3OS1A

Pfv target capture complex (tcc) at 2.97 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os1A03
5D6YA 2YNHA 2HHWA 1ZYQA 4E7LA 1BHLA 2BANA 1FKPA 1TGOA 2JTFA 2B5JA 2LCCA 3TI0A 3DOLA 1SKWA 2DIQA 1RTJA 3AO2A 2KFZA 1L5UA 1KFSA 4OVAA 1KVCA 2D5RA 1C1BA 4BE2A 2Z1IA 2IAJA 3DLEA 3RRHA 3QO9A 3RMDA 1CLQA 4KKOA 5SZTA 3NH0A 5HLFA 2F5KA 4CJFA 3LGFA 4FL6A 5KGWA 4CK1A 1BL3A 3OS2A 2PQWA 1RBSA 4W5OA 2HHSA 4CHZA 3V9ZA 2HVIA 3AA5X 3IG1A 4O0JA 1VSIA 3V1QA 3K59A 3VQQA 4E3SA 3P5JA 1RT5A 1RT6A 4CEEA 1RCHA 4H4MA 4CGGA 3VQDA 4UC4A 5FDLA 1N5YA 2RJDA 3PV8A 1NOYA 3SPZA 2EQMA 1LAWA 1YTAA 2ETJA 2R5AA 1GOAA 4FYDA 4CIGA 4LD6A 4FLYA 4DQRA 3SQ1A 4QQGA 1A5XA 1J9AA 3ZSQA 4IKFA 3NGZA 4DWIA 4R5PA 3MEUA 4KAZA 3TR8A 3PMTA 4IDKA 5SWMA 1BI4A 4PA1A 3MEDA 3KLHA 3HJFA 2RF2A 3E9FA 4N76A 4ZTFA 4HUEA 2DTUA 4CJ3A 2OA8A 2G8FA 1WNSA 1DTQA 4NCGA 1L3VA 3KUFA 2X6NA 4ELVA 3HPOA 1JLQA 5C0MA 3V9SA 1X1PA 3I8DA 4CEDA 1RI0A 3KD5E 4EP5A 3MEGA 1EP4A 2F8TA 4X34A 1UA1A 4FK2A 1TAQA 1A5WA 3T19A 1VRTA 4NS5A 4PLLA 1CXUA 2FBTA 2WONA 4CECA 4E7HA 2R5MA 3CG7A 4CEAA 4CGDA 3HP9A 3EYZA 1R0AA 2L8DA 1HQUA 4DU3A 4C8LA 5CIUA 1RBTA 1WAJA 3AVFA 4B9WA 4KREA 1O1WA 1S1TA 3SV4A 2RN2A 4DSFA 4DFJA 1REVA 4EP4A 3QESA 4RW9A 5JS1A 4HCZA 2G3RA 4FVMA 1TKTA 3HP6A 4ELUA 3LALA 5I42A 3IS9A 2KW4A 1U04A 4M3UA 3OYLA 4DLEA 2A1SA 1ZBHA 4DSEA 4DQPA 1RTIA 4CJTA 2PYJA 2VG7A 3BGRA 1RDCA 4LSNA 3C94A 3AVGA 4FLTA 1NJZA 4M3YA 3OYEA 1ZBUA 3FEOA 2RO0A 4J2EA 3RR7A 1TV6A 3A2FA 3MXIA 4KHSA 1NK5A 4O5BA 2EKOA 2X6SA 4GY5A 3HK2A 3DLMA 3AVIA 3B6OA 3V81A 3ZSWA 3AVKA 4ICLA 3ZSRA 2GFUA 3SQ0A 1FXXA 4LH4A 3LWMA 2EHGA 2XO7A 4LH5A 3U3YA 3AVMA 1YTUA 3TAFA 4E1MA 3OQ5A 1Q9YA 3MEEA 4B9LA 4M3TA 4A4HA 3QBYA 2PZSA 2YHBA 3ZT0A 5J1EA 2JZ2A 1GOCA 2D9TA 1A5VA 4BWJA 3B6PA 3OA6A 2RHYA 2RI3A 4KTWA 4XIUA 3NNQA 5J2QA 4CJEA 4LD0A 3DLGA 1WSJA 3ZSVA 2M1HA 3BDLA 3SUOA 3MECA 4FJ5A 4DLGA 4KRFA 3F70A 1Z25A 4B9MA 4QQDA 1RT2A 1YT3A 3FFIA 3V9UA 2M0OA 2D0AA 4CE9A 3DLBA 4EZ6A 1FK9A 2RJCA 3AA4A 3NAEA 3C4SA 5KRSA 4Y1CA 3K2PA 1MU2A 1B9FA 3ASKA 2KTQA 5CYMA 3OS0A 1RDAA 4OPKA 4KHNA 3CFRA 3NCIA 3OYAA 3NFAA 5KGXA 3VQAA 1BIZA 4FM2A 1X9MA 2IGIA 4BDPA 3QEWA 2XY5A 4GW6A 5FROA 1X9SA 2OPPA 3M8RA 2XK0A 3C6UA 1S6QA 3SQ4A 2HB5A 4CFBA 4I2PA 3VA0A 1EKEA 1JKHA 2G8UA 4N4IA 3SYZA 2EQJA 1NK4A 4KHUA 3VQ8A 3ISNC 4CEFA 3LYIA 4JLHA 4RW8A 3LP1A 4CF9A 4IFYA 1RT1A 4CK3A 1U45A 4CHQA 3HO1A 4B9TA 3NTHA 2OPRA 2RJFA 2LVMA 3HL8A 4IUUA 3LANA 4RW4A 3MAQA 2E4LA 4AHVA 3DRPA 5J26A 4CFAA 4M3XA 2HW3A 3OVNA 3RMCA 4BE1A 3PUFA 4FJIA 1EX4A 4H8KA 1I39A 3V9XA 3HPHA 4CIFA 2NUBA 3DB3A 3P83D 1OI1A 4FCYA 3LLRA 3CQ8A 3ITHA 1BQNA 3D45A 4ZHRA 3OYFA 4IUVA 4CGHA 3SI6A 3WNHA 3L2VA 3L8BA 3DB4A 4FJGA 3H6ZA 2OZMA 1TK5A 3OYDA 1D5AA 3AO1A 4TSXA 2YNGA 4OPJA 3NH2A 2O4XA 3V4IA 4Z4IA 5DMRA 2XY8A 4N5SA 3MEVA 2XDPA 3FC3A 1TKDA 3NF9A 1WJQA 3H08A 2VG5A 5CZ2A 1LV5A 3VQPA 4IFVA 4O55A 3LZJA 3T1AA 3V6DA 1BI4B 3OYIA 3RRGA 1KCFA 4FJJA 3ZSZA 5KI6A 2QQSA 4B8AB 2PY5A 4IUPA 1OZ2A 1JLAA 1ASUA 2X74A 3K5NA 1Y97A 2RI2A 2LRQA 3LP0A 1T05A 4DTJA 3OMGA 2XY7A 2P51A 3DOKA 3Q1JA 4CK2A 4F4KA 4QAGA 1BISA 4DTMA 3WNGA 1DLOA 1D8YA 4CCHA 4LSLA 5T7BA 2IS3A 4DQQA 3LWLA 3VQ5A 1RTHA 4B8CA 2DFEA 2G8KA 4JS5A 1C1AA 3AO4A 1WJSA 4OGEA 3OY9A 4E7IA 4DSKA 3QETA 1HRHA 4O0IA 3S6WA 4KO0A 2XRIA 2HHQA 4CGFA 3OYGA 1S9GA 1KHCA 2B8AA 2RHIA 3IAYA 1S1WA 4DU1A 1S1VA 1JLEA 4PY5A 3P8HA 2XY6A 1WSGA 4CHNA 3VQCA 3AVJA 4KFBA 3K58A 2KZMA 2RHXA 2FHDA 3VQ9A 4I7FA 1RBVA 3SUPA 1S1XA 1TK8A 2IG0A 4CIEA 2MWOA 2Z1JA 5J2NA 2EX3A 4DU4A 3HM9A 2RHZA 3KK3A 3EY1A 1C6VA 2EFIA 4RW6A 4AHRA 2RHUA 3AO3A 4Q5VA 4K8XA 5CY4A 4W5NA 2Y1IA 4FLUA 1VRUA 1JXEA 1IG9A 4FJKA 4QQ6A 1JLBA 3SZ2A 5KE2A 3PX0A 5HBMA 1XC9A 3DRRA 3NDKA 3SJJA 3OYNA 2YKNA 1MHNA 1HJRA 3TAGA 3EZ5A 3AVAA 4E1NA 4Q5WA 5D3GA 2Z1HA 4CJKA 3S3OA 3HSTB 2LSNA 4F8RA 3M9QA 4F2RA 3FDRA 4Z4EA 3LH0A 1BIUA 3OJSA 4CEOA 2X35A 4IBNA 3QERA 4YFUA 3QNNA 4DFPA 2DFHA 4A4EA 3CYMA 4DF4A 4KI6A 2GUIA 5HRRA 2GFAA 3AV9A 1VSEA 1KRPA 2BE2A 4CHOA 3H8ZA 3ALYA 1UWBA 2HHUA 1ITGA 3QINA 2O4IA 1KTQA 3O3FA 1NJYA 5HRPA 1NKEA 1S5JA 1ZBFA 1QS4A 1LWEA 4J2BA 1T8EA 1VSDA 4CHYA 2CKKA 3RR8A 3M8PA 3PY8A 3PX4A 1CZ9A 3P1GA 4CERA 2YNIA 2E6MA 2QKKA 1SL1A 1QHTA 1VSFA 2A1RA 2P5OA 3UWNA 3VQBA 5I3UA 4DMNA 2HHVA 3PFSA 1XHZA 2D0CA 2YNFA 1U4BA 4CJUA 3KTQA 4DTNA 4DTOA 3E01A 1J5OA 3K5MA 4B9XA 4Z0UA 1QQCA 1HYVA 1NK8A 1TVRA 4FU6A 1LAVA 4N41A 1VSLA 2RPIA 5DK5A 4JRQA 1LWFA 3HXMA 3KLGA 5KCOA 3TAEA 4HUGA 3KJVA 1ASWA 4O4GA 2YV0X 1VSJA 3S3NA 2HNZA 2P5GA 4E89A 1C0UA 1VSKA 4Z4CA 5KTQA 2RJEA 4IUQA 3I0RA 4FLWA 4RG2A 3THVA 4CJQA 3OYJA 3DM2A 3M8SA 3DI6A 4UQGA 3IRXA 2QQRA 1TL1A 4HCCA 5KCHA 2LDMA 2F8SA 1C0TA 3NTIA 1RTDA 1RT4A 4CRIA 5FRMA 2GV9A 3JYTA 3WNEA 2ITGA 1RILA 2G8HA 1BQMA 3SD4A 4F2SA 1WN7A 4N4GA 4FLXA 1HMVA 1RDBA 1LW0A 1QE1A 4FZZA 3NBPA 5C42A 1SKSA 4C5IA 1TL3A 4OKJA 2FBYA 4DQSA 4N4HA 1NK9A 4CGIA 1KVBA 2KFNA 3HT3A 4KV8A 4C5HA 4C8KA 2Q3SA 4DSIA 1UOCA 3LP2A 3S9HA 1KVAA 4FZXC 2DY4A 4IUTA 4CGJA 4FJMA 4HHTA 3U6FA 5J39A 2QK9A 4CEQA 3QIIA 2O4GA 3OMCA 1OYXA 4CF2A 4CHPA 