3OS1A

Pfv target capture complex (tcc) at 2.97 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os1A03
3OYLA 1S9EA 4LSNA 4B8CA 2VWKA 1KHCA 1WSHA 3EY1A 2G8IA 4IKFA 1WJQA 4GY5A 1HMVA 3OYJA 1OYXA 1Z26A 3L2QA 1HPZA 2LCCA 2E6MA 4CJ4A 4CK3A 3SZ2A 2X4XA 3HT3A 3M8PA 4CHNA 3TANA 3K58A 1RT3A 4J2BA 1IKYA 5J1EA 1IKVA 3LALA 3NH1A 3PX6A 1UAXA 3CFRA 3EYZA 4HCZA 4I2PA 4IG3A 5C25A 2PYJA 2GUIA 3P8DA 4BD3A 3VQAA 1EP4A 3ISNC 4CGDA 3KK2A 5J2NA 3HPOA 2DFHA 3DOLA 4R5PA 2P5GA 3T19A 4BWMA 3V4IA 4CHPA 4DS5A 1VSDA 4AHSA 3QO9A 3QEWA 2YHAA 4O5BA 3L2WA 1C6VA 1YTAA 3OYIA 4BE1A 1SL0A 1KLNA 1N27A 2BE2A 4B9NA 1SUQA 3M8QA 2F8SA 4NS5A 2LVMA 1C1AA 4CGJA 4C8KA 4LH4A 1RILA 1VSHA 3NGIA 3V6DA 2OPSA 4QVZA 1H3ZA 2QKBA 2PZSA 1ZYQA 4M42A 3B6OA 4C8MA 4PLIA 3P83D 4RW9A 3TAFA 3V9UA 3LZIA 5C24A 1Y97A 4CJLA 3C4SA 3O3FA 2ITGA 1T03A 2EX3A 4FJNA 4KHSA 3P5JA 3V9SA 2ZD1A 3D45A 1EXQA 4HVJA 5C0MA 4W5TA 3RMDA 4CJVA 3K5MA 4C8LA 3RR7A 3OYDA 2RI5A 4EDUA 1O1WA 1VSMA 4I7FA 1T05A 2G8VA 4OKKA 3PO5A 5D6YA 1RDDA 5CY4A 4M45A 1JKHA 2D5RA 1KVAA 3OYKA 1RI0A 3LX7A 1NK7A 4AHRA 4FJGA 4FJ9A 5FROA 3SQ4A 3TAGA 4C5GA 3DI6A 4CEAA 2JGUA 3QLHA 1HYSA 4CJRA 5I42A 2BKDN 2DIGA 5J26A 2QXFA 4DTJA 1B9FA 1S9GA 2BDPA 4PA1A 1Q9YA 4UQGA 3VQDA 4YNQA 3JSMA 1KSPA 2RJDA 2OYQA 4NZGA 1BGXT 4LY7A 2B4JA 4DF8A 2EQJA 3V9XA 3RMBA 4BDZA 1ASVA 4FVMA 2R7YA 2YNGA 2P5OA 4PUOA 3QESA 2KZMA 1S6PA 4ZTFA 4ELVA 4FM1A 1ASUA 1BISA 4CJUA 1VRTA 1SKSA 2KTQA 1S1TA 1HQEA 4GW6A 2WACA 3PMTA 3DYAA 4BWJA 2O4IA 1IKWA 1RTHA 3LP2A 2HHTA 2X6SA 4GMJB 2X4YA 1BI4B 2B8AA 4O0IA 3SV4A 1NOYA 4DSKA 3RWUA 4Z4IA 1HYZA 3RMAA 3AVBA 4N4IA 4JLHA 4X34A 1RT4A 2G8FA 1WN7A 4DSEA 4DTMA 4FYDA 5JS2A 5KCOA 1LWCA 3BDLA 3QEIA 2YRVA 3P8HA 3KLIA 3NBPA 4FJ7A 1SL2A 5CIUA 2RHZA 3SD4A 4TSXA 4KI4A 4OVLA 2X35A 2IS3A 4KTWA 1QHTA 2Z1GA 4H4OA 3S3NA 4CEQA 2XO7A 3KTQA 1WJRA 3C95A 3IG1A 4CEZA 4FCYA 1RBTA 3AO3A 1VSJA 1OZ2A 1JLFA 4RW7A 3WNHA 3NF6A 4IDKA 3VA0A 3THVA 3VQQA 4CF2A 1R0AA 1F21A 1QE1A 4CJPA 2OPPA 4FK4A 4B9UA 4CF1A 1D5AA 3AV9A 4OPKA 3NAEA 1SKWA 3K5LA 4QW2A 2D0AA 2DFFA 2BUDA 3ZSXA 1ASWA 5HROA 2A1SA 1U45A 2QKKA 2RI2A 4N76A 1W9HA 1NKCA 4FJHA 2E4LA 3DMJA 4BE0A 4DTXA 1RT7A 1SSFA 3VQ7A 4AHCA 3QIPA 4EZ9A 2HHVA 2X4WA 3TAEA 3HPHA 1KLMA 5KCHA 5I3UA 4B9MA 1REVA 3UT1A 2M0OA 4UC4A 1UWBA 1U04A 4E1MA 4OKJA 1OI1A 1EX4A 1KVCA 2YKNA 5SZTA 1VK0A 5DMRA 3KJVA 2MWPA 2VWJA 4B8AB 2LRQA 2XY6A 3TARA 3HVTA 4Z4EA 2XRIA 1LWEA 1QSYA 2QQSA 4DQIA 1NJXA 2K3YA 5HRRA 4DQPA 3NGYA 2F5KA 3PMIA 3DB4A 1U48A 1NK9A 4FU6A 3DRSA 4MQ3A 4E7IA 1FKOA 3LGLA 3CFOA 4ZTJA 3DRRA 2KZZA 3H8ZA 4CEFA 4JS5A 2Y1IA 3NGZA 4IUTA 3EAEA 2DTUA 3FEOA 3QIOA 3F70A 3OVNA 4CFDA 4DTOA 3OA6A 3UWNA 3OS1A 4OGCA 4LD0A 4FL6A 3OYNA 3H08A 3HSTB 1B92A 3PUFA 1RNHA 4QQDA 2XK0A 1J9AA 1NJZA 2MWOA 3SYZA 3OMCA 1RTJA 4FLYA 1TV6A 2IGIA 3K2PA 4QOZB 4E1NA 3NDKA 1WJSA 1FKPA 4KKOA 4RW4A 1HNVA 2F96A 3KK1A 3AVHA 2AJQA 3WNEA 4O55A 3OYAA 4FJ8A 5KE2A 4E3SA 4EZ6A 4FZXC 2FBVA 4FXDA 1TAUA 4IURA 3T1AA 1S1VA 4N4HA 3AVCA 3NNQA 4H8KA 3E9GA 2W42A 1Z25A 3EZ5A 4FLWA 1BHLA 4CHZA 4DFPA 2G8UA 4K8XA 4CK2A 2RO0A 3DLKA 2A1RA 4FM0A 1MHNA 4I2QA 1GOAA 1YT3A 3GOXA 4PL6A 1A5WA 4CIGA 3S9HA 1SKRA 4NYFA 3KLHA 4FJXA 4DF4A 4QQ6A 4GVMA 1NK4A 1BIZA 3G0ZA 4DFMA 1QSSA 3S3MA 4Q5WA 5K14A 1ZBFA 3KK3A 3LZJA 1BI4A 2XDPA 3O8VA 1U49A 4B3OA 3OYMA 3LPUA 4FLZA 1KRPA 1RT2A 2PY5A 2RPIA 4FLTA 4CEDA 1OZ3A 3LP3A 2QQRA 3ZT4A 4PWDA 2DY4A 1BL3A 4OVAA 4IG0A 3NH2A 3HL8A 4FLXA 1JXEA 3OYFA 3HPGA 4M3ZA 1ZBIA 2HHUA 3O4QA 3ZCMA 1UA0A 3CM5A 3HP6A 3PV8A 3LAKA 2B5JA 4O4GA 3AA5X 3ZSQA 3VQ6A 4XIUA 2XY7A 4CEOA 2RHUA 1NK6A 1YTUA 1JLQA 5CYQA 1NK0A 2RJEA 1RTIA 3OYBA 1GOBA 1LWFA 2G3RA 2Z1JA 3NH0A 2E6LA 1D9DA 4B9VA 3ITHA 4M41A 3AO4A 4FK0A 4Z4CA 4BDYA 4I9LA 3MP6A 3V81A 1DTTA 3SI6A 4KO0A 3VQPA 4CF8A 3QINA 3NE6A 1T7PA 4RG8A 2FHDA 4JS4A 5HRPA 3FDRA 3WNFA 1JLEA 4OGEA 1FK9A 2Z1HA 2JZ2A 3F9KA 4CGFA 3NHGA 5J2QA 3PX0A 4KPYA 3TWHA 4A4EA 1DTQA 2NUBA 3ME9A 4DS4A 4FJMA 3DB3A 4C8OA 1S6QA 3C94A 3NF7A 3CEYA 3PNWC 1A5VA 3OYHA 1Q8IA 1ZBUA 3AVNA 4FLVA 1SL1A 3DLBA 5IAYA 4M3UA 3MO8A 1TKZA 5J39A 1WSGA 4CJEA 4M3WA 1KVBA 4BDPA 4E7LA 1HQUA 5FRMA 4JRQA 3OYCA 1TL3A 4B9XA 3SCXA 1TK5A 1G15A 5FDLA 3V1QA 3KLEA 2M1HA 4ELTA 1IKXA 2IOCA 3KIOA 3K5NA 4IUVA 1ITGA 4Z4HA 3QETA 3TABA 2FBXA 4J2EA 1B9DA 3HO1A 3MECA 5HLFA 3AVMA 1U4BA 3SUOA 3MXJA 1ZBLA 2RHYA 1NKEA 4LD6A 4ID1A 3MEVA 2O4XA 2FBYA 4CJFA 3AVJA 3VQEA 2EKOA 4WE1A 2ZE2A 2RHXA 5HBMA 1C0UA 3QBYA 1BIUA 1HNIA 1G5VA 1VSEA 3ASMA 3JYTA 2HNYA 2XHBA 4DU1A 5D3GA 4PQUA 4E7JA 1RCHA 3VQ8A 2BIVA 3OS2A 4CHYA 2RF2A 1NJWA 2RHIA 1TVRA 3NTKA 1WSEA 3I0RA 3LANA 4CERA 4CK1A 4YFUA 4BE2A 2O4XB 1QTMA 3BDPA 2P1JA 4L59A 4Z4GA 1TK0A 2VYTA 3MP8A 2O4GA 2M16A 1RT1A 3VQ9A 3SNNA 3C6UA 2OZSA 3MEWA 5KH6A 2RKIA 3MEAA 2YKMA 3O4NA 3MAQA 2RJCA 2CKKA 4CIEA 2HHXA 3QKJA 1CXQA 1QQCA 2KQ2A 4FW1A 3LDSA 3RRGA 4OLAA 2YHBA 3HVRA 3WNGA 2YNIA 2DAQA 3BGRA 5FRNA 1KTQA 1VRUA 3IS9A 3TR8A 5KRSA 4Q0BA 3L2VA 1W0HA 1WSFA 2L8DA 3VQ5A 4CJKA 2IDOA 3MP1A 1BQNA 1NOZA 5HRNA 1T8EA 1RDCA 2K3XA 1WSIA 1YVUA 4Y1CA 2EFIA 4N4GA 