3OS1A

Pfv target capture complex (tcc) at 2.97 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os1A03
4MFBA 1OZ3A 2B5JA 1NKBA 3OYFA 4CEFA 1BCOA 3IG1A 3NF9A 3KD1E 5JS1A 1OYXA 3O8VA 3WNGA 3LZIA 4CF9A 1BL3A 1WAJA 1WN7A 4JS4A 4DFPA 3QLHA 1I3AA 1IKWA 2OYQA 3KK1A 4HCBA 3TAGA 2YHBA 3O3GA 1BI4A 4RW9A 4DSEA 4FJHA 4E7JA 1LW2A 4FLUA 5IN1A 4O4GA 4Z4FA 2A1SA 2YRVA 4A4FA 1S6PA 4Y1DA 3NF8A 2F5KA 2R57A 1RTIA 1UWBA 1XWLA 1FK9A 3VQ9A 2HQEA 3EAEA 3TAEA 1SL2A 4FK2A 4DS4A 3RMAA 1TV6A 3ZSZA 2BUDA 3NGZA 3HVRA 4OKJA 4KKOA 1N6QA 5DMRA 4M42A 3ZSQA 2GFAA 3G0ZA 4IBNA 2DTUA 3P5JA 3QEVA 4DTJA 1RT3A 3KLIA 2Y1JA 4FLVA 1WSEA 1KLMA 1RTHA 4E19A 3LP3A 2HHQA 1LWCA 3PFSA 1W9HA 2BGGA 3V4IA 4UQGA 3OYAA 2RJEA 3QESA 3QEWA 3OYMA 2RN2A 4KHYA 4B9LA 5I3UA 2F8TA 3HPGA 1B9DA 2OZMA 4EZ9A 1G15A 1J53A 5KGWA 5FROA 1YTUA 4KAZA 4Z4CA 1S1UA 4F8RA 1CLQA 4HUGA 1UOCA 4Z02A 3NTHA 4RG8A 4BWJA 4G1QA 2M0OA 4LY7A 1LAVA 2R58A 1D5AA 3AVLA 4DFJA 2LCCA 2KW4A 2YNIA 2NLUA 1A5WA 3AVKA 4KTZA 5FRMA 4JS5A 3OB9A 4GW6A 2BIVA 2RI3A 5FRNA 1CZBA 3DOLA 3ITHA 2IDOA 3C6UA 4I9LA 4B8AB 4IDKA 4KB1A 1VSLA 4CEDA 4DTNA 4I2QA 4DTPA 4B9XA 1QTMA 5D6WA 2IG0A 2ATQA 4CEOA 3L2WA 2FBYA 4L8RB 3F9KA 2PYLA 4EDUA 1WSJA 3DI6A 3SV4A 1C6VA 2O4GA 3AO3A 3QO9A 3H6ZA 2KFNA 4KV8A 2MWPA 3KUFA 3CFRA 5KH6A 1HNVA 1RTDA 4OGCA 4HVJA 3NGYA 5HP1A 4DMNA 5KCOA 3K2PA 4IUTA 4J2AA 3AVIA 4JRQA 4CEQA 3LP2A 3VQ4A 3T3FA 4J2BA 4PQUA 3OYBA 1U04A 3LLRA 3LAMA 5HRNA 3NDKA 3MEWA 1S1VA 3L3UA 4DTSA 1NK5A 1TKDA 4W5RA 3OMGA 2XY5A 4CFBA 3EZ5A 2XO7A 3OYCA 5HROA 2B8AA 4OVAA 4CF2A 1JLEA 1LWEA 1TAQA 3MEGA 1X9WA 4IG0A 4FJ9A 1J5OA 2VG7A 3IS9A 1D9FA 2RHXA 1HRHA 1RILA 3K5MA 3BGRA 4AILC 3P1GA 1KTQA 3LH0A 1S5JA 2OPQA 2XRIA 4Z4HA 3B6PA 3KLFA 3ZSWA 3NCIA 1BGXT 1LWFA 3ZT2A 3BDLA 1RT1A 4B9TA 1TKTA 1Q9YA 3QEIA 4CEZA 4C5GA 2RHZA 1KSPA 3DLRA 3L2UA 3QNOA 4B3OA 4E1MA 2QQSA 3PV8A 2KTQA 5CY4A 4FM0A 4CJRA 3HP6A 1BHLA 3C95A 4TSXA 1ZBLA 5SWMA 4QCLA 3DLKA 1NJWA 1IG9A 4IG3A 4O0IA 2Z1GA 3P83D 1J9AA 3HPHA 4ID1A 1XHXA 4NYNA 1GOBA 4FXDA 3VQBA 2DIQA 3P8HA 1JLCA 3VQPA 1HMVA 4CGIA 4FCYA 4KHUA 1ZBHA 2L3RA 2LVMA 1BI4B 1ASUA 4FVMA 5CYQA 2K3XA 3VQ6A 5HRRA 3VQ5A 3HT3A 2K3YA 4CF0A 4FLTA 4DS5A 1SKWA 4ELUA 4CGHA 4XIUA 4OLBA 1VSHA 4KHQA 1FKPA 1T7PA 3PNWC 3QIPA 1HNIA 5CYMA 3TR8A 2G8UA 3NBPA 3E9FA 1MU2A 2G8IA 2Z1IA 3C94A 1RT6A 3I0RA 5J2PA 4B9NA 4CCHA 3BDPA 2X6NA 3ZSOA 4FLYA 3SQ4A 4FJGA 2R5MA 3WNEA 2B4JA 2FBXA 4DTMA 3QINA 4KHWA 2JLEA 3E9GA 3B6OA 4CJKA 4NZGA 3LGLA 4Z0UA 4BD3A 3OYEA 4YNQA 4OPKA 2L8DA 4IUQA 3ALYA 4DTOA 5JS2A 2DFFA 1U45A 1X1PA 4F3TA 4CJEA 1VRUA 4CJWA 5M9OA 4FW2A 4CJLA 2W42A 1C0MA 3K59A 4DSLA 2DIGA 1QHTA 3FC3A 2LSNA 1DLOA 3HL8A 5J1EA 1JXBA 5HLFA 4FJNA 4EP5A 3THVA 3M8RA 2BE2A 1SL0A 4FJIA 3M8QA 3MEUA 5J39A 2EFIA 2RO0A 3U3YA 4W5TA 2BKDN 1U4BA 1WLJA 4FLWA 1KFSA 1JL2A 2M1HA 1Q8IA 4IKFA 4OGEA 1WNSA 3V1OA 1ZBFA 3V9WA 1TAUA 1N27A 2IOCA 3SV3A 1YVUA 3KK2A 1U49A 3UWNA 3A2FA 3NH2A 1LV5A 4KI6A 2QQRA 1G5VA 2X74A 4C8OA 3SUNA 4KPYA 4FK0A 2LDMA 4CE9A 3V9ZA 4KHSA 2D5RA 1EETA 3RRHA 2PY5A 4H8KA 4C5HA 3JYTA 4DTRA 3TAPA 1C0TA 4KRFA 1HYVA 3L42A 3C6TA 3OVNA 3DB3A 3O3FA 4LH4A 1S1TA 4FJLA 3KKRA 4E7KA 3ZT3A 4Z4GA 2M16A 2AJQA 3JSMA 1GOCA 3HP9A 3SUQA 1T8EA 3SUPA 1Q9XA 4PLLA 3V9SA 3G10A 4B9VA 4JRPA 3ZEHA 2ZD1A 3SQ2A 3HO1A 4Y1CA 5I42A 4KB0A 1RDDA 2EQJA 4CK2A 3KLEA 3LDSA 1RCHA 1TK0A 2HW3A 1KLNA 4HUEA 3L2QA 4B9WA 1C1AA 3D45A 1ZBUA 3MEAA 2G8WA 3ZT0A 1Z25A 1VSKA 3NF7A 2BANA 5D6YA 4JLHA 3D0PA 3SCXA 1RBSA 1VSMA 1HPZA 1RDBA 5T7BA 2D0BA 2HNYA 2KFZA 2E6LA 4Z4EA 2ZE2A 2A1RA 1WJSA 4IFVA 3V1QA 4BDPA 4NCAA 3NE6A 3CM5A 1QSYA 4M3UA 3AVBA 3RTVA 3OYDA 2HHXA 3PMTA 2XY8A 5EU7A 4DSKA 4FJ5A 5J2MA 1NJYA 4FJKA 2HVIA 3S3MA 3MP6A 3LWMA 5C0MA 1A5XA 5J2QA 4F2RA 4BE1A 4DSFA 3OYJA 4CJQA 1SL1A 4RW6A 4FM2A 4E1NA 2E5QA 3ULDA 3SI6A 2X4WA 3DM2A 3H8ZA 2MWOA 3OJUA 3MP8A 4LSNA 1ASWA 3MXMA 3ZT4A 4CHNA 4W5QA 1TVRA 3RRGA 4DSJA 4KHNA 3RMDA 2QKBA 2RF2A 1SSFA 4W5OA 3MAQA 5CZ1A 2OZSA 4UC4A 3DRPA 3H08A 3I0SA 4AHSA 2RJFA 1KVCA 1JL1A 4CJ4A 3SJJA 2KQ2A 3AV9A 4FW1A 2RJDA 3AVHA 4CRIA 4EZ6A 3RWUA 2IC3A 1IKYA 1C1CA 3MEDA 4HCZA 3I8DA 3M8PA 3TABA 1NOZA 4C8KA 1BCMA 3KD5E 3VQQA 3PX4A 3QKJA 4FL6A 1JLBA 4FU6A 3KTQA 4QQGA 3AVNA 4N56A 4FM1A 3FEOA 1FXXA 4YFUA 4J2DA 1BISA 3LP0A 2O4IA 3C4SA 4IUUA 4OKKA 2ETJA 4FJMA 3PX6A 2HHTA 1QSLA 3TAFA 1RBVA 3NH1A 1BIZA 4BDYA 3NTIA 3NHGA 1LAWA 3PX0A 3RMBA 1NK6A 3V9XA 4DLGA 4M3XA 4CHOA 4M3TA 4PUOA 5D3GA 2HQXA 3MEEA 4CJSA 4ZHRA 1MHNA 4H4MA 4CERA 3HK2A 3K5NA 2OPRA 4Q5VA 1XHZA 3SPYA 3M9QA 4CK1A 3L3VA 1L3UA 3MP1A 4CGGA 2X4YA 4C8MA 4CFCA 3ASMA 3DYAA 1WJRA 3OYIA 4PLIA 1WSHA 3K5OA 1IO2A 3MECA 2D9TA 3QJ6A 1CXUA 4DG1A 4FJJA 3OYNA 5J26A 2RJCA 1WSIA 2HHVA 4I7FA 4CJFA 4CK3A 1B9FA 2R7YA 4FZYA 3ASKA 1QS4A 4CEBA 3ZCMA 3CG7A 3QETA 2LTOA 4QQDA 2XDPA 3DMJA 3HSTB 2Y1IA 4N4IA 4DSIA 4QQ6A 3LGFA 3NNQA 4M3RA 1EX4A 1Z26A 4IUPA 3SPZA 2CKKA 3MO8A 1XNIA 2RI5A 3QERA 3AA3A 2E6NA 3OYGA 3AA4A 2PZSA 3ZSXA 3RMCA 4OJRA 2X35A 3VQ8A 4K8ZA 3CYMA 4KTWA 1RBUA 4Z4IA 1OI1A 2G8KA 4BWMA 4BE2A 4O44A 2YKMA 4AHVA 2DY4A 5HRPA 