4OPHA 4CI6A 5AFUH 2X6XA 4KRFA 5K5OA 3F10A 3MXJA 3H5AA 1LPQA 1WXBA 3EAEA 2XICA 2X6WA 5L3GA 1X1BA 3LDPA 3AVMA 3CCRT 1SVMA 3SZTA 1VQLA 1CZBA 4EP5A 1NLVA 3PQKA 4OLBA 2P5VA 2KEAA 1ZUYA 4ZYHA 3K70D 2CGPA 4BD3A 4AI5A 4PLIA 3SUOA 3ULEB 4I02A 2DFUA 2KQWA 2FBIA 2BY3A 1K9MC 3CC7T 4AT1B 5J39A 4M72A 1K8KA 4KPYA 3K4NA 4M7AG 1YCSB 3M1CA 3SV3A 2QQSA 3CCVI 2NRTA 1IAWA 4HA8A 5CHZA 2DAQA 2W85A 3U21A 4AD9A 2LQKA 5HNHA 3TL4X 4UXNA 1WJAA 2I7NA 3KUFA 4XQ3A 3CCMT 4GFBA 1Z9CA 3J80Z 3JRHA 3NFCA 3EKUA 1KU9A 1OCPA 3G0ZA 2GQVA 4F52A 1AT1B 4FLXA 3ULQB 2XHIA 1N6QA 4DR1K 3KYLA 4DSFA 1T98A 2CUFA 3R0JA 3BCBA 1GLLO 4DB3A 3IHUA 1I1SA 2ESNA 4PJNA 1RBTA 2WACA 3IKVA 2JTFA 1BI3A 1N8RO 1O3TA 3NVMA 5CVUA 4P5OA 5KE2A 4JK9A 1Z7LA 4B3AA 2NOBA 1BCOA 1H3HA 2CQKA 2XY5A 3HXMA 3FJ5A 3K5OA 5F2RA 4A4HA 1BM9A 2RI3A 3WVDB 2VQCA 3HTRA 1YX3A 4JUVA 4DTUA 4DV5K 5LGUA 1U2WA 1EKEA 3I0SA 4NL3A 4OB0B 3QYHB 3BPXA 2DJQA 1KONA 5KYYA 1KQSS 2QTDA 4YHHK 1SL2A 3G4SN 5T7BA 2QEXT 2HFHA 2CGHA 2NAZA 3PO3J 6AT1B 3ZQIA 2EGAA 1O13A 4FZYA 3DKWA 4J2EA 3BDPA 2O8DB 4QVCA 3V9SA 1LJOA 3MP8A 3SHWA 3SBTA 2G8IA 1HW5A 2K57A 1LAWA 2ZJQF 1Q86R 3OIPA 2K85A 4E9FA 1L5UA 2F5FA 3SEQA 2DD5A 1ZSZB 2E2JJ 2V1XA 3ZEUA 1NK6A 2L3RA 1NPPA 3OS1A 4KH1B 3GTLJ 3HXLA 3I8DA 3DQVC 1UHMA 2HQ5A 1XHZA 4YFNF 2OQGA 4BH9A 4YFXF 1XC9A 4O4GA 3EFSA 4FVUA 4XRMA 4RAFA 2VG6A 1KCFA 4IUVA 5GAMh 3NQOA 3VESA 3VSKA 2JMCA 3R61A 1L3VA 1VQ7N 4L5JA 1PWTA 2LH9A 1K78A 1RDWX 4XM3A 1K8AC 3DWLA 2HEQA 3KEQA 1T0FA 2PMZN 1YIJQ 4XMYA 2L7MP 4AIHA 1U3EM 3V9ZA 3CCVT 2QCOA 4XN0A 4HQMA 3CWSA 5BS6A 2E70A 4Z0UA 1W7PB 2NRZA 3MAJA 3QO3A 5IHKA 4BRLA 2EYZA 3TMOA 1NH3A 2QWWA 3J81Z 3A0BC 3TP0A 5DYMA 3JSCA 3K5LA 3DPTA 2CSQA 1IGQA 2WBNA 3WHCA 3G0QA 2VJJA 2W40A 3EY1A 3W6KB 1T08B 3LSGA 2ZF5O 4OAZA 4IHVA 3J81K 5F0HA 2ECBA 5JFRA 5J1RA 1TWGJ 1DTTA 3CJTB 2YHBA 2PQ8A 2NUTB 1ON1A 2JS0A 1RAHB 2D0AA 2LX9A 1RUOA 4EMGA 1WGXA 2LDUA 3MD2A 5BR9A 3VYUB 1V5EA 4C3HJ 4NCAA 2YHTA 2HOAA 5J4VA 1K4SA 3O08A 5D7UA 3S3MA 1T3LA 3SV4A 3NF7A 4FLYA 4B21A 1YJ9I 2FBKA 2Y1IA 2MG4A 3QLHA 4CGIA 2R5ZA 1QBJA 2F4OB 2XKOC 1G4DA 2A08A 3RPUD 3KZBA 3ZMSA 2X0LA 3JRZA 2X48A 3KFVA 3DLHA 3BLYA 2QXLA 3BJOA 2OV7A 4M77G 4CF8A 1T03A 3GTPJ 2RHYA 4HUEA 1TQIA 3PO2J 1H89C 3CEYA 4IEIA 4IRIA 5GJWB 3TWHA 2ABLA 2FPEA 4JLHA 2HDDA 4FWOA 3P9KA 1W36C 2MWOA 1ZUUA 4HDUA 1DGRM 2E5QA 3HSCA 4CEDA 3C0BA 1NGEA 1YOVB 3CCQN 3Q7CA 1LMZA 4PL8A 1TU0B 3CCUN 3LZJA 