1MU2A 2DFEA 3ZSOA 3OYGA 3KLGA 1L5UA 4F2SA 1JXBA 3META 2XY8A 3PFSA 4DG1A 3V9ZA 2LTOA 4FM2A 2KFNA 4K8ZA 1NKBA 4RG2A 2NLUA 4E0DA 3KD1E 2R57A 4DTRA 3AA2A 1J53A 3LYIA 1RT6A 3CFPA 2Y1JA 3SQ2A 3MEUA 4CJTA 3IRXA 3L3VA 4CJSA 3KKRA 2HHQA 3ZSWA 4CJQA 3CYMA 4M3TA 1HJRA 4CHQA 4DTPA 3AO5A 4CEBA 4QQGA 1TL1A 1S5JA 3TAQA 1LW2A 3ZSVA 2R5AA 2G8WA 3F73A 3RRHA 1N5YA 3K57A 1DLOA 4G1QA 3I8DA 4KRFA 1C0MA 3OS0A 4HHTA 1JLAA 4LSLA 1KFDA 4Y1DA 2RN2A 4H4MA 4W5NA 4IFVA 3LWLA 4NCGA 4JRPA 2ZQBA 3ZT0A 4PY5A 1S1UA 5C6SA 4L8RB 2ATQA 3DOKA 1NJYA 4HCBA 3CG7A 2YNHA 3NTHA 3D0PA 3SPYA 4LH5A 1WGSA 1J54A 3V1RA 3VQBA 4FJ5A 4E89A 4KTQA 2HHSA 1RBUA 3HYFA 5DK5A 3PO4A 5JS1A 3QJ6A 5M9OA 2YNFA 3ZSYA 4B08A 2QK9A 3ZT1A 4CJWA 4IUUA 4B9SA 2E5QA 3V9WA 2VG7A 3SJJA 1JL1A 1A5XA 4CEEA 4Z0UA 3G10A 4EP4A 3ULDA 1QSLA 4CRIA 4CGIA 1RBRA 2Q3SA 4W5OA 1TGOA 1C0TA 2Z1IA 1FXXA 2WONA 3VQ4A 3OY9A 4AHTA 4Q5VA 3LP0A 3SPZA 4KB1A 3LGFA 3QEVA 4B9WA 3FLGA 5KGWA 4HUFA 4C8NA 4ID5A 3FFIA 1K6YA 4DLEA 4DSIA 2JLEA 4OPJA 4FLUA 3SUPA 4DMNA 2FBTA 4PLLA 3OQ5A 3AA3A 4FZYA 3NTIA 1X9WA 2EQUA 1IO2A 4CJ5A 4CHOA 1S1XA 2IG0A 1BCOA 1JL2A 4ICLA 3DLEA 3K59A 1LV5A 3DLRA 1KFSA 2FC0A 1C1CA 4FJLA 1WNSA 4KV8A 4HUEA 2BANA 4AHVA 5HP1A 4DQSA 4J2DA 1RDBA 2HNZA 4CFBA 4DTNA 3Q1JA 1I39A 2OA8A 4NCAA 2HB5A 1XWLA 3DLHA 3HJFA 2P0KA 1JLCA 2PQWA 3TAPA 4OLBA 4HUGA 4KHQA 3KUFA 3DLMA 4DU3A 3LLRA 3AVGA 3AA4A 1BCMA 1VSKA 1QS4A 3LAMA 1D9FA 1RBVA 3MEGA 4KB0A 4IUQA 3FC3A 2EQKA 3SUNA 2R5MA 1EKEA 3QEPA 5KGXA 1J5OA 2WOMA 4OJRA 4HCCA 3U6FA 2HVHA 1U47A 4DWIA 4E19A 4OKEA 4B9TA 2BGGA 1LAVA 3QERA 2VG6A 3OMGA 1C1BA 4I9QA 4CF9A 1SV5A 1XNIA 2D0BA 3VN5A 1XC9A 4CFCA 4KHNA 4CF0A 4DSLA 3QNOA 4M3XA 2L89A 4KHYA 1ZBHA 3T3FA 3KKSA 4MFBA 1EETA 4C5IA 4FK2A 1L3TA 3ASKA 3S3OA 4CECA 3TI0A 5HRSA 4CFAA 1XHZA 1N6QA 3HM9A 1IH7A 3AO2A 3ZEHA 4DLGA 4CE9A 3B6PA 4F8RA 4Z4FA 4DSFA 3U3GA 3AO1A 3VA3A 1UA1A 4QCLA 1X1PA 5J2MA 4AHUA 4CGHA 2EQMA 4B9LA 3MXMA 3MEDA 4KAZA 4KI6A 4W5QA 3OYEA 3V1OA 2D9TA 3ZT3A 4E7HA 3M8RA 4DTSA 3ZSRA 2HW3A 2HVIA 3SV3A 2G8HA 3L2RA 3RTVA 1WSJA 2X6NA 3HXMA 4KHUA 3LPTA 4CCHA 3AVKA 2R58A 3HP9A 2HQEA 4M3RA 1X9MA 1BQMA 2HQXA 3I0SA 4ZHRA 1IG9A 2JTFA 2RJFA 4DFJA 4M3YA 2GF7A 3K5OA 1JLBA 1WLJA 2GV9A 4C5HA 4IFYA 4HTUA 1S1WA 2GFAA 2IC3A 3O3GA 2F8TA 3SQ1A 2DIQA 3SQ0A 4N5SA 5IN1A 2E6NA 3IAYA 4KTZA 4O44A 4W5RA 5EU7A 4FJKA 3O3HA 3M9QA 1CZBA 2X74A 4N47A 1GOCA 1KCFA 5KI6A 1TK8A 1D8YA 1Q9XA 3QNNA 3OB9A 4II1A 4DQQA 1UOCA 4KHWA 1XHXA 1CLQA 4F3OA 3H6ZA 2IAJA 4C5EA 1X9SA 4IBNA 4DSJA 1TKTA 2GBZA 1TAQA 4RW8A 4E7KA 4F4KA 2HMIA 3L42A 1JLGA 1RBSA 1I3AA 5CZ1A 3NF8A 4KFBA 3CQ8A 1RTDA 2KFZA 3VQCA 5C42A 2EHGA 2OPRA 3L3UA 3ZT2A 3PX4A 2LSNA 3LP1A 2B6AA 1LAWA 3A2FA 1VSLA 1XI1A 3LWMA 3QEXA 1TKXA 3QIIA 2VG5A 2ETJA 4CGGA 3OJUA 3KLFA 2PYLA 1HYVA 4KREA 5E41A 5KRTA 4QAGA 2L3RA 4CIFA 4A4FA 1NK8A 4CESA 1L3VA 1L3UA 4IUPA 2D0CA 3MXIA 3OJSA 5SWMA 1L3SA 3E01A 2X78A 1TKDA 2OZMA 3E9FA 4FZZA 4A4HA 3L8BA 2HNDA 5KTQA 5KE3A 5D6XA 1HRHA 1WAFA 3L2UA 2LDMA 5CYMA 2YV0X 3ZSZA 3DLGA 4AILC 3MEEA 4DQRA 3AVIA 1VSFA 2KW4A 4RW6A 2G8KA 5J2PA 3HK2A 5CZ2A 3NFAA 1VSIA 4N41A 3S6WA 1CXUA 3NF9A 4FJJA 4FW2A 4AH9A 3U3YA 3TAMA 3AVFA 4F2RA 3P1GA 3NCIA 3M8SA 4FJIA 1RT5A 4CJ3A 3LH0A 5D6WA 1CZ9A 2P51A 4O0JA 4DTUA 3UIQA 3C6TA 4DFKA 2GFUA 4A4GA 2OPQA 3ALYA 4BACA 2XY5A 1LW0A 3RR8A 3KD5E 1RDAA 1WAJA 3AVAA 3AVLA 3PY8A 5T7BA 3DM2A 3DRPA 2I5JA 4F3TA 4N56A 3SUQA 4ELUA 4DU4A 1NK5A 4NCBA 2HHWA 4NYNA 4J2AA 3RMCA 2RI3A 4EP5A 3CM6A 4Z02A
chains in the Genus database with same CATH superfamily
2XGXA 3OYLA 4BHBA 3EY1A 5CHZA 5CQEA 3IC7A 4NXNK 2X4XA 4XLAA 3LALA 2QSHX 1YIJI 4ILJA 3EN9A 2ZPFB 3OS5A 1EH8A 1VSDA 2IVOA 5KYXA 3QO9A 1YJNT 4V2SA 5AQHA 4JKGB 2F8SA 5LGNA 4C8KA 3Q7CA 1RKTA 2HDCA 3HPWA 1JKQC 3UATA 3P83D 5EOYA 3F3XA 3O08A 4GKJK 3WTVC 1XSXA 2H6CA 4QIWN 1IXDA 2JJ7A 4JKCA 2K9MA 4A0XA 1IRFA 4JI7K 2D5RA 1KVAA 2IPQX 4AHRA 2CH4A 2QWLA 2DIGA 4ENKA 2QXFA 2Q8KA 1KO9A 4PA1A 1Q9YA 2DTHA 5A0LA 1BGXT 3AGKA 3RMBA 3VMFB 3TOAA 3SBGA 4BQZA 1ZSZC 3DYAA 1Z3YA 3VYGA 4IFEA 2K79A 3RMAA 2UUCK 1B8IA 3SD4A 1H9GA 3O9RA 5TRDA 3EH1A 1YCYA 1R0AA 4GYGA 1FOYA 1K73C 2ZGZA 2QKLB 2MIOA 1Y56A 3DF8A 5E8GA 1KD1C 1KLMA 2FPFA 4PCQA 1N3CA 1EX4A 1C0GA 2A5XA 4M73A 2DDBA 1R5GA 2IS6A 3I9QA 4DR1K 3L1PA 5EEAA 2O3FA 1JO8A 3OH6A 2J6KA 1LDDA 1AHJB 3WGGA 1IG8A 1VQ7I 2YWWA 4OGCA 1WQ7A 3PUFA 4E6KG 3KTUA 1K79A 4FLYA 1MBGA 2IW5A 1HDDC 1QZYA 1ZLKA 3NVKA 4UY8I 1HNVA 2AJQA 2DE0X 3CC2Q 5L3GA 4I09A 4FZXC 3R6MA 1PU8A 4OF1A 3CCUN 4HLXA 2H3EB 3FX3A 1MHNA 1GOAA 2JK3A 3DCFA 2OUMA 1UB4A 4BROA 1ZARA 2NYXA 4FLTA 2DA7A 1KQ8A 2DY4A 3HL8A 2CUZA 3D2FB 3O4QA 2MA3A 2L9VA 2UXXA 2DN0A 1E3OC 2O8DA 1B3QA 3BDUA 1M3HA 1WI3A 1N8RC 2O03A 3QINA 4X66K 2ZJQL 4CYDA 5HRPA 1FK9A 3LFKA 4JAXA 3C6HA 1ETVA 3G7ZA 2IA2A 2JA5J 1K76A 1TKZA 2CJJA 2NRTA 4EATA 3GNGA 4C2UA 3V1QA 3U9GA 2M1HA 4KDPA 1IKXA 2CV0A 2IOCA 4LF7K 4QVDA 4Z4HA 2BEOA 4J6YA 3Q0VA 4LK1F 4OMLA 1I1SA 2DL5A 3ESWB 3GFMA 5L3DA 2CGLA 4DV5K 3CCJQ 3VF6A 1LWVA 1RCHA 3VQ8A 2XASA 5FFXA 2Y4XA 2QXLA 2P1JA 2MSYA 1QZZA 4IL6C 