1S9GA 3VQAA 4QW2A 1UA0A 1L5UA 4CGDA 3IAYA 2VG6A 2DAQA 1L3SA 1KRPA 3AA2A 4AHTA 3HXMA 4CGJA 5D6XA 2HVHA 1EP4A 3VQDA 3V6DA 1EXQA 4N4HA 1XC9A 2O4XA 5KCHA 2FBTA 3HYFA 1L3VA 1LW0A 1VSFA 5SZTA 3OS1A 4PY5A 2X6SA 3MXIA 2E4LA 3VQEA 2DFHA 1JKHA 3DLMA 2F8SA 1ASVA 4M41A 3EY1A 4DFKA 2WONA 4O55A 4RW8A 3K58A 2X4XA 3TARA 2IGIA 1XI1A 4CESA 4NCBA 1WJQA 4DU4A 4O0JA 4N47A 4M3WA 1TGOA 4N41A 4W5NA 2OA8A 1RT5A 3ZT1A 1NK7A 4KREA 1OZ2A 2L89A 3PUFA 1WSGA 2QK9A 3DLGA 1HYSA 4DFMA 4CJ3A 2HHUA 2EHGA 5HBMA 2P0KA 2DFEA 2XK0A 4CGFA 4E3SA 2Z1JA 5KI6A 4CEEA 3HPOA 4DQSA 1VSDA 2G3RA 1NKCA 2GUIA 3CEYA 3M8SA 4EP4A 5KGXA 4DTUA 4FLZA 5C25A 4CHZA 4WE1A 3U3GA 4E0DA 4E89A 3VA0A 3KIOA 4F2SA 4OKEA 2O4XB 2YHAA 1RT7A 4NYFA 3VQ7A 4AHCA 3F73A 2WOMA 3IRXA 1SV5A 4FZZA 3F70A 4QOZB 1KVBA 4GVMA 1QSSA 3AA5X 3SD4A 4LSLA 3DLHA 1WSFA 1KHCA 2GFUA 2FBVA 2HNDA 4GMJB 5C24A 4CEAA 3AVJA 3HM9A 3WNHA 1NKEA 3CFOA 3CFPA 4A4HA 3SYZA 2G8HA 1NK4A 1VSEA 4IFYA 1O1WA 3KJVA 1QQCA 4LD0A 2P5GA 3S9HA 3O4NA 3EYZA 1ITGA 3PO4A 4DQRA 4N5SA 3K5LA 4Q5WA 4NCGA 2YKNA 4C5EA 1S1WA 4HTUA 1VK0A 4M3YA 4GY5A 1U47A 1NJZA 4FJ7A 1KCFA 3DOKA 1NJXA 1YTAA 5CIUA 3AVGA 3DRRA 4B9UA 2G8VA 3U6FA 3LWLA 1VSIA 3S3NA 3TAMA 3FDRA 1RDAA 3KKSA 3AVCA 3OQ5A 1IKVA 3TWHA 2JZ2A 4ZTFA 5KRSA 2VYTA 4DF4A 4DU3A 2VWKA 2BDPA 1ZYQA 3OYKA 4KFBA 4KI4A 2R5AA 4OPJA 4J2EA 3QIOA 4F3OA 2VG5A 2F96A 1RT4A 1RNHA 2QKKA 4B08A 3SUOA 1NK9A 3FFIA 1VRTA 3L2RA 1IKXA 3TI0A 3QIIA 1BIUA 4C5IA 2FC0A 1CXQA 4PA1A 2P5OA 4IURA 1FKOA 3OJSA 4DQIA 2EQKA 2E6MA 3UIQA 2RHUA 1R0AA 1TKZA 2RI2A 3OMCA 1RBTA 2D0CA 4I9QA 3T19A 1NK8A 2I5JA 4BE0A 1BQMA 4N76A 1WAFA 4FYDA 1K6YA 2G8FA 4M45A 4DF8A 4FJ8A 4ICLA 1WGSA 3DB4A 1J54A 1HYZA 2HHSA 3L2VA 5HRSA 4CJPA 1SKSA 1X9SA 4CHPA 4RW4A 2YNHA 3O3HA 3P8DA 3VQCA 3WNFA 5KTQA 3AVFA 1EKEA 1JLFA 4FZXC 4R5PA 4IUVA 1CZ9A 4ELTA 5C6SA 3LYIA 4CJTA 1W0HA 3T1AA 1T05A 1C0UA 2Z1HA 4DQPA 4CF1A 2XY7A 4CFDA 1NOYA 3OS2A 1JLAA 1TL1A 4BDZA 4DU1A 4MQ3A 2EQUA 3RR7A 3LAKA 3LP1A 2EQMA 3LALA 3LPTA 3O4QA 3KLGA 4FLXA 3TAQA 4M3ZA 2X78A 3DLBA 1KFDA 4CIEA 3AVMA 4CIFA 1JLGA 5KRTA 3CQ8A 4KTQA 4RW7A 4C8LA 4ZTJA 3KK3A 4O5BA 3K57A 5KE3A 4A4EA 4PWDA 3AVAA 3ZSRA 4AHUA 4HUFA 4X34A 3MXJA 1DTQA 3PO5A 4PL6A 4NS5A 5KE2A 4OVLA 4B9MA 3NF6A 3HVTA 3V81A 2WACA 3META 3AO4A 1N5YA 5DK5A 2EKOA 4L59A 5C42A 3NAEA 3LX7A 2NUBA 3E01A 4C8NA 4E7HA 2LRQA 4LD6A 2GV9A 3OYLA 1VSJA 3ZSVA 4DQQA 4E7IA 1Y97A 4H4OA 4B9SA 1RI0A 2D0AA 1QE1A 1REVA 4HHTA 1S9EA 2RHIA 2GF7A 4K8XA 4N4GA 4II1A 1S6QA 4CF8A 1GOAA 1H3ZA 3QNNA 2QXFA 4QVZA 1HQUA 2RHYA 2JTFA 2EX3A 2RKIA 3S6WA 2FHDA 3VN5A 1JXEA 2GBZA 3MEVA 1SKRA 2YNFA 4QAGA 1L3TA 2HB5A 1RBRA 4BACA 4CHYA 4RG2A 1S1XA 4ELVA 4FK4A 4F4KA 4FJXA 3NTKA 1YT3A 1SUQA 3LPUA 1KVAA 3RR8A 3OS0A 3S3OA 4ID5A 3ME9A 2P1JA 1RT2A 4A4GA 5IAYA 3V1RA 1TK5A 4CJVA 2ITGA 4CFAA 1T03A 2PYJA 3DRSA 3NGIA 5E41A 3AO1A 4I2PA 2XHBA 4DTXA 3FLGA 3TANA 1ZBIA 4Q0BA 1A5VA 2XY6A 1UAXA 2B6AA 1X9MA 5K14A 3Q1JA 1JLQA 4CECA 1TKXA 2VWJA 3GOXA 3SZ2A 1BQNA 4OLAA 3OY9A 3L8BA 1D8YA 2PQWA 3PMIA 3AO2A 3OA6A 3AO5A 3LANA 4LH5A 1TL3A 2YNGA 1F21A 5CZ2A 3ZSYA 2HMIA 5FDLA 4CHQA 3V9UA 2KZZA 3VA3A 1U48A 2HNZA 3QBYA 1RTJA 5J2NA 4HCCA 3HJFA 3UT1A 1DTTA 3NFAA 4KO0A 3QEXA 1HJRA 2YV0X 1NK0A 4E7LA 3CM6A 3QEPA 4CJ5A 3LZJA 2JGUA 2IAJA 1I39A 4DLEA 3SNNA 1UA1A 2KZMA 2OPSA 1HQEA 2P51A 2RPIA 4AHRA 1B92A 4AH9A 4CIGA 4CJUA 1TK8A 3DLEA 2Q3SA 3OYHA 2ZQBA 3SQ1A 3ISNC 3SQ0A 3PY8A 1D9DA 4B8CA 3KLHA 2HHWA 1IH7A 1RDCA 3NH0A 2OPPA 4DWIA 1C1BA 2IS3A
chains in the Genus database with same CATH superfamily
3ISPA 3SK3A 4M9SA 2KRCA 5AQKA 2XF5A 1IREB 5M5WJ 3G1LA 3RQIA 2DNUA 5LHIA 2E35A 1NPPA 2P9IA 3K7AJ 4B1XB 2QDYB 1GLNA 3V7CA 2R57A 1RTIA 3KK7A 3CERA 5M1PA 1YS7A 5DMRA 4DOWA 3ZSQA 2KJCA 5EOYA 5ILSA 2LMJA 4FLVA 5HY6A 4E19A 1NBWA 4A53A 5FROA 1NLPC 2D0QB 2M7AA 2CP2A 2KW4A 4GVEA 3QFUA 4DTPA 2CP5A 5GAHJ 3EG1A 3N5BB 3VENA 2F1LA 5J4YA 1N5ZA 1Z21A 4I02A 3X28B 5KAIC 4YFXF 2VYPA 2DKGA 1QVPA 3SB2A 4BRLA 4UY8O 4OVAA 2JWTA 1X9WA 2K7LA 4DV6K 4KGXB 1JGGA 1HW1A 3NCIA 2SEMA 1BGXT 1HNZK 3QYFA 3QEIA 1H8AC 4XSZF 4B3OA 3WTZA 1NJWA 1P7JA 4BRAA 3ML6A 3O6WA 3P8HA 2IS6A 3VQ6A 3CQZJ 4FWRA 5F6FA 2HKXA 1I07A 1VQ6Q 1KU9A 2VI6A 1YQKA 2Y0SN 2L3PA 1YJ9Q 3TSQA 2VWFA 1IXDA 1RETA 4J01A 1RAGB 4NUBA 3WNEA 3WHCA 2JLEA 3B6OA 3BFMA 4JNEA 4D9JA 3C0CA 3DWLA 3BR5A 3DFGA 3M1EA 1BR4A 2FU4A 3WVEB 4H0XB 2AHJB 3J81E 3FC3A 5J1EA 4IWVA 4GKKK 1TXQA 4I76A 1H9TA 4FLWA 3WGHA 1K83J 2SRCA 3SV3A 3JRCA 3A1PA 3VW4A 2KPMA 3PSFA 3LWFA 3O4WA 1U49A 1H641 5GAOl 1PVSA 2LDMA 2YLCA 2D45A 4Z2YA 3H9QA 4V2GA 1S1TA 1N39A 2WSCE 3UKRA 4C2MJ 3CC2Q 2HYGD 5I42A 3PE0A 2D4WA 2H8WA 1WHHA 1VQ5N 2FVUA 2KDSA 4J9IA 3WVDB 1VQ5T 1IJJA 3GLXA 4JLHA 3THYA 4XQ3A 1VQ9Q 1HPZA 4JDSA 4DIQA 1LB2A 1D5YA 2KHMA 2ZWHA 3A8MB 3AGRA 2Z9OA 2W24A 1BKBA 1JT6A 1ORNA 3A5ZB 2JRMA 3MP6A 2LBFA 2COYA 5BPMA 4EJZA 2X4WA 3I56N 1SFEA 1WH5A 2J7IA 4IZ9A 3RMDA 2K5CA 3I0SA 3BE3A 1UE9A 1JL1A 1QWFA 2PVGB 2OANA 1FBSA 1FOXA 4DBRA 2GXBA 1JLBA 4DR3K 3RPQA 2KT0A 5I2SA 3A0HC 1MV3A 3K69A 1YJNN 3F6VA 1PU8A 2K6DA 2P9LA 3MP1A 