3OS1A

Pfv target capture complex (tcc) at 2.97 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords Integrase
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os1A03
5IN1A 4IURA 4M3TA 2IDOA 5JS2A 4CJRA 5CZ2A 2ITGA 3MEAA 1LWCA 4A4EA 3I0SA 2X4YA 3PNWC 3MP6A 3U3YA 1X9SA 2X6SA 4CFCA 2FBXA 4Z4CA 3AVBA 3KK2A 3AVGA 2D5RA 1JKHA 1XC9A 4FVMA 1XI1A 3RMBA 1REVA 2JGUA 1JLGA 3OYLA 1W9HA 2WACA 2OPQA 3QKJA 1K6YA 1N27A 4Z0UA 4AHVA 3V81A 1C1BA 1KVBA 3TAQA 1XNIA 4FZZA 4EP4A 4KAZA 3HM9A 2EQUA 1WSGA 4O0JA 3PMIA 4IFYA 4IUTA 4FK2A 2QQRA 1ZBFA 4FJIA 2R58A 2HHQA 2KZMA 1D8YA 5DMRA 4QAGA 3F9KA 3QEPA 2QK9A 3LP1A 3HP6A 3OYKA 3V9ZA 1SSFA 2G8UA 4N76A 3AVAA 2RF2A 1BQMA 3NH2A 3RMCA 4FM1A 4OKEA 1RT6A 1S5JA 1VSIA 5JS1A 1ASVA 2DIQA 1YTAA 4PUOA 4DFMA 5C25A 1KCFA 3ZT2A 4L8RB 5J39A 4IUVA 2RJFA 4B08A 1HRHA 1OZ2A 2RHYA 1BGXT 2ZD1A 3KKSA 4PA1A 4CJLA 4FJMA 5KCHA 1HNVA 1Q9YA 2DAQA 3QLHA 4M3ZA 3HPHA 3JYTA 2Z1HA 2DTUA 1MU2A 1X9WA 4L59A 1J54A 1ZYQA 2P51A 4HCCA 4QW2A 3SUQA 1ASUA 3ZT3A 2XO7A 4RW6A 4DLEA 4E7JA 3NF8A 1U48A 3Q1JA 1YT3A 3L8BA 3HSTB 1SKRA 1Y97A 2VG7A 3S3NA 4KREA 2OPRA 1HYSA 1NKCA 3E01A 5HBMA 3SV4A 4HUFA 4CGDA 4Z02A 3K5OA 4C8MA 4LY7A 4B9LA 1WJSA 4CJUA 1RDCA 2BGGA 1YTUA 1LWFA 1EKEA 4NCAA 3LALA 4CJWA 3A2FA 4CHPA 2OPSA 3AO3A 1IKYA 4B9TA 1D9DA 3TABA 3FEOA 3AVHA 4DG1A 4O44A 4M3YA 1SKSA 3VQEA 4CJFA 4CK1A 4FLTA 4KFBA 2BUDA 4E0DA 3SD4A 4DTXA 3LP3A 2KW4A 1HMVA 3RMDA 1CXUA 3B6PA 1CZBA 1JLQA 1WN7A 4JLHA 2DIGA 4H4OA 2DFHA 2IC3A 1KFSA 4A4FA 3DRRA 3C95A 3SYZA 1ITGA 5C42A 1W0HA 3DM2A 2G8VA 1JL1A 1VRTA 1SL0A 5KE3A 3AVCA 3LPTA 4DFJA 4DS4A 1TK8A 3U6FA 4TSXA 3NDKA 5D6YA 1U04A 1TV6A 3PX0A 4RW4A 3LZJA 2W42A 4C5GA 2QKBA 1Z25A 4KTZA 1LV5A 3FC3A 3VA3A 5KGXA 3M8PA 3ME9A 3SUPA 2HVIA 4ELVA 3PFSA 3MEWA 1KRPA 3SUOA 2ETJA 4YFUA 3QIPA 3OJSA 3HL8A 2HB5A 4FJNA 1C6VA 4QQ6A 2L3RA 1JLEA 1RDDA 2EQJA 3KLHA 3SQ1A 1S1VA 4EDUA 3CFOA 4OGCA 2YKMA 4CJ5A 4B9VA 4BDZA 2D0BA 3B6OA 3K5MA 1NOZA 3QEXA 1F21A 1WJQA 2X74A 3TANA 1UA1A 2WOMA 5J2MA 3M8SA 4HUEA 3RRHA 3E9GA 3MEVA 2FBYA 4DSJA 1GOBA 2F5KA 3C6UA 3D0PA 4QQGA 4F3TA 4E19A 3K57A 4CHQA 3TAGA 3QJ6A 3SNNA 5CY4A 1DTTA 4JS5A 4FYDA 4B9XA 3LGFA 2X4WA 2GUIA 1S1TA 4KI6A 3H8ZA 3PX4A 1J9AA 2XDPA 1C0UA 3P1GA 4ZHRA 4DTNA 5HP1A 2FHDA 5KGWA 3SZ2A 3RR8A 4KHNA 3WNFA 4BE2A 3CM5A 4M3XA 3PX6A 3SCXA 1HQEA 1IG9A 1VSDA 4EZ6A 2VG6A 3NH0A 5KE2A 4CIEA 3NCIA 4QCLA 4FJKA 2LTOA 4JRPA 4BE0A 5M9OA 4OKKA 5CYMA 3CQ8A 1JLBA 3WNGA 4LSLA 3PUFA 4J2DA 4DMNA 4HTUA 3VQ8A 1JLFA 3M8QA 3OYHA 3I8DA 2KZZA 3AO4A 2LDMA 4FM2A 3K59A 2R5MA 3OS2A 1LW2A 2CKKA 1RNHA 3QIIA 3KD1E 4KHSA 2VG5A 3CYMA 2A1SA 2EQMA 5KH6A 2HQXA 2NUBA 3ZSXA 4Z4IA 4CEDA 3AVMA 2K3XA 1KSPA 4Q0BA 3RTVA 4DF8A 1IO2A 2IOCA 4F8RA 4KV8A 2VWKA 4HUGA 4N4HA 2LSNA 1FKPA 3O4QA 3AVIA 3NFAA 4WE1A 4KKOA 3KLEA 2HMIA 3OYFA 3AVKA 4B8CA 4G1QA 3ZSRA 3H6ZA 3AVJA 2HNYA 4W5QA 3DOKA 3MECA 4DTPA 1TAQA 4BDPA 1U45A 5CZ1A 5I3UA 3ITHA 3V9SA 2B8AA 4DFKA 4CJVA 2YKNA 2G8IA 1NJWA 1RTDA 4FCYA 1UAXA 4DTJA 2X4XA 4W5RA 5HROA 4I2QA 3CFRA 3DLHA 4K8XA 3L2VA 2L89A 4CIFA 3IAYA 2OZMA 3QETA 4M41A 4FJJA 1RTIA 1NK6A 3VQBA 1IKVA 3L2QA 3AVNA 4OLBA 1VSFA 2RJDA 4CRIA 3KD5E 3TWHA 3ZSVA 3DLEA 2F8SA 3LDSA 4F3OA 3PMTA 3NF7A 1JLCA 5KI6A 4KHYA 3NTKA 1H3ZA 3BDLA 3AA4A 5J26A 2MWPA 1KHCA 1L3VA 2BDPA 4BDYA 1S1XA 3ASMA 3SQ2A 1TL1A 2G8HA 3HXMA 1KVAA 2P1JA 4II1A 3MXMA 1LWEA 3V1OA 3QERA 4KHUA 4CE9A 4C8NA 2RPIA 2G3RA 3O3FA 3P8DA 4LD0A 3MP8A 3DLKA 1UWBA 3FFIA 2KTQA 1IKWA 4AHCA 1R0AA 4FK4A 3NGIA 3D45A 3TAEA 3K2PA 3PV8A 2IG0A 3DRPA 4FU6A 3HK2A 5HLFA 4CF0A 4DQQA 4FJGA 5KRTA 4DTOA 4IUPA 3V9WA 2GFUA 1QE1A 4K8ZA 4PL6A 2M0OA 4LSNA 4CJPA 2F8TA 1ZBUA 2E6MA 4C5EA 2G8WA 1Q9XA 3IS9A 3KLFA 3OY9A 4CIGA 3OYBA 4DTUA 3VQDA 1VSMA 3DI6A 2NLUA 5FRNA 4CJ4A 2GBZA 2Y1IA 4KI4A 2GFAA 4RG2A 1TAUA 4M45A 4E1MA 4OJRA 3VQQA 4CJEA 1HJRA 2G8KA 1B92A 4CK3A 4CK2A 4CEFA 2YNHA 1U49A 1LAWA 4FLXA 4O4GA 1I3AA 3KK1A 5SZTA 4DQRA 4EZ9A 1TGOA 3TAMA 1EX4A 4E7LA 2P0KA 4OGEA 3KLIA 3LH0A 1L5UA 4QOZB 2FC0A 4C8KA 4RW9A 4CF2A 3L3UA 2YHBA 2I5JA 1BL3A 2PQWA 3DLGA 3AV9A 1T8EA 1QSYA 1RDAA 3MEUA 2DY4A 4J2AA 4DSLA 5FROA 4PLIA 4M3UA 2HHVA 4NZGA 3ULDA 3DLBA 3BDPA 3DB4A 1QS4A 3VQAA 3PY8A 4M3WA 4Y1CA 1NK4A 4CJTA 3CG7A 3OB9A 3O8VA 3OYEA 1FXXA 4CJ3A 3LP0A 3F70A 3MEEA 4I2PA 3KKRA 4M3RA 4AHSA 4EP5A 3ZT1A 4E89A 3L2RA 3HVRA 4PQUA 3K58A 4NCGA 1GOAA 2Q3SA 1L3SA 4N4GA 4ZTJA 3HYFA 3EZ5A 2HHWA 2VWJA 4OPKA 1DLOA 3THVA 4CFDA 3VQ7A 4FW2A 4Y1DA 3QBYA 1NJXA 3LP2A 2OZSA 4FJHA 1NJYA 3V9XA 3VQPA 4FJ7A 4W5TA 4CEEA 4FLVA 1Q8IA 1TKDA 3AA3A 1VSHA 4B9MA 1A5XA 3MXIA 4AH9A 1RBUA 5D6WA 2Z1IA 5FDLA 2HHXA 2RN2A 3LLRA 1TK0A 3U3GA 3L2UA 3NGZA 3ALYA 4NCBA 4DSEA 2QKKA 1RBTA 4FJ5A 5HRPA 4CEAA 3AVLA 3MO8A 4DQSA 3P83D 3LAMA 4N56A 1KTQA 1CZ9A 1RCHA 1RBVA 1BIUA 1NK8A 3LZIA 4OLAA 2PZSA 2E6LA 4B3OA 3AA2A 3KUFA 3O3HA 2XK0A 3DRSA 1G5VA 3EYZA 4DTMA 1RT7A 1OZ3A 1SKWA 4PY5A 3QNNA 1T05A 2YRVA 1S6QA 4DSFA 5FRMA 1U47A 2X6NA 4KTWA 3META 4LH5A 1S1UA 4MQ3A 3M9QA 3QEIA 1RT1A 1BHLA 1QTMA 2BE2A 1WAFA 3PO4A 3CM6A 2HHSA 3K5NA 2O4GA 1QSSA 4E7IA 3ISNC 2FBVA 