4M9SA 4UXNA 1WHKA 1CXQA 2NXNB 3WNGA 1FSEA 2V75A 2DAQA 2O8FB 3OW2S 2VJ5A 4EMSA 1MU2A 4F2SA 1VQ5I 4IZZA 4JHDB 2R57A 4LE9A 2DBBA 4CJTA 1S7AA 2YU9J 4QQGA 1ACIA 1GVDA 3LFUA 1DLOA 4CZGA 1TS9A 4KICA 2F5FA 1S1UA 2ETHA 1USSA 1NJYA 3OIOA 3I56T 3KE2A 4A12A 2QSGX 1QHAA 2XGCA 2B0LA 2E5QA 2L7MP 3CP8A 4M75D 5EJCA 2DI3A 1J09A 3VQ4A 2NVXJ 3LP0A 5FU7B 1D1AA 1OYWA 3UPUA 1OQYA 2QGFB 3ZL7C 4M3DA 4IRIA 1N36K 3M5AA 1X9WA 4ICLA 1VQ9I 3DLRA 4MLOA 4OIOF 4OIPF 1KG4A 4CFBA 2JHJA 1ENHA 5IP7J 1P7IA 2DTIA 1PUFA 1YBYA 3TQNA 1H88C 3LLRA 4LD5A 2STWA 2DQLA 4KB0A 3QEPA 1ZHIA 5KGXA 2A5WA 3QYBA 2HVHA 1KC8C 4B48A 2M7BA 2V1DA 1ZG3A 2HTJA 2R7FA 4M75G 3M59A 4CF9A 3VN5A 4BRLA 1GLCG 4AVZA 4F8RA 3GIBA 3HM9A 3CCMI 3VPZA 2EGAA 3I56I 1RRQA 3FM3A 5AONA 4YOWA 4BB7A 3L2RA 2VPRA 2BE9B 5FPMA 4XN3A 3LPTA 3KD1E 4ESRA 1QO0D 2F8TA 2IC3A 3VENA 1IV0A 1HYOA 4N47A 2ISYA 1VQMA 1GVJA 3CTAA 2YRDA 1K8AO 2AXTC 4J7IA 2QWPA 1WJBA 4DSJA 2KMUA 1QVGA 4LC9B 1RRSA 4JUVA 2EHGA 2LX9A 1WWXA 2MAMA 3VEPA 4ZN1A 1EZZB 5B66C 4KREA 2F4OB 3CCSA 4Y52J 4GLMA 3CJ1A 2JWLA 1DT9A 2GCXA 3CMEI 2EFOA 4XLHA 3VEYA 3H3UA 2VN2A 4A4HA 4BQOA 2Y90A 2JVHA 3CCRN 3DLGA 4W1UA 2DOEA 2CZ6B 3BY6A 1QVGM 4F2RA 1MGTA 4BXFA 5D6WA 1I5OB 2GELA 1JTYA 4BGBA 2LR8A 4KBMB 2EJ9A 4XRFA 1Y07A 4BS9A 1J3TA 5T7BA 4DV7K 4EMKB 5EZHA 1VYVA 1NK5A 5KVRA 5KYWA 2QAZA 4NYNA 1WYXA 4B8CA 5AQTA 4MHGA 2A05A 3UA7A 1M90O 4BR2A 2NUPB 3LA3A 4CGDA 1S72A 2DFHA 4XBFA 2E88A 4HZFA 1SHGA 1TG0A 1C6VA 5KNLA 2YX4A 1ZN2A 1DGKN 1VQMN 2YHXA 4CGJA 1VQ4Q 4O5VA 1Q82O 4QVZA 1S5LC 1KU2A 1YJ9T 5LRSA 1NG9A 1ZGAA 3QOPA 5LHGA 1R1UA 5FKKA 3RMDA 3ZQGA 1WH7A 2O9VA 5GANf 3DU6A 4R0KA 4NQWB 5GAMg 4RTVA 1IG7A 1ACMB 1O3RA 2GX9A 4FJ9A 2XIGA 3LX7A 5C3EJ 2FSKA 2M4KA 1B9FA 1FYMA 2PVOB 4M7DD 2XKOC 4BI3A 2P5OA 3FZKA 4FVMA 4J9CA 3AG1H 3CCLI 2FVUA 1M27C 2O4IA 2VPLA 2GOXB 4H4KC 2E1NA 3VS5A 4F55A 1WN7A 1HX1A 1N8RO 2PLYA 4KT5C 2FQ4A 2EWSA 1SL2A 3CCUA 2O7OA 2XO7A 4KH1B 1R9TJ 1MJ9A 1OZ2A 4JI2K 3Q9VA 2F48A 2EZLA 4FJHA 3BROA 2W84A 4JI6K 1UWBA 1KU7A 1JRIA 2P81A 4YOVA 3LSKA 2LREA 1Z77A 3E5QA 4RMOA 1XGOA 1JJ8C 3H5NA 3CCEI 1NJIC 2A37A 4JS5A 1ZREA 2W24A 4Q47A 2E60A 2ZMEC 3F70A 3UKGA 3HC7A 2MWOA 3JV3A 4TVRA 2DA3A 1ERDA 2OJED 2V9KA 2R7ZJ 2VQLA 2HQRA 3MWPA 2ZJ2A 3GEZA 3LSIA 3NNQA 1N9RA 2RO0A 2PMHA 4PL6A 4FJXA 4GVMA 4FX0A 5LJ5f 3QOEA 2OV7A 3JW4A 1PRLC 2XDDA 4OVAA 4M3ZA 1ETOA 2XPUA 3MVPA 4O4GA 5DLQE 5J4VA 2Y30A 4CW7B 2EIKH 3M6GA 1VQ7A 3MP6A 3WTTC 1I81A 3VYTB 1T7PA 4C92D 3FJ5A 3G3ZA 4H5RA 3WVDB 3CCQQ 4FJMA 3NF7A 4B3AA 1A5VA 1ETQA 1YJNN 2A7YA 4CH7A 4UUTA 4FHTA 4ELTA 3ZEUA 3FBIB 4JX5A 1ITGA 1JUMA 3TABA 2FBXA 1GLBG 3AVMA 3BG9A 2Z3YA 3CMAI 3GFIA 3CC7I 2RHXA 1SAUA 1R58A 1JCGA 5B8HA 5BPDA 5FGMA 2BIVA 1NJWA 3BDPA 4A5BA 4LLNA 4CD3A 1OYIA 4IF4A 3MEWA 4IEEA 1HKSA 4JKEA 3JRBA 1R8OB 5FRNA 1W7AA 2O8BA 1MH4A 1H9TA 1RUWA 4FPBA 3CD6A 1YVUA 4Y1CA 3HBLA 3PVQA 2GM4A 1NGNA 3WGHA 2ABKA 4HQMA 1AD5A 2X1EA 1UHMA 5DM7L 4O6JA 1P2FA 3HTSB 1LW2A 4CBXA 5KK1A 2XKOA 4PJJA 4H4MA 4XLEA 4GO1A 1MGQA 2COWA 3ENHA 1JCEA 1D1BA 3NTHA 4LH5A 2UZKA 2NRZA 3QBWA 5JS1A 5M9OA 2UWMA 5M1NA 5EY4A 3TTFA 4BXXJ 2Q97A 1Y1VJ 5HOOA 4P5NA 1N77A 2DTRA 2K27A 3INZA 2Z1IA 1Q81C 3JCMP 1W5SA 3FLGA 1TWGJ 1Z05A 2E7XA 4OPJA 4PJOB 2P5VA 1R4MB 4IHWA 2QQAA 1MBJA 1UGSB 1WNSA 2LY9A 1TUDA 5HP1A 1K7AA 4AFZC 2OFKA 3O9UA 4QS9A 3RQIA 1RPWA 1JQQA 3AA4A 3JRHA 1BCMA 2STTA 3MKYB 4Z4EA 2R5MA 1TC3C 1JXOA 4K42A 2HZYA 2GA2A 4EQQA 1U5TA 2ZJQF 1MD0A 3CD6I 4M63C 1XC5A 2O9SA 4BNCA 2XAUA 4XLCA 4BRNA 4AG2C 4CF0A 1WHHA 2V6EA 4E4HA 4M3XA 1W2BA 3T3FA 1VQKQ 3K0LA 2F2EA 4L18B 1YITA 2HOSA 4QCLA 4PKCC 4CGHA 3UKUA 4ZZLA 4TV7A 4E7HA 2RM4A 3M8RA 2GQIA 1RADB 1VQNN 1BA5A 2M1BA 2XMFA 1Y96A 1RACB 2NNWA 1JLBA 1JEGA 2YSRA 1QVGS 3TO7A 1IV6A 3M9QA 1Q9XA 2DQRA 2LQKA 3A8MB 4XU0A 4F3OA 1XCVA 2XGEA 4HSRA 1W2BM 1U8RA 4WCEL 2ATCB 1MV3A 1D5YA 1LVAA 4DGWB 1I1JA 3CO7C 1QWFA 5GANg 2VV5A 1NGHA 2PYLA 5TKWA 4MMLA 2SRCA 4LDYA 3AL0B 3O9SA 1L3UA 3S41A 4W97A 2B7EA 1J9IA 5D6XA 1U47A 4J9IA 3MEEA 2G8KA 1TW3A 2DNUA 1VSIA 2LJ1A 4KT6A 4A3JJ 4FW2A 3SJHA 1Z21A 2F2XA 3K70C 4R8HA 1JTXA 5I9EB 3AAQA 3EYYA 3H3ZA 4PFOA 4FO0A 2IS1A 4RTZA 3T9NA 2PUKB 2I5JA 1JB0E 4N0BA 2NZTA 4M75B 1AWJA 4AYBN 3JCMV 2LCCA 1TTHB 1YTYA 4J2BA 5B1AH 3TSWA 1V5GA 1JJ6C 4LK0F 4AG1C 4RAFA 4A3FJ 1SFUA 1BUPA 4G94A 3L2WA 5L8RE 2Z33A 2K02A 1B34B 3REBB 5AQIA 3TP3A 4DQ8A 2VI6A 3EGXA 1H3ZA 3L2CA 1YITQ 1XPXA 3VETA 4LF6K 2W85A 4C8MA 1ATNA 3BCAA 2CH6A 1PWTA 1M2VB 4J9HA 3L6QA 4LD9K 2FXAA 1OPLA 3I4MJ 1T3VA 2RVCA 1T05A 2LKXA 2G8VA 2R7UA 4J9BA 2NNYA 2NWMA 4CD1A 4FJGA 4PZJA 4HAMA 3WHBA 3REOA 2DYRH 1P90A 4CEAA 2QBYA 5FB2A 3FXRA 2F9WA 5J26A 1OV3A 1F43A 5ILUA 2W04A 2HS5A 4BDZA 1ASVA 3GBTA 1S6PA 2I0NA 4XKVA 4WCIA 1VRTA 4E7ZA 2E35A 1TQPA 4FWKA 4FISA 4CZJA 4IRGA 4BYYA 2B8AA 3VS4A 2XAGA 3WTZA 1FOKA 2HVRA 4ZDLA 2HKQB 2E2HJ 3TSPA 2CGKA 4RTXA 4EMHA 4B3SK 4A63B 1QCNA 2IS3A 2Z16A 1WEGA 4H4OA 3CC4T 1TUYA 1WJRA 4RW7A 3K9TA 3GTLJ 3VQQA 4CF2A 4F92B 5CKEA 3AT1B 1D5AA 2WAQN 2E5NA 2EW3A 2P9IA 3D6RA 4OIRF 2DRMA 3TAEA 1YJNQ 5I3UA 1ON1A 1U04A 4CZKA 2CH5A 