1TKXA 1IH7A 4CJRA 4CJLA 4DS5A 1UAXA 4E19A 3L2UA 2YKMA 3VQ7A 1XI1A 3VQEA 4KHQA 4Z4GA 2JGUA 2NLUA 3AVCA 2G8VA 4CJ4A 1HPZA 2ZD1A 4OVLA 1L3UA 1NJXA 2R57A 1B92A 1JLFA 3KD1E 2BGGA 4Q0BA 3MO8A 5HP1A 1LW2A 4GMJB 4CJWA 2X78A 3K57A 3NHGA 3QEXA 4KB0A 1SL2A 1BGXT 3LGLA 3NGYA 1QTMA 3DLHA 4YNQA 4CJPA 3L3UA 5FRNA 4BACA 1KFDA 4O44A 1WSEA 1KSPA 2OPSA 1BCOA 4AILC 1HYSA 3QEIA 4FLZA 4FZYA 3GOXA 4IG3A 1NK6A 4EDUA 3CFPA 2RI5A 4CFCA 3DRSA 3LAKA 2E6LA 3ZT3A 4F3TA 2HNDA 4WE1A 4C8NA 2L89A 4AH9A 2R7YA 3G0ZA 2KQ2A 4L59A 4G1QA 4N47A 4HVJA 1K6YA 4K8ZA 1G5VA 4BE0A 2EQKA 4JRPA 5E41A 5HROA 4NYFA 4CF8A 2K3YA 4KHYA 1EETA 5EU7A 3ZSYA 3HYFA 4DTSA 3PX6A 4DFMA 1JL2A 1VK0A 2YRVA 4ELTA 4BDYA 1HNVA 3QLHA 4Z4FA 4AHTA 1L3TA 5CYQA 4Z02A 3BDPA 2DAQA 2HNYA 1JL1A 3QKJA 2X4WA 3ASMA 3META 3TARA 3LPTA 3KK1A 4W5RA 4OKKA 3AVHA 3FLGA 1QSLA 4OGCA 1WSFA 3SUQA 3U3GA 3P8DA 3CFOA 4IURA 1TKZA 4NYNA 3RMBA 4FXDA 1ZBLA 4FW2A 4AHSA 1I3AA 1JLCA 2XHBA 4FLVA 2FBXA 2HQXA 4RG8A 4FW1A 1KLNA 2OPQA 5IN1A 4QOZB 4KB1A 3E9GA 1S9EA 3O4QA 4NCAA 3AA3A 4HTUA 3OYBA 4B3OA 4OLBA 3PO4A 4I2QA 3RMAA 1IKXA 3PO5A 2IOCA 1C1CA 1W9HA 1VSHA 1TAUA 3O3GA 1WAFA 4N56A 3AO5A 5C6SA 3TANA 1HQEA 2EQUA 5J2MA 3V1RA 4DTUA 3KK2A 1ASVA 3AA2A 4B08A 3ZSXA 3SUNA 1C0MA 3KKSA 2RKIA 3HVTA 4FJ7A 4DF8A 1NK0A 4BDZA 2HHXA 3L2WA 4FJNA 4QVZA 4PLIA 2OYQA 1U47A 1S1UA 2D0BA 3O4NA 2L3RA 1Z26A 1J54A 3G10A 2X4XA 2P1JA 1GOBA 3CEYA 5D6XA 2HQEA 1XNIA 1WLJA 3HPGA 1NJWA 3S3MA 1D9FA 3QNOA 4OLAA 4E7KA 4FJXA 1T03A 4DTRA 2MWPA 4FJ9A 2ZE2A 4FM0A 2Z1GA 3UT1A 4W5TA 4DFKA 4QCLA 2BUDA 4FK0A 2QKBA 3O8VA 4PWDA 1JLGA 3VQ6A 2X4YA 4PUOA 3L3VA 4AHUA 1YVUA 2R58A 3SCXA 3QJ6A 3ZT2A 4MFBA 4ZTJA 3LAMA 1SSFA 2BKDN 3AVLA 3NGIA 3DYAA 2HVHA 1JXBA 4E0DA 4BWMA 3NE6A 4FJLA 3OYMA 3LDSA 3I0SA 4ID1A 1RBUA 1WSIA 4NCBA 4OKEA 4E7JA 4A4GA 4NZGA 1IKYA 2HMIA 3OYCA 4CESA 4C5EA 4ID5A 3WNFA 4GVMA 4M41A 3ZCMA 4HUFA 3NTKA 1X9WA 5M9OA 3RWUA 1WJRA 2VWKA 3ME9A 2DIGA 3KLFA 1NKCA 4B9UA 3SQ2A 2F96A 4M45A 2B6AA 2BDPA 3JSMA 3DMJA 3NF6A 4IG0A 1CXQA 4I9QA 3ZT4A 3SPYA 3AVNA 2VG6A 4JS4A 3TAPA 1NOZA 3OJUA 1DTTA 1IO2A 3LX7A 1EXQA 1F21A 2YHAA 3C95A 3MP1A 4PL6A 4Y1DA 2Y1JA 4M42A 3QIOA 4Z4HA 1H3ZA 2FBVA 4C8OA 1RDDA 1QSSA 2PYLA 3KKRA 1UA0A 1SKRA 4KHWA 4FK4A 4C8MA 3HVRA 4FJHA 1WSHA 3L42A 1NK7A 2O4XB 3MXJA 4EZ9A 4HCBA 3MXMA 1WGSA 1B9DA 1VSMA 3VA3A 3SV3A 3LZIA 3F9KA 5J2PA 3L2RA 1J53A 2ATQA 4CEBA 1LWCA 2KZZA 4KPYA 5KRTA 2M16A 3CM6A 3MP6A 1RT7A 2IDOA 3SNNA 1RBRA 2JLEA 3CM5A 4CJ5A 1KLMA 5KE3A 1XHXA 4RW7A 4CEZA 3ULDA 3QIPA 2WACA 4II1A 3K5LA 4C5GA 3TAMA 1D9DA 1N27A 3QEPA 2E6NA 3VN5A 1W0HA 4W5QA 1SL0A 1Q9XA 4B9SA 3LP3A 3KLEA 1U48A 3TABA 3DLRA 3VQ4A 3TAQA 3ZSOA 2B4JA 4FM1A 2VYTA 3NF8A 4CJVA 3OB9A 2G8IA 3OYKA 2I5JA 4KTZA 4DTPA 4AHCA 3AVBA 5K14A 3M8QA 3ZT1A 4CFDA 3DLKA 3O3HA 4KI4A 5C25A 1XWLA 2DFFA 2QXFA 4LY7A 3MP8A 3EAEA 1OZ3A 1SV5A 3KLIA 2E5QA 2P0KA 1CZBA 2OZSA 3RTVA 4J2DA 3D0PA 4M3ZA 2G8WA 4F3OA 2GBZA 2K3XA 2HHTA 3PMIA 4B9VA 2VWJA 4PQUA 1G15A 2GF7A 1IKWA 2WOMA 3F73A 3K5OA 4MQ3A 1IKVA 4KTQA 4QW2A 3V1OA 4A4FA 1SUQA 3C6TA 4BD3A 1S6PA 3T3FA 4I9LA 2LTOA 4B9NA 3LPUA 2AJQA 1U49A 3OS1A 3OYHA 1RNHA 4DSJA 4H4OA 3MEAA 2W42A 4DG1A 3TWHA 1ZBIA 3NH1A 4DTXA 1QSYA 2BIVA 1L3SA 5HRNA 1BCMA 3V9WA 3UIQA 5IAYA 2IC3A 3QEVA 4L8RB 1FKOA 3MEWA 4CF0A 4M3RA 2FC0A 3PNWC 5CZ1A 3ZEHA 3L2QA 1NKBA 1T7PA 4DQIA 4M3WA 5C24A 4CF1A 1HNIA 4DSLA 5HRSA 1N6QA 5KH6A 4OJRA 1Q8IA 1HYZA 1TK0A 4DS4A 4CJSA 3NF7A 5D6WA 2ZQBA 5JS2A 4J2AA 3KIOA 1RT3A 4FJ8A
chains in the Genus database with same CATH superfamily
2YNHA 1VQKI 4OIQF 3VS3A 3AAQA 1BHLA 2F6CA 2OCCH 3N5NX 1ONVA 4A5NA 1H88C 1TGOA 3KEYA 4ILHA 2JTFA 2ADUA 2ACJA 3IWZA 1XB4A 1FOKA 1KU9A 3CDLA 1YFNA 3AO2A 1L5UA 4OVAA 2L4AA 1JJ6C 3G3ZA 4RA2A 2YSRA 3DLEA 4D5FA 3QO9A 4EMKB 5HLFA 2F5KA 2OF7A 4CJFA 1PVEA 5KGWA 2HR3A 4B21A 1J59A 3OS2A 1CKAA 1W70A 1RBSA 4W5OA 2ZWHA 4CHZA 1FNNA 2HVIA 3AA5X 3VGKA 4RB0A 1USSA 1S1NA 1KGSA 2RGVA 1ZXOA 2A3ZA 3V1QA 2P9PA 4M75E 1IV0A 1TS9A 1RT5A 2GLOA 1Q82O 1VQ4A 4BQQA 2DDAA 2K2MA 5CKTA 4BQOA 2B63J 2X9HA 1NMDA 2Q0RA 3HGGA 1Z9CA 1TWCJ 2LREA 2RJDA 5K5OA 3ZQQA 1KONA 3SPZA 1Y39A 2EQMA 1YHQN 1W7PA 2UWMA 2MYSA 1X1BA 4CIGA 2H27A 2IS1A 4FLYA 3BR6A 4D8DA 1FYKA 5GAMg 2KYMA 2FQ4A 4I6MA 2LR8A 4QQGA 3SQ1A 1QVGM 2QA4N 1HJDA 4AIHA 4KICA 2MIOA 4R5PA 1GLJO 4XRMA 2P9NA 2Y90A 4BG8A 4PA1A 2FL7A 2JWTA 1QHGA 2MC4A 3HGYA 3E9FA 3NMZC 3I59B 1GV5A 4N76A 4HUEA 2DK3A 2DTUA 2OA8A 2GWKA 2L7FP 3KUFA 1BJAA 3IHOA 1C6VX 4FQGA 5GAOr 4EM1A 5FPEA 1VQ7N 5AQZA 2O8CB 2KRMA 3V9SA 3KLNA 3AGKA 4DBQA 3CPFA 1X1PA 1YJNQ 5FW9A 3KHYA 3M0UA 1SZ2A 5BR8K 4CEDA 4EP5A 1OR7C 2UXXA 2EIFA 1I0CA 5DV5A 3T8RA 4X34A 1A36A 4FK2A 2K9QA 3RYPA 5A2QE 2CGJA 2JTMA 4M7AE 5EEHA 1YITN 3H92A 3O9QA 2OTJA 1PUFA 4M78C 5F27A 4CGDA 4G9YA 4GRIA 1OLTA 1X01A 3D4VA 4C8LA 5CIUA 2DA5A 2OV7A 1WAJA 2Z33A 3D1NI 3EFSA 5GANd 5HS7A 1ZA2B 5BPDA 3GLXA 4XONA 4LE9A 2EIMH 2QTVA 3T7ZA 3K4CA 3CF2A 4NXNK 1K8AO 5JS1A 1IV6A 3R6OA 3LALA 5I42A 1RL2A 5LJ5h 3FDYA 1ZSZC 3EH1A 2WB1N 9ANTA 3OYLA 1W36C 3CC2T 1LEAA 1UDLA 1PRMC 2A1SA 