3Q0VA 2XGEA 1K4US 4J9DA 2RHIA 3G73A 3HI0A 3SYZA 4NOYA 5DDGA 2HXIA 4HBLA 3EH1A 1W5CC 5AT1B 3HZJA 4PFPA 3G71I 4NQWA 3VB2A 2QLZA 4AIJA 3CDLA 1BC8C 2KAFA 4IZ9A 2KYMA 3LSMA 4CBWA 4CESA 2Q36A 3K1NA 4JKGB 3L2RA 2DRKA 3MKZA 1YJWN 4DR2K 3CXCS 1T8EA 4A2AA 2EQMA 2P0QA 1WAJA 1VQOA 4B3OA 4DZPA 1OZ3A 4CC4B 3VEVA 3JTHA 4XICA 4JI4K 4LGWA 3TSQA 1KC8C 4Y7NJ 3DLKA 4EZ9A 2X6NA 1R6RA 3KHYA 3RDIA 4NNJA 1X4OA 3EO3A 3ZT3A 3K10A 3K1PA 2GTDA 2GBZA 1KD1U 5GPCA 1Y6IA 1WSJA 1TC3C 4FOIA 5LFAA 1E4FT 3FZLA 4HXJA 3CCJA 1HYSA 4HCKA 4CZJA 2EYQA 1KG4A 3D1NI 1M90C 4CZGA 5C4XJ 3GZ6A 3NF6A 1YI2Q 2E5ZA 3SJMA 5A2QK 4GXOA 2L54A 3H1CA 4PFOA 4B4CA 3PIPL 3THWA 3CG7A 1ZR4A 3FLCO 2XV4S 3SHFA 1VA7A 2VXZA 2HOTA 1VSIA 4XIUA 2DJZA 3FE1A 2E4LA 3MDQA 2E65A 2L9SA 1WJSA 2EX3A 4CF0A 1BBYA 4C5GA 2OTJT 2JTMA 1O3RA 3VQEA 1IREB 1WFXA 2M0YA 3WXLA 2OJ2A 1UUEA 4UOBA 3KFWX 5GMKe 3TOBA 1M1FA 3MEVA 4RAYA 4M75B 4WQ4C 1OULA 3VPRA 2I5JA 4JP0A 4EMKB 1LE8A 3ULRB 2IAIA 4KUIA 1Q81R 2A40A 2VXDA 2DERA 2ME0A 2IBDA 1H3ZA 3MEXA 2NZTA 1WHMA 3OYHA 4G9YA 1UA1A 1SD6A 5HCKA 1H92A 5HS7A 1S7EA 4L5EA 2HBWA 1K9MO 3F8BA 2EPFA 1LFPA 2DN0A 4FJXA 1ZQ3P 4IFEA 2EB7A 3I64A 4JKEA 2NS8A 3BDDA 1ZSZC 1VQ9T 2O8FA 1WOQA 2NOFA 4DJAA 1P7JA 3CCEA 3A8HB 5DLOA 3A4CA 1SC7A 1ZBJA 5FKMA 3F8MA 2RAEA 3TR8A 2ETJA 3CCMI 1QQIA 1BU1A 2DTHA 3VS5A 1M3QA 3EG1A 4KB1A 3TVTA 4JPBW 4NQWB 1RBVA 3LP2A 2KRFA 2QDLA 1FW6A 3I5RA 4OGEA 2JPSA 4EIKA 1ZG3A 2Z2SB 3GO5A 3ZCMA 5J1EA 1MMNA 4RB1A 2F9TA 1RDUA 6PAXA 2R7DA 2HD0A 3TEDA 4J8OA 4NC6A 1I8FA 1YITN 2ZD1A 2XB5A 5BPMA 5AQLA 5D6EA 3C6AA 3CCMN 1G2HA 3GTKJ 3A2KA 1PSFA 1ESVA 1ZGJA 5ICFA 2HHQA 2UWMA 2GV9A 4D7NA 1RLQC 1JLFA 3O8MA 3LAJA 4OPKA 2IGKA 1GL5A 1YVNA 1OMIA 4BNCA 1LV5A 3ZRGA 4DUYK 2OPRA 4ELTA 1T3VA 4IX7A 3HBLA 2QK0A 3VU3C 3EYYA 2DMNA 1R1UA 1EO1A 4DFJA 2AA4A 3H5NA 1ABOA 4ZGDB 3LPUA 3S16J 5KAIC 3N4MA 5IHIA 2X3XD 3THYA 1HQEA 1FPQA 4CF9A 4KJZA 1NK7A 1YJNQ 1TL3A 4CCNA 3RKYA 4PA1A 1IRGA 4KBOA 2Q2EB 3TGNA 1FJGK 2IS6A 4M7DD 3UT1A 4M3GA 4BRKA 3MEWA 4PUSA 2DT6A 4IDHA 2B4JA 3NAEA 1U48A 5FKLA 4C8QE 1SFKA 2BHZA 4FISA 2H8WA 5DUKA 2HHHK 5H6QA 5GIPA 3CQXA 3DV8A 4WFNL 4KHPK 3JCMe 4RS8A 2FPFA 2NLXA 1D3YA 5FWCA 3RMSA 1IGUA 2G0EA 1D8JA 1R7JA 2PUOB 3L9FA 3K58A 4KTWA 1H9GA 1X9WA 1P4WA 4EA4A 5K14A 1AU7A 1FIPA 1Q82C 3ROUA 3FMQA 1Q7YO 3MN6A 1MZBA 2RQVA 2ENMA 3U9ZA 1QLYA 1WSFA 4X1EA 4CERA 5FJ8J 2NVQJ 5C15A 1QNTA 4FLVA 3SQ1A 2MH2A 4AUXA 1J6ZA 3BF3A 