3TMOA 1XTDA 1GHCA 3LDOA 3HVTA 1SKUB 1YLFA 2K9GA 1JT6A 2EYYA 1H8AC 1RIOH 1L0OC 1E0EA 4I01A 4H5WA 2RGVA 3JRZA 3VPRA 2ACJA 3NGZA 1Y0NA 2ABLA 5IT9E 1KG7A 2ZO4A 4LFCK 1RNHA 4DV3K 1BR2A 3RZDJ 2O0YA 2QKMB 2OJ2A 1WLPB 3A5OC 2KGTA 4BVOA 4HDVA 3CWUA 3ZQFA 2EYQA 5AZIB 5DCMA 2K85A 1IDZA 3G0ZA 4Q5WA 3KK3A 3CCVA 1PD1A 1DP3A 4A69C 1Q1VA 5LEKA 1F4KA 3CJCA 1XJWB 4JHDA 4CBWA 5D8LB 2M4GA 4MIMA 2NOJB 3I55I 2CP6A 1JCFA 2YT6A 1GOBA 1QVFP 4JX6A 4XKCA 2WSFE 4I9LA 4KO0A 4I02A 3GPLA 5M3FJ 2DA1A 4M3EA 4A4EA 1ZBSA 3CCRA 4HVUA 3VODA 1IHWA 3MO8A 1WSGA 3I0XA 3A03A 4A2AA 4E7LA 1VQ8I 3MJXA 1VYTA 2A08A 4M7AA 1OCOH 4OMQA 2M34A 4XNFA 1K9MU 2RK1A 2M51A 4C2MJ 1NKEA 2FBYA 3M8EA 3DXMB 4AUXA 4G6DA 3G4SA 1X3ZB 1M90R 2O8BB 2WAFA 2EAYA 4CHYA 1TVRA 4UVBA 4RBOA 2WTEA 2RHIA 3QODA 1M3AA 4HT9A 5IXFA 1RI9A 1NGGA 4L59A 3OWTA 2M16A 2OZSA 4OB3B 1WJDA 2EK5A 2P4WA 1X43A 2X4HA 3HOXJ 1MUZA 3GO5A 1AKHB 2KFZA 1W0HA 1VQLA 1ZGJA 4YOQA 1BQNA 2JW4A 2JNGA 4CCLA 2EH3A 5M3MJ 3HDDA 1F5TA 1YHQI 2MYSA 4M77F 4M7AC 3HZ6A 1RABB 2CQ7A 2RNGA 3CFPA 3L3VA 4EGZA 1LMZA 3HIFA 2VL8A 4CEBA 4LFAK 2P9SB 3F73A 5HLTA 3I8DA 1S7OA 1NLVA 1MV0B 3IAS2 5KAIC 4YDUC 1T2KA 4UVAA 2EZIA 5GAN3 2YNFA 5I2SA 1UG1A 5LHIA 1S72I 4Z0UA 3ABUA 2Q3SA 1Z6RA 2WONA 4XONA 5KGWA 1LEAA 5I2MA 4C8NA 3FFIA 2QGGA 4M72A 5C10A 4FQGA 2G9WA 4FZYA 3U8XA 5L3CA 2WUSA 3K59A 2W0ZA 4MEYF 3I5UA 2JG6A 2K5CA 5JI6A 5F1JA 1Q86O 4YEJA 2ZB9A 4GV3A 1XGNA 4CC7A 1QS4A 4B9QA 1YN8A 1E4GT 5D5VB 2WOMA 4OJRA 3EH2A 1X1BA 1LAVA 2DA5A 1C1BA 2M3AA 1XC9A 2W41A 3LDPA 3FIWA 2R7TA 1PNJA 1P92A 4C92F 2EB7A 2HHXA 1VQ4A 3ZT3A 2NAZA 2V1XA 3RTVA 3CC2A 2A61A 4ZHRA 2EWNA 3BG5A 4ATOA 3K5OA 2A41A 4B1XB 2E10A 3I5RA 2E6NA 1EV7A 2MMPA 4B23A 1YS6A 3DXJF 2DXBA 3QWLA 5CQXA 2CUBA 1M30A 5B1BH 2XB5A 2YRCA 3RKWA 2VXFA 5TISC 1T0HA 1XNRK 4RW8A 2RV8A 3L42A 2MPXC 5CKHA 1NZ9A 3P39A 4HT8A 2KBTA 3LP1A 2LQNA 4Y91A 1VI0A 3QEXA 4PIIA 2FMYA 3UA6A 1OU8A 3H1QA 4IZ9A 3LDNA 2PN6A 3WXIA 1OCPA 2LX7A 5AQLA 3DV8A 4YRVA 5E1WA 1IXSB 2KHMA 2EJRA 3BR5A 4XRSG 1HDPA 5J3LA 3M8SA 3A0BC 4FJIA 3M4OJ 4I6ZA 2P51A 2ZGWA 3C6TA 3CCUI 1AKHA 1LW0A 3AVAA 1MBFA 3C65A 3OR2C 4PJOF 3CMYA 4G12A 4EJZA 4CO8A 2OD5A 4QKUA 1O3SA 4E9FA 1OYXA 2E6MA 4MMKA 3TANA 5H6RA 1JE8A 4YIIA 4IG3A 5E1XA 2PYJA 1XMXA 3ISNC 3BF1A 2OTJT 3HBTA 3T19A 4LF9K 1BI1A 5LLQA 4KYWA 3CJQB 3RIRA 4LH4A 2XU8A 2QKBA 1YJ9N 2P0WA 2Y48A 3E0JB 3KP2A 4N0AC 4BVPA 3CPWM 2VE9A 4C8LA 2RQQA 5H2FC 2RI5A 3RQ4A 2I5WA 3SWNC 4C8QF 2K40A 1M2OA 1R0BG 1BL0A 1HYSA 4J9FA 4JJNK 2BKDN 4N0AA 3FM5A 2PMUA 2B4JA 2FLOA 1HJOA 3W3DA 2FYKA 3LOCA 3JRFA 3H5AA 1GFCA 4F7ZA 2LY1A 3ZETB 2G8FA 3EHRA 1MBKA 2P9UA 3A4CA 2ZBKA 2VXZA 2L2OA 3SFZA 2P9IB 3AY9A 1MDMA 4S05A 2R7QA 3VSLA 4CF1A 3OW2P 1W36C 1J59A 1K73R 2DVJA 3VQ7A 5KCHA 2J7IA 4DQ2A 1B34A 2IAIA 1FLIA 4M3BA 2XY6A 1ZLMA 1KZHA 1KQSM 5KYNA 4OINF 4EIAA 5AFUA 3RI4A 1PRMC 5M5YJ 1OISA 2KRCA 2KZZA 2Y1IA 2Y9YA 4B3MK 3OS1A 4FL6A 3KEQA 3H41A 2XK0A 3WXJA 1J9AA 1KA8A 1UFMA 3D7EO 4L0ZB 4LLLA 3CO6C 1WJSA 4BJ6C 4O55A 3QZ9B 1IREB 1CSKA 2OTLT 2DTZA 2VC0A 3EZ5A 1NMNA 1VQ6Q 3JAMK 1ZELA 3U9DA 4M78D 3S9HA 4IEJA 1KQSA 4M9XA 2AKLA 2CZ0B 3D4VA 1GLDG 3S3MA 1QKXA 3I71A 2ENMA 4YOUA 1BL3A 4M7AD 1OX9A 4HVVA 3ZQQA 1IRXA 1ZBIA 1IV8A 1AT1B 1NK0A 2YCHA 4NNJA 4FK0A 5GAEP 3VQPA 1QP3A 1U2VB 3S32A 3WNFA 1G3SA 2Z1HA 3I0WA 1DTQA 2QQ9A 3KZBA 3QFPA 3P31A 4AWXB 4B22A 4LG0A 1SEMA 3ZYYX 4YORA 1VQPI 2ELKA 4ESFA 4IHYA 4XTXA 3OYCA 5BRFA 2D8HA 4XH4A 3KLEA 5KYYA 4E9EA 4IUVA 1VUBA 1B9DA 1LNWA 3J7YP 1Q7YC 1U06A 3MXJA 2RHYA 1Q95G 2L9RA 3TDUC 2O4XA 3CPWP 1S3XA 5I22A 2M8EA 3SYTA 2HCKA 2HBMA 2ZE2A 1KQ2A 2K4YA 5D3GA 1JJ2M 1HJDA 1VQ6A 2CP2A 3ZMUA 3CC2N 4X6AJ 1TK0A 2AP1A 2NUTB 4GV9A 1YQMA 1UELB 4OLAA 3LWFA 2YNIA 1W5CC 1PVEA 3CMEN 4Q0BA 1T8EA 3MP1A 1TU0B 1K8AU 3PO2J 2A6HF 3DP7A 5LJ3f 2DPPB 1ORPA 3CCRI 1ILYA 3H9JA 3A8LB 1BO5O 3SQ2A 2FSNA 4A93J 5BNGA 2VT3A 3HKZA 3M4GA 3RRHA 3HSEA 1JJ2A 5D4RA 1IDYA 3CETA 2GZWA 4IFVA 4NCGA 3THYB 5C6SA 1J0RA 1K9AA 3RPUD 3CG7A 4H5TA 3VQBA 5H20A 1RBUA 2ZPBB 3KHYA 1NM1A 2WAQA 1Z9ZA 3C0BA 3KBGA 3QO3A 4HV6A 1MDUB 2R7OA 4RLFA 3Q0WA 4CGIA 2GWRA 1RBRA 1TGOA 1BI0A 4C92A 3LWHA 2KJCA 4FLUA 2ASMA 2CYYA 3NTIA 2WB1N 2E64A 4AIJA 5I11A 3EUAA 5ICGA 4RWTA 1BI2A 1N78A 1S1NA 4LMYA 3DU5A 3IQLA 1RBVA 3R61A 3SUNA 3Q3SA 4F04B 4F9OA 4HCCA 1ZSZA 5GANe 1LFPA 2IP2A 3E6MA 3LM9A 2JS0A 4MZMA 2QTVA 2D0BA 2ZMEA 4CECA 1N6QA 4OMPA 3BZ6A 4DLGA 4C3JJ 4L0YB 1UMQA 5M1KA 5BPMA 3ZSRA 2FMLA 1BC7C 3M3ZA 1FYKA 1GFDA 3ZQLA 1K4TA 2HBJA 1R00A 2WSCE 1WLJA 2GV9A 4ENNA 2GFAA 3SQ1A 1B4AA 1PKTA 4K41A 2ZSHB 3MN7A 4B1RA 3ZMTA 1MKMA 2FEZA 3R8EA 4JKGA 3RMSA 5GMKi 3NF8A 1UGVA 4HCKA 4PJOA 1VQOA 5DM7F 4OMMA 3FKIJ 2DXTA 3HHHA 1MNDA 3CUQA 3SZGA 1NGEA 3X28B 2H09A 5DPKA 4CJ7A 4HW0A 2D6FA 4MGRA 2X78A 2OZMA 1AU7A 3E9FA 2ZNZA 2HF3A 5GJVB 3KEYA 5LL6S 4VUBA 2AHQA 1WEFA 4B47A 4FJJA 4AH9A 1W7PB 3IH2A 2MF2A 3AVLA 4DCHA 5GAGP 4KGVB 3J7AY 4F3TA 4A61A 3WEEB 2QEXN 4PSWA 1HCRA 1WSHA 1PM3A 3QP6A 1Z26A 2DPUA 2NOHA 2XAHA 4BEHA 3ZRGA 1EP4A 3BE3A 3OYYA 1WJFA 1DJ7B 3KWIA 1TBXA 4DUYK 1FMKA 1EBMA 2BBYA 