1WAJA 1RT4A 2FBTA 1OI1A 2X78A 3IRXA 3T1AA 3SI6A 3V4IA 5I42A 3AO2A 3ZSWA 1NJZA 2QQSA 1S9EA 3S6WA 1YVUA 4BWJA 4KB1A 4CESA 4F2SA 3E9FA 3ZT4A 3OVNA 5J2NA 2ZE2A 1S1WA 1EXQA 3RMAA 1HQUA 1VRUA 4AILC 3O3GA 1TKZA 2XY5A 4LH4A 3KK3A 4ID5A 3SPYA 3JSMA 3UT1A 5SWMA 2RHXA 2HW3A 3RRGA 4IFVA 1NK0A 4HHTA 4FZXC 3VQ5A 2BKDN 3LYIA 2YNIA 1L3TA 4UQGA 4GW6A 4FLUA 1Z26A 3IG1A 2MWOA 1SL1A 3DYAA 2PYLA 4KHQA 1TVRA 4DS5A 3L2WA 4DSKA 2YV0X 1NKEA 1C0TA 4M42A 4W5OA 4N47A 3HPGA 1L3UA 2HVHA 2O4XB 3DMJA 4GMJB 4J2BA 3CEYA 5IAYA 4FW1A 4I7FA 4OPJA 3OMCA 3WNEA 2RHIA 1G15A 1B9FA 2E5QA 2A1RA 4DFPA 1BQNA 3S9HA 3L42A 2OPPA 4ICLA 5T7BA 5EU7A 4O0IA 4GVMA 1MHNA 1SV5A 1ZBIA 4N41A 3TAFA 4FZYA 2P5OA 1CLQA 2EQKA 3S3OA 2AJQA 5HRRA 2ZQBA 1JLAA 2KFZA 1I39A 4ELUA 1BISA 3KLGA 1LW0A 1TKTA 4C5HA 4PWDA 4B9UA 3ZSOA 1BCMA 2QXFA 2XRIA 2RHUA 4DTSA 3OYMA 2HHTA 4FJXA 1T03A 4F4KA 4I9QA 1OYXA 1RI0A 3C4SA 2XY8A 4DU4A 4RW7A 4X34A 1JL2A 4CHNA 2RHZA 1SUQA 1BI4B 3CFPA 3RWUA 2GF7A 3NTHA 3MP1A 1KLNA 2P5GA 3ZCMA 3QNOA 2E4LA 1GOCA 1X9MA 2LVMA 5HRNA 2RO0A 3L3VA 2RI5A 1HYVA 3G10A 4Q5VA 2DFFA 3HVTA 4KRFA 4DU3A 3OYNA 3ZEHA 4B9NA 4IKFA 1WSEA 3SQ0A 3KIOA 4DF4A 2ATQA 2RI2A 2XHBA 3VQ6A 4BD3A 2JZ2A 2YHAA 1RT5A 4DQIA 4CGFA 3VQCA 1WSFA 4JRQA 2B4JA 2JLEA 4MFBA 2M1HA 2G8FA 3I0RA 3NE6A 1BIZA 1KVCA 3ZT0A 1ZBLA 4KPYA 3LANA 2WONA 4C8OA 1NK5A 3ZSQA 1JXEA 1B9DA 3SQ4A 5C24A 3V1RA 2Y1JA 3VQ4A 4HVJA 4CFBA 1RT3A 2RKIA 3DLMA 3TR8A 1HNIA 4H4MA 1XHXA 4N5SA 2D0CA 2EFIA 2GV9A 4I9LA 1XWLA 4A4GA 1WNSA 5J2QA 3LWMA 3OQ5A 4DWIA 2IGIA 4RW8A 4OVLA 3AO1A 4BE1A 2R5AA 1O1WA 3WNHA 4HCBA 4KHWA 1U4BA 3OYIA 3EY1A 2L8DA 3MEDA 4CF1A 3LX7A 4IUQA 1VSJA 2KQ2A 4QVZA 3G0ZA 4CERA 3V1QA 1NOYA 4CHOA 1IH7A 3ZSYA 4CGGA 4BACA 3TARA 5KTQA 1VSLA 3KJVA 1D5AA 1FK9A 3OYDA 3AVFA 2K3YA 1S9GA 5C0MA 4CJQA 4ID1A 5C6SA 4C8LA 3VA0A 1EP4A 4IBNA 4AHUA 3OMGA 4FJ9A 4UC4A 3LGLA 2O4XA 1KLMA 4N4IA 1RBRA 1VSEA 2Z1GA 3NAEA 3P8HA 4CECA 5J2PA 2OYQA 3RR7A 2YNGA 4B9WA 2D0AA 2O4IA 1N5YA 2R57A 5J1EA 4DU1A 2RJEA 4DLGA 4XIUA 1TKXA 3QEVA 4KB0A 4R5PA 1S6PA 4Z4FA 3FDRA 3AO5A 3NHGA 4Z4HA 3HPOA 1IKXA 1TK5A 4FLZA 5D3GA 1ASWA 3LAKA 4FLYA 2XY6A 3UWNA 4E1NA 1EETA 1FKOA 1DTQA 5CYQA 2D9TA 4O5BA 5KRSA 3TI0A 1CXQA 3C6TA 2R7YA 3MEGA 3SV3A 4OVAA 3NTIA 1VSKA 3HO1A 3OYCA 2F96A 2JTFA 4QQDA 2EHGA 1WLJA 1RT2A 4E3SA 4A4HA 1VK0A 3MAQA 4AHRA 4CGIA 3AA5X 4LD6A 3NGYA 4CHYA 1BI4A 3OS0A 1HPZA 3NF6A 3EAEA 4GY5A 4E7HA 4J2EA 2X35A 3VQ9A 1UA0A 3LPUA 1UOCA 1NKBA 2RI3A 4W5NA 1NK7A 3OJUA 1T7PA 4FJLA 2HNDA 4CHZA 2BIVA 4H8KA 3SUNA 1HYZA 2LRQA 3HT3A 4IG0A 4CEQA 1QQCA 3P5JA 1RTHA 3SPZA 1ZBHA 2RJCA 3GOXA 1SL2A 4F2RA 1QSLA 3PO5A 3DOLA 4FM0A 3OS1A 4ELTA 3NNQA 3K5LA 4OKJA 4CGJA 1JXBA 4CJSA 1J53A 2HQEA 3KTQA 5D6XA 3NBPA 4NS5A 3HJFA 4CGHA 4Z4EA 3OYJA 1LAVA 4KTQA 4FLWA 1A5WA 2LCCA 4FJ8A 2HHUA 4NYNA 2VYTA 1C1AA 3NF9A 3ZSZA 4IG3A 2B5JA 3O4NA 3OA6A 1X1PA 4B8AB 3C94A 4DTRA 3QO9A 3OYGA 3UIQA 1C0MA 2IS3A 1WSHA 3OYAA 4CJKA 1KFDA 4RG8A 4B9SA 2B6AA 4NYFA 5HRSA 3SJJA 4JS4A 3H08A 1RDBA 5KCOA 3BGRA 4CCHA 3VN5A 4CF9A 1A5VA 1NK9A 3QINA 1RILA 2XY7A 1WSIA 3QESA 4IDKA 1XHZA 2DFEA 1J5OA 4CEBA 4CEOA 4FK0A 3T19A 4KO0A 2E6NA 1RTJA 1RBSA 4CEZA 2YNFA 2PY5A 1C1CA 4HCZA 3QEWA 2BANA 3LWLA 3V9UA 3M8RA 4AHTA 3S3MA 1WGSA 2M16A 3QIOA 2PYJA 4ZTFA 3V6DA 3ASKA 2HNZA 1BCOA 5DK5A 4DSIA 4E7KA 4BWMA 4FXDA 1TL3A 2Z1JA 2KFNA 4IUUA 4CFAA 1D9FA 1WSJA 1N6QA 2EKOA 3DLRA 3F73A 2OA8A 2IAJA 4YNQA 2EX3A 3MXJA 4Z4GA 3NH1A 4O55A 3HP9A 4PLLA 4Q5WA 5K14A 3DB3A 3T3FA 3FLGA 1QHTA 5CIUA 3TAPA 4CF8A 5E41A 4DQPA 1WJRA 4FL6A 4C5IA
chains in the Genus database with same CATH superfamily
3I55N 3KETA 4IURA 3KP5A 2DL8A 2XIGA 4M71A 3CMEI 1KIKA 4JYKA 1KGSA 2LF8A 3DXJF 3VS1A 1Z1DA 2RK2A 3CCLA 1LWCA 5C2FA 4A4EA 4AFZC 2ZPHB 4ZZDA 1SMYF 3MP6A 2KT1A 1QGPA 5GANf 1YRNA 2LR8A 2M9HA 4AMCA 3AVBA 5IP7J 2D5RA 5K5RA 1JKHA 4FVMA 1IXCA 2MLGA 2OCCH 3J7AY 2QQBA 2JGUA 3U4LA 2FX0A 3HTSB 1RUWA 4A2BA 1FOYA 3F9MA 2OPQA 3QB0A 5ADXA 2E4HA 4R55A 1W4SA 1WHHA 2LLKA 4WCGA 5GAN6 3EYYA 2VOOA 1KC8U 3TW6A 1RDUA 1OCRH 1YS7A 3KEYA 3CMAQ 1X3NA 4OMZA 4B43A 3H3UA 2UZKA 5A0LA 2NNYA 1IGUA 1FYLA 3H9JA 3HKZN 3OSVA 4EW0A 4F9OA 3L7WA 1LQ1A 4O0JA 1XQHA 1WZ2A 5GAN5 1VQNN 1UGVA 3CC2A 2E88A 4H4KC 1D8YA 5DMRA 4QAGA 3CC7N 2QK9A 3S2DJ 3QO3A 3LA2A 1SSFA 3CCMA 4N76A 3E5XA 1FMWA 3O1WA 3VEPA 1K4SA 5A0GA 2BE9B 5EC7A 2Q0UA 2GXAA 2DOAA 2FOKA 2YXYA 1S5JA 1ASVA 2HVRA 3AGRA 2ECBA 3CCQQ 4C8QG 3UA7A 1YTAA 4A5BA 4PUOA 4DFMA 1Q81R 4XH1A 3S1RJ 2HBJA 1D5YA 3NAUA 4L8RB 4LFUA 1KD1R 2IP2A 1WXUA 4ZYGA 4PFPA 1U06A 1I3QJ 3CD6Q 1OZ2A 1IHWA 1GBQA 4IRGA 5CLSA 3SLCA 2ABKA 2RHYA 5ICGA 1BGXT 1BWFO 4C8QF 4FJMA 2EBPA 2FRYA 4B3MK 3IKTA 1IUYA 3EFRA 2EZLA 2O8EB 1IZ6A 1ON2A 4Z88A 3I0XA 3L2ZA 1ZRCA 3QLHA 1WRJA 2YWWA 3LCNA 3JYTA 5BR9A 4UUSA 2QKMB 3QPLA 3FRNA 2XRLA 3O6WA 4N9IA 3ULQB 4CH7A 5DDGA 2B63J 4HCCA 4QW2A 4YOWA 2VLAA 1N8RO 3GTGJ 3ZT3A 1VIFA 5AQQA 2DXCA 2DE0X 1T0JA 2LMJA 5TGTA 1YT3A 2L4AA 3L8BA 1SKRA 1QQNA 3GO5A 5BRHA 4KIGA 3IKVA 3ASNH 5LGUA 5HBMA 3SV4A 5LJ5j 3LDLA 1Q7YU 1H8KA 2Y30A 5IHIA 5M1OA 4C8MA 4JJBA 