3OS1A

Pfv target capture complex (tcc) at 2.97 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os1A03
2R58A 1X9WA 3L42A 3HVRA 1KRPA 1BHLA 4IUPA 3HT3A 4E7JA 3MXIA 1JLBA 3M8RA 3E9GA 2DIGA 4E89A 3JSMA 3F73A 4M3RA 1NK7A 2HVHA 5FROA 4C5GA 4DU3A 4CF2A 4DSIA 3AV9A 4W5OA 4W5NA 3P5JA 1Y97A 4CIGA 2YHAA 4CFDA 4Y1DA 3D0PA 4NYNA 3TAQA 2YRVA 4DSLA 2HHUA 4LY7A 3OYJA 1VRUA 2E6NA 3MEGA 4JRPA 2G8KA 3AVHA 4QVZA 4Y1CA 4KHSA 3MP6A 1LW2A 3LALA 4CEEA 4L8RB 1RBRA 1UOCA 4MQ3A 3MAQA 4CJ3A 3SD4A 4CFAA 2M0OA 3MXMA 2QKKA 1G5VA 2G8VA 4I9QA 4DLEA 1KVAA 4H8KA 1S1VA 4K8ZA 2RJDA 2D0CA 2NUBA 3P8HA 3L3VA 3V4IA 5HLFA 3AA3A 3ZSWA 4CFBA 2HHXA 4CJQA 3M8PA 4HCCA 5FDLA 2O4XB 2JLEA 3RR7A 5KGWA 3M9QA 4OPKA 1A5WA 3HJFA 1TV6A 5DMRA 3V6DA 4DQPA 2O4GA 4DWIA 4QCLA 2F8TA 5KH6A 1TL3A 1ZBUA 4IDKA 1W0HA 1RT3A 1S6PA 3A2FA 3DRPA 3SNNA 2X4YA 2BGGA 3AO5A 3CEYA 1S5JA 1TVRA 3OYNA 1VSJA 1B9FA 4C8NA 4HTUA 1L5UA 1J5OA 1RBUA 1KSPA 2HW3A 3LAMA 3LGFA 4Z4EA 3AVAA 3V1RA 1ZBFA 3SJJA 3AVGA 3VQDA 2RO0A 1RDAA 2K3YA 3S6WA 1RDCA 3AVIA 4CJWA 3KD1E 2KZMA 1RILA 2PZSA 3NGIA 2P5GA 3ALYA 5J2MA 2Q3SA 1FKOA 1HYZA 5E41A 3L2RA 1YT3A 3AA5X 4DLGA 4NCBA 1VSLA 4HCBA 3DRSA 4DSKA 4OPJA 3HVTA 4OKKA 3CFRA 5SZTA 4CCHA 3NF7A 4OLAA 1WSFA 2FBTA 4PLIA 3SUOA 3P1GA 3ASKA 4IUUA 3OYKA 4A4EA 3V81A 2A1SA 2E4LA 4QQGA 2QXFA 3ISNC 4AHTA 3K58A 3PX4A 3OMGA 1D5AA 2EQUA 3NH2A 2RKIA 2EQKA 2GF7A 2VG7A 2GFAA 1I3AA 1FKPA 1RBTA 4O0IA 4FLUA 3HP9A 3HXMA 2PYLA 2PYJA 4B9LA 4F4KA 4CGHA 3OYIA 1RTHA 3HPGA 3LYIA 1NJYA 4B8AB 3OYMA 1IKXA 1DTQA 3H8ZA 3KLHA 4DFMA 5J2NA 1YTUA 1MHNA 4FW1A 2X78A 3I0RA 4QW2A 4L59A 3SYZA 4CGJA 4F3OA 4NCGA 2MWPA 4DQQA 4N5SA 4PQUA 1BISA 2IS3A 3LP0A 2M16A 1G15A 4KKOA 4M41A 3PV8A 1BI4A 1TAUA 3IAYA 2R5AA 1BQMA 4QQDA 2FHDA 4C8MA 2Z1HA 1BCMA 2RN2A 3VQ7A 1HYVA 3NHGA 4JRQA 3OB9A 4HVJA 4ELTA 1LW0A 4FJLA 3AO1A 3SV4A 1RT4A 3PNWC 2XY7A 3SUPA 4OVLA 4B9TA 5CZ1A 1ZYQA 1EX4A 3WNGA 1SKRA 3KJVA 4B9NA 1TL1A 4FJGA 1XNIA 3OS0A 4JLHA 4O4GA 3LWLA 3LAKA 1B92A 4EZ6A 2PQWA 4CJLA 3V9WA 4ID5A 1IKVA 3T3FA 4DTXA 3RR8A 4FJKA 1LAWA 4E1MA 4DQSA 5IN1A 1C1AA 1JLFA 2YNGA 3AVFA 4KI6A 4OGCA 3QEXA 3KD5E 4N41A 1XI1A 2DTUA 3RRGA 4CJUA 1NKBA 3KLIA 3NF9A 4IKFA 1QSYA 1TKXA 4LD0A 4FJXA 1EXQA 5HRSA 4FZYA 4CJ5A 2OZSA 3H6ZA 4RW4A 5D6XA 4NCAA 2HHSA 1T03A 4BE0A 1JLGA 1HQUA 1RI0A 1WJRA 1TKTA 3PMIA 3S3MA 2X6NA 3HL8A 4ID1A 2ATQA 4CHZA 1N5YA 1SL0A 2RI5A 2LRQA 3MP8A 4DFKA 1RTJA 4OLBA 3ITHA 4CEQA 1KLMA 4DTOA 3QLHA 3VA0A 2EQMA 2P0KA 5KGXA 3NE6A 4FM0A 4M3TA 4BDPA 3TWHA 1S1WA 4PUOA 3GOXA 4QQ6A 1HNVA 4CK1A 4N56A 1J54A 4HUGA 5HROA 2EKOA 1TK8A 4CHPA 1N27A 3B6OA 3L8BA 4PA1A 3SUQA 2DFFA 4FJIA 4KHNA 4RW6A 5C25A 5KCOA 2WONA 3C95A 3L2VA 1HQEA 1Q8IA 2RI2A 3LZIA 4DQRA 1HPZA 3TAGA 5KE3A 1DTTA 1RTIA 4CJRA 2GFUA 5HRNA 2XDPA 4FZXC 4B08A 3I8DA 3VQ9A 3PFSA 3LZJA 3KK3A 2HMIA 3DLMA 1SKSA 4IUTA 4I9LA 4DFJA 4F8RA 3QO9A 1RBVA 1S6QA 2KW4A 1C0UA 3RMCA 2G8UA 4B9XA 3DLEA 1VSHA 2FC0A 3CQ8A 3QERA 3LDSA 4CEBA 4AH9A 1Q9XA 4NS5A 1ZBIA 3ULDA 1D9FA 4KTQA 3EAEA 1ASUA 4GVMA 3HYFA 4DTJA 3RMBA 2HQEA 4CK2A 3QETA 1NK5A 5C6SA 4CGGA 3BDPA 1NOYA 4FK0A 1NJXA 1TGOA 3HO1A 2HVIA 3AVCA 1RDDA 3CYMA 3LP1A 2YNFA 1WJQA 4CJ4A 4W5RA 3HPOA 3NCIA 2L8DA 2RHIA 3VQCA 1RT2A 1GOBA 2LSNA 2HQXA 3OQ5A 4W5TA 3K5LA 4DTRA 3U6FA 1U45A 3E9FA 3UWNA 1VSKA 3NTHA 1HNIA 3HM9A 4H4OA 3DB4A 4M3XA 4BWMA 3ZEHA 1REVA 3KKSA 4CGFA 1QS4A 1S1UA 4CJTA 5T7BA 4EP4A 3TAPA 3HP6A 1TK5A 5FRNA 3UIQA 1U49A 3VQ8A 4FJ5A 1TKDA 2E5QA 1CZBA 1UA0A 2G8WA 4X34A 1HMVA 1QTMA 2BE2A 3KTQA 5M9OA 5EU7A 4G1QA 1YVUA 1XHZA 3DLGA 3NF6A 3G0ZA 1NJZA 1QSSA 1UWBA 3OMCA 3TANA 3RMAA 1N6QA 1JLEA 2DAQA 3O3FA 4RW8A 4E0DA 1TKZA 4CJSA 5J1EA 4JS4A 3VQEA 2IDOA 4AHRA 3L2QA 3DB3A 4H4MA 4KTZA 3LWMA 4FK4A 1L3UA 4CRIA 1A5XA 1J53A 3QINA 2Z1JA 4Q0BA 4DG1A 3I0SA 2DIQA 4DTSA 1JXEA 2RJFA 2YV0X 3SUNA 4IURA 2BKDN 2YKMA 4E1NA 3MP1A 3PY8A 1QQCA 2B6AA 4KHYA 4KO0A 2A1RA 3KLFA 2LVMA 5C42A 3U3YA 4J2DA 2JTFA 4FJMA 3PX6A 2R57A 3UT1A 3DI6A 1KCFA 4FLWA 4CEZA 1WLJA 2R7YA 3ZT2A 3NGYA 4FVMA 5J26A 3THVA 1RTDA 4F3TA 2BIVA 2EX3A 1IKWA 1NK9A 3OYHA 4O5BA 3AO4A 3VN5A 1L3SA 2P5OA 3AVKA 3SZ2A 1JLCA 1X9SA 4B9VA 3S3NA 1Z25A 4N76A 4BE1A 1NJWA 4KHQA 1L3VA 3Q1JA 2E6MA 1JLAA 2HNDA 2K3XA 3O3GA 1LWCA 3VQBA 4BACA 4CEAA 2LTOA 3C94A 1S9GA 1LWEA 4DSFA 4DTUA 1VK0A 1IO2A 2JGUA 3ZSRA 3PX0A 1KFSA 2X4WA 2B8AA 2X6SA 3V1OA 3V9XA 3LPUA 2IC3A 4E3SA 3MEUA 1VSMA 4OKJA 4AILC 4FXDA 4E7HA 4Q5WA 3SQ1A 2KFNA 4BE2A 2RHYA 1CXQA 4Z02A 3K5NA 4BDZA 3F70A 3EZ5A 1D8YA 4BWJA 5KCHA 4Z4GA 1WSIA 3KIOA 4I2QA 1ITGA 4IFYA 4CHQA 5I42A 2LDMA 3LH0A 3EY1A 2YHBA 4OKEA 3U3GA 3T1AA 4Q5VA 4C8KA 4HUFA 4C5HA 4FJNA 1MU2A 2W42A 4FCYA 4CHNA 2XRIA 2RHXA 4GMJB 3NH1A 5KRSA 1NKEA 1XHXA 4CJPA 4A4FA 4Z4CA 2HHVA 3VQAA 3LANA 4KRFA 2R5MA 1FXXA 1KFDA 3NTKA 2ETJA 3OYFA 3CM6A 3NNQA 3OYBA 3MEAA 1EKEA 2E6LA 2RF2A 5HBMA 3WNEA 4CF9A 1JXBA 4M42A 1BI4B 4CFCA 1X9MA 3PO5A 2ZQBA 4I2PA 3T19A 5IAYA 1RCHA 2IG0A 2OYQA 2P51A 4AHVA 1K6YA 3MXJA 3ME9A 3S9HA 1RT1A 3CM5A 4F2SA 4E7KA 1HJRA 4ELUA 2DY4A 1X1PA 1R0AA 2JZ2A 4GY5A 4M3YA 1T7PA 2WACA 4PY5A 