5HDGA 1WWXA 1RTIA 3MJXA 2FXUA 2VG7A 5KN8A 4EHUA 1RDCA 2FPFA 2LKSA 4RB1A 5H20A 3AVGA 2GAUA 3AG3H 4LGWA 1NJZA 1WI9A 5AQGA 1VUBA 2MMPA 1U5TA 1ZBUA 1R59O 2I8DA 5IXBA 3CC2I 1W2BS 3SDGA 5AQNA 1BOBA 1P90A 1NK5A 3W3DA 2ZJPF 2E1MC 1Y64A 5HY6A 4GY5A 3KP7A 2DK5A 3DLMA 4ELZC 4CCNA 3AVIA 3V81A 3ZSWA 2ECZA 4J6XA 1AU7A 3JRIA 2HNIA 1F4KA 3ZMZA 1YIJT 3J7YJ 1FXXA 4YIIA 4ZYAA 1X58A 4D5CA 4IEJA 1R0CB 3ZMSA 3I0WA 3FXRA 4E1MA 2ZXWH 2CUZA 1MD0A 4M3TA 4KGZB 3MZ8A 4A4HA 1RRQA 3QBYA 2PZSA 3ZT0A 3PSIA 5HKCA 1S5LC 3BZ6A 1GOCA 2BY3A 2E1MB 3OA6A 2RHYA 1YIJI 4R79A 4CYDA 1WLPB 4LD0A 4A0XA 4JOMA 2V6EA 3VERA 5FKOA 3O3KA 5DTDA 3JAME 1QZZA 2QI2A 4PJJA 3MECA 1SF9A 1FP2A 4FJ5A 4IF4A 4B1UB 3DBLB 2E1OA 1ITYA 3CC4N 2Z99A 1UAAA 5LMUK 4BXUA 4CO8A 4BS9A 4BRFA 4HNTA 1WYXA 4B9MA 3WTXC 2A07F 4JK1X 4M78D 1YT3A 2B86A 3FFIA 4AI4A 2M0OA 3QP5A 3BPXA 1ZRDA 3Q3SA 1M2VB 3NARA 1MH4A 1G83A 3PNTA 3SFZA 2ZSHB 4KT5C 1EH7A 1YBYA 1NGDA 3RR6A 3BDDA 2LZ6B 1VQON 2VVKA 3QG1A 3CDHA 5KPZA 2L3PA 4KGVB 4Y1CA 5KN9A 3QPLA 1DGWY 2A6EF 4F7ZA 3CCSQ 5CVRA 3C1DA 1B9FA 4F55A 1J2XA 4WQ4A 4LF8K 2KTQA 1RPWA 4AUXA 1S72A 3OS0A 1RDAA 4J9BA 2R7SA 1S6LA 3I9V2 2I7NA 3OYAA 1W36D 2PI0A 2QXLA 1BIZA 1YQAA 2IGIA 3QEWA 2UUZA 1YX5A 4XRFA 3FHGA 1SQKA 4RWTA 3SQ4A 4BRCA 3WE2A 5E79C 2HVSA 3I55Q 2P4RA 1U1SA 2E88A 1KG5A 4KHUA 3VQ8A 1QVPA 3LYIA 3CCRQ 4IFYA 4MHGA 3HO1A 3NTHA 4TVRA 1IDYA 2W1OA 2HEOA 2EW3A 3E9LA 2HZDA 1NH3A 3H5NA 2DOAA 3MPUB 3E6BA 2XSJC 2EQIA 1YIJN 4AHVA 1XSVA 5EX5A 3GE1A 2A36A 5J26A 2AHQA 3A98A 2COMA 3H9QA 2XAHA 1W7AA 4M75G 1RLQC 5A2QK 4FJIA 1EX4A 5IHKA 1I39A 3A8OB 3E1YA 2D6FA 1JEGA 3DB3A 4PGGA 3G73A 1WZOA 2ZM6K 2EVRA 1K8KA 3I56T 1OI1A 3WTZA 5FU6C 4M7DD 3CQ8A 3ITHA 1T6SA 1UHFA 3OYFA 4IUVA 4CGHA 2KROA 3FM3A 5KHDA 4DEYA 3WU0A 5E3NA 1WEFA 3P7NA 4FJGA 3H6ZA 1B8IB 2ME0A 2OZMA 2HNHA 2MK5A 3CC7Q 2IVMA 4F16A 2O4XA 1DP7P 3LL3A 4Z4IA 1G6NA 3I56I 1DGKN 3H9GA 2VJ5A 2XDPA 3FE1A 4MLEA 1P4XA 3GFMA 4H5VA 3O9RA 4X9CA 1M1KC 1WJQA 4UUTA 2P9KA 1BA1A 1JJ2M 5FU6B 3WU1B 1T95A 3CUQA 3SWNA 3QWLA 3OR1C 1XMXA 1LE8B 3HRTA 4IHVA 3LDQA 1VQ8Q 3HSFA 3BQYA 2I7PA 1P2FA 5GAOp 4LMYA 2QQSA 1N34K 1IO6A 2M9HA 2FSKA 1JLAA 3CPEA 3HHTB 3ASOH 2KJCA 5DM7L 5AZIB 2AQFA 4JKEA 3Q9SA 1RAEB 3GP8A 3IC7A 1BA0A 3BY6A 2XY7A 2UV1A 4M75F 2O8FB 2PJRA 2DYSH 3Q1JA 4M7AG 4DV1K 1OPKA 4F4KA 3BPVA 5GAOm 2R7FA 3ZEUB 2M2EA 3UA6A 4QAGA 2LVSA 4HF2A 1MBGA 1P92A 4ZN1A 4G6TB 3QDRB 3G4ST 3LSTA 1DLOA 4XLNF 1IBLK 3EUHA 2STTA 4LSLA 1ETVA 3K1PA 5T7BA 4DQQA 4UVBA 1RTHA 2DJIA 2G8KA 4IJAA 1RACB 1DT9A 1WJSA 5DCFA 2JM9A 4CW7B 1JQQA 3ZYYX 4DSKA 1HRHA 3JAMK 2VUBA 3G4SI 1WFWA 4O0IA 4B1XB 1H8KA 3M8FA 2HHQA 4BAYA 2K5CA 4CGFA 1FMVA 4IHTA 2WA0A 5CE3A 2LNBA 4C92D 2CW0F 3DLLA 2B8AA 3MX2A 2K5FA 3I64A 3FHFA 3V8JA 2PLYA 5BPLA 2E1HA 1S1VA 1NG6A 5J4YA 1JGSA 1NJIC 4O6JA 3E3VA 1ZRCA 3TTDA 4CHNA 1RKWA 2DOFA 5M1OA 5LJ3j 4RCHA 5DD8A 2IP2A 3KEOA 4KFBA 2ASMA 3I9QA 1U5TB 4I2OA 1BA5A 4FYXB 1M1KR 3CMAQ 1FIPA 5AQOA 3GBTA 3R8EA 3WGHA 2ZJRF 1TK8A 2IG0A 3ENBA 4M7AF 2DOEA 8AT1B 3I4NJ 5CCAA 2A5WA 1K0XA 3F21A 3KK3A 4ZGEB 4I98B 1NYFA 3Q0WA 3N97A 5F1JA 5JICA 5D5UB 4XH4A 5D4RA 3H46O 2LLKA 1OULA 3HOVJ 3M56A 3OBYA 2HBPA 4FLUA 3GDQA 1QPMA 3SZ2A 2NRTA 2VV5A 2YUNA 1X19A 3UATA 1KQSM 4JZ4A 3RUXA 2Q2EA 1UECA 2EJFA 3X25B 1ZGJA 2R5ZA 4WQ5A 1XC9A 1JJ8C 3JCMP 2XB0X 2NRXA 4HLYA 3DRRA 5F6FA 2KP6A 2HOEA 3QDFA 2E19A 4M7AA 3G4SN 4LOCA 3FJ5A 3EZ5A 1B9MA 4CC7A 1UG0A 1P6RA 3FXOA 2R7DA 2WAFA 1QQMA 2NUPB 4D6WA 2P6TA 1RETA 3CCEA 2LSNA 4Z4EA 4F2RA 1IDZA 2I0NA 4FISA 2YX4A 3QNNA 4E9HA 4DFPA 1YTYA 3VTHA 2LT4A 1VQ6N 4JQFA 2FRHA 4ABZA 1T33A 4IQJA 3BR2A 1M90O 3L9FA 4LF7K 1M1KU 1IHVA 1V76A 1IGNA 1QWFA 1D0XA 3ULEB 1KTQA 3HOTA 3O3FA 1NJIR 4A3EJ 2H6BA 4IHXA 5HRPA 1ENHA 3CCJQ 1NKEA 2DO7A 1PU6A 1MJ9A 4BH9A 3MN2A 4CI6A 5GAGP 2H6CA 2CKKA 2H1LA 4CHYA 3PY8A 1CZ9A 1Z3XA 3Q7CA 3P1GA 3EL2A 4CERA 2QKKA 1SD7A 1PKTA 5H6RA 2DXCA 3J7AY 3OYYA 5AQRA 4LB5A 2A6HF 2P5OA 1X75C 1Z1DA 3IAM2 3LMMA 4GO1A 2FSNA 3IQLA 3O08A 1XUPO 2LX7A 1TWHJ 3CCUT 2DYBA 1WQ2A 4DTNA 4KN4X 4A54A 1I1GA 1WSUA 3S2HJ 3ONQA 5FKKA 1J5OA 1U8RA 1HR0K 3TPQA 4B9XA 3EG1A 3CJ7A 1QQCA 4BVOA 1N78A 3QU6A 3D5RC 2RPIA 4PDKA 4M7YA 3KWIA 4XTWA 5IT9Z 1LWFA 1RLPC 1NMNA 3CCUI 2E6ZA 2OTLQ 3HXMA 4HUGA 2QQ8A 1K8KB 2A3SA 4M3DA 1IBMK 1B72A 3VS5A 5JVGL 3P4IA 3VEVA 2XB5A 4ZYEA 5GAMj 5JLWA 1I5OB 2E7WA 4O8KA 1DGRM 2E12A 2W24A 2J4RA 2O88A 4FIBA 2DJZA 2RJEA 4EJWA 1OEBA 4C0FA 4ESJA 1KG3A 1VQMA 5TKWA 4IJNA 4DK9A 4OMQA 3OS5A 3V8LA 5GANg 2EILH 1MNMC 1SFUA 1LWYA 3E97A 2K3FA 3IH3A 3SWNB 1X3ZB 4F3QA 1WDXA 1NJIU 4GCVA 3CPWS 4BXFA 1JUSA 5K1YA 4RTXA 5CKHA 2LDMA 4MQ9F 3HOZJ 1O75A 2MH9A 1RTDA 1TUDA 3PLAA 1JTXA 1T56A 2GV9A 2M1BA 3HOUJ 2QYZA 2NNYA 2ITGA 3CIPA 3GTQJ 2KGTA 1BQMA 3SD4A 2IGKA 4F2SA 2EWNA 1YCYA 1WN7A 4MMLA 2CGKA 1H89C 1RDBA 2V1NA 5DD4A 3NBPA 2RQTA 2CH4W 2ELJA 4JNEA 2FBYA 3QWXX 4DQSA 1WH5A 3HUGA 2G0EA 2DPPB 4KYWA 2Z5UA 2QGUA 2IIMA 2BZ8A 4DSIA 1P9QC 1UOCA 4OIRF 1SFKA 5AQUA 3S9HA 4L5EA 1ZGAA 2NRRA 5ILVA 1W5SA 4KJZA 4JJBA 4M75C 4CGJA 3CCUN 3Q5FA 3J7AF 4HHTA 4IX7A 2XDDA 1PUEE 