3OS1A

Pfv target capture complex (tcc) at 2.97 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os1A03
3WNGA 4FCYA 2XY7A 4NYNA 3OJUA 4DFPA 3V4IA 1W9HA 4OPJA 1KRPA 2R5MA 1JL2A 1FKOA 3MP8A 4KRFA 1WSJA 4M41A 3KKRA 3V81A 3DLKA 3ZSRA 3UWNA 3DOKA 5IAYA 5DMRA 1OZ3A 3C6UA 1U04A 3OYHA 1TGOA 1CLQA 4II1A 4O0IA 4CEDA 2E6MA 2R7YA 3DM2A 3T3FA 1JL1A 3HPOA 3NTIA 4N56A 1TK5A 2JZ2A 4CJRA 2XDPA 4DTRA 1RILA 1WLJA 1BL3A 5K14A 3DLEA 4IG3A 2GV9A 4OGCA 3VQAA 5KGXA 1D9DA 2EHGA 3NH1A 1VSHA 4AHUA 4B8AB 4CESA 3FC3A 4CIEA 4CFCA 4F3OA 4FW1A 3O4QA 2IOCA 3SUPA 4B9VA 4BDPA 1TK0A 4I9QA 1A5VA 5KCHA 3IS9A 4IUVA 5HRRA 1QQCA 1Z25A 2R57A 4DSFA 3RMDA 4PLLA 2IGIA 4PY5A 3VA3A 3K2PA 4FJMA 3QEXA 1XNIA 4IUQA 4DTJA 2HHQA 4DSJA 5HP1A 4R5PA 4E7LA 3AO2A 2BE2A 2X4WA 3TWHA 4BDZA 3HVTA 2B6AA 2A1RA 2RHUA 3LH0A 4FW2A 3NNQA 3K5NA 3TI0A 1RBRA 4J2EA 4CEBA 3MP1A 3QEVA 3MEEA 3QEWA 4FU6A 4JS5A 4PA1A 4CJKA 3F9KA 3HJFA 4CEEA 5J2NA 3VQ7A 4FJJA 1ASWA 5JS1A 1WJRA 1O1WA 4KB0A 2X74A 1QSLA 2G8UA 2F8SA 1BIZA 1CZBA 4B9TA 4FLVA 2HQEA 3H08A 3AVNA 4DFJA 3NH2A 4Q5WA 3EZ5A 2HHVA 4BWMA 3KIOA 3KTQA 4QCLA 1ITGA 1LAVA 3CG7A 1ASVA 5KGWA 4K8ZA 3TARA 3DYAA 1RBVA 1NK7A 4A4FA 2F8TA 3AVKA 4UC4A 4CJVA 4KHYA 3KK1A 4RW8A 4GY5A 5HRNA 1IH7A 3IAYA 3SQ2A 3DRRA 1G5VA 3DLHA 1NJWA 3C4SA 3SUOA 2G8HA 3THVA 2VG7A 1TKDA 1QHTA 1C1CA 3CFOA 1NK8A 4H8KA 3HM9A 1S9GA 4DF4A 1UA0A 1VRUA 4LD6A 1C0TA 4CIFA 3V1QA 1YVUA 2RJFA 1WSIA 4CEOA 3O8VA 3RR7A 2NLUA 3PO4A 4CF8A 4NZGA 1Q9YA 3NHGA 3VQDA 3NFAA 4OJRA 3ZT1A 4OKKA 2LDMA 2G8IA 4FJGA 3META 4CIGA 1N27A 1Z26A 2KW4A 2A1SA 1X9SA 3WNFA 4FJXA 1SUQA 1SV5A 4FLYA 1C1BA 3AO4A 1L3UA 3HXMA 3ASMA 1LWFA 3CYMA 5CY4A 2B4JA 2EFIA 3K58A 4IFVA 1BI4B 4O5BA 4QW2A 2PYLA 3M8PA 4Y1DA 5HROA 3P83D 4PLIA 2Z1HA 1NKCA 1JLFA 3ZT0A 2YRVA 4FJ9A 4KREA 1T03A 1W0HA 2DFEA 4HUGA 3PV8A 4JRQA 1BCMA 4CJPA 4C5HA 4E1NA 5FRMA 1D8YA 3M8RA 4FZZA 3LWMA 1JLGA 2X6NA 1JXEA 2HHSA 4C8OA 1TL3A 3VQ5A 3OYLA 3SI6A 4M3RA 4JS4A 3AVCA 4TSXA 1TVRA 5HBMA 2HHWA 2VG6A 3KUFA 3RWUA 3LP0A 3QBYA 1WSHA 3KLEA 2YHAA 4FZXC 5I42A 3QIIA 3IG1A 4CFBA 3TAPA 1GOBA 4EZ9A 2LCCA 1UAXA 5FRNA 4DQPA 4DTMA 1WSGA 4DLEA 