3OYNA

Crystal structure of the pfv n224h mutant intasome bound to magnesium and the insti mk2048
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oynA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oynA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oynA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oynA03
2HHUA 2Z1GA 2D0CA 1I3AA 4Z4GA 3LYIA 1T7PA 2RHZA 1A5VA 1WNSA 4CJWA 3HPGA 1G5VA 3OYIA 2X4YA 4CJUA 3VQDA 3P8HA 2EHGA 4AHUA 1ASUA 1RBTA 2DY4A 1WSFA 3DI6A 3K59A 2JGUA 3DLGA 3QLHA 5SZTA 4CF0A 2ZD1A 4C8LA 5J2NA 3P8DA 1JLCA 1ZYQA 2RHUA 1JXBA 2F8SA 5IAYA 4G1QA 2G3RA 3KIOA 4DFMA 1VRTA 3DLHA 5HRPA 2GFUA 3SZ2A 4CK2A 4KHQA 3VQPA 3CYMA 3LALA 4DTNA 5HRNA 5SWMA 4A4GA 2X78A 4KTWA 4O0JA 2KZMA 1U45A 3CM5A 3MEVA 4IG0A 1B9DA 4DSEA 3MAQA 3E9FA 3NCIA 3QKJA 3KK3A 3SQ1A 4FJHA 3LP0A 3NBPA 4BDPA 3ZT0A 2OPQA 5KGWA 2BKDN 2NUBA 1BHLA 2G8UA 5I42A 2X74A 3LX7A 1KLMA 1YT3A 5KGXA 4DF8A 1NK0A 4HUFA 3AVLA 3PNWC 1VSEA 4LH4A 1FKOA 4I9LA 4CFDA 3OYJA 1EP4A 3PO4A 2B6AA 2YV0X 1TKDA 3QBYA 4NYNA 4IG3A 2RJEA 1HNVA 4RW9A 1BCOA 3KD1E 3AVNA 4C8KA 1KFSA 4CIGA 3SPZA 3O3FA 2QQSA 1S6QA 1NOZA 4CJTA 2BANA 4CGGA 4FYDA 4OLAA 4DTMA 4B9NA 4FJNA 1QE1A 3NH2A 2AJQA 4M45A 1BISA 1KRPA 1IG9A 2OYQA 3ZT1A 3V9XA 4RW8A 1TL3A 2PYJA 1J54A 3V1RA 2A1RA 2JTFA 1JL1A 4R5PA 3MXMA 3QEVA 1TGOA 3S3OA 1S9GA 3QETA 1B9FA 4KFBA 3OYCA 1CXUA 2PY5A 1QHTA 3C94A 3QEWA 2D5RA 3ZEHA 3TAGA 4CJKA 1S1VA 1LWCA 4FJJA 1U48A 3AO3A 3DB3A 1JLAA 3AVMA 5C42A 1SKSA 1D9FA 4FCYA 5CYQA 3QO9A 3ITHA 3LGLA 4OGEA 5KE2A 4KHYA 3V9WA 1RNHA 2R57A 3ZSRA 1UWBA 2FBTA 1C1CA 4PY5A 4KHNA 4CJPA 2LDMA 4BWMA 2LCCA 2L8DA 3QESA 3HP6A 3RTVA 3DB4A 4B9UA 2IG0A 1IKVA 4QQ6A 4FVMA 3PMIA 3TAPA 4E7HA 1N6QA 4ELUA 4AHRA 3HP9A 4IBNA 3NHGA 1OZ2A 1N27A 4CGFA 2OPPA 3G10A 1J5OA 2M0OA 4RG8A 2O4XB 1JLEA 1WGSA 2XDPA 4FZZA 3KLIA 1KCFA 1YVUA 4PA1A 3ULDA 4LH5A 3PV8A 4HCCA 4N47A 3AVKA 4CFCA 5HP1A 1BL3A 3KKRA 4DTOA 3L2RA 4QVZA 2EQUA 4ZTFA 2YHBA 2CKKA 1L3TA 4DMNA 2MWPA 1GOCA 3ZSQA 4E7KA 3DRRA 4KV8A 4I2PA 4Z4CA 4Q5VA 1RCHA 4KAZA 4GY5A 3ALYA 1XC9A 2HNZA 5FRMA 3NF9A 4DTPA 3HVRA 3ZT2A 2K3YA 4A4EA 2HB5A 1RDCA 3NNQA 1K6YA 1TAUA 4CJVA 4CJLA 3NDKA 4HCZA 2XK0A 3PMTA 4ZTJA 2RI2A 4OVLA 1HQEA 4AH9A 1QSSA 2B5JA 3CQ8A 1RTIA 5HROA 4FK0A 4K8XA 3SUOA 4OKEA 4O0IA 3OA6A 2L3RA 3KK2A 4OKJA 2VG5A 3NTIA 2HHVA 5C0MA 4FJXA 3EY1A 3SYZA 4CEFA 3ZSVA 4CEAA 1SSFA 4B9WA 4ID5A 4M42A 2QKBA 3A2FA 3LPUA 4B3OA 1TK8A 1SUQA 3HM9A 2EQMA 2E6MA 3RRGA 5JS2A 4FLYA 2DFEA 3SV4A 1LWFA 3OYKA 2DFFA 5HRSA 1LV5A 1UAXA 3CFPA 3U3GA 2HNYA 3AVBA 5DMRA 4Z4EA 4OPJA 2GF7A 4H8KA 5EU7A 4KB1A 4FJGA 2O4GA 1NJXA 1WAJA 2QXFA 4EZ9A 1QTMA 2HHXA 4CESA 1FKPA 4CEOA 4DQSA 4NCGA 5FROA 4FZXC 4EP4A 3V9UA 3LANA 4W5NA 2LRQA 3RMDA 4B8CA 2W42A 1J9AA 1HMVA 2G8VA 3S3MA 2KTQA 4N4GA 1LW2A 1QQCA 1KVBA 4C8MA 3VQBA 4DTUA 3PUFA 3ME9A 2VG6A 4JRPA 4CHPA 3OYBA 1X9MA 5CYMA 4CK1A 4C5GA 2I5JA 1RT2A 1BQNA 2DIQA 1XHXA 2IS3A 2BGGA 5FRNA 3HO1A 4FXDA 4B9LA 2GFAA 1X9WA 4E7LA 2PYLA 4DF4A 2Z1HA 4FM2A 2JLEA 4CF9A 3T3FA 4BE2A 2XY8A 2IOCA 4CIFA 2D0BA 3LWMA 3AVIA 3QINA 3AVAA 3HK2A 3OB9A 3QEIA 3VQCA 1LAWA 4FLUA 4J2BA 1C1BA 1XWLA 4LD0A 1U04A 3MXIA 4FJLA 1WJSA 3LLRA 3ZSXA 4IKFA 2X4XA 1NK4A 2YNIA 4E89A 1U47A 2BIVA 1RBSA 3DRSA 3F73A 3FFIA 4BDYA 3TAMA 3L3UA 2HVIA 2HHWA 3T1AA 2QKKA 4FU6A 3Q1JA 3LDSA 4L8RB 3SQ2A 3IG1A 1VRUA 3QERA 4C5HA 3U3YA 5HLFA 3S9HA 3AVJA 4KHWA 3VQ7A 3D0PA 5D6YA 3HT3A 2P5OA 4HVJA 4XIUA 4PLIA 1BGXT 1NKCA 5D6WA 4BE0A 4FJ7A 2IAJA 4J2AA 3DRPA 1GOBA 5KI6A 2RN2A 4Z4HA 2OZSA 4Z4FA 3UIQA 1KLNA 1C0MA 1O1WA 3OYGA 3F70A 3MP6A 5CZ2A 4FK4A 1KSPA 4RW7A 4DQIA 3SUQA 4CRIA 1WLJA 1JLFA 4CF8A 4M41A 1T05A 3ZT4A 1RT6A 1W0HA 3M8QA 1RDAA 2Y1IA 4KI4A 5KRSA 1BIZA 2RKIA 4DFKA 2M16A 5J2QA 3EAEA 2R7YA 3O4NA 4DSKA 4W5TA 1BQMA 4W5QA 3C4SA 1RT7A 3HPHA 2GV9A 2YKMA 3QNNA 2F96A 1EXQA 3MP1A 5J39A 4CEQA 4LD6A 3K5OA 1ZBFA 2O4IA 1CLQA 3WNFA 4ICLA 3V6DA 1F21A 2PQWA 4EZ6A 3NH0A 4CJFA 4F3TA 3HVTA 2HHQA 4J2EA 3AVHA 1X9SA 1VSFA 3O3HA 2MWOA 4QW2A 3H8ZA 2NLUA 2LVMA 4NZGA 3RMBA 4B9TA 2X6SA 3SV3A 2K3XA 1CXQA 1T03A 5J1EA 2YNHA 3HJFA 4CHNA 4FJ9A 3CM6A 3SQ4A 3M9QA 4DSFA 3PX0A 3I8DA 3OYMA 1WN7A 2ATQA 4C8OA 5KH6A 4A4FA 4AHTA 3GOXA 2P5GA 2ITGA 4CCHA 1S5JA 3K58A 2OPRA 4ELTA 3AO5A 3HYFA 1NK7A 1U49A 3DYAA 3ZT3A 5KE3A 3I0SA 3JYTA 2BDPA 4NCBA 1RDDA 5J26A 1BI4A 4CECA 1WSHA 2E5QA 4QQDA 1VSJA 2G8WA 3K5LA 1KVAA 3LP2A 2DFHA 4GMJB 1RILA 3OYAA 1JLGA 3K2PA 3ASMA 4KTZA 1S1TA 1RBRA 4KB0A 4M3XA 1H3ZA 4W5OA 3KTQA 4FLWA 4O44A 3F9KA 3OS0A 2X4WA 3OMCA 4E1NA 3ZCMA 1KHCA 4CEBA 4HCBA 1IKXA 2RHXA 3LH0A 3C6TA 2EFIA 3NF8A 4BDZA 1HJRA 2FBXA 1RT4A 3DLEA 4DLEA 5CZ1A 1SV5A 4CJ4A 4FJKA 1D9DA 1XNIA 1VK0A 3VN5A 4CEDA 1SL0A 4OVAA 1EETA 4YNQA 1T8EA 3DLKA 4M3RA 3OYEA 1RT5A 2G8KA 4DU1A 1UA0A 3KLGA 2HQXA 4CJRA 3OYFA 5J2PA 2RPIA 3NFAA 3L2UA 4DLGA 1NJWA 4MFBA 3L3VA 1A5WA 1OI1A 2F8TA 4DTJA 3H6ZA 2RHYA 1YTUA 1SL2A 4M3WA 1NK5A 3TR8A 1QS4A 3RWUA 1VSHA 1NK8A 3O4QA 1YTAA 4CEEA 2YRVA 1IKYA 4OGCA 3SI6A 3QIPA 5D6XA 1VSDA 3P1GA 4Y1CA 3AA3A 2DAQA 1L5UA 3AA4A 3VQ4A 1U4BA 4Q0BA 4IUTA 1CZBA 3AVGA 1KFDA 