1OYXA 3K0SA 4CF2A 2A5XA 1Z3YA 1TKXA 5HK0A 5C12A 2KEAA 1XNRK 3TO7A 1UAXA 4E19A 4LK1F 3VQ7A 1XI1A 2D5VA 1YAGA 4BBRJ 5CVIA 5FLXE 4Z4GA 2JGUA 2HSTA 1ACIA 3MKLA 4CJ4A 4OVLA 1L3UA 2R57A 2XPWA 1B92A 1JLFA 3EH2A 2BGGA 3EGDA 1IXSB 2VBZA 4M75B 1LW2A 4A59A 1WHGA 4A61A 4IZZA 3VS7A 3QEXA 2CU7A 3EZWA 1SL2A 1Y8RB 3I33A 3WG9A 4YOWA 3LGLA 5M1PA 3PIPL 1QTMA 2NOLA 4YNQA 1QHAA 3W0LA 4CJPA 3FK6A 2IBDA 2GXAA 4ITVA 1JUPA 2R93J 2CH5A 2V4JC 4FZYA 3GOXA 4EVIA 2C0IA 4EDUA 3CFPA 3OIOA 4HVWA 2R5YB 3FGUA 5DCMA 1U2WA 3QMLA 1K78B 4CFCA 1AHJB 3EFOA 1OX8A 1OFCX 3DXMB 4JKGA 3SJMA 3NMUA 4F3TA 2HNDA 4WE1A 2L89A 1FMKA 2EGEA 2R7YA 3IL2A 1KJWA 4UV8A 1LPLA 4G1QA 4JN4A 5M3MJ 3VEZA 5AIQA 3U1KA 2NNNA 1UGVA 2XASA 4BE0A 2EQKA 5E41A 2MF2A 5GAEP 2DLPA 2PU9B 2CW8A 1HUXA 2DTHA 5AQQA 4XIDA 5L23A 4DTSA 1TBXA 1R4MB 3ZQGA 5GAN6 2DN0A 5EEAA 4MNUA 4QLCU 3IKTA 4DBHA 4AHTA 3FXUA 1L3TA 5CYQA 4ILGB 3ZMTA 2UXNA 5I9EB 3BDPA 1NGIA 3M0QA 3T0YA 4ZZDA 2E5NA 2CUJA 2NOHA 4XAXB 2V51B 4X64K 2X4WA 3R6NA 3TDZC 1S3XA 4NUBA 3META 1HNZK 2HKOA 3GBQA 3TARA 4LC9B 4BC2A 4XEIA 1FSHA 2DMOA 2CSQA 3HOSA 4JPBW 3U3GA 3P8DA 3CFOA 4NYNA 1X3UA 2VI6A 1QVGS 5D5XB 1PU7A 4FW2A 3MFKA 1H92A 2L0AA 1Z05A 5DY9A 1TU0B 2FBXA 2HQXA 2VJJA 4YOYA 1LUJB 1UJ8A 2ED1A 4KT0E 1OCOH 1YHQQ 2P6SA 3K2ZA 5IN1A 1X2NA 1BBZA 1B34A 5EEGA 3E9GA 2MW8A 3GX4X 2ED0A 3CF5L 2QA4Q 2OQRA 3MEXA 2LTPA 4EJZA 3S1QJ 1PWTA 2QF7A 2X6OA 4C8QE 3BJOA 2E7XA 1VQ4T 4OLBA 3PO4A 5IT9O 2XUBA 3PO5A 4XSXF 1Y07A 1C1CA 1W9HA 2FA5A 3M0TA 2CUEA 3CHWA 2CZ7B 4ME7A 1VSHA 3F6VA 3BTJA 2QSFX 1WAFA 4CH7A 3AO5A 2VBYA 2DRKA 4IOAF 2QW9A 3QJYA 1T0JA 3ULQB 1TW3A 1WVRA 2EQUA 1E2XA 1VQ7Q 3VYTB 3F8CA 3KP2A 2H3GX 1RRSA 1VQ4I 2FSWA 4H03B 1MKMA 1VI0A 4N9HA 1C0FA 3WU2C 4B3XA 1MJAA 3ZSXA 1X4PA 1R58A 2ZJ2A 3LA7A 3V7RA 1ERDA 1ATSA 1LQ1A 3LWIA 4LXCA 5CVVA 3HB9A 4FJ7A 4ZGJB 4DF8A 1QVFP 1NK0A 3RDIA 3G6EN 1B72B 2OA4A 2VGMA 4NO7A 4PLIA 2OYQA 3WODF 5FLXK 4BHCA 3I5SA 2D0BA 2FRWA 3G10A 2M0YA 2F9WA 4D9JA 2KDOA 3ZX3A 4I0BA 4EQQA 1GOBA 1Y7XA 5D6XA 3CZ6A 3KZIC 5GJWB 3TKYA 5LGNA 2K3BA 2W25A 3S3MA 4ISFA 2F2VA 4XKBA 1I1SA 4UVAA 3TSPA 4C23A 2KHOA 2ZGZA 3GF2A 4DTRA 2MWPA 1KG1A 1D5VA 4LF6K 1ZG1A 4EPCA 4HQMA 3WTVC 2OTJT 3E6CC 1X3MA 1UGRB 4PGHA 4W5TA 4DFKA 1VRLA 4QCLA 3QZ5B 1I6XA 4P55A 3JCUC 3BT9A 3HBLA 1YVUA 4CI0C 4Q47A 3ZGKA 2R58A 4P9FA 1O3RA 3ZT2A 1X6BA 2OTJI 3LL7A 4IZ9A 3OMYA 4A2AA 4WFAL 3LQQA 3JCMW 1O3QA 3ATVA 2M34A 1VQ4N 3IDHA 1RBUA 3WVDB 4NCBA 3OH9A 4OKEA 4E7JA 3ECOA 4NZGA 2K5IA 3CBPA 1YX3A 1SSHA 1MBEA 3OYCA 3ZLJA 3BDUA 1PG5B 1UELB 4AFQC 4KULA 5LJ5g 4HUFA 3DLLL 3RCOA 3NTKA 1X9WA 5IYDJ 2NOFA 3RWUA 1FEXA 1T08B 2L4MA 3GFLA 2KE9A 5D5VB 5F64A 2QTDA 2NWMA 3SAGA 4YFXF 1T6CA 2B6AA 2EJGA 2BTFA 5DM7R 2GUPA 1IUYA 3ZT4A 3GWZA 3TAPA 3PJRA 3C2HA 1HPMA 4XOTA 1IO2A 3QAHA 4BY9C 1F21A 2YHAA 4MFEA 7AT1B 1T0FA 2COZA 1CQTA 2Y1JA 3VF4A 3CC4Q 2EPFA 3N4PA 1Y96B 1H3ZA 2FBVA 1VQLN 2M51A 3KKRA 2PG4A 2W0ZA 2KJBA 5F0HA 3VWBA 2ZF5O 2LF7A 1UA0A 4KHWA 4C8MA 3HVRA 1WFXA 2DTZA 3TQNA 2W6LA 4WX9A 4FJHA 1GUUA 1K79A 2XICA 2UUBK 4A5MA 4HOBA 1OKJA 2EIKH 1VQOQ 2LP5A 2EAYA 2H1KA 2O8DB 2CSOA 5IYCJ 1B9DA 3IH4A 1EJ9A 2VGNA 3VYHB 2ZKZA 4JKGB 3S1RJ 3CC2Q 4NB4A 1NLVA 2OTJN 4FWOA 2FPDA 1OPCA 2FLOA 1R5HA 2UUCK 4ANJA 3SXYA 2M0MA 5AN4A 2MOXA 3LWHA 2IT0A 3I71A 2JG6A 2ISZA 4FOEA 2YPRA 3MZHA 2R7ZJ 2RF0A 4Y33A 2K9SA 2JLEA 3K9KA 4HV5A 3VV0A 1OH6A 1KC8C 3O6BB 1B3QA 1XHXA 2FBHA 1KYWA 4DQ2A 1MNEA 2J6FA 1M1KO 2WACA 4L0YB 3A8LB 4II1A 3K5LA 4QPQA 1R77A 3S16J 1S7EA 5FPNA 1D9DA 5I21A 1S72T 2YLCA 2XIGA 1YIJQ 4X62K 1O9SA 4JJNK 3JCMc 1HW2A 1OH8A 2QM1A 3FZLA 1FTZA 3ZMUA 1H9TA 4W5QA 3WQTA 4B9SA 2H94A 5CVUA 3T1HK 3TABA 2EINH 3U9ZA 1K1ZA 1BR1A 2YLBA 3A5ZB 3K10A 1LEBA 2VYTA 2JJ7A 4FX4A 2NOZA 1N39A 2LBFA 3OB9A 2HTSA 4BL0B 1S72I 2MG4A 2CO5A 2NS7A 1D1BA 1R49A 2YSQA 3JS6A 2HXIA 3CCQN 3M8QA 3ZT1A 5D6FA 5C25A 1QKWA 5M3FJ 1UG1A 1QA6A 3GTLJ 5KYWB 1XWLA 5M1NA 4XKWA 5HLIA 3S2DJ 1GBQA 1ORNA 2AA4A 1YQLA 1CZBA 1G59A 4FWPA 1B34B 4M3ZA 5LEKA 2VLAA 2M02A 4C8QG 5AQTA 3DKWA 1X3WB 3W6KB 2HHTA 3KP5A 5GAN3 4B3RK 1ZLMA 3VW4A 2OAZA 1XC5A 2BW3A 2RV8A 1MV3A 2PFUA 1Y57A 4H5TA 3FWEA 4EJUA 3G7ZA 4QW2A 2GCXA 2VWFA 4CCMA 1WEIA 4I9LA 1ZHFA 1BC8C 1RI9A 2FVUA 3H36A 1XOVA 3JCMh 4ENMA 3VDXA 4E1JA 1WJCA 4HCKA 4DG1A 4Z8AA 3I58A 3TWHA 1ZBIA 3ECHA 5E8GA 1QSYA 5HRNA 5HLHA 1FBUA 3UIQA 2E36A 3OIQA 3U9GA 2ESNA 4UUSA 3MEWA 1NJIO 1KC8R 1IG7A 3THXB 3F6OA 3F8NA 2HQ5A 4JX4A 3ZEHA 4OF1A 1S7AA 3WXKA 1OYIA 3K70D 2BVLA 1UMQA 4BQNA 3DTKA 3PFYA 5GANj 1Z67A 3SDBA 2R0QC 5C24A 3CERA 1AWXA 1AKHA 5HRSA 2RAEA 2E2PA 2GQIA 3M1FA 3BZKA 3RSEA 4DS4A 3DPUA 1NU0A 2V8IA 5JS2A 1ZC6A 2DL4A 4FM4B 2HHWA 2ROTA 2JMAA 4E7LA 4DOVA 4C8QF 3EEQA 3L1PA 5AQYA 4E9FA 2BANA 3IUCA 3JB9G 4DR5K 1U6GA 1VYTA 1U06A 3DXKA 5AR0A 3SZTA 3HXLA 4KN7X 3CVTA 5L3CA 4OMNA 4I99C 3IFRA 1MNDA 4M6XA 4F52A 1RZ4A 2KFZA 4BRKA 4EW0A 1KVCA 5GMKe 2D5RA 3LOCA 2DL7A 2PUKB 4UB8C 2FZCB 3S41A 2NYSA 5EGOB 4ZH4F 5GMKi 1W7PD 4OAYA 1RABB 5F0XA 3RMDA 1CLQA 3NH0A 2Q31A 2PBDA 3LGFA 3AG1H 4FL6A 3B8AX 2L9RA 3TP3A 3CO7C 3EE9A 3TSQA 