2RF2A 3TAGA 1WAJA 1IKYA 4B9UA 1YTUA 4CGHA 1XHXA 3V9ZA 1KFDA 5KCOA 4Z4HA 3MXMA 4E89A 3UIQA 5SZTA 4I2QA 3U3GA 2D9TA 3TAFA 1KLNA 3OVNA 5KRSA 1C0UA 1DTQA 1TAUA 1HMVA 2I5JA 2VYTA 2OPPA 2OA8A 4DSLA 2EQUA 4BE1A 3ULDA 4CJEA 2DAQA 1TKTA 1VSMA 1NJYA 4CHQA 1KVCA 2EQKA 3G10A 4RG8A 1KSPA 3AO1A 1IKWA 2M0OA 3VQEA 4M3XA 4EP4A 4DQSA 1BIUA 1KFSA 5I3UA 4HUEA 4CJFA 3PO5A 5C25A 3ITHA 3O4NA 1RT3A 1L3VA 3M8QA 3SV3A 1X1PA 4FLWA 3T19A 3LGFA 4QAGA 4AHTA 4EZ6A 1F21A 3DLBA 3QO9A 3LANA 3LALA 3KD5E 2RI3A 1HJRA 2G8VA 4C5GA 3C95A 2KZMA 2Z1JA 2IDOA 5CZ2A 2F5KA 5SWMA 1UA1A 4HCBA 4DMNA 4YFUA 4KKOA 2PZSA 3OB9A 3PY8A 4W5RA 4NS5A 2BDPA 3WNEA 2P0KA 1NJXA 1VSLA 4DS5A 3S3NA 3SJJA 4B9LA 1KTQA 4FM0A 3LZIA 3V9XA 3JSMA 4KO0A 3DB3A 3OYNA 4CECA 4CF0A 2K3XA 5D6WA 4W5TA 3DRSA 1BQNA 3HP9A 1QSSA 1IO2A 3FFIA 2DY4A 3HYFA 1BCOA 1YT3A 3K5LA 3PUFA 4KHSA 3K59A 3B6PA 3TAEA 1HYSA 3TAQA 4EP5A 4FK0A 4HUFA 4PWDA 3UT1A 4FK4A 1OZ2A 4IURA 2FBVA 4CE9A 5FROA 3LAKA 1X9MA 1N6QA 3EY1A 4B9MA 4JRPA 2G8KA 5KTQA 3NF9A 4AHCA 4FM2A 3RRGA 3SYZA 3PX6A 1BQMA 4N4IA 3PX4A 2Z1IA 1RTJA 4A4EA 3ZCMA 1I39A 4FVMA 3SV4A 2YNIA 3FDRA 2IC3A 4NCAA 4BACA 4OLBA 1EXQA 4CGIA 4YNQA 4CJWA 4H4MA 3MEUA 4ZTFA 1X9WA 3D0PA 4O4GA 4Q0BA 2HHUA 2Y1JA 3SUQA 2LRQA 4CGDA 2VWJA 3VQQA 3SQ4A 1IG9A 3NAEA 1QSYA 3HT3A 1K6YA 2ZE2A 3O3FA 4E7HA 3MP6A 1ZBLA 4N76A 2RKIA 3QIPA 4DFMA 5CIUA 4KHWA 4DTXA 2E6LA 1J9AA 2K3YA 1VSJA 4CJTA 2G3RA 4C5IA 1QE1A 1EETA 1RT6A 3NTKA 3P8DA 3PMTA 1WN7A 2G8FA 2FBTA 2GUIA 2BIVA 3PMIA 4E3SA 5T7BA 1HYZA 2W42A 3EYZA 2IS3A 4CHYA 1EP4A 3CQ8A 4Z4FA 4LSNA 1SL2A 4FJ8A 4CCHA 3SCXA 1DTTA 1OI1A 2D0BA 3E01A 1ZBUA 2ITGA 3SD4A 2CKKA 4RG2A 1BGXT 3I8DA 3H8ZA 3LDSA 4L59A 1U48A 4FLUA 2O4XB 1DLOA 2D0CA 3AO5A 2HQXA 3VN5A 1HYVA 3OYJA 3NGYA 3P8HA 3QEPA 4CEFA 2WACA 4M42A 1CXUA 1BISA 3LP3A 4KAZA 3NGZA 3CFRA 5CYMA 1SSFA 3L2QA 3ZSOA 4ICLA 4BWJA 3C6TA 2BUDA 4PQUA 4B3OA 2DIQA 5C24A 2F96A 1T7PA 1Q9XA 3VQ6A 3AVFA 1I3AA 1ZBFA 1D5AA 2D5RA 3OMGA 3NTHA 3KKSA 1RTHA 4N47A 3ZT2A 3LP1A 1C1AA 1NK5A 1FKPA 2YV0X 4A4GA 2P51A 3ALYA 4FJ7A 4C8KA 3LYIA 1S1XA 5C42A 1JLAA 1RTDA 1RDAA 1XC9A 4Q5VA 5HLFA 3MEGA 3HVRA 3QNOA 