3LX7A 4AHCA 4FZZA 4KHWA 1CLQA 3AA2A 4CE9A 4CJFA 3SV3A 3MECA 2L3RA 2I5JA 5JS2A 1OI1A 2G3RA 4CF8A 2YKNA 2OPQA 4CJEA 1BIZA 5CYQA 1OZ2A 3ZSVA 1C0MA 3NAEA 1SUQA 4ELVA 2VWJA 1SSFA 4Z0UA 2B5JA 5FRMA 4BD3A 5SWMA 3KUFA 2WOMA 3ZSOA 1RT6A 4FJ8A 4RG8A 4DTNA 4B3OA 2EQJA 2VYTA 2QKBA 4DSEA 4KAZA 3P8DA 1Z26A 3QBYA 1HRHA 3QEIA 3BDLA 4DMNA 4A4GA 1YTAA 2RJCA 2BDPA 1EETA 2KQ2A 2OPSA 3ZCMA 1KHCA 2MWOA 2X35A 2QQSA 3QIOA 4KHUA 3H08A 2XHBA 1RT5A 1SL2A 4FM2A 2G8HA 4IG0A 3ZSXA 2OZMA 1VSFA 4CEFA 3DYAA 4CHYA 2FBXA 1LWFA 4FU6A 3DM2A 4EDUA 3LP3A 5KRTA 1WSGA 3SCXA 3TI0A 5KTQA 4M3WA 2EFIA 2VG5A 3L3UA 3AO3A 4FLTA 2KZZA 3V9UA 2GV9A 4B8CA 4TSXA 4RW9A 3NF8A 4DF4A 3IG1A 3FDRA 2OA8A 3MO8A 3MEVA 1KTQA 4EP5A 3OS2A 3VQQA 2XY6A 5C0MA 2O4IA 3BGRA 1S9EA 2F8SA 3QIIA 3RWUA 2DFEA 4CIFA 3OJSA 2HHQA 4N4GA 4FL6A 4II1A 3AVNA 1RT7A 3ZT3A 1BIUA 3KK2A 4CGIA 5CYMA 1JL2A 1T05A 4XIUA 3ZT4A 1ZBHA 3C4SA 4DU1A 4YFUA 3E01A 3OA6A 4CF1A 1L3TA 4J2BA 1WSHA 1IG9A 1RDBA 4CF0A 5JS1A 1LAVA 3S3OA 5C24A 1U48A 2XK0A 4KREA 3OYDA 3META 4KTWA 4GW6A 3ZT0A 4DTMA 4B9MA 4IBNA 2M1HA 5D6WA 3OYLA 2P1JA 1EP4A 3QESA 3OS1A 4CHOA 2LCCA 3QEWA 3V9SA 4ICLA 4IUVA 1JL1A 3DOKA 4W5QA 3VQ5A 1SL1A 4N47A 3PMTA 3TAFA 4M45A 2AJQA 3F9KA 3QEVA 1W9HA 1JKHA 3SPZA 2IGIA 3KKRA 2BANA 4CK3A 3QEPA 3NGZA 1C1BA 1VRTA 1XC9A 4E7LA 4DF8A 1WSJA 1SV5A 2GBZA 4Z4IA 2ZD1A 5I3UA 4F2RA 5KI6A 3ZSYA 3AA4A 4CJKA 4IG3A 4DFPA 2G8IA 4PWDA 1GOAA 2VWKA 4MFBA 4OGEA 4FLZA 3IS9A 2Y1JA 2PY5A 4I7FA 2HHWA 1UAXA 4AHUA 4ZTJA 3G10A 4LD6A 3SQ2A 4B9UA 2DFHA 1RNHA 1WSEA 2NLUA 2RHZA 1WN7A 3FLGA 2O4XA 4O44A 3VQ6A 3HSTB 3CFPA 3L2UA 1WAFA 4FK2A 2CKKA 3NH0A 3M8SA 4YNQA 2IAJA 1SKWA 4KB1A 4Z4FA 4O0JA 2FBVA 5J2PA 2QQRA 3K59A 2XY8A 4FLXA 3VQ4A 4KPYA 3DMJA 3M8QA 3FFIA 4RG2A 3NBPA 1C6VA 3SQ0A 2B4JA 1CXUA 4Z4HA 4FJHA 1NOZA 4J2EA 3TAMA 1J9AA 1QHTA 2BUDA 4C5EA 5KE2A 4E7IA 1U4BA 3NDKA 3K5MA 2RI3A 3C6UA 5CY4A 3KLEA 1KLNA 3FC3A 1NKCA 3VA3A 4HCZA 2X74A 4CEDA 3QNNA 3L2WA 3AO2A 3MEWA 4N4HA 3QJ6A 4B9SA 1S1XA 4QOZB 3DRRA 2VG6A 3IRXA 3O4QA 1IH7A 1S1TA 3OYCA 4CEOA 2RPIA 1QSLA 2YNHA 1O1WA 4RW7A 4HUEA 2X4XA 1VSDA 3O4NA 3ZT1A 3DLHA 3TARA 3PO4A 2RJEA 2Z1GA 4CIEA 4OJRA 2QK9A 2ITGA 3PUFA 3V9ZA 3K5OA 3LGLA 1DLOA 3DOLA 3QIPA 3TABA 1NK8A 4C8LA 3JYTA 3HPHA 4CGDA 5D3GA 1BQNA 3CG7A 3VQPA 4E19A 1B9DA 1XWLA 5HRRA 1D9DA 4DU4A 4C8OA 4DSJA 5HRPA 4K8XA 4NYFA 2ZE2A 4C5IA 3DLKA 3SI6A 3QNOA 1KVBA 1ZBLA 4HHTA 1VSEA 2D9TA 5K14A 3ZSZA 1Q9YA 3OYEA 1ASVA 4N4IA 1I39A 4UC4A 3AVMA 1KVCA 4IFVA 4KFBA 2D5RA 2D0BA 4FJ9A 2D0AA 1WGSA 3LPTA 1BGXT 3OYGA 2L89A 1H3ZA 2HB5A 1OZ3A 2HNZA 3MEDA 3P83D 4FJJA 3SPYA 3DLRA 2EHGA 4LSLA 1U47A 1GOCA 2KFZA 4FJ7A 1WNSA 4DS4A 2XY5A 1QE1A 4FW2A 4PL6A 4FLYA 4FM1A 2Y1IA 1NK6A 2KTQA 1ASWA 4AHSA 4BDYA 3MEEA 4FYDA 4CERA 3OJUA 3EYZA 4M3UA 5J39A 4FLVA 2F96A 2G8FA 4DTPA 1C1CA 3OYAA 1WAJA 3RTVA 2OPPA 3NFAA 4NZGA 1CZ9A 3WNHA 1OYXA 3C6TA 1NK0A 5CIUA 3O8VA 4ZTFA 3AVJA 3OVNA 3LP2A 1NK4A 3ZSQA 3AVBA 3HK2A 2F5KA 1FK9A 1JLQA 2FBYA 3AVLA 3WNFA 3RMDA 5CZ2A 3DLBA 4EZ9A 4KB0A 4WE1A 1VSIA 3ASMA 3RRHA 5DK5A 3CFOA 2RHUA 3TAEA 2Z1IA 4KV8A 1U04A 3B6PA 4PLLA 4OVAA 4QAGA 4DQIA 4O55A 3V1QA 3LLRA 2HNYA 3KK1A 1LV5A 1HYSA 1T8EA 3NTIA 3FEOA 4CESA 3QKJA 3SQ4A 2XO7A 5HP1A 1UA1A 4UQGA 4DS5A 3K57A 1TK0A 2HHTA 4M3ZA 3TR8A 4LH4A 3D45A 3OY9A 1WJSA 2YNIA 4R5PA 1RBSA 2IOCA 3KLGA 4IUQA 5J2QA 4J2AA 1TAQA 2GUIA 2OPRA 5D6YA 4B9WA 4LSNA 4CECA 1BCOA 4ZHRA 1A5VA 4A4HA 4KI4A 4LH5A 3K2PA 1IKYA 4CJVA 3O3HA 1BL3A 4JS5A 1F21A 1C0TA
chains in the Genus database with same CATH superfamily
3PQJA 3CUQC 3LDQA 2XU8A 3HT3A 5CE3A 1WHHA 3SB2A 3E1SA 2VKHA 1SEMA 1TWCJ 3VF6A 4I76A 4DSIA 3E97A 2IIMA 2E6NA 5LEJA 4KH6A 1FPQA 4BRAA 4CFAA 3GTMJ 4I9QA 2DD4A 1YXQA 2PZ1A 5HLFA 3PIPL 1WZOA 3EUAA 5B8HA 2P9NB 5DMRA 4DWIA 4ORZA 1S22A 4PJJA 2DK3A 2QWWA 1YJ9I 3ZQ7A 5LD2C 1SRLA 2HVSA 1DGWY 5IY5H 1WBDA 1UGQB 4ZNXA 2OTLN 3CDHA 1NPRA 1QPMA 3FDYA 1SVOA 5E41A 4LIVA 1RAGB 4M78F 3EKSA 2MBFA 1I5LA 2ASPA 1H88C 4IUUA 4JI5K 2KK4A 4QQGA 1LOTB 4XLPF 2EQKA 2O31A 1FKPA 1RBTA 3HP9A 3BG9A 1QVPA 2A0FB 4WF9L 2R3SA 2IJLA 5D5UB 4BRDA 2EAYA 4N5SA 1YJNQ 1W6XA 4QQDA 1BCMA 2P9KA 4HVJA 3KP7A 1PHTA 3M54A 1TUCA 2IVWA 2YNGA 3H45C 1F1ZA 1ZBXA 1UG0A 2XIDA 1QBJA 2DA1A 2IA0A 3CCJQ 4BBRJ 3KWIA 1FSHA 5HRSA 3DXMB 3MKZA 1JLGA 2YJEA 1U2WA 3WODF 2QA4A 3CQZJ 2UUAK 2TRTA 3NE6A 1KG2A 3QPLA 3OBWA 1UFFA 1Q82C 3QHSA 4PKCC 2CGHA 1PD1A 2MC4A 2DFFA 5KCOA 4KBMB 2UXBK 1FJLA 3M7GA 2P5LC 4IXCA 1DTTA 1SC7A 2DLLA 1BA5A 3IV5A 4ENNA 3CJ9A 1QCOA 1K73R 1T0FC 4P9FA 3RMCA 1QVGP 2AZSA 3CQ8A 3ZFJA 3HGYA 3CC4N 3CJ1A 3E6DA 3QICA 1FZPB 4A62A 5IOZA 3BDPA 2L7KA 4CW7B 4FOIA 3RSEB 3FZMA 3HPOA 2KRMA 1ZQ1A 2L8DA 4EA5A 3E9FA 3QJYA 3NTHA 3GYHX 3HP6A 5KQDA 3VQ8A 2WAQN 3EFRA 4H5TA 4XU0A 3J7ZO 3ONQA 1MV0B 1BIBA 2YRCA 1UWBA 2OUMA 4MTDA 2DAQA 3QPHA 4PGGA 4AVZA 3LSRA 4H4MA 5GPCA 4NLBA 2I7NA 3E2UA 2NUPA 4A6EA 4C92G 4B1XB 1IZ1A 1ERDA 3KLFA 5GMKj 1ZSZC 2JTFA 1FOWA 4Y33A 1VQPQ 1RTDA 2BIVA 4KDPA 1IKWA 5BS6A 2H56A 2VWBA 5EGOA 2ZAEA 1WEIA 2M8EA 2JRMA 1Z6TA 3GFIA 1PM3A 1UJYA 3E5QA 1BL0A 