1HNWK 3E1SA 1GLBG 1JGGA 2BHZA 1TUYA 2D1VA 1KQSS 1VSIA 1LFBA 2XKPA 3K59A 5BR9A 2PTKA 1X6GA 1GXPA 3VQQA 1KXPA 2FBKA 2AKKA 3H3UA 4A6DA 1IXCA 2GTJA 1KC8U 4CEEA 3F9MA 3BF3A 5KPRA 2HAXA 3UNGC 4UC4A 1YLFA 2DYRH 1W4SA 3C18A 4I09A 3RZOJ 3D2FA 1FBQA 2IRFG 1R8OB 5KYYA 2IGMA 2R5AA 5CKEA 1XN7A 2FOWA 2D1HA 4BVPA 3CD6N 2PNIA 4LD6A 1UFMA 1JI8A 3MKWB 4HZFA 5HLTA 2FOKA 1QCNA 1JHHA 3BR3A 3RI4A 1A5XA 2AXTC 1Q95G 3JB9F 2ZPGB 1J9AA 3JRCA 4BR4A 2K40A 2FE3A 3NGZA 9ATCB 5AQLA 3G4SQ 1R5GA 3PM1A 4ORZA 3CJ1A 3MEUA 4KAZA 4X6AJ 1REPC 2K02A 4IDKA 2V1DA 2E2OA 3ZOBA 1HSTA 3HC7A 3LQRA 3I53A 2CFXA 2M45A 2FRYA 4B3AA 4L9NA 2WC9A 4CJ3A 2G8FA 1BOAA 4S0HB 1UHMA 3D5LA 3HM5A 3PL8A 4ELVA 1JLQA 4XR6A 1WJBA 1VQ6Q 4FVUA 1HOMA 2E1YA 3KD5E 2H3JA 3MEGA 3VKIA 4C1NI 2ESHA 2F8TA 4PFPA 3WHCA 1AWJA 4AU7A 2GXBA 4FASD 2XG8D 5GAEJ 1TAQA 4P9UA 4O5FA 3DWLA 1ZBXA 1VRTA 4YDUC 4NS5A 4RGUA 2CP2A 4E7HA 2NUTA 3CG7A 3JAMZ 3CCET 2XPUA 4O8UA 4A3LJ 2ECCA 5BPNA 4BRIA 5F04A 3VYGA 4LUEA 4DYCA 1KQ0A 3M1CA 3CUOA 4XLHA 3LNQA 2D0NA 4HVUA 2G7HA 1XTAA 1UB4A 3CPWP 4KREA 1O1WA 1S1TA 4H4KC 3DP7A 1JT0A 2RQPA 5EC7A 2HF4A 3SV4A 1REVA 5F2RA 4JEPA 4EP4A 3QESA 1WJFA 5LJVA 2KVQG 4B1WB 4BY6B 1MPGA 3ZMDA 1KG6A 3CCEI 2L9NA 3QB0A 5GAN7 4ELUA 4X66K 5ICGA 2PMUA 5GP9A 5AFUH 4M3GA 2KPMA 1MUYA 2XRLA 1RR7A 4DLEA 2HL3A 2M7BA 1F1BB 1UHWA 1AWWA 4DQPA 1YE9A 1RDWX 4XQFA 2E3IA 5GIPA 1PSFA 4FLTA 4YY3K 3OYEA 3FEOA 4J2EA 1S29A 2P4TA 2ZFWA 3CCSA 3SHFA 3MXIA 2DMNA 2YUPA 2D0QB 2DT5A 4Y52J 2DW4A 1NGGA 4B9QA 5ICCA 2K2VA 2X6SA 4FT2A 3HK2A 1QNTA 2HGCA 3EUAA 3I8BA 3ZSRA 2YG9A 3VUZA 2KDZA 3CUQC 3VFZA 1TWGJ 4LH5A 3K4LA 1SVOA 1YTUA 1TUCA 5TKYA 4C2UA 1Q9YA 4FO0A 3CCRA 4RGSA 2YHBA 3VEYA 4A2BA 4PJLA 2DD5A 2JZ2A 4FWSA 2RI3A 4XIUA 4AIKA 4BBSJ 3EGUA 1IUFA 4CC3A 3G71N 3ZSVA 2A05A 2EYQA 2M1HA 1FOYA 4YG2F 1JKPC 1Z9QA 2GEMA 3NQOA 2O6GE 2KIFA 1VQMT 1WBBA 4A3IJ 3FIWA 2EFOA 3CCEN 3ENOA 2ZMEC 2E5ZA 5EG0B 4KBOA 4A4KA 2RH2A 4DV6K 2IVNA 5IOZA 1Z25A 4QQDA 1X9JA 4AIDA 4FSXA 2CH0A 4G6DA 3A5MC 3V9UA 3PQKA 2CGLA 4CZJA 4QWQA 1I50J 1SAXA 2L3SA 1KO9A 5A0GA 1VQMI 3CCUQ 1QVFM 3VB2A 2BZXA 4C9YA 1HSJA 1J6ZA 3AL0B 2ESWA 3C4SA 3M0PA 5KRSA 4P96A 1G4DA 1FC3A 3K2PA 1UB9A 3FRNA 1TL8A 3RSEB 2CQXA 3ASKA 4G7HF 1ETXA 4P1WA 5A2QO 4WFBL 3HSEA 4YPRA 3LDNA 4HG2A 1AHDP 1ACMB 3NFAA 1FJLA 5KGXA 4GW6A 2A28A 2FB7A 3U23A 2X3XD 3DXKB 4J19A 1S6QA 1VQ8A 3ZQHA 2L3QA 3A5OC 5K7HA 3SYZA 2JUGA 3TO9A 4M78E 4C8QC 1YIOA 3K6GA 1VQ5N 4Q48A 2NS0A 3THKA 2E1CA 4CF9A 4JI4K 3L7WA 4B9TA 4FETA 4FWLA 3F8FA 3V8KA 4IOCL 5E1ZB 2Y0SA 4IOXA 1OCCH 5M5YJ 3DKYA 3HL8A 3LANA 5D7UA 4RW4A 3MAQA 3CJ9A 5DDGA 4AIAA 4ZZLA 1ZR4A 3CCLN 3AAPA 1ZELA 1KAXA 2V7FA 3KWGA 3DRPA 5FWBA 2HW3A 1SMTA 3RMCA 3M58A 5LJ5j 4HT9A 1RAFB 2F5FA 1R00A 4C8QB 4H5RA 2FPEA 3EHQA 2RDPA 3HPHA 4CIFA 2MCNA 2O8EA 1HF0A 4FX0A 3I55N 1KAZA 3OV8A 1W1FA 3P83D 1IRZA 3SMSA 1FY7A 2W48A 2Q97A 1KG7A 2JVHA 4ZHRA 2LYCA 1MV0B 3A5NC 2Y48A 2XU8A 2Q0UA 1RKTA 1D5AA 5FO5A 1IN8A 1I94K 3FHZA 5KYYB 1JRIA 1E3HA 1FIAA 1YJ9A 1Y1VJ 4YELA 3FZFA 4PL7A 2XY8A 4N5SA 3MEVA 3FC3A 3NF9A 4BUPA 2VG5A 1WHKA 1Z0XA 3S14J 3GG4A 1QP2A 2KLAA 2KIQA 4JLIA 4NLBA 2JA6J 1V4SA 4IFVA 4O55A 1Q1VA 4KHPK 2QSHX 3T1AA 3V6DA 1SHFA 3JREA 1KG2A 3IKMA 3SAHA 2DZCA 1LNXA 4I0AA 4DA4A 3ZSZA 3FHNA 3K4JA 3VOEA 4B8AB 2PY5A 3HZ6A 2HBLA 3CMAA 2X74A 2H8WA 4M7DE 5KYXB 3E7LA 1GFCA 1Y97A 3JAMO 4N0AA 2LRQA 4JRIA 1XMOK 3TP0A 1SMYF 3LP0A 3FZHA 2XGEA 3FLCO 3X28B 4B3TK 5LGUA 3Q0UA 2CS7A 3O4WA 3ELKA 2BBYA 4J83A 4N4NB 3RSNA 3MCPA 1VHXA 3SBTA 1G99A 2DF6A 1MA9B 2HQRA 3L09A 2JWKA 2KRFA 1XDUA 4A57A 2YI1A 4LFBK 1W0TA 4B8CA 1PKSA 3IMXA 1EFNA 3KBGA 1NGCA 3RBBB 4KA4A 3E2UA 4M77C 3AO4A 5AZJB 2UU9K 5JHFA 2ASPA 2JZYA 4E7IA 3JB9J 4J8OA 4CJ7A 3QETA 5CHIA 1LOTB 2GOXB 5GIOA 2VXFA 4YTLA 3WG7H 2K85A 3JCMQ 3QXEB 3LSHA 1QP3A 2J5OA 1LFUP 1KHCA 3IAYA 1Q86O 5HOOA 2NVXJ 1S1WA 2RM4A 5CQXA 3O9SA 3G1OA 4YIRX 4YRVA 2L7MP 4M77B 3V4GA 5L3EA 2CYYA 1NK3P 1U84A 3CTAA 3HTUA 3ML6A 1KQJA 3ID6A 4UY8I 1YN8A 2MAMA 3G6EQ 2OC6A 4J9DA 3SJHA 2E5LK 2FHDA 3VQ9A 4OFEA 1RBVA 3SUPA 1VIFA 1SS6A 4M7AD 1RIOH 1EWQA 2BXYA 5C10A 2L9SA 2Z1JA 4M6YA 1BKBA 5HNHA 1HYOA 1GVDA 1GLDG 3CCJA 2RHZA 1YNZA 3KPHA 4UB6C 1C6VA 1Y0UA 2EFIA 2COWA 5FWCA 2L9VA 2WV1A 1ZSGA 2FYKA 2LCLA 2W40A 4DZPA 1T6DA 3QDKA 3H0IA 3QQAA 2LQNA 1OH5A 4AHRA 2RHUA 4Q5VA 4W5NA 4BRDA 2RN8A 3TEEA 1BDGA 3JTGA 4UUVA 3J7AO 1NLOC 4FJKA 2KL4A 4RGRA 2WSCE 5KE2A 1BI0A 2WTEA 3P31A 2X1EA 3DAWA 2IEKA 5HBMA 2AZSA 1KD1C 5BN8A 3CCVN 1TT0A 3OYNA 1VTNC 4R8HA 4BG9A 4GGGA 1MHNA 3TOAA 1HJRA 4C3JJ 1KK7A 5LRRA 3ZPLA 3TAGA 1UFFA 4K41A 1UCRA 2GQVA 1USTA 1HDDC 2OTLA 3R0JA 2ZPIB 1JUMA 2EQRA 3QP6A 2JVVA 3HSTB 1POGA 2JS0A 4EJTA 3M9QA 3FDRA 1OPLA 1BIUA 1VQ4Q 2X35A 4BRPA 2VC1A 3H0DA 1IAWA 3QERA 2V79A 4I6ZA 1YI2A 2R92J 3H9NA 3CYMA 4DF4A 1IRGA 2X4HA 1ZQ3P 2FG0A 4X1VA 2DAOA 2GFAA 1VSEA 1KRPA 4QS9A 3VRYA 4CHOA 2WY7Q 5ICFA 4EMKA 3WXIA 1NTCA 4DBRA 3EYIA 3E9PA 2DXUA 1ITGA 3QINA 2O4IA 1N25A 2K4BA 1WH7A 5D4SA 2QWWA 5D8LB 1QS4A 1BO5O 1X4OA 1JB0E 2KRSA 5HNFA 1VSDA 4M78G 1XGMA 2CG4A 2JTVA 1SL1A 1VSFA 1U5SA 