1LV5A 1KCFA 4EDUA 3CM5A 4Z4GA 3HSTB 3DRPA 2HW3A 4O0JA 3LPTA 3S9HA 2ETJA 2GFAA 3AA3A 4FJIA 1RTIA 4E0DA 2BKDN 1H3ZA 3K5MA 4RW6A 1S6QA 3V6DA 3ZSXA 4Z02A 4QQDA 1MHNA 3B6OA 3RMAA 2AJQA 4IUUA 1CZ9A 3SNNA 1VSEA 4Z4EA 5JS2A 3ISNC 4IUPA 3G0ZA 3F70A 1JLQA 2FBYA 4ELVA 3OS2A 4NCBA 3RR8A 4MQ3A 2HNZA 4G1QA 2XRIA 1HNVA 1WAFA 5CYQA 4PL6A 1RDCA 1T05A 1U49A 4CK3A 3OYGA 2RPIA 1JLEA 1RNHA 2L3RA 4GMJB 2WOMA 4DFKA 4DSKA 4FZYA 3WNHA 1L3TA 1GOCA 1N5YA 4CF9A 3ZT3A 2Y1IA 4C8MA 2DIGA 4FLTA 4BDYA 4DQQA 3AA2A 4CK1A 3KJVA 3DLRA 2O4IA 3S6WA 4FK2A 4CJLA 3VQCA 4DTSA 2LTOA 3OYEA 4M3WA 1WNSA 1LWEA 3ME9A 3PNWC 4L8RB 2IG0A 2ZQBA 4FJKA 3M9QA 4ELUA 1RT4A 4CJUA 4DSEA 1L5UA 1NK6A 3OY9A 1SKSA 4OVLA 3OQ5A 1WSFA 1Q8IA 3LP2A 4J2DA 4ZHRA 1KLMA 1WSEA 4KB1A 1R0AA 3I0RA 1S1UA 5J39A 2RJEA 1KHCA 5M9OA 4CHNA 3KLFA 4MFBA 3OYCA 2P5GA 1RT1A 3NH0A 4I2PA 3OS0A 4NCGA 4HVJA 2PQWA 2ZD1A 4CFDA 1LW0A 4QVZA 2XO7A 2X4XA 3ASKA 4IDKA 4E7KA 3HP6A 1B92A 2HMIA 2XY5A 3SQ0A 2RHZA 4KFBA 1SKRA 2O4GA 1A5WA 2QQSA 3DMJA 1TK8A 2R58A 4F3TA 5J2QA 3RMCA 1G15A 1S6PA 3AV9A 5HRSA 3ZSZA 3DLGA 3CEYA 1U4BA 1C6VA 4B9WA 4C8NA 4J2AA 4CGFA 4OGEA 1SL1A 3T1AA 2DTUA 4DSIA 4Z4CA 3OYBA 1ZBHA 4CJSA 3C94A 3ZT4A 2RI2A 2QK9A 1NKEA 2HB5A 1YTAA 2QQRA 3QIOA 4LD0A 3P5JA 3V9SA 2YNGA 3V9WA 3KK3A 2HVIA 4CRIA 5KI6A 2PYJA 3ZSYA 3V1RA 3BDLA 4M3TA 3AO3A 4FJHA 2XY6A 3MEWA 1UWBA 4CEZA 2XY8A 4ZTJA 4B9XA 4ID5A 4CFAA 4W5OA 4E7JA 1LWCA 3A2FA 1NK4A 3QERA 5D6YA 4AHVA 4OKEA 4HCZA 1IKXA 3QNNA 1NOYA 2Q3SA 2GFUA 4DS4A 1JLCA 3ZEHA 1ZBIA 4CERA 3AA4A 5J2MA 3LAMA 2MWOA 5J2PA 1U45A 1HQUA 3OS1A 3SQ1A 4CHZA 4E19A 2EKOA 4QOZB 3QJ6A 4Z0UA 3VQ8A 3KD1E 4M3YA 2QKBA 1A5XA 1T8EA 2RHIA 1WJSA 4DQIA 3NDKA 3S3OA 3MEVA 4M3ZA 3JYTA 4FL6A 5D6XA 1VSIA 2RJDA 4GVMA 2KFZA 4RW9A 2LVMA 1S9EA 5CZ1A 4KHNA 2VWKA 4IUTA 3AVMA 2DFHA 3BDPA 1VSDA 3K5OA 1NOZA 2RN2A 5J1EA 3L2RA 4F2RA 4W5NA 3NF7A 3L2UA 4W5QA 3LPUA 1MU2A 1S1WA 1Y97A 2KZZA 3MEAA 1WGSA 2BGGA 4LY7A 4DQRA 3M8SA 3OYMA 1JKHA 3ZSVA 4GW6A 1CXQA 4FJLA 2O4XA 2MWPA 3ZSQA 3U6FA 3AVAA 4CGGA 5KRTA 3L8BA 1VSFA 1XWLA 1TV6A 2RJCA 2FBXA 2E5QA 3OYIA 1KVBA 1HRHA 4QQ6A 4DG1A 3NBPA 4BE0A 1RT2A 