2XKOC 2A7YA 4E3SA 3CMMA 4FM4B 2LCSA 4BE2A 1XNRK 4BUPA 2GLOA 4F52A 2UYTA 3EFOB 1NGBA 2CZ0B 4A3GJ 3MKLA 4W1UA 4FCYA 1QVUA 2XRNA 1WJ5A 4A4FA 4IF4A 4Z4CA 2EGCA 3ZYYX 3RKXA 2EGAA 1NK2P 3UE5A 3CM6A 3C18A 2DVJA 1N36K 2DQLA 2XPWA 1RT1A 3CM5A 4ELUA 3BC8A 5FFXA 2DT6A 5L3CA 1VQ7N 3CO6C 2DF6A 4MIMA 2VE9A 4BD3A 4DUZK 2Z3YA 3MN9A 2LQNA 1T8IA 1VQ8Q 3QYBA 3BR3A 1VQ4T 3GWZA 1WSGA 2ZC2A 1OLTA 2JZYA 3FE1A 1R1VA 3X20B 4DBRA 1WQWA 1DQUA 3QAHA 2DFEA 2FG0A 1WFWA 4I0BA 4FWSA 5CYMA 1QZ6A 1GLLO 4C0DB 5BOXA 3F3XA 1WSHA 1IG9A 4BRMA 1U48A 3BF1A 1VQ6I 1N77A 2FVUA 3THKA 1AU7A 3R2XC 1DIZA 1J5EK 3SPZA 4J00A 3R6OA 5FU7B 3CCRT 1IG8A 3SYTA 4JX6A 4F2RA 5GMKm 2ABLA 1KAYA 4FLZA 2HHWA 3WEEA 3FLGA 3HSTB 3U9GA 4IHVA 3RZDJ 3NH0A 2G0EA 3CC7T 2JUFA 4OFHA 1RUWA 1NOZA 3URGA 3KLEA 4CHUA 3F8FA 2QKLB 4XTUA 1VQ5T 5IT9K 2KVQG 3KYCB 4AYBA 2GCXA 3OR1C 5AQLA 2DYIA 5M3MJ 5FKLA 2M9UA 1VA7A 4C8LA 4ZDOA 2P9KB 1CKAA 3C2HA 4CSWA 4RDUA 3CVTA 4N4IA 1EF4A 3QXEB 2JTMA 3G4ST 3AVMA 5CAIA 2FRHA 1OZ3A 2AQFA 1G6NA 2P5VA 5D4SA 3CBPA 3PVLA 2ZMEC 4E4HA 4FLVA 2F96A 2QWMA 1A04A 3I59A 3O8VA 8AT1B 3NPFA 1E6GA 1JU5C 3WNFA 1IV6A 3FHFA 3HEFA 2OJED 5C4XJ 2Z1IA 3GTOJ 2OA4A 1CGPA 1T8EA 3WT0A 4M7AA 3QOPA 3TR8A 5JLHA 3KLGA 3C6HA 2UXNA 3ABLH 5K5RA 1T39A 4CZHA 3J7AO 5GAN3 3EG1A 3GMEA 4JKDA 2P0WA 2HPIA 3D0PA 2YRVA 4DSLA 2UXCK 1DU0A 4LY7A 4HT8A 3ECOA 4JRPA 1KC8U 3VV0A 4B3MK 2FF3B 3LALA 2DL7A 1NPPA 5JHUA 2E1CA 3VETA 2K7LA 4BREA 1HJDA 1NGJA 2LCLA 1WFXA 5K7HA 3BJ6A 2DFIA 5M5XJ 3LL3A 2YWWA 1VFCA 2BVLA 1RRSA 2A69F 2ZPBB 3ZETB 4OFEA 1MGTA 3L6QA 4IDKA 2BBYA 3DRPA 3SNNA 5F1RA 1T6DA 1TVRA 1N9SA 1J5OA 3M8FA 4BRIA 1N78A 2DFUA 2CQNA 3SHWA 5CR4A 3I55A 2ZKZA 5DCMA 1IJWC 4B3SK 5E3NA 4RBOA 2KT0A 3CFRA 2KT8A 4DQ2A 2FBTA 2QSGX 3MN6A 1GVDA 2IIRA 2VT2A 3ZOBA 2QWNA 4O0IA 3HXMA 4B9LA 2DYBA 2OTLI 2L3SA 4PK4A 2DMUA 3WUHA 1YX5A 2XSJC 2HBMA 5EZGA 3M4YA 4M63C 2DPNA 4B48A 5EG0B 3IAYA 4ELTA 4FWMA 2DN0A 4D8DA 4ZDPA 4V2SA 1ZELA 2FD5A 3C1DA 3OOPA 3QDFA 4NB4A 3BZ6A 1BW6A 1VQLI 4BXXJ 1Q86U 3KLIA 1TC3C 4UY8O 1NG6A 3H6ZA 3VS3A 4Z88A 3CCJT 4CHZA 1VQ5I 3MAJA 2Q0RA 1N9RA 3IRRA 5KN8A 5HCKA 3O6BB 1O57A 6PAXA 4HSRA 3A4CA 4LFAK 1IG7A 4F92B 4BGAA 4IIMA 2FSWA 3I58A 1QMCA 4OMNA 4M78D 2DE0X 2FNAA 2QA4I 3LNQA 3D6RA 3JTHA 2GFUA 5HRNA 2AXLA 3LZJA 2LY1A 2HMIA 1UGSB 2ZGWA 3DLMA 2J5PA 4B24A 4IUTA 1M90R 4DZJA 2ZJQF 3F10A 4F7ZA 1K73C 3DEUA 2KYMA 3LDSA 4NS5A 1XB4A 5F0FA 2EZKA 1W0UA 3J7YP 4BEHA 3CF5L 5FPEA 3HO1A 3RERA 3M8JA 4CJ4A 3LA2A 1TK5A 1EFNA 2IVMA 4CJTA 2QA4N 1WJDA 3MCAB 3TW7A 1M3QA 3OGDA 2BE2A 3TANA 1Z3XA 1H89C 1MH3A 1YJ9Q 4JS4A 4PJLA 4J9CA 2IDOA 4IXAA 3U9DA 2HR3A 1A5XA 4DTSA 1JXEA 3SUNA 2R4GA 1ATNA 1ZH5A 1I07A 4M75D 4LB5A 1D8JA 4B3XA 4FVMA 2A68F 1NK9A 1HX1A 1W36D 2OTJT 1TNSA 2QWRA 3S3NA 3KVGA 5BPLA 2GBYA 1MBGA 4F7UG 2GEMA 4CC4B 2GWKA 4HVVA 3OL3A 1IO2A 2GXGA 3SQ1A 4B6MA 2V51B 5FFZA 5HNHA 4I2QA 2L7FP 3LH0A 3CQXA 3T1AA 3C3WA 4FJNA 4X9CA 1LEBA 2W42A 3IFRA 2ISZA 3OV8A 4BQNA 2OTJQ 2EQIA 3IUCA 2DBKA 1VQMN 1SD7A 4BQLA 1I6HJ 4M42A 5HVQC 4CFCA 2ZQBA 5L3DA 1MBEA 1K6YA 1VIEA 2DA4A 4GY5A 4D9JA 2XICA 2DA7A 1MUYA 3ZR8X 2YKNA 3GLLA 4RLFA 1GV5A 3ZSOA 1RT6A 4B3OA 4FO0A 2E10A 5HLTA 2Y75A 3VB2A 4B09A 1YTAA 3VRYA 4C0DC 1Y64A 2HOTA 1RT5A 1JT0A 3S14J 5KYUA 4JJDA 4GKJK 1YS7A 2LMDA 4FX0A 3P38A 1XPXA 2GTDA 1TNTA 3OW2S 2EFIA 1OULA 1HJOA 4RW9A 3NF8A 2A41A 3IG1A 3PTAA 3MEVA 4LG0B 2ZPIB 2OJ2A 1OH5A 2HOAA 2V1XA 3C7NB 1WHJA 1H641 1NEBA 2RD1A 2KSSA 5EX5A 1HYOA 1QHHD 5D6WA 2EFQA 4EPCA 3SAHA 4JYAK 4M75C 2LP5A 3DXJF 2H3EB 3TAFA 1W9HA 1G3YA 2H6BA 1PWTA 1XGOA 1UAXA 4OFAA 4IOAF 1ORNA 2NLUA 2IW5A 3CFPA 2D8JA 1E3PA 4QPOA 3I8BA 3PFYA 2YSQA 3RPUA 2BEOA 2EIMH 2CW7A 3M0TA 1O7FA 2CYZB 1IDYA 2G9WA 3THXA 1WJBA 1FX7A 1USTA 3M4GA 5HY6A 2DQRA 4EIKA 3FC3A 3L2WA 3H36A 4EW4A 1MUNA 3CXCP 5M5WJ 4HUEA 3VEPA 1P4AA 4BQAA 1JJ2S 4II2A 1EIFA 2DMNA 3BTIA 4H0XB 4DU4A 1SSHA 4A61A 1ZBLA 1VSEA 5JI6A 3ZSZA 1X9JA 3REAB 3CXCA 2VKVA 2D0BA 1VQOQ 3P83D 3QO3A 2Z0WA 4FJ7A 1T56A 1HNZK 2CUDA 2VC0A 2JXBA 4LITA 1T0FA 3SAGA 2IPQX 3LQRA 1C1CA 3HTSB 2YS9A 3MZ8A 2D0NA 4YFKF 2K7AA 3AVBA 2F5KA 4KB0A 3CFOA 1XQHA 2QI2A 1XJWB 3CCMQ 2KQRA 1QQNA 3SMPA 1QZZA 1F1BB 5AYFA 3MCZA 1ZA1B 1RBSA 4LG3A 4CECA 4JAXA 3JCMf 2CGLA 4XBFA 2MSYA 2ZJQL 1MMDA 1JLBA 3LDLA 3QQAA 2CO5A 3P5JA 4Y1DA 3IH4A 4NYNA 3PJRA 4LF7K 1S29A 1G3WA 1M9SA 3MAQA 2M0OA 2QKKA 2E1NA 5D7UA 1Q7YO 2GTOA 3CDIA 2R7SA 1WLPB 4A57A 2P7CB 2M9HA 3QSUA 3T69A 3UPUA 2RH2A 2KJCA 1HQCA 5LJWA 3FB9A 3OYNA 3CCRA 3VEOA 3I0WA 2E2IJ 3NWSA 2Q3SA 4P55A 1YHQQ 3G6EA 3LWHA 5FWCA 4U67L 4A0ZA 2ZMEB 1K8AO 4FHTA 2JG6A 1Z9CA 2V8IA 2H3JA 4E9GA 3BQZA 1ZKGA 3ISNC 4UY8I 2CP3A 2EYXA 2CWEA 2GF7A 4AM6A 2GFAA 5LJ5j 3TO6A 3LYIA 3M0SA 3WG9A 2F4IA 4MZPA 3ZQGA 1XSXA 2F4MB 3NEUA 5HK3A 2ROTA 3BF3A 4IHWA 4UNFA 1G15A 1TAUA 3QWYA 1R59O 3CCUA 2F48A 1B72B 2ZZDA 3OOUA 4OB3B 4HT9A 4O4GA 5E3MA 4A93J 4DTXA 3RR8A 4M7AD 4KIFA 1KU9A 3MWMA 2ZMEA 2E71A 2HEOA 1EXQA 2F9TA 1RL2A 3S41A 5EF6A 5HK0A 1X1DA 2QASA 1YAGA 2MLKA 1N3AA 1X3WB 3QLHA 4UB8C 1XMOK 3EG3A 1LNWA 1M3HA 2O8BA 4FJIA 2WB1N 2DYRH 