2JWKA 4JJDA 2C06A 4YOUA 1BI3A 1RDCA 3BR2A 2ESNA 2WSEE 4BG9A 4L18B 2JRMA 1XNQK 2P0WA 3BWGA 3R6OA 1Q7YC 1O3QA 4BS9A 5IT9K 1ORNA 5CVRA 3JAMZ 3E6BA 4LNPA 1S72T 2IIRA 4D0PA 1DU0A 2D5VA 4WXHA 1IKYA 4B9TA 2CQQA 1D9DA 4O44A 3C6HA 1SKSA 4CK1A 4O3MA 1S7AA 3TKYA 1YQLA 5IYCJ 3H0GJ 2JM8A 3RPUD 1CZAN 4A12A 1X58A 3J81Z 2LQWA 3JCMV 4KFBA 2CW8A 4PHTX 2NNNA 1WJFA 1VQOQ 3QOEA 3LP3A 4DTXA 1WI9A 3QWLA 2MI6A 2KW4A 1HKGA 4RGXA 2R93J 3SAGA 2DA7A 1S29A 3TSZA 4LN2A 1WUAA 3BJ6A 1WKMA 4AWXB 2DIGA 4Y92A 1IHVA 2DFHA 3LOCA 2VUBA 1BA1A 1RAAB 2E20A 1QCFA 1ITGA 2O8CA 3K1MA 3DTIA 2JPCA 4M73A 3FHZA 4XIDA 5I2SA 5GMKe 1R00A 2JUCA 2HVQA 4TSXA 3NDKA 5D6YA 3M56A 4BRPA 1V5GA 3JRHA 2O8KA 1LFPA 4M77A 3RKXA 4DZJA 3PX0A 4RW4A 2PNIA 1IXRC 5KYUA 4C5GA 4HNVA 2RPNA 2QKBA 1Z25A 5FD6A 3OS5A 2XUBA 5KGXA 1VQMQ 2CUBA 2YUOA 5LEJA 2HF4A 2L0KA 3SUOA 4XEIA 4C0ZA 1QHHD 1X6GA 3QIPA 4UY8I 3ESWB 3L1PA 1OJLA 4QQ6A 2DL3A 3RQIA 2L3RA 2VVKA 1RDDA 1Y0UA 2M0CA 1Z6TA 3KLHA 2ZXHA 4L5IA 4EDUA 3M5RA 3JCMf 3THYA 3CLOA 3G71I 2JS2A 4RCCA 4EJYA 1KAZA 1SFOJ 5BQTA 3A5OC 1M1EB 3AG2H 3QQAA 3LFKA 1VQ4A 3KTUA 1VQ9Q 2KRMA 1NOZA 2KIMA 3DXMB 2O0YA 3CDLA 1F21A 2VJ5A 1WJQA 3JS6A 1N36K 2WOMA 2GQQA 5J2MA 1B9NA 1OU9A 5GAGP 2HYGD 4QIWN 5L3CA 5DY9A 3KYDB 4XLFA 2OD5A 4ABZA 4F3TA 4E19A 3K57A 3QPSA 3VMFB 1HKCA 2MG4A 5KYYA 4JI3K 1G99A 5CQYA 3VGMA 4EA4A 1H88C 3LGFA 2X4WA 2IVNA 3HB9A 2DMQA 3RJPA 3PX4A 1EF4A 2XDPA 2Z9OA 2O6GE 3B6AA 3HOZJ 5B3SH 1M3AA 1H0MA 4LDUA 4CA0A 3FLCO 3WNFA 4BE2A 2H56A 3UE5A 3CCEQ 2VUMJ 4XU1A 4QCLA 1VQKQ 3FHNA 1NK3P 2FEZA 3DWLA 3G0QA 2D1XA 3FMRA 4KGVB 1JLBA 1GXPA 3EG1A 2KDOA 5M5XJ 5JVHL 1VQ6A 4HTUA 3PSIA 1JLFA 1BIAA 2KZZA 3AO4A 1AWJA 1VQ8T 2R5MA 2JWTA 1USTA 3QXEB 4XICA 4NHJA 3OS2A 4PJMA 1O75A 1GXIE 1PKSA 1RNHA 2LRDA 1FWZA 1F4KA 4IO8A 4I01A 1FBSA 1ATRA 1EFNA 2QEXT 3D6RA 1I6XA 2EQMA 2A68F 2P84A 2HKNA 1SHGA 4NNJA 1U8BA 3ZSXA 4Z4IA 1VQ5N 4MQVA 4PSWA 5LJ3g 3M4GA 3ZRGA 4HVWA 2IS2A 2MA3A 4Q0BA 3O80A 2Q0RA 5F1JA 1IO2A 4LXCA 2IOCA 3CESA 3T7ZA 4PJOA 2GAUA 4N4HA 2K5CA 1QZYA 3RKQA 1DPUA 1N8RU 3VESA 2KRHA 2HMIA 3OYFA 3ZQCA 1LPQA 1YJ9N 4B8CA 3I0WA 1TTYA 3N4QA 3OH6A 1Z91A 3A8LB 3AVJA 2OI3A 1R9TJ 1Z7LA 1G8XA 2HNYA 2H3JA 1LDKB 1TAQA 3AARA 1Y8QB 2CP3A 1N8RC 4UNFA 4J9HA 7AT1B 2J7IA 4BRIA 4HRIA 2GA2A 1H92A 1W5CC 1G4DA 4WFAL 4MIMA 5HOOA 1R0BG 4JN4A 4XSZF 3VRYA 4ILJA 2Q0OA 3SWNA 2YCHA 1FYNA 1RTDA 1ENHA 1VQ7A 3PNVA 3D4VA 5BN9A 4DTJA 3CCLN 4J7IA 4I2QA 3I55I 3PIPA 3CFRA 3KP2A 3MHXA 4K8XA 3LSKA 1VQPI 4H0TB 4CIFA 3CJQB 5CHZA 4KISA 3QDRB 5ICFA 5H2FC 3EGUA 2E10A 2OZMA 3AFHA 4FJJA 4MLOA 2V7FA 3AVNA 1YHQA 2P9PA 2H1LA 2B9SA 5GAMf 3KD5E 2JNGA 3TWHA 4H5NA 3MMYB 1BA0A 4KH6A 3CQTA 3IUOA 4F3OA 5KI6A 1QVGS 3AA4A 3VSKA 1KHCA 3VPZA 2BDPA 1XTDA 4BDYA 2E2NA 3UB5A 3LA7A 1TL1A 3R2XC 1W7PA 4IRHA 5E79C 3OWTA 2QQ9A 5IXBA 1VQLN 2XAJA 1Y07A 2RA2A 4LC9B 1LWEA 1PVEA 3J80O 4KHUA 3QYHB 4C8NA 3EE8A 2RPIA 1PRMC 4FPAA 2NVXJ 1M5Q1 4MLHA 2BVMA 3O3FA 1NMDA 4LD0A 4XTVA 3EUKL 1N6AA 4FK4A 3I4PA 4L6V5 3H0IA 3CCMN 4MO5A 2IG0A 1B8IB 2YLBA 2QENA 1KU9A 1LOJA 4FU6A 2GEMA 3HK2A 1R49A 1W4MA 1YG2A 3VUZA 2D2WA 1E3MA 1EBMA 4DTOA 1UDLA 1QPMA 5EGOB 1HXDA 3I71A 4PL6A 3H5AA 4IO9L 3H0HA 4LSNA 2MIOA 5DTDA 1YJWI 4BQLA 2PJRB 1ZBUA 2PVGB 1ZSGA 2EPDA 3U23A 4L9JA 2QSHX 2E1MC 3KLFA 4QWQA 3OYBA 4NQWB 1WB9A 4LF8K 1AD5A 2LC4A 5I2MA 1VSMA 5ICEA 1Y1VJ 3DI6A 2NVTJ 3CPEA 4A69C 2MH2A 4MDXA 1T0FA 4M9SA 4HLYA 3C2BA 2NVYJ 4EJUA 2Y1IA 2KDZA 4IZZA 4XKWA 2CGJA 2E1ZA 2P9LA 2GFAA 1TAUA 4M45A 4OJRA 3DLLA 3I56T 3TSQA 3RMSA 4CCKA 2W7NA 5DCMA 4E4HA 1B92A 2L7MP 4X1VA 4AQYK 5D5XB 2KRCA 3EGXB 2YNHA 1LAWA 2DNUA 1YIJI 4CSWA 2DTHA 4J7FA 4GGGA 3KK1A 1HD3A 4XTUA 4DQRA 2F2WA 3H6EA 1A6IA 3DF8A 3C18A 2A0FB 1EX4A 4E7LA 3IRQA 2M45A 4LFBK 3RESA 3ZPLA 3WTYC 3KLIA 4YEJA 4M3EA 3LH0A 3J80Z 5IHNA 4QOZB 4RW9A 4RAGA 5CR2A 2KL4A 1FOKA 2VQCA 1FPQA 3ZN0A 1M3BA 2P9UB 5AQTA 4LIVA 2I5JA 2HYJA 2DJNA 1TH7A 3K7AJ 3HOVJ 2ZC2A 4O5FA 4BGAA 2CFOA 2DY4A 1QHAA 4J2AA 4JKHA 2DRKA 1SG5A 5KPZA 4NZGA 4ME7A 3M6GA 4BC4A 4L9VA 3DB4A 1IG8A 3F6OA 4RCBA 3VGKA 5AQUA 3PY8A 4A53A 4B4CA 4AT1B 1UELB 4Y1CA 1FP2A 3OOPA 2IS1A 3O8VA 2XKOC 1LJOA 4AC0A 2K40A 4YFNF 3E9PA 3R1XA 4CCMA 4XRFA 3QICA 2FBHA 4EP5A 3C65A 5LBQA 4J8FA 3L2RA 4A3MJ 4HT9A 2M3AA 1AVZC 3HRMA 1MDUB 3H3ZA 3HRSA 4FOIA 3JB9J 4C30A 3HYFA 3V7SA 3A01A 3KP6A 1TU0B 4DQ8A 3DBLB 4JI0K 1ZRDA 2CREA 4ZYAA 2DMUA 1DLOA 1RGIA 3IV5A 1K4US 1U2VB 3QBYA 4B1VA 3LP2A 2OZSA 3G7ZA 3V9XA 4W5TA 4CEEA 1MMNA 3AA3A 1WX6A 1HK9A 5D5UB 2QQAA 3SZPA 1MBJA 4AH9A 1RBUA 2A41A 1HLVA 5J3LA 1P59A 1G6NA 3BR6A 5HDGA 1SANA 2CGKA 3MVPA 3VEYA 2RAEA 3VYHB 2XF6A 2A05A 4MNUA 3NGZA 2QG9B 5E3OA 3ALYA 4XOTA 1R58A 2X51A 3RSEA 2EB7A 5FLMJ 3DP7A 2AIRB 4CC4B 1ORKA 2QKKA 2VGNA 2V9KA 2DOFA 4DEXA 4ATOA 5B1AH 2WB1A 3L9FA 1GDTA 4DQSA 2R7UA 1O9SA 3CCVT 2XVCA 2ELHA 3K2AA 4OLAA 2PZSA 1I50J 4HAMA 5I22A 3QBXA 3KUFA 3O3HA 3CC4I 2XK0A 4E7ZA 5AQXA 4DB3A 3CBPA 2Y9ZA 1TXQA 1G5VA 5AQWA 4IHTA 1RT7A 1OZ3A 3HHHA 3P9CA 4DSFA 2R5YB 1OLTA 1RLPC 3C2HA 2RF0A 2QWLA 2X6NA 3LWFA 5AR0A 1VOMA 3META 1S1UA 3M9QA 2HMPA 1YX3A 3X2QH 