4HUEA 4ZHRA 4PL6A 3VQ8A 2Q3SA 1KTQA 3K57A 4FLZA 4X34A 2GBZA 3AA2A 5I3UA 3M8SA 5HRRA 5HBMA 4CJQA 4EDUA 3VQ9A 3AVCA 4I2QA 4FLVA 3NF7A 1G15A 2OA8A 4DS4A 3OJUA 4FLXA 4O5BA 3KLEA 1N5YA 2IDOA 3DMJA 4I9QA 3K5NA 3LWLA 1TV6A 3AO2A 2XRIA 4RW6A 1JXEA 3K5MA 4F4KA 4ID1A 3UT1A 3E01A 2F5KA 3TI0A 5CIUA 3AO4A 1XHZA 1ASWA 1LW0A 3CEYA 3OS1A 1QSLA 4TSXA 4FM0A 4E0DA 4FJ8A 4C5IA 3THVA 1A5XA 3E9GA 5C6SA 2EQJA 1IH7A 4F3OA 4M3YA 3LP1A 2RJDA 2ZQBA 3LAMA 2RJFA 3PX4A 1I39A 1KVCA 1IKWA 1SKWA 3I0RA 1JL2A 4H4OA 2RO0A 4GVMA 3ZSWA 4J2DA 3DM2A 3NTKA 1HQUA 2D9TA 4CF2A 3RR8A 4E19A 2HVHA 2OPSA 3S3NA 3L8BA 2YNFA 3EZ5A 4UQGA 3PO5A 3LAKA 4FZYA 3AV9A 4I7FA 2E6NA 4QQGA 4AHVA 2YHAA 2KW4A 3JSMA 1VSLA 4FJMA 4PWDA 1RTHA 3QIOA 3O8VA 2A1SA 4AHCA 4O4GA 4Y1DA 4KREA 2P1JA 4CGDA 5K14A 4CEZA 3L2VA 4Z02A 1BCMA 3V1OA 3B6OA 4LY7A 3C95A 1Q9YA 1L3UA 1DLOA 3LGFA 2XY7A 4RG2A 2VWJA 1RTDA 4Q5WA 1FXXA 3OMGA 3OQ5A 4DFPA 1ITGA 3FLGA 4CK3A 4OPKA 1NK9A 4M3UA 2KFNA 3NGZA 1C0TA 4DTRA 4L59A 2WONA 3IAYA 3BGRA 3V9ZA 2KFZA 1REVA 3PX6A 4LSNA 3TARA 1B92A 2Z1IA 2DIGA 3SCXA 4QCLA 4KHSA 4Z0UA 2BUDA 2X6NA 2G8HA 2R58A 3L2QA 1LWEA 4JS5A 2KQ2A 4CFAA 3DLBA 4FK2A 3KKSA 3CG7A 1VSMA 1ASVA 2IGIA 4IURA 3HL8A 4AILC 4E7IA 2D0AA 2XY5A 3SUPA 1C1AA 4DSJA 4N4HA 3G0ZA 1L3SA 3VQEA 4C5EA 3OYLA 2RHIA 3L2WA 2Z1JA 4B9XA 4FL6A 1HNIA 4JRQA 1TK0A 1NKEA 4IFVA 5J2MA 3PY8A 4CHYA 3SQ0A 2FC0A 4K8ZA 2G8FA 4IUUA 4IUPA 3CFOA 1OZ3A 3MEWA 3MP8A 2JZ2A 3D45A 2PZSA 1OYXA 3ZSYA 2Y1JA 4CHZA 2DTUA 2VYTA 1DTTA 3KJVA 2XHBA 4FM1A 4OKKA 5D3GA 3MXJA 2EX3A 3P5JA 4DWIA 3IS9A 4B08A 1D5AA 3ISNC 4DTSA 1RT3A 2WACA 4DSIA 1EKEA 1D8YA 3QEPA 2X35A 3O3GA 2E6LA 4DQRA 1TK5A 4KPYA 4DQPA 4CERA 4F8RA 3KUFA 1DTQA 1VSIA 3NGYA 2KZZA 1ZBLA 4DQQA 3KK1A 5KRTA 2ZE2A 2VG7A 1MU2A 3HPOA 4N56A 3WNGA 5IN1A 3RRHA 2B8AA 2HMIA 4B9VA 1BIUA 3RR7A 1QSYA 4HHTA 5KCHA 3AO1A 4OJRA 3T19A 3ZSOA 1TKZA 4CHQA 1RI0A 2R5AA 3QIIA 2FBYA 1ZBUA 3VA3A 4GW6A 4KTQA 3NGIA 1EX4A 3SNNA 2LSNA 3MEUA 1HYZA 4YFUA 2M1HA 4CHOA 4JLHA 4DU3A 1TAQA 3TWHA 4F2SA 4W5RA 4NYFA 3MEAA 4FJIA 1IO2A 1S1UA 3TAEA 4PQUA 4BD3A 4DTXA 4B9MA 1R0AA 5KCOA 4CF1A 3KLHA 3MEEA 1L3VA 4CGIA 1NOYA 2HW3A 1RTJA 1WAFA 2LTOA 4WE1A 3VQ6A 4M3TA 4N4IA 4LSLA 2P0KA 1S9EA 3IRXA 1XI1A 1TL1A 1NK6A 5C25A 4CJ5A 4CJEA 4E7JA 4EP5A 4CIEA 2RJCA 3ASKA 5CY4A 5C24A 4BE1A 2XO7A 4KRFA 3OYNA 3NAEA 4PUOA 2RI5A 1Z25A 5KTQA 4FJ5A 1Z26A 5FDLA 4CGHA 5E41A 3RMCA 4IFYA 3META 3WNEA 4A4HA 2YKNA 3L42A 2FHDA 1TKTA 4BWJA 1TVRA 3PFSA 2HHSA 3NH1A 1X1PA 4CGJA 1S6PA 1RDBA 3SD4A 2B4JA 4QAGA 4HUGA 3V4IA 4RW4A 3MECA 3NE6A 1UA1A 1C0UA 3AVFA 3DLRA 2L89A 4QOZB 3V81A 3CFRA 3KLFA 3OVNA 4DU4A 1UOCA 4CJSA 4N41A 3BDPA 1GOAA 4CE9A 3S6WA 3VQAA 4BACA 3HSTB 1ZBHA 1VSKA 2IC3A 3MEDA 4IUQA 4DS5A 2HHTA 2YNGA 1HRHA 3OS2A 3TANA 2OZMA 1HPZA 2R5MA 1SL1A 4CJ3A 3H08A 1SKRA 3M8PA 3ZSZA 1NJZA 4OLBA 2HNDA 4M3ZA 1JLQA 2QK9A 1WSJA 3HXMA 4C8NA 3MEGA 2QQRA 4NCAA 4N76A 3OY9A 3LZIA 1JLBA 4FW1A 4KHUA 3FEOA 2WOMA 4II1A 5DK5A 3QEXA 3OYHA 4JS4A 4MQ3A 3LP3A 4B8AB 2P51A 3V9SA 4ELVA 1WJQA 2GUIA 4H4MA 4B9SA 5M9OA 1RBVA 4O55A 3DLMA 2BE2A 3SUNA 4KKOA 1Y97A 3DOKA 5T7BA 3FC3A 3SJJA 1NJYA 1HYSA 3TABA 1WSEA 4HTUA 4IDKA 4F2RA 3NTHA 4PLLA 1Q8IA 1RBUA 1HYVA 3U6FA 3TAQA 4DSLA 1TKXA 3KD5E 4FW2A 3M8RA 4N5SA 2HQEA 4NS5A 3VA0A 1ZBIA 3FDRA 3OJSA 1S1XA 1MHNA 3QJ6A 3P83D 3OYDA 3TAFA 2VWKA 3V1QA 5JS1A 3VQ5A 4E3SA 4IUVA 2O4XA 1WSGA 4DFJA 3UWNA 3NF6A 1S1WA 3WNHA 4KI6A 2ETJA 3AA5X 4KO0A 3SPYA 1FK9A 3B6PA 4UC4A 3QNOA 3C6UA 3LZJA 4AHSA 3EYZA 2RF2A 2RI3A 1CZ9A 3MO8A 1J53A 1NKBA 2XY6A 2EQKA 1BI4B 2E4LA 1WSIA 1LAVA 1C6VA 4FLTA 1Q9XA 3LPTA 1WJRA 2G8IA 2EKOA 4Z4IA 3VQQA 4DG1A 3BDLA 4E1MA 4CFBA 3RMAA 3DOLA 2FBVA 1W9HA 1RT1A 1JKHA
chains in the Genus database with same CATH superfamily
1YCYA 2YPRA 4QS7A 4A3EJ 4XR6A 1HSJA 2XVCA 5BPDA 4ZYDA 3LCNA 1B6AA 1WNSA 4CJWA 2QA4T 1G5VA 2EHGA 2ZPEB 3TOAA 3SZGA 3UDCA 3W6VA 3O5BA 3ZYYX 1ZRFA 3K59A 4IIOA 1NGAA 5SZTA 2E6ZA 3C65A 1D8KA 4A5MA 5J2NA 3P8DA 4P5OA 1ZYQA 2F8SA 5IAYA 4G1QA 1I94K 2DNUA 4HRIA 4DFMA 4XRSG 3DLHA 2GFUA 2L4AA 4KNYA 5IYDJ 3CD6I 4A0XA 2Z33A 2Z9OA 4DUYK 4IRIA 4BR9A 3CYMA 4EA5A 1S72A 1YO5C 4A4GA 2F69A 2X6WA 3HIFA 2M45A 1N39A 3ID6A 1U45A 3EZWA 1ORKA 1YQKA 1B9DA 3SFZA 1NEGA 5H6RA 1AHJB 1WQ2A 1YQRA 5E8IA 4RB1A 4U67L 4OMZA 2RQQA 3KYLA 1JHHA 1V4TA 1BR4A 1Q86U 4KRTA 1SANA 3X24B 4BDPA 5LRRA 3CC7T 3ZT0A 5KGWA 1KYZA 1ZX6A 1YXQA 1BHLA 3TCJA 1XG1A 1YT3A 1WA7A 2KHOA 1NK0A 4HUFA 3AVLA 1VQNI 2NOZA 1KD1C 3K0LA 2HOSA 1FKOA 4XONA 3OYJA 2XG8D 4BG9A 3PO4A 1R6RA 2B6AA 2BTFA 2YCHA 4IG3A 2RJEA 1K73C 1N32K 3H46O 5C4XJ 2K9MA 1GLNA 3BG3A 3O3FA 2OAZA 3HSFA 3UPUA 2L3PA 2EZLA 4L5IA 3TREA 1K78B 1S6QA 3ULEB 3EFOA 2YHWA 4XEIA 1UB9A 1X9JA 2H6CA 3EH1A 4L5GA 4M7AA 1ERDA 5BOXA 3MPUB 3EHQA 2JM9A 4DTMA 2UXBK 2CMPA 2VXZA 1M2VB 2K7AA 6AT1B 1SMYF 1TL3A 1NM7A 3I56T 4HDVA 1SFOJ 4H03B 3RQIA 2V1RA 3R0AA 4K2EA 5LMUK 4XN0A 3EG1A 3IWZA 2DMTA 3DFGA 3QEVA 5CVJA 1TGOA 2L54A 3QETA 2PFBA 1I27A 2KIUA 1Q82U 2PVGB 4H0YB 4BGDA 2KGTA 4XTUA 5EEGA 3EGDB 1E0EA 3CI5A 4CJKA 1KC8O 3FMSA 3AO3A 3DLLF 4PNOA 5C42A 2O8KA 2PFUA 