1HQEA 5AQOA 5GANf 1LJ9A 4CJRA 2R7RA 4FZXC 3TU4K 3O8GA 3OSSC 3QDKA 1OCTC 4CGZA 2HYGD 3F8MA 4M78G 2HDCA 4YTLA 5AZJB 1XG7A 4FK0A 4BAYA 4W5RA 1YI2A 3NCIA 3VEXA 3DCFA 3U6FA 4YORA 4M3XA 3CJQB 1CF7A 4IOAL 3E9OA 1WOQA 2JNGA 4Z8AA 1TKDA 4X65K 5KAIC 1XHZA 2Y31A 4FE7A 1YJNN 3CWAA 1B34A 1OMIA 5KYYA 4LF8K 5J1EA 3AG3H 2JSPA 4AHRA 1HSTA 5GMKl 1L3UA 3CCQN 3CP8A 2LJ0A 1H92A 2YHWA 4J2DA 2A42A 4XTYA 3DI6A 1D1BA 3VWBA 3K9JA 1ZBJA 2IS1A 4N76A 4EMGA 4OMZA 3HB9A 2UXXA 4V2GA 1W0TA 2OTLQ 3QUIA 1K4US 2BZXA 1W5TA 3C0CA 4FXDA 4Z4GA 4X9DA 3I56Q 3PE0A 3PNTA 2JPCA 1I4K1 1ATSA 4CHNA 3NH1A 2EZHA 3VQAA 1WPYA 2RF2A 3QBXA 3RPQA 3CCET 1GCQA 3VS4A 4LIUA 3CD6I 3SZPA 1YQLA 4K25A 2P9SB 5C3EJ 4KHWA 2KPMA 1IAWA 4Z89A 3SV3A 4R1HA 5GAMh 3O2PE 3CC2A 2LF7A 3NAEA 2EA2A 3D2FB 1DP7P 3V7SA 2HGCA 4K0KK 1Z26A 2BY1A 3EUHC 4C92D 2O8BB 2G6FX 3LOCA 2COYA 3QIOA 3H5NA 3GNFB 2VODA 1TP4A 3H0HA 3M1FA 4OMQA 5KPZA 4M7DD 3SCXA 3DBRB 4M3WA 3AO3A 1N33K 2GV9A 1K6OA 4B8CA 3CPFA 2BVMA 1H1VA 2HHQA 2UUZA 3CPWS 5LJ3e 2H1LA 1TXQA 1JJ2M 4ZYGA 4DEYA 3E01A 3CUQA 1QPIA 2HKNA 2ZNZA 1R5ID 2YCHA 5JS1A 1AT1B 2HMPA 4DTMA 2WAEA 4CZKA 1RI9A 1NE8A 2O7OA 2AJQA 3WHBA 2Q1NA 1YBYA 1OCOH 4N9HA 4L0ZB 3CCVQ 5AZIA 4XOTA 3VTIA 3F8CA 3AG2H 3Q9VA 3ZSYA 3CCRI 1F9NA 4AUXA 1Q1VA 4I6MA 4B9UA 2HKQB 3O4WA 4UVBA 3R4KA 4PL8A 2E1OA 4UOBA 3CCEA 2CKKA 2EINH 3M5AA 1A6QA 1XC5A 2EB7A 5LBQA 1Y1VJ 3I5SA 2VKDA 4G9YA 1KIKA 4YOUA 1X4OA 3S8PA 4MEYF 1YVNA 1S1XA 3A1PA 2PUKB 2P9UA 3S2WA 1ENHA 3JYTA 3ERMA 4K8XA 2XAHA 3ULRB 4HHTA 5K14A 3FXKA 1ASVA 3OW2M 3THYA 3CF2A 3VYGA 3SPYA 3I55T 2NS7A 3ZCOA 4J6WA 1ASWA 4G7HF 4FYDA 2QUFA 1D8KA 2V1DA 5BRHA 2DTRA 4J01A 1OYXA 4OMPA 1JE8A 3DLBA 2XVCA 2JVHA 4S04A 5F2RA 4OVAA 2FA5A 3KZYA 4M7DC 3BR1A 1FYNA 2XO7A 2YSRA 2E65A 4A53A 3FSPA 3EGXA 3HBTA 3WXIA 1FP1D 4LSNA 3UF4A 3CCUN 1X9WA 4NXMK 2K9QA 3MXIA 2OU2A 4Z6YA 2PAVA 2RA2A 5H1SQ 4CBWA 4A3DJ 3U8XA 4A3LJ 3EKUA 4QVZA 5GADJ 4A6DA 3M1CA 4BHPA 2K5CA 2WC2A 5GTIC 5IHIA 4HWIA 1U5SA 5C2DA 4BXFA 3L3VA 4HCCA 3VS7A 4IOCL 3M9QA 4LOCA 4HNTA 3HFNA 1W0HA 3VPRA 1MSFC 2X4YA 3DTIA 3AO5A 4IJNA 2EK5A 1TWBA 4Z4EA 5GAOn 2C6YA 1OPKA 1ZBFA 2CH0A 3GPLA 2FO0A 3CCVN 3OL4A 1M1KO 1L3LA 2CT3A 4EJVA 3DRSA 4DSKA 4OKKA 5SZTA 1LE8B 1GBQA 3HOSA 3EN9A 3ASKA 1JGSA 3HJEA 3HI0A 4PKGA 4OF1A 1JCGA 2B0LA 3JCMe 1NK3P 4B22A 5IP9J 2DA5A 2FMYA 1ZG5A 4FLUA 3ENOA 1Q18A 4IHTA 1X43A 2M30A 1EWQA 5AQSA 5J2NA 2EFPA 1DTQA 3KLHA 1ACMB 4CC7A 1T98A 2EJ9A 1BISA 3G3ZA 2G8VA 4WYBA 1FC3A 3TO7A 1LW0A 3HKZN 3NMZC 3ZL7C 3FX3A 1XN7A 1PUFA 1BJZA 1VQ4I 5IN1A 2R7QA 2F6CA 1K76A 3LW5E 1D5YA 4JX4A 5LY3A 3F6OA 1UGVA 1HQUA 2LSOA 4ID1A 5AQUA 2OC6A 4UVCA 4OLBA 3ITHA 4JLGA 2YG9A 5IYDJ 4HQEA 1TK8A 4M6VA 1R71A 1W5SA 1VQ4N 1YFNA 1Y0NA 2E2OA 2GWRA 2A40A 4E6RA 2LKPA 2DMQA 2X6OA 2KQWA 3M55A 4WQ4A 2WY8Q 3EAEA 4I6ZA 1NTCA 4CGGA 1ZGJA 2IXSA 3HRTA 1X1CA 1KD1O 4FLWA 5K1YA 2LSNA 3OQ5A 4PJOB 1QS4A 1M3CA 4BR0A 1QZYA 1E2XA 4G1QA 3SQNA 3FZFA 4BKXA 4E1JA 1I0CA 3RSNA 1EWRA 4M6YA 2MK5A 1UHMA 2NVQJ 2F4OB 5LHGA 2DJQA 4FK4A 3QZ9B 2YV0X 4KBOA 2BKDN 2EGEA 1VYTA 2FNPA 1ZBSA 5C42A 2KL4A 3OMYA 3CP2A 1WEFA 4OPHA 4JPBW 4DV3K 1W4MA 4RGRA 2R7FA 2HFHA 3JAMO 1S9GA 4EM0B 2B8AA 2R93J 2W85A 3R3LA 4P9UA 5JLXA 2CZ1B 2YX7A 1U6ZA 3MKWB 4GBQA 1D8YA 1MNDA 5M3FJ 3L1AA 2CS7A 1GLEG 4HX4A 1A5JA 2EWNA 5LJ3g 3OYFA 4N0AC 4AFQC 5HBMA 2HD0A 4PKIA 2IG0A 3VYSB 4AG1C 2GQVA 1T6CA 4II3A 3CCJI 2ZPFB 2IVNA 4PJMA 2GM4A 4AHCA 4PY5A 3LSKA 3F21A 4JZ3A 3BDDA 1ON2A 1XTAA 2CH6A 1Q86C 2B5JA 5FRMA 1KA8A 1SFOJ 2P0PA 2LBFA 3SJHA 4PKHA 2LX7A 4PNOA 4DB3A 4YOWA 2FPEA 3DLAA 1IJJA 2XHIA 3ID6A 3ZSXA 1VSFA 1YJ9N 4C1NI 5GAHP 3V9UA 1N8RC 4QPQA 1MBJA 3OBYA 4XK8E 1AA7A 1Q82O 4DV0K 1S9EA 2HU9A 4II1A 3AVNA 1U2VA 4JI3K 2V79A 4P5OA 3K4JA 2ZXIA 3FWEA 4DV2K 1C0FA 3ENHA 5TKYA 4NC6A 3S3OA 2J6FA 3OSFA 3VEZA 5FKNA 2H3GX 3ZBDA 1UCRA 3V8KA 4LD5A 2EV0A 3JSPA 3EDPA 3THXB 1AHJB 4UHTA 3CCQA 3T8RA 4GY2B 2K5FA 3NGZA 1C1BA 1BN5A 2JMAA 3F8BA 4A3EJ 1TT0A 3CQYA 3G10A 1WHUA 3VRZA 1NGGA 4IRIA 1G59A 1DP3A 2FSNA 1XGSA 4M78A 3G71N 3PLAA 2IAJA 3J80O 1VQNQ 2QQRA 4BXUA 3VW4A 5LJVA 2ZGYA 4RG2A 2NS0A 5IH2A 5GIPA 3TQNA 5GMKh 4GVEA 2ASOA 2RB6A 1JJ2A 1OYWA 3MEWA 4AT1B 1VQLT 4MDAA 2NOZA 2LNBA 1W7PD 2L0KA 1J6ZA 1M8MA 5EXWA 3JAMK 2X4XA 1ORPA 2V7YA 3D0SA 3VS1A 4WXDA 3GBGA 3A8MB 5D3GA 4DSJA 1FT9A 2ZE2A 2K02A 2Y30A 1KVBA 3G71A 3L1PA 1WHMA 4CZLA 4LDWA 4B1UB 1PD0A 2PEXA 2ZFUA 2EYQA 1GCPA 1VQ4A 4IFVA 2CW8A 1WGSA 2HB5A 2PFUA 4IX7A 4FJJA 2XMFA 2L7ZA 1JJ2P 3HM8A 3SAFA 1MD0A 2NYSA 2P9PA 3A01B 3UNGC 1GLCG 2AP1A 2VUBA 3L7WA 3WTWC 3BCAA 2DX1A 4ZYDA 2A37A 4LUEA 2D0QB 2MI6A 4LDYA 4FPAA 2HBPA 2ID6A 1Z6RA 2FJ1A 3Q7CA 1UA1A 2FZKB 3K57A 4AC0A 3OY9A 4QS7A 1AHDP 5D6YA 2QTXA 4A4HA 5IXFA 1GLBG 4C2TA 4C1NK 1RR8C 1UHCA 4X62K 3M8RA 4OPAA 4W5NA 1NGDA 5HLIA 1AWJA 2VB6A 2G8KA 2FXUA 4I7HA 4ENMA 1Y0UA 1BA0A 3MXMA 1OCPA 2GELA 2NUBA 4UNOA 1ODDA 3ULEA 4CFBA 2HHXA 5FDLA 4FWKA 4NHJA 1IXCA 2OFIA 3X2QH 2E5NA 2Q0UA 2NNNA 3FHZA 4N0AA 4M74A 5EYRA 3LAMA 2E41A 2H94A 4JI8K 2KRHA 1VQ7Q 3W6KB 1J9IA 3FZKA 1RILA 5JVTA 1HYZA 2ENMA 1X75C 