2A1RA 4S04A 2HQNA 2OCEA 1GBRA 5K5QA 1TZLA 3VQBA 4FWKA 2QG9B 1VQLQ 3TVTA 4A0YA 1WXUA 4J00A 1WHMA 1XHZA 4B1RA 4OMMA 2D0CA 2YNFA 2DBKA 4V2GA 3P9CA 5CQEA 2LY9A 3H41A 3D2EB 3HHHA 4WYBA 2ABLA 2XROA 2DK8A 1OMIA 2PVOB 2KKOA 3NGPA 1HYVA 1NK8A 2FO0A 4UY8O 1QU3A 4FU6A 2LK2A 3OBWA 2DODA 1VSLA 2CP0A 1JJ2P 3GMEA 3GL1A 5GAN5 2HKNA 3QSUA 3FXLA 1LDDA 4JRQA 2O8EB 5JHUA 1KU7A 2E5KA 2OTJQ 1KAYA 3M4OJ 2IPOB 1IV8A 4M9XA 3TAEA 1J5EK 1KD1R 5BN9A 3KJVA 4H0PA 2A08A 1OCRH 5LJ3f 1TUUA 3PSFA 2YCHA 2ZGWA 3X20B 1LVKA 1QZEA 1C0UA 5GANh 5KTQA 3GEZA 4KFCA 4HF0A 1I6HJ 2LDUA 1MGQA 1HA8A 1X1AA 4DJAA 1TSFA 4W1UA 4RB2C 1ZLKA 2O8CA 2OU2A 4IUQA 3FXJA 4HBLA 4OFAA 4FLWA 1NG9A 4PUSA 3F72A 4RG2A 5IXFA 5ADXA 4OP0A 3DM2A 4M78F 4XBFA 3M8SA 5AIPA 3DI6A 4HW0A 3SFMA 3T1BA 1K4SA 4ZJZA 5BQTA 4RB3C 3RPUA 2DA2A 5KCHA 1ETKA 1CGPA 2L2OA 1RT4A 4IWVA 4M7DG 2IXSA 5FRMA 2YUSA 3NVKA 1TNTA 4CZLA 3JYTA 2XV4S 1GFDA 1RILA 4XICA 2F5TX 3JCMf 5F1XA 3OL4A 2M0CA 2L7KA 5KAFC 1OR7A 1WCMJ 4UHTA 4C5IA 1X6OA 1TL3A 3CJQB 2ZO4A 3RKQA 3CCQQ 1ULYA 4A3MJ 2DYIA 1PJRA 4N4HA 2GA2A 4CGIA 3CQZJ 3LM9A 5A0DA 4C5HA 4B1ZA 4E47A 4GV9A 1WIEA 2NNWA 4WXHA 4M78A 3O6WA 3QRFF 5E17F 4B1YB 2COYA 3VOVA 4D0PA 4YFKF 5CVJA 4QKUA 2QK9A 4CEQA 4AM3A 3K2AA 3QIIA 4OB2B 5AQJA 4GV3A 4CHPA 4KNYA 4CJRA 3MN9A 4CJLA 5F0FA 1LNWA 1XSDA 1KD1U 3WHBA 1U2VA 3SEZA 5GAHP 3VQEA 4KHQA 4XLAA 1V4TA 2YG8A 2LNHB 4C0DC 3CXCA 4DUYK 2L5QA 2ZSIB 5LJWA 3HSRA 3H0HA 1QQOA 2ZD1A 1NJXA 3Q0VA 1ZSZA 2K3PA 4E7ZA 4K42A 3R6MA 2VQFK 4Q0BA 1WPKA 3IKVA 3MO8A 4H0VB 1G8XA 4FPAA 4GMJB 3K4NA 4BQAA 4CJWA 3IP4B 4BRGA 2CQQA 4J9GA 4KB0A 3I35A 4M7DF 2ITMA 4J5YA 4WCIA 3SMPA 2V1RA 2KZGA 1O13A 3L3UA 1VQNN 2CQ7A 1KSPA 1KQSP 4AILC 4C0DB 3QEIA 2F4IA 4FLZA 3R0AA 3CJBA 3BR1A 4BI3A 4IG3A 1NK6A 2OD5A 4EJOA 2YU3A 4U0WA 4CCJA 3SQNA 3J81Z 2Q2RA 4JI8K 3X24B 2X9DA 3CO6C 4AFUC 3PQJA 1YHQA 4ATOA 3DQVC 3A0BC 4QS8A 3TREA 3FZVA 1W6XA 2ZJQL 3MDQA 4GFBA 5EDNA 2EGAA 3G0ZA 2RPNA 3OA9A 2KQ2A 2EYWA 1R4NB 2QA4A 3S6IA 2FJ1A 3GTKJ 2KFDA 4U88A 2AT1B 1MMSA 2FUG2 2M4GA 4K2EA 2HDDA 1M5Q1 4JX6A 2VXEA 2LQKA 3SLCA 4M63C 2ISYA 5HROA 3WXJA 1MSFC 1M2VA 3TGNA 5GAMf 4KHYA 1EETA 1RGIA 1TQIA 5EU7A 2QK0A 3HYFA 3K9TA 2V26A 3H35A 3BG3A 4DFMA 1VK0A 1NG2A 2E35A 1RUWA 4G7ZF 1VQ7A 4Z02A 3ZBDA 2IW5A 2F5DA 2NRZA 1N33K 2TRTA 4FPBA 2HNYA 2P9SB 1NPRA 3OW2P 1V54H 1JL1A 2KRNA 2O31A 1N5ZA 4DR4K 3LPTA 4A3BJ 4RAYA 3HI0A 2ZC2A 3RIRA 2ELKA 2DXTA 3FLGA 3M53A 3AVHA 2UUAK 2KIMA 1YITA 5CJ9A 1PDNC 5KVRA 1ZHIA 2CP6A 5E84A 1YJWA 2MFZA 1IRXA 2KT0A 1VQ9N 2YHWA 1ZBLA 3U21A 1I3AA 4AHSA 1OKRA 1EF4A 1GT0C 2TDXA 3HKZN 2DPNA 5EJCA 3H6EA 2OJED 3H5AA 3L00A 4XU1A 3GPLA 3LSRA 2K5LA 4RG8A 2GX9A 2NOGA 3FZKA 3FF5A 2P5VA 3S15J 1KLNA 1VQPA 1X3NA 4KH5A 2OPQA 2XKOC 3CD6Q 2L01A 4XL9A 3VUBA 3CP2A 1S9EA 1VYVA 2L0KA 2WB1A 3ABMH 2ZXJA 3TW7A 5EY4A 1MDMB 1JXOA 3ZX0A 1GLEG 5IP6A 4B3OA 1G2HA 3HSCA 5FLXO 1IKXA 3RMAA 2RNJA 4E9GA 4QPOA 2JK3A 1B8IA 3FKJA 3DEWA 3DPLC 3F0ZA 4GXOA 4OIOF 4AYBN 5J2MA 1RNLA 4CZZA 2DD4A 4JJDA 4F91B 3KK2A 1TQMA 2XAJA 1ASVA 2KBTA 4CZGA 3TSZA 2Z1DA 4B08A 3SUNA 1C0MA 1IGQA 2FF3B 1VQKN 2F1LA 3KZZA 3N4QA 2VIXA 2MLGA 3KZYA 3Q7BA 5JMVA 4PZJA 1T3VA 2Z0WA 2V1QA 1LE8A 4DR7K 2ZGYA 4BDZA 2OX7A 4FJNA 2K9NA 2JSPA 4RTTA 2QZ8A 2RA2A 3C7JA 2HQAA 2JT1A 1MUZA 2VWBA 2B0LA 1AVZC 3O4NA 2L3RA 2X4XA 2YRDA 5BRDA 2OI3A 5GAOq 3JSPA 3BG7A 5AZIA 1JO8A 2VPRA 5IOYA 5J4VA 3T9NA 2QBYB 1FPQA 4DW6A 1WLJA 1XNIA 1JKQC 1VA7A 3V7SA 2O8FA 1WRJA 1D9FA 2IIRA 3WVEB 3CMEA 1IN5A 3CC4A 3ZEUA 2HU9A 5GAN8 4FJXA 4AM6A 1I1JA 3V42A 3FR0A 2ZE2A 4FM0A 1TTYA 3RNJA 4AVZA 3HRMA 3CJAA 3UT1A 1Q82C 3NRVA 3KE2A 4RMNA 2O2OA 1J3TA 5FPDA 2DA6A 4AFZC 1OVYA 2X4YA 2JA5J 3L3VA 1VQOA 3EGXB 3E5UA 3SEQA 1J09A 1A5JA 3JB9I 4BRAA 1EH8A 5HDKA 3PIOL 5L3BA 2G9WA 2BKDN 3AVLA 3VETA 4AC0A 1XQPA 2HVHA 1JXBA 4KIGA 2DEQA 4WTOB 1LDJA 4LIUA 3NE6A 3G25A 1QW1A 3OYMA 3M8JA 3ZQFA 2AO9A 1NM7A 4QTRA 4M78B 3IH7A 4X9DA 3H1CA 2EIJH 3CWTA 1IKYA 1WJ5A 4C5EA 4ID5A 4HQEA 3O2PE 3VEPA 5J3BA 3ZCMA 1W5TA 1JU5C 1IN4A 5EVZA 3M54A 4ESBA 1WJRA 1U2VB 2X48A 4XN3A 2VWKA 4BC4A 3CCST 2KNBB 4B9UA 1WX6A 4HV6A 2F96A 1O4XA 2BDPA 3MHXA 3DMJA 3NF6A 1ZSZB 1SD6A 1ATNA 3ERED 3SPYA 1B9NA 3G71Q 4JS4A 3UKUB 3OJUA 2Z9OA 3LX7A 1NGBA 1QVFS 3FK7A 2BE7D 1FMWA 1A04A 3CCEQ 2DFIA 3DKXA 1QZYA 4M42A 3CCSI 4OAZA 1WEGA 2V9PA 3FBIB 5JVHL 1RDDA 2PYLA 2KDSA 3A8HB 2P0QA 3AG2H 3CCRT 2R7RA 1SKRA 4C30A 2P9LB 3UPUA 2CUFA 1W0UA 3OR2C 4HSBA 2OFIA 3QYHB 4M7DC 1NK7A 3QYBA 3VESA 4LLNA 2EBPA 2IA0A 2CFOA 4YPHA 3ZQIA 4F92B 1XPXA 2XRNA 1WGSA 1IJWC 1NKUA 4PSWA 2JRMA 5AT1B 4F93B 1K7AA 1WB9A 3CCRI 3WT0A 3GUDA 4HX7A 3M57A 3F9KA 1Q82R 3K7AJ 1IRFA 3L2RA 2LRDA 3TTCA 1W5CC 2ATQA 1LWCA 4B43A 4KPYA 2NUPA 3H5RA 2WY8Q 3CM6A 4M7DB 4MDWA 3MP6A 4G94A 4KUMA 3VPZA 2PUOB 4NC8A 1VFCA 3K0LA 3CM5A 5C4XJ 2GA1A 3G1LA 2RMOA 4F04B 2YX6A 1RAIB 2V8KA 3K69A 1KLMA 4LFAK 4TV7A 4XN0A 5GTHC 1VQ5Q 4CEZA 4DGWB 4R56A 3GCMA 5AQIA 3BTIA 4DOWA 2YX7A 4DR6K 4BC5A 3M0RA 5K7FA 4BI8B 1IXRC 3CC2N 3PVQA 3CCLQ 3ULEA 1SL0A 3HIFA 4F7UE 3LP3A 2MH2A 1U48A 2OAWA 3HL2A 1T0HA 3TAQA 4JI2K 