2DXCA 3M8FA 1EIFA 2ASOA 1SD5A 4EPCA 3V9WA 4X1VA 1RNLA 4H5NA 1ABOA 2ZZDA 3M0PA 2DODA 3SBGA 4LK0F 1UE9A 4KHNA 2KDZA 2LT4A 4E6KG 1W70A 2KEAA 2MMPA 4II2A 2LCCA 5HOOA 2DA1A 1HLUA 2BY0A 3DB4A 3CCMA 1NH3A 4B9UA 2IG0A 5LJ3f 4JP0A 3JCMb 3QB0A 2WA0A 4NBQA 4QQ6A 3TAPA 4I7HA 1Z21A 4D7NA 3REOA 2DMQA 1E6GA 5BRFA 2XHIA 1VQ9N 5LL6S 5D8KB 2Q8KA 3NHGA 4OFEA 4X62K 3T1BA 3SBTA 2L3SA 4JAXA 2LY1A 1J5OA 4UB6C 2NUTA 3CJ9A 2O4XB 3FZLA 3EYYA 1S1NA 1TQIA 2EFNA 5B1BH 1C0WA 1YIOA 2ABKA 4PJOA 5GP9A 2RC4A 2EJ9A 1VRLA 3ULDA 2F4VK 1KQSP 4LH5A 3PV8A 2D6FA 2Y75A 2M5WA 1Q1VA 1HKGA 4L0ZB 2RQUA 3SAFA 2OTJI 2Y0MA 2GTOA 1U8RA 3FIWA 5GANf 1UGQB 1L3TA 1W7PB 2MWPA 4JRKA 1KONA 2HBLA 4XNFA 4LDUA 5CQGA 4E7KA 5AZJA 4FHTA 3FISA 2HL5C 4KV8A 3LSMA 4Q48A 4I2PA 3K9JA 2YG8A 2KLOA 2G7HA 2CH5A 1LWVA 2IVNA 1YIJQ 1U84A 1XC9A 3PM1A 2HNZA 4K11A 3NF9A 4S05A 1KQSM 1TAUA 5HLTA 3FR0A 2JOYA 4IRGA 4DHYA 2IS1A 5CVUA 2IS4A 3D5LA 3T5XA 1X2QA 3J7AF 4GKJK 4OVLA 3A5MC 2DYRH 4CO8A 5KNLA 2MF2A 2VT3A 1RLQC 5JVHL 1GCQC 1K9AA 4C92C 1WJ5A 1Y1VJ 2QYZA 4OKEA 4LG0A 4O0IA 1ENHA 4U0VA 3HRGA 2L3RA 2ED0A 4AFQC 4OKJA 3JR9A 5AQFA 4ILJA 2RF0A 2ZKZA 3EY1A 3M56A 3ZSVA 2FD5A 3CBMA 4ZZLA 4CEAA 5LJ3h 2MABA 3DP7A 3A2FA 4B3OA 1SUQA 4ZH4F 3HM9A 4C92B 3NWTA 3S15J 4LXCA 1TUUA 4A3JJ 1VQ7Q 2EW3A 4L9VA 4Q5SF 2DXIA 1MUNA 3OYKA 3W0LA 5JLXA 2DFFA 4RLQA 1UHSA 4IOCF 3AVBA 4Z8AA 2JUGA 1E7OA 3RSEA 4A2BA 4PJOG 4IQJA 2VQFK 1NGJA 1DU0A 3G4SQ 4OPJA 1YG2A 5LGNA 1M8VA 4H8KA 2D0OA 1SHGA 3FGUA 3AAPA 2IVMA 4DEXA 4GV3A 4EZ9A 4QS8A 1QTMA 1K0SA 3BY5A 4CYCB 2L7KA 2EZIA 3K2ZA 1JUPA 1XSDA 2RKHA 2QENA 1GLAG 2CZ1B 5E1XA 2HQNA 4EP4A 3A0BC 4JKDA 1BIBA 1N5ZA 1XNQK 3RZOJ 4FOEA 3OBYA 5GANh 3LDLA 4XM3A 2ME6A 3CCVI 4B8CA 4DR7K 3GUDA 1K83J 2IS2A 3D2FB 5D5VB 1YX5A 3FMRA 5FLXO 3CF2A 4BRQA 3S3MA 2ZJRF 4N4GA 1K1ZA 3SDZA 1Y57A 1RAHB 4H5WA 3BY6A 2EIJH 3WGHA 5FD6A 3WU1B 2HGCA 2M4KA 2BH1A 1F4KA 3PUFA 2CG4A 3KP4A 3QWLA 5IYCJ 1BOTO 1OYYA 4FWRA 4PSXA 4CI0C 3TBIA 3GZNB 2PAVA 4CK1A 5DCMA 2HDWA 1HKTA 1NJIO 5AFUA 1M5Q1 2GFAA 2HOTA 1X9WA 4DF4A 4FM2A 2JLEA 1VF9A 1R00A 2DLPA 1X1AA 4CIFA 4YRVA 4I0AA 3AVIA 4AIDA 3QINA 3RMSA 3AVAA 1QHAA 2J6OA 4EATA 3T0YA 4P9FA 1Z7LA 3PIOA 1IC8A 2CFXA 2XASA 2FB7A 3ZLJA 4V2GA 1C1BA 1XWLA 2R7TA 5AZIB 1M90O 3WTUC 5CR4A 2CQ7A 2LQNA 4JI5K 1VQ9T 4FJLA 3S2DJ 4BXXJ 3GFIA 4IKFA 5AQJA 1NK4A 4S0HB 2ZM6K 3SDGA 3A4CA 2EAYA 1ZBJA 2WWYA 3O8HA 2DOEA 3BFMA 3TAMA 2J7IA 3CD6Q 4AWXB 3K4MA 2V6EA 3T1AA 5F2RA 3RPUD 3Q1JA 3T7ZA 4A12A 3H0HA 3SQ2A 4L8RB 1NBWA 3ERMA 2LKXA 3IUOA 2LT1A 3IG1A 3QERA 1U6GA 2Q36A 1FP2A 3M9AA 2LBFB 5IOYA 2NRHA 2P0QA 1XC3A 2CREA 4KHWA 2NRWA 5FWCA 2AXLA 5D5XB 3M0UA 2WSEE 3VQ7A 3HRUA 3E9LA 2ZSIB 4HVJA 1V55H 1IAWA 3G71I 2LNHB 3CD6N 2WSFE 2E5KA 1WHGA 2EPDA 2QBYB 5GIOA 2ETHA 3DRPA 3M3ZA 1YITI 1GOBA 3PJRA 1G3WA 1QCFA 1VQNQ 4Z4HA 2CQKA 1K8AO 1KLNA 2P9IA 1O1WA 2ISYA 1JI8A 4HLXA 2Q0RA 4GCVA 4KICA 5KYUA 4BRGA 1KSPA 5TKYA 5FLXE 2RPNA 1RUWA 5D6FA 4J6XA 2X6OA 3LDPA 2XSJC 3M8QA 3I55I 2PUKB 2P9LA 2E7WA 5ICGA 2E2JJ 4KI4A 1MUDA 2CGPA 4A3FJ 4ILGB 1T95A 3GDQA 1VQNN 3EAEA 2WAEA 2Q2RA 3BF1A 4B3AA 4DSKA 4W5TA 2ZCWA 3BR5A 4J9BA 3C4SA 2GV9A 3GZ6A 4BB7A 3MN7A 1OLTA 1H3HA 4IEEA 3L7WA 2HD0A 5J39A 2E7XA 4FYXB 3K5OA 2M1BA 2EA4A 2DD4A 1FIAA 3CXCP 1Y8QB 2DRMA 3IUCA 2VJIA 3H3UA 1SHFA 4EZ6A 1VQ8A 3QSUA 4CJFA 3O9UA 5CCAA 3EPZA 3HVTA 1PWTA 3NAUA 4CW7B 3AVHA 1CSKA 2Y9ZA 2ZSHB 1X27A 4FWOA 2EYXA 1T33A 2E20A 1J7KA 1J6ZA 2WV1A 1CZAN 4B9TA 3BZ6A 4XKBA 1T8IA 6PAXA 2A05A 4N0AA 2H09A 1VQOA 1PU7A 1TOVA 4FJ9A 1X4PA 2QSGX 1MIJA 1QHGA 4OPHA 4WX9A 4J9GA 3M9QA 4DSFA 4RGXA 5HNFA 3CWTA 4RMOA 1FWZA 2RHKA 1VQMI 4L9TA 2X85A 4A4FA 8ATCB 2JJ7A 3GOXA 4OB0B 2OPRA 4FO0A 2VOPA 2NOIA 3ULQB 4M78D 2DDBA 2DFIA 2DA4A 3HYFA 1U49A 4I0BA 3ZT3A 1QVGM 4NCBA 4HEA2 2VB6A 2CSIA 4L9JA 3H3VK 4Z89A 5J26A 1TC3C 1VYTA 1FLIA 4CECA 4F7UF 1SFUA 2CJJA 1VNDA 5E3MA 2YUOA 1Z91A 5ICFA 5M3MJ 3TVTA 3QBWA 2K5FA 3ENOA 1ZGJA 1RILA 2P5KA 3GTJJ 3PT9A 4LD9K 3K2PA 3ASMA 3RERA 4PFOA 1S1TA 1H3ZA 4NLCA 2KQRA 2G6FX 1W4SA 3OMCA 1VQ4N 3JRIA 4DR2K 5HVQC 4CEBA 1KD1U 4YOWA 2JXBA 2DL7A 2RHXA 3LH0A 3E6DA 4IQ4A 2EFIA 2ZFWA 4DNCA 1HW5A 1YX3A 5AQOA 4DV0K 3BWGA 1K6OA 4CDGA 1BG3A 3BDUA 2A3SA 4IHTA 4DLEA 1SRLA 1SV5A 1YJ9A 1HA8A 3I9QA 2MH9A 3VEOA 4CUGA 4EJUA 3UATA 3VS5A 3BUZB 1XNIA 2X1EA 4NHJA 2K6DA 4G94A 4CEDA 4PZJA 1K4SA 1ZH5A 2FZGB 4L3QA 1UG2A 2YX7A 4JK7A 2K9GA 4HCKA 4AC0A 4XLAA 3KFWX 5M5YJ 1GLBG 5KAIC 4DLGA 2R7SA 2NVQJ 4A61A 4LF9K 4HV5A 2F8TA 1ZUYA 3H6ZA 2XAUA 1IN6A 2XGCA 1BJZA 4LMYA 4A2UA 3TR8A 3RWUA 3O4QA 1RACB 1BJAA 4S04A 1RFQA 2LQKA 2LCSA 5BPNA 4XMYA 3I3LA 5D6XA 3LSJA 3CCEI 3P1GA 3ELKA 2JN6A 1KEAA 3RKWA 1N8RR 3DPLC 1AWXA 1WHKA 2I7NA 2UXXA 3CMAI 2KRSA 1QBJA 1L5UA 3GVAA 4B43A 3RIRA 3L00A 4BRLA 2L2PA 1MSFC 3LAJA 4BGAA 1NG2A 3LWFA 4HUEA 2O8CB 3MAJA 1BK2A 4EMKB 4BNCA 2F1LA 1T6DA 4LC9B 1K78A 3L1PA 5CPRB 4X34A 4ESJA 2GBZA 3MVPA 3HGGA 5HBMA 4UY8O 4DQ8A 3S32A 2FPEA 2YLCA 3HTRA 4M7DF 5GMKh 1MNEA 5JHFA 1YW8A 2CGLA 2KRCA 2OA8A 3CCVQ 4JYKA 1M2VA 3OJUA 4FLXA 3EH2A 1GVJA 4EGZA 3A8GB 2K85A 3I58A 3H1QA 3KLEA 1E3MA 1D1BA 1N5YA 2JPBA 