5C24A 4PLIA 1AT1B 3SLCA 1CXUA 3GBQA 3VS7A 4HV5A 1B9FA 4PSWA 1MH3A 2H09A 3ABKH 3SAFA 4N4IA 3NNQA 3MO8A 3IRQA 2E6NA 3TTDA 3FIWA 1KO9A 2QWLA 1VQ9I 3LQRA 1UHSA 1L3SA 2EFPA 3F6OA 5KHDA 2OTLQ 3TSUA 2O4XA 2E6ZA 3OS1A 2HQ5A 4G9ZA 3U8XA 1HSTA 4M41A 3EY1A 4BYYA 4IHWA 3O08A 2NS7A 3TARA 4D6WA 3EKSA 4O0JA 1VQNA 3JCMe 2V9VA 4QLCU 4J7FA 3IWZA 2CSIA 4NQWA 1NKCA 3W6KB 3OIPA 5IP6A 4NB4A 3U3GA 2K79A 1W2BA 2BZTA 3QG1A 2UUCK 3I9QA 4LG0B 4HCKA 4XTWA 4GVMA 3SBTA 2HOSA 2OD5A 3CXCS 3PIOL 3RTRA 3WNHA 4M6XA 4IFYA 5EGOA 1TWHJ 2O8BA 3MZYA 4C2TA 3EYZA 4H5NA 4RB0A 1WHMA 3NWTA 2CH6A 3IKTA 4CHUA 4AIJA 4DCHA 5D6FA 2ZGYA 2W10A 5LMNK 3DOKA 3CTAA 2MLKA 3CCQI 3LDLA 1EF4A 1S3JA 1R71A 3U4LA 1XMXA 1X1DA 4DU3A 3J80K 2F4IA 1UGVA 3QIOA 1RNHA 3FFIA 1CF7B 2X9HA 1MPGA 3C7JA 1VQKT 3T19A 1REPC 1M1GA 1EZZB 2QYZA 4M45A 1HBXG 4JKCA 1DKGD 1O7LA 3NVMA 1EFNA 1K73R 3GVAA 2COMA 3O4QA 2BY1A 4G9YA 4X1VA 1Y39A 3W2AA 2ASPA 4AHUA 3CWUA 4WCEL 5JVHL 4O3MA 5EG2A 3M8EA 4F52A 2EKOA 3NAEA 2Z99A 1K0SA 5FLXO 4CXFA 4BHPA 3EO3A 3J7ZO 4LD5A 1S6QA 4Y17A 3M0RA 4ILGB 3CCUT 2F2VA 2G6FX 3RDVA 4QAGA 1RBRA 4F4KA 2P0WA 2KVQG 2P1JA 1JU5C 2ITGA 1T03A 3AO1A 4XQFA 2QF7A 3AO2A 1U8BA 4IL6C 1TL3A 1U48A 2HNZA 2IGMA 3SDBA 3AL0C 3HFOA 3QEXA 3RPUA 1MA9B 4H5VA 4C8QA 1B7TA 1ZLJA 2P51A 1B92A 2AZSA 3PIPF 3CVTA 2C06A 5HL7L 2A3LA 2E2IJ 3CP8A 2E5LK 4QT7A 4ZN3A 2HGCA 4B3AA 2CP6A 1K9MC 3OW2S 1OPLA 4DSEA 1KK7A 4XTYA 4LE9A 1S6PA 3CCUN 2HQEA 2P4WA 4F7UA 4FK2A 4LUDA 1VQ4T 4M42A 2CH0A 4OPAA 4AFZC 2DBBA 2HU9A 3DXMA 2RN2A 4CYDA 2E41A 1J9IA 2ISZA 3KP7A 3GOIA 4KULA 2MPXC 4OIRF 2AK5A 4JEPA 5BPIA 1Z6TA 1G83A 3I59A 3CC2A 4CEDA 3ZFJA 2WSEE 3F9KA 1WSJA 1IV8A 3QU3A 2BGCA 4KV8A 5KQ8A 4EJVA 2MD0A 4GDFA 2OAWA 2XICA 3K2PA 4IUTA 5LJ5f 5HRNA 5GAGJ 1WYXA 3DU6A 4G7HF 1S1VA 3WEEA 1Q81O 3QHSA 4W5RA 3FHNA 4AWXB 2XO7A 2GEMA 5HROA 1S5JA 1XS9A 1W36D 4K25A 3CC7N 4B9TA 1WPKA 4U87A 1X3MA 3WXIA 1QZYA 2RHZA 1XPXA 4E1MA 1ZBLA 4QPQA 2I7NA 1Z7UA 4LN2A 4IG3A 3H41A 3VGLA 5AT1B 1B9NA 5HRRA 2EB7A 4XORA 3BP8A 4J9EA 3CCVI 3DLAA 2XD0A 2IS1A 2DDAA 1PP8F 4HV6A 5FO5A 3A5OC 3R8EA 2CZ6B 3GZNB 4X0GA 4DTOA 1X3ZB 3WODF 4EJWA 5GAOr 2GTJA 5AQOA 2E71A 1C0MA 3UA6A 1XQHA 2PN6A 3H1QA 4UXNA 2EILH 2OUMA 3VYSB 2Y4XA 1CQTA 3TQ7P 4KI6A 3WG7H 1XC5A 4JKEA 3V9ZA 4F93B 1BW5A 4KRFA 1C0TA 1VQPT 2YG9A 3ZT3A 2AJQA 3SMPA 1A6IA 2CUBA 3LSIA 2PFBA 2G8WA 3HGYA 3G3ZA 4Z8AA 2QAZA 1VSKA 3PJRA 3IUCA 2ZSHB 4WFNL 2WTUA 3O5ZA 1DU0A 5K7FA 1WZ2A 3UKUB 1QPIA 3CM5A 1TWAJ 4DYRA 1MBJA 5M3FJ 4HX7A 2HVIA 5GAOn 4NOYA 3QWLA 4FM2A 4E1NA 3OJUA 2MWOA 4CHNA 4KHNA 1C0FA 1TZLA 5CVUA 1JGSA 1BB9A 2HNIA 1R59O 2BE5F 2ZXIA 3WE2A 1FXXA 6PAXA 4KJZA 3WEEB 4RTVA 2DEUA 1BIZA 2LK2A 3FZFA 4LDVA 3FWEA 4O8KA 1RR8C 4C3HJ 1X2QA 3KE2A 3UATA 2I10A 4FJJA 5IHIA 1IXSB 2CW8A 2V26A 2KZGA 1R9TJ 1OOTA 2YJEA 2ZJQF 4JK7A 2Y31A 2FJ1A 2JUGA 2CKKA 3RMSA 4LFBK 2EPFA 3ZSXA 2M34A 1X43A 3WXMB 2LFBA 4CGDA 3SZPA 1KRPA 4YOWA 3K0LA 1PRMC 3TSPA 1EP4A 5GTIC 2FBTA 2VQCA 4M4ZA 2X6SA 1X1BA 3CC4I 3FZHA 4A0ZA 1S72I 1X6GA 2DLLA 4QIWN 1YN8A 4CZGA 2ZO4A 4HF1A 1D0YA 4LDYA 4CJ3A 2NLXA 3G4SQ 1KG6A 3HZJA 1NGAA 2QWRA 4A54A 2HI3A 4E89A 2X4HA 4FT2A 1GFDA 2O4XB 1NGNA 3CCSA 3HBLA 4PJJA 1HLUA 2DRKA 3CBOA 4RLFA 2FBVA 4JKHA 2V7ZA 5CKTA 2ELJA 1VQNT 1Z67A 2ZBKA 3CDHA 3GIBA 5CKEA 1PUFB 1S1WA 4HTLA 1NU0A 4BVPA 4E4HA 4GY5A 3CCUQ 5BN8A 4DV1K 2HYFA 4IFEA 5EF6A 2DU9A 1WDXA 5F1RA 3TAMA 2L5QA 3DQVC 2K57A 1SHFA 1LOTB 3L2RA 2V6EA 5CKDA 3HKZN 4EJTA 3OSSC 3CUQB 2D0CA 2MBFA 1PCXA 1BQMA 2MA3A 1VQPA 1NYGA 4UB8C 3JS6A 1WFWA 3C12A 5KTQA 1T6SA 2BY0A 1MSFC 3ER0A 4HVVA 4XAXB 1IN4A 3EG3A 2PJRA 1Y71A 4FM4B 2WUSA 3Q0VA 5E20A 3K10A 2VJJA 1YJWN 5DM7L 5KE3A 1KXPA 4A3KJ 2LT1A 1ON1A 3AVAA 4WQ5A 1DTQA 2LG4A 4OIQF 4LLLA 1N5YA 3THXB 4E7IA 3O8MA 1QE1A 3ULQB 2ZB9A 2CP0A 4FO0A 3CC4A 4JPBW 2PUKB 2AS5F 4AVPA 3K4CA 4RG2A 4E9HA 5CR2A 4RTXA 1TWGJ 4DR5K 1MKMA 5IAYA 4NQWB 1GFCA 5KYYB 3G71Q 2WV1A 5GMKe 3BPVA 3OMYA 3PFIA 5JVGF 3L8BA 2ABKA 1K8AC 3DKWA 1BBZA 3A01A 2YI1A 1JKOC 4AI4A 1S72N 1GVJA 4LGWA 2DERA 4PFZA 2DDBA 5GAMh 2W04A 3MKYB 4G12A 3BY5A 1D9DA 3KLHA 5H2FC 2W6KA 4FWLA 2B5JA 1SEUA 3RZDJ 4XU1A 1K4TA 4CF9A 1WAJA 2EW3A 1JE8A 1K73C 2P0QA 2K40A 4RDUA 1HKSA 2KROA 3Q9SA 1UB9A 5JFRA 3VEYA 2YRVA 1UWBA 1AU7A 1YJNQ 1W97L 4ITVA 1P7IA 1R8OB 4OKJA 3EUKL 3VS4A 4IBNA 2QEXT 2VJ5A 4HA8A 3GDQA 3PFSA 4WXDA 1NG2A 2VL8A 3E1YA 3RERA 4PKHA 3D1NI 3MVPA 1B9DA 2J6KA 4JHDB 4CZKA 2KT8A 2X48A 1Y56A 3R4KA 4G1QA 3SBGA 1S5LC 4CZEA 4A3IJ 4OB1B 1GBRA 4W5NA 3CCJT 1SZ2A 1VQ4A 3DEUA 1WJAA 4IO8A 3CCST 1VSLA 3CCJN 4DTNA 2ATQA 2YUSA 1VQ7Q 3BG5A 3MZHA 3BTIA 3Q5FA 1DDNA 3X20B 4A5MA 4AUXA 1QZZA 1T6DA 5E17F 2Y0MA 1KEAA 4BRCA 5D4SA 3GPLA 3NQOA 3LAPA 1ESVA 1TKDA 1NGEA 3OMGA 2JVHA 2DL4A 1JB0E 3QSUA 3MHXA 1VQMQ 1YITA 2W1OA 1I1SA 4PKCC 4AYBN 4QCLA 3ZQLA 2RVCA 4Y33A 1AVZC 2ASOA 9ANTA 2ZJRF 1WQ7A 1BI4B 2CS3A 3BG7A 2P7CB 1KG1A 1VSHA 1FKPA 3TR8A 5FLXK 1JUPA 3VGKA 5I9EB 1X2MA 3HM5A 3W2VA 3CCVA 1Z0XA 2HDWA 2EYWA 3P9KA 1Q82C 3CXCP 3QINA 1O13A 4KHWA 3GNGA 2DA2A 3OYEA 2PG4A 5GPAA 4FW2A 3K59A 5LGTA 2ROLA 3JAME 3HTVA 