1VQ8T 4FM1A 2D1XA 3A8GB 1T38A 4BB7A 2UYTA 1XQHA 4CJVA 2Y75A 4M3FA 2HYJA 1YF5L 1BK2A 1X1DA 3QPSA 4HA8A 2CZ1B 2HSPA 4XLEA 3SAFA 4DTPA 1QGPA 2Y2ZA 5D5WB 4ZGDB 4DV4K 4KI4A 3M5AA 1UGQB 4AG1C 2HZTA 3VS4A 4QS7A 1VQ8I 2PBIA 3N5BB 1KSWA 4XORA 1OU9A 4FSSA 4NNJA 4FWMA 1K73C 3E6DA 3D0PA 2X85A 1X69A 3PUBA 3ZCOA 2GBZA 4MZMA 2WC2A 2JWLA 2NLXA 3PMIA 4B9VA 4LNPA 2VWJA 1Q82U 3TU5A 4C92C 1CF7B 3F73A 1JXMA 1APLC 4MQ3A 1IKVA 2D0OA 3V1OA 1SUQA 3G0QA 3C6TA 1U8BA 4EMHA 1M3BA 2C0OA 4BR0A 4N4OB 3MVPA 2DI3A 4B9NA 3CLQA 3LPUA 2AJQA 3ZN1A 3THYB 1V5EA 2BZTA 2A41A 4FE7A 3GW2A 4OMLA 3KEQA 3MN5A 4H4OA 2ZAEA 4DTXA 2BIVA 4OB1B 5FKNA 1YJ9T 1DUXC 1HDPA 1BI2A 1STZA 2Y9YA 5IAYA 4C92B 2HKXA 2IC3A 3QEVA 2PZ1A 4DR1K 3M07A 2CS3A 5GINA 4HX4A 1BIBA 3CJCA 3BG5A 2VKDA 3INZA 4G8XA 4PK4A 2DA3A 2I2LA 3PTAA 2XAFA 3BJAA 1YJ9I 2X6WA 1U6ZA 3CQYA 2P8TA 3HDDA 4BRQA 4M3WA 1N77A 4DIQA 1SC7A 4CF1A 3CMAT 1HBXG 2QQ9A 2GBQA 2YWWA 1EIFA 3O80A 2DA1A 4RM2A 4L9VA 1Y6IA 2O7OA 5D6WA 4HVVA 4BHBA 4XKCA 4J9EA 2XPVA 4CZEA 1E3PA 1RT3A 5ERIA 4FJ8A 3J80E 1ZYQA 4Y13A 2EGCA 2E65A 1RAHB 1D3BA 3CMAI 1IXDA 3VEXA 4RS8A 1R71A 4B44A 1G3WA 2LCCA 1BW6A 4QSHA 3KLOA 3TI0A 2DIQA 2Q36A 2Y0SN 3ZRGA 1DQUA 1J5YA 4B09A 1KA8A 3OTOK 1KFSA 3PVLA 3G2BA 2YXYA 1J9IA 3GLLA 1GXQA 1KD1O 5GMKl 1KQ8A 2YT6A 2Z1IA 1XGSA 2IAIA 3L4QA 2JA2A 3RRHA 1KU2A 4H0TB 1K73R 2DQRA 1VQ6A 4Z89A 2XMFA 2VQCA 4KMUX 4XU3A 4DR3K 3SDZA 1R0BG 4CK1A 1BL3A 4IO9L 2PQWA 1E6HA 2HQHA 1GRIA 3I56N 4M75A 1PC0A 4O0JA 5LY3A 2LC2A 1SFEA 5GMKj 3BR0A 4L5IA 1ZGWA 4XTVA 2VE8A 2DA4A 2HI3A 3GTPJ 1RT6A 3J7YP 4H4MA 3ZN0A 4IRGA 4CGGA 3VQDA 3UKRB 3VSKA 1T98A 3R3LA 1Z9ZA 1YJ9N 1DU0A 5DUKA 2E64A 1N5YA 3JW4A 4YFNF 3C0CA 1LAWA 2RQUA 5HL7L 1GOAA 5EZGA 2HOAA 2F5VA 4BJ6C 2R5YA 1BJZA 3FBNB 3OSVA 3EG9B 4PKHA 3HOYJ 5CK9A 4IEEA 3CCVQ 4BHPA 1K78A 3KZBA 3JB9D 3CCJT 4NBQA 3I54A 1X43A 3ZSQA 2RD1A 3DXMA 4DWIA 1Y56A 2MABA 1GLFO 2DE0X 2QWLA 1HKGA 2DZ9A 5SWMA 4MZPA 4LN2A 2FEIA 1XTDA 3COAC 3UR3C 4ZTFA 2OANA 3Q9VA 4PJOC 4ENNA 1WNSA 4NCGA 3CCJI 1I81A 1ZRFA 3WEEA 2A0FB 3HPOA 4ON0A 1XMKA 2F4OB 4A3DJ 3TQ7P 5C0MA 4JDSA 2EV5A 3C7NA 5IHIA 4GV6A 4OMPA 5EF6A 1K73U 3O8MA 1EP4A 1RC9A 4A69C 2W7NA 2STWA 5HVQC 4CYCB 4FL9A 3RDVA 1UA1A 2JN6A 1A5WA 3T19A 2OTLT 4PLLA 2FBTA 4DB3A 1A0NB 2WONA 3I4MJ 4HX8A 4CEAA 4M3EA 4JYKA 3HP9A 2QLZA 1V29B 3HYIA 1R0AA 2L8DA 2ZZDA 5GANf 4LDWA 4DU3A 2ASOA 4JUVA 2O3FA 4YOVA 4LG3A 1YI2T 2CW7A 1RBTA 3AVFA 2B7EA 5DM6L 4B9WA 2EA4A 3LSKA 4F9OA 2JHJA 4XK4A 4BXXJ 1G2BA 3J7ZO 1SFOJ 4CGZA 2OTLI 2LY2A 1BG3A 1ABOA 2RN2A 1WNLA 4HCZA 3I0TA 2LKXA 1JT6A 3HOWJ 4F7UG 4FVMA 1NEGA 3HP6A 5BMZA 3IS9A 3IHUA 3GFJA 1BW5A 4IPAA 2O03A 4MTDA 1U04A 1YI2I 2SEMA 3ZETA 4M3UA 3C12A 3TO6A 1WPYA 3OW2M 2DERA 2FZGB 4DSEA 2PFBA 4WF2A 2KQRA 2LF8A 2QSGX 2PYJA 1NLPC 2KKZA 1K0SA 3BGRA 1H641 2QEXA 3C94A 1O7FA 2WAQN 2R7QA 5TISC 2N8GA 3CETA 4M3YA 2CQKA 2HFHA 2RO0A 1OVQA 1TV6A 1SVMA 3MK6A 1NGEA 5H6QA 2XD0A 1A31A 1YCSB 1VAZA 4NLCA 4O5BA 1TLHB 2HHHK 2EKOA 1GHCA 1SVLA 2J05A 1FYLA 5TGTA 2E2QA 3J80K 2EV0A 1ON2A 3AVKA 4C2MJ 3ABTA 2YJFA 5DM7F 2GFUA 3TEDA 3SQ0A 3L2ZA 1L0OC 4LH4A 4EATA 1TQPA 1MGTA 3GNGA 2EHGA 3NEUA 2XO7A 3U3YA 3QWYA 5B1BH 2P0WA 1IG8A 3JRBA 4IXCA 4B9LA 4PJOD 5ELZA 5I22A 2HMAA 2JS2A 5J1EA 2D9TA 3ULRB 4BWJA 3B6PA 4CC2A 4KTWA 4XU0A 1U78A 2H3EB 5J2QA 4N0AC 5GADP 3DLGA 4R55A 4F7UF 4CA0A 1M90C 3SUOA 2A7YA 5HS9A 2V6CA 2COBA 3W6JB 3LDPA 2LY1A 2OPTA 3HSBA 2E34A 2EK5A 2KISA 1WZ2A 2K4YA 1NEBA 2AIRB 4B24A 3I0XA 1R5ID 3BWGA 1O3TA 1NBWA 4JK9A 1KQ1A 5CLSA 4BEHB 1JTYA 3DLBA 4EZ6A 1XMAA 3R4KA 1FK9A 4MDXA 2RJCA 3CCMA 2QDLA 3VEOA 1HK9A 2O8BB 2E10A 4YIFA 3N0UA 2K9GA 2K27A 1IB8A 1NG7A 1MU2A 2RREA 3OGDA 4DV3K 1BI1A 4BRMA 2C06A 2M30A 2RC4A 4F7UA 3E0JB 4CDGA 3NCIA 4RAZA 5DS9A 3ATUA 3H3VK 1PHTA 1X9MA 5A0LA 2ZNZA 5FKLA 2XY5A 5FROA 1D3BB 2W10A 2OPPA 4XSZF 2LC4A 3C6UA 4FWQA 2KRHA 4A3FJ 4CFBA 1LB2A 5ADXH 1EKEA 1JKHA 4N4IA 5FJ8J 2CJJA 2EQJA 1NK4A 3ISNC 4CEFA 4JLHA 3SYTA 3LP1A 5CKFA 4CK3A 3QYEA 4CHQA 1U45A 2DDBA 3M4GA 2OPRA 4ZC3A 4LIVA 4IUUA 1VQNQ 2A3LA 1I4K1 2VKEA 1H0MA 4CZKA 2O8KA 1YQMA 4RAGA 2ZCFB 1UG2A 2EA2A 1J7KA 2DL8A 2JPCA 2UXBK 4CFAA 3VENA 3FJPA 3HTSB 2E3HA 3A8MB 1K4TA 4BE1A 1LKXA 1WGXA 3PUFA 4V2FA 4H8KA 3CQTA 3KVGA 3VSLA 4L3QA 4LD9K 4KGXB 2NUBA 3HEFA 5J8FA 1S22A 4J9HA 4DQ8A 4CC4B 1TXQA 1BQNA 1Y96A 1M90R 2GM4A 3NPFA 4C3HJ 2Y30A 2JT4A 3SI6A 3WNHA 3L8BA 4X0GA 1Y0MA 2VKNA 4HSTA 1V55H 2PMZN 4KH4A 3NH2A 1V5FA 5J3LA 3DBRB 4BY1J 3JR9A 2WBMA 2UXDK 1TKDA 1YHQT 1XS9A 2O8DA 5FFZA 1ZBJA 1B59A 2HEQA 3ZXSA 5ICEA 1ETOA 3QODA 3REAB 3VQPA 1V3FA 4HSRA 2A6AA 3UDCA 2QA4T 2W04A 4FT4A 2ZXHA 1FJGK 3WGIA 3DEEA 2VONA 4FJJA 4JRKA 3A0HC 2ZJPL 3EKSA 4IUPA 1OZ2A 3G6EA 1NE8A 1YHQI 3A0IX 1ASUA 1FT9A 3VS6A 1YUWA 3WEEB 2R4GA 2KXDA 5J8CA 4M4ZA 1TH7A 2CRGA 3BW1A 1OYYA 3C7NB 3J8AA 2J06A 1VQ9Q 2W85A 2QA4I 1T05A 1ZKGA 2HOTA 4DTJA 3OMGA 1VQ7T 3DOKA 2X51A 3CJTB 4CK2A 1LCKA 4CBXA 1XJWB 2QGFB 1YP5A 3LSIA 3FKIJ 5B8HA 2JMWA 1BISA 4L0ZB 4DTMA 4KMFA 4LLGF 1D8YA 2E1ZA 1VYUA 1YITT 1VQ7I 4Y15A 3VQ5A 2QTXA 2DMPA 1YJWT 1B6AA 