3DMJA 1QZ6A 5DM6L 5HL7L 4I9QA 2G0EA 2JVGA 1LEBA 3LWLA 5AYFA 3A01B 1Z67A 3ONQA 2GGRA 5KYNA 2V7YA 3UT1A 2A41A 2FMYA 1XC5A 3PTAA 1U9OA 4IHSA 3S2HJ 3EGDA 5F1XA 2A61A 2NOFA 5GAOp 3O9TA 1Q18A 3OS1A 4FM0A 1DKGD 4E0DA 2PMZN 2NRXA 2V1UA 3TSZA 2M87A 3H0IA 3SHWA 4WXDA 1A5XA 3E9GA 2KMTA 2BVMA 4N9HA 2MG4A 4BL0B 2F2WA 4BU2A 1IH7A 1J5YA 4BUGA 2LVSA 2QWQA 1R0BG 2NVYJ 1FSHA 4XAXB 3NMUA 2ZQBA 2KNBB 5HS7A 1UEBA 4YIRX 3LDNA 1I3QJ 5AQUA 3I0RA 3ZL7C 3WODF 4RTTA 4JI4K 4JKBA 1VIEA 1QZYA 2YXYA 1GV5A 3PGGA 1JGSA 4LDXA 2G7UA 3FXRA 1H8AC 3MK6A 1HQUA 3IWFA 3F6OA 1BI2A 1QVFA 4ZGDB 2KT0A 3A5ZB 2JG6A 4FT4A 1FT9A 3S3NA 2Y0SA 3L8BA 4A6DA 3EZ5A 1AWJA 1YJWI 4NOYA 4EHTA 3JB9G 1LCKA 5BN8A 4FZYA 1JKPC 1QHHD 4YEJA 4QQGA 2NVTJ 2XKPA 4YOYA 1ZSZA 2X3WD 3CWSA 1TLHB 5AONA 1WEFA 1VQ4T 1VQPT 4RMNA 3E1YA 2CRGA 4E9HA 1CQTA 3HOSA 4ISEA 4AYBN 1R71A 4A3DJ 2OC6A 5K14A 5DM7F 1YFHA 3JTGA 5KPZA 1MDMB 3OIQA 1BCMA 5GAN6 3H9QA 1J3TA 3S2WA 2NOGA 3W2AA 1QVFS 2AK5A 3LGFA 4NL3A 1RTDA 3OMGA 3G71Q 1BN5A 5FU6B 2IVWA 4DFPA 1NGHA 3L4IA 4CK3A 4CC7A 2BY2A 1NK9A 2DDAA 4I2OA 4M3UA 1YITQ 2KP6A 2M0CA 2D8HA 3ZQIA 3X26B 1MSEC 3OA9A 1YHQN 1WH7A 5JR3A 4CZEA 2EA2A 2OTLT 4LSNA 3BY7A 3VGKA 3RZDJ 4A59A 3G7ZA 4QCLA 3MZYA 2EVRA 4B1YB 4XOPA 2VT2A 4M63C 2LREA 3AL0C 2F5TX 3I55Q 3TEDA 3L2QA 4AD9A 2PEXA 3JB9F 2YRCA 4M7XA 4FYVB 3V7RA 2CYYA 4M75E 4K42A 2E71A 3CCLA 5GAGP 3CG7A 2A40A 2WY7Q 3MN6A 2FNPA 3HL8A 1EO1A 3AL0B 4E7IA 3A8LB 3FM3A 2R7XA 3PQKA 5J3LA 2PLYA 4HAMA 4LIVA 1L3SA 4YFXF 3CCQA 3SWNC 3HHGA 4EW4A 1ZARA 2RD1A 4L5JA 4KGZB 4ABZA 1HNIA 3RNJA 1JXSA 4JRQA 1FNNA 3FJPA 1YJNI 2ZBKA 3SQ0A 1NLOC 4BROA 3EE8A 4WQ5C 4K8ZA 1Y7XA 2G8FA 4JKFA 4FPBA 1S3XA 1TG0A 2VUBA 3MEWA 1O7FA 3LL7A 4CYCA 1SF9A 2VJ5A 3MP8A 3D45A 2PZSA 4B9QA 2FOKA 2XRLA 3CO7C 1OYXA 1HJDA 2TCTA 2DTUA 3WXIA 4M3BA 5D3GA 1WHMA 1NGGA 5KHDA 1NPRA 3P5JA 3KHYA 4PSWA 3D2FA 1W5CC 4V2FA 2DO7A 3H3ZA 2XAFA 4DTSA 2I5WA 1RT3A 4GGGA 2WACA 1VQMQ 4J9HA 5F64A 4UXNA 1UMQA 1VQ6A 3VJPA 3ROUA 5BR9A 3LW5E 3HSEA 3W2WA 1XGSA 3GFJA 1YP5A 1TK5A 2EBIA 1XQPA 4KPYA 3H0DA 4FQGA 2GWRA 5ILSA 1TWGJ 1JT6A 1U5TA 2LZ6B 1DTQA 3NGYA 1S9HA 1PD0A 4HVWA 4DQQA 2XGDA 2HSEB 3CCUA 5KRTA 2QAZA 2ZE2A 2VG7A 4LGWA 1WI3A 1X1CA 4CZMA 3WNGA 5IN1A 2MK5A 2B8AA 2MBFA 1BI3A 4MZTA 2DD5A 4IXAA 5IT9K 5GAN2 3RQ4A 3ZSOA 1M90C 4O8KA 1QZZA 2R5AA 2QEXI 2FBYA 2Q1NA 4CD1A 4PGGA 5LGUA 4C92G 3BTLA 3CCJN 4BVPA 1EX4A 2LSNA 5AZIA 4XLFA 2EB7A 1WZ2A 2JVVA 5L3EA 4HT8A 2DA2A 3A5NC 2OANA 3I5UA 5A0GA 4F2SA 4FJIA 1IO2A 5DUIA 3CCRA 2Z99A 1S1UA 4MDAA 3TAEA 4PQUA 3TU4K 2JSCA 3JCMf 1GBQA 3DBLB 3MN5A 3NPFA 2QTVA 3C7JA 2BY3A 3CDHA 2ZMEA 4ISGA 2P9UB 3H9NA 4BRAA 2DXTA 3KLHA 2HYFA 3BR0A 2NNNA 5EY4A 3UKUB 3MEEA 1L3VA 3JTHA 5KYYA 2JRMA 1KC8R 4ESRA 1OULA 2O8DB 1S72I 3HOUJ 4WE1A 3AT1B 1QRYA 5M5WJ 2LBFA 4IO9L 4EA4A 4P9UA 3WQUA 1S9EA 4IHVA 5IOZA 3FXLA 1P7MA 2OJED 2W84A 3DEUA 3SZTA 1XI1A 1ZQ3P 3ZX3A 2HYGD 1NK6A 3U1DA 4CJEA 2DK3A 2E2PA 3TW6A 5CY4A 5C24A 4KRFA 1YRNA 4NC8A 5FLXZ 1UECA 1M2OA 4PUOA 3CCEQ 4BXFA 4PKHA 2A68F 4A3GJ 3CQYA 2LNVA 5E41A 4IFYA 3CMAQ 3ER0A 4BBRJ 4B1WB 2KQWA 5KVRA 4JNEA 3CMEA 3FF5A 1M30A 4A4HA 2YKNA 1YHQT 2FHDA 4BWJA 1Y8RB 1B7TA 5GPCA 1UGSB 1FP1D 3CC4A 1I6XA 2A6EF 2V75A 2JMAA 4CGJA 1S6PA 3G1LA 3GE1A 3QPSA 5LJ3g 4HUGA 3HFNA 2GQIA 3VS6A 2Z5UA 4M77E 4RW4A 3AVFA 4R55A 3Q7CA 2QI2A 1IGUA 4QOZB 3ML6A 3CFRA 3KLFA 3THWA 2EWSA 3BF3A 1UOCA 1AZEA 1N25A 4BC4A 4CJSA 4KISA 1GOAA 4OMLA 4CE9A 1M1KC 4BACA 2BHZA 3I0XA 3HSTB 1ZBHA 2IC3A 2XF6A 2LQ8A 2KYBA 4RWTA 3CP2A 3HKZA 3DXJF 2DLLA 3DXMB 4KGVB 1CGPA 2A07F 2LY9A 4LIUA 3M3YJ 1PKSA 1HRHA 1W36D 4PGHA 3OS2A 1KFZA 2OZMA 1B1BA 2D45A 3CCSN 4IZZA 4XTZA 2ECCA 1SL1A 3FMQA 1Z6RA 3KYDB 4IDHA 3JRZA 3H08A 1S29A 5ELZA 3CDLA 5L3BA 4QS9A 3M8PA 2KMUA 3ZSZA 2FF4A 2IBDA 1E3OC 2UUBK 3U9ZA 4F52A 2DA7A 1JJ2P 2NOJB 1JLQA 5H1SQ 1HNZK 2LFBA 4BRPA 3HXMA 3M4YA 4DUZK 1RDWX 4KHUA 1GLFO 4U7BA 4JI6K 3WHCA 1LMZA 4EM2A 3HJEA 4M7AE 1A0NB 1TYQA 3LP3A 3CVSA 4B8AB 4F14A 5JLHA 3A8OB 1WJQA 2GUIA 3RVCA 2ADUA 3DLMA 3U4LA 1GL5A 4XLCA 2KKZA 3DOKA 3V7SA 5CR2A 4G12A 1NJYA 4RB3C 4GV6A 1HYSA 3QOPA 4HTUA 4LUDA 2IEKA 1JJ2M 3QYHB 4IDKA 2FLOA 5JVGL 1WHJA 1YJWQ 1RBUA 2W24A 1V1CA 2QKLB 3M1EA 2DA3A 2D0NA 2E1ZA 4HYEA 1TXQA 5ADXA 3BG7A 4O5VA 1K8KB 3M8RA 2ZPIB 1EA3A 2ZXJA 4R8HA 4RTXA 2X1CA 4KIBA 3VFZA 2CS7A 3H0FA 3GX4X 2K79A 3V1QA 3E3VA 2VL8A 1X6OA 4RLFA 3CCJT 2MH2A 4FTHA 1BA5A 4DFJA 4HX7A 2LC4A 1ABQA 1B9NA 3F2KA 3KP7A 1KJWA 4HF0A 4M7YA 3WNHA 4C1NK 4KI6A 1KO9A 3SJHA 3SHFA 3TQ7P 3LM2A 1IG7A 1EFNA 4UC4A 2HOEA 3L9FA 3C6UA 3UNGC 1HBXG 5L8RE 4Z2YA 1V5EA 3UR3C 2VQLA 4G6QA 4DJAA 2WTEA 1NKBA 3JW4A 3CJ7A 4FE4A 1UG0A 4DV4K 2EQKA 1Z9ZA 1SFXA 4RGRA 2NS0A 5KQ8A 1WSIA 3NHNA 4D6WA 1NJIR 2CH6A 3IAM2 1IN5A 1UUEA 2FF3B 3LPTA 1KC8U 2W85A 4EQQA 4CZKA 1WX6A 2VWFA 4OO1J 1R5GA 2KHMA 2E34A 4HG2A 4EVVA 1Q7YC 5GINA 1TQMA 3ENBA 3DV8A 2ZPFB 2Q1ZB 1JKHA 2KFDA 1OCCH 2QZ8A 2VJJA 3LYIA 3DXKB 2LK2A 2RHZA 1W97L 1E2XA 1A5VA 5TRDA 2Z16A 3OYIA 2X4YA 3E6BA 3P8HA 5CK9A 4AHUA 3J7AP 2VE8A 1WRJA 2XDVA 1DT9A 1ASUA 3ZR8X 1RBTA 4JX5A 4IXCA 1X3MA 1U1SA 2JGUA 1JHFA 