4CEQA 3TR8A 3L3UA 4OLAA 1S1TA 1D9FA 3OYDA 3O3GA 4I7FA 1RI0A 3E9GA 3AVIA 3QESA 2YNHA 3RMBA 4E7IA 1RDBA 2D0AA 1S5JA 3QINA 3AVBA 1REVA 1U47A 1RT5A 4DU4A 4JLHA 1B9DA 3LLRA 1BHLA 3HK2A 2RHYA 2QXFA 3VQBA 3NF8A 1RBUA 4ID1A 3L2VA 2BANA 2VG5A 3K57A 2RO0A 5EU7A 1LW2A 1RDDA 1NK9A 4F4KA 1TL1A 3DOLA 3RTVA 4CJ4A 3NF6A 3LX7A 4LSLA 1GOAA 1S1VA 2KQ2A 3PFSA 4OKJA 3CFPA 4KV8A 1OYXA 2R5AA 1J54A 3SPZA 4KTWA 3NGIA 1BI4A 4DU1A 4FLZA 4CF2A 1XI1A 1NJZA 3SZ2A 4KHQA 4N4GA 4B9SA 2OPSA 3DB4A 3HPHA 2E4LA 3EAEA 1RT7A 4CGJA 4DTPA 4XIUA 1WJQA 4DTUA 3DI6A 4FM1A 4BD3A 3L42A 4DF8A 1QTMA 4NYFA 4CJ3A 5KH6A 5C6SA 5IN1A 3ZSWA 2EQJA 2P5OA 4KPYA 2Z1GA 3SPYA 2XHBA 1TAQA 3AA5X 3NCIA 4KTZA 2P1JA 3L2WA 4LH5A 4KHUA 1LAWA 4KI6A 2JTFA 1EX4A 1HPZA 3HO1A 2L89A 2L8DA 4KTQA 3TABA 1SL0A 4CHPA 4CJQA 3QETA 4F2SA 2OPRA 2KTQA 4DWIA 4CHOA 4AH9A 3TAMA 1JLBA 3VQ9A 3LGLA 4Y1CA 3H6ZA 4B08A 4IKFA 2HHTA 1EKEA 1JXBA 2ATQA 1FK9A 4FLXA 3AVLA 1RCHA 1TKXA 4DTNA 2HVHA 3AVHA 1QS4A 2YKMA 2HHXA 1FXXA 4CEAA 2DFFA 1J53A 4DTOA 1L3SA 3KLGA 3DLMA 2HNDA 2YKNA 5DK5A 3QEIA 4AHSA 4B8CA 3E9FA 4DLGA 2QKKA 3AVGA 3IRXA 4WE1A 3FLGA 4C5EA 3Q1JA 1UOCA 4KI4A 1VRTA 4LH4A 5D3GA 3HPGA 1RBTA 2OPQA 4FJ5A 2FC0A 5HRPA 3S3MA 2HNYA 3MXIA 3FEOA 3BGRA 3OMCA 3KLHA 3P1GA 3RRHA 4X34A 2X35A 4OPKA 4N5SA 3LZJA 4IBNA 2NUBA 3TANA 2G8WA 2JGUA 3QLHA 5KE3A 1ASUA 4H4OA 4F8RA 4C8LA 1XHZA 4DU3A 2JLEA 4E1MA 1RBSA 2M1HA 4FYDA 4FXDA 3L3VA 3OYAA 2EX3A 2KFNA 4FJNA 3MO8A 4PUOA 2E6NA 2GBZA 4J2BA 4HHTA 1KVAA 3LWLA 3KK2A 4N4HA 4M45A 2EQMA 3VQPA 3QKJA 4UQGA 4A4HA 4OVAA 4QQGA 2PY5A 2RHXA 1HNIA 5KE2A 1B9FA 1ZYQA 2GF7A 3SUNA 4HCCA 1NK0A 2OYQA 3O3HA 2LSNA 4CF1A 4O44A 3VQ4A 1HQEA 1VSKA 3GOXA 4I9LA 3OYKA 5C0MA 4B9NA 2X4YA 4O55A 3F73A 4N41A 3OYFA 1C0MA 1VK0A 3VA0A 5FDLA 4M3UA 4AILC 2FHDA 5J26A 3KLIA 3MEDA 4RW7A 2WONA 3OJSA 1SKWA 3MAQA 4Z4IA 2YHBA 1J5OA 2IAJA 4ELTA 3OA6A 3MECA 2X6SA 3NE6A 3HL8A 2B8AA 2B5JA 2X78A 2XK0A 3V9UA 4HTUA 4BE2A 1IKVA 2YNFA 3AVJA 5E41A 2OZSA 3I0SA 2RI5A 4CJ5A 3U3YA 1TKZA 4IG0A 2OZMA 4RW4A 4IFYA 3PX0A 2M16A 4CK2A 1NKBA 4K8XA 3D45A 3V1OA 4AHRA 3CM6A 3MXJA
chains in the Genus database with same CATH superfamily