4E1MA 4B3TK 4CBUA 4JAXA 2HS5A 1U8BA 4I09A 4DOZA 1NNEA 3ECOA 2MGQA 2XPVA 3PUFA 2V79A 3X28B 4ZDOA 1AHDP 3CWAA 4M3EA 5KE3A 2YNIA 4LLNA 4PJ0C 3AAPA 1B7TA 4BRPA 1I1GA 3AG2H 4B1VA 3HEFA 1W4MA 2W41A 4KHNA 3W2WA 4B3RK 2ELJA 5GPAA 1REVA 3J80E 2MLKA 3ECHA 1JB0E 4I76A 2KDSA 3ZETB 2CP7A 3AL0C 3DKXA 1ZG1A 3M55A 4FHTA 1EV7A 4YORA 1UG1A 4NL2A 4LNPA 3CCLQ 2YHAA 2VKHA 1XPXA 4MZTA 3AY9A 2DTZA 2HSEB 3KP7A 1FKPA 4C8LA 3OYEA 4EM0B 2MCNA 1WJCA 2PJPA 2QKLB 3X24B 2W00A 3M7GA 1SD7A 2E5LK 5KYNA 4JKHA 3L0QA 2R0QC 2O61A 1OV3A 2ATCB 2X78A 5M3FJ 3M5RA 2FBYA 2DA7A 4XAXB 1HNVA 3CTAA 3K7AJ 2FF6A 5ILUA 1HF0A 2GNCA 3EL2A 2DA9A 3KJVA 3FSPA 5LJWA 2KQRA 4NHJA 3GWZA 2E5KA 3RWUA 5F0CA 5FROA 4BGAA 3GFMA 1KRPA 4DU4A 1OPCA 4LFUA 1HJDA 4K42A 3NWTA 3R8EA 3THXA 1WSHA 5IYCJ 1WEIA 3RMCA 1IXRC 3GOIA 3ASNH 1E4GT 3RKXA 2Y69H 4KV8A 3E9FA 1DJ7B 5GAN8 2ZKZA 4B9UA 1DP7P 1T3SA 1SEMA 1BQMA 4XK8E 2YLCA 1N3AA 2DOFA 2QA4A 4EMKC 1Q9XA 4XSZF 2D1HA 4PKHA 1QKWA 3CXCP 2DJIA 2FUG2 1YJNA 2FVUA 5HLIA 1EJ9A 1YJWQ 3VGKA 3EG9B 3JCMW 4QQ6A 3VQ5A 3FHFA 1S72A 2VWFA 1R5ID 2VJ4A 3ESWB 1D8YA 3SZ2A 2FMLA 4RTXA 1ZBSA 4NLBA 2GXBA 3G71N 2XB0X 4GV6A 2XHCA 4RTVA 4DK9A 1K6OA 2V9PA 1VQ6A 1PNJA 4GGGA 4NS5A 2YI1A 3MX2A 3LGFA 4EJWA 3V7CA 5CAIA 4DA4A 2YR2A 4JLIA 1MMDA 2P9UB 2OZMA 1U5TA 1T0JA 1GCQC 1TWCJ 1N8RU 4DTMA 3R6OA 2LY1A 3WXIA 3L42A 4LUDA 3M9AA 2DFFA 3QO9A 4BBSJ 3CO7C 4BR9A 3HPHA 3Q5FA 3DLEA 4IPAA 2MI6A 1VQOT 1U9NA 1ATNA 4CHUA 3HKSA 2ZXWH 1HYVA 1JGGA 2WTUA 4C8KA 4H8KA 3ZT0A 1BN5A 2EZIA 3OYCA 2ZPBB 2OFKA 1M8VA 3EEQA 1K9MR 2M2EA 1HSQA 3SFMA 2V9KA 3K70C 2V1QA 2P9SA 5HLFA 1ASUA 1X3ZB 4DGWB 5AONA 1OU8A 3K5NA 5L3FA 1PU7A 2E3IA 5AQWA 1RTDA 4JQFA 1X3NA 1MIJA 1XDUA 5E3MA 2W6KA 3KETA 3K4BA 4RGUA 2IPQX 3AARA 4KMUX 3FHGA 3L2VA 3VA3A 1YP5A 2M5WA 2K9GA 1UELB 4JV5K 3ASMA 4H4OA 2HU9A 4DSJA 3EGDA 1P92A 1PJRA 2EZKA 3TW6A 2DMOA 3O4WA 2R58A 1TKXA 4ZTJA 3J8AA 8ATCB 4KFBA 4BHPA 3LNQA 5HKCA 2I10A 1HNWK 2L9RA 4ELVA 3AGKA 4XBFA 2K7AA 1VQNI 2QAZA 5D6YA 5DV5A 2LY2A 2EKOA 2P9LA 2YUSA 4KMFA 4UC4A 4F14A 4TV7A 4LF4K 3CCVQ 1KD1C 1K8AO 1YI2N 3BY5A 5FKOA 3PFYA 1BW5A 2HZDA 1N5ZA 3MXMA 3GP8A 3DOLA 1DU6A 5AN4A 2JNGA 1I5LA 2JXBA 1KXPA 1JLQA 2J05A 3FC3A 1F9NA 4HAMA 3TU4K 1TWHJ 3VTIA 4B9NA 1Q7YR 5AQPA 4M3WA 3BG9A 2PN6A 1I07A 1OVQA 2XDVA 3WNEA 3NCIA 3CZ6A 1TBXA 4NDLA 1GFCA 1YJNI 1HPZA 3PY8A 2DA4A 3KLIA 2A28A 3AVJA 2KRNA 4YOUA 1BL3A 2O8XA 1P59A 3CCVA 2CZ7B 4DR4K 