1VQLA 2D5VA 4OIOF 1RRSA 1P6RA 3CBPA 3M56A 1ZBFA 2CUZA 4A61A 3FMSA 4ZYHA 3UWNA 3A2FA 1KYZA 3IH2A 1G5VA 2HBJA 2D5RA 2VUBA 3FX3A 2IXSA 2VJ4A 3OVNA 1Q82O 4DV2K 5E8IA 2HQNA 3D7EO 1S7OA 1RAIB 3ZEHA 2ZD1A 4IQJA 4U7BA 1EO1A 2YU3A 3UKUA 1UGPB 4OMPA 2YDLA 2FMLA 2HXIA 1OYIA 5GAN4 2XIDA 1MW7A 1MGQA 3OWTA 4XICA 3C6HA 1VQOI 1P7MA 4CGZA 3OYDA 5B3SH 3M6GA 1EA3A 2LSOA 2E20A 5AZIA 2E5QA 2X9DA 3PNVA 3MXMA 2I2LA 2XC7A 4HEA2 2RF2A 2WAQN 1KVCA 2MI6A 1YI2N 4FOIA 4JRKA 3JTHA 2P0PA 4HCZA 4XU2A 3X25B 4DUZK 4BH9A 1VQLI 4BC2A 1BISA 2A5YB 3CPWP 2DL5A 3GTPJ 2GCXA 4C9YA 2OZUA 2QEXA 3S2WA 3PX0A 2HQXA 4BGDA 4PKIA 4ZHRA 4RGSA 5GJWB 1LFBA 2R7OA 2KHOA 2X4JA 2X4YA 3MDQA 2O2OA 1IO2A 3CJTB 2JPSA 2D8JA 3EDPA 3LDPA 3TBIA 1WJCA 3FDYA 5CK9A 2RQPA 4FVUA 4M3GA 3ID8A 3FIFA 3I0XA 4C0FA 3QQAA 5KVRA 5LD2C 4I99C 4IRHA 3LGFA 4CI0C 4M3RA 3WQTA 4ME7A 5EJCA 1M27C 2Q97A 1V76A 3N4QA 4EV0A 1JCFA 4KTWA 2YKMA 4QW2A 4X64K 4JOMA 2VG6A 3OW2A 4WQ4A 3OW2M 5EC7A 4A59A 2B86A 3HRUA 5MLCQ 3LWHA 1LW0A 2Z2SB 3EFRA 4AQYK 4PY5A 4U67L 2V6CA 3A02A 4BQAA 4OFEA 5AQMA 3MXIA 2FA5A 2DFHA 3H9GA 5CVIA 3Q7BA 4RW8A 4B1UB 3GNFB 3CF5F 3IC7A 2RN8A 3D4VA 2OA8A 4CW7B 1PHTA 4CGFA 2HF4A 1TYQB 2GWKA 2W41A 1D8JA 3IH4A 2QQ8A 3VEXA 4E0DA 5AZIB 1Q86C 4XR6A 3M1FA 4EGYA 2DEQA 3DLHA 3EYIA 4OMFB 2JMAA 3AL0B 2G8HA 5BPDA 3I55N 1T08B 3KJVA 3EGXA 5EXWA 4NC8A 2CZ0B 4C5EA 5FD6A 2Q2RA 5EGOB 2MIOA 5C10A 3BEXA 2JT1A 3O2PE 1ZSZB 2G8VA 1W0UA 1XSDA 1QW1A 4JYAK 1MZBA 2ZXHA 4XMYA 2DYRH 3Q3SA 2Y4YA 5AQQA 4JYKA 4ESBA 2DT6A 4PJ0C 4LLNA 5DCMB 2F4MB 2F5DA 3JAMZ 2VE9A 3HRGA 2HBWA 1SVMA 5GINA 1J54A 2KRSA 1NEBA 5IYBJ 2ATCB 2DA4A 3DXKB 4M75D 1D1CA 1W0HA 3T1AA 4DQPA 4N4NB 3BQZA 3OS2A 2LNVA 2L54A 4OMQA 3S6IA 3DLBA 1CZAN 3CCQT 4LDWA 4FT4A 3I5SA 3CCQN 4L3QA 1FNNA 1IRGA 1ZKGA 4OVLA 2PZ1A 3H45C 1V5GA 3E6BA 2CG4A 2EA4A 3BR1A 2KYMA 2E1OA 3IAS2 3SJHA 3LX7A 2LRQA 2QKLB 4B9SA 2E1ZA 5CLSA 1REVA 2DYIA 4K8XA 2R5YB 3KEOA 4QVZA 1HQUA 2PJRB 2W85A 1RUOA 4YRVA 2CREA 1YT3A 2IA0A 3D2EB 1KVAA 3ZGKA 1YITQ 1SF9A 2DMNA 3AT1B 3VSLA 4G6DA 3NARA 3QBYA 2FRWA 1N9SA 4HVWA 2Q3SA 4JKGB 3NH0A 4EMKB 4NDLA 2YRDA 4LFCK 5E79C 4PGGA 1U6GA 5HNFA 4C30A 3P4IA 1WN7A 2C6YA 2OYQA 1XMQK 4FYYB 1K0XA 4JZ4A 2KAFA 4A4FA 1ARKA 1M90R 1SL2A 3N97A 1JI8A 3M4YA 1W4SA 1TV6A 5C44J 4KKOA 3P5JA 2FEZA 1RT3A 3MX5A 2ME6A 5I3UA 2O8CA 2CJJA 1PD0A 3R60A 5J8FA 3KP4A 1S8NA 1LAVA 2P9SA 2IBDA 2BEOA 1IF1A 2R58A 2UXNA 2NLUA 1A5WA 2AXLA 1YW8A 3CUQC 2DI3A 1YFHA 3D2FA 3QU6A 2WWYA 2LQ8A 5F0HA 3GO5A 3H3UA 4GLMA 4P5NA 4YOTA 4RB1A 1Q81R 3EUHC 4JRQA 4DOVA 1I6XA 1WHGA 4HLYA 3JRZA 1EH6A 3CQYA 1PVEA 4CI6A 3HUGA 4B09A 1YWPA 1KTQA 2NNWA 1WJ5A 5CQGA 1I50J 2ZXJA 3ZSWA 1KHIA 3ZT2A 2M8GX 4IJAA 4C5GA 3J7AP 4O5VA 1WVRA 5HLHA 2D0OA 3HRTA 1J9AA 4MTEA 3PVQA 3FBIB 2DIQA 2L3RA 2G9WA 3U2RA 1HKCA 5GANj 1VQOQ 3VQ5A 3I3LA 3SHWA 2QSFX 5IT9Z 2G8UA 5KYNA 5ELZA 5J2PA 4BJ6C 4FLYA 3V8LA 2P9NB 2F9WA 3B73A 3TW6A 4I7HA 2HTSA 4CCJA 3TQNA 4BRNA 5JS2A 2DFFA 2O7OA 3CCRN 5M9OA 4ENMA 3K2AA 4DSLA 3TKYA 1ZRCA 2GIVA 2LNBA 1VQNQ 2YU9J 4S0HB 2HOAA 4J9DA 4WTOB 1U1TA 3ASNH 1HU0A 1Q7YR 5EEHA 2CQNA 1U84A 2EFIA 4W5TA 4BG9A 4OGEA 1T39A 2UXCK 3KXTA 1WA7A 1LFPA 1WFXA 2CH4A 1LV5A 3MMYB 1VQKA 1GRIA 4DYQA 3GL1A 2KXCA 3C6TA 1IGQA 3TVTA 5CKHA 4IHXA 3KZYA 4FTHA 1VQKN 1VQLT 5F1XA 1RDDA 1TK0A 1PWTA 3MJXA 1ZBUA 3OIOA 1FBUA 2DA3A 4IO9L 3HC7A 4C8QF 2LQNA 3LA3A 4XKWA 3VKIA 3G1JA 4Z89A 1A5XA 3HI0A 1SL1A 4PJOE 2EIJH 2BE9B 2B9SA 3JR9A 4LSNA 1BOTO 1RKTA 2EK5A 2ADUA 1QSYA 1HC8A 1Q7YU 3MEDA 3SAHA 3M8PA 3OSFA 3CBMA 3CC4N 4XLPF 2CUEA 3PQJA 1RLPC 4LD9K 3HZ6A 2ETJA 3FZKA 1GLJO 1RBVA 1U5SA 3NH1A 4NLBA 2DA5A 3H92A 2RE2A 1FP1D 4JLIA 1VYUA 3ZEUB 2DPUA 4J6YA 4Q5VA 3A2KA 1NHAA 4C8MA 4XU0A 1WSHA 4MO5A 3MECA 2NOGA 3C6AA 2HS5A 1QQMA 3DMJA 2XDPA 1XTDA 1I4K1 2M30A 4AHVA 1BR2A 3VQAA 4UVAA 1YX3A 3HXMA 1YW9A 2KJBA 1XC9A 4RCHA 2R0QC 5K1YA 1IB8A 3K58A 2RQVA 5E26A 1SFUA 2HOEA 2OF7A 3KP3A 3ZT1A 5L3CA 5DLQE 3F8NA 4UOBA 2D1HA 3DLGA 3S15J 2EHGA 4IHSA 3MKWB 5LJ5e 3A5NC 1OMIA 3VS5A 4UUTA 4I01A 3VA0A 3H36A 3CC2N 1RDWX 4K2EA 3CC2T 5C2FA 4A62A 4I6ZA 2Z5UA 3HSRA 2EYQA 2EJ9A 3CFOA 4A4HA 1JBMA 1YJWQ 3MN2A 3PO4A 2DXIA 1TNSA 1YJWA 1VNDA 4M3YA 1U47A 2MF2A 3HB9A 1VSIA 2HVQA 3K2ZA 1P4WA 4JK9A 2KRHA 4CZJA 4UVCA 2I5WA 3KFWX 5E3OA 1QGPA 2P5OA 2NS0A 2E1HA 2RHUA 2QXLA 1KC8U 2MOXA 5JMVA 5KPRA 2YUQA 3DTIA 3CCEI 3O3HA 4A3JJ 3VQCA 3KEYA 3BUZB 2D0NA 3K70D 4U0YA 4C92B 3KLGA 4KICA 3O9SA 3TAQA 2Z33A 4RW7A 1SFKA 4HUFA 1YNZA 2I5UA 4GYGA 2FO0A 3I5RA 5H20A 2ACJA 4KT5C 2RHIA 2DK3A 4XH1A 4II1A 4CF8A 1SEMA 4Y3OA 3ZL7C 5LHGA 2DL8A 2L3DA 4HNVA 4M75A 4Y52J 1LDJA 4XL9A 3IKMA 3FLGA 4Q0BA 1B6AA 2VWJA 2KZVA 2PQWA 4AIHA 5LY3A 4YFKF 2LF8A 4HCCA 3LZJA 2OPSA 1EWRA 1I94K 3OYHA 1IN5A 3UKRB 1UJ0A 1UG1A 3AG4H 1SS6A 5KK1A 4M78A 5EG0B 2Q31A 3H1VX 4RKUE 4J00A 2DPDA 3ZX3A 4YOYA 4HCBA 5DD8A 1XG1A 2YHBA 2MD5A 4HX4A 5KNLA 5AFUA 1JJ2S 3FKJA 1WWXA 1TW3A 4HF2A 4HKEA 3I0TA 2DMTA 4KUMA 1MUNA 3VS0A 2LJ1A 3CCRQ 5C4JJ 3OYMA 1L3LA 1KQSM 1O3QA 2KIMA 3L2ZA 3M4GA 1T0FA 1VQKQ 3DJCA 2NNYA 3D5RC 2DMPA 1TUYA 1XC3A 