1HLUA 1VSHA 3MN9A 2PZSA 4WXHA 1ZYQA 5M1PA 3TAFA 4M3GA 3V9UA 2BXYA 2ITGA 1R1TA 4F7UG 4DZPA 3K2AA 2PFBA 4X65K 4DOZA 4EDUA 3H9NA 1O1WA 1KAXA 5D6YA 2VKVA 5HCKA 3JB9D 1JKHA 2DXIA 3CQZJ 1LEBA 4AM3A 4PFPA 3P9CA 3VSKA 3DBRB 1S9HA 4EIKA 1J5YA 5KPZA 5IT9O 4CZZA 1NG6A 4CZLA 2GQQA 2ELJA 5C2FA 1HK9A 4BY9C 4E47A 1HQEA 2M45A 5J4YA 2NS8A 1ZSZB 2AO9A 1NOYA 3DKXA 2PZ1A 5JICA 4ENMA 2ASPA 5K7ZA 4Z8AA 3N4MA 1N5ZA 2KLAA 1JHFA 2H1LA 1DQUA 2MH9A 3LA7A 3THWA 4QT7A 1PU6A 4S04A 2E41A 1WUAA 1ZR4A 3TOBA 2QKKA 4H5NA 1W9HA 1SFEA 2HHHK 4ME7A 4C3IJ 4Y17A 2MD5A 3UT1A 1WGXA 2M2EA 4V19S 3QSUA 2GXGA 2MWPA 4C3HJ 2ZJRF 2QQSA 3CCVT 4JK8A 4E7IA 3NRVA 3L2ZA 1UJYA 3LGLA 2E70A 3Q9SA 2DYSH 3FEOA 4D1QA 5DY9A 1VRLA 4WFNL 3UF4A 1VYUA 2LSOA 4EJWA 3UDCA 4QOZB 3TVTA 2F96A 4PDKA 3TGNA 3KK1A 5CYVA 1HKBA 4M7XA 4IURA 3T1AA 4N4HA 4EMKC 1D8JA 3F0CA 2KE9A 1GV5A 1B72B 5CKBA 1SKRA 1MSEC 2BW3B 5HLGA 2O88A 5AR0A 2QA4T 4DFMA 2HAXA 1NJIO 5K14A 3OYMA 2VC1A 3ABKH 4CEDA 1ZQ1A 3SMSA 3ERMA 4RKUE 3CC4Q 2OBPA 3K4KA 4LUDA 4CEOA 3CD6N 1HSTA 3NH0A 3SDZA 2DMOA 2MW8A 2VWBA 3QPTA 2A5YB 1OCCH 4PFZA 4DR4K 3MD2A 4JS4A 3PFIA 4X62K 4KPYA 3TWHA 3EETA 3GNFB 2EQRA 1UUEA 3ME9A 3OW2M 1XD7A 3GZ6A 4C8OA 1N25A 4FIBA 4M78B 2DT6A 2Z99A 2XAQA 4RCBA 3IH3A 2OCEA 1HQUA 1VQLT 1G15A 1WKMA 4G7ZF 2NOBA 1VQ9A 1WQ2A 5HS8A 1KQ9A 4XEIA 1A6QA 4QPQA 2QWRA 4J2EA 4A5AA 4MFDA 4DIQA 4XSXF 3MEVA 4YDUA 4IO8A 1X27A 1DU0A 3X20B 2X51A 2Y4YA 1Y8RB 3LSPA 4PUSA 1KAZA 5GAHJ 4ANJA 4CBUA 2RF2A 3LANA 1BU1A 3PSIA 3GZNB 2O4XB 2ITMA 3ABLH 4Z4GA 3IH7A 2RKIA 2CKKA 4FW1A 3QHSA 1QQCA 3Q0UA 3HVRA 4KITB 3MFKA 5BPIA 2GQVA 3OYGA 1Z67A 1QZEA 3SB2A 1BKBA 2OPTA 1J53A 4F93B 2CQQA 1U2VA 4J19A 3OHRA 3K57A 1GLAG 2LMDA 4HHTA 1YP5A 1FN7A 4PY5A 2DEUA 4L8RB 2R7VA 2H27A 3CCUT 4E89A 2VYPA 1VQ9Q 3ZX2A 2UUZA 5IT3A 3O5ZA 2DEQA 2ICWG 2K3BA 4C0DC 4B9SA 3D5RC 2VG7A 1K9MR 3SJJA 4BBSJ 1C0TA 1WXUA 5CAIA 2KLOA 4B9WA 2OQRA 3FXJA 1HKQA 4OMYA 2KXCA 2Q2RA 1IO2A 1QBJA 1RFQA 4F17A 1WHGA 3SFMA 1X3MA 1X9JA 4KA4A 5KN8A 3HJFA 2P0KA 3ECOA 1JLCA 1ZXOA 3IRQA 1Y8QB 3MPUB 2WTUA 1R0CB 4LNPA 1EQYA 3TW6A 1J5OA 1EKEA 3BF3A 1YJWT 4E19A 2QWQA 4UUSA 1WHUA 2P9LB 5JVTA 3TDZC 3K70D 4GXOA 1JI8A 4OMOA 4KHYA 4C5IA 3OIQA 1QZ6A 1X1PA 1BIBA 1VQ8Q 5E8IA 1TLHB 1MW7A 1R22A 2DBMA 2JTEA 2X6NA 3G71I 1QGPA 3EEQA 4HTUA 1CQTA 2UXCK 4W5RA 4LOCA 1VQ9N 1D8YA 2WV1A 1RUOA 4D5FA 4IQ4A 3K4JA 3SJMA 2HMIA 2RQWA 1RTDA 3V4GA 1RDWX 1VQMQ 3VYRB 1ZSGA 3LQRA 1J2XA 3A1YA 2DL7A 2R4GA 3WG9A 2Y2ZA 3QIIA 1XMQK 3VS7A 3ZEUB 1YQAA 4DEYA 2A6AA 2D1HA 5SWMA 3FF5A 2IVPA 4FZZA 4Z6YA 3CCLQ 5AYFA 5KTQA 3ZSZA 1ZUKA 3IRRA 3CCMT 5F04A 3M0TA 4F7UF 1XQOA 4CJ3A 1CZ9A 2H8WA 1RESA 1XQPA 1K8AR 3CC7A 2GUPA 1MZBA 3PY8A 1K8AC 4J2AA 1Z1DA 1KHCA 1N34K 3OH9A 4FK4A 1IKYA 1ESVA 1WCMJ 1WRJA 3I55N 2QG9B 4LFUA 4R5PA 3MK6A 3J7AF 1R5ID 4LIVA 2ROTA 1K73O 1QKWA 1N27A 2X6XA 3VUBA 1KG5A 1A6IA 2DFIA 2UYTA 2VKEA 3LSRA 3B6OA 2O8XA 3HGGA 5K5RA 3LZIA 5C24A 4W5TA 3CZ6A 3V7RA 3E9LA 3EFOB 4OKKA 5M5WJ 1RDDA 4NLCA 5IOYA 1RI0A 1XOVA 3KETA 4BQNA 3G1OA 3E1SA 3L4IA 4CJRA 3U21A 1U8BA 4UQGA 2DA4A 3SMPA 4NZGA 3ABMH 5GAGJ 2DJIA 4HPQA 3C2BA 4KIFA 3VYHB 3RR6A 2QTDA 5TKYA 2KISA 1HYZA 3UB5A 1T6CA 3KCCA 3GTJJ 1IHVA 4NOYA 1S3JA 4BI8B 3NBPA 4FJ7A 3DFGA 4TSXA 1NK2P 5CLSA 2Z1GA 3THYA 1D3YA 3PO3J 2FE3A 3H6EA 1EFNA 3VA0A 3A01B 1WVRA 1YOVB 4D8KA 5A0GA 4AHCA 3QIPA 1M4ZA 4MZTA 1OPKA 4O8UA 2JN6A 3ZQHA 2VVKA 2VUMJ 2EPDA 4EJTA 1HSJA 1FKOA 2IIMA 1AHDP 3ER0A 4ZTJA 4ZYGA 4CEFA 3BY5A 3QIOA 2XIDA 3WQTA 1NG7A 3FK6A 4NHJA 2D5VA 4F91B 4I98B 2E2NA 3K10A 3ZMDA 1KYWA 6AT1B 1J6ZA 1IRGA 5AQSA 4DR6K 1TP4A 3HFOA 5KE2A 1KIKA 2E1OA 1OCTC 1S1VA 3PTAA 3RBBB 4OWRB 3SFIA 4CC3A 4ENJA 5GAOr 5FLXE 1T0FA 4B3TK 2VBZA 2EV0A 2ECCA 4Z88A 4JI1K 1RTIA 2Z1JA 1J7KA 3QUIA 1VQNA 2PMZN 5L23A 3PNTA 4R1HA 3FDRA 4CGFA 4C23A 1Q86U 5A2QZ 2RHKA 1NM7A 3CCSN 3DB3A 3CEYA 1IN8A 1M3QA 5AQXA 4FLVA 4M3WA 3AARA 4DJAA 5HODA 4IOAL 2J4RA 1K61A 1FIPA 1LOTB 3MAJA 2C6YA 4JN4A 5JMVA 2KY9A 2NVTJ 1ZBLA 4JPBW 4O8KA 3SK3A 1IJJA 2QI2A 4RB2C 1IBMK 4GYIA 4PQUA 3ZN0A 2OTLQ 4CK1A 5FU6B 4N9IA 1RUNA 2VYTA 1KEAA 1EJ9A 2BYVE 1YXQA 5EVZA 1Q81O 1XTAA 2KQ2A 1TWCJ 1AWCA 2OANA 3H0FA 4DBQA 4UUSB 3H3VK 2LYCA 4J7FA 1WX6A 3I0TA 2VE8A 1XMAA 2C0OA 3LW5E 4BC5A 3HZJA 4OFEA 1Y57A 1PSFA 2YNHA 4NL3A 1SEUA 1U3OA 2E1MC 2CSQA 1NHAA 1K1ZA 1VIFA 2X1CA 1KG3A 1A5XA 4C0DB 1SANA 4BRQA 3M7GA 1QSLA 3RNJA 1KC8O 4W5OA 1Y39A 4A57A 4KB1A 4MDBA 1K6YA 1N33K 2LH9A 5AQRA 3A02A 2FBTA 2IXSA 3X24B 2Y9ZA 5IHNA 5KQ8A 4CYCB 1K4SA 1YNZA 1RR7A 4OMFB 2BANA 1T38A 2HNZA 2ZWHA 3IKMA 4GV6A 2NRWA 4I2OA 1OKJA 2DZCA 4BR7A 2NUTA 2OA4A 1VSKA 2VUBA 2KT0A 3ID8A 2K3FA 3TTDA 2CUDA 1BWFO 3U6FA 1YFNA 1MWKA 4HF1A 2Y69H 1XNIA 2BGCA 1OMIA 3HG9A 1GCQA 1XG7A 4HVWA 1HPMA 4G8XA 1MDMB 1XHZA 4CC2A 4FE7A 4ZNXA 4DSFA 1IO6A 2L7FP 4RTWA 2XSJC 1K83J 1NU0A 5GPAA 3I9V2 2CO5A 3WUHA 5GP9A 3HRMA 3CVTA 3VESA 2DRKA 3FB9A 1X9MA 5FWBA 4PKHA 4I0BA 3K9KA 1U6GA 1UE9A 3H35A 4LITA 2DIQA 2HKXA 1V1CA 3Q5FA 5CK9A 2ESHA 1BU6O 3AHUA 3PJRA 1CLQA 5J47A 1JLGA 4KGXB 1GXPA 2LSNA 3ZGKA 4XH5A 4YOXA 5IYBJ 3N05A 