4FCYA 1SAXA 1H88C 1KONA 2XY7A 3T1HK 2NUPA 1J2XA 2HU9A 4OPJA 1TSFA 4DBRA 2E2PA 1SZ2A 2CYYA 5LJ5j 3MP8A 4GYGA 2VQLA 1HBXG 3JSOA 2GEMA 2IGKA 1WSJA 3VS2A 2FEZA 2VPRA 5D4SA 5B5EC 4XRFA 2YUPA 3V81A 1MSEC 1KO9A 4FIBA 3U9DA 1OPLA 4BXFA 4J6WA 3MHXA 1E3OC 1OZ3A 4GV9A 4OPHA 3DXMA 1CLQA 4II1A 4O0IA 4C8QA 3LDNA 1VQMA 1TK5A 1N8RU 2JZ2A 2PUOB 1WLJA 5K14A 3VQAA 2RREA 5KGXA 1K8AO 4L3QA 4B8AB 2EJGA 4DR6K 5ERIA 1VQ4A 2VUMJ 3CCLQ 1N9SA 4RTWA 1NGIA 2HGCA 4MMKA 2LNHB 2RQTA 2RQWA 2WB1A 3TL4X 2IVWA 3IAM2 1J09A 3QYBA 3SUPA 1J59A 3VU3C 4Q48A 4J9GA 2ECBA 2CYZB 3ELKA 3CIPA 4IUVA 3T9NA 2K5FA 5K5RA 4YEJA 1Z25A 3RMDA 2ZMEC 2GIZA 3VA3A 4FJMA 3QEXA 2XGCA 1XNIA 1H3HA 4BRQA 3HJEA 5AT1B 2RK1A 4BG9A 2I2LA 2BE2A 1YHQI 4BDZA 3HVTA 4U7DA 3GIBA 5LJ3j 3SJMA 1Y1WJ 2KRNA 5J8CA 2B63J 4JRKA 2W6KA 1ABOA 3TI0A 1RBRA 2NOGA 4PL8A 3CO6C 3HG9A 3MP1A 3MEEA 3QEWA 2HMPA 2TRTA 1QCNA 4M7AB 2NRVA 4JS5A 5EJCA 1IV8A 3E97A 5DTDA 1Y57A 5C12A 2R7OA 5DM7R 2IGNA 5JS1A 4DCHA 1VQLT 1Z7UA 2X74A 1V55H 3M0QA 2G8UA 3KNTA 3EUHA 3REAB 4ITVA 3A4CA 3E9PA 1ILYA 3G2BA 3F8CA 2V9PA 4DV0K 4LLNA 2H8HA 2CO5A 1FN7A 3CC2T 1MJ9A 1ZG3A 1L3LA 2HQEA 1RPWA 1VUBA 4A63B 2I0NA 2HHVA 1CZAN 3KIOA 1TTYA 3KTQA 1ITGA 1RUWA 2LZ6B 3QO3A 2DD5A 4ZZLA 4ZNXA 4DYRA 3K6GA 4A4FA 3VEZA 2KRHA 4BJ6C 5BREA 3KK1A 3QBXA 4RW8A 3CMEI 4GY5A 3ECHA 5LJWA 1VQ7A 1WPYA 5ICFA 5CKHA 3MKZA 5M5XJ 3IAYA 3SQ2A 2VE8A 2RNAA 1G5VA 5KAIC 3C4SA 2NVYJ 3FHGA 1TL8A 2V75A 2G8HA 2VG7A 4XLFA 5CYVA 1W36D 3RERA 2YWWA 1NK8A 3HM9A 1YNZA 2VYPA 4Y7NJ 3HTUA 4CZIA 3INZA 2VKHA 1WJFA 2FRHA 2CSOA 3CCVI 1C0TA 4JBAA 1R0BG 4CIFA 2MK5A 4HQMA 3LSHA 4J9BA 3FMRA 4U0VA 2L02A 1WX6A 3EL2A 4EM2A 4MMLA 3NVMA 1Q9YA 1FW6A 3NHGA 4M75G 1HKTA 2KDSA 4MFDA 3G71T 2CU7A 3META 5J3LA 2KW4A 2EPFA 5LGUA 2D0OA 3H1VX 1SUQA 1SV5A 2MH2A 3CJQB 4YOQA 4FLYA 3V7RA 5M1NA 2EIFA 1YHQA 1H0MA 4LITA 2DT5A 1VQNA 1PP7U 2B4JA 1M8MA 1YJ9Q 1QRYA 1BI4B 2PYLA 1NKCA 2QQ9A 1FMVA 1JLFA 1YYVA 4FJ9A 1R8OB 4H5TA 3GEZA 1T6DA 1U0JA 1AU7A 4HUGA 3PV8A 3IHOA 5EEGA 4GKJK 1BCMA 4E1NA 2X1DA 4KGVB 2M7AA 1V54H 5FRMA 1D8YA 4M77D 5M5WJ 3I56I 2JTVA 2BGCA 5FLXO 4BI8B 4CZLA 