1KQ0A 1M1KC 3CCEA 2M0OA 5F0FA 3AVLA 1NZ9A 4M77G 2ZZDA 2UWMA 4L0YB 2H3JA 3KEQA 2FSWA 4IEEA 1WEFA 4B9XA 5D6EA 3CCMN 2EFNA 1B72B 2PU9B 5ED4A 3CJRB 4YELA 2PJPA 1JKPC 5BRFA 2BW3A 2NUZA 1HCRA 1VQNN 4XTVA 4F7UG 1YJWT 2JMCA 3LAMA 2VASA 2IW5A 4JQFA 4BQZA 4FYWB 4YDUC 2CGLA 3MCZA 2RHXA 2FOWA 4X9DA 2JOYA 4M63C 3CO7C 5CY4A 4FM0A 2Z1GA 3P83D 4EJYA 5FKKA 3S93A 2GM4A 2RKHA 4HSBA 5AQFA 4XLCA 2QLZA 3CCRI 1HNIA 4WWCA 2LF7A 2Y48A 1YG2A 5CR4A 2E1NA 2B4JA 3ZMUA 4Z0UA 4JX6A 2H3GX 1NGBA 1ZC6A 5GAN6 3ZX2A 3KYCB 3M53A 1PSFA 1Q81C 1I5LA 1XNQK 1KG7A 4OB3B 2X1EA 5FD5A 2R93J 3CPWS 4MO7A 1H1VA 4ZDOA 2E7WA 3R6MA 1YI2A 3QICA 3QB0A 3NMUA 3J7AO 1YVUA 2XGCA 4II3A 2QQRA 5IT9E 4YHHK 3DB3A 4Y13A 1UGQB 1YRNA 4HSRA 2M16A 4CZFA 3CQTA 4XU3A 4M7AE 3ZMSA 3G10A 4N9IA 3KLEA 1Z05A 1OVYA 4KUIA 1YBYA 1ZBJA 4ETSA 3M54A 2COWA 2D0BA 1KD1O 2KFZA 4Z4EA 1K1ZA 5FKOA 3BR6A 2B63J 4BDPA 3NE6A 5L23A 3CJCA 3PMTA 4XONA 2XY8A 4QTRA 2K2VA 5C15A 3TO7A 1NWKA 4XLEA 3ONQA 3O9TA 4BRQA 3ULDA 4IXAA 4GRIA 2OI3A 3TL4X 5F27A 4AHSA 4M7XA 4XK4A 2VBYA 3CI5A 4FM1A 2O4IA 5JI6A 4YIIA 1QSLA 1R23A 4BL0B 2GWJA 4WCIA 4DLGA 5D3GA 3FISA 2FYKA 1I5ZA 1USTA 1ZSGA 1S7EA 2ZMEC 3OBWA 1YITN 1UFMA 4M75C 1M1KO 4OIPF 5BPLA 5J3LA 2E2JJ 1RKWA 2DOEA 3I5UA 5C2DA 2JHJA 3CC2I 3HSTB 3G1OA 2FZCB 4A5BA 2OQGA 2CP3A 1MNDA 2CRGA 2E2PA 3QERA 1FW6A 1K9MU 2P9UA 1WGXA 4BE2A 4XH4A 5BNGA 3IAYA 1MUYA 2JS2A 3P7NA 3V6DA 4F7UE 1JXOA 5ERIA 3SAGA 3L1PA 1JXMA 3UDCA 2E4LA 4DNCA 1W5SA 4OWRB 1ZUYA 1T44A 3FXLA 4DU4A 2W82A 5CQEA 3G1MA 3OH9A 3LW5E 3RSEA 3ENBA 1U2WA 3VOVA 2JHNA 1TP4A 2FPEA 2DD4A 1M90U 2P7VB 3CETA 2CU7A 3CQXA 3CCJA 4OKEA 2EINH 4A57A 2PBIA 1ZTRA 4OFHA 3SD4A 3OIQA 5B66C 2NXNB 2CT4A 1QVGM 4BRGA 1VSEA 3GP8A 2P5GA 3S9HA 1S9HA 3K5LA 2YR2A 3H5RA 3WTUC 4EMKC 1AWWA 3R6NA 3VV0A 3DPLC 2FRYA 3BG9A 3KKSA 4DF4A 2JZ2A 1K4SA 1ODDA 3PO3J 1RT4A 3IH7A 1YI2T 2HPMA 2CH5A 3GW2A 3O8GA 3J80E 3GFLA 4I0AA 2VE8A 1UHWA 1PU6A 2HCKA 2DXTA 2VT2A 2XAUA 2DXBA 2OJ2A 2COBA 2KFDA 5ICEA 4MO4A 4CHPA 4ILJA 1RAEB 1ETWA 1BC7C 4MFEA 5C6SA 1R00A 2VJIA 3KYDB 5GAMd 1NOYA 1LCKA 2RK1A 2VUMJ 3LP1A 4BRMA 3CJAA 4O5BA 2NVUB 3K57A 5KE2A 4H5WA 4F9OA 1ETQA 2NRXA 3T69A 3DLLL 2JJ7A 5C42A 3D0SA 3T8TA 3CJ9A 5K7HA 2V8JA 3G6ET 3NFCA 2VXZA 5FU6C 3QJYA 1Z6RA 3AY9A 1T98A 2XB5A 1U8RA 4BKXA 3TANA 2FSNA 2KE9A 2MSYA 5ICGA 3UNGC 3S14J 5DUIA 2PFUA 3V9UA 1W7PD 4UY8I 1CKAA 5AQPA 2M4GA 1N9RA 4E2FB 3JTGA 1JJ8C 3JB9D 3DEWA 1JO8A 3SQ1A 3S41A 4CJ7A 4AVZA 1M5Q1 3RYPA 2HL3A 1APLC 5LJ3f 4BB7A 4M75F 1XD7A 4RTUA 3JB9F 4M3BA 5HS9A 5AQYA 2HBPA 3T1YK 4KH0B 2GTOA 1T56A 4CZZA 4V19K 4FLUA 3TAEA 3GYHX 3SEZA 4A3DJ 1K8KA 5DEQA 1D3BB 4HDUA 4R56A 3S1QJ 4HBLA 2J5OA 1VQLN 1SFOJ 3LP3A 1BL0A 2RJEA 3S17J 1STZA 1IAWA 3AAFA 1S1UA 4HUGA 2H6BA 4RG8A 3CZ6A 3ID6A 1BA5A 2YNIA 4WQ4C 1XX5A 3CMAN 2RI3A 1CZBA 4EW0A 2IDOA 4IDKA 2BOLA 1FMWA 4WF2A 5L3GA 2L7ZA 4C92A 1C0GA 3H6ZA 1YIJN 4XOPA 4RA2A 3S1RJ 1WBDA 4HXJA 5DTDA 4KH6A 1RGIA 3I0WA 1XJWB 3CCET 1UCRA 3VYRB 6AT1B 1R0CB 1VQ5Q 4DTSA 3HSBA 1SD4A 2EJFA 1IZ6A 2Q0RA 4E6KG 4OAZA 5IXBA 2KMUA 1Q82R 2W7NA 1JLEA 1ZBXA 3CLOA 1D9FA 4AFQC 3KLFA 2ZGWA 1YITI 2ICWG 1WX6A 4ZH4F 3OV8A 5LRSA 3MKZA 2O31A 1SC7A 3QFPA 1MMDA 2XB0X 4I6MA 5E84A 3LH5A 3JRHA 1ZQ3P 4PJNA 2P6SA 2CQXA 5CYQA 2O8EA 4O6JA 4FLTA 1BIAA 2XI9A 1WHKA 3E9FA 1W7PB 5IT9O 1WJBA 4BEHB 4HQEA 4M7YA 2X6NA 3W6VA 2E1MB 2RQQA 4J6WA 5D7UA 1VUBA 4CJLA 1UHMA 5J1RA 2DOAA 3LQQA 4NNJA 2IA2A 1LWYA 4XRSA 1AWJA 2UUAK 4KUDK 3V1OA 2ZPEB 2KBTA 3I56I 4LC9B 1WJDA 4RM3A 2FXUA 3ZX0A 4CE9A 5DYMA 2QWMA 3RRHA 2P81A 1S1NA 2DCEA 5AQSA 2RNJA 4XLNF 2ZNZA 4B9VA 3MZ8A 2JA8J 1X6OA 4YPHA 3KZZA 4CK2A 2FSKA 3B02A 3C0BA 2Z16A 1RPWA 1U9NA 2DQLA 1RBSA 5T7BA 2HNYA 3SEQA 3PO2J 2JZYA 2ELHA 5IP7J 4BRFA 4BROA 2DTZA 1ULYA 1E3OC 2NUPA 1ACMB 1Y64A 4F7ZA 3MWPA 4PJOG 1QLYA 2AKLA 3LWMA 5J2QA 2OV7A 2PNIA 2LQKA 2E7XA 2JTEA 5CZ1A 2GIZA 2LC4A 3SJJA 4WQ5C 4BEHA 2ZMEA 2DYBA 1T3SA 1GLFO 4IXCA 3VETA 3URGA 4N56A 1HDDC 5DM7R 1S29A 3L0QA 2CYYA 3G0QA 1MIJA 2RH2A 2BYVE 3L9FA 4M74A 4ZYDA 4DV7K 4B48A 3A0IX 2IVMA 1O75A 4M78F 1ORKA 2XGXA 1FBQA 1NG6A 4DBHA 3DYAA 4UNOA 3TCJA 2XDBA 4CJFA 3DEEA 1JTYA 1OH6A 1VQ8Q 2DPNA 3KP6A 5AIQA 3QETA 4QQDA 4A4KA 4DSIA 3F21A 4N0AC 1SAXA 2G8KA 2CUJA 4O44A 1VQMN 1L5UA 2H8RA 4IOAF 3JSOA 5ECAA 1ETOA 2VCPA 2V1DA 2P8TA 1BM9A 5SZTA 3CCMI 1MMAA 3IQLA 2NOEA 3JAMO 3JRAA 4C8QD 3VQEA 4DFKA 1ZSZA 4B3SK 3FBNB 4PJLA 3LSRA 2FUG2 2AZVA 3EFSA 2GUPA 3TPQA 2IGIA 3U9ZA 4BR0A 4NCBA 2H6CA 1M8MA 5HK3A 4UNFA 4M77D 2X6OA 3VTIA 3CJNA 1X4PA 2DPPB 4FYXB 5C25A 5IHKA 3SFMA 4NYFA 1OU9A 3FF5A 2HEOA 3QPLA 3IRXA 2PUOB 5KYWB 2V9KA 2YWWA 5M1NA 3VEVA 1WSFA 1KHCA 1WZOA 2ESNA 1JRIA 2DL7A 4R1HA 2NWMA 3U9DA 5FJ8J 2XU8A 3O4NA 2GBYA 2G7UA 4ISGA 1FSEA 2ZJPF 1N6AA 3V4GA 3MCPA 5IH2A 3L7WA 4PNOA 3VF6A 4WFAL 1BU6O 3TO6A 2K3FA 4PJOD 2IT0A 3S3NA 1D5VA 1JJ2A 4F55A 4RLQA 4FX4A 2VYTA 1G2HA 1BU1A 1ZYQA 2R5AA 2DD5A 4IIMA 1WIEA 4Q47A 2PMUA 3E97A 1ACIA 2FL7A 4M7DB 1N8RR 3RSNA 1OH8A 4BQQA 2L02A 1XCVA 2EPDA 1WGSA 5HRSA 4XTXA 5LL6Z 2HBKA 2K02A 4NO7A 1IJWC 3LCNA 4M7AC 4CJTA 2GA2A 1H92A 