2XF6A 5KAFC 5LL6Z 2P6TA 1U5SA 4A4FA 1NK8A 1L3VA 4CCNA 1Y7XA 3D7SB 1R4NB 2DPDA 4XTYA 2GOMA 3RMQA 2F5EA 2VXEA 1BR1A 2OTLN 3QFUA 2K9SA 1MMSA 3HK2A 5C2DA 3OL4A 1NYFA 5LHHA 3QRFF 3BZKA 5AJ3K 4LF5K 5FO5A 4DFKA 1K9MC 3UKUB 1BC8C 3DM2A 3BZCA 2DPNA 3JTHA 1Q82C 2FXUA 2RI3A 1ABQA 2KPMA 1LE8B 2QEXT 2F5CA 3HYIA 1K78B 4ZYHA 3OYJA 1ZRFA 2KZVA 1SD7A 3SZ2A 1JKRC 1W6XA 1BI3A 2F69A 1RT3A 3PX6A 1R7JA 3FZVA 1QVPA 4ORZA 4BD3A 1X58A 5DM7R 2WV0A 2M7AA 3GXOA 2VCPA 1F1BB 4LB5A 3W6JB 4IWVA 3EG0A 4YIRX 1C1AA 1NPRA 5GIPA 5JVGF 4ZZDA 1GDTA 5BN8A 3V9SA 1KG6A 3KNTA 2L3QA 1IB8A 4XQFA 4HVJA 3R0JA 2CUEA 1WPKA 4FWSA 1V5EA 3GMEA 5CY4A 2HFHA 3C3WA 3TO9A 4ELZC 2XPVA 3KFWX 1GCQC 3CC2T 2A07F 2OYQA 4BRHA 1Z0XA 2EQJA 5AQGA 4ZTFA 3BLYA 1GLJO 3EG9B 4AM7A 4A6EA 4DNCA 3LP2A 3W3CA 3GZ5A 1LUJB 1W5TA 2E20A 4WQ4A 1AA7A 2BZXA 5LJVA 2I10A 2EKHA 5F2RA 4OO1J 3KLIA 4NC8A 5CIUA 4KI4A 2KQWA 5EGOB 2J6FA 5JLHA 1N3AA 4CICA 4FCYA 1MJBA 1BB9A 4CJPA 4AFUC 2DETA 2RB6A 2H8HA 5LJ3e 5HROA 2P9UB 3PIOF 2IGKA 1SRLA 1QW1A 4BY7J 3CWSA 2HBPA 2K9QA 2Q0OA 1RAHB 5ELZA 1QQMA 2G7HA 2YKNA 1X4OA 2R5ZB 5SZTA 3G6EA 3LQQA 4B8AB 2O8CA 1QSYA 4OFAA 2L4AA 4M77G 3H8ZA 1HD3A 3TTCA 2LF8A 3VF4A 3VRZA 1Q18A 1NE8A 2E2QA 3DXKA 1R36A 2A3ZA 1DPRA 3CP2A 1VNDA 4YOYA 2VGNA 5TGTA 2V9PA 3CUQB 4LJZF 3CCJT 3RDVA 4MEXF 3SWNA 4EZ6A 3R6NA 1O9SA 3E9GA 1SFKA 3IKTA 2ZMEB 2YJFA 4EVVA 2FZKB 4BH9A 3OTOK 3S1RJ 2AQFA 3U2RA 4QQ6A 5C4JJ 3W2WA 1HF0A 3LZJA 3S2WA 2EGCA 4FLZA 2L9SA 2ZXJA 1RT2A 4M77C 2NOEA 3V8LA 2NRXA 4JLGA 3GOIA 2HHUA 2ZAEA 1XG1A 3CM5A 3HP6A 3CJRB 2R7WA 4KBOA 3OSFA 3OYBA 5HL7L 2LNHB 3MKDA 1QA6A 2CDTA 5IPAA 2F1LA 4C30A 5DCFA 5IP6A 1HR0K 1XUPO 3SHFA 4J8OA 2DMPA 5LJ3j 4BEHB 2QDYB 3CCVQ 4FTHA 4DV1K 3SAFA 3QETA 3MECA 2V6CA 2IBDA 2WC9A 2WFBA 4EEFG 4OPAA 5FW9A 4KH5A 3BR3A 4CZHA 1Y6IA 1U5TC 4XLNF 3SHWA 4M78F 3VQ9A 5HLHA 2FRHA 1YW9A 2JSPA 4MFEA 1KQSP 4M77D 3BUZB 1UJ0A 1VRUA 3WG7H 3HOUJ 1QVGP 5GAEJ 4J8FA 3J7YJ 3HSFA 3META 2KJBA 3PFSA 2KFNA 3D2FA 2RF0A 2K9NA 2F5TX 3OBYA 3HRUA 2Y1JA 4Y33A 1BR4A 1VQ8N 4BG8A 3EUHC 5J8CA 1N5YA 3A8YA 1OLTA 4KRFA 4WK8F 1JLAA 1KFDA 3LWLA 4HX8A 3DLLL 2QEXI 1PUEE 4L5GA 1N39A 3G25A 1UECA 4KIGA 4I6MA 2DMTA 4FJ5A 2XI9A 5IP9J 5EC7A 4KTQA 3P9KA 1YJWA 3ZSYA 2LP0A 4RB1A 3QYEA 2YUPA 2YG9A 1ETWA 5DDGA 2Z5UA 1GUUA 2ID6A 3I5SA 3BDDA 4RCCA 2JLEA 2X85A 1KU3A 3HHTB 2EQUA 4CHOA 3E6BA 3J81Z 3VTHA 1XSDA 1AEYA 1C1CA 1JUPA 5F0CA 1RDBA 4L5IA 3Q1JA 1AVZC 2HB5A 2LJ0A 1SMYF 3HSBA 1FBUA 1IJWC 1REPC 4KN7X 1ZA1B 1JXSA 2W10A 2HXOA 3JCMc 4C1NK 4CHUA 1NJIR 2Y31A 2OAUA 4A2BA 3EGDB 2UXDK 3K69A 3ATUA 1M1KO 4MFBA 5BRHA 3TI0A 3ZEHA 3B6PA 3A5LC 2AZSA 5IYDJ 3HUGA 1GXIE 1LDKB 2D9TA 2CQNA 1S72N 5AQWA 3H1VX 2VQFK 4JK7A 2ZPIB 1VQPA 2P9KB 1N6AA 1IG9A 1YIOA 3CLQA 4BR5A 3JCMf 1J5EK 5IN1A 3GP8A 4F52A 2JSCA 3IHUA 4N9HA 2CYZB 3FZFA 2NS0A 1UOCA 1XHXA 2F4VK 2GBZA 3K1NA 2E2IJ 3J7AO 1RAFB 1RBSA 1D09B 2FRYA 3L3UA 1U3EM 2DT7B 2R5YB 3BR0A 4P5OA 5EEHA 1M2VA 5LJ5d 1YJ9Q 1WB9A 3MCAB 2PJRA 2VONA 2H94A 1MUDA 3TKYA 1SVOA 5F08A 1L3SA 4LIUA 4M75F 1UCRA 3VV0A 1B72A 1WAFA 4XU1A 4DQRA 1U9NA 1B59A 2UUBK 6PAXA 3AVFA 3P1GA 4O5FA 1YO5C 4O0JA 2DA2A 5FWCA 3WU2C 2BE5F 1WAJA 5GAHP 1VOMA 4AI5A 4N56A 2G0EA 4BR4A 4LGWA 2NS7A 3RMCA 4EP5A 3CM6A 5C0YA 4C2TA 4LSNA 1W0UA 2YI1A 1T3SA 3M8PA 5J1UA 1XQSC 3TSUA 3F0ZA 3DBLB 4PJNA 2JVVA 5HDKA 3VQAA 2L54A 3OOPA 3GF2A 3DOLA 3I55T 5D6FA 4O5BA 3OYIA 2XDVA 5GAMd 1G8XA 2Q1ZB 2KIQA 1VQMT 3PQKA 4JV5K 2E65A 3ECHA 2QVOA 1Y97A 1I3QJ 2XAFA 2VT2A 4AM6A 3LSJA 1AZGB 2P9LA 3FXOA 1IF1A 3OYKA 2AT1B 4IDHA 2QA4I 4CYCA 3QLHA 3IHOA 3PIOA 3R9PA 5I42A 1S9GA 2RDPA 3JSMA 2LDUA 2FL7A 5HK3A 1KQSS 1H92A 4KIBA 2WA0A 2IGOA 3CC4I 4A6DA 3PMTA 1K8KB 4XM3A 2OI3A 8AT1B 3UE5A 1EA3A 3J80O 3C1DA 4DTMA 2FO0A 4FWNA 5GAN2 2JRTA 2K3PA 3KVGA 3NF6A 1YJ9I 2O8FA 4B9UA 1QLYA 3TO6A 4QW2A 2ZM6K 4N76A 5FPEA 2V52B 2RD1A 4DA4A 2X4WA 5GAMe 3ZR8X 3GVAA 3WTYC 1OQKA 5LJ5e 3JAME 1XC3A 3DB4A 4HA8A 4FYVB 4XORA 3FZMA 2VBXA 1IGUA 1E17A 2E3HA 3W2AA 1HLVA 1APLC 1H8KA 3H9QA 3OYNA 3H08A 3PGGA 2HQAA 3OIPA 3OMCA 2M0MA 2CP5A 4RGSA 1TV6A 5D4SA 3K2PA 4PJOE 2KRHA 2M02A 2RH2A 2IT0A 4EFHA 3WNEA 3OYAA 5C15A 4FX4A 1HC8A 4LUEA 1OH7A 4ZJZA 1QU3A 4RGUA 3F21A 4C0FA 2TRTA 4LDUA 3GOXA 3SEZA 4DF4A 3S8PA 2LTPA 3VYUB 4CXFA 2QWNA 5GAOn 4DV6K 1UA0A 3VUZA 1LWWA 3NMZC 2KYMA 1GL5A 1KQ1A 2X9HA 1S72T 1Q82U 1OX8A 1X6GA 3ASNH 4RGXA 2MI6A 5HY6A 3TU5A 1P9QC 3ZQCA 4IHVA 1XDSA 1G2HA 2F5DA 3L0QA 4EW4A 1FSHA 1FOWA 2HDAA 2CP0A 1QPIA 4JD2B 3T8TA 3G71N 3M5RA 1OVYA 4Y3OA 4B9XA 4C92E 1TK5A 3CCJA 4LLGF 3B8AX 4FPAA 4ISEA 2E3IA 3K5NA 4WYBA 1VQOQ 5BN9A 3HO1A 5HLFA 3BTLA 1VQ4N 3M1CA 3RDIA 3UKRB 5MLCQ 1H1VA 4DYCA 3AVJA 2Y0SA 2X9DA 2L7KA 2NVYJ 1ONVA 5HBMA 2LRDA 2A6EF 3ASMA 2EIFA 1MH3A 1W70A 2HZDA 1N8RU 1QTMA 3D0SA 3O8GA 3UKRA 3H9GA 4JP0A 2ECBA 3MAQA 3O1BA 1RDUA 5F6FA 1I94K 4N4NB 1T0JA 1EH6A 3CMAQ 4IJNA 1RC9A 3PVLA 4KNYA 3ZBDA 1W2BP 4K8ZA 2EFIA 3F8BA 3K1MA 4BRAA 3OA9A 3OSGA 1NMDA 3G73A 1UEBA 4HSBA 2NLUA 5ECAA 1VQKT 4DTRA 1RT6A 3S2DJ 2V26A 1C6VX 4FYXB 2DLLA 4EHTA 3AO5A 2CQKA 2MLKA 1TL1A 3DKYA 5HDGA 