2L2PA 3ZQQA 3AVIA 4BR0A 1QWEA 3HSFA 4J6WA 4CCHA 4CF2A 1CKBA 3FZVA 1CZ9A 2DTRA 3EGUA 2DX1A 3CD6T 5K5RA 3S15J 2RE2A 2DXTA 1PP7U 5JLFA 3CDHA 4PDKA 4V19K 1X2KA 4W5NA 3L3UA 3NMUA 3EKSA 4BU2A 1SKRA 3RI4A 5B3SH 4AG1C 2UUBK 4ORZA 1W2BA 3BOQA 1GCQA 1WH5A 2EBPA 4E7SA 2FSWA 2L9NA 1LFBA 2HL3A 1PVSA 2IAJA 3E3VA 1XC5A 4M63C 3A8YA 2Q1NA 4F4KA 1CGPA 1Z1DA 3F0ZA 4QVZA 3F73A 3JTGA 3H9NA 3OWTA 3GLXA 5D5XB 4CZEA 3ZETA 4F3OA 1NKUA 4DV4K 3SDGA 2D1KA 2NLUA 2R5YA 5IT9K 3AO2A 3CCMQ 1HNZK 2DF6A 5CPRB 2VKNA 4DCHA 1U1SA 2BZXA 2XRNA 3VS4A 3VS0A 2KRSA 4E2FB 2DL3A 2RMOA 5SZTA 1NGDA 4BDZA 2QYZA 3TAQA 3K59A 1IN8A 1TQMA 1UGSB 3NNQA 3M8QA 4IDKA 4X1VA 4CGGA 3HUGB 3DLRA 3LSIA 4BRHA 3VF2A 1Y0NA 2DMPA 2E12A 1VQ4A 4C23A 2CQXA 1XWLA 2UV1A 4CHZA 1MWMA 3OTOK 3OW2S 1I4K1 2GM4A 3CC7A 3CCLA 3LM2A 4BUGA 3VGLA 4ID1A 5HROA 3BR1A 2WADA 3BF1A 2EV5A 4ICLA 4XRSG 1RI0A 1F21A 1IJWC 1LWEA 3NF9A 1NBEB 4NYFA 1U04A 2M8EA 1IKVA 1LFUP 1QVFS 4KI4A 3PSFA 4J8FA 3VYRB 4F7UB 2DIQA 1VI0A 4MLHA 3H46O 4RLQA 4AFSC 1F1BB 2XO7A 5F04A 2HHSA 4FT2A 3BUZB 4J2BA 3GBQA 5M1FA 4BY7J 2WV1A 1MV3A 2LF7A 2XAUA 1Y39A 1BIZA 2RPNA 3VV0A 4I2QA 4WWCA 2LCCA 2DW4A 1YIJA 1LJ9A 2K9LA 4KTQA 3AG3H 4PQUA 2Z3YA 1QPMA 4IHTA 1M30A 1M1KU 2YHWA 4UUTA 3V8LA 2AJQA 3ABKH 1U1TA 4XTZA 2HVQA 1VQMQ 1WUAA 2RQRA 2V52B 4UY8O 3BR5A 3DB3A 4MO4A 2P5LC 2GQQA 2KPMA 1VQ9A 1AOYA 1MH3A 1MSEC 3OHRA 1PG5B 1HKQA 2G8UA 3CJCA 3BC8A 4Z4FA 3CF5F 3S1QJ 3CCQT 4JI1K 3L7WA 4A4KA 4CJFA 4ENNA 3BJ6A 1AKHA 4CGZA 3TTCA 2FJ1A 1RDCA 3OYGA 3G4SA 4E0DA 1MBKA 2X4WA 5AQSA 3VQ7A 4UV9A 1USSA 4CZKA 1XUPO 1QRYA 4FJNA 4G6DA 2OAWA 1RIOH 2Y31A 1IUFA 2O6GE 1GV2A 1HSTA 3MQ0A 2Z5UA 1M8MA 1NWKA 2JRMA 3MX5A 1RDBA 4B1ZA 3LFKA 1D3BA 3CC2Q 3PO5A 3G71Q 1XHXA 2BGCA 3VQPA 5C0YA 3IH7A 1SKWA 4II2A 2EINH 2F8SA 2NRXA 4AHVA 1PUFA 2OI3A 2YNHA 4FK2A 1AZEA 1BJAA 3DWLE 4FLUA 3PIOF 4M3RA 3LAKA 2ZGYA 4RAZA 3UNGC 3OJSA 1Q81O 3IAS2 3DYAA 2NUZA 3THYB 5EEGA 3RPQA 2DXCA 2IJLA 1B34A 4XONA 5AZIB 5GMKm 1OYIA 2DYRH 4ZN1A 5C3EJ 5LJ5f 1WVRA 3JRIA 2PQWA 3VQDA 2VLAA 1E6HA 3A98A 2F4MB 3AFHA 4HNTA 1YHQQ 1E6GA 5M1OA 1LW2A 5KK1A 3RPUA 1EETA 2Y4YA 2NYXA 3ULDA 2OTJQ 1BI4A 4R1HA 2R5YB 1M1KR 2HQAA 1QP2A 2NYSA 5A0LA 1YJ9Q 1WWXA 1NJWA 2HF3A 3QBWA 3HL2A 3S32A 4KGZB 3V9WA 3X2QH 2EZHA 1ZXOA 2HXOA 1X1AA 2JA6J 1VYUA 3ZX3A 2ETHA 2IS4A 3K4LA 1MDMB 2HEOA 4UNOA 1DIZA 4C8QF 3VQQA 2DETA 2A3SA 4FT8A 3LAPA 4N0AA 4DW6A 3HOZJ 2BOLA 5BREA 3LSJA 4QCLA 