4CCOA 3GTQJ 2KQRA 4DZPA 4M3ZA 5KYXB 3ZRGA 4H0YB 3EG9A 4M77E 5KRTA 3BJ6A 3BC8A 1WHUA 1NM1A 4CDGA 2X6YA 4B44A 4YIRX 1YQMA 1BOAA 2H94A 1NE8A 1QVFP 1C6VX 2DO7A 2HQRA 4F04B 1RI0A 4ESRA 5KCMA 2GF7A 4K11A 2E5ZA 4KYWA 1HD3A 1X75C 4HYEA 5ICFA 3VRZA 1M3BA 3VF4A 2K5IA 3NTKA 3FLCO 2R5ZB 1BOBA 4ID5A 3J8AA 2HVRA 1DT9A 4DV3K 1ZBIA 1YF5L 2B6AA 4HW0A 4LH5A 4CHQA 2KZZA 3GF2A 3G6EA 4FE4A 3HJFA 5ICCA 4QKUA 2YT6A 1VQPN 2Q2EB 2KIFA 5LEJA 1XMAA 1NK0A 3SNNA 2KZMA 2L0KA 1HQEA 4CIGA 4HWIA 1TK8A 5FPDA 4AH9A 1U9OA 3HKZA 2WAEA 1E7OA 5AYFA 3PNTA 3ECHA 5K5OA 1JHHA 5GAMf 1OYXA 1EV7A 1R1UA 1B1BA 1M9SA 4BRPA 4E7JA 5IN1A 1IO6A 1T38A 3NF8A 2CV0A 2Q0UA 3VQ9A 2LMDA 3EAEA 3RMAA 4BR2A 3EYYA 1PJRA 2DVJA 1QZEA 4IQ4A 3KLIA 2JA5J 2BBYA 4IHYA 3SHFA 2VPLA 1ZXOA 3QAHA 2GQQA 2E88A 3QEWA 3CCYA 1M2VB 1KU2A 3CC7I 2FBIA 3LDNA 1UOCA 4DR4K 1P4AA 1W6XA 1OQYA 1IBKK 3AVKA 3QZ5B 4KT6A 2KNBB 2LKSA 1IUFA 3L09A 3G25A 4JI4K 3H35A 5LMUK 2QG9B 4EDUA 1X2KA 3JCMd 3VMFB 3KP2A 1R4MB 2E70A 5HP1A 2ZPGB 2HKOA 2CGHA 2LYCA 3UE5A 5I2MA 3VQ4A 1U04A 3MEWA 1NK5A 3EZ5A 2LKPA 2YSRA 2VKDA 5GJVB 1OKJA 5DPKA 1ETXA 5LJ3d 1LWVA 3BGRA 1GLCG 3REOA 1U6ZA 5DS9A 3B6PA 4CC3A 2M02A 1RABB 2VQGA 3CJ1A 4E9FA 4MDBA 2BVLA 2R5YA 3QWXX 4ID1A 2WBMA 2X3WD 3EE8A 3PNYA 4OU0A 3ZQCA 2DMOA 1NGFA 1R1VA 4CGHA 3EGDA 3E6MA 1SKUB 1VQOA 3NBPA 2EZLA 4RGXA 3ABMH 1UELB 1RAFB 3THKA 1N8RC 2JTVA 4BD3A 4C23A 1GXQA 4CJWA 2OC6A 2DIGA 4FJNA 3THVA 2AO9A 4XLAA 4IKFA 5DCMA 3V9WA 5B1AH 4IF4A 3H3NO 2NVQJ 4C8OA 4M75B 3MPUB 4DTRA 3VEWA 1VQKI 4C8QC 3VYTB 2QA4A 2ZF5O 4JRPA 1FWZA 2O0YA 2QSGX 5GANd 4KB0A 1ZGWA 4IRIA 4GKJK 1HLVA 1I3QJ 4QVDA 4M7DG 2AA4A 3VOEA 3TSWA 3CWAA 1VQ9A 4NCAA 4FSSA 1SFXA 2KMTA 1Q18A 3AVBA 3ZQFA 5HLIA 4DSKA 3CCMQ 2LVSA 5GANh 5C0MA 4DV5K 4BE1A 3W2WA 4GO1A 3UPUA 2A3ZA 1ASWA 2F48A 1ZSZC 1A35A 2KQ2A 3H0GJ 3TABA 3D5LA 3FEOA 1LPQA 2DBMA 3BTCA 3LP0A 4WCGA 2QTDA 3BR0A 4DGWB 1KAZA 3DPUA 1MSEC 4CUGA 3RMBA 1IXRC 2FQ4A 1IC8A 2FSJA 2VBXA 1E3PA 4DV4K 1JJ6C 3JB9G 3H46O 2OPRA 2O5RA 4FWMA 2ZFUA 4CK1A 4CGGA 3QJ6A 2NVXJ 3I64A 4RMNA 4FZYA 2NRTA 3VYGA 5CHIA 2P4TA 1RZ4A 4H0EA 3AA4A 1SMTA 1JQQA 1GCPA 3LFKA 1VQ7T 1GT0C 1VTNC 5AQNA 4C3JJ 1R5HA 4AHTA 2X0LA 5LFAA 1L3VA 5A0GA 4A3MJ 2E65A 1ZUKA 1XGMA 3ENOA 3BCBA 2KEAA 1R5ID 4C2UA 1TGOA 3C7NA 5FWBA 5HK0A 2CW7A 1O4XA 2XK0A 1NGHA 1VQ8A 4JKAA 4CEEA 2HHHK 1KONA 3DKXA 1VIEA 1A6QA 4WE1A 4F2SA 1N77A 1SV5A 1K78B 5KYUA 2DMUA 1QSSA 2QBYB 1JJ2P 5LJ3g 4LSLA 3P9CA 2GFUA 3HM9A 5GAEJ 2C0OA 1WLPB 1O1WA 4UUSA 2QSHX 2FD5A 2P9SB 3QDFA 1YWOA 5GMKi 4NCGA 1VQ8N 4XRMA 2E3HA 3I33A 1W2BS 3DRRA 3DLLF 1XG7A 1RESA 1QHGA 3HRSA 3LWLA 1RDAA 2O9LA 1LEBA 2YX4A 4MMKA 1R7JA 1Z91A 3SZGA 1YJNI 1VRTA 3QIIA 5CKBA 1BIUA 4H03B 3K1MA 4CBXA 2O6GE 5J6XA 4PDKA 3K1NA 2HPIA 3ULRB 1KAYA 2I5JA 3P8BB 3EGDB 1WAFA 2G7HA 2VKVA 4MEYF 4FJ8A 3DB4A 3U9GA 1SKSA 2YNHA 1XOVA 1E0EA 2O61A 3LSJA 2F2EA 2HDAA 4X1EA 4CICA 2I8DA 5BN9A 4CFDA 1OCTC 4XIDA 3F8CA 1OCCH 1AEYA 1XDSA 2NYXA 4K42A 4O8UA 1VQ9T 4C8LA 1VQ7I 2P6TA 2MCNA 2X1DA 1BI2A 3DP7A 3WU0A 2K27A 3N5NX 2NUBA 3DLLA 4QVCA 4EGZA 4E7HA 1FYNA 4BU2A 3FXJA 3K4BA 4DQ2A 4CYCA 2HDDA 1FEXA 4LDXA 3HSCA 2RA2A 1EQYA 4JI5K 4HVUA 1NJXA 5GMKh 1SKRA 5GAN8 3VODA 3PVLA 3E9OA 2GBQA 3CCQA 4ZYEA 3H6EA 4ELVA 4FJXA 1B72A 3ME9A 3M1CA 1SQKA 3V1RA 4CFAA 1XQPA 3NMZC 3CMAQ 2FEIA 3PMIA 4RB3C 1JUSA 5FDLA 1ZA1B 4BY7J 2VVKA 2JGUA 5LL6S 3QPSA 4XOTA 1HX1A 5GADP 4FSXA 2OPPA 2XSJC 3WU2C 1FIAA 4MGRA 3HG9A 2BXZA 2ID3A 1I3AA 4L0ZB 1HKBA 1PP7U 1VQ7A 1YHQN 2KT1A 4DEYA 1G4DA 4GGGA 4Z4FA 5DLOA 2A1SA 1MH4A 1CF7A 2EWNA 4JI7K 3NGZA 1IBMK 2CH4W 3G0ZA 4OPHA 2CGJA 3JREA 2R7RA 1USSA 2OZMA 4KH5A 3OOUA 2K4JA 3H3OB 4A3GJ 2JA6J 2NOBA 3OB9A 1JEGA 4M77B 5E3LA 3C6UA 1H8KA 5GIPA 1KYWA 5FW9A 2L2OA 2V1XA 3CMAI 2LKXA 1ZREA 4CEOA 1QTMA 3QO9A 1W1FA 3QYBA 4JJDA 4M9ZA 4HDVA 2R7QA 3BTJA 1QQOA 5KPTA 3T3FA 4JBAA 2LREA 2B8AA 4MZTA 4PJOF 4FWSA 4RAYA 4BY6C 1RILA 1WQ2A 2STWA 1OQKA 2ESWA 2K5FA 3HKSA 2M3AA 1N78A 4YTLA 1E4FT 1OX9A 2YHWA 2A28A 2PEXA 5F08A 3AG2H 4DBQA 4QSHA 2VV5A 1VYTA 2BZ8A 3VQPA 1JLCA 3R2XC 1HMVA 2Z0WA 4FCYA 3ZYYX 1YW7A 1T0FC 4OLBA 4CC2A 4UUSB 3PNWC 2R92J 1MU2A 4OMLA 3C94A 1Z3XA 4PJOB 3K0SA 3MMVA 2JA2A 3TOBA 3TEDA 4JKFA 3CPWM 4ZYGA 4L9JA 1SD6A 4ZYAA 1QHTA 3CCLN 5JLFA 4QWQA 3M8RA 1VQON 4FJIA 4BHCA 1VQOT 3ZN1A 1KZHA 5LEKA 4CZLA 4OX9K 4J7IA 2LJ0A 4YOQA 1OCPA 1IGNA 1NK3P 4H8KA 3JYTA 2O8EB 4FJLA 2JNGA 2NOFA 1Q82U 4QS7A 3HP9A 4PLLA 3V9SA 3V8KA 1AA7A 5KQDA 4Y1CA 4BXFA 2HW3A 3H9NA 1EJ9A 1KQJA 5AR0A 3ZT0A 1Y07A 2VC8A 1TTYA 1NG7A 2VGNA 1G3SA 2A1RA 1ATSA 3V1QA 3THYB 2EZHA 2J6FA 3QZ9B 5CE3A 4I0BA 5HCKA 4QS9A 4EIAA 5AQVA 2YRCA 2RMOA 2QGGA 1M3QA 1M90C 3UB5A 3ZMDA 1J6ZA 3MP8A 3CP2A 3I4NJ 4OFAA 5JLHA 1W2BP 3CCEN 3KD5E 3E1SA 2DF6A 2HZDA 1C0WA 4A63B 4FU6A 1LEAA 2OPTA 5JHFA 2P9IB 1Q1VA 1ON2A 4FJMA 4BR9A 1M90O 1DGRM 4M3TA 4MDXA 1YJ9N 3L6QA 1LDKB 5BOXA 5LHHA 2H1LA 3CXCA 2V8KA 2HSTA 2OCEA 1ZG3A 4CK3A 5KPZA 1IXCA 2P9KB 1Y6IA 1B07A 3VSKA 1ZK8A 2COZA 2NYSA 3FHGA 1RUNA 1K76A 1Y7XA 4GY2B 1YXQA 1I6HJ 3IFRA 3J7AY 2C0IA 4F17A 3HSFA 4A69C 4XTZA 1OCZH 