2CP7A 5HL7L 4NBQA 3H9NA 3OMGA 1K8KB 4A3BJ 4ISFA 2UV1A 4M9ZA 3M0PA 1KHIA 5GAN7 2ME0A 5DCFA 4DFMA 3T9NA 4XMYA 2EV5A 4U0WA 1I3QJ 4GYGA 3AO1A 4DCHA 3QG1A 4LD9K 3CCRQ 2KHOA 1JXOA 4MO7A 4B9NA 2A6HF 4ETSA 2LKXA 1P59A 3OW2A 3LAKA 3T3FA 4PJOD 4F91B 4HZFA 2LBFB 1RZ4A 1C1AA 1WXBA 4FT4A 1VQPN 1NYFA 3KD5E 4FSVA 1R58A 2VT3A 2JA7J 3FXQA 2Z9OA 3CCEI 2AKLA 1RAIB 2V6CA 3GFMA 4BE0A 3FISA 3F0ZA 1SL0A 2GX9A 3P7NA 1EH6A 5C10A 3REOA 4CEQA 5ADXH 2EZLA 4LC9B 2P0KA 4FM0A 5CLSA 1BJAA 3WXLA 1VQ7I 2XIGA 4JYKA 4QQ6A 4ZZDA 2DMTA 2GOXB 1N27A 3VS0A 9ANTA 4KHNA 2V7FA 2JVGA 1HPZA 2NNYA 2Y4YA 1H9GA 4C92B 3PFSA 3KK3A 2HQHA 4PJOC 4BRCA 4LGWA 4G9ZA 1C0UA 1M2OA 2Z2SB 3QERA 4CEBA 3S6IA 2YLCA 3ZQQA 2J5OA 4EFHA 1ZN2A 1NK5A 3U4LA 4K2EA 4CK2A 1M4ZA 1NJXA 1YWOA 1SAXA 2HVIA 3LP1A 3K5LA 1E6HA 1HDDC 1VHXA 4BWMA 1SG5A 4M77F 1S1UA 2RNGA 2E5QA 1NGIA 5H20A 4DIQA 2J4RA 5EU7A 2P5KA 3ZMSA 4D1QA 4E0DA 2FLOA 2VPRA 1ZX6A 2ZXHA 3GBTA 2Z99A 2PJRB 3KX2A 1Q82R 1ITYA 3K1MA 5IP7J 2KY9A 1YRNA 4F3TA 2X48A 4OMMA 1ZGWA 1WZ2A 1L3SA 4MDBA 1XOVA 4FYWB 4DR3K 1K9AA 3LFUA 4RAZA 2XV4S 2L54A 4CEAA 4XKVA 1LWEA 4WQ5A 1VK0A 2V7ZA 3TDUC 4AILC 1PDNC 1BO5O 3I55Q 3EH1A 4BNCA 3A0BC 3KFWX 1O3SA 3O80A 2JSCA 4C5HA 4L9VA 2AKKA 2OTJN 2PG4A 1NKEA 1YRNB 4CJPA 3BY6A 5KQ8A 1V5GA 4CD3A 4BUGA 3MQ0A 1YN8A 4I2PA 1NJIR 5D8LB 2OI3A 2O8DB 4M3YA 3ABUA 2E2HJ 1NM1A 4EMKC 1RDUA 1VQ5Q 2O0YA 2L3RA 4N0BA 4Y7NJ 2ECZA 5CYQA 2DJIA 2VWJA 1WJFA 2KISA 3ROUA 3KUFA 3E1YA 4E9HA 1VQMA 2QKBA 1BM9A 5F1XA 1BU6O 2ZJRL 5LJ5d 2DERA 3CMYA 4E9EA 1KHCA 4LFBK 1PVSA 5DS9A 4RCBA 2OZMA 4M77G 2I7PA 1DEJA 5ADXA 3U1DA 4RTUA 1JTXA 3T0YA 2DO3A 3JCMh 2MYSA 4KGVB 1N8RR 1SHFA 2XGDA 1GV2A 3LA3A 1KGSA 4FL6A 1OCRH 4LLLA 3CCLN 3KEQA 1JL2A 5K5OA 1E4GT 3OA6A 4WWCA 2Y9ZA 1PP8F 5C24A 4KTWA 1P9QC 4CZMA 1IGQA 1R00A 4K41A 5DDGA 3QODA 1JL1A 1SL1A 1GFCA 1RABB 4IHSA 4IQJA 4CK3A 5KAFC 1KZHA 1KD1R 4JJCA 1JUPA 3SWNC 3CXCM 1GOAA 1RACB 1ZAOA 2P9NA 2A3ZA 2HTJA 1WDXA 1NG9A 1SEUA 2FBVA 2BHYA 1ZQ3P 3M8QA 5EEHA 5JVGF 1U4BA 4CCOA 3VA3A 4XRSA 1HBXG 4QOZB 1HC8A 2W1OA 2F5CA 2X85A 3H3VK 4A59A 1VSDA 3M3YJ 4QLCU 3DTKA 1PC0A 2Z1GA 2WBNA 1W2BA 4WQ5C 1M1FA 3K5OA 3LGLA 4XIDA 2KKOA 3QYHB 1T38A 3VQPA 4MZTA 2K79A 3KP6A 4F7UE 1R0CB 4AYBN 5F6FA 1S9HA 3ELKA 1H9TA 1MV3A 4XAXB 2E60A 5AQZA 3GTPJ 1NLPC 1BGXT 1ZG3A 4XOPA 3DLRA 3EUKL 4LSLA 5JVHL 4ITVA 2W25A 4FW2A 4PL6A 2DEQA 5BRFA 2DMPA 3CCJA 3BTJA 4X0GA 1XNQK 2BY3A 2NRXA 3LP2A 3D5SC 4AIDA 4HVUA 3GCMA 2LY2A 2W4SA 2F2EA 2EWSA 2R92J 3JCMJ 1SHGA 4DR6K 3V1QA 4XU3A 2HZYA 3QKJA 4VUBA 2BZTA 4JV5K 3HOXJ 3RQIA 1BCOA 1D0XA 2RF0A 1ZYRF 3Q9SA 1PYVA 5EG0A 1PUEE 2KROA 2QWQA 2WAFA 2LTPA 3KZIC 3LSPA 3OYJA 1TOVA 4L8RB 3WTYC 4BL0B 4HBLA 1KG1A 2JQ7A 3V4IA 3ZMUA 1QCNA 4YOYA 2V9PA 2K40A 1PCXA 3GVAA 2BGGA 3WVDB 3E0JB 3DKYA 3TL4X 1RBUA 3LGFA 3AVAA 2ZPHB 3CCLI 3VQDA 2RO0A 3TBIA 2HAXA 3NGIA 1D1AA 3ALYA 2CP6A 2IRFG 3GZ5A 3SEQA 4F16A 1JJ8C 2A6AA 2OTJA 3M0QA 4HCBA 2ZCFB 5GAN5 2BZYA 5JVGL 1YHQT 1P7IA 2OCEA 3CVSA 1VQ6T 3OYKA 3ZEUB 3KYLA 2EKHA 2L9SA 1K4TA 4EHTA 2PYLA 1YQMA 4I02A 5D4RA 1YTUA 1MGQA 1S72T 2K9GA 2WC9A 5IWAK 1HKQA 4CD1A 3FKJA 4FJLA 2KEAA 3SV4A 3SUPA 2IAIA 3DU5A 5ECAA 2HYJA 2DXIA 3P4IA 1XNIA 4J83A 3H9JA 4U88A 4B1YB 4XLAA 3J7AP 4F7UF 3F6VA 3AG1H 5KYXB 2LVSA 4CJUA 4D7NA 2DOFA 2QTVA 1Y39A 5KVRA 3ASNH 1TH7A 3CCLQ 4JKEA 1UAAA 4BDPA 1GLNA 2Q8KA 1JUMA 2EKOA 1N75A 4D7MA 3B6CA 5ICFA 2I0NA 1NG7A 1FSEA 2SRCA 1Z67A 5FLXK 1SKSA 3DBLB 2DOAA 4DFJA 2ID3A 3FZLA 4BI3A 2RNJA 3CO7C 3V42A 5D5XB 2LK2A 5JR3A 3SZTA 4E47A 1E0EA 3S15J 2CUJA 4OIRF 1QA6A 3EG2A 1G2HA 1RDDA 4WCIA 4F7UB 3WE3A 1FBSA 1U49A 2KMTA 2BTFA 4IQ4A 4JK1X 3VTHA 3HPWA 4MDWA 3EG0A 2ZXJA 1SAZA 3DLGA 3OMCA 1LVKA 2DW4A 4AU7A 2O9LA 4Q0BA 2Y90A 2YUQA 4BU2A 2QXLA 1U6GA 4FQGA 3CC2I 3U3YA 1ETXA 2RQVA 4M3EA 2M7AA 3ZT2A 2CUFA 3KCCA 1MKMA 5M1KA 1JUSA 2Y48A 1NYGA 1V4RA 3VN5A 4XH4A 2AIRB 1UECA 3JCMX 1OU8A 4CZEA 1YITA 2H27A 3M58A 3WXKA 1L3VA 1OU9A 1WRJA 4EJWA 2FQ4A 3S1RJ 2X6SA 2VQLA 1XSDA 2HQNA 4GV3A 3G73A 3JW4A 2HDDA 4L5EA 1U0JA 1PU6A 3R0JA 1G8XA 2DPPB 2HXOA 3LSHA 1RR7A 3I56T 1NGAA 1I1GA 4AQYK 3ZGKA 2HBJA 1JXBA 2VASA 2V8KA 4RTXA 1X9MA 1OJLA 3HG9A 3ME9A 1JO8A 3CCMT 3CCEQ 4C3IJ 2IGNA 2YDLA 1L0OC 3LWFA 1IUYA 3MECA 1BR4A 4WXCA 3ZSVA 5J47A 1ZRCA 1JEGA 4DOWA 3MMVA 5LJ5e 1WQ2A 3P8DA 3D2EA 3EHQA 2M5WA 5LLQA 3J80K 2PTKA 5CO7A 1MMAA 3THYB 1RESA 2HSTA 1TQPA 4TSXA 4DF4A 1YIOA 4I2OA 4ESFA 1HR0K 2CP5A 4JI4K 5EOYA 3BPVA 1X3UA 2Q31A 3VQQA 3MDQA 3D4VA 3JCMb 5ERIA 2CZ6B 3VJPA 3C4SA 4BR7A 3CCVI 1L3TA 1NBWA 3Q5FA 4EW0A 2WSEE 3OYLA 2P1JA 2D8HA 1U8BA 1VQ7T 2LCCA 2IA2A 2Z5UA 4J9BA 3WGGA 4L18B 4AIJA 5CKDA 4V19S 5K5QA 4M7AG 4UV8A 2OANA 3JCMQ 5AJ3K 1UB4A 4IZ9A 1N8RO 3SQ2A 1WSEA 2NOIA 1IDZA 2K5IA 4O3MA 4A3JJ 4OP0A 2OAUA 5DM6L 3IMXA 4KISA 3CCUQ 3QU3A 1XTDA 5DLOA 4EJTA 1IRZA 1EH7A 4NNJA 2BE7D 4E7IA 3FMQA 1QZEA 2BW3A 4B9SA 2ECCA 3FMSA 1FTZA 5E3LA 3CMEN 1N3CA 2QGGA 4BQZA 1X4PA 3RR6A 2F2WA 1KG7A 3I5RA 5CYVA 3QIPA 3CBMA 2TDXA 1O13A 3TABA 1BQNA 4C8OA 4AIHA 1YCSB 2E2NA 4NYFA 3SI6A 1GLFO 1RUOA 2KYBA 5F0CA 3CCST 1JGGA 3RNJA 