3QDKA 5AQIA 1W5TA 1L3SA 4W5OA 1JCEA 2JN6A 3ZSYA 1S7AA 3LCNA 1FOXA 1T6DA 3FDRA 3KX2A 1VQ9N 4HNVA 3HBTA 1VQ8A 1G8XA 1ZBFA 3AVNA 2F5DA 3C7NA 2BH1A 2ZB9A 1O9SA 3H1QA 5CVJA 4CJLA 4EEFG 1UE9A 3DXJF 2A6AA 1YIJI 4C2MJ 3T19A 3FMRA 1FBQA 3W3CA 4M7AC 1SD4A 9ATCB 1NKBA 3OL3A 4LF5K 3VOVA 2NVUB 4KIFA 4WCEL 4I6MA 3HGYA 2G3RA 3KIOA 1JXMA 1I5OB 2E8AA 2G8VA 3G25A 1IN5A 1U6ZA 5SWMA 1WB9A 5HOOA 1LOTB 3H92A 5AQUA 1WHHA 1QSSA 2KIMA 4BQNA 3J81O 2DK3A 2XY7A 2QQRA 2Q31A 1NK2P 2J7IA 4BR5A 2KMUA 4NUBA 7AT1B 1N34K 2QEXN 4IJNA 4CGFA 3R0AA 2EGCA 5LJ3f 3U1KA 4D9JA 1TT0A 4KH6A 2FG0A 5IY5H 4OVLA 1Q1HA 4K11A 4OWRB 2EHGA 3WQUA 2YJFA 2VGNA 2OPQA 3GBGA 1BA5A 5ADXA 4JYKA 1XGOA 1VQ6N 1UB9A 4G1QA 3HYFA 3JV3A 2X6OA 2QBYB 3HVRA 5EU7A 2LP0A 5CKEA 5KYXB 4JYAK 3UKRA 3LA7A 3ZSWA 3BG6A 5J3BA 4XU0A 4UQGA 3WXMB 4M3FA 3EHRA 3E6BA 5GAN7 4FT4A 1WXUA 2CG4A 5KHDA 4XKCA 3RTVA 5EG0A 2BUDA 2DYIA 3OYIA 5GANj 4HX8A 2KGTA 5BPLA 3E2UA 4HF1A 4QPQA 4O3MA 4LF6K 4ZHRA 1QZ5A 3KK3A 3OYAA 4FLTA 4DYRA 4F7UF 2RHUA 2A5XA 4E70A 3JREA 4CUGA 1WHJA 4XK4A 3CMAA 3MKLA 2VQHA 4ESFA 3WE3A 4RGSA 1W7PD 4B3XA 1MU2A 4JJCA 4UNFA 4KRTA 1RACB 2ELHA 3JSMA 2UUAK 1NPRA 1VQKN 1ETYA 4MZPA 1LW0A 4P9UA 3REAB 5IAYA 1NJIO 1HR0K 2CDTA 2IXSA 4WQ5C 4QKUA 4A5MA 4F2SA 2NRWA 1ETOA 4BRIA 4ZYGA 4FWSA 3HP6A 5GAMg 2W7NA 4CHNA 3SB2A 3AVLA 2OJED 4EMHA 3QFPA 4CICA 2FBTA 4IOXA 1Z3XA 3GNGA 2Z1HA 1QVFM 1NJIC 2O9VA 3QHSA 3NFAA 2VQEK 1R71A 2O31A 3QZ9B 2A3ZA 2QM1A 3QBXA 2HQNA 4CHQA 1O7FA 1RNLA 3F72A 5GAGJ 2OAZA 4CE9A 2UXXA 3DAWA 2GBYA 3CD6I 3CCJQ 4FZZA 4JJNK 1NZ9A 2BHYA 3KP6A 4HCZA 4LN2A 3U2RA 1YTUA 1N6AA 4JI8K 2X35A 3FZKA 4E1NA 3PIOL 1X9JA 2M7BA 2HBMA 1Q86O 1QSYA 5KYUB 3MHXA 4PJOD 4O8UA 2RQPA 1IGNA 1WX6A 1A6QA 4LJZF 1IZ6A 4L9NA 3O5BA 1D1BA 2X1DA 2Q1ZB 3OSFA 2JA8J 3QIIA 1PC0A 1T05A 2EH3A 4JBAA 3BPVA 2EFQA 1AA7A 2NNNA 2ESWA 4W5QA 2FNAA 4LITA 2XI9A 5KVRA 2PVGB 2YX4A 2XU8A 2RK1A 1VYVA 3OBYA 4N4NB 1HRHA 4RBOA 2KT8A 5FPDA 1ACMB 3W3DA 3LQQA 1G15A 4Z2YA 3UB5A 4L6V5 5LJ3d 2ASOA 1JEGA 2W10A 3G6EN 4AVPA 4MMKA 3GYHX 2DTUA 4C8MA 3I55N 3OYLA 4M7DA 2YNFA 1OCRH 1ETQA 2ZXJA 2DTOA 4J83A 4HDVA 4KGVB 1PKSA 1JBMA 5CCAA 2DVEA 3NH0A 2O03A 3NE6A 4M77A 3DEWA 1FSHA 3S1MJ 4PJOC 1OCCH 1XSVA 1TNTA 4CYCA 3ML6A 4LB6B 2HQHA 3O4NA 1S1NA 1Q7YU 4JN4A 5LLQA 3F6VA 4OGCA 4LIVA 1REPC 1VK0A 1TAQA 3SMSA 3HSRA 3NGIA 1TUCA 3CC2N 2CGLA 4ZJZA 1Z05A 1S9GA 1V3FA 4ZDPA 4HVWA 3I56T 2ZJQL 1ZLKA 4DTJA 