3VQDA 2KKZA 3QPTA 4LUEA 2CGKA 1WEGA 2HNHA 3CPEA 4CESA 5GAOm 4N47A 4M3WA 4OMYA 1TQMA 5AQGA 1VQ4N 4XKBA 2E19A 4PSXA 2K9SA 2YUPA 4IO9F 2RNAA 1NGCA 4J9FA 3AGKA 1VSDA 4O5FA 1CGPA 3SMSA 5HDGA 1P4XA 3GTGJ 1T8IA 1ZR4A 1RIOH 3P31A 5FLXZ 3M0PA 2GQVA 5K7ZA 3A8OB 4YY3K 2GAUA 1J5YA 1KAXA 4M3DA 4FE7A 3U6FA 2VIXA 4JN4A 4JP0A 3L2CA 3OQ5A 3N4PA 4ZTFA 1X19A 1NLVA 4KI4A 2O8DA 3D6RA 5GP9A 4C92D 2E1MC 1IKXA 2JN6A 2O8XA 2DYSH 1M3CA 2HEQA 3H0IA 4DQIA 2M9UA 4IURA 3OGDA 5AJ3K 1TKZA 3T8RA 3KLOA 1M8VA 2JRTA 2X3XD 3MCAB 4JX5A 2LP5A 3QBXA 2RPNA 1BJZA 1Q86R 3COAC 3H9JA 4IPAA 3P8DA 1JLFA 3HYIA 1YQLA 4BDZA 2RQWA 2EQUA 5JLWA 4FLXA 2LLKA 2EQMA 5B1BH 3KZIC 1JLGA 4KTQA 1FOKA 3JV3A 1JKQC 1N33K 3MWMA 5IPAA 4B9MA 2LY1A 2QASA 4NS5A 4E7ZA 1TG0A 1GLEG 3CMET 4PL8A 5DK5A 4L59A 3BY6A 5GAMj 4JD2A 4IDHA 1KQSA 2DETA 1HSJA 2IA1A 5TKWA 1Y97A 1YJWI 3TDZC 1QA6A 1UHFA 5GAN3 1AOYA 3QNNA 2RHYA 4KFCA 4BR5A 2FHDA 1LMZA 2XV4S 3JSCA 1L3TA 3SZTA 2IVNA 4I09A 2RQUA 3M5RA 3X24B 4FT8A 4CJVA 3NGIA 3SWNA 4N9HA 5E8GA 4AMCA 4F92B 5AQTA 3KFVA 3GOXA 5GAN7 5L3BA 3HOVJ 2QGFB 1CKBA 2HBLA 2ED1A 3I35A 1U2VB 3NFAA 4KO0A 3IRRA 4B6MA 2DW4A 3NWSA 1XUPO 4RTYA 4CJUA 1IH7A 1O3TA 2NUPB 3JSPA 3KD1E 2KQWA 1LKXA 1B3QA 1NJIO 5JS1A 3WNGA 2DBKA 3LZIA 1OEBA 1BL3A 1DQUA 4J9BA 4EMSA 3FM3A 5KN8A 3C1DA 5M1OA 4WX9A 1TNTA 3O9RA 2KRNA 1FK9A 2UZKA 5EVZA 1NLOC 1X3WB 2DZ9A 2A6TA 3QEVA 1X69A 4DTJA 3CCLQ 2Y1JA 4UVBA 2VQFK 2RD1A 1NNEA 4ZC3A 1TWCJ 1LNWA 1QZ5A 1EBMA 1MJBA 3M0QA 2F8TA 1O3SA 5KGWA 4F8RA 4NC7A 3FE1A 1CLQA 4ENKA 4Z02A 5I11A 2LOOA 4ILHA 2IG0A 4JKGA 4RAZA 1Z77A 3SV4A 4FETA 4FPBA 2YHXA 5BR9A 2CSQA 1W4MA 3N4MA 2BE7D 1MJ9A 1K4US 2GXAA 2A5XA 3A0BC 1QZ6A 1YCSB 3I55Q 3LP2A 4J2BA 4OINF 3LLRA 2QA4N 2ZCFB 4XN3A 2IVWA 2ZPBB 1I1GA 3PV8A 5C4XJ 3LH0A 1XQSC 2OJED 4MQ9F 1WHJA 3JB9I 4FWOA 2NZTA 3HP6A 1O57A 3DLKA 1XQOA 3PFYA 3MKDA 4FXDA 5AZJA 3G73A 4GV6A 4TVRA 1W5CC 3ASOH 3G6EI 4XIUA 2LJ3A 4KHQA 3RQ4A 2JVGA 3SDGA 2QWWA 1A0NB 1BI0A 1AHJB 4CCHA 2IPQX 3M0UA 4B3XA 3FXRA 3LGLA 3CPWA 2JQ7A 4C3IJ 4P9FA 2VONA 3R6SA 3EGUA 3HOUJ 1WNLA 4A2BA 1B59A 3OL4A 1SL0A 4WXCA 2BTTA 1HSQA 4MHGA 2E5KA 3MEUA 5J39A 2BKDN 1TBXA 2A40A 2M1HA 1Q8IA 1AWOA 5D5XB 3BG3A 2V51B 5B8HA 2XRNA 3E0JB 4GXOA 4BUPA 4FK0A 1EETA 3D5SC 2PY5A 1ZG5A 4C5HA 3PTAA 3F10A 3KWGA 1YE9A 5IY5H 3TW7A 1HK9A 3KKRA 1TWBA 4LF9K 4XKCA 2L2PA 4CZMA 4M7AB 2L3SA 4OOIA 2HZTA 2Q2EA 1KQSP 4EJOA 1UG0A 2E6LA 5J1YA 3MN5A 5H6QA 3JRBA 4KISA 1Q86O 4J19A 4JI6K 4M78D 2B7EA 3RVCA 3CD6Q 2IPOB 3GZ5A 3INZA 1TVRA 2LR8A 1SAZA 1HF0A 3QPHA 4UC4A 2RJFA 3NAUA 4CRIA 1S3XA 5F04A 1U5TA 2O01E 2CP7A 1OCOH 2HVSA 2L4AA 4FHTA 3HTUA 9ATCB 3TAFA 3D7SB 2LDUA 2K4BA 4BDYA 1J3TA 1LAWA 1W70A 1QCOA 1NK6A 4EW4A 2QEXQ 4EMKA 2XF6A 4JV5K 2X85A 3W3CA 2DMQA 5AQIA 1L3UA 5AQRA 4A3EJ 4DZJA 4U7DA 3PIPA 2YG8A 3OYNA 2CUDA 3ASKA 5DCFA 4E9EA 3GTLJ 1M1KR 1UJYA 4H0VB 4JI0K 1ZHIA 2Y1IA 5TRDA 4UV9A 1OU8A 2M1BA 3VESA 3AA3A 4C92E 2NUTB 2DJQA 1OI1A 4AC0A 4BJ5C 2WC9A 1ZGAA 5L8RE 5CVVA 4K43A 2DILA 5D6XA 1ZG1A 5KCHA 4XRFA 2XHKA 4OAYA 5GAEP 1JKHA 2ZM6K 1TLHB 2Q1ZB 2IJLA 1ZYRF 2WB1A 2K9MA 5DV5A 1WSGA 1QWEA 3BR3A 2RN7A 3A8GB 1A31A 2VOOA 3K1PA 3AFHA 1GVDA 2OTLN 1N8RO 1QVUA 2P5KA 4AHCA 3F70A 2HYJA 1MDUB 1ABQA 3MX2A 4LF5K 5TKYA 1E6GA 4XLHA 5EYRA 2IP2A 2L9NA 1WJFA 5AQWA 4Q5WA 1Q1HA 1GV2A 3E19A 3PL8A 4IEJA 1D0ZA 5A2QO 3E5QA 1JCEA 4ESJA 2O9VA 4B9QA 5CIUA 2A69F 1VQ7N 3DXMB 3ZR8X 1RAAB 2EV5A 4M7DC 2MH9A 4KFBA 1QVFM 2M0MA 1IV0A 4XNFA 1FJGK 4WK8F 4B08A 1WUAA 3SUOA 2PYLA 4N41A 4C5IA 4EIKA 2VPRA 5BR8K 2MK5A 4ZZDA 1KC8O 4JKBA 3EN9A 2IRFG 1VQ6N 1BO5O 2KYBA 1BIBA 1TUCA 1FX7A 1YAGA 1XB4A 1YI2I 1CZ9A 2XGDA 2Z1HA 3BTLA 5FWCA 4N0BA 4NL2A 5M1FA 2MAMA 3CD6N 3RR7A 2MH2A 2O3FA 4A5AA 1Y0UA 3ZMVA 2WC2A 2JUFA 4MLEA 1P8ZA 3JCMQ 1HKQA 3V7SA 4EA5A 2XKOC 4C92C 3CJ7A 3BZ6A 5E3MA 2B0LA 4C8NA 1U0JA 2FNPA 5F0XA 2H3EB 2LX7A 2D0AA 1S72Q 2Q1NA 2RKIA 3VN5A 2K9LA 1I8FA 1CSKA 2BV6A 2J4RA 1RT2A 1RADB 3DRSA 4RM2A 2QA4T 3QOPA 1MWKA 3ERMA 1OPKA 3S2DJ 5GMKj 5K14A 5D5VB 1TKXA 2QWPA 3SZ2A 1NGGA 1K7AA 4PZJA 3LWIA 4R79A 3ZSYA 3ZQIA 4AM6A 5H1SQ 4Y92A 2YV0X 1OYYA 1NJIC 4J8OA 3G6EQ 3S1NJ 2RPIA 4AHRA 4KDPA 2ASMA 2HHWA 1ILYA 2RREA 2R7DA 5DD4A 4X6AJ 4PJOA 3VEOA 3HOYJ 3PUBA 3G7ZA 2E2NA 1WI3A 3JXUA 3KETA 5IWAK 2O8FB 4B8CA 1XWLA 3EL2A 5HLGA 3I56T 5E3NA 1RRJA 1MBHA 1WSEA 1F5TA 1RTHA 1QRYA 4A6DA 1IN7A 1KG4A 4KAZA 3DXKA 2PVDB 4BWJA 2F5EA 2AIRB 3WTTC 4H4KC 1V29B 1W0TA 1SG5A 4MMLA 1RI9A 5LJ5d 3Q0WA 3BR2A 1BUPA 4B8AB 4I9LA 1EH8A 3CWSA 1JCGA 2WADA 5AQHA 4CD3A 1W1WE 1ZLMA 1C6VA 2MWPA 5LGNA 3NGYA 4I98B 4DMNA 3IKVA 3VFZA 3CCJI 2A08A 4KH4A 1BBYA 1TAQA 2Y2ZA 4C0GA 2VG7A 3K4KA 4Z88A 1LWFA 3J80Z 1Q9YA 2DA9A 1PDNC 4PGHA 2M45A 3C95A 1GV5A 5FKLA 1NJIU 4TSXA 3JCMh 3RCOA 5HVQC 3PX6A 5AN4A 1SKWA 2Z3YA 2VKEA 3THXA 4B9NA 4PK4A 1R77A 3ZSOA 3SQ4A 4NL3A 2FG0A 2XPVA 2Q0OA 3H3VK 4NZGA 3HDDA 2EH3A 1X1PA 1MGTA 4OF1A 3I4PA 3FGUA 4C92G 1JXSA 1BWFO 2RGVA 1K61A 1L0OC 1JXBA 2GA1A 2XROA 3R1XA 2A41A 3U3YA 5GPCA 3VEZA 1U4BA 2ED0A 3FMQA 3JAMK 4D0PA 2CFOA 3GE1A 5DDGA 5FU7B 2X74A 1VQ5I 1D3YA 