3VKIA 3U2RA 3T8TA 4HLXA 4OO1J 1AT1B 4B1YB 2DL8A 1NEBA 2QM1A 3LP0A 4B1WB 3DBRB 5J1YA 1WSHA 4BRMA 4ENKA 5IP9J 2Q0OA 2GWJA 3M56A 1X2KA 3L1AA 1OVYA 1O13A 1WSGA 2XB0X 1TC3C 1IKYA 2DAOA 1R5GA 1S8NA 4MEYF 1NMNA 1QCOA 3ZEUA 2YG9A 1YIJT 3OOUA 1IC8A 2QWWA 2OPTA 4E89A 2RQUA 2MCNA 3TCJA 2GXBA 2QBYA 4U88A 2QKMB 2DL3A 1CKBA 2QSGX 4ELYC 4PKIA 1Y8RB 4JKBA 1DTQA 1TAUA 1HMVA 2I5JA 2RA2A 3F9MA 4NB5A 4BE1A 2XGXA 3ULDA 4N4OB 2OCCH 4R0KA 2EILH 1K9MU 2DA7A 2L9SA 2O9LA 3CCVA 3SZTA 4CZCA 2SEMA 5F1JA 3WGGA 4CHQA 1E6HA 2I7NA 4NQWA 4B1ZA 4BY7J 1TLHB 1U9OA 2QLZA 4XKVA 4JKDA 2HOSA 2OTLA 4WFAL 3VTHA 1XQOA 1CF7B 2CDTA 4KFCA 4CUGA 3RNJA 2M0OA 4M3XA 4M78B 4NHJA 4CYDA 4RCCA 3G1MA 1E3PA 1KG3A 1KFSA 5I3UA 5EG2A 3PIOF 1E7OA 3EE8A 2TDXA 1EWQA 4CJFA 4MQ9F 5FLXZ 3ATVA 3ITHA 4JK9A 3TKYA 3O1BA 1RT3A 4F16A 4WCEL 3MJXA 4EJOA 1VAZA 3EG9B 4M74A 2YI1A 4EA4A 1Z0XA 3SV3A 1X1PA 3KZBA 4QAGA 4UVBA 4AHTA 1NM1A 4HV6A 3I71A 1F21A 1F9NA 1OYIA 3DLBA 4BNCA 4PJOF 3QO9A 3LANA 2RI3A 3L2ZA 3I55N 4AG2C 3QZ5B 1I0CA 2Z1JA 2DT7B 2P5LC 2F5KA 2LMDA 1EIFA 1QU3A 4HCBA 3RVCA 4KICA 3KK7A 1N9RA 2FNAA 1UEBA 4HCKA 3I3LA 2BDPA 4BROA 2DBMA 1FBQA 4HX8A 2M5WA 2M45A 1WSUA 3SZGA 4A69C 4XRMA 4YIRX 3TW7A 4B9LA 3LZIA 2K4JA 4KO0A 2ZNZA 3O08A 5KPZA 4CF0A 4ON0A 1JGGA 4OB0B 3LFUA 5AJ3K 1IO2A 1VQ5T 1BCOA 1SMTA 5E1ZB 4CBXA 3K5LA 1ZSZB 2GWKA 4MNUA 3FLCO 3CD6T 4KHSA 3LH5A 5DY9A 3WTWC 3TAEA 1J75A 1IUYA 3TAQA 1U3EM 1LOTB 1J6ZA 4JX5A 4HUFA 3H9JA 3UT1A 4FT8A 2VCPA 4YDUA 4GRIA 1OR7C 3KEQA 2DQLA 3ZOBA 1N6QA 3KP5A 4J6YA 3HTSB 3GPLA 3HM5A 4B9MA 3VEVA 1VNDA 2DL4A 4BC4A 3QP5A 2PN6A 4JRPA 1NGFA 1ETVA 3C6HA 3E9OA 3NF9A 3DKYA 3B6CA 3PX6A 3VGKA 1WHJA 4FX0A 3A0IX 1R0CB 2ZJQF 1BQMA 2HCKA 3CCLT 1K1ZA 3U9GA 1WNLA 4OMFB 4N4IA 1WRJA 3QSUA 1X3WB 4F04B 1RTJA 4A4EA 1V5GA 1I39A 2BY3A 1MH3A 4FYXB 2OANA 2YNIA 3TSUA 2CUZA 2KSSA 2NUPB 3EHQA 4NCAA 1HUXA 4OB2B 5GADJ 3JCMg 1EXQA 1SAUA 4H4MA 3D0PA 1K73O 4LXCA 2HHUA 3G6EA 1NJIR 3QPSA 3ULEA 5D5WB 1WUAA 5CE3A 3DXMB 2C0OA 3M5RA 3E6CC 2VBXA 3VQQA 1P4XA 3RZDJ 1XNQK 4C8QB 2W24A 1T8IA 4CCMA 4N9HA 4BXUA 4GLMA 3LNQA 1M1GA 4M78F 5KN9A 2V1RA 3O3FA 3MP6A 1ZBLA 4N76A 