3JB9I 1WQ7A 4E7ZA 2A69F 4PKCC 4V2SA 1HXDA 2QW9A 5DLQE 1ZSZA 3LAMA 4ELZC 5GADJ 3DLLF 1YX5A 3SFZA 3FRNA 3G71A 2ADUA 4AFQC 5D5VB 4KGXB 2IS2A 4FWQA 3NTHA 5J2MA 4L3QA 4BXFA 3CFRA 3K2PA 1BG3A 3AVKA 3IHOA 3FZMA 3UDCA 1ZG5A 2W4SA 4EZ6A 1ZA1B 2A3LA 4JJBA 1SG5A 1C6VA 1WBDA 2VYTA 3ZX2A 3UKGA 2VE8A 1VQ7Q 2NVXJ 2LTOA 4B8AB 5MLCQ 4HCCA 2KXCA 2J6FA 3ZT4A 4XRSA 2EPDA 1V4RA 1UCRA 3CLQA 2LK2A 3QPSA 3CC2A 3HM8A 4BY6B 4RA2A 1WQ2A 2FSNA 4NCGA 1MBGA 3QPTA 4B8XA 4N5SA 5CYQA 5ICCA 2VONA 1YBYA 3WODF 3TAMA 1JHHA 3RTRA 2CZ6B 4BUPA 3IC7A 2H1KA 1LB2A 4NC7A 5LHHA 2ZPIB 5GAN4 3TARA 1JCFA 3X25B 1KG1A 4E9GA 4A63B 5L3DA 4X6AJ 1QKXA 1KD1R 3SD4A 3CC4T 2Q0RA 3TI0A 1LWFA 1ZKGA 3RZDJ 1FYKA 4BEHB 3DI6A 3SDBA 3SK3A 4BE1A 5D8LB 5E8IA 2O3FA 2P9KB 1ZGAA 1I1JA 3I55A 1A36A 2JZ2A 1WCMJ 3MP6A 3P4IA 3BEXA 1MUZA 1O1WA 5IP6A 2M02A 1M90R 2KZVA 4QPOA 3U8XA 1RPWA 4PSWA 2QWRA 3ZMVA 3A02A 1JUSA 2XY8A 4YIIA 5I21A 2LJ1A 2XUBA 4FW1A 2XIDA 4EDUA 1M2OA 1K4TA 2Z1GA 3GX4X 1WLPB 4JZ3A 4ENKA 4I2OA 1NYGA 1TWAJ 3AVAA 1QZ6A 2NOJB 2XK0A 3VYTB 4IEEA 5ILSA 5KCMA 3L2ZA 1A5JA 4NO7A 3VUBA 2NOIA 2HR3A 1VQLN 4CEFA 1UB4A 2QG9B 3IP4B 2QEXQ 1W4SA 3T0YA 4CK1A 4BHCA 4B1YB 2EJGA 2O01E 1J09A 1S72I 1YJ9N 3IUOA 4CC3A 5AQVA 1S5JA 1V4TA 4U88A 4JRQA 3S2WA 2O88A 2UU9K 3FX3A 3K4JA 3TDZC 1VQ8T 1GOAA 2F48A 1X2MA 3CQYA 4H03B 4M3DA 1K73U 2NOGA 2P6SA 4UB8C 1KAXA 2HDCA 2ZPEB 3VF6A 1Q86U 2P9NB 2QZ8A 4FYWB 1R77A 4K25A 1JKRC 3RMAA 4LG0B 3V81A 4HSRA 4U7BA 1SFXA 3CMAN 2CSOA 2XMFA 2DOAA 1BOTO 4H0XB 1Z77A 1SL1A 4ZYEA 2HI3A 3VGMA 1J9IA 3A1YA 2QGUA 3ENHA 3QUIA 1YW9A 2CWEA 4J2DA 4ZYAA 2BTTA 1A6IA 3HJFA 3TKYA 1Y0MA 2K3FA 5C42A 3CCMA 2G8KA 1P7IA 2E6MA 1UJ8A 1VQMT 2Q8KA 1W2BM 4CCMA 1SVOA 2KHMA 1SFEA 2J5PA 3TO7A 3S3OA 5BRHA 1A5WA 2HKQB 1OJLA 3AO3A 4AC0A 4Z4IA 2DA2A 3JRBA 2KTQA 3T1YK 4B24A 3C7NB 4DNCA 3O4QA 3HKZN 5D4SA 1RAFB 2ZCWA 1S6LA 3NWSA 1N9RA 3HGGA 1FBUA 4PJOF 2KFDA 2VQFK 2R7FA 2CH6A 1RKTA 4MIMA 4FWPA 2A0FB 1SMTA 4XKWA 5K5QA 1NK4A 2KKZA 2OTLQ 3THVA 3CFOA 2BE2A 2SRCA 2VE9A 1ZHFA 1Z9QA 3T8TA 4BR2A 4F7UG 3DU5A 1FC3A 1VQPQ 4MO5A 1JJ2S 1NHAA 3VRZA 4BQAA 1C0GA 3TU5A 2V1DA 2DMUA 3DLBA 2LKSA 1U9OA 5AIPA 4B47A 3AA4A 4OF1A 3BR0A 5EDNA 1L3LA 4JRPA 5LHIA 3HTUA 2A07F 3S6IA 1BGXT 4ZNXA 3GBTA 4HVUA 1ZX6A 2E10A 4GLMA 2D0QB 3ERED 4JKBA 4JEPA 3I55I 1ZLMA 3THXB 5GMKl 4M9SA 4O0IA 2A5YB 3S1RJ 2IA0A 2EIJH 2M30A 2W6LA 3SPZA 3PNVA 4VUBA 3ZMDA 2P7VB 1VSMA 3AAFA 2QF7A 4OMMA 