2J6OA 2NRZA 3PGGA 2VKVA 3CHWA 1BHLA 3O9RA 4Y7NJ 1QVFS 2VBZA 2BE2A 1S72A 2RQWA 2HI3A 3PFIA 4CI0C 1O4XA 4AM3A 1OPCA 5JHUA 1XGOA 3GIBA 3VYTB 2FBTA 2RVCA 2X78A 2JMAA 2JOYA 2K2MA 4LG3A 1PDNC 1ZKGA 2XDBA 2KAFA 2KEAA 1NJZA 4M7DA 1YW9A 3S6WA 3CCYA 3PT9A 3H45C 1Q1VA 3WXJA 2VQLA 4KB1A 3MN6A 4CESA 4BR2A 3E9FA 3OVNA 5J2NA 2ZE2A 3G6EI 2CH4W 2CV1A 3R60A 3H36A 2XY5A 3ZYYX 2L0AA 3VS2A 4LH4A 3KK3A 3FFKB 2ZWHA 2EFWA 1WJCA 5SWMA 2RHXA 1NK0A 4YDUC 4HHTA 3JCMc 2QTDA 3VS6A 3GW2A 4FZXC 3VQ5A 2YNIA 4F91B 1L3TA 3KZBA 2K9LA 2QBYB 1M8VA 5GAEP 4FLUA 2ZNZA 1BK2A 4DW6A 4S05A 4BR4A 1Y8RB 2CH6A 3WUHA 2PYLA 4UUSB 4BYYA 2MD5A 3CLQA 2YV0X 3ATVA 1NBEB 2HZDA 1E7OA 1NKEA 2NOJB 4RS8A 4GMJB 2ZF5O 4FYYB 5IAYA 3L00A 4FW1A 3NGPA 4I7FA 4OPJA 3UKUA 3WXLA 1ETVA 1VQ5I 3MKWB 1G15A 1D0XA 2GQVA 2LNHB 3EPZA 2E5QA 3J7YP 1JTYA 1X2QA 2ITMA 5BNGA 4N9HA 1GV5A 4ICLA 5T7BA 5B5EC 1O3SA 5EU7A 2K9MA 2HQHA 4GVMA 4O0IA 5LHHA 2IGOA 3QU6A 1ZBIA 4FWQA 4ZDOA 2P5OA 1YJ9I 2AJQA 2C0TA 4Q47A 1OVQA 4XLAA 2RGVA 4NL3A 2WC2A 3BJOA 3HL2A 3UATA 1O13A 4D6WA 1TKTA 4C5HA 1CKBA 4PWDA 3AG3H 3ZSOA 3EKUA 4PUSA 5CAIA 2HZYA 3OYMA 1YQRA 1T03A 4F4KA 2XAUA 3BC8A 4C3JJ 5AQJA 2BHZA 4H0YB 5AIPA 3OW2S 4Y91A 3MN7A 4B9QA 3QOPA 1JL2A 4A0ZA 3QMLA 3W3DA 2B7EA 3HRGA 1YHQN 4GKJK 2P9IA 3MN9A 3BR5A 3MPUB 2P5GA 4ILHA 3ZCMA 2R7XA 3S6IA 1LEAA 4EMKB 3QYBA 5J4VA 1HYVA 3Q9VA 3RPQA 2DFFA 4ESFA 3QSUA 3OYNA 3ZEHA 4IKFA 3VYUB 3SQ0A 4MQ9F 3K0SA 2PBDA 4HOBA 4JQFA 1PWTA 2NYXA 5JVTA 1XSVA 5B8HA 5CK9A 3HRTA 2R7ZJ 1MUNA 1E3OC 4EJTA 2O8XA 2RI2A 4C92A 2K5LA 5KQDA 4MTDA 3F0ZA 1RT5A 5M3FJ 4RTXA 5FLVA 4CO8A 4JRQA 2B4JA 1XC3A 2JLEA 1VQ8A 2R7VA 1ZA2B 5AQOA 2IRFG 1IN4A 4JX5A 4BKXA 5AQIA 1BR2A 2V1XA 3CC2I 1KVCA 4LB6B 2CG4A 4KPYA 2E6ZA 4XAXB 2WC9A 4J01A 2QEXA 2ZJ2A 4A5AA 1Q86O 1JXEA 1Y56A 3ZQIA 4S04A 4E9FA 2X4JA 3M4YA 1T3VA 5C24A 2Y1JA 1HNXK 4BC5A 1WJ5A 1NZ9A 4C1NI 2IVMA 1B59A 1YP5A 4L5EA 2O5RA 3TR8A 1YX5A 3DPLC 3FJPA 3CMEQ 2DJQA 1HKBA 5J2QA 2IGIA 4RW8A 3E9OA 4CW7B 1KG7A 4DA4A 4M77E 4YTLA 2BZXA 2JQ7A 3M54A 1QP3A 4M77G 5DUIA 2RC4A 1VQKT 2L8DA 1B9MA 5L3EA 4CF1A 2I5UA 4JRKA 4FHTA 1MZBA 4BR9A 5GAN3 4Y17A 3G0ZA 1SAUA 4IEJA 2I8DA 4XN3A 4OIRF 1DPRA 3CCUT 3OTOK 4BACA 3SFIA 5KYYB 5KTQA 2HDWA 1DUXC 1KQSA 3WU2C 4J9EA 1ZTRA 1NJIR 3OYDA 2X1CA 2EJ9A 2ZJQF 5C0MA 4DJAA 2KJCA 5DD4A 1D09B 4N0AC 2HHHK 1HU0A 2J6KA 1BIBA 5GIOA 2V7ZA 1EP4A 3B73A 4AHUA 5C15A 4AF1A 2YJEA 5LL6S 2O4XA 4FT8A 1TQMA 3P8HA 4CZZA 4CECA 4DK9A 1ZHFA 5J2PA 3VFZA 2YNGA 2D0OA 5C12A 2O4IA 5J1EA 2E71A 4DLGA 3P8BB 1NNEA 2VXDA 3ZQGA 5IT9O 3QEVA 3LWHA 1PD1A 4KB0A 2CV2A 4ZC3A 4Z4FA 4P5OA 2AS5F 4JUVA 3C3WA 2PZ1A 2DK5A 1GL5A 3FXOA 3NHGA 3GTMJ 3O9UA 4B3XA 4A3IJ 3TPQA 2O61A 5D3GA 3BQZA 2LKSA 4E1NA 2L5QA 3CWSA 5CYQA 2FRWA 3MWMA 2Y0SA 4LG0A 5F6FA 1D1BA 5CR4A 2JHNA 4R56A 3CXCA 3R6MA 4JK9A 3NTIA 2QA4T 1I6HJ 2EHGA 2F5DA 1LDDA 3DWLE 1XOVA 4N0BA 1VK0A 3KP4A 1JCEA 1TSFA 1P92A 2KMUA 4A5MA 3SJMA 1K76A 4LD6A 3AA5X 2E70A 2QTVA 1WH7A 2I5WA 2E8AA 3LSMA 2OAZA 3RI4A 1WJDA 2HFHA 3OS0A 3NF6A 1X3WB 2DDAA 2GWKA 2VE9A 3PNTA 1FT9A 2X35A 1BOTO 4WF9L 4F7UA 3K0LA 1F5TA 3ZN1A 3AT1B 4KIBA 5LJ5e 2QSFX 2H6CA 2JT1A 3LSPA 4IJAA 2Q1ZB 1C0WA 5KPTA 3GFJA 1NK2P 1T7PA 2BW3A 3VW4A 1JCGA 1ZQ1A 1MDMA 4W97A 4H8KA 2FO0A 4PJOE 5F1XA 2GUPA 1T95A 2GTJA 4CEQA 1K83J 5EX5A 1Q82C 3I56A 3K4JA 4AIHA 2W82A 4ISGA 4XKVA 4HF2A 3SPZA 3EG3A 2EKHA 2RJCA 3W2VA 1KG4A 4PJOG 4PL8A 5CQEA 3G2BA 1OOTA 5GAN2 3D2FA 2EK5A 3OS1A 3TDZC 3ABLH 1MBKA 3GFLA 3VERA 4ELTA 3K5LA 4OKJA 4CGJA 2ZSHB 2P9PB 3KHYA 2R5ZA 2HMAA 5CYVA 5D6XA 3EG9A 2VXEA 3QZ9B 4NS5A 4ZYDA 1NLVA 3Q7BA 1ETQA 3HJFA 3A0HC 4BEHB 3KZYA 5EJCA 3MN2A 3K4LA 3E6DA 4EFHA 5E3NA 4GXOA 1J9IA 4ITVA 1W7PB 1C1AA 3AGKA 3NF9A 4DR4K 3ZSZA 2HBPA 2F4OB 3OA6A 4K11A 4B8AB 1VQ4I 1UECA 1S3JA 5TKWA 1NMNA 4DTRA 3QO9A 1IBMK 2YUSA 1RUOA 4JHDA 2BTFA 1K79A 1AU7A 3CWAA 4NC6A 5FFXA 4FO0A 2J5PA 3ZX0A 1RAFB 3K4BA 2KSSA 2ZNYA 1S72N 4CJKA 3RZDJ 5F64A 4B9SA 3K9JA 1R36A 3DPTA 1IRZA 3N0UA 2JRTA 4JJNK 1XGSA 3QP6A 4I2OA 2Y48A 4A6DA 1KYZA 3VGLA 4BL0B 3KVGA 3FXQA 5CKTA 5F0CA 2XDVA 3CUQB 1KA8A 1SD7A 4EJZA 3BGRA 3I5SA 4CF9A 1A5VA 4JI7K 3T5XA 1HKTA 2PVDB 4X62K 1Q86U 1AWXA 4U0YA 2L9SA 5M1KA 2DQLA 3PVQA 1BYMA 3KP7A 3M1FA 4EM1A 5FKMA 2KI7A 2KQRA 1NGBA 1Q86C 3JRIA 4FK0A 4KH5A 4UV8A 3F8NA 3SYTA 4XH5A 5IPAA 1PUFA 2CP2A 2OCEA 2ME0A 1N3CA 1IUFA 5AQRA 1VQ6I 3KEQA 1V5FA 4EMKC 4LD9K 2TRTA 4OFHA 3G71Q 3V9UA 4M7AF 2JPSA 5DCMB 4ZH4F 3GTJJ 4ENJA 3IWZA 2NOZA 1RR8C 1LWVA 3ASKA 3CQYA 3I0TA 5DK5A 5JR3A 2I7NA 4E7KA 2UUAK 2WY8Q 4FXDA 3JV3A 2NYSA 4BJTA 3FZMA 4F55A 5E84A 4Z8AA 4LJZF 3H9NA 2CP5A 4D7MA 3JB9G 1N6QA 5BREA 3CCVA 2DMPA 3F73A 2OA8A 2IAJA 2L02A 4AVPA 2RH2A 3CCSN 1GT0C 3L1AA 3E2UA 1Y96B 4M3DA 3JCMP 3ZQHA 1ITYA 5K14A 2FA5A 1MIJA 3I58A 1VYTA 1Z6RA 5EZHA 2DVJA 1CSKA 4CF8A 3A8MB 5GANe 1QP2A 5FLXE 2F5TX 4DQPA 3IC7A 1ETOA 5IN1A 2X6XA 4CC3A 1FEXA 4M3TA 4CJRA 5CZ2A 3A5ZB 2X48A 3I0SA 2X4YA 1JKOC 1SFEA 3GXOA 4LMYA 1VQ7I 3PNWC 1H1VA 1PU8A 4AYBN 3TO7A 2X6SA 1F36A 2V9VA 4DYQA 1U2WA 1V54H 4XK8E 1XC9A 1IC8A 1K9MR 2R7SA 1TG0A 1LE8A 4U0WA 