4EJVA 5AQRA 3QLHA 4CF0A 3FKIJ 4H0EA 2HL3A 3O9QA 4CZLA 1OPCA 4EMKA 3ZCOA 4DCHA 3DKYA 1VRTA 2R7DA 3HOTA 4PL8A 2OQGA 4JPBW 4CBXA 2IGKA 2X78A 4KTWA 2EIMH 3M8EA 4OPAA 3UB5A 1Z7UA 2D2WA 5C44J 2JA5J 1AWWA 3JCMQ 3EYIA 3MAQA 3W6JB 1KK7A 5BPLA 3NCIA 3A5OC 4M75C 2W41A 1ZGWA 3KK3A 2AHQA 2F5DA 3SQ1A 3LP0A 3OIOA 2K7LA 2LX9A 3A01A 2OPQA 2BKDN 1ZR4A 2NUBA 2QA4A 5DUKA 2G8UA 2CSOA 5BRDA 5KGXA 2RQPA 4M75B 4BEHA 4E2FB 2DPUA 3PNWC 5GJVB 2R7UA 2DKGA 4X9DA 5CAIA 4I9LA 1K8AR 3CCST 3C2GA 1KG5A 1EP4A 2E3HA 4OMYA 1TKDA 5J8FA 1OR7C 2JN0A 3C3WA 2P81A 1HNVA 4RW9A 3M8JA 4C8KA 2VGNA 2YU9J 4CIGA 4XTVA 4JI7K 1YNZA 4WQ4A 4NLBA 4C8QE 3I33A 2E1MC 2STWA 1IUYA 1QZEA 5GAOm 2UXDK 1SSHA 3JRBA 2QEXQ 2PZ1A 4PFPA 1TZLA 4CGGA 3QMLA 3QYEA 4FYDA 2HNIA 4OLAA 3QDRB 5DDGA 4JHDA 1WI7A 4LFAK 1EH8A 1KRPA 1BISA 4EM0B 3UF4A 3ZT1A 2PJPA 2GELA 3CC7A 4WXHA 5TKWA 3V9XA 2F6CA 2QKMB 4NUBA 1J54A 4KDPA 1W7AA 3OSSC 2JTFA 3G6EQ 4R5PA 2N8GA 2PN6A 1NU0A 2CW7A 3JXUA 4A3LJ 3AG2H 3LSTA 2Y2ZA 1S9GA 2QEXN 5D4SA 3LA7A 2GOMA 4KFBA 4EEFG 1FMKA 1RESA 2PY5A 2M9UA 2PQ8A 4J19A 3ZEHA 1S1VA 1LWCA 4FJJA 1U48A 1RRSA 3E66A 1S72Q 4U0WA 2R0QC 2CU7A 4HQEA 3J7YP 4LF4K 5KN9A 4OGEA 3JAMK 3G6EN 4KHYA 2E2NA 3K6GA 3T9NA 1RNHA 1ETVA 2R3SA 2MC3A 1SVMA 3ZXSA 4PY5A 4OIPF 1MMAA 3MZHA 3G2BA 2FSNA 2LDMA 4BWMA 3K4CA 3VOVA 3VS4A 3QESA 3IFRA 2EPFA 3HP6A 3S14J 3VKIA 1WPYA 2ZPHB 3KEOA 2YJEA 2QUFA 1JXMA 4HKEA 3I56A 2OD5A 1V5FA 1B4AA 4FVMA 4E7HA 3RKXA 2OX7A 4GVEA 3HP9A 3P39A 4IBNA 1Z3YA 1AT1B 4XSZF 4WFNL 2BW3B 2K86A 2O8EA 1NJIU 2L4MA 1JLEA 1KG3A 4EVIA 5ADXH 1OCOH 3GW2A 4EW0A 5AQLA 4FZZA 3B6CA 1KCFA 4Y28E 3C2HA 2E1YA 4PA1A 3I54A 2BY1A 3RCOA 5IPAA 2P6TA 2F9TA 5DCFA 4N47A 1AKHB 5HP1A 2ICWG 4YIFA 4KH4A 3M58A 2I5UA 2KJBA 2FMLA 5J3BA 1PUEE 3M0TA 2HXOA 3L2RA 3TTCA 5CKHA 2CKKA 2F7TA 3PIPA 5IT3A 3DRRA 1KU9A 1M90U 4IOCL 1XB4A 4Z4CA 4Q5VA 5J47A 1W1FA 1R4NB 3DEEA 4NNJA 3ALYA 1LJ9A 4IVNA 1VQ8I 2KE9A 2X0LA 4DTPA 3HVRA 2BVLA 4OB2B 5I2MA 1RDCA 4RS8A 2AIRB 2DW4A 3K1NA 2IA2A 4CHUA 4LDVA 2OFKA 3Q7BA 4HCZA 1QWFA 3KFVA 4BJ5C 3K4BA 3VS3A 4A63B 2QQ8A 1WWXA 4AH9A 3LDQA 2C6YA 1WNLA 1WI9A 1QSSA 4CZHA 3UA6A 5IY5H 1VYUA 1R5HA 5FKKA 1RTIA 5HROA 1XMOK 4K8XA 1VQOI 2ZJQL 4M77C 3HFOA 3J7ZO 3VEYA 5C10A 2D1XA 3OA6A 1QNTA 1PNJA 2ZJRL 3NTIA 4FJXA 3SYZA 1QWEA 1SEMA 3VS0A 4FISA 4B9WA 2HBWA 1TUDA 4M42A 2QKBA 2EQMA 2STTA 4M77B 4D8KA 1ESVA 1ZBSA 2D0PA 2ASMA 4FLYA 3VRYA 2DFEA 3SV4A 4AIAA 4BI3A 4G9YA 3BCBA 5HRSA 4PJOD 2P7VB 3CLOA 3NRVA 3TTDA 2J6KA 3U3GA 3CFPA 1K8AU 3HBLA 1EQYA 3VB2A 4YHHK 2AQEA 1NGEA 1VTNC 2EV6A 5EU7A 3BZKA 2VQEK 4JJDA 2O4GA 2HZYA 1NJXA 3CJ1A 1GXQA 2QXFA 3BCAA 1FKPA 4NCGA 2BGCA 1XSXA 1AA7A 3RR6A 1Z9QA 2GBQA 1PKTA 5FROA 2CP7A 3OMYA 4FZXC 4BR5A 3ISPA 3ABMH 4BG8A 4OAZA 2JPCA 4ENKA 4MEXF 3P4IA 3VF6A 2XRNA 5D6EA 2ELHA 1YJ9I 1RPWA 4M7AC 2G8VA 2KTQA 3ZQLA 1LW2A 1Z3XA 1QQCA 2NUPB 3MCAB 1K9MC 4G7OF 8AT1B 3VQBA 4DTUA 4TVRA 3ME9A 1JRIA 3GG4A 2P9UA 1B3QA 4M7AB 4C5GA 5GJWB 1M1KU 4KBOA 3UKUA 2O9VA 2BGGA 2YLBA 2E60A 5IP7J 1GDTA 3CMMA 2O8DA 2OAWA 1E3HA 2Y4XA 4B9LA 2RVCA 3RMQA 4JJBA 1MJBA 2QWRA 3B73A 1SG5A 4JZ3A 4AFZC 4A62A 3PE0A 4CF9A 5DM6F 3DKWA 4DK9A 2AZVA 2IOCA 2JTMA 3G6ET 1TUGB 2D0BA 1HQCA 3GO5A 3E0JB 4FPAA 3GCMA 2LTPA 3HK2A 5M1PA 3QEIA 1XMKA 2W04A 3VYGA 1LAWA 4R56A 4VUBA 4J2BA 1GRIA 5GAN7 1X01A 4LD0A 5GAGJ 2VN2A 5A2QK 1EBMA 4HZFA 3C0CA 1UELB 3LLRA 4ZN3A 4PK4A 3EG9A 2GA1A 2UYTA 3BJOA 2YNIA 1D4XA 1IXDA 3PNTA 1RBSA 4B3SK 2X9HA 4LDYA 2WC2A 4JV5K 4LJZF 1MV3A 3L3UA 2Y4YA 5CKBA 2HVIA 1Y71A 1MPGA 2NOBA 3OHRA 1BB9A 3LDSA 3BG6A 4OMQA 3SB2A 1XS9A 2KT1A 4L18B 3VYRB 1NGCA 1VRUA 1I1GA 3U3YA 4PJOC 4F7ZA 3F0ZA 3CC2N 3R6MA 1IW7F 1XQHA 3KETA 3UKGA 2GTJA 2M3AA 4KITB 3CESA 5FKMA 4OMOA 2HKOA 2DL8A 3OIPA 4PLIA 1YS6A 3DXMA 1BGXT 1NKCA 1QZ5A 1H1VA 2XV4S 3CJAA 1IV6A 1FN7A 2ESWA 4K25A 4X65K 2WAQN 5KI6A 1VQ9A 3UE5A 3JCMV 1DDNA 3DPUA 1JTXA 2HNHA 3DWLE 2VONA 4ZNXA 2DMNA 2DBKA 1C0MA 2XPWA 3F6VA 3SQNA 2GQVA 2ED1A 3OYGA 2NRTA 4Y91A 1Q82C 4L6V5 2XB0X 4RW7A 3Q3SA 1MMGA 1JLFA 4CF8A 4Y13A 4M41A 4LNPA 1T05A 1J75A 4OMMA 4IO8A 5GIPA 5JLWA 1TNSA 5AZJB 1SRMA 1VI0A 2CUDA 2EV5A 2F2VA 3ZETB 2Y1IA 5HS9A 2DMPA 1BIZA 1X6BA 4EHUA 3VYHB 5J2QA 1SFEA 4CC2A 1OU8A 1TP4A 1E17A 2SEMA 2R7YA 3O4NA 2O9SA 2F2XA 1OH7A 2M51A 1ZREA 1NK2P 2DA5A 2GZWA 3I5RA 4MIMA 3QNNA 3H9JA 2KBTA 2F96A 1EXQA 3ZX0A 5HDKA 2F4MB 3CPWM 1CLQA 5LGTA 5LL6Z 2TDXA 4ICLA 2LRDA 3TO9A 1YWPA 3V6DA 4MEYF 2PQWA 3NH0A 2EIFA 1OVQA 3GTOJ 4LG0B 3FZHA 4EJOA 4J2EA 1D0ZA 4NC6A 1N75A 1VSFA 5FPDA 4QW2A 2L2OA 5FJ8J 3MN9A 1TWCJ 4KIGA 4NZGA 2WADA 2X6SA 3M1FA 4J9FA 2O9LA 4FX0A 3HJFA 2R7FA 3SQ4A 3QYGB 4ZC3A 1ETWA 2I0NA 3M54A 3WQTA 3JCMe 3I8DA 5LMNK 3RSEB 3OYMA 5AQVA 3O2PE 4H0TB 3KNTA 2ATQA 1QGPA 2JSPA 4XQ3A 3KP6A 5E1WA 4CCHA 1SVLA 1P7IA 2LLKA 4C8QB 3LL3A 1ETOA 1ZSGA 3JYTA 2BDPA 1IHVA 5J1RA 4A5AA 3FZMA 2EK5A 5FKOA 2YUNA 1RDDA 2NYXA 3CP8A 2XU8A 4WF9L 2XDDA 2FL7A 1DGKN 1M4ZA 4OMNA 2L7ZA 3O6WA 2WUSA 3TO7A 3E19A 3B8AX 1KVAA 4HX8A 4RTYA 2IPQX 4GMJB 4U87A 1RAIB 5FGMA 2VQGA 1OPKA 4M3XA 2XKOA 3KTQA 3F9KA 2X4WA 4GKKK 1NG7A 2XGEA 2DILA 5E26A 1ZAOA 