5EY4A 4JP0A 1G99A 4OLAA 1YW7A 3LPTA 3A8GB 5ELZA 4Y15A 2EJGA 4MMLA 3JCMc 3GG4A 3G4SN 2UUCK 2CT4A 2X9HA 3TSPA 4RTZA 2HI3A 3JXUA 2XG8D 2QLZA 3HK2A 3AVLA 4IVNA 3JB9F 4KIGA 2VVKA 4AFSC 4M7YA 1HF0A 3B6PA 4PLLA 3KK1A 1LV5A 4FSSA 2RQTA 3WU2C 2UUBK 4M3ZA 2NOGA 3DXKA 1ACIA 5CVRA 2XAQA 3RMSA 1A5VA 5BMZA 4CJVA 3K2PA 1IKYA 3R61A 4XR6A 2R58A 4NL3A 2P9IB 2YUOA 1N8RU 5AQVA 2B7EA 3CCYA 2PVDB 1VQ8A 4M3RA 2HVHA 5FROA 2P7VB 3AG4H 3RZOJ 5LJ5h 4BGDA 3IAM2 4KHSA 3BG5A 5CHZA 3SD4A 3EYIA 1KVAA 3AGKA 4CJQA 3CTAA 1X2MA 3LQQA 1UG1A 4FISA 3R6SA 2XKPA 3A2FA 5AZJA 1UMQA 3D5RC 1LJOA 2MA3A 4MLHA 2VQCA 3V1RA 2EBPA 3AVGA 3SZGA 3HSFA 3CDLA 4M3BA 3X26B 1FKOA 1D5VA 2FF4A 2FOKA 3SUOA 1J5YA 4KT5C 3FZHA 1TYQA 4GYIA 3K58A 2BH1A 4WQ4C 1D1CA 3OYMA 3H35A 1SPKA 3I0RA 4L59A 1EBMA 4M41A 2K3BA 2WV0A 2F9WA 4PZJA 1BI4A 4C8MA 3NHGA 1ETVA 3OB9A 5E17F 2VCPA 5CZ1A 1BC8C 3KJVA 4ILJA 2CFXA 1HKGA 4FIBA 2VBWA 4JLHA 4YY3K 1GL5A 4U7BA 1R1UA 4XH1A 4CJLA 4HLXA 1IKVA 3MKYB 4DV5K 4DYCA 5LJ5f 1YITN 5CVJA 3QEXA 2GQQA 1MNMC 2X6NA 3S3MA 2LF8A 3HOZJ 2JT4A 4YIFA 5M1QA 4AD9A 2JM9A 4H5RA 4J9EA 3EGUA 1KQ9A 1WH7A 3N0UA 1N25A 1ETWA 4N56A 3B6OA 3L8BA 2DDAA 3O9RA 1VQ9A 4G6TB 2NAZA 1YITI 4PGHA 5KE3A 1Z05A 6AT1B 1ETYA 5FKOA 4CICA 4B9XA 3DLEA 2FX0A 2JUCA 3CCMN 4DR7K 3I0TA 4QSHA 1LB2A 4M7AE 1ZXOA 4AH9A 2GIVA 1DU6A 4JNEA 2YUNA 1KYWA 2XPVA 3H92A 3AVCA 3CYMA 4HDUA 1FJGK 1KAZA 1J75A 4WXHA 1JQQA 2HQXA 5LJ3j 4W5TA 1VSKA 3ZLJA 2DPUA 2LZ6B 1HXDA 3BTCA 2CV1A 1VQNA 4H0OA 1NLVA 2XB5A 2MLGA 3KTQA 1R4MB 3G0ZA 4CZJA 2J05A 3GL1A 4KTZA 1VQOT 3QINA 2DIQA 4F17A 3FK6A 2IS6A 3HHGA 3S32A 1OEBA 2EX3A 3T7ZA 1IXSB 2JMCA 3UB5A 4JEPA 4NXNK 4EEFG 2BE5F 4AFUC 4H0PA 4AMCA 5LGTA 4HKEA 4IFEA 2K3XA 4M7DB 3O3GA 4IPAA 4EJOA 2LTOA 3MPUB 2J6KA 4DR5K 1PP7U 1OISA 5FPDA 4HSTA 1Q7YC 1HKSA 1ITGA 4OB2B 1LPLA 4YOVA 4F55A 1Q95G 4C9YA 4DR1K 1XHXA 3QPSA 4XTVA 3EZWA 3HOWJ 2DT7B 3WNEA 1TSFA 5EZHA 4A63B 4DR2K 4M77C 3N05A 2P81A 3S9HA 2X1CA 2QBYA 5LMUK 4LF6K 1I1JA 2DBMA 1QQJA 1CLQA 2KRCA 3PQKA 4RAGA 4CJFA 1F5TA 4LE9A 5JS2A 1Y57A 1P4XA 5AT1B 3GF5A 4G8XA 3E6BA 2KQ2A 1JT6A 2WSCE 3W0LA 4UUSB 2NZTA 3ULQB 3SXYA 4WFBL 2YUSA 3I56A 3VPZA 4EDUA 5KRTA 3SDGA 1QQIA 1SANA 3OS5A 4RUGA 1B3QA 4XN0A 4CCLA 3BGRA 3TW6A 1RT7A 4YOTA 3KK2A 3QWXX 4XIUA 1VQKT 3D2EB 2W41A 2K3FA 3OYDA 4IBNA 1YWPA 2K85A 3QESA 1HW2A 2GNCA 1T0JA 3KP3A 3U21A 4W5QA 2HKOA 2H8RA 3LSIA 3OSGA 8ATCB 4IWVA 2HS5A 3HUGA 1XC9A 1GLDG 3S16J 4C3HJ 5KI6A 4TVRA 2VWKA 4M7DE 4MFBA 4XQFA 5EVZA 4ZTJA 4M72A 4WX9A 3FMRA 2BW3B 3K9TA 4LLGF 2JUGA 2EV6A 2VOPA 2XY8A 4FLXA 2K2VA 3NVMA 4FJHA 1XSVA 1RKWA 1FEXA 3HSBA 5KE2A 3NDKA 2WAQA 2RREA 3M4OJ 2CGPA 3TSUA 3QJ6A 1GUUA 2YHTA 2QDYB 3OYCA 2RPIA 1QSLA 4RW7A 3PO4A 3W6JB 2YI1A 2ITGA 2CSQA 1DLOA 3RKQA 1YG2A 3CZ6A 3DLKA 4BY6B 2CV0A 1XQPA 1JJ6C 2LT4A 3A8HB 2HOEA 2D5RA 5CVUA 4BRHA 4UXNA 1VNDA 2VI6A 4P1WA 3DKXA 1JXSA 1WAJA 2OPPA 4NZGA 1P90A 3RMQA 3RRHA 2A3SA 2KHMA 2H8HA 4LMYA 3GUDA 3OIOA 2KE9A 1K73U 1RKTA 4UQGA 2IP2A 3GZNB 4IOXA 2PVGB 1YITQ 4I98B 3TO9A 3M6GA 1YIJI 1ZREA 3QYGB 3BWGA 4JS5A 2FMLA 3AFHA 1JB0E 3LAPA 3K0SA 3M3ZA 5AQXA 2KRNA 1X3MA 3ZN0A 3IRQA 3NMUA 2O8EA 4CIGA 5HODA 3DQVC 3Q0UA 3ZN1A 3ZQHA 1GVJA 1RBRA 3G2BA 3CCQQ 1V3FA 2Q36A 3ZQFA 2D0CA 4BVOA 3P8HA 5HDKA 5GAOr 3M5RA 4C92E 4OPKA 3W6VA 3GIBA 5KH6A 2DA6A 4N4NB 3VYRB 4OMYA 1XMAA 2I5UA 1B9FA 1YTYA 3CC7N 3JB9I 2OQGA 1RDAA 4Y3OA 3S6WA 4I09A 1MPGA 3V7RA 3PIOA 1U9OA 2VV5A 4HF1A 3HVTA 3VEYA 4BG9A 4KH4A 1U06A 1SQKA 4A4EA 4GLMA 1QVGS 1W97L 4AHTA 2HOSA 2HL5C 1HUXA 2EJRA 3OYIA 2ZSHB 4JI1K 3CMAA 1QWEA 1M5Q1 2HWVA 2CFOA 4Y13A 4CGJA 2XF5A 1ETKA 2Z16A 4OINF 1RADB 2D45A 3VYHB 2O8CB 2VXDA 2VPLA 1Q7YR 4CBUA 4B9TA 2XB0X 3CJTB 4FJGA 1IF1A 4IJAA 2F5TX 1K73O 4N41A 4BY6C 3B73A 2E4HA 4D5CA 4EIAA 3LDPA 5FLXE 1CSKA 1T03A 1IRXA 2IEKA 4DTUA 1W5CC 4KIBA 1U9NA 5KN9A 2LRQA 3BROA 1FOYA 3KTUA 4BI8B 1K8AC 4DTOA 3DWLE 1TQMA 1SRMA 1IV8A 2EFOA 4ELYC 1S1WA 4IZZA 1M1KR 4HUGA 5HROA 3OW2P 5BN9A 2X4JA 3B6AA 1HNWK 3I8DA 2Y4XA 1LWVA 3H1CA 2HQRA 4A3IJ 1QNTA 1MH4A 5C4JJ 2V52B 2JRTA 3TOBA 1XG1A 2D1VA 2DA9A 2JMWA 2DTHA 1YHQN 3CCMA 1WHGA 1YO5C 5AR0A 5M1OA 1UHWA 5JLFA 4MEXF 3WGHA 3HM9A 4CC2A 5CK9A 1Y7XA 1ZUUA 5T7BA 2RNAA 2P84A 2RN8A 2BUPA 3G71T 1D09B 3T8TA 3E7LA 4EMKA 2RMOA 1HMVA 1RC9A 1QTMA 1YVUA 2F2VA 1N6QA 1IRFA 4HX7A 3KHYA 4DOZA 3WG7H 1RAHB 1YJWA 3L2QA 3WGIA 3TSWA 4RTFD 3GXOA 1J53A 2KZVA 2VYPA 4E1NA 4EATA 2LJ1A 4M3UA 1YHQI 3PGGA 5LHHA 1ZUYA 1C0GA 5J26A 1MJAA 1IXRC 4I99C 2L9RA 4O5BA 1UB9A 2DZ9A 1LFBA 3KFVA 5AQTA 4HX8A 1T44A 3I56I 1QRYA 5D5WB 4JQFA 1MA9B 5BPMA 3SBTA 2J6OA 4BH9A 5BR8K 4OO1J 3X25B 3V9XA 5CQGA 2A5WA 2IC3A 4UUSA 4ZYEA 2E2QA 1QQMA 1XGMA 2D1KA 5GTHC 2RQWA 4R56A 2XRIA 2RHXA 1RGIA 3J80E 3VSLA 1KFDA 3NTKA 4HXJA 1S72Q 2O5RA 2KAFA 5LJ3d 1BI4B 2WBMA 4KA4A 2Y69H 4BJ5C 4AHVA 3MXJA 1R0AA 2UWMA 2HTSA 4CE9A 2WTUA 1ZK8A 4C8QG 1SSFA 5J1RA 4KRTA 4KAZA 1G4DA 3TEDA 1RUNA 2LJ3A 2BDPA 3ZEUA 2P6TA 2PU9B 2E70A 3ECHA 4M75A 4PHTX 1UTIA 5EEAA 3IAS2 2V9VA 5KTQA 4NUBA 3F22A 5L3BA 1FIPA 2GAUA 1YIJA 4YELA 1K9MU 5MLCQ 4OB0B 2WADA 3ZT3A 