3RPUA 3CXCM 1GBRA 4ZYHA 4CCJA 3M0RA 1HSJA 1BC7C 2ETHA 1G2BA 4Y33A 5GANd 2LT1A 4AHVA 1JB0E 3JREA 1EH6A 1WEFA 2RNAA 3H46O 1X4PA 3VENA 3ZFJA 4HT8A 4RM3A 1M30A 1C1BA 4LLNA 4JV5K 3LMMA 1XNIA 3FBIB 3EGDA 4KAZA 2COZA 4BY6C 3G73A 1YWPA 4KUIA 2K9NA 1X3UA 3A0BC 1ZXOA 2OTLT 1WJBA 1PHTA 1SEUA 1T39A 1ZUKA 1VQ8N 2AKLA 2R58A 2HHQA 2NLXA 1UGPB 2JSCA 1QKXA 2G0EA 2PX9A 2YRCA 4HA8A 2QKLB 3LP1A 3H3VK 2IPOB 1JUMA 1MMGA 2G8UA 1F1ZA 3DV8A 3BOQA 3NH2A 5JICA 2XRNA 2RNJA 4WF2A 3GFIA 1RT6A 3VS7A 1IXDA 1O3RA 3NWSA 2DIQA 1HJOA 2O8DA 3FM5A 4EW4A 1J6ZA 1PP7U 2XASA 5J39A 3K1PA 3I55Q 1RAGB 4HQMA 1VQPQ 3QZ5B 3JAMK 1EWQA 2O8BA 4B08A 4P1WA 4DBRA 2OBPA 2W10A 3ENHA 4DBFA 3LAJA 3KKSA 4PA1A 3JB9I 5EOYA 3QP5A 4CJLA 2DKGA 5E26A 1Q9YA 2OQGA 2EQIA 3G1MA 3GG4A 3LDPA 3J81K 4MLEA 1K1ZA 4DV4K 3HPHA 2F7TA 2Z1HA 5CKDA 1WQWA 2HVSA 3ZR8X 1YJNT 2P9SB 1X9WA 4KGXB 1J54A 3SHFA 1ZYQA 2ZO4A 2BXYA 3RERA 4B8XA 4NO7A 2VKHA 5DPKA 3CQZJ 1ACMB 1M3HA 4RW6A 4M7DB 4DLEA 3ZBDA 1U48A 1ZQ3P 3A2KA 4CCOA 2ZM6K 3CWTA 1RIOH 4JPBW 1D3BA 1MSEC 2A3LA 2RQQA 5FW9A 3SQNA 4MEYF 1HYSA 3BTCA 1VQNQ 4XU0A 1ON1A 4HUFA 1POGA 3TU5A 4B9LA 2E5KA 1Z3XA 4EVVA 1WJSA 4CJUA 2BGGA 4M78F 1YTUA 2ZGZA 1LWFA 1I27A 1EKEA 1FSHA 3LALA 1W2BM 3DBHB 1YJWQ 3A2FA 2OPSA 4M7DE 2LOOA 3HSRA 1P4WA 4OMFB 2WA0A 1QKWA 1QQMA 3TSUA 1Y57A 2Y0SN 3ZEUB 4QPOA 4M7DG 4WYBA 3FEOA 2UXBK 3SBGA 2NNWA 3E6CC 3VU3C 4QPQA 1NM1A 1YCSB 5K7FA 2BE5F 5E8GA 4C2TA 3MZYA 4LK0F 3JRAA 4OPHA 1HKQA 1Q1HA 3UKUB 4FLTA 3QBWA 1M1KR 4E0DA 1RABB 1SHFA 3SD4A 3UPUA 1I81A 3X24B 3RMDA 1YTYA 4HV6A 1W1FA 3IAS2 3N5BB 4EPCA 1CZBA 3SZGA 2G9WA 2QWNA 2QXLA 1CQTA 4A4FA 3ZX3A 1YIJQ 1K73R 3FK7A 3F6VA 4G9ZA 3C95A 5C42A 1A04A 3PIOF 3DM2A 3CUQC 4MFEA 1SL0A 5KE3A 2MSYA 3LPTA 2LP5A 4IVNA 1TK8A 3H5NA 2RN8A 1VQKA 1XC5A 5DLOA 3VTIA 2KYMA 1JEGA 4BRFA 1RACB 1YITT 1TV6A 1PKTA 5JLXA 5L3BA 1XCVA 3FK6A 1M3CA 1M2VB 3LZJA 2A3SA 3CCUA 3KFWX 3ZQQA 4AU7A 3CCEI 5KCMA 3WU0A 1D4XA 4KTZA 3CJTB 1I1SA 3VA3A 5ECAA 3BCBA 3ME9A 3LSJA 3SUPA 3Q3SA 1A36A 3RCOA 2H09A 4ELVA 3PFSA 4D8DA 3NARA 3MEWA 4M75B 4YFUA 3HUGA 2NRVA 4KDPA 2YUNA 3OJSA 3BQYA 4FJNA 1JLEA 1J2XA 2FU4A 2M8GX 3O1BA 1YI2I 1W0UA 1IDYA 4MDWA 2XGEA 4YFXF 3SQ1A 3KP3A 4AFSC 2JUGA 1G3YA 3CPWA 1S1VA 4L5JA 3A02A 3O4WA 2AHQA 1MBHA 5FU6B 2HBMA 2YG9A 2DXUA 2MBFA 2DDBA 4XLEA 2YKMA 2XAFA 3M0QA 4P55A 4CJ5A 1D1CA 4BUGA 2RDPA 3ZETA 5L3FA 1KQ1A 4HXJA 3B6OA 3K5MA 3JR9A 3VF2A 4DR6K 3M8SA 3JCMd 5E1WA 1WA7A 3P38A 3MEVA 4M75E 4P9FA 4DSJA 4K0KK 3C6UA 3N4PA 5C2DA 4EEFG 5ILVA 4M4ZA 3D0PA 3M3ZA 2GXGA 5M5YJ 3EUAA 3TAGA 4JS5A 3LAPA 2DYBA 3IDHA 3Q0VA 4OB0B 2O8EA 2GUIA 4D5CA 4BI8B 2LKXA 4EV0A 4FT2A 4DYCA 4KI6A 3HOTA 3H8ZA 1J9AA 1NYFA 1TNSA 2E2JJ 2QA4A 4ZHRA 4DTNA 5F0FA 4DOZA 2K4YA 1MNDA 4PJNA 4G7OF 2NS0A 1L3LA 3SZ2A 5BMZA 3PO2J 4K43A 3VPRA 4M3XA 3PX6A 4J6XA 2OV7A 1P4AA 4NXMK 2CZ1B 1IG9A 1VSDA 4AI5A 4FIBA 3WVEB 3NCIA 2DX1A 1ABQA 4FJKA 4JRPA 2E3HA 2K3BA 4C92G 1YAGA 3OIQA 3BZCA 3W2WA 4H0OA 3EHRA 5M9OA 4OKKA 2M87A 2JJ7A 3I9QA 3CQ8A 1GFDA 4Q48A 3R4KA 5F0HA 2V6EA 2ED1A 3M5AA 1X19A 4EIKA 5FFZA 3M8QA 2LDMA 1VQLT 2P0QA 4FM2A 1WXBA 3K59A 5C3EJ 1LW2A 1JRIA 1DP7P 2CKKA 3TVTA 2CQKA 3QIIA 4C92F 3CC4Q 1BUPA 1ZA1B 1IN5A 5CPRB 1ZBJA 3IH3A 3ENBA 3KZZA 1XGNA 5KH6A 3ZQ7A 2HQXA 1RFQA 4DOVA 1GLLO 1WSUA 4OX9K 1DU6A 2EBIA 2K3XA 2DBKA 1KQ2A 3VEZA 1VF9A 4B09A 4IOAL 4F8RA 4KV8A 1YE9A 1RESA 5GINA 1M9SA 1FKPA 2JWLA 4H0PA 2NS7A 3ERMA 2E2HJ 3KLEA 5JLFA 4ANJA 1BDGA 2RQPA 4XR6A 2ID6A 1JHHA 1SEMA 2J06A 3OH9A 3T69A 3BDDA 4Q5SF 3H6ZA 2ZZDA 3BROA 4Q4ZF 2EJRA 4W5QA 1ULYA 3DOKA 4BDPA 1U45A 5CZ1A 4PNOA 1N9SA 5I3UA 2G7UA 5IYBJ 2XI9A 1TYQB 2GIZA 3E1SA 4CVNE 2JVVA 4B3SK 1MJ9A 3G6EQ 3M8EA 4MZMA 2EA4A 2KLAA 2ISZA 2AQEA 1UAXA 4W5RA 3K9KA 4RWTA 4A3JJ 3GP8A 2M5WA 2L89A 4JZ3A 4DHYA 2RE2A 2ZFUA 2KPMA 4EHTA 3MKZA 5LGNA 4M41A 1Z77A 1YCYA 1Z9CA 2K4BA 3S41A 1IKVA 4YELA 4G7ZF 2Y90A 1VSFA 1I1GA 3W3CA 2GX9A 4KICA 5FWBA 2F8SA 1JLCA 4KHYA 1EV7A 5JFRA 3VS3A 5LL6Z 2VL8A 2DL4A 4JK1X 2MWPA 2JPBA 3H41A 1OH5A 2CSOA 1XG7A 4F7UB 3SQ2A 2H27A 2NWMA 5GAMd 2G8HA 5E17F 4DGWB 3WTUC 3VYGA 2FMYA 3QPTA 1VQ5Q 2XKOA 3HOSA 2UUCK 1KAXA 1V1CA 4CE9A 4A2AA 3ZGKA 2FSNA 2NOIA 1MDMB 2HF3A 2G3RA 1XMOK 3FWEA 4GYIA 1DKGD 4UXNA 3P8DA 4BREA 3MP8A 1UWBA 4JKBA 4HNUA 1IKWA 5AQNA 4AHCA 4DUYK 4XN0A 1Z9ZA 2H6BA 4LE9A 1WGXA 2NOFA 3D45A 4CCNA 1YJ9Q 2EILH 4KYWA 2KZVA 4CD1A 3SHWA 3DRPA 5GPCA 4H0XB 5HLFA 3FIFA 3E7LA 5BR8K 4FJGA 2QEXI 4EVIA 4FTHA 2OQRA 4F7UE 3HSCA 5LJWA 2R5ZB 1JJ8C 1IV8A 1T0HA 2H94A 4UOBA 2CGHA 2F8TA 3J7YJ 3U9GA 5EEAA 4F7UG 3H3NO 1FIAA 1RI7A 1USSA 5FPMA 2VJ4A 1Q9XA 3FIWA 1WYXA 3BG7A 3WHCA 1KZHA 1VQON 4FWNA 2DXBA 3CCLQ 1TWFJ 4RBOA 2CGPA 4YOXA 4A6EA 3QJYA 1TWGJ 1T44A 4N4NB 2KE9A 3LW5E 4J9GA 4JHDB 3GFMA 2ZCWA 1EH7A 4O5VA 2G8KA 4CK3A 1WHUA 5HLHA 2WFBA 1SFKA 4CEFA 5A2QZ 2IGMA 3GNFB 2DILA 2V1NA 3HIFA 2A08A 2V1QA 2ME6A 2PFBA 3BY6A 1TGOA 2K86A 3D0SA 3J7ZO 5GJVB 2MYSA 5AFUH 2AP1A 4J9CA 1L5UA 3CC2Q 2FC0A 3CDHA 4C8KA 3L3UA 1R5GA 3X28B 2YHBA 4M75C 1QQOA 4FOEA 5GAN7 3M0PA 1YYVA 1NLOC 4DV3K 5L8RE 1T8EA 3CCMQ 4G9YA 2JA2A 3MEUA 