1TS9A 3PFSA 3DEEA 5I42A 2DTIA 4IIMA 4CJ3A 3CJNA 3H6ZA 5CR2A 3VENA 3LDQA 4A54A 2LC2A 3E1SA 5M1PA 3IV5A 2V1UA 3SUPA 3HO1A 1JKPC 2BE9B 2GLOA 3QYGB 4EMSA 5E1WA 5GANd 1RRQA 3E9LA 3LOCA 2BY0A 5KPTA 4BXXJ 5HY6A 3ELKA 4R79A 5E3LA 3L2QA 3WTZA 3HSEA 4FL9A 2EA2A 4YRVA 2I5WA 4Z89A 1YITQ 1VSJA 5F64A 1WGSA 3ID6A 1ITYA 3CVSA 4FVMA 1KLNA 4KHYA 4AHSA 2P5GA 2Q0UA 5IHNA 3IWZA 2O4XB 1P2FA 4Y0WA 1LOJA 3IG1A 2QUFA 1YHQA 2DXIA 1SHFA 3QEPA 2PJRA 5M1QA 1OX9A 2O9LA 4DQ8A 2PYJA 3SDZA 5KYWA 4EPCA 4C8OA 4LIUA 2F69A 2ELKA 5IYDJ 1WA7A 4M78F 1MUYA 4N4OB 4M7DB 3LSPA 2M4KA 4A2UA 2YPRA 4BVPA 4CO8A 1J5YA 4KITB 2ZCFB 4M78G 4OIPF 3EE9A 3OYNA 3E6MA 4DTPA 2CSIA 1VSFA 1QQCA 3IL2A 4B9TA 3QXEB 2NNYA 2IGMA 2BVLA 1UGQB 2LCLA 4EJTA 5EXWA 4KHWA 2QWPA 3ZOBA 2WC2A 4B9VA 1ATSA 5CIUA 4MTDA 2K3YA 3ME9A 5KPRA 4M3UA 1DKGD 4HV6A 1VQPT 4MLEA 3VJPA 4FETA 3NAUA 3WU0A 3EQLF 3LWLA 5CYMA 2GXGA 4FM1A 3S6WA 3D2EA 4R0KA 2HBLA 1F43A 1AWCA 3URGA 2K9NA 3AA2A 3M0QA 1EXQA 2E1YA 2IPOB 1I3AA 4BI8B 5HNFA 3WG7H 2QGGA 1K6YA 4PY5A 4C1NK 2K3BA 1ZBHA 5BMZA 2OZUA 3TW7A 1Q81U 4BRQA 3BTIA 4IUTA 4KT5C 3RQ4A 1HKTA 3CJ1A 3JCMV 2WONA 3A1PA 3AGRA 4ISGA 3JXUA 1UTIA 3ZFJA 3RSEA 3A5ZB 4QT7A 4BYYA 4BACA 4M7AA 2DMTA 1OLTA 1UA0A 4C2UA 1BI2A 1S1UA 2X3WD 1X6OA 1W1WE 4M7YA 3R9PA 2K79A 3D7EO 2LT1A 2ZNYA 3M4YA 3ZEUB 4IQ4A 4RCCA 3LM9A 3C6HA 4A69C 1P9QC 1Z3YA 5JHFA 1M1GA 5FD5A 2ASMA 3I59A 4LH5A 2Z1JA 1Y96A 3DB4A 2RH2A 3WEEB 1Q1VA 3D5RC 5LJ3e 1RZ4A 2ID3A 3SQ0A 1UFMA 4GKKK 1GVDA 5K7ZA 2XGCA 2RV8A 4M4ZA 1RT1A 1I5ZA 3F8NA 3R6SA 1HYOA 1QZZA 4FQGA 1VQ4N 4U0WA 3CCQI 1HKGA 1KGSA 1HBXG 1J75A 3IDHA 1WPYA 4AU7A 5KYWB 1BIBA 3TBIA 3OQ5A 3PL8A 2F2EA 4XLNF 1IO6A 1OH5A 3VQ4A 2DMQA 2DY4A 2BY2A 3HUGA 3JRDA 1TOVA 3E6DA 2JSPA 2NOLA 4BC5A 5A0GA 1R49A 2VT2A 1G6NA 4M6YA 1HA8A 1MUDA 3H3NO 1W0UA 3DLMA 4GY2B 2ZJ2A 3CD6Q 3ZQLA 3ZEHA 4RM2A 1T7PA 1RR8C 4KHUA 2PMZA 3ZP5A 4GW6A 5J2NA 2B5JA 3TSWA 3WXKA 3DXKB 2RC4A 2B7EA 2L7FP 2KT1A 4KAZA 1MGQA 1NGHA 1PKTA 2XGDA 3GLLA 3JRCA 2VV5A 2OPSA 1OYYA 3NEUA 3AG1H 1PRLC 3ZT1A 2VWJA 2PBDA 5JVTA 4IUQA 4LDYA 4DBFA 3LALA 2JS2A 2XDPA 5CZ1A 2X1CA 4DF4A 4YEJA 4YG2F 3JCMh 1EZZB 1Q82U 3M0UA 3WQTA 1CKAA 1POGA 1QPIA 5J47A 1XN7A 3AL0B 4ID5A 4AM7A 4LF8K 1G59A 3HOYJ 2ZPFB 4C0GA 4IUUA 1U2VA 1HLUA 3JCMd 5CVRA 1X75C 2OTLI 2AT1B 4XTYA 1XNQK 1JL1A 1OOTA 1WZ2A 2J6OA 3GVAA 4A5NA 1NTCA 3GTJJ 1SEUA 2V75A 4PHTX 4H5NA 3O2PE 1AKHB 2V1RA 1NOYA 3WUHA 4MFDA 