4KH1B 4LG0B 3VYHB 3FF5A 4KHWA 1R00A 4IL6C 3MX5A 4CICA 1VQLA 1B3QA 3I33A 4BI3A 4AM3A 3M5AA 2DPNA 1TT0A 3X28B 1JTYA 3WE3A 1S7OA 1EETA 4W97A 1T0HA 1K7AA 1RT6A 3G4SN 1WN7A 1TUYA 1XMXA 1LWVA 2ENMA 5BOXA 2GUIA 2BIVA 3SMSA 4X6AJ 1V5FA 2DM1A 3H3ZA 4IOCF 1HD3A 2W03A 3FHFA 2XGDA 1EP4A 4YTLA 2Y4XA 2JNGA 2CW7A 1SFOJ 1DTTA 1OI1A 4RGRA 4IVNA 3CQZJ 1ZBUA 2ITGA 4JKAA 3CMAI 1B1BA 2DTRA 2KYMA 1WVRA 3DWLE 4F7UA 4L59A 3K10A 1U84A 1T39A 3AO5A 3I64A 2VB6A 3F22A 4BEHA 3U23A 1B59A 3OYJA 1Q81C 4AC0A 3QEPA 4IOAF 1OULA 4CEFA 2EGAA 1D5YA 3UATA 3QMLA 3H9GA 3GFIA 2D2WA 3SHWA 4KAZA 3NGZA 3CFRA 1I94K 1SSFA 4Q47A 2RNJA 5AIPA 1ORPA 3ULQB 4IQJA 3C6TA 4PQUA 2P8TA 5ILUA 2DIQA 3HTRA 1R49A 2OV7A 1T7PA 1Q9XA 5C4XJ 2OAUA 2PAVA 2ICWG 4E1JA 1JJ8C 1V29B 2ZO4A 3CCRA 3OMGA 1XMOK 1OKRA 4DR3K 3LM2A 5J3BA 1IRFA 4KDPA 5IXBA 3KKSA 4IHWA 5IHKA 1S72N 3ZT2A 3FM5A 2H56A 2QQ8A 4N0AA 4OAYA 1UG1A 5GAMg 1IUFA 4CJ7A 4C8KA 4M78C 1RDAA 1RTDA 4BRDA 1WFXA 3MEGA 1A36A 3ZMDA 4EM1A 1LV5A 2EAYA 4M77G 4F17A 3VPRA 3ZX2A 3F8FA 3HRGA 4Z4GA 2KXCA 4M7DB 4IOXA 2HXOA 1UFFA 3DRPA 2GZWA 2V1NA 2E3IA 3CUQA 3JCMJ 2GFAA 3AA3A 4HNTA 3TBIA 3IKVA 1H3ZA 1LJ9A 4HKEA 4PHTX 4W1UA 5AFUH 5DD4A 3KEYA 3FIWA 1S1NA 3B6OA 3Q0UA 4LK1F 3RMAA 2F69A 2QWOA 1GUUA 3DTKA 4IUPA 3CPWS 4OFAA 3ISNC 1AVZC 3QWXX 3M1CA 1JLQA 4MO5A 3LWFA 4M3EA 2CP6A 5E20A 2K02A 1HLUA 4G1QA 2XRIA 1YLFA 1CSKA 2KHOA 4YOXA 1T05A 1U1SA 3K70C 2WTUA 1T95A 2VWFA 1QZYA 3OYGA 3CMAA 2ESNA 1RNHA 1NLOC 1MBFA 2KR3A 2DYIA 3CJBA 2G6FX 2A3ZA 1YIJA 3OSFA 1QVGS 2RQQA 1HA8A 4DFKA 2P9IA 4CF9A 1KGSA 2E2QA 2EZLA 4IDHA 3ISPA 2O8XA 2CW8A 2K79A 3PVLA 2NXNB 1A6QA 2DPDA 1VQPN 5BMZA 3S6WA 2JWLA 3A01A 4LB6B 4A2BA 2QWMA 4BBSJ 1ZSZC 3VQCA 5KCMA 5AQTA 2V51B 2YU3A 1NH3A 2ED1A 4DV2K 3FZMA 3OYEA 3LA7A 1D8JA 2Z33A 3HKZN 5LJ5d 2P9PA 3CBPA 1WNSA 1HSTA 2X85A 1WBBA 3QDKA 2ZQBA 2QK0A 4AFUC 1UAAA 3PGGA 3DU5A 1RT4A 4EV0A 4CJUA 4DSEA 1L5UA 6AT1B 2CGPA 3C12A 3RPUA 2E88A 2FMLA 1M27C 3OQ5A 1KQSA 1FNNA 3VPZA 4L9JA 3H9NA 1GDTA 4IEJA 2JM9A 4RM2A 3NGPA 4C2TA 3W6KB 5J1UA 2K86A 5B1BH 4XSZF 1KLMA 1BA1A 4KB1A 2J5OA 3ZEUB 3I0RA 4PGHA 1S1UA 1MPGA 1PU7A 3VSKA 1NM7A 2BTFA 