2F5DA 2KBTA 3ZT4A 2ZM6K 1MDMB 4GV6A 4YFUA 4JKGA 3ZQLA 2VOOA 1UGRB 5DYMA 4EJUA 3O08A 5JHFA 3RI4A 4NLCA 3SEZA 2K9SA 4XL9A 1SF9A 4JKBA 3S2HJ 3PMTA 2GBQA 4B3RK 3F9KA 2QEXT 2BANA 1WSJA 4HW0A 3VENA 2HKXA 4Q48A 2Y1JA 4RAFA 4AHUA 3EQLF 3V8JA 5GAN6 3ULEB 4BRLA 4PL7A 4RB1A 1VQ4Q 4P96A 1AVZC 5J2PA 2YU3A 4MHGA 1B1BA 4KPYA 2Z33A 3VYUB 4HLYA 5E1ZB 3SQ0A 1B8IB 3EGDA 4C0ZA 3U9ZA 4C5EA 2CP2A 1FW6A 1K83J 3QBWA 4KH0B 2YLBA 3RYPA 4N4HA 3U1KA 3TVTA 1PVEA 1VQKQ 5DTDA 4PJ0C 2I10A 3E3VA 4XKCA 3QU6A 2F69A 1YQRA 1FWZA 2ECBA 4LF5K 2QW9A 1S72A 5L23A 5F0HA 3V9ZA 4XONA 3F0CA 3GP8A 2MH2A 4AFZC 4EAHD 4X6AJ 5DM7F 5AN4A 4E9FA 2QDLA 1DPRA 2L89A 2HNZA 2E19A 2KFZA 1WNSA 2P9IA 4PSXA 1K9MO 3B8AX 2RQPA 1XQSC 3OJUA 4ILHA 5J39A 4DV6K 4C8QD 3RTVA 2DOEA 3BP8A 2WUSA 1F36A 4WE1A 1ZSZB 3K1NA 3TAEA 3H46O 1U04A 3LLRA 4A2AA 2ZJPL 1GXQA 3QP5A 1OYYA 3BLYA 2I2LA 3D45A 2HQAA 1WJSA 2YNIA 2IOCA 2ASMA 4KI4A 1K0XA 1UEBA 2DTUA 1BL3A 3T1YK 1F21A 2W0ZA 3M57A 3HVRA 1KRPA 4IUPA 1QVFA 5LL6Z 1TU0B 2A6TA 3HTVA 2JJ9A 4ZH4F 1NK7A 3BOQA 3G1MA 4XLNF 2YHAA 3BR0A 1LDDA 3EEQA 1RIOH 1BW5A 3NFCA 2Q2RA 3DXMA 1UOCA 4MQ3A 5L3GA 2HPMA 2O8KA 4H8KA 1OVYA 4PUSA 3M8PA 2O4XB 1VQOI 4G6QA 3VESA 1G3TA 1W1WE 2FEIA 2X4HA 2JWTA 1RT3A 5LRRA 3L4IA 1A36A 1VSJA 3NWTA 2NVXJ 2JA5J 3BW1A 5IT3A 2XROA 4UUVA 5J4YA 5IT9E 3JCMg 5CVIA 2JWLA 2R5ZB 3JCMd 3QYEA 3BFMA 3P1GA 4FYYB 2CSIA 3RSEA 1I3AA 1WGXA 3UR3C 3RCOA 3FZVA 4OX9K 2V6EA 2V1RA 2D1XA 4IIOA 4PQUA 2KRFA 2VQGA 5M1NA 5GAN4 4J7IA 5DM7R 4F9OA 1D4XA 3LM9A 4DNCA 3CC4T 4EZ6A 4ID5A 4J7FA 3FFKB 1VZ0A 3MMYB 2VC8A 2MCNA 4BI4A 5AQJA 4IKFA 1QSYA 1R22A 4NCAA 2QA4T 4XKBA 2HHSA 4GLKA 3MEXA 1WJRA 3CHWA 3MHXA 2ATQA 2DILA 4DFKA 1X01A 1LDKB 5K7FA 2KRSA 1HNVA 3M9AA 4RW6A 5BNGA 3VFZA 2EYYA 4DQRA 3EFOA 5FW9A 3H0IA 2NRRA 1RBVA 2NRAC 1TUYA 3EETA 4JI6K 3WQTA 1MJBA 2BE9B 3C7JA 4R55A 1ASUA 5FPMA 5C6SA 1TGOA 4XSZF 3WTXC 5FO5A 2YNFA 1WJQA 4C23A 5GAGP 2YUPA 4KULA 4EP4A 2Q0OA 1Y96A 2UXDK 2BY0A 3WTZA 3ABMH 2DJNA 5BR9A 3NAUA 1I5OB 1A6IA 3O3FA 4CJSA 2W57A 3E9PA 1TW2A 2YT6A 3DB3A 2E12A 3VMFB 2HZTA 5C12A 1TUUA 2QTDA 1TTYA 4U0VA 2KDSA 3MP1A 4KO0A 3PX6A 2R57A 1OPCA 1RRQA 4S0HB 2DBBA 1I50J 3K0LA 2D0PA 1Z25A 2L9VA 4ASNA 1JLAA 4LG0A 2O03A 1ATRA 2LLKA 2HNDA 3CMAN 3MZYA 1H3HA 3V1OA 3LPUA 5IHKA 2E5LK 2EVRA 1A35A 3P31A 1SFUA 4WFNL 2Q2EA 1DKGD 3K4CA 2I5WA 3M59A 3U3GA 2FE3A 3UKGA 5LRSA 3SJMA 2QEXI 1FXXA 2R5MA 4F7UA 3JRHA 3S2DJ 3R0AA 1PSFA 3HL2A 1FLIA 3SWNB 4KUMA 1HW1A 1LPQA 1D3BB 3T19A 3HDDA 3EUHA 2JZ2A 1T7PA 5L3FA 2ATCB 4FZZA 2CMPA 1OR7C 5LFAA 4HF2A 4CA0A 5ED4A 4DBQA 5GMKe 2WOMA 1XS9A 2EQJA 1NMDA 5HS9A 3BDLA 4JBAA 5IT9Z 3CJRB 2X3XD 3BY7A 4DMNA 2R7XA 1W7PA 4QT7A 3A1YA 3SFMA 3VF4A 3BUZB 4CEFA 3DM2A 2FUG2 3TOAA 4KFCA 3KLOA 3CC4I 4CDGA 3PFIA 2YR2A 2NRVA 1YLFA 1HLVA 4HRIA 1QLYA 3TP0A 3KP2A 1UFMA 4XM3A 3KEYA 4RB2C 2CV2A 1EJ9A 1WI3A 4CJ7A 1VQ5A 3META 3ZT0A 3PUBA 3U2RA 2W6KA 3V9SA 3SFZA 3VQ5A 3OR2C 5FU7C 5KCMA 3QEVA 1SV5A 3CD6Q 3QRFF 3E6CC 4Z4IA 2D4WA 3IS9A 2E35A 3AAQA 3TTCA 1SD4A 3L2UA 1WAFA 4GKKK 2M45A 4EVIA 1M27C 4F14A 2PNIA 5KPTA 4Z4FA 3DP7A 3FFIA 1YHQA 1C6VA 2B4JA 1ZSZA 5I2MA 2J06A 4EM2A 3IKMA 4HCZA 3TTDA 2YPRA 1LWYA 2XF6A 5GANd 1RLPC 2F5FA 2VG6A 3ZP5A 1O1WA 3NHNA 2JHNA 3O4NA 4CVNE 2XRLA 5J3LA 4BR9A 2HCKA 2AA4A 2QENA 2DAOA 5AQQA 2P9SA 2ZPGB 5HRPA 2DDBA 4EHUA 1BOAA 2PQ8A 3FGUA 2L4MA 2DXUA 4DV1K 1Q9YA 3OYEA 4UC4A 3HOTA 2IGKA 1VQ9N 2D0AA 4DF8A 4JK9A 1B59A 5IOYA 1U47A 2JA2A 1O4XA 3OA9A 4DS4A 3MWPA 2YHXA 2I8DA 3T5XA 1STZA 2M02A 3PM1A 2EYWA 4HF0A 1JBMA 3AVJA 3P39A 3ZQCA 2W04A 2RHUA 1VQ5N 4BY7J 5KHDA 3X28B 3SQ4A 5HP1A 3P9KA 1IXDA 4R5PA 2VXFA 2KXCA 2ELKA 5A2QK 3IUOA 4ATOA 2CUZA 1M2VB 2CH5A 3HOVJ 3VA0A 4ESJA 3QWLA 2E1MB 2W03A 4L5JA 1YIJT 4BC4A 5IP6A 3NRVA 4FWLA 3AV9A 2A36A 2HHUA 1RI7A 3AVHA 1Y0MA 1FBQA 3MP6A 3EH2A 2LY9A 1DJ7B 1G5VA 3CC7A 4B43A 1HD3A 1QVGM 4C8QC 3VGKA 1MUDA 4DQPA 1JKQC 4Y4RA 5HS7A 3CEYA 3KZBA 3FXUA 4QS8A 1QGPA 4XU2A 4GFBA 1TWFJ 2TCTA 3CMAT 3KD1E 4YFNF 3M53A 3CD6T 3K4MA 4CYCB 5FU6B 5J2MA 1NNEA 4NCBA 4L5IA 4XLFA 2SEMA 4JKAA 3VS2A 2JPBA 4C0FA 1SS6A 3G6EQ 3CCSA 2W00A 2W40A 2WTEA 1D5AA 1TYQB 2RKIA 2FF6A 2YX6A 4R79A 4FW1A 3SYZA 3K2ZA 1QVGA 2CSOA 4F3OA 4QVDA 4DQQA 4LK0F 4CZFA 1BQMA 5AQYA 2AT1B 2Z1HA 1T0HA 5IHNA 1LFPA 1I94K 5AQRA 1T3VA 1XD7A 1H8KA 1QZ5A 3CCJN 3OYYA 3KE2A 5GAOq 4O8KA 3PSIA 2RI5A 2RM4A 2OF7A 1O75A 2F4VK 4BVPA 2KDOA 2P0QA 2E2JJ 3H9GA 2HL3A 4MMKA 3MN2A 1W7PB 1AD5A 1HSQA 4CHPA 2BYVE 3AL0B 4DK9A 3CC4A 2BXYA 3K4LA 1YP5A 4PIIA 2K4BA 5E18F 1KC8C 2XHCA 4NDLA 1KD1C 1QHGA 1BUPA 1ZBIA 2IPOB 1D9FA 3DV8A 3JV3A 1ILYA 1U45A 4ZZLA 1OH8A 4RM3A 2H6CA 1HK9A 2H09A 5CKEA 1X69A 1KQSS 5GAMg 2QVOA 1MBKA 2Z1JA 4IURA 4KHYA 1QQCA 1WBBA 3MD2A 4JUVA 3GTKJ 3IHOA 3CMET 2P9UB 3OYHA 3CJCA 1MBFA 1P7MA 1U5TC 1C6VX 4H0YB 5ILVA 3DLLF 3NGPA 4WCEL 1Q81R 2OFKA 4YDUA 4MFDA 2P6SA 4U7DA 1FMKA 3DEWA 2DA2A 3DF8A 1IW7F 4Z02A 3EZ5A 1LFUP 4CHQA 3BJOA 2QWOA 3I56N 1H8AC 4JI2K 2VJIA 2CGKA 2O9VA 4HUFA 4RGUA 5H6QA 1YX3A 3CMAI 1J3TA 3KWGA 1P7JA 1A0NB 3JRFA 1Y07A 3D7EO 5IAYA 2P51A 4N4OB 1V5FA 