2DFEA 3NVMA 1HQCA 1M90U 1C1AA 2M9UA 3H3OB 1GV2A 3OY9A 4PKGA 2RKHA 2K4JA 5JVGF 3S6WA 4KO0A 1IREB 5C3EJ 2Y9ZA 1N75A 2WWYA 3SFIA 5KYWA 5BOXA 2QYOA 1YITI 3OYGA 1YJWI 4OIPF 3WXMB 4J6YA 3ZETB 3RZDJ 3HRGA 1VQPT 2QASA 1PP7U 4DU1A 1ZUKA 2BVMA 5TRDA 3V7CA 3O5ZA 4BU2A 3LSPA 2XDVA 3RKWA 3P8HA 1CZAN 2XY6A 4PY5A 3HFOA 3J81E 5FPMA 5BS6A 1GVJA 1MMDA 3VQCA 1VQKQ 2DVJA 2BUPA 3K58A 5LD2C 1MW7A 2A69F 2RHXA 1VQPI 4I7FA 3A4CA 4EM2A 1TNSA 1LFPA 2MWOA 3ZR8X 2EX3A 4DU4A 4B4CA 1GL5A 2RK2A 2QWOA 2DJNA 3JXUA 3MWTA 4L9TA 5E8IA 5LJ5f 4MDAA 1Q7YC 4RW6A 2IVPA 4ZDPA 5AYFA 1P7JA 3VRZA 4K8XA 1GCQC 5CY4A 1P8ZA 1KHIA 2Y1IA 2RK1A 3THXA 2K7LA 2QM3A 4JI3K 1VQLA 1BN5A 3IUOA 2M4KA 1JXEA 1IG9A 4QQ6A 1JLBA 1AZGB 1ZK8A 3JRDA 2XI9A 3PX0A 4XNFA 4RCCA 2ZPHB 1BI3A 1BL0A 2MD5A 3RKYA 1G3TA 3NDKA 3SJJA 3BEXA 4K11A 4AFSC 1NPPA 1P7IA 1RR8C 3QUIA 4E1NA 4Z6YA 4J9FA 1WJEA 4Q5WA 2E2IJ 1FP1D 5I2SA 4CJKA 4A3GJ 1YJWN 3CMET 3K1NA 4UXNA 4EA4A 4F8RA 2F2EA 3CC4T 1M8VA 3PNYA 3LH0A 5EG2A 1BIAA 1HKBA 4IBNA 1DKGD 4YFUA 5AQKA 2DFHA 2QKMB 3S17J 2VOOA 2WV0A 2XGXA 2GUIA 3IRRA 5HRRA 3AV9A 1PCXA 1T8IA 2KR3A 1HCRA 3PIPF 2JPSA 1XC3A 1VQOT 2E1NA 5EGOA 4GYIA 3CMEI 1VQPN 3CC4I 3ALYA 2EZHA 3BLYA 4F7UB 2VXZA 2HHUA 4RMOA 2XHCA 1NJYA 4XTUA 1S5JA 3LSJA 1ZBFA 1NGAA 1LWEA 4J2BA 1TYQB 3DEUA 2BGCA 5B5EC 3RR8A 4XTXA 3PX4A 3IAS2 1VQOI 2YNIA 2KY9A 2E6MA 1ILYA 4CVNE 1YQRA 1NGHA 1B07A 4JHDA 2GWRA 2KZVA 2LD5A 5I3UA 3QPHA 3DU6A 4DMNA 2HHVA 2GQQA 3PFSA 1K4US 2CP5A 2XAGA 1MJBA 3KTQA 1Q7YR 4DTOA 4M77E 3E01A 3PIPA 4EV0A 3CCQA 2KK4A 4Z0UA 2KAFA 2DILA 1TVRA 2K7AA 1HJOA 1FX7A 4RTZA 4ZNXA 1I27A 1D5YA 5JLXA 4UV9A 3H0GJ 3RPUD 2KQWA 1NBEB 3KLGA 5KCOA 4OU0A 4PHTX 5ECAA 1ASWA 4BKXA 4KH0B 3A1PA 3TL4X 1K6OA 4FYYB 2BZYA 1WI3A 2HNZA 3JV3A 1HLUA 3AFHA 4MZTA 2IS2A 2GTOA 3CXCM 5KQDA 4Q5SF 4WCEL 2CQNA 1K73O 3CMEN 1TC3C 1FOWA 1EO1A 2MI6A 4AG2C 3THVA 4CJQA 4KIBA 1LJOA 4BGDA 4BRLA 2KT1A 2QQRA 1FTTA 3MQ0A 4HCCA 2F8SA 1C0TA 3J81K 4CRIA 1IF1A 5E1WA 1NNEA 1KQ2A 2ZJRL 3JCMJ 5LL6S 1N8RC 1LOJA 4ENJA 3EKUA 2G8HA 3CF5F 3K70C 2DVEA 4XMYA 4N4GA 3D7SB 1HMVA 2CGPA 1QE1A 4FZZA 4EFHA 1SKSA 3CQXA 4OKJA 3KFWX 1JCEA 1Q7YU 4JAXA 4M72A 4XKVA 2W6KA 1O7LA 4YDUA 4KV8A 3F2KA 2Q3SA 4CICA 3IH2A 3LP2A 1T2KA 1KVAA 3WE3A 5LJ5e 3ER0A 2RQRA 3GNFB 3FM5A 3BCAA 1OYWA 2HYGD 4HEA2 4GLMA 5J39A 5GMKh 2VC8A 4C1NK 3H1QA 2RNAA 4F17A 1BC7C 3BY5A 4RTWA 3B6CA 4OWRB 3T1YK 2LFBA 4DHYA 4L5JA 3L2UA 2YKMA 2MLKA 1T3LA 4XOPA 1NGFA 1D0YA 3MKDA 1ESVA 3M0SA 5CR2A 1JJ2S 1V1CA 2G8VA 3BTCA 2PEXA 5IH2A 4M74A 2E60A 5GAGJ 1RAAB 3VPRA 3KD1E 1GXIE 3L0QA 4BQLA 3GFIA 1F36A 1OCTC 5HP1A 4YEJA 2P9PB 1AA7A 2X78A 3M9AA 2ZCWA 1W2BA 2EH3A 2YR2A 1JXSA 2V7ZA 3NGYA 2LKPA 2E20A 3WTSC 5L3GA 1QVFA 4BACA 4LJZF 1KFDA 1WSEA 1BCOA 3K4KA 4Y3OA 1MDUB 4HAMA 3QBWA 1AOJA 4QIWN 1R1UA 3LSGA 1BR4A 1W7PB 2Q8KA 3R6SA 2VJ4A 2DU9A 5BRFA 3D5SC 3R9PA 2C6YA 2HKQB 2RI5A 4E6RA 4YOUA 1CKBA 1Q81C 4AF1A 5IWAK 2CV0A 2ZPBB 3DRSA 4I6MB 5I11A 1XX5A 2ZBKA 3RJPA 4FOIA 2YHXA 2E6LA 2F5CA 3CD6A 4B47A 3MMVA 3UA7A 4R1HA 3ZT3A 1N8RR 1SKUB 1E4GT 2P9NB 4CCLA 2HYFA 4JKCA 4AH9A 5EG0A 4U7DA 4L59A 4H0YB 4UVCA 2GBYA 1BYMA 2F48A 2KI7A 5BPIA 5GADJ 1QO0D 1ARKA 3O5BA 1WKMA 2V75A 4H5NA 4JI7K 2IS4A 3JRFA 1BOTO 4JRPA 1G5VA 1RUNA 4NYFA 4CF8A 2K3YA 2NXNB 1X1CA 2W57A 4J9CA 3JCMX 3ZSYA 2VKVA 3ID8A 2YRVA 3BROA 4ELTA 1S72N 2CMPA 4BDYA 5GJVB 1HNVA 5EOYA 3QLHA 4DEXA 4Z4FA 1VOMA 2ROLA 2D1KA 2AK5A 2ZMEA 3BTLA 1OQYA 3DLLF 1A6IA 1YRNA 1JCGA 2QWQA 3QOEA 3QKJA 2VBWA 1PUFB 2VQGA 3OH6A 4MMKA 3KK1A 4U87A 2FZKB 2NRWA 1T44A 4OKKA 2L02A 3MMYB 3ZP5A 3I56Q 5KNLA 4CD1A 4OGCA 1EZZB 4P5OA 3SUQA 4IURA 4A3KJ 3OSFA 2XHKA 2D4WA 3RMBA 4FXDA 4Z94A 3NHNA 4OB0B 2LSOA 1U5TC 5L8RE 1Z7LA 1TTHB 5HLGA 1YJ9Q 1YJNA 1VQ6T 2DBBA 3ROUA 3ISPA 5GAN4 2EFQA 4DZJA 3RMSA 2W00A 4XTZA 4LITA 1BM9A 4QVDA 2YHTA 4WF9L 2P81A 2PVGB 1N8RU 2BHYA 2BH1A 4C8QA 2CH6A 4NCAA 1BB9A 3AA3A 1VQ6I 2V52B 4B3MK 2NVUB 4HTUA 1Q81R 3LM2A 1TWBA 3OYBA 2B9SA 3CCYA 2VYPA 4JHDB 4I2QA 4JKDA 4M73A 4M77G 2IVOA 4L9JA 4N56A 3A5LC 5C6SA 1D1CA 2MA3A 1LCUA 1JCFA 2DA9A 1HQEA 3RKXA 2NZTA 3TW6A 5EYRA 2GGRA 5J47A 4PNOA 4A12A 4GKJK 4BROA 5LJ5d 3OOPA 3H3ZA 1E6GA 1OH7A 3EE8A 5CR4A 2VQHA 4EEFG 3KKSA 3J7AP 2RKIA 4KISA 1F5TA 1D0ZA 1ON1A 4C3IJ 1GLLO 3AGRA 3L2WA 2HHXA 1ZAOA 2XF7A 5FKMA 3OHRA 5CQGA 4MEXF 2HBWA 4QVZA 1TT5B 3X26B 1U47A 5AFUA 1QVUA 1UUEA 1QWEA 3GZNB 4L5GA 4OX9K 3RYRA 3SHWA 3LFUA 5C15A 5KYXA 3VYRB 4X1EA 1ORPA 3OW2S 4JP0A 1M1EB 3KCCA 3G71A 4LB6B 4WQ4C 3LAPA 4JKHA 2HQEA 3MCZA 4E4HA 1YG2A 2EFPA 3P38A 3MCAB 4OLAA 1M3HA 1PSEA 2CSIA 3HM8A 5B3SH 2Z1GA 4M77F 3W2WA 2DQLA 2JN0A 1K61A 1QZ5A 4PWDA 3O8VA 3SB2A 3VQ6A 1Y0NA 1EWRA 1Q81U 4LUDA 1QZ6A 4D1QA 1FWZA 3VF6A 4PKIA 2OJ2A 1TW2A 2DBMA 3WTUC 3FXKA 2HF3A 4RTFD 5CQYA 4ZTJA 5AZJA 3LAMA 3C6HA 2JHNA 1SSFA 3JRHA 1NWKA 3EG3A 4Y0WA 3K1MA 3NGIA 3DYAA 1AD5A 4E0DA 4BWMA 1D8KA 3I0SA 4J01A 4IHWA 4PIIA 3CWSA 4ID1A 5M1QA 4BR5A 1NHAA 3A03A 5E3OA 3GTMJ 2HMIA 2VXDA 3ZX2A 1HSQA 3WNFA 4CSWA 1YO5C 2QEXT 5GMKm 3BFMA 5AQSA 4M77A 2L3DA 1TWFJ 5J40A 1VQ5A 1PM3A 3HZJA 2UXCK 2A68F