5DM6F 1NG6A 3EH2A 1MA9B 3HTSB 3A8LB 4L0YB 2R7UA 2PZ1A 1N33K 4A0YA 3EG2A 1YO5C 3CC4I 3CFPA 3GF2A 5AZJB 1Z0XA 5GMKi 2P1JA 5GAOl 2M1BA 3ITHA 2TCTA 2M0CA 3A5OC 3JB9H 5IT9Z 1ZYRF 2YUQA 4H5VA 2YG8A 2IVWA 3H6EA 1FYLA 3H3UA 1VQLQ 2QGFB 3NBPA 4C5HA 2EQKA 1GLAG 5HLGA 5ERIA 1Q82R 4XNFA 2V4JC 1D9FA 3L1AA 3B6OA 5IN1A 2K7LA 3RZOJ 4GLKA 3VYGA 4II1A 3DBHB 1UHSA 4NLCA 4JS4A 2E35A 1G3TA 1YHQI 4HPQA 2HNHA 4LSNA 2VT3A 3WU1B 4CEAA 2LKXA 2CV1A 5KQ8A 2KBTA 2EZLA 3LP0A 4Z4CA 2ISZA 4QS8A 3B02A 1DPRA 3O3HA 3R3LA 2Y0SN 1C0MA 3VEYA 1VQON 1APLC 2G7UA 1U8RA 2JZYA 4M7AF 3CCYA 5A2QZ 1NMDA 1IG9A 1UJYA 2I8DA 4Y92A 3HM9A 1KG7A 2V8KA 4CYDA 3GUDA 2UUZA 3FIFA 5HVQC 3META 2MYSA 5HLHA 2EWSA 5HL7L 5AQXA 2A41A 5GAGP 1R23A 4IIOA 5TKWA 4ABZA 3M59A 1JLGA 4Z6YA 4CJ5A 4AHTA 5CKBA 1R1TA 3T69A 4BI3A 3PX4A 5EF6A 4B43A 2GIVA 2DVJA 3KTUA 4BRFA 3JB9J 1MDUB 2RQTA 4D0PA 4IG3A 1Q9YA 2HKXA 3H5RA 1BHLA 4ATOA 3OR1C 2ZSIB 2FX0A 2RNJA 1TV6A 3RSNA 4O0JA 2F8TA 2M16A 3NHGA 4A57A 1TL8A 2CH5A 2CQNA 2L01A 3HSBA 4B9SA 1QVFA 1BL0A 2C0OA 1TUDA 2M7AA 4HG2A 1J3TA 3OA6A 2GAUA 1Y64A 2MF2A 4KT0E 4C3JJ 2KRCA 1TZLA 2L3DA 1VQ5A 1G83A 3FJPA 3CI5A 4A3DJ 4I6MB 2OTJI 5DPKA 4MEYF 1HDPA 2HOSA 1YTAA 4CFAA 4CJRA 3THWB 2ZE2A 2PUKB 3CMMA 2LQWA 3GFIA 3SEMA 1A5XA 4RTZA 3SMPA 3HOXJ 3H36A 4ELUA 2EWNA 1ZBUA 4PJMA 3E5UA 3WTTC 4EHUA 3D5LA 4MDXA 2JM8A 4H5RA 4P1WA 3H3OB 5M5WJ 1WLJA 1YUWA 2E6ZA 1N77A 4MMLA 3S41A 5H20A 1A31A 4UVBA 3WNGA 4WQ4A 3D4VA 3DKYA 3IRXA 3ZSVA 3LP1A 3CPEA 4EMKA 2GCXA 2F9WA 3RDVA 4JI5K 1EWQA 1DLOA 4WCGA 4O5BA 1W70A 1NMNA 5FKKA 4JX5A 3MAQA 2M9UA 3FXOA 1S8NA 3JCMc 1TTYA 1AEYA 2JN0A 1SANA 1TSFA 3VEWA 2HDAA 1X19A 1JQQA 1NK8A 4GBQA 3FXLA 1D09B 2X85A 1J2XA 3THKA 1CF7A 2QI2A 4QAGA 2F1LA 3CC4A 1UAXA 5TJJA 4PCQA 3FK6A 5GAMe 3DTKA 1QHGA 4C8QA 1U5TC 1NGCA 4OMFB 3OOUA 3MPUB 4IXAA 3IKTA 3VWBA 4EJVA 3MZYA 2DPDA 1JLBA 3D0SA 3CCUT 2EYWA 2FZGB 3M56A 2DPUA 4XU2A 1IRXA 2R92J 3QNOA 2LVSA 1YIOA 2DA1A 2YKNA 2XRLA 4K8XA 1ERDA 1H641 2GTJA 4HVVA 5H1SQ 2DBBA 1MD0A 2EK5A 4IG0A 4LF7K 3J7AF 4E6KG 2D0PA 2J6KA 1X3WB 2EVRA 2HW3A 3D2FA 1QA6A 3G1LA 1J0RA 1WH7A 4KISA 2EFOA 4BGDA 4F3TA 5DTDA 5L23A 3AT1B 2O4GA 4DSKA 5B5EC 3U23A 3BZCA 3LW5E 3HPGA 3TSPA 1XTAA 4CCOA 4EJOA 5C44J 4RCBA 3AVGA 5HS8A 4XL9A 3AVCA 4FTHA 3TANA 4JRIA 3PT9A 3IQLA 4C5EA 3CCUI 5DM7F 4LF9K 4L9VA 2MPXC 4BY9C 3TABA 2Y9ZA 1SD5A 2R7TA 1Z9ZA 3MKDA 4C92A 3B6AA 3AHUA 3SJHA 2PAVA 3F8CA 3TSUA 3MWTA