3E5UA 3FXMA 1B8IA 3TAPA 2V79A 4HNUA 2PTKA 3E5XA 1QU3A 3SUQA 1R5GA 1Q9XA 2YXYA 4BJTA 1P92A 3CMEI 2ZJRL 1B34B 1HXDA 2JWLA 3J80O 2FE3A 5IT3A 2MC4A 4RUGA 4IJNA 4CZCA 4CCMA 2BANA 4KITB 4H0PA 3WXJA 2XF7A 4CZIA 5EU7A 3CCVQ 3S16J 4EPCA 4YDUA 3E9LA 4WXHA 3ZT4A 4DSJA 2PMZN 1UGRB 3OSVA 4W5OA 3MAQA 2OZSA 1T2KA 4B21A 3F2KA 2IGNA 1QO0D 2IC3A 3N0UA 3HOWJ 4GCVA 4FL6A 3HGGA 3P9IA 4J2DA 1ZRDA 2VQLA 4IZZA 2WFBA 1BA1A 4CCKA 2JT4A 2ZJQL 1WXTA 2EJGA 1XDUA 1DP7P 2VT3A 4LG3A 1WB9A 4XSXF 2GWRA 5F2RA 4XTUA 1WJRA 4M3FA 2R7YA 1G59A 4CC4B 3ZCMA 2EYZA 1Y0NA 2YUNA 1EX4A 1Z9QA 1XNIA 2P9PA 4XRSG 5BMZA 1VQNI 2X35A 5BS6A 5EG0A 4K8ZA 1UA0A 1S9GA 2YPRA 2KP6A 3CO6C 3M58A 2UXDK 1XMKA 2X51A 4CGJA 1IGUA 3FXKA 2KY9A 1ONVA 3CMAA 2J06A 3IDHA 1UHCA 4G7OF 1VZ0A 1FSHA 3T1BA 3CESA 2BHZA 3K4LA 4LF8K 3M3YJ 2GOMA 1NK7A 2HHUA 1WBBA 5A2QK 5KI6A 1OH7A 5JVGL 1VA7A 1R22A 2DJNA 3J7ZI 1RT7A 3F3XA 2HAXA 1PRLC 3U23A 2AP1A 1KVBA 2TDXA 4H0TB 4RTTA 2HNDA 3FXOA 2P9UB 3K9JA 3ULEA 3SYZA 1OX8A 1LWWA 4CC7A 3K70C 1ITGA 2F4OB 2H1KA 4HTUA 1KG5A 2NRWA 4FJ7A 3I8BA 2DFIA 5AIPA 4B9UA 1FIPA 2E64A 2OX7A 2XAQA 3T9NA 1AD5A 3F0CA 2K2MA 2KISA 3VUBA 1UGSB 2FC0A 3ZN0A 1H89C 1GCQC 3OMCA 3A8YA 4CSWA 3VU3C 2GTDA 1IRFA 4FYDA 1R36A 3G6EN 3CC7T 2NOIA 1YJ9T 2KLOA 2IVOA 3WNFA 4IUVA 1SVLA 4CF1A 3HHHA 3C2BA 3GG4A 4RTZA 1N8RU 3LAKA 3CQ8A 1GHCA 3H3ZA 4KN4X 4ELZC 2MC3A 1D09B 4MLHA 5H6RA 2ABLA 1NJIR 2ISYA 1HKTA 1I27A 4H0OA 4LD6A 3HIFA 3ZXSA 4AFSC 3NGPA 1WQWA 4HPQA 3O80A 4X66K 3PLAA 3VYHB 1QVGS 2JTFA 4LFUA 1NMNA 3QRFF 4CHYA 2UUBK 3NRVA 4IX7A 4A3FJ 2VN2A 1KSWA 1FMKA 2RHKA 1SANA 4PFOA 2XHBA 1ZLKA 1IBLK 4BXXJ 3Q1JA 4OLAA 3V8JA 5TGTA 3OY9A 3Q0UA 4JK1X 3VA3A 2XRLA 4A3BJ 3HL2A 5J2NA 5AZJB 1I1JA 3KBGA 1HJRA 2IAJA 1MDMB 5D5UB 4IRGA 3PY8A 5CPRB 3HOTA 1RDCA 2E5NA 3OYFA 3IG1A 3O8VA 4L5GA 3KHYA 2MABA 3QLHA 1IKWA 1OVQA 4GBQA 3TAGA 4D5CA 4YOUA 1NGJA 1BI4A 2E2OA 1RNLA 1RUWA 1HQCA 4Y1DA 3H0DA 4LFAK 2ITMA 2DE0X 2OAUA 3LM2A 3EEQA 2P4RA 3WTVC 4IEIA 4FWPA 2EIMH 3RJPA 2EGAA 2OTJA 4EZ9A 1JUMA 1NEGA 1T0JA 5TJJA 5CO7A 5FRMA 5TISC 4GW6A 3P39A 1TL8A 3RNJA 4DJAA 1MUZA 4QPOA 4B1WB 3JCMV 5D6WA 4L8RB 3LSKA 4BXUA 3J81K 2KFNA 1ZELA 3WG9A 3A1YA 1HNVA 3G4SA 4JK8A 3GLLA 2HBMA 2LQWA 3MD2A 3O1BA 5AQXA 4JI8K 5L3EA 2A0FB 1G3WA 4LIUA 2DTOA 2W03A 1MBFA 3UA7A 3P1GA 2OPQA 3ZQQA 5LJ5g 4CEZA 1PSEA 1KSPA 4JI2K 3I58A 2JUCA 1BC8C 5SWMA 2AKKA 3HPHA 3ESWB 4CGIA 4FVMA 1ASUA 3HT3A 3WTSC 3UR3C 4HNTA 1YJ9A 4AF1A 1KD1U 3QIPA 2G8IA 2L7MP 5FKMA 1POGA 1LDDA 1M3HA 4LB5A 4AIDA 3E9GA 5GAHP 4A0XA 3ALYA 2LCSA 2QQAA 2FF3B 3ZPLA 4NB5A 3HL8A 1TWFJ 4L9TA 4ZGDB 1IHVA 2HSEB 1VF9A 3VEPA 1R58A 1V54H 5FB2A 2NRRA 2WSFE 4KHSA 1Y57A 2A3SA 4KA4A 3EKUA 2HKNA 2LRDA 1NM7A 1GOCA 1T8EA 1VQ8I 3CVSA 1ZX6A 3W0LA 4XKVA 1QQIA 3H5NA 3I59B 1SAUA 1C1AA 5BQTA 2DZCA 5D6YA 3O8HA 4B3TK 1BJAA 3KP5A 1X3UA 2JN0A 2F7TA 2AQEA 4BNCA 5EEGA 3CMEA 3QP5A 3OYJA 2YS9A 1KQ1A 3H8ZA 3JW4A 3RRGA 2QKBA 4M7DF 4F3QA 2XGEA 2RJDA 4EZ6A 1YVNA 1X4OA 3VQQA 3PX4A 3REAB 2DODA 3K4MA 1RR7A 2A36A 5CVJA 2X6WA 3BF1A 4M75G 3MEEA 2Y69H 1Y96B 1W5TA 3HOSA 4AG1C 2KIQA 5AQZA 3SPYA 3QXEB 4ESFA 2PI0A 4K41A 4CYCB 4CFCA 4BGBA 3K5OA 4KIFA 2AT1B 4E70A 1BW6A 2D1KA 4I7FA 4UV8A 1Z9ZA 3LA7A 1Q81U 3KNTA 4M78E 4Y91A 1ENHA 5CQXA 4KGZB 4M7AF 3FFKB 5GAMe 2KRFA 4DW6A 3WGGA 4B1VA 3RMCA 3VQ8A 2W0ZA 1TUUA 2XPWA 4JLGA 4CCLA 1TC3C 4G8XA 3QBWA 2K5LA 1EXQA 5E1XA 1PU7A 1SSHA 1YIJA 4KN7X 1OJLA 3EG2A 2VXFA 1UMQA 4EFHA 2ME0A 1RRQA 3GTOJ 5EZHA 1OZ2A 3PUFA 4UHTA 3DU5A 2LNHB 2XAJA 1BA0A 2XAHA 2Z1JA 2GLOA 4YORA 2G3RA 3M8SA 4EP4A 1ZN2A 2RQRA 1FYMA 4D7NA 3QYGB 3VQ7A 3F73A 1VHXA 2PVOB 1ORPA 4GMJB 4R55A 3HM8A 4DR6K 1TQIA 5GANf 5DM7F 2GQIA 5K5RA 2H56A 3R3LA 1VQ8T 4GNIA 2DJZA 2KKOA 3KZBA 1Y1WJ 3BG6A 5DUKA 2QM3A 2WA0A 1V5EA 1MMNA 4M78B 2HXOA 2Z1DA 2DL3A 3TGNA 1LFUP 2R5ZA 4ZNXA 3F72A 1IKVA 2EWSA 2FZGB 3MFKA 3LA2A 3G71I 3K4JA 3A5MC 1CXQA 4F7UB 3OJSA 1R6RA 2E6MA 1M1FA 1R0AA 2RI2A 4EATA 4F16A 1G6NA 4F91B 2EFOA 1F4KA 2G8FA 4DF8A 3J7YJ 4PKGA 3L2VA 2CFXA 3AVFA 1YUWA 3VB2A 5HLTA 1HUXA 3DV8A 3LYIA 3S2HJ 1I81A 2PQ8A 3FKIJ 2A5WA 2M9HA 2EZIA 3SJMA 2FBHA 2DA1A 3E7LA 4M77C 1AKHB 4NC6A 3F8BA 1NPRA 1KFDA 2LZ6B 2EGEA 3MXJA 1TOVA 3NF6A 3LAJA 2CWEA 3M57A 1NBEB 2CQKA 1QHAA 4E47A 1O7FA 2K4YA 2LH9A 1S22A 3OS5A 3ZSVA 3CDLA 3LMMA 4Z94A 1MNEA 1Z3YA 4N4GA 2HL5C 2QXFA 1NTCA 3MEVA 5F64A 2YNFA 4BACA 3PIOF 2JWKA 2MGQA 1LUJB 3LPUA 1NGDA 4W97A 1K8AU 3HTSB 5CHZA 4FJHA 4A2AA 2CDTA 4CECA 1BQNA 1KIKA 3OA6A 3AO5A 5C3EJ 2VOPA 3T5XA 2K9QA 3O6BB 1A04A 3DKYA 1R1TA 4A0YA 2XASA 4MDAA 4IOCF 3RMQA 2ZQBA 5BRHA 2Y9ZA 4ZGJB 1NKBA 4CEFA 1BCOA 3NF9A 4HSTA 2Y30A 4XM3A 1ZR2A 3HOXJ 1LVAA 1V1CA 4YOVA 1YCYA 2HMAA 2DTUA 5FFZA 2M0YA 1K9MR 4DS4A 1PM3A 1X58A 1YP5A 4P55A 5LGUA 1LWCA 2W40A 3V4IA 2QWOA 4B9LA 2LTPA 2EA2A 1YTYA 2H8HA 5FU7C 1YTUA 2NRZA 2DT7B 4FASD 2OFIA 1XNRK 4N4OB 3ABLH 2WAQA 2M8EA 1YLFA 3SWNB 3DOLA 5FRNA 2CYZB 1K73O 3MN9A 2DTRA 3HXLA 4L5EA 1SRMA 1VQ4Q 4DB3A 2TCTA 2UXXA 4LLGF 5AQJA 3CD6T 1QNTA 1SHGA 3PT9A 2W48A 4OGCA 2E2HJ 1T3LA 1ZBSA 2VQEK 3TTCA 4BC5A 2O8FA 4MZPA 2STTA