2H3EB 1X3MA 5EG0A 3F8MA 5FROA 4PLIA 1OCZH 1BN5A 2HHVA 1M1KU 3ULDA 2DL7A 1HOMA 3DLBA 1LUJB 2OTLA 4EMGA 3V42A 1UJ8A 5LHGA 1QS4A 1Y64A 4V2GA 1E4GT 2QLZA 5HDKA 1YLFA 1Q7YR 3O9SA 3WTXC 2A3ZA 3NMUA 3F70A 4M75D 3IHUA 1AOJA 1KQSS 4X66K 3TQ7P 4YOQA 1YVNA 2R7FA 2P81A 3KKRA 4M3RA 4EGYA 2C6YA 3TGNA 3K4KA 4AHSA 4JI8K 4OMPA 3A03A 3VS4A 1HNZK 1X2NA 4R8HA 1TQPA 4F52A 4PQUA 5AONA 2DPPB 3K58A 4I02A 2A37A 2Q3SA 3EG0A 4YDUA 1L3SA 2HHWA 3ZMTA 3WXKA 3RBBB 4OPKA 3M0SA 3THVA 3FX3A 2R7DA 1K7AA 3CJBA 4Y1DA 1W1WE 3CIPA 4RKUE 4EJWA 4FJHA 3DU6A 1X6OA 2KJBA 3IRRA 3HTRA 3VQPA 1ZSZB 1APLC 1N32K 2FD5A 2CYZB 3KLOA 3CVTA 1QCNA 1A5XA 1RZ4A 1VQKN 2VPLA 3TMOA 3I35A 2Z1IA 3CP2A 1LB2A 4A93J 2XHCA 1ZBSA 1ZG3A 4BXFA 4OB2B 3FKJA 3BPVA 2YSQA 1AHDP 3F8CA 2DT7B 3A5LC 2LP0A 5FKLA 2DPNA 4B1XB 3L2UA 2F4VK 1FTTA 3PSFA 3VSLA 1YJNA 3OYYA 3I56I 4DSEA 1RBTA 3JRFA 2HQAA 3P4IA 1B8IA 1DGRM 1WFWA 3E66A 2E2OA 3GOIA 5D4RA 2KISA 2WAFA 1AWCA 4DV0K 1BIUA 3QFUA 3LZIA 2ZXJA 1B1BA 2LNBA 3LDQA 2PJRA 3DRSA 3HSBA 3VEOA 1O3TA 5M1QA 4XLCA 1BU1A 4OOIA 3MEXA 3M4OJ 4NQWA 1T05A 3EGDB 2YRVA 1E4FT 2HTJA 2EGCA 3C12A 4FWOA 4U0VA 1U47A 1VQPT 2CUFA 2B86A 4KTWA 4CBXA 1T2KA 3GWZA 2YU3A 2UU9K 3MD2A 5HCKA 1UHWA 1F9NA 2LF7A 2R0QC 4OIOF 5AQVA 2CMPA 3SMPA 1U84A 2E7WA 2ZMEB 1QTMA 4OMQA 3IP4B 1Y7XA 1XMQK 2E5LK 4C0FA 3CM6A 5HLTA 4FT4A 5IOYA 3MJXA 2HOAA 2FBVA 2LBFB 2QA4N 2IA2A 5I42A 4I7HA 3SFMA 5AN4A 3E19A 1S9EA 2DTZA 3F23A 1YVUA 2K6DA 2XHKA 1LVAA 4BWJA 1YQKA 1JQQA 4FE7A 2PU9B 1R5ID 2A40A 1C0GA 1S1WA 4B1WB 2AO9A 2ECZA 4HVUA 3DFGA 2E12A 3QU3A 8AT1B 2P9NB 5IP9J 1LNXA 1TKZA 3HI0A 2FB7A 2O8BB 4UUTA 2LQ8A 2NRXA 2FJ1A 1QZ6A 4ID5A 2Z2SB 5EY4A 3FXKA 2KY9A 2YX7A 1AWOA 2JN6A 1KG1A 3LYIA 1FYMA 3VF6A 3VB2A 1RDWX 5FPEA 1Z26A 4GVEA 3IG1A 1GLJO 1K8AO 2ZJPF 1Y71A 1YITA 4G12A 3L2WA 3HDDA 1C0TA 2K5IA 5JMVA 2HVHA 1MMDA 4B1ZA 4J2BA 2C0OA 2DXIA 1VQ4Q 3CCRT 2L7ZA 1NGHA 3IH4A 2DODA 4U87A 2VWBA 4E47A 4M3BA 1U5SA 2OAUA 2RHIA 2HNIA 2A1RA 1Y6IA 1YUWA 1BQNA 3S9HA 2X0LA 3VYRB 1D0YA 1GLAG 3F0CA 2FL7A 3DQVC 4QTRA 1IB8A 1R71A 1MHNA 4ZGEB 2GCXA 4N41A 1S8NA 2LCLA 4NXNK 1IF1A 3CCVI 1IN7A 1FMVA 2W24A 3LSTA 1U2VA 2XAQA 1ABOA 3S3OA 2HD0A 5HRRA 2ZQBA 4AIKA 1MBEA 4EIAA 2KFZA 2P5KA 1J0RA 3UA6A 2ELJA 2XMFA 3KLGA 1LW0A 3ZCOA 4O6JA 6AT1B 1R4NB 2RM4A 3WODF 1Z0XA 1XMKA 1HCRA 1WVRA 2XRIA 2RHUA 3NRVA 1KG5A 2DLPA 4IF4A 4R1HA 3C7JA 2CW0F 1OYXA 5K1YA 2XD0A 3RUXA 4XSXF 4A63B 4CHNA 4B6MA 4NL2A 5B66C 3HSFA 3CFPA 1WHGA 4LUEA 1VQ6Q 4MDBA 3MP1A 1MWMA 1KLNA 3R3LA 1IJWC 1R7JA 3NVMA 1X9MA 3MX5A 2LVMA 2EJFA 2Y4XA 5HRNA 3L3VA 3MWTA 1WLPB 1XUPO 1M90O 2EZIA 2KGTA 4M6XA 1VHXA 4DU3A 4B9NA 2QGGA 2D8HA 2DVEA 5FKKA 3S8PA 4IIMA 5GMKm 5EXWA 1UB9A 1D0ZA 1OKRA 5A0DA 3CP8A 3K4CA 3MKLA 2F6CA 4BD3A 2JZ2A 2EIKH 1DQUA 5TRDA 1T3LA 4CGFA 2R5YA 1HW2A 4A59A 1M1GA 5FPNA 1VQLA 5CKBA 2PQ8A 1ZN2A 2QGUA 4QS8A 3HHTB 3M3YJ 3AAPA 1G3WA 1ZAOA 4RTWA 5GAOm 2W00A 4AIJA 3NE6A 2FZKB 1BIZA 4X9CA 3S32A 3JAME 3BLYA 3ZSQA 4B23A 1HX1A 3HUGB 2W6KA 3MWPA 4OWRB 1KHIA 3K69A 3VQ4A 4Y0WA 5H6QA 4OB1B 2VOPA 4CFBA 2RKIA 3JAMO 1HNIA 4F92B 1JJ2M 3H9QA 2SEMA 1RAIB 4GDFA 2GV9A 1OYWA 4BI4A 1NE8A 2IW5A 1XQOA 4A3FJ 2QZ8A 1NEBA 3NFCA 2JMCA 3JSCA 2STTA 4BE1A 3G1JA 3ZETB 1VQ7Q 1O1WA 5M3MJ 3J81O 3JCMJ 2CSQA 3OYIA 1WDXA 2EV5A 2PVOB 5HNFA 3HOUJ 2CP7A 2CU7A 1NYGA 3THKA 3B8AX 3H9GA 3LX7A 3F5TA 1KQSP 3QDKA 2VPRA 2KQ2A 2E64A 5C44J 2QBYA 1IH7A 1YHQQ 3PL8A 3VETA 3TARA 1GLEG 1H3HA 1VSLA 1Y0MA 1PUEE 1D5AA 2K3YA 1TC3C 1ZSZC 4ID1A 1ZBXA 1HYOA 1W6XA 3T0YA 6PAXA 4C8LA 4B3RK 1CF7A 1B07A 2DERA 4IBNA 3OMGA 2EIJH 4X64K 5IP6A 3V7RA 2Z1GA 5GANg 2ZXIA 5AT1B 2ZFWA 3GLLA 2XPWA 4IO9F 2IS4A 2M02A 1N5YA 3FXLA 1V76A 2R57A 4MMKA 2E1OA 4EMSA 4XIUA 2QW9A 1TKXA 1OCOH 1OULA 4F04B 4BG8A 1OR7C 2KZGA 1TQIA 3HRUA 4R5PA 5LJ5h 3AO5A 2XKPA 2E41A 2XGCA 2KIUA 2HL3A 1E17A 1R8OB 1YQMA 4Z4HA 3HPOA 5HK0A 1IKXA 1TK5A 2VASA 1JKPC 1LFBA 1GLFO 1ASWA 2QWPA 2K27A 2XY6A 2D1KA 3OBYA 2VC8A 4O8KA 1FKOA 2OTLN 1YFHA 3CXCP 4A3LJ 5LRRA 2D9TA 4M7AC 3DAWA 2ROTA 3JRZA 3JCMb 3MEGA 4OVAA 4LUDA 2CQ7A 3G6ET 1P90A 3JTHA 4PGGA 3REOA 1TNTA 2E1MB 1WLJA 1OQYA 3HM5A 2OJ2A 1RT2A 1X1BA 2HBLA 1K0XA 1K8AU 2EQRA 3JRBA 2ZMEC 2NXNB 2BY1A 4A0XA 5FU7C 2YU9J 1B7TA 4AFUC 5GMKl 2W57A 3H3OB 2LH9A 4M7AD 3EAEA 1TOVA 4GY5A 1K8AC 2EPFA 2DLLA 2IT0A 4LLLA 3K6GA 5TKYA 4EMKA 4E7HA 2OTJT 4FX0A 2DBBA 1HSQA 4DYRA 1P8ZA 3Q9SA 5GAOl 3LPUA 1UOCA 4EJOA 1P7JA 4WXDA 4X0GA 2CZ0B 2L54A 1J75A 1WZOA 2HNDA 4KH0B 3JRDA 2BIVA 3LH5A 3SUNA 2LRQA 1MWKA 1QQCA 2WV0A 1R0CB 3TL4X 4JI6K 1IW7F 3GOXA 4CC2A 2ZPFB 3FISA 1YJNN 3CCUI 2KK4A 1XDUA 2WADA 4XK4A 4FM0A 5CO7A 3PQKA 4NB4A 4BH9A 1LFUP 1R1TA 3I4NJ 3KWIA 1JXBA 1U78A 3FHGA 4FWKA 2DEQA 1DP3A 2JTVA 4CD3A 5KVRA 1X75C 2HL5C 4Z4EA 1SPKA 1LAVA 3ONQA 2HWVA 1A5WA 4DR1K 2IIMA 3CCST 2LCCA 2JA8J 1QPIA 3L4IA 2F5EA 1Z9QA 2VYTA 2EGAA 2F69A 2VYPA 3BFMA 1G59A 2EAYA 3BR1A 2YHYA 2DTOA 2ESHA 2I0NA 1X1PA 2F9TA 2IJLA 4XLHA 3C94A 1JI8A 4YIIA 1UGSB 3UIQA 1M90U 4AUXA 1H8AC 2IS3A 2DT6A 5AIQA 1WSHA 5LMUK 1EWRA 3ML6A 3OYAA 4CHUA 4WCEL 1M90C 5D6FA 3CPFA 4JI1K 3CCJT 2MMPA 