1QQIA 4MO5A 3R9PA 1QCOA 3CCLI 4MLOA 5KYXA 1Z0XA 5AQTA 2V8IA 3BPXA 4KT5C 1HJRA 3VMFB 1R1VA 4NB5A 3HYIA 2KY9A 2DAOA 3KWIA 2XIGA 3FXUA 3V42A 1A36A 4HNUA 4KH0B 1TWAJ 4BRFA 1KSWA 1A35A 3M55A 3GXOA 3VPRA 3BE3A 4HTLA 3CCQI 5JVTA 2YG9A 2DE0X 2L7FP 1O75A 1LB2A 1LKXA 1VQ8Q 1LE8A 1HW1A 2XMFA 2JNGA 2YX4A 3D1NI 2ID6A 4R0KA 1WHLA 2H27A 1MWMA 1Q81O 1N8RO 2JT4A 3L2UA 1NJWA 1YQLA 1MBEA 2DPPB 5AIPA 3L3VA 2PBDA 5B8HA 1OI1A 2GEMA 3HPWA 5F08A 4DTJA 3AGRA 3CC2T 1VQOQ 1SL2A 3K0SA 3JCMg 1JEGA 4FL9A 1HYOA 4M3WA 2K3PA 1HX1A 3VETA 4BHPA 3JCMJ 4B1VA 1QS4A 1NK8A 1WJBA 5CLSA 4M3DA 3TP3A 4JI1K 2Q31A 2YRVA 1VQ6I 4OGCA 5CVIA 4NDLA 5ICEA 5ECAA 1GLJO 1VSDA 2FSKA 1NPPA 1X3UA 4PCQA 1YLFA 3VU3C 3AA3A 2FO0A 2QWPA 1KZHA 1LPLA 4NXNK 2IIRA 4M9XA 2BXYA 3CCUI 2UUCK 2XAJA 3OW2P 3TPQA 4B09A 3G1OA 1KFDA 4LF5K 2JTVA 3IRRA 1BUPA 4CZCA 4ZHRA 4L5EA 3QUIA 2A36A 4PL6A 1S7EA 2LSOA 2Q3SA 1HSTA 4MMKA 2WB1N 1KTQA 4DOVA 2W6LA 3LQRA 5I3UA 3JCMd 2YT6A 1HU0A 2AA4A 3WTSC 2Y90A 4QSHA 1LNXA 2IIMA 3HL2A 4FLVA 1G15A 2BYVE 1RUNA 1HDDC 3MMVA 4AM3A 1LWWA 5KYUB 4O5BA 3OW2M 1QVFP 1YI2N 3GTQJ 1YJ9Q 2IDOA 1YBYA 4HNTA 1GV2A 2LKSA 4C0DB 1LVAA 3EFSA 5KPRA 3WT0A 3AO2A 2O8FB 4JYAK 3LWIA 1KQSS 5A0DA 1WQ7A 3ATUA 4RGSA 1JXEA 5F0CA 3KZZA 3CCRI 4ID1A 1XTDA 3FBIB 4EJYA 1OEBA 2F5KA 3TI0A 4BQNA 1ZG5A 1X43A 3E6MA 3AO4A 1LW0A 3H36A 1VQKQ 3WTZA 4TSXA 4P5NA 3RPUA 2FSWA 2DZ9A 2ZNYA 2HF3A 5C6SA 2YHYA 1ULYA 2JS2A 5DM7L 1E4GT 2GLOA 2EQJA 4F3OA 2CV1A 1LCUA 2FE3A 2AQFA 1VQLT 2KZVA 4B3RK 2QDLA 2D4WA 3EN9A 2E35A 4HSBA 2NVUB 1JL2A 4N0AC 1VQKN 4M75G 2Y69H 3AG1H 2RO0A 3GIBA 3HSBA 2D1KA 1U5SA 3FHFA 5HLGA 3T1HK 5M5XJ 3DM2A 1ZBXA 4BR7A 5D7UA 3NTKA 2D9TA 2FF6A 1IZ1A 4CCMA 1QPIA 1V76A 5EX5A 2KLAA 1Z1DA 3CMEI 3JB9D 2OPSA 2MLGA 3VDXA 2VKNA 1O4XA 4MDBA 3FB9A 3SMPA 4YOVA 1EV7A 3PO5A 1WEGA 3CC4I 2DMOA 2SRCA 2NRZA 3JCMc 5ICCA 2VKDA 7AT1B 2CW8A 3JSMA 3ZQFA 4LF8K 1MBHA 1ZYRF 5FFXA 1AKHA 4FJMA 4BYYA 3IKVA 2Y48A 3K4JA 5LLQA 3O8VA 2A1SA 4AHCA 2COMA 4KREA 2P1JA 2QWWA 4CEZA 2CH4A 5B5EC 4DV5K 1MJ9A 4Z02A 1BU6O 3HEFA 3VEWA 2E1NA 1NBEB 3DTIA 2GWKA 3V1OA 3B6OA 3C95A 2W82A 2ZWHA 1YCSB 2XY7A 1N36K 1WDXA 1Y64A 4Q5WA 1LDDA 4A0YA 4HF2A 1MUZA 1FXXA 3OQ5A 1ITGA 2VBYA 2VE9A 4FETA 3E9PA 1RL2A 5JI6A 4TV7A 4B21A 2KFNA 1C0TA 3K70D 2FPFA 3F3XA 1D3YA 3PSFA 2QASA 3R1XA 2I7PA 2D0QB 3QYBA 1HKCA 2MC4A 2UZKA 3EG2A 2RA2A 2W1OA 1REVA 3PX6A 2MGQA 5BPIA 2Z1IA 1ITYA 2BZTA 3CUQA 4KHSA 2BUDA 2X6NA 1K9MU 5HKCA 1BBYA 2JT1A 1BOBA 2G8HA 1G4DA 2R58A 4KA4A 1XG7A 2PVDB 1W0TA 1VQ4A 1VQPA 4J9EA 3WXJA 1VQ5Q 3VS2A 3MN2A 2UV1A 4HOBA 2L9RA 3KVGA 4BRHA 3CWUA 5DD4A 4B3XA 2X48A 2XF5A 4PJNA 3NEUA 1IXRC 1FBQA 1VSMA 5BQTA 1GFDA 4HF1A 3M1CA 3DTKA 4DKWA 4IURA 2ACJA 4AILC 3M4OJ 1N3AA 4B1UB 2VPLA 4M77A 4B3MK 3CJRB 4M78A 1C1AA 2A37A 5C4JJ 2QYOA 2O8BB 2R5ZB 4C23A 4D5FA 2IPOB 2NNYA 3L2WA 1ZUUA 2Z1JA 4B9XA 1IO6A 1VQ5N 3EUAA 4JI2K 4HX4A 3O8GA 4IFVA 5J2MA 5GAHJ 2OTLA 4IUUA 4JKHA 2E70A 3VESA 4AF1A 2K9QA 4DA4A 4E47A 5BRHA 1W7PD 4FVUA 5LJ5e 3IV5A 3ZSYA 2R7WA 1SZ2A 2Y1JA 3ENHA 1ETYA 3KJVA 5FD5A 3C7NB 2EX3A 4MO7A 1VHXA 4FWQA 1D5AA 4YG2F 3MJXA 4DSIA 1I50J 3J7YJ 2NUPA 1YI2T 4PKGA 3WU0A 2QWOA 2XAQA 2E6LA 3THXB 3F8MA 2OCEA 3U2RA 1ON1A 1UGPB 5K7FA 1NE8A 2V9KA 1ODDA 4F8RA 3I64A 2DX1A 2EBPA 3MCPA 3F9MA 3VEZA 1X75C 4RCCA 2XPVA 4A53A 3ZMTA 4B47A 3VS1A 2EILH 3KLNA 3HOZJ 3J81K 1MH4A 1WOQA 2LP0A 2V6CA 2DTZA 3U9GA 4RB2C 1KAXA 3RR7A 5HLIA 3FSPA 3L1AA 4YDUA 4A0ZA 5EYRA 3RUXA 4C92D 4OJRA 1WB9A 3DKMA 1TKZA 2VWBA 3K70C 4HV6A 5FLVA 3QIIA 2V4JC 3HHTB 1ZK8A 4PHTX 4M77G 3CCLQ 3L2CA 4KTQA 5EVZA 3OR1C 3QYFA 3EL2A 2RDPA 1VQKT 3RYPA 4YFUA 3VEPA 1HYZA 2M1HA 4DB3A 4CHOA 5KPTA 4IPAA 3VS7A 5HK3A 4XRFA 1TWBA 1TAQA 1MGTA 3CCQQ 3CWAA 5D4RA 5TGTA 1X69A 2Y31A 5IHKA 3MEAA 1I1JA 2CUBA 5E17F 3HM5A 3I9V2 4C30A 1QVGA 2E10A 1D3BB 4XN3A 4F7UE 4CF1A 3TP0A 2PMZA 3M0SA 2IJLA 2H6BA 3H3NO 3KZYA 4N4NB 4KT6A 5K7ZA 1UGVA 3H6EA 3H92A 1HKQA 2LTOA 4FYWB 2KPMA 3URGA 2OF7A 3IMXA 1ORPA 1IB8A 2MPXC 2P0KA 3CMYA 1ZSZC 4KFCA 2LX7A 4RUGA 2MOXA 3FM5A 3Q5FA 5DV5A 2ZO4A 1FOYA 4A57A 3WHBA 4E7JA 4EP5A 3ASKA 3J8AA 1QVGS 4C0GA 2XO7A 1VQ6Q 3OYNA 3P31A 1ZHIA 4N4OB 4M7AG 3NAEA 2F5VA 3FBNB 1BU1A 2QA4I 1ZSZB 3S1MJ 4XKCA 5KTQA 2DXBA 4BRIA 1Z26A 5FDLA 1KQ0A 2DT6A 4XLHA 3THYA 5GAOq 3CCUQ 3GL1A 1WJCA 3L42A 1P4WA 4YOQA 4KHPK 3H0GJ 3FWEA 5FKLA 3JCUC 1W0UA 4JLIA 4DZPA 3NH1A 4AI4A 5LJ5d 3M0RA 1X1PA 4YTLA 5L3FA 1FYLA 2HEOA 3ZETA 5E8GA 1WXBA 2B4JA 1AVZC 1EJ9A 3K4NA 2EJRA 1XCVA 3V4IA 3MECA 3NE6A 1I5LA 1C0UA 3DLRA 4W97A 1UTIA 2LD5A 3V81A 4AYBA 1DQUA 2JHJA 2KYMA 4H5TA 3OVNA 4KH5A 3Q9SA 4NC7A 4DU4A 2ASPA 1VYVA 4N41A 1N9SA 2IAIA 1RT1A 5EEAA 2JHNA 4E9GA 1MWKA 3CC7I 4A6EA 4IUQA 2COBA 5IWAK 1SAUA 3VYUB 2ZGWA 4CD3A 2XI9A 4A5NA 5IT9O 4E7ZA 3R0JA 3H5RA 2FRHA 1YIJN 3M0QA 4MHGA 1GLDG 3RKYA 3CCRQ 1VQ5T 1MD0A 1A6IA 1IDZA 3CQXA 3TANA 1DPRA 1Q7YR 1YHQA 1WBDA 4M7AF 5LBQA 2V8KA 3BJAA 3KE2A 2P8TA 1RUOA 2MYSA 1XDUA 1SKRA 2L02A 5J6XA 1NJZA 3WTVC 2HNDA 2NXNB 3EEQA 2V1QA 1PSEA 4XU1A 1QVPA 4M4ZA 4M3ZA 2RK1A 3WXLA 2F5CA 2QK9A 1WSJA 2QQRA 2VBWA 2V52B 3OY9A 1JLBA 4FW1A 4LB5A 