1B8IB 1C0MA 3EQLF 3OS0A 4JRPA 3GTPJ 3GW2A 2Q2EB 3TQ7P 4Q48A 1W36D 1V55H 1ZAOA 3QJ6A 4B08A 4JJDA 3CC2I 3IV5A 5D5XB 2OZ6A 3TCJA 1DEJA 1VA7A 1M90U 4QVCA 4I6MB 2HI3A 2HNIA 3MKLA 1P8ZA 2E2PA 3OQ5A 3AA3A 1SS6A 3CPEA 5H1SQ 1WBBA 1T0FC 2EYXA 3ZX3A 4KV8A 5JLXA 2KHOA 2JUFA 2OA8A 4J2DA 3ZOBA 1P6RA 3HHGA 2QSFX 3MEGA 1SAXA 4GCVA 5AQPA 1FTTA 4AD9A 3H45C 5GINA 2VG6A 1VQ6N 4RS8A 3GUDA 1FX7A 5DCMB 2GIVA 2YR2A 3KKSA 1EETA 3OSSC 4FK2A 2KL4A 1D3BA 3S3OA 4LXCA 1CZAN 3I8BA 3NWTA 3E1YA 4CE9A 5EF6A 4EM1A 2HD0A 2ZSIB 5D8KB 3VS6A 2EQMA 3LA2A 4KI6A 2I7PA 4A3IJ 2HTSA 3HKSA 4H5VA 4BQQA 1ZKGA 2QA4A 4V2GA 4JJCA 3TBIA 1S22A 2GF7A 5IWAK 2A6TA 3RESA 3IAYA 1UGRB 1ZYRF 1TWHJ 2GXBA 1G3TA 1KCFA 3NAUA 2QCOA 2COZA 5JVGL 4C5EA 4J6XA 3BTCA 4F4KA 1DIZA 4PJMA 3CDLA 2F4IA 1T39A 2OPRA 3ZT2A 5FD6A 2KI7A 1FBSA 2L4MA 2HMPA 3WQUA 1YQLA 1NGCA 4EVIA 2X4JA 1BJZA 1LOJA 2KRFA 3R6OA 1H89C 5HLIA 1KGSA 4UB8C 3AG2H 1ORKA 3HB9A 4M75C 2FBHA 2LDMA 2LNVA 1NWKA 3VW4A 2KW4A 3VS1A 2LNBA 3G71A 2RQPA 4M7DF 1MNMC 2ZPEB 2DK3A 4BC3A 1ULYA 3FMRA 2MGQA 1XCBA 4BACA 3I53A 3DWLE 5AQFA 4KISA 4DEXA 1CGPA 3DLAA 3CHWA 2HHVA 2DYIA 3DWLA 3VERA 1HMVA 3L2QA 1HPZA 3KEOA 1XSVA 2UV1A 4ON0A 2XRLA 4XSZF 4IHTA 1POGA 4XLFA 5A2QK 3EGXB 2NNNA 4CCJA 2DLPA 3TP0A 4M7DC 1GLFO 2LD5A 1VQKI 1IAWA 2CU7A 1KSWA 2O8CB 5LGTA 5CO7A 2IS4A 3QDFA 2VLAA 2FF3B 1OJLA 2EX3A 1QVFA 4CGZA 1F1ZA 2IVMA 3D45A 4ESBA 2COYA 1ZA2B 4FSSA 4ILHA 2FPEA 2FG0A 4UB6C 4MDAA 2OTJN 2BDPA 4JI5K 1WIEA 1MUNA 1X2QA 2XGDA 4KFCA 1QPMA 5ILSA 3N5NX 1YJNA 1O3TA 4I99C 3GYHX 3TREA 4ELVA 4HQEA 4GW6A 4BWJA 1TQMA 3JB9J 1YITI 4DSKA 2X4YA 4IQJA 1BI4B 5JLFA 1VF9A 2FQ3A 3AVBA 2E5KA 1DGRM 1QVFM 1LWCA 3BDLA 3QEIA 2HOEA 1YI2I 2XICA 1K78A 2K5FA 2DERA 3T8RA 2JM8A 1F21A 3HI0A 1SKWA 2L2PA 2BUDA 4C92C 1ASWA 3VTIA 3CCSQ 2VIXA 2R5YA 4L9NA 3Q7BA 3B6AA 4EM0B 2EGEA 2ROLA 2M0OA 4LB6B 3HJEA 1OI1A 3VU3C 4MO5A 4UOBA 3OOUA 1Q81U 2W82A 1ATSA 5GAOp 1WPYA 2PU9B 3DRSA 3HOVJ 3LH5A 3EAEA 3NHNA 5LGUA 4DTOA 3D1NI 3F10A 2VBYA 2DYBA 1U78A 4I0AA 1YUWA 2VBWA 4E3SA 1TAUA 1ZUUA 2A3SA 3CCRT 3AVCA 1BHLA 4CK2A 3THXB 2W6KA 3FE1A 4JKBA 3QYHB 3BEXA 2JA6J 2WADA 4NYFA 3ULQB 5AQYA 3G71T 5AQMA 3HUGB 1OZ3A 4PWDA 1V4TA 4JBAA 4F16A 4L5EA 3S1MJ 3VQ6A 2XY7A 5ERIA 1O4XA 3O5BA 1LJOA 4M6YA 1WHLA 3QAHA 1DTTA 1NGIA 3NE6A 4B09A 5KYWB 4CVNE 1JLEA 2O8EB 5GAOq 4DS4A 2O8DB 1JHHA 3M8JA 2PTKA 1VQ5T 2OC6A 5J39A 1IC8A 5M5XJ 3QICA 5FRMA 5FKNA 1TL3A 3SCXA 5GAN7 5FDLA 1QHGA 2ID3A 2CS7A 3F23A 2NOZA 2ZXHA 3L00A 4ASNA 1G83A 2DA6A 4FWMA 1B7TA 2KMTA 2EKOA 4U0VA 3THKA 3CQTA 5K1YA 1C0UA 5LMNK 1UZCA 3KLNA 3OS2A 1YQKA 4II2A 1WXBA 1EWRA 4XTWA 2O4GA 2M9HA 1PUFB 1HKGA 4CIEA 3HL2A 2DK8A 1FC3A 3I4PA 5E3NA 4A5NA 2AK5A 1KTQA 4JKAA 4G7HF 3L2VA 3CC7T 1NBEB 1G3YA 2K3XA 3MKWB 5AIPA 2XY8A 4JZ4A 4DG1A 2OTLI 4M4ZA 2DCEA 4A4KA 3F6OA 1BG3A 2XROA 1IZ6A 3LYIA 4M3TA 4F14A 4DTPA 4FWLA 2SEMA 2O9LA 3LL7A 4XK8E 2D0OA 1LKXA 1UAAA 3N5BB 1FBQA 2JS2A 3ZT0A 2HL3A 3C7JA 3FBNB 2FF4A 2K2MA 3R1XA 5DUIA 3QYGB 1JGGA 4CJWA 3VS3A 4M7DB 1QQNA 1JL1A 1VTNC 3G10A 4CRIA 3CBMA 1GLNA 2HXIA 4AHTA 4FT8A 2ZXWH 1YS7A 2CRGA 3I59B 3M55A 2FF6A 5LBQA 3NMUA 2MFZA 4E70A 2JT4A 4IIOA 1V3FA 2PQWA 4OLBA 4KHQA 2ZPGB 5EXWA 3KLOA 1VQ7T 5GAMf 1LCKA 2EQKA 2XSDC 2VQGA 3ZQ7A 5A0DA 2A69F 2NOLA 1QMCA 1F36A 3QERA 2YHTA 4KHNA 4DSLA 5DUKA 5F1RA 1ZBHA 2BOLA 3CQYA 1XMOK 3CCJI 5ICEA 1FJGK 5C12A 3IWZA 2FRWA 5IXBA 3FK7A 3PT9A 4KHUA 4CCHA 2R58A 3JCMh 4FWRA 2ZJPF 1BQMA 3ERED 2P6SA 2AIRB 3PFYA 5CVUA 4J01A 1QQJA 3QBXA 5EX5A 5EU7A 4WQ5C 3GF5A 2QLZA 3IL2A 1SC7A 1TKTA 4JI3K 3TW7A 1TAQA 2K86A 3GLXA 1KD1O 2MOXA 5FU6C 2FPDA 3S15J 2Q0RA 2NUZA 2ZJRL 1QCOA 2L02A 4QAGA 4CIFA 1T8IA 2WWYA 3HRGA 4EJOA 3JB9G 1EH7A 1YHQQ 2W7NA 1BBZA 4V2FA 2PBIA 5LD2C 4FWPA 4D7NA 3CJTB 4I76A 2P0QA 3NCIA 1U1TA 2YX6A 1WJ5A 3CXCA 3ALYA 2DK5A 2RNAA 1Z9QA 2YLCA 3LWIA 5HDNA 1EF4A 2R3SA 2ED0A 2AQEA 2GBQA 2F2WA 1FIAA 2BY3A 5JLWA 1WJQA 3PUBA 4CJ4A 4CK3A 2E34A 4HOBA 2ZFUA 1R23A 1CKAA 2RMOA 2PEXA 2ELHA 1TL8A 3J7ZO 4K11A 4HXJA 4JRIA 3EYZA 2PFUA 1D0YA 1N75A 2P5GA 2RQVA 4AHSA 1AZEA 3ABTA 2JPCA 2NRRA 3S93A 2DZ9A 1BIAA 1TNSA 2F6CA 1VQLN 3NGIA 3DBHB 3EFOA 4AI4A 1E3MA 4YPRA 1FJLA 2XHKA 4CJLA 3C4SA 3FGUA 5E3LA 2CSOA 2DD5A 3CCYA 2VJJA 2BY2A 4I7FA 2V1RA 2L01A 3R2XC 2BVLA 4R55A 2YU3A 3DI6A 1FP1D 4RDUA 2ZNYA 5AIQA 1P4AA 3VQDA 5AQNA 1KSPA 2HZTA 4FASD 5GJWB 2YNGA 3O6WA 1VQ6T 1TXQA 1S1TA 3CF5L 2QBYB 5ADXH 3QPSA 4GMJB 4JYAK 3NPFA 5F1XA 3CPWA 4DSEA 1VHXA 3QPHA 2YRVA 2HYFA 3PL8A 4RTFD 2R0QC 4KTWA 3CF2A 3D5LA 3S3NA 5GANh 4LDXA 3C95A 4CEZA 1RBTA 1VSJA 1JLFA 1NKUA 2P7CB 1RLQC 2I2LA 2OZUA 1T33A 1I4K1 4KULA 3GG4A 5D5WB 1PCXA 4RTTA 1NKCA 4PJ0C 2E4HA 1RT7A 2FX0A 2CT4A 4E1MA 5AQKA 3CMET 1X6BA 4CZMA 3CWTA 4BHCA 2FUG2 4A0YA 3C7NB 1A35A 4DR5K 1NK9A 4D0PA 3S1NJ 4MQ3A 4JI8K 4LDWA 3DRRA 1Q7YU 4C8QE 2GEMA 1RETA 3OA6A 4BC4A 2V7ZA 1I5ZA 4P9FA 2XHIA 3SYZA 4IOXA 2JOYA 5I21A 4C8QA 4OFHA 4DB3A 3AVHA 4FOEA 4A3EJ 3JCMe 1HQCA 1ZUYA 3S6IA 2W57A 5HS7A 1Z25A 3IH4A 2EJFA 2O01E 1K8KA 1U49A 1ZBFA 4JI0K 4D9JA 2RPIA 2KRNA 3ZT4A 1PP7U 2VOPA 4CSWA 