3CI5A 2DU9A 2DTRA 3SJJA 2OPTA 1U6GA 3TP0A 4KH1B 5D4SA 5KCOA 1QQIA 1W2BP 1FN7A 3VN5A 1E0EA 1QZZA 4HKEA 2UXXA 2QA4I 3T1BA 1NK9A 1BOAA 2UXNA 2ZPGB 1FMKA 3S1MJ 1TP4A 3KWGA 5J1RA 1UEBA 5ADXH 3QINA 4N4OB 1RILA 2XY7A 1TWCJ 2QWWA 4PKIA 4GCVA 4LDYA 1DT9A 3CPWS 5KPRA 1A6QA 3LSGA 2RQUA 1XHZA 2DFEA 1YW7A 1HQCA 4BBRJ 4ZNXA 4CEOA 1BKBA 2WY7Q 4OINF 4AI4A 1PYVA 1BI2A 1PNJA 4KO0A 2E6NA 3L6QA 1ORPA 4E2FB 1RTJA 2PG4A 1YI2Q 5GANj 4CEZA 3EHQA 2F2VA 3OV8A 2PY5A 4XKBA 1C1CA 3KXTA 4IRIA 3FXUA 2GLOA 2XHIA 3TCJA 3S3MA 2Y31A 1YITN 2XGDA 1HBXG 3QIOA 4IHXA 1ZHIA 4CZCA 4ZTFA 4I6ZA 1ZARA 1W5TA 1BCOA 2RV8A 1VUBA 4KHPK 1D1AA 4A3GJ 3BEXA 4DSIA 1VNDA 2NRRA 4BWMA 2TDXA 4MGRA 1TL3A 2Z1JA 1QVGA 5AZIB 1NG7A 3BZ6A 1WIEA 4IUUA 5GTIC 4CFAA 1WHLA 4BC3A 3HXLA 5MLCQ 5BS6A 3OBWA 4R0KA 3K9TA 3G4SI 3JCMg 1OPKA 2EX3A 3MXJA 4Z4GA 3G25A 1S72Q 1WNLA 4HVVA 2ZKZA 1JCFA 3VRZA 4E6RA 3CMEN 4PSXA 4M78C 5E8IA 2M4GA 2OU2A 3TAPA 5EG0B 4A4KA 1XQSC 5E41A 2X6YA 4B3AA 5JI6A 1JUSA 3AG4H 3EUHC 5J4YA 1VQPA 1I5ZA 1MMAA 2NOGA 4I0AA 2ACJA 5F08A 1VI0A 2IDOA 2DFIA 2HS5A 3AHUA 2ITGA 3MEAA 2FSJA 2KT8A 3GBGA 5DM7L 4BRQA 4HNTA 2JTMA 3LM9A 3HC7A 3CZ6A 1ZGJA 3FF5A 4M78D 4DNCA 1U1SA 1QBJA 2VWFA 2FBXA 2VGMA 4BVPA 4Z4CA 4JLGA 3AVGA 3CJAA 2AA4A 2DFUA 5E18F 4YY3K 5F2RA 1BBYA 1XI1A 3H1CA 3Q0WA 2RHKA 3OYLA 4JAXA 2ZXWH 1K6YA 3QKJA 4IHYA 2DA9A 1N27A 4Z0UA 1WEGA 4J00A 2ZJRL 4BEHA 1X27A 2P5LC 3DJCA 1IXSB 4CBWA 3ZXSA 4FSVA 3J80E 3N97A 1KVBA 4BQZA 3TAQA 4FZZA 4EP4A 3HM9A 1Y1WJ 4RDUA 4ESJA 2LCSA 2EQUA 3M57A 5DLQE 4MZPA 4IFYA 4IUTA 4NB5A 2QQRA 2DBMA 2HCKA 1ZBFA 3VOVA 3JTGA 4FJIA 1WH5A 2LMDA 2OAWA 2COYA 2UUBK 3F9KA 3QEPA 4FETA 3OYKA 1VQNI 3NPFA 2LYCA 2YSRA 1KG6A 3AVAA 2RF2A 4HX8A 1ZH5A 4BRLA 2UXCK 2VC1A 5ELZA 3QYEA 1QO0D 5BN8A 2E34A 3RMCA 4JI2K 2L9NA 2RQTA 3CC7I 1VSIA 5JS1A 5IWAK 3BTIA 3CCRA 3HG9A 1D8JA 3EH1A 4RTFD 3KE2A 3S93A 3U8XA 2Y2ZA 3PFYA 3CUQA 1HLUA 3W6VA 3K2ZA 4DV2K 2ZGWA 1NM7A 3ZT2A 3CWUA 4IUVA 3MCPA 1YIOA 4YOTA 4UB6C 1MUDA 2QI2A 1B72B 2JUFA 3U2RA 1NGDA 1JKRC 2Z0WA 2KFDA 5DUKA 4C0DB 5GPAA 2ZD1A 2CP6A 2V51B 4KFCA 3M0UA 5KCHA 1BA5A 1HNVA 2FZCB 2BHYA 1N33K 3LDNA 2Z16A 3IL2A 2D6FA 4M3ZA 1ZR2A 4JD2B 2UWMA 2DTUA 2HOSA 2BXZA 3VJPA 1MU2A 2HU9A 4RLQA 4L59A 3CF5L 3H1VX 3DLAA 3VWBA 5HK3A 1ASUA 1M3QA 5D5WB 4PJJA 4GV6A 3EFOA 3E5UA 2HDAA 3TTCA 1BW6A 4E7JA 3NF8A 5IT3A 1UCRA 2VXFA 1CGPA 3Q1JA 4YIFA 1VZ0A 2Z33A 3I5UA 1Y97A 1ATSA 2NOLA 2AZVA 4KREA 3R9PA 5GAMg 4LDXA 3PIOL 4UHTA 1VQ8Q 3GTQJ 3ROUA 1OISA 2M7BA 1NKCA 3E01A 3EYIA 2ZPBB 3W0LA 4LITA 2DD5A 3SDBA 2Y69H 2GZWA 2QEXQ 1Y96A 1UFFA 4ELZC 5JLHA 5LJ3h 4IIOA 4CJWA 3MQ0A 3BW1A 4CHPA 2DN0A 2RNGA 1D3YA 1K6OA 2XPUA 4CZMA 1V29B 3V8LA 5D7UA 4XORA 1JXSA 1ETKA 1GCQC 3OL3A 5CHIA 4HLXA 3AVHA 2NRHA 3OA9A 4CYDA 2I7PA 2H8WA 3BDUA 1FC3A 2YX6A 3I9V2 2DI3A 1Z7UA 2F4IA 2HEOA 2ZSIB 5JLWA 4C3IJ 1ETYA 3I3LA 2BUDA 5C0YA 3B02A 4XMYA 3D5LA 2A6EF 3VOEA 1CXUA 2YHXA 3B6PA 3G1LA 2GELA 1NG9A 4XQ3A 2JG6A 2YS9A 5FKOA 3WXIA 2P7CB 2DL5A 4BU2A 5HVQC 2IC3A 5GADP 1KFSA 4H5WA 1RLQC 2ZPIB 1QVGM 5EVZA 1OEBA 4DV1K 2IVPA 1VRTA 4JKGA 3EQLF 2FRHA 2ADUA 3AVCA 4DFJA 5L3DA 2NS8A 1QVFA 1AKHB 3U6FA 4RA2A 2DJIA 4LOCA 4C23A 5LJ5f 3WVDB 1X01A 2ZAEA 3SB2A 3CMAT 4BR7A 4Y15A 2LNVA 1LV5A 3FC3A 1P2FA 3M8PA 1BBZA 1RKTA 1KU7A 2PLYA 2HVIA 1H89C 4BQOA 1KRPA 1R5HA 3QG1A 3CPWP 4Z6YA 4HW0A 4C9YA 1C6VA 1Q82R 3RYPA 1EH8A 2EQJA 5D8KB 4KUMA 3VEXA 1MNMC 3CMMA 3OGDA 4RTTA 2CT4A 3CFOA 4OGCA 3FXRA 4A0YA 2DO7A 2EH3A 1X2KA 3U21A 1WJAA 2WAQN 2D0BA 2KHMA 2V9PA 3QEXA 5GJWB 3THXB 3A98A 3CCQT 2Q2RA 1JUPA 1RC9A 4HUEA 3RRHA 3LQRA 3E9GA 2NOBA 2FBYA 1NTCA 2FSKA 5GAHJ 4QQGA 3CD6T 4FWSA 3DTEA 3QJ6A 3J7AO 2AK5A 5CY4A 1DTTA 1IDZA 4FYDA 2XAHA 4B9XA 2P9KB 3GBTA 4HV5A 3M8FA 2VKDA 4GYGA 2P9SA 4UB8C 3G6EA 3P1GA 5HP1A 2FHDA 4XRMA 1M4ZA 2XICA 4CZEA 2GIVA 4KHNA 2EFOA 3CM5A 2CS3A 3SCXA 4LGWA 4XTWA 1HQEA 3INZA 4EZ6A 2VG6A 3NH0A 4CIEA 2WTEA 3V4GA 2LTOA 2QYOA 1K9AA 1WBBA 2L3SA 4BE0A 2HSPA 2HKQB 3I56Q 3UKRB 4QS9A 1QWEA 2M0MA 4LSLA 4J2DA 3D5SC 4YOVA 3OSGA 2OTJA 2F1LA 3VQ8A 1UHCA 3E9LA 4E1JA 2E19A 2LZ6B 4ENMA 3R61A 2E2IJ 2DJZA 3M8JA 4BB7A 5CVVA 1HR0K 1Q86R 5GAMj 3OW2A 5GMKi 3KD1E 3ATUA 2X1DA 2K2VA 1S7EA 1HF0A 1RUNA 2A1SA 2KRNA 3PO3J 3WEEA 1UJYA 2BE7D 3ZEUA 1YITI 4CEDA 2HPMA 4PFOA 1CF7B 2CUZA 4C1NK 1J7KA 1KSPA 4GFBA 2EINH 1K4TA 3RTVA 3O5BA 1SS6A 2EA2A 2VWKA 4WQ4C 2L2PA 1KG3A 4LB5A 2LSNA 3O4QA 2E65A 3AVIA 2YJFA 5FKNA 2XAGA 2X6OA 3AVKA 1PU7A 1Q82O 4RLFA 3RYRA 3V8KA 2J05A 3JB9H 4LD5A 1VQOT 3CCSA 2J4RA 3DBRB 4DTPA 3HYIA 1FZPB 3MCAB 4RCHA 3EH2A 2VN2A 2PUKB 3V9SA 2DYIA 1T38A 2B8AA 1GXQA 3RDIA 1HUXA 4DFKA 1VQPN 4CJVA 1KQ9A 4KULA 2V6CA 2OX7A 4HX7A 4ORZA 2YKNA 4BXXJ 1ZG1A 2G8IA 3W6JB 1NJWA 3M1EA 2PJPA 1MH3A 1QMCA 4RAFA 2X4XA 4ISEA 2X3XD 5HROA 5BPMA 2QDLA 2YHWA 4IHVA 1M2VA 3L2VA 1FX7A 1UGRB 4C0DC 4PL7A 1RRJA 2A7YA 3CCJA 5H6RA 1W5SA 5J6XA 4W1UA 3CCLI 3L2QA 4M75A 2KP6A 4AYBA 1XNRK 4OLBA 2RJDA 4CRIA 1N34K 4CZIA 4BY1J 3FHFA 1VQMT 1EQYA 3NF7A 2HBWA 3K10A 4C8QB 5K5OA 1BR4A 1SRLA 2WAEA 4EGZA 1QCOA 4OAYA 3WGIA 3DTKA 2M30A 1L3VA 4K41A 4GV3A 