1M90U 2Q97A 4F2SA 5K7ZA 3LA7A 1TQIA 4DR4K 1WXTA 4Z2YA 4EV0A 3BG3A 4Z0UA 2VYTA 3CJAA 4DSEA 5CKFA 1E7OA 3HRUA 1KQ1A 1Y71A 2M4KA 2E3IA 4J5YA 1KD1U 2X35A 3D1NI 4EMSA 2E1HA 1MBHA 3H08A 2XHBA 2XGCA 3J7AF 1HA8A 5M1FA 3DYAA 2R0QC 2K9MA 2E1MC 1W4SA 2DL5A 3MCPA 3O6WA 5LMNK 2VG5A 4KJZA 3MN5A 4RCHA 2KZZA 3MVPA 4JHDB 1KTQA 2IA1A 3PNYA 3KP5A 3OJSA 3MX5A 5GAMf 1BIUA 3O9UA 2VE8A 1J7KA 1IHVA 2CH4W 2XD0A 5GJWB 2K6DA 4C3JJ 1KJWA 5GAGJ 2LDUA 1GLAG 4HOBA 4N47A 4CCNA 3G0QA 3JB9D 1Z9ZA 2IGIA 3E6MA 5FKMA 1I1SA 1IGUA 2GBZA 3M0UA 3GW2A 2ZD1A 4IG3A 4DFPA 3DU6A 3AAFA 1BWFO 2JWKA 3G71Q 1T6SA 2AHQA 1EV7A 3FHNA 3FXMA 1UHFA 3HOYJ 5EC7A 1AZGB 5AQWA 1ZR2A 3HKSA 5AQKA 2HVQA 3HRSA 4OMOA 4BY9C 5TISC 1S6LA 4J2EA 4ZGEB 2EZIA 3L0QA 4JI7K 2FB7A 3CMEA 3BQYA 3H1QA 2V1UA 2YJFA 1F43A 2ZF5O 1ZHIA 1P2FA 3ZT1A 1HOMA 1VYVA 4GO1A 5CKTA 2LRDA 4EGYA 2QA4Q 5FJ8J 3KEOA 3PUFA 1KO9A 2AHJB 1NK8A 3M56A 2LYCA 1B6AA 3L2ZA 1TUDA 2COWA 3FIFA 2VKNA 2RC4A 3ZPLA 1ZGAA 2V75A 3DBHB 1R49A 1I39A 4XEIA 3CMEI 1B07A 1IRGA 1VQLN 4CH7A 2EPDA 1Z1DA 3G4SQ 2V4JC 1AWXA 4PDKA 5EG2A 3V7CA 3GTJJ 4HAMA 1X2KA 2NOLA 4KGXB 1NK0A 3RMDA 5GANh 2QEXN 4GGGA 1P8ZA 1VQ9I 5KK1A 4CESA 4EMHA 3Q0WA 1SAUA 4H0EA 3TREA 3FJ5A 1OX8A 1R77A 4FVUA 1MSEC 2X6XA 3TSZA 1UJ8A 3JSMA 4LXCA 4C2UA 3I0XA 2FSKA 2Y0MA 4DQ8A 1XMQK 2F7TA 2O8EB 2A08A 2RVCA 3CBOA 1IBLK 2FRWA 1D3BA 2ITMA 3PL8A 2AS5F 1ZUKA 1CF7B 3AA3A 3J7YJ 1BDGA 4L5GA 4JI0K 2IGMA 3WXJA 3CI5A 1R7JA 1TV6A 4ZN3A 4M3GA 1NH3A 3G25A 3VOEA 1S5JA 2HSPA 1QVFM 2VBYA 4C8NA 2HW3A 4HQMA 5GAHJ 5E3OA 5FB2A 5GAMj 4NC8A 2K3YA 1RDCA 3W2WA 1MIJA 4GRIA 4P5NA 2V26A 1BC7C 3A8OB 1I27A 2DMOA 1K8KA 2MC3A 2LQ8A 4EJZA 5TRDA 2QXFA 3AL0C 2VJ4A 3NH2A 5HLHA 4GXOA 1VQ6N 2DRKA 2JW4A 4ENKA 2LH9A 4JLIA 1B9MA 2EBIA 3JCMV 1D0YA 4NCGA 3PV8A 5BPNA 5F1JA 2FHDA 1QQOA 1JTYA 2R7ZJ 4RTYA 4RWTA 2O8FB 2OPTA 3PNWC 1MMSA 1OX9A 1SKRA 4IEJA 1YYVA 3H9QA 4YFXF 2PQWA 3GDQA 3ZETA 2DYSH 4YIRX 1JLFA 1OCCH 4OGCA 4R0KA 3I3LA 2LQKA 2VONA 3LWIA 1TKXA 4FZYA 4HNVA 1QWFA 1IB8A 3PMIA 2E64A 1SFXA 3BR2A 2MG4A 2LOOA 2B86A 1BI1A 1EH8A 1GDTA 3QB0A 1LNXA 2EQMA 5D6EA 3M07A 3W3CA 5A2QE 4FYXB 1FYMA 3WXMB 2KMUA 3C95A 1UZCA 4QWQA 3PO3J 1S1NA 3HRMA 5A0DA 4B08A 3CD6A 3VQ9A 3BG6A 1KC8O 1Q81C 3E19A 4B3AA 1TL8A 1R6RA 2LX9A 2X3WD 2QGUA 2ZSIB 1VIFA 3K4BA 2L9NA 3QETA 2VXEA 5GJVB 4RGXA 2LT1A 2XAUA 1PUFB 3VQCA 3BG7A 1HNIA 3DB4A 3L2CA 3ZEHA 4CGFA 1ZHFA 3UIQA 4FJ5A 1LKXA 2GZWA 4WK8F 1R23A 2K4JA 5ICGA 2G8WA 4IL6C 1NU0A 3QDRB 3CCEN 4A5MA 2EILH 3P9CA 5JLWA 4M7DA 1FYKA 5FU6C 1MWMA 3ZQIA 3R60A 2ZWHA 2NS8A 2W84A 1HW5A 3JR9A 1YITT 3SBGA 4DV4K 1UJ0A 5CQYA 3CERA 2P5OA 1Y1WJ 3AVKA 3I9V2 4ESRA 3CPEA 1X9SA 4MNUA 4CXFA 5KNLA 3CCUT 5GAEP 3LDNA 2AZVA 4BACA 2YXYA 4DSFA 2X4WA 3MZHA 3M8EA 3MEUA 1VSMA 4E7HA 4Q5WA 1OYIA 3UATA 1WJAA 3K5NA 2RHYA 4O8UA 1K79A 3HYIA 4BWJA 1SFKA 2NYXA 4PFOA 2GGRA 1P6RA 4RAYA 5FKKA 3J7ZI 1RAEB 3TTFA 4FYVB 2NLXA 1BI0A 4PFZA 3CXCS 1TWHJ 2VBZA 1RCHA 2CRGA 4LFUA 2NXNB 1M1EB 4J8FA 1K8AR 2CGJA 3GOIA 5GANg 2I5JA 1TLHB 1OI1A 4ELVA 5CPRB 2COZA 1R9TJ 3LAJA 2E3HA 3F8NA 3F5TA 4OMLA 3QEIA 2ZB9A 4PSWA 3B02A 4O5FA 4B8XA 2L2OA 3ZCMA 3SMSA 2QQSA 5A0LA 3TDZC 2G8HA 1WI7A 2GIZA 4CHYA 1VQNT 2FBXA 5FLXZ 1LWFA 4FU6A 2E1YA 2DVEA 5HDGA 3DEEA 2GXAA 3PNVA 4OIPF 3FDRA 3MO8A 4BR5A 1HKCA 3PO2J 2XY6A 3J81E 3A03A 4JD2B 1UUEA 4A3MJ 3VODA 3ZMZA 1VQLQ 5B1BH 2W10A 2COBA 2NWMA 1X1BA 2IBDA 4J6YA 5CQEA 1I81A 1K1ZA 2XK0A 3FXLA 1P92A 4CI0C 1K61A 4JRKA 1ESVA 1YQAA 3CPWP 2M0MA 3ZMTA 1YI2I 1Q86O 3LFKA 2O8CA 3AARA 4M45A 1S7EA 3IKTA 2CH4A 3QEPA 1JCFA 2H8WA 4YPRA 1LWWA 5I3UA 2EIJH 4MGRA 1PU8A 2LG4A 4JJNK 1ZARA 1BR2A 4YHHK 2KKZA 3DKWA 1VQKI 1ABQA 2LFBA 1T3LA 1YJNA 4BY1J 1NM7A 1CXUA 5IYCJ 5TJJA 1NKCA 1IHWA 3SLCA 4CEDA 2X51A 3AO2A 1Y96B 4IHYA 4KNYA 1KU7A 4RMOA 2K3PA 4FSXA 4M6XA 1OH6A 2FPDA 4FWRA 1G2BA 4CIEA 4ZGJB 4KGZB 1R36A 2NUPB 4HCKA 3INZA 2F2XA 4E19A 1B9DA 1BR1A 1XWLA 5HRRA 2B63J 1T3SA 1QP2A 1M30A 3RBBB 2EIKH 4KHPK 2M4GA 2DL8A 3CD6N 3MJXA 3CC2Q 3OYGA 3MEDA 2EHGA 4TV7A 3RKYA 1QE1A 1IO6A 4YRVA 3MK6A 2JHJA 1YW9A 3ZX0A 4JKGB 2ZXWH 2JA8J 1KC8R 2W82A 4QS9A 4BS9A 2E5ZA 1X3NA 1T08B 4HYEA 1FK9A 3DWLA 2E2PA 2P4WA 1NG2A 4QAGA 4FOEA 4M7DF 2O2OA 2RK1A 2HNIA 9ATCB 4B3TK 1BG3A 1YE9A 4C8QE 4LH4A 3H5RA 2QQ9A 1AWOA 3COAC 1UHSA 1OR7A 2OPRA 4B9WA 3N4QA 2QG9B 2LNVA 3R6MA 2OCCH 1KG3A 2DIGA 3K4NA 4NC7A 4W5OA 1ZLMA 3O9SA 1MW7A 2D6FA 4XTXA 2HSEB 3CCVA 1S8NA 2JA6J 4ELZC 2Q1ZB 1SD5A 2XSDC 1U8RA 3ABKH 1B9NA 1AKHA 1YS6A 1YOVB 1BOBA 3S1QJ 5KGWA 2V1NA 2GXBA 3V6DA 5AQFA 4KYWA 3EPZA 2EPFA 2JN0A 2HMAA 2CG4A 5GIOA 1L5UA 3L9FA 4OB1B 2CW0F 1U78A 3ML6A 3JCMP 3SJJA 1O3QA 4CJWA 3CC2N 5D8KB 1BU1A 2QSFX 3UA6A 4KT0E 1VQ7A 4BG8A 4CCHA 1OQYA 2N8GA 1JRIA 3MFKA 5HKCA 5IYBJ 2E4LA 1HPMA 1AKHB 3S1NJ 1RTHA 2E36A 1M3BA 1X6BA 4CCMA 1IKXA 2DU9A 2X78A 3HUGB 4MFEA 3QOEA 2R5AA 3R9PA 4UB6C 1KQSA 2XY7A 1ZYQA 5GANe 4U0YA 2NRTA 2PMZA 3R6NA 1NBEB 1LAWA 3ATVA 4DQSA 3AVFA 3CWSA 2JTEA 1V1CA 2XI9A 5BRDA 1NKBA 1GT0C 3ENBA 3CESA 2QYZA 3ERED 4B4CA 4JKFA 3AHUA 1RI0A 2QQ8A 2QM3A 2ABKA 1RTJA 2CP0A 4MQVA 3PIOF