2PMUA 3CCRN 1XDSA 4B1ZA 4II1A 4A93J 3LMMA 5E3NA 4M7DE 4JS4A 3TKYA 3FKJA 4C8QA 3V9SA 3I0WA 4ELVA 2M0MA 1DUXC 2WAFA 4B9SA 4KGXB 3I56I 1KGSA 3FZFA 1VQ7N 4Y4RA 3SUNA 1LDKB 1Y97A 2NOEA 2NVXJ 4ZYGA 2CFOA 4M72A 3TABA 1KD1O 1WSEA 3FX3A 2ZPGB 4F2RA 1IGNA 2ZJQF 2HQ5A 4UOBA 3G4SN 2D1HA 1B34A 5I11A 1U5TC 2W57A 3CC4Q 5EG2A 1K73O 4YELA 3OH9A 1HYVA 4EFHA 2X6XA 4HXJA 2XAGA 1H92A 2UXNA 4I02A 4CICA 3HHHA 1KG2A 2HQEA 2P84A 3VA0A 1ZBIA 3GBGA 3FDRA 3OJSA 1S1XA 2P9SB 3HTUA 2O5RA 2PI0A 3QJ6A 3P83D 1JT0A 4WCGA 1U5TB 2A3LA 5IP6A 2I2LA 2HI3A 2KT8A 4J9IA 1I81A 1E6HA 1ZRDA 4F04B 2VODA 3DLAA 3UWNA 1WCMJ 2CZ7B 1TS9A 4WCIA 1M3HA 4XSXF 3AY9A 4BY1J 4PJOF 1HNWK 1N8RC 3DU5A 1S22A 4ESFA 3HRSA 1CZ9A 1J53A 3REBB 1KAZA 2W48A 3A8HB 1VUBA 2BHYA 2XY6A 1BI4B 2ZXWH 4DYRA 3HGYA 2VKHA 1C6VA 1SFKA 3IP4B 1FEXA 1W2BP 1Q9XA 2K5IA 1XGNA 2V1DA 4YY3K 1QP3A 3JRCA 2ZMEC 1BBZA 5GAN8 1KQ2A 5IT9E 4DG1A 3IH7A 5A0LA 3M57A 5KN8A 4JN4A 4CFBA 1O9SA 3GTGJ 2Q0UA 4FWLA 2IS6A 3A0HC 1OYWA 4C8QG 3CCJA 3LQQA 4F17A 2D0CA 2CS3A 2ZMEB 4RTVA 1I3AA 4Y3OA 2QGGA 2H1KA 3VWBA 4Z4GA 1DP3A 4HNVA 1NGIA 2CH4W 3F0CA 2COWA 4D0PA 4JZ4A 5KYYB 1MDUB 4R79A 1WSUA 4CJUA 1W2BM 3VQDA 1JTYA 2GIZA 1WSFA 2F9WA 3DI6A 4JJCA 1NZ9A 4H5RA 1PDNC 3DLGA 3VUBA 1WXUA 2ZD1A 4C8LA 3TTFA 1JLCA 2QM3A 3IH4A 4IOAF 4L0YB 1JXBA 3GP8A 2G3RA 3KIOA 5HRPA 3SZ2A 2VIXA 2CQQA 1H0MA 4V19K 4A3CJ 3VF2A 4A3MJ 1REPC 3KK7A 1S6LA 1UZCA 1YRNB 4KHQA 5TISC 3VQPA 3KTUA 3LALA 2P7CB 4I6MB 3D5RC 4O0JA 2F5EA 3CM5A 4BGBA 3MEVA 2A6HF 3R4KA 4EMSA 4DSEA 3E9FA 4J6YA 5GAMe 3VTIA 2LMJA 2C0OA 4GFBA 3QKJA 2Z1DA 1UCRA 1D09B 3BC8A 5KYWB 4FJHA 4BQAA 1NYGA 2E12A 2O8FA 2Y30A 3BR1A 1YTYA 1KU7A 3I35A 4J7IA 2A5WA 5HLHA 1KG7A 4LLGF 3K69A 1UB4A 4EJTA 2X74A 3CPEA 1KLMA 1BIAA 2RNAA 1YIJT 1P2FA 3R61A 1NMNA 2EFOA 4IHYA 1MJAA 1VSEA 2DJNA 4WFAL 4BY6C 2BZYA 2DVEA 3THWB 3D2EB 2HBJA 2NS7A 3FZVA 4MTDA 2CDTA 4NYNA 5ILUA 1XD7A 5HK0A 4AU7A 4FT2A 1KQ8A 2LJ1A 2PUOB 4JX4A 1KQJA 1BCOA 3AVNA 1UFMA 2EQRA 3MD2A 3SPZA 4BY6B 2QQSA 2L0AA 3O6BB 2VQCA 2QGFB 3CCYA 5M3FJ 1FPQA 1TBXA 1NOZA 4CJTA 1SC7A 4H0PA 3TSUA 3V8JA 4ELYC 4JDSA 2JTEA 3P38A 1SQKA 5BR8K 3MWTA 2I8DA 1QE1A 3NH2A 5HS8A 4JQFA 5GPAA 4QWQA 5CQEA 2RQTA 1IG9A 2OYQA 3INZA 2EYWA 1XQSC 1OOTA 4RW8A 3V1RA 1HR0K 1VQ7T 3VW4A 1TUCA 1JL1A 3CXCM 1NMDA 3W6KB 4XORA 2XDBA 3I71A 3T1YK 3TSWA 3M59A 3G4ST 3CCSA 3K7AJ 1MH3A 1R7JA 3IAS2 1TYQB 3PSIA 4ZYHA 3PIOF 3WXMB 3CETA 1XCBA 1Y96A 3OL4A 3AVMA 3LNQA 1FYNA 3SMSA 1SKSA 1D9FA 4FCYA 5E79C 1P59A 3JB9J 3R6NA 5FO5A 2GXBA 3ITHA 1L3LA 3LGLA 4BR4A 5KE2A 2FSJA 1TT0A 1RLPC 1R77A 2R57A 1K7AA 3FXKA 5KCMA 1UWBA 2FBTA 4FWSA 1C1CA 1QW1A 3TOBA 1PD1A 3AG3H 4H5VA 1IKVA 2FOWA 4BBSJ 1RABB 3PMIA 4AG1C 1S7OA 1VQ9I 4QPOA 4AHRA 4RTFD 5J8CA 3ABTA 4Z88A 3IH3A 2M7BA 5CE3A 1OZ2A 5F0FA 1GHCA 1N27A 2P0PA 3BLYA 2DM1A 4CGFA 2OPPA 2OTJQ 3VODA 1YVNA 2CUEA 5GMKm 2HU9A 2F5FA 1WFWA 1JB0E 1ETQA 3ZQ7A 1YVUA 2EQIA 2R5YA 1USTA 4QLCU 1B72A 4Q47A 4HCCA 2ZF5O 5BREA 1LOTB 3AVKA 5AFUH 5BNGA 4F7UB 4CZIA 4WWCA 3KKRA 2DO3A 4QVZA 2EQUA 3U21A 4FT8A 4ZTFA 2OTJN 3ZMZA 2HF4A 2O8BA 2R5ZA 1TWHJ 5ERIA 3OH6A 4Y33A 4YPHA 4DMNA 3MKZA 4G6DA 2RB6A 4DEYA 3CC7Q 1RETA 4XTWA 5K5RA 3W3DA 5GADP 1RCHA 2MI6A 2JA8J 2VQHA 2R7RA 1GLCG 3WTWC 1DPUA 3C18A 2O6GE 5CKTA 2K3YA 1KG4A 2HB5A 2DPDA 1K6YA 3HOWJ 3NNQA 3DQVC 4JKCA 4CJVA 1QKWA 4WYBA 3EDPA 1TUYA 2FPDA 3NDKA 2J06A 4DZJA 3IDHA 5CYVA 3PMTA 4ZTJA 2RI2A 2X9DA 3CD6T 1Q81R 1HQEA 2ENMA 3FFKB 4RM2A 5DEQA 1Q86R 4EMKC 3DWLA 4PL7A 2BE9B 3CQ8A 1ACMB 3C7NA 1OH5A 3GNFB 1ACIA 4JI0K 3SUOA 1P9QC 3TL4X 5LJ5j 2OBPA 2GWJA 5AJ3K 2VG5A 5C0MA 3VEVA 4JK8A 4CBWA 2ECBA 3BQYA 2P9KA 1GCPA 4CZFA 2L9NA 1SSFA 4ID5A 3THXA 3LPUA 3O1WA 3FDYA 4N0BA 4KN4X 1P6RA 4GBQA 3I4PA 5JS2A 2K4JA 1MBFA 4BH9A 1LWFA 2E36A 1VQNT 4XU0A 4BI8B 5DY9A 3JAMO 4BY7J 5DMRA 1U2VB 5GAN3 2CWEA 2DYBA 3QWYA 4ISFA 4BAYA 2GF7A 2ZXIA 4C3HJ 3TEEA 2K4BA 1TTYA 1H9GA 4KB1A 2WTUA 4M9SA 2P4RA 1WAJA 5BN9A 1KC8C 2HHXA 4CESA 1R23A 2VBXA 4CEOA 2VV5A 2YDLA 3NFCA 1G2BA 2V79A 5AQPA 2BBYA 4BEHB 3NQOA 1MMSA 3LANA 3A2KA 4WQ4C 3ZQCA 1R8OB 4CZJA 4PFZA 4A54A 3CCVN 2VLAA 1HMVA 1G83A 1IJJA 2AKKA 3ESWB 3ECOA 4J5YA 3CQTA 2VG6A 4CHPA 4G7HF 4CI6A 1D3BA 2FA5A 2EYQA 5F04A 1B9MA 1HPMA 1X9MA 1YQAA 5CYMA 4M7DB 4ORZA 4O6JA 4I6ZA 1RT2A 2F48A 2L0KA 1R36A 3KX2A 1JJ2A 4JHDB 1XHXA 2IS3A 1QKXA 2UU9K 4XBFA 5FRNA 3HO1A 1NGDA 5GAOn 4UY8I 3VRZA 1RAEB 2R93J 1QP2A 4YOUA 1WEIA 2EIKH 4YIIA 2PYLA 2AHJB 3HTSB 4ENJA 2Q97A 4GXOA 2XY8A 3I8BA 1G59A 3J80K 5JFRA 3LWMA 1OH6A 1MA9B 5GAEP 4KIFA 3X28B 2E41A 5L23A 2EFWA 1KQ9A 1ETXA 3VQCA 1MMNA 3KYCB 3DLLA 4O8UA 2ROTA 2VC1A 1J0RA 3OSVA 1RC9A 3M5RA 1JJ2S 3MXIA 2E1CA 2V1NA 5FU6C 5M1NA 1MBGA 5EC7A 1WJSA 3ZSXA 1FOWA 3QWXX 3U23A 1P7JA 1K4TA 5B1AH 2M2EA 4OP0A 4ENMA 1U47A 4CZZA 2BIVA 4ELZC 3GLXA 3THKA 2YSQA 3FFIA 1D5YA 1NLVA 3KPHA 2ZJPF 5AQGA 1ZUKA 2OUMA 2KKOA 4IZ9A 2HHWA 4YFNF 2QCOA 5IYBJ 4NQWA 4I99C 4IHXA 2KVQG 3GEZA 3O9SA 3G6EA 4F55A 4ZJZA 1G99A 4J6WA 3JAME 1N33K 4BQZA 1OYIA 4LB6B 2YR2A 1D0XA 2O8EB 5EG0B 3X25B 2OTJT 1QQJA 4WFBL 3HT3A 2P5OA 1VOMA 4XIUA 2FEIA 3G71N 3LWHA 1I07A 4LITA 