The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
100
|
sequence length |
365
|
structure length |
365
|
Chain Sequence |
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb |
molecule tags |
Recombination/dna
|
source organism |
Human spumaretrovirus
|
molecule keywords |
Integrase
|
total genus |
100
|
structure length |
365
|
sequence length |
365
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.7.7.49: RNA-directed DNA polymerase. |
pdb deposition date | 2010-09-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00665 | rve | Integrase core domain |
A | PF17921 | Integrase_H2C2 | Integrase zinc binding domain |
A | PF18103 | SH3_11 | Retroviral integrase C-terminal SH3 domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Arc Repressor Mutant, subunit A | ||
Mainly Alpha | Orthogonal Bundle | Endonuclease III; domain 1 | Endonuclease III; domain 1 | ||
Mainly Beta | Roll | SH3 type barrels. | SH3 type barrels. | ||
Alpha Beta | 2-Layer Sandwich | Nucleotidyltransferase; domain 5 | Ribonuclease H-like superfamily/Ribonuclease H |