3PV8A 3RSEA 2RNJA 2JN0A 3E5XA 4BRIA 3CDIA 4M41A 3O4WA 4EA4A 2RK2A 2NRAC 1YQRA 5KN9A 2FHDA 2X48A 3U23A 4XIDA 4Y13A 3I33A 1P4WA 1ARKA 3HSRA 5KHDA 4HBLA 2CZ1B 4OX9K 3JRAA 2GXAA 1Q8IA 3I35A 2GA1A 1A04A 2CGJA 5LJ5h 1R49A 2EQIA 4Y7NJ 2V4JC 2DA9A 3M58A 5LJ3d 9ANTA 3CD6T 1YX5A 4RGRA 1X01A 3SUOA 2AXLA 1VIEA 3C2GA 3F72A 2DKGA 2LG4A 3MDQA 1OH6A 1OU9A 1VSEA 1WSEA 3BTIA 3GWZA 4IXAA 4E9HA 1RT1A 3C6UA 2A0FB 2LQ8A 3LDSA 3CI5A 4QSHA 3IS9A 5CPRB 1QNTA 4FOIA 1WSFA 4EHUA 3ULEB 3VRYA 5J3BA 3DEUA 2DFEA 3CCSI 3KLGA 2LVSA 2CREA 2RQUA 1NKBA 1O13A 3W6KB 4II3A 5DD8A 4CDGA 4R56A 4B1VA 1S72Q 3MEUA 4CJSA 1EWQA 3FFKB 1IZ1A 3ZETA 2HL5C 3M0RA 2GTOA 3QXEB 2DOAA 4W5NA 4GLKA 1U6ZA 2O8EA 4Y15A 4AFQC 1ZX6A 1MWMA 3D0PA 2FNPA 1J54A 4KH4A 4J83A 3FXLA 3LDLA 3HM8A 2UUAK 5GADP 2H1KA 2OU2A 2W40A 3BOQA 4CEEA 1VQOT 3ULDA 5AZJA 4A54A 4DOWA 1WFWA 2BZ8A 4BRFA 3EUHA 1IN7A 3FJPA 5HKCA 4EV0A 4BUGA 2L3SA 4ID5A 4B21A 3UR3C 2LBFB 2JXBA 2ESNA 3PIPL 1K9MO 2A3LA 2GNCA 1HNXK 2IG0A 3G6EQ 3BY7A 2DT5A 2WSEE 4DTNA 1BOBA 3DLHA 4J9EA 3TAPA 2CV1A 4DU3A 3DLMA 3AVGA 1D9FA 1ZH5A 3C2HA 4XTVA 4FYWB 3OL3A 2FOKA 2YXYA 4BRKA 2QA4N 2P8TA 5K7HA 4IEIA 4DR3K 4B9TA 3IAM2 1SV5A 2JM9A 2PX9A 1KQJA 3RUXA 5LY3A 1KK7A 3E66A 3FSPA 2RN7A 3VA3A 4FT4A 2YUOA 1CF7B 1D3BB 4M3RA 3HP9A 2HQEA 1YIJA 4YG2F 2P9PA 5IT9K 4IXCA 3PLAA 2Q31A 2E7WA 2NOGA 4BY6B 2FBKA 3NEUA 2HDDA 5GMKe 5KI6A 1CZBA 5L3BA 1SHFA 3MEXA 4M78G 3C7NA 2D1XA 2KK4A 4E7KA 4XMYA 3T1HK 5CZ1A 3HRTA 2HSTA 1OCRH 2VODA 1I0CA 2UXBK 2A68F 1M90C 4FETA 3R0AA 3HTRA 3BG7A 3OJUA 2JPBA 1QQIA 2ZZDA 5KRTA 2QEXA 2D0CA 2LCLA 1E6HA 3WE3A 3GLLA 5CVRA 1D0XA 2V8JA 1RKWA 2YV0X 1W4SA 1WXTA 2DJZA 3ZN1A 2JA2A 3BPXA 2FB7A 2P9SA 4GVEA 1DP7P 3JCMg 3A0HC 4DOVA 4WF9L 2JWKA 4B1WB 3BG3A 2GFUA 3M0PA 4A4GA 1SPKA 2IGNA 5E20A 3KD5E 2HOTA 1ZR2A 3MN6A 3WTSC 4IKFA 2ZCFB 4GY5A 3BR2A 2JZYA 2BV6A 3SDBA 4CHNA 5J1EA 1KD1R 3CFRA 1SF9A 4I2PA 2FZGB 3KK2A 5IT9Z 1YI2Q 3V4IA 4CHPA 2MK5A 3VS0A 4IJAA 1L3LA 4M7AG 3M8QA 4NS5A 4O3MA 2HSEB 2COBA 1WA7A 1X3UA 4X1VA 1T6DA 5IHKA 4FWQA 5E79C 4RB3C 5C0MA 1H0MA 3GDQA 4PJLA 2KAFA 3I4NJ 1YWOA 1IUFA 3ENOA 5L3EA 2O31A 3ENBA 4M6XA 3MWMA 2CW7A 3M53A 1NBWA 1RZ4A 4HRIA 2RJDA 4PL8A 3DTKA 5AQZA 1H3HA 3DKMA 2KTQA 2M8GX 2WACA 4HKEA 2BHYA 4O0IA 3SV4A 2QA4Q 1GXQA 3M1FA 4EA5A 1OKRA 3AL0C 1G2BA 3P8HA 2YLBA 5GADJ 2DO7A 3B6CA 1KYZA 2YUNA 4LDVA 1QHTA 4CEQA 4E1JA 5IYCJ 1E3PA 4AIAA 1TTYA 5GAN8 2Z9OA 2B86A 4D6WA 3AV9A 3N4QA 1M8MA 2I7NA 4ZDOA 2NOFA 3CJ9A 3DMJA 4DYQA 4L3QA 1YCSB 2KNBB 3H46O 3HPHA 1REVA 4UC4A 4OKJA 3GCMA 3VYSB 1X2KA 1A31A 3T5XA 1QP2A 2Z0WA 1BJAA 2LQWA 1ETKA 4DQIA 2V79A 4DQPA 3NGYA 1Q7YR 2P4RA 4JJBA 1IGQA 3U4LA 1NEGA 1NGFA 2E1MB 3SWNB 4QQDA 3AAFA 4ZGDB 3V8KA 3TSZA 2D0PA 4FYYB 1SZ2A 3DLLF 3CUQC 1STZA 1P4XA 4E1NA 4RW4A 2DTOA 3H0IA 4CCOA 2BUPA 2Z2SB 3P4IA 4FLWA 1W4MA 2A1RA 1ODDA 1KU9A 5GMKh 4B3RK 1I50J 1BIZA 2RA2A 1ZC6A 2EJGA 1K0XA 2XAJA 4M7AF 1RNLA 2DILA 3I55A 5AZIA 1AWOA 3COAC 1TUUA 1ETXA 4BREA 3CJNA 2XHCA 1G59A 2EFQA 4A2UA 3BQYA 4ABZA 4KH6A 5BR9A 3O3KA 4Z4CA 1JUSA 4NL2A 4RG8A 4QWQA 2CW0F 4YPHA 3CW7A 3C94A 5L3FA 4M3UA 1FP2A 3DLBA 5HNFA 3BJ6A 2DO3A 5FLMJ 5ADXA 2LMJA 3CXCP 2LY2A 4A3DJ 5CVIA 5M1QA 2G7UA 2HR3A 3GE1A 4UUVA 3L7WA 5F0HA 3AG4H 1B9MA 3J7AP 3G6EN 3MKZA 3KK7A 1HA8A 1IGNA 3A5ZB 3SAGA 3CCRQ 3I0RA 5GIOA 3IMXA 2HEQA 1RRJA 2ZCWA 1KAYA 2AKKA 3GFJA 3TEDA 4RM3A 2ZXIA 1YJWQ 4Z94A 1NOZA 4DR7K 2HYGD 2KDZA 3SZTA 1T08B 1JXBA 1I1GA 5FJ8J 1VQON 2CUFA 1PP8F 4FM2A 1LQ1A 4H0EA 2NUPA 2HHQA 1KFZA 3C12A 1HJRA 1VQ8T 2G8WA 3QU3A 1QWEA 3U1KA 4Y1DA 2VC8A 3KP4A 2C06A 4GGGA 2ATQA 1V4RA 3CCET 1GCPA 3SPYA 1XMKA 3V1RA 2KEAA 3ZCOA 1BW5A 2JVGA 3BR6A 4OP0A 1PKSA 3HOTA 4ZYEA 3EG2A 3DPUA 1YW8A 1YX3A 3M8FA 2LOOA 4GRIA 4YY3K 3ZMSA 4DSIA 4BUPA 2DW4A 1NJIU 2VGMA 2L5QA 1BCOA 1KC8R 3RTRA 4B8XA 1WI9A 3BT9A 4DQSA 4IOAF 4BI4A 2PJRB 1I39A 3F2KA 3NVMA 2CT3A 3K0SA 1VZ0A 2ZPHB 3U9ZA 3CC7Q 3CCMQ 3OMGA 3QU6A 2OTJI 1UGQB 2MABA 4YELA 3LL3A 2BW3A 3ASKA 3RKQA 3AO1A 4AHUA 3CIPA 3IFRA 3MEDA 2ZF5O 4M78C 2HW3A 2HVIA 1YITN 1NLOC 3I0SA 2EFPA 4BRDA 4M75A 1UHSA 2LZ6B 3DEWA 3R6SA 4HV5A 1YI2N 3M07A 4KTZA 1ZHFA 1OVQA 1AWWA 1E4FT 3MZYA 4QLCU 3LNQA 4M78E 1X9SA 4BL0B 8ATCB 4IBNA 4KN4X 2P9NB 4XK4A 4JLIA 2OQGA 5C42A 3PX4A 1OH8A 1TUCA 2B6AA 1YWPA 1Q81R 3KLFA 4UV9A 3JTGA 2CW8A 4M77E 3P8BB 2J6OA 1R77A 3V7CA 3RZOJ 2L3RA 3JXUA 1I27A 3LAJA 4MO4A 5KCMA 4C8QD 3L8BA 2HNDA 5KE3A 4JK1X 4AILC 2ZC2A 1IBKK 5GAOm 1VSFA 3ZFJA 1TNTA 1M1KR 3RJPA 4A3BJ 2JPSA 4HTLA 3CPWS 1X3NA 3DPLC 3RSEB 3RR8A 2XY5A 3KPHA 4LF4K 1SAZA 2M0YA 4KMUX 4KJZA 4AMCA 3U1DA 4BY1J 1S9EA 2RREA 5CVJA 3JSOA 2NVQJ 3K58A 3NH1A 2P0PA 4HNTA 3HSCA 2VKNA 2GUIA 2K5IA 2K9LA 1U2WA 2QENA 3VF2A 3CCEA 4GDFA 2YHAA 2GTDA 4NO7A 2DFUA 4DZJA 4OAZA 1SUQA 3LMMA 1KONA 1QVUA 9ATCB 1MMGA 4XKBA 1FMVA 5CKFA 2EYZA 2OPSA 4K25A 4QPOA 3O3FA 1T03A 1QRYA 3AGRA 1YVNA 2E2JJ 3LAPA 1IN5A 2GIZA 1PG5B 2DJQA 3HKZN 2FJ1A 4X64K 2V9VA 5F64A 3J80K 5FROA 5DM6L 4ISGA 3TAGA 3SQ4A 1VAZA 4KRTA 5FKLA 2EFNA 1WOQA 2LT1A 1G6NA 2JMAA 4YNQA 3QQAA 2JA7J 2VKDA 2OAWA 1LNXA 3QESA 1AOJA