4O5FA 5D6WA 4BE0A 4U88A 2KDOA 4J2AA 3GPLA 1YITN 3JSPA 1WUAA 4LLLA 3GZ5A 4Y17A 3LH5A 1MGQA 2OZSA 4M3FA 4Z4FA 2RK2A 4OAYA 1JJ6C 1IUFA 2IW5A 3F70A 3MP6A 2O01E 4FK4A 4HVUA 4LUEA 3MKDA 4DV7K 4CRIA 1IREB 2NOLA 3D5SC 4X1EA 1UDLA 2RH2A 2KJCA 1Q81U 1N8RU 1RT6A 3DF8A 3LA3A 3I55N 1RDAA 3MDQA 5KRSA 1Y6IA 1RKTA 4DFKA 2R7VA 2V9VA 2ATCB 2LOOA 1IV8A 1NTCA 2O8XA 3TDUC 4IX7A 2E5LK 1BQMA 4MQ9F 2VC8A 1XMAA 1RT7A 3ZGKA 2YKMA 4IEJA 4CC3A 1IGQA 3VEXA 4NB4A 2XAHA 1F9NA 2NRRA 2WSCE 1BW6A 1ILYA 2A42A 1E3PA 2OJ2A 4CEQA 4LD6A 2O4IA 2G9WA 5LEKA 3LSHA 3HOXJ 2PVOB 2YU3A 4LFBK 2K5CA 3KBGA 3O08A 2FQ3A 2QK0A 4UVBA 2GOXB 2NAZA 3DAWA 4W1UA 2D5VA 4AMCA 1X9SA 3ECHA 2CUJA 5CJ9A 1OX8A 1JUMA 2MWOA 1NJIC 1RRQA 4PJJA 1T98A 1QLYA 2EKHA 4M9ZA 3CVTA 2P9SA 3U1KA 3EETA 1CXQA 3I0TA 5J1EA 2YNHA 5A2QO 4CHNA 4J00A 3A02A 1YWOA 2XROA 2LMDA 5F6FA 1MUYA 1MW7A 4WK8F 3WVEB 3CCVT 4CGZA 1WN7A 1VQMN 2Q0OA 3WXKA 4AHTA 1KYWA 4WCEL 2DTRA 2ITGA 2A7YA 1S5JA 4DBRA 3K58A 3VSKA 4AI5A 2VCPA 4ELTA 5AQSA 3F8CA 1WYXA 4V19S 3PNYA 4B8XA 1BM9A 5M1FA 2K9NA 5IT9Z 1VQ9Q 5L3GA 1BDGA 1BI4A 1JCFA 1ZKGA 1WSHA 2E5QA 5HDNA 3M7GA 1JJ8C 4DQ2A 2CO5A 2LF7A 3W3CA 2G8WA 3MQ0A 3K5LA 3LP2A 3MZ8A 2LY2A 3OYAA 1JLGA 2FEZA 2VUMJ 2CYZB 2FBHA 4IL6C 1X19A 4KTZA 1JCGA 2LF8A 4OMFB 3D0SA 1RBRA 3QZ5B 1K76A 3WUHA 4W5OA 1M1GA 5LRSA 1VQ4I 1VQPI 3BR3A 4GYGA 4E1NA 3ZCMA 2KI7A 1IKXA 2GQQA 4HBLA 3U8XA 3C6TA 2YSRA 2DTIA 3NF8A 3D7SB 4BDZA 1T3VA 3F5TA 3A03A 3FXJA 3KEQA 4AG2C 2H3EB 2UUZA 4BXUA 4P96A 4OIRF 3HUGB 3DLEA 1ZELA 5CZ1A 1R58A 2E65A 5BPMA 4ENNA 1RR8C 2A28A 1ZA1B 1NNEA 2VPRA 3CIPA 4FJKA 3O5ZA 2IGMA 1PU8A 1D9DA 1T0FA 3EGUA 4UVAA 2M4GA 3GBQA 4F91B 3LOCA 3VN5A 2L3QA 2B9SA 3LSPA 1SL0A 4YFKF 4OVAA 1TSFA 3S1QJ 1PJRA 1FBUA 1T8EA 1K8AC 3DLKA 5AQNA 5E3OA 2OTLI 2RM4A 3OYEA 1N34K 2OI3A 4M3GA 2QWMA 3V4GA 4RAZA 1FYMA 1X4OA 2ZXHA 3LA2A 4I6MA 5J2PA 4C92F 1T3LA 3C1DA 5FPNA 3A8MB 5K5QA 1F36A 3E7LA 4C0ZA 3KLOA 4MFBA 4ANJA 1KHIA 1A5WA 2CP2A 4GLKA 2FNAA 1YTUA 2RHYA 2NRAC 4MLEA 3FK6A 4XTXA 3E9OA 2CP6A 3EG9B 1JBMA 1X2NA 3RKQA 5KYWA 3AGKA 1GBRA 3G1MA 5EGOB 1YTAA 2JA7J 4XLPF 1AHDP 1LDJA 3JREA 4UB8C 3QIPA 5GAMj 3G71T 3CCEN 2O7OA 4BRKA 1TW2A 2HQHA 4M78E 4Y1CA 5DS9A 2DRKA 1I4K1 2QW9A 2DAQA 2W00A 1YITT 3CMAN 5A2QE 3AA4A 3VQ4A 1EWRA 3D2EA 1T3SA 1CZBA 1OQYA 1FIPA 4DV6K 3AVGA 3WGIA 3GFLA 1GT0C 2Y9YA 1V54H 2ISZA 2VI6A 1D1AA 1T6CA 5AN4A 3I55T 2NUZA 3JCMh 2GX9A 4FLZA 3AA2A 3M8SA 1UAAA 3QRFF 3K4KA 4CJQA 4I76A 3CC2A 2EGAA 4CZGA 3QICA 3WE2A 3VQ9A 3QPHA 2O03A 2PMHA 4ESBA 2YUPA 4I98B 4DS4A 2DTOA 2DK8A 1WQWA 2MLKA 4KJZA 3PVLA 3K5NA 1HD3A 1TV6A 2AS5F 4BRCA 3H9GA 1Y56A 4RW6A 2E19A 3K5MA 1OU9A 2WAQA 4ILHA 2KL4A 4OOIA 2XHKA 3C0BA 1XHZA 1ASWA 2DFUA 1W5SA 2DI3A 3H35A 4FJ8A 4HPQA 5DM7R 3M4GA 3DEWA 3R60A 1WZOA 3CCMI 4GDFA 3CQZJ 4GNIA 1VA7A 2HDCA 4AM6A 3ERED 3KXTA 4BR0A 2QDYB 4PUSA 2YWWA 4M6VA 5D8LB 4H0OA 1PC0A 1TL8A 2JMCA 2QQ9A 2RNJA 3PX4A 4M75D 4XQFA 1CF7A 3CTAA 1KVCA 3F23A 1SKWA 4J83A 2LCLA 3ZQGA 1VQMT 3MFKA 4ATOA 5LJVA 1W4MA 2MAMA 4GVMA 3ZSWA 1HW2A 4F9OA 4J2DA 4D8DA 1J59A 2KXDA 4JUVA 4E4HA 4DOZA 3RR8A 1LFUP 1FTZA 4E19A 5E1ZB 5C15A 5I2SA 2Z3YA 3RSNA 1KD1R 3GTPJ 4JLGA 1QMCA 1YJWN 2HR3A 5FFZA 4JKEA 2DYSH 3LAKA 3AV9A 5LJWA 2E6NA 3EQLF 3ASOH 1K73R 2YHAA 2KW4A 5I21A 2HTSA 3JCMW 1IDYA 4ZYEA 4DR1K 4GY2B 2VVKA 1WBBA 4G8XA 2DVJA 5D5WB 1VSLA 4CCKA 1PM3A 4PWDA 3QIOA 4IJNA 3M07A 1AOJA 1PVEA 4O4GA 3HOVJ 3AHUA 4F7UA 1PRMC 3QU6A 4ON0A 2WV0A 4CGDA 1SVOA 2FBIA 2XKOC 3T8RA 2IGOA 3L2VA 1VQLA 2R7QA 2DEQA 1BO5O 2A3ZA 4WF2A 3RBBB 3AFHA 5CHIA 2K2MA 1L3UA 1DLOA 4I01A 4RG2A 2DTHA 3QG1A 1OCPA 1E4FT 4XIDA 4GYIA 1JCEA 3NGZA 1STZA 4XL9A 1QCNA 3EUHA 3WTTC 3EKSA 4L59A 2BZXA 2WONA 3QU3A 1YHQI 2P9NA 3WE3A 3ZMSA 3V9ZA 5KYXB 2O31A 5IHIA 2ZFUA 1B92A 3S1RJ 1UHCA 3IH2A 1P4XA 3CF5L 3EGXB 2HZTA 2H56A 4PIIA 1MBJA 5CKEA 1DU6A 3S93A 3C6HA 1N3CA 2E88A 4XKVA 1LWEA 2KQ2A 4CFAA 4JD2B 4H0XB 4PKIA 1XGOA 2HSPA 5GAOl 1YJNQ 3IHUA 1LE8B 2YUSA 3PO2J 3KKSA 3AARA 1WHHA 1ASVA 3EKUA 2O2OA 3N4MA 5GAN5 2RQVA 1BR1A 3H5AA 2D0AA 2XY5A 2H94A 2J5PA 3SUPA 3OV8A 1GXPA 3OBWA 3PFIA 2EGCA 4KH1B 3CCET 1Y1WJ 2EZKA 1UJYA 4N4HA 3G0ZA 3F8BA 2BOLA 5AQXA 3VQEA 2VJ4A 5AQIA 1ATRA 2H1LA 2NOHA 2RHIA 1J5EK 2IVPA 3CMAT 1Y0NA 1U2VA 3Q9VA 3IKTA 1TK0A 1NKEA 3ZQHA 3A8YA 4BY9C 4OIQF 1PCXA 3PY8A 4E70A 1YJNN 1YE9A 3NARA 1PHTA 1HC8A 4IUPA 1OJLA 1OZ3A 2JZ2A 3RESA 2IRFG 4F7UG 2JRTA 3QODA 3HZ6A 3SYTA 2KROA 1K4US 1GVDA 4IHWA 3GF2A 2XHBA 4FM1A 4OKKA 3RTRA 4DWIA 2V9PA 2B86A 4M6YA 3OWTA 4RA2A 4B08A 1RRJA 1NM1A 3L6QA 4J9CA 1M1KO 2OPTA 4M74A 1RADB 2BE5F 1EKEA 1D8YA 3QEPA 1J09A 2DJIA 3F8NA 2IT0A 1PRLC 2X35A 3ZEUB 2P9PA 1QVGP 3O3GA 1Q1HA 1AWCA 4DQRA 2O88A 5L3CA 4CERA 3FHNA 1B07A 5EXWA 4M7DA 3CPWA 3KUFA 4DIQA 2EH3A 2KZZA 1Q95G 1ZBLA 2R92J 3KK1A 4BJ6C 3DBRB 1ZTRA 4IJAA 3H45C 1MU2A 4N56A 3ZPLA 4OWRB 5E18F 1OH8A 5LJ5f 2HWVA 4PKCC 1G6NA 4OINF 2OCCH 2PJRB 1G2HA 1BIUA 1YOVB 2NYSA 4HHTA 2WB1A 5F0HA 5KCHA 4JK1X 1R49A 3AO1A 3MKYB 3M5AA 1VQ4Q 1VQPQ 3CUOA 4M77D 3T19A 5AQWA 1DGWY 4CHQA 3BR6A 1RI0A 3H3OB 1ZBUA 2NLXA 1IZ6A 2ELKA 3VA3A 4ZYAA 3RYRA 2VASA