5LFAA 3OL4A 2HQNA 3ASMA 4XLNF 5L3GA 2EWSA 1KC8C 3HXMA 2DMOA 2L3PA 1KVAA 3P9IA 2AZSA 4L5GA 1FNNA 2P1JA 3O8MA 4II1A 1HPMA 3MXMA 4DV6K 5A2QK 2D1VA 4BHCA 2ZBKA 3V1OA 4LF5K 1OPLA 4ZGJB 1VQ9T 2PN6A 2A61A 3DLKA 1SFXA 2KTQA 1SRMA 4I98B 3VYSB 1VRLA 1R0AA 1VQLI 2FUG2 3CCVQ 3TAEA 2FE3A 2DK3A 2BZ8A 4C8QE 1QVFM 3PV8A 3CO7C 2D4WA 2HKOA 1YJWN 2QDYB 3FZKA 5FWCA 3DKYA 4B3TK 2CV0A 4J9IA 3ABTA 2W03A 4FSSA 2OUMA 4EMHA 1QLYA 4CF0A 4DQQA 3DU5A 2LKPA 2KYBA 4YORA 4IUPA 3V9WA 2XB5A 2GFUA 1QE1A 3CCRN 2COWA 4K8ZA 3CCMI 3WE3A 2IAIA 4CJPA 2YPRA 1REPC 2E6MA 1GRIA 4C5EA 5K7ZA 2G8WA 4BNCA 1NH3A 3VTHA 4AD9A 1E2XA 3DKXA 3IS9A 2NRAC 3OY9A 2XSJC 2FVUA 4DTUA 1H641 3VQDA 3VS5A 4DZPA 4E9HA 3GNGA 3RQ4A 5BPNA 4HSBA 4LFCK 3CCET 5DS9A 5AQLA 3JCMW 3BG3A 1BO5O 4UY8O 1I94K 2KT0A 1YIJN 1JU5C 4CJEA 2OFKA 5GAOr 1UG0A 2DQRA 1BJAA 3LQQA 4D9JA 1YI2T 5IXFA 1EJ9A 3LFUA 1U49A 1HDDC 1W97L 2PMHA 4O4GA 2QCOA 1I3AA 2W40A 2VBXA 1OQKA 4M77F 1EZZB 4MDAA 2DA5A 1EO1A 1V3FA 2PMZA 4YRVA 3RKWA 4EZ9A 3TAMA 2AXTC 2DXTA 5IT9E 1MUYA 4BY6B 1FOWA 2CZ7B 2CFXA 2K4JA 4BHPA 3OHRA 4JX4A 1VYUA 3I59A 3O9QA 1V4RA 1RDAA 4JLIA 2P7VB 4DSLA 3HKSA 4M3UA 1TYQA 5IY5H 3C6AA 4EM2A 3HOYJ 3C1DA 1SVOA 4M3WA 4RGUA 2WSFE 2AXLA 3M55A 4H5VA 2VI6A 4HSRA 3OB9A 2ED0A 4KUDK 1MA9B 1S6LA 3OYEA 4CJ3A 2DF6A 3LP0A 4DUZK 3JRGA 3MEEA 4I2PA 3S1QJ 3TEDA 3U9ZA 1JKQC 2O03A 3OW2M 1MSFC 4J83A 2L9VA 3HVRA 2QWOA 2E5ZA 1TS9A 1D8KA 1GOAA 2M7AA 4J9FA 3EZ5A 2HKXA 4XU2A 2VWJA 4HWIA 1T08B 1NJXA 3SJHA 4H0EA 3QDFA 1Q81O 4CYCB 4KT5C 4BY7J 5HODA 1UZCA 3VEVA 1KD1O 4B9MA 4DV5K 5KNLA 4WWCA 3MXIA 2EV6A 4OMLA 3MX2A 1JJ2P 2VXZA 2CDTA 2LX7A 3EL2A 3CF2A 3S14J 2E1NA 1Q82U 4HG2A 2DAOA 5FDLA 2HHXA 2RN2A 4C0GA 2Q2EA 3QPHA 5FGMA 2GOMA 2K3FA 3LLRA 1TK0A 2KXDA 2AHJB 3U3GA 4FVUA 4FISA 4RB3C 2NOHA 1YS6A 5LJ3f 5D8LB 3HBLA 9ATCB 4ZDPA 4FJ5A 1RKWA 4CEAA 1U0JA 3AVLA 2ASPA 3MO8A 4A3KJ 2ZCFB 3UR3C 4M3FA 3CC4N 1XG1A 3ECHA 3URGA 1WEIA 3NVKA 1KTQA 3DXKA 1RCHA 4D1QA 2E6LA 4B3OA 3Q0UA 3BT9A 3JCUC 3AA2A 1SMTA 3WQTA 1TBXA 3FDYA 1QA6A 4B22A 4DTMA 4PJOF 4ELYC 3D1NI 1SKWA 3N05A 4PY5A 2EJGA 2Z1DA 3PUBA 3Q5FA 5E1XA 3BF1A 1SAXA 2CQNA 2JA5J 1HC8A 2K3PA 2ZJPL 4CZJA 2WTUA 3GBQA 4LH5A 2A5XA 1X43A 3RKYA 2KRSA 2XGXA 3ZOBA 1RT1A 1I4K1 1I5OB 1OCCH 4CCLA 3LM2A 1AA7A 3BE3A 4PKCC 3PO4A 1S9HA 1NGCA 4OAZA 2HHSA 5M1FA 3TW7A 3S1NJ 3P39A 2X6WA 3TDUC 2W25A 1QSSA 4E7IA 2DETA 1UG1A 3SI6A 1FJLA 3IRXA 1OI1A 1BM9A 2YUQA 3V4IA 3G6EN 3AO2A 3ZSWA 2YDLA 2DRMA 2XF7A 1QQJA 1NGGA 3UF4A 4DV7K 2R4GA 3WQUA 3PIPF 1X3ZB 1TZLA 3HHGA 2QF7A 3O3KA 5FPDA 4F2SA 3ZT4A 3A1PA 3HBTA 1EXQA 1VFCA 3ER0A 5CVJA 2YI1A 1BL0A 2A69F 3I5RA 1X1AA 1W2BA 1SAZA 4BR0A 1RRQA 3CCUQ 3SPYA 3JSMA 2LQNA 3UT1A 4J5YA 2HW3A 1M2OA 5CVIA 2OTJN 1VA7A 4IOXA 2P8TA 5ED4A 4UQGA 4GW6A 3CERA 4C8QC 2FBIA 4A62A 3D5RC 1VIEA 2GWJA 1KJWA 2DPDA 4DS5A 4DSKA 1WCMJ 2KKOA 4UNOA 4P5NA 2DA2A 3CMAA 1U3EM 4W5OA 4N47A 3HPGA 1L3UA 1QWFA 1SF9A 1KQ0A 5AQPA 3EFOB 3DMJA 3K4NA 4L3QA 4CJ7A 3JRCA 2YRDA 3TTFA 5KYNA 3WNEA 4CUGA 3EETA 2YG8A 4QKUA 2C0IA 3M53A 4C8QD 2MD0A 3ABUA 4FYVB 1IAWA 4AM7A 1E3HA 5KAIC 1ZC6A 4YIRX 2RN7A 3VS0A 1YXQA 4GBQA 1SV5A 1K78A 5AQHA 2HSEB 3TAFA 2DM1A 4FZYA 1CLQA 1BC8C 4JI5K 2M34A 3E3VA 2DCEA 4XM3A 1TUCA 4JP0A 3CCQA 4WXCA 1JLAA 1ZSZA 1I39A 3N5NX 1R4MB 4ELUA 2QA4Q 3O08A 4A3BJ 1TUYA 1H9TA 2ROLA 4AG1C 3BY7A 3F8BA 3JB9F 4OU0A 3J7AP 1BW5A 3T9NA 4QLCU 4J9DA 4B9UA 4OMYA 3M59A 5HS9A 3CD6A 2QXFA 4DTSA 2HHTA 3RTRA 4FASD 1LWYA 2CGLA 3CW7A 2NVUB 1G3SA 3CCJN 4DU4A 1IJJA 3LNQA 3DLLF 4RW7A 4X34A 2RHZA 1XB4A 1WXTA 1WI3A 1BI4B 2GF7A 5FLXK 1OR7A 4S0HB 2K57A 3NTHA 1FIPA 2DZ9A 4IOAF 3QHSA 2E4LA 2XDDA 3CBOA 1GOCA 2QWRA 1XQPA 3X20B 3PNYA 1YWOA 3ULEB 2QVOA 3JSPA 2RO0A 3OSSC 2RI5A 3DEUA 4IOCF 5BPIA 2X1EA 3G10A 5F04A 4Q5VA 2EV0A 3HVTA 1MJAA 1WQ2A 1YHQI 4KRFA 2BTTA 1WSEA 2SRCA 3KIOA 1JT0A 4JKGB 4M7AA 3TTDA 4IQJA 1NU0A 1UTIA 2COMA 2XHBA 1RI9A 3VQ6A 3CC2N 3MK6A 1I1JA 2M8EA 4B47A 4I76A 3HSEA 2Y0MA 1ZLKA 4MFBA 3Q7CA 2M1HA 2MGQA 1Q81U 2E36A 1NG2A 3KEOA 3P7NA 2V8JA 3G4SQ 4J6WA 2P5VA 4NUBA 2O2OA 1WHMA 3NHNA 4PCQA 1KU2A 1B6AA 3ZP5A 4JKFA 1KD1U 1P4XA 1ZBLA 2ZMEA 4PKGA 3LANA 3WTWC 1AEYA 4C8OA 1N9RA 1NK5A 4BROA 1Q81C 1QVPA 2QM1A 3V1RA 2HXOA 5C4XJ 4HVJA 2STWA 1RT3A 2NVQJ 1GVDA 1KD1C 2LBFA 3DLMA 4YPRA 3NMZC 1D5VA 3OIOA 5DEQA 2K5FA 2MFZA 3W6KB 4JK7A 4N5SA 2D0CA 4Y13A 1O57A 2YR2A 4I9LA 4A4GA 2PEXA 1WNSA 4GRIA 3LWMA 3OQ5A 3CCRI 1M27C 3E1YA 5KYWB 5KN9A 3AO1A 4XLPF 4B48A 3QODA 2VT3A 2CS7A 5F1RA 4HCBA 3WNHA 1QZEA 2RREA 2P9NA 3RVCA 4U67L 2W85A 1BOBA 3X25B 1U4BA 3A5MC 1NG6A 1VQOA 1U5TB 3BP8A 2NOEA 1SSHA 5AQSA 1IV0A 3MEDA 3AG1H 4OMOA 4L0ZB 2X9DA 3GE1A 3S2HJ 2JSPA 2LJ1A 2FG0A 1IBKK 1Y39A 1UHFA 4CERA 2RD1A 4Z94A 2FPFA 2GTOA 4M72A 3V1QA 1NOYA 3ZSYA 2ZB9A 1RADB 3KJVA 4C3HJ 5J40A 3IH7A 5GAN4 2QK0A 4KMFA 1S9GA 4CJQA 1OCTC 4LDVA 5J3BA 5C6SA 1UGQB 3HPWA 5AJ3K 3WXMB 2E35A 1MKMA 2K9GA 4BR5A 2PMZN 3QWYA 4UC4A 2VT2A 3LGLA 4N4IA 4BAYA 3J8AA 3NAEA 3TOBA 2DOEA 3ELKA 1JBMA 3RR7A 5F0XA 2LY1A 2P4WA 1S5LC 4ZN3A 2D0AA 2JTEA 3NEUA 1VQMA 4DU1A 2RJEA 1AHJB 4II3A 4I99C 4OO1J