3O8GA 3RUXA 1YQLA 2OZUA 3KLFA 1J7KA 2P5GA 1BKBA 1HSJA 3JV3A 4IO9L 4I2PA 3M3YJ 2DXCA 5GMKe 2WV1A 3OS0A 4HVJA 2HKQB 3HHTB 1NZ9A 1MGTA 2ZD1A 3CMET 2CQKA 4D7MA 1U1TA 3S32A 1SG5A 3CCJA 4DZPA 1LW0A 4QVZA 3KFWX 1P59A 2D1KA 2XO7A 2E10A 3ASKA 4C8QC 4HQEA 3JCMX 2HMIA 5GAMj 4YOYA 2M87A 1ZX6A 1I50J 2MOXA 5EZGA 5FPDA 4XH5A 1V4RA 2K3PA 3HHGA 3W6JB 4BR4A 2R58A 4HWIA 5J2QA 1KHIA 3I55Q 1GT0C 2DF6A 1G15A 1S6PA 5J6XA 5LJ3d 1IN4A 2FYKA 1M3BA 5HCKA 3SAFA 1MNEA 1HPMA 1Z3XA 1IHWA 4CGZA 2DMUA 4PKCC 2WAFA 4IEEA 3A8MB 5B66C 2R5YA 5FD5A 3LAJA 2DTUA 5D7UA 3QBWA 2O31A 1ZBHA 2VBYA 1D0ZA 1X2QA 1I1JA 1ZARA 2EFOA 2RI2A 3IH7A 4FYWB 5FU7C 5ICCA 4JHDB 1N3AA 2QDLA 3AY9A 3JB9H 1KQSP 3GW2A 3PUBA 4DR2K 3I0XA 1YI2I 2GM4A 2BY0A 1GBQA 1K6OA 5L3CA 3CJCA 2PJRA 5DCMB 4VUBA 5KI6A 2HQ5A 3M4OJ 1UB4A 2DILA 2XDBA 2CRGA 2HTSA 1YJNI 2DO3A 5E8GA 3SXYA 3AARA 1OH6A 2JMCA 2JS2A 2CZ7B 3BDLA 3IH4A 4IF4A 3CLQA 4FJHA 3I56T 4HF1A 2NNNA 3R4KA 4O3MA 4FWLA 1E4FT 4C92G 1HXDA 5D5UB 2XY8A 5C44J 4M75A 3P7NA 2F5VA 2A5WA 2H6BA 3F0CA 3HTVA 2OJ2A 3ZMTA 1SQKA 2ACJA 1UHFA 4ID5A 3BP8A 1SRMA 4W5OA 3NHNA 4B44A 1LPQA 4X1VA 4BGDA 1NK4A 1XC3A 4HDUA 2LQ8A 3EUHC 3CCUN 3H3UA 2VXEA 1ZKGA 1W1WE 3PSIA 2DTIA 2Y4YA 1OH8A 1PDNC 1NOYA 3FXQA 2Q3SA 1N25A 2WAQA 4CZMA 1JLCA 1WEGA 3ZEHA 3ZXSA 4FWRA 3JRFA 5J2MA 1X4OA 2IPOB 3LAMA 2MWOA 1U45A 3RQIA 4EMSA 2EKOA 2PI0A 3CF5L 4QOZB 2QSFX 1YITI 1IF1A 3CF2A 2GOMA 2HL3A 1RL2A 2E1HA 2A3SA 3WG7H 1NBEB 2IS1A 3BZKA 4IXAA 4M7DC 1A5XA 2RHIA 3PT9A 4DQIA 3MEVA 4M3ZA 4FL6A 2X6WA 5FJ8J 2YSQA 2RJDA 5KYUB 1KC8U 4GVMA 3CCYA 1S9EA 2D1VA 2Q31A 5CZ1A 3OHRA 2ABLA 1Z7LA 1EBMA 4FSXA 4XTWA 2HVSA 3BJ6A 1UMQA 4CCNA 3KLOA 3TO6A 3CCSQ 2QZ8A 1B07A 2A40A 3J7YJ 1VSDA 1NOZA 3CC4I 2XMFA 1FPQA 1KG5A 4GO1A 5CVRA 4J8OA 3NF7A 2FU4A 2V6CA 2B9SA 1MU2A 3H5RA 3ULEB 4CYCA 3G4SQ 1WI7A 1K9MC 1W70A 4D8KA 3HOUJ 1QPMA 4DQRA 1YI2A 2A68F 2VL8A 1TQPA 1JKHA 2DLPA 3A5ZB 1M3AA 3A8OB 2OQRA 2E71A 3IRQA 1XQPA 2CUJA 3H36A 2CUBA 2O8BA 3RYRA 2Z0WA 3BG5A 3M9AA 3THXA 3VF6A 2JUGA 1MDMA 3HZ6A 5J4YA 5CK9A 1Z1DA 5FLMJ 3M0UA 2R7SA 3S17J 1TV6A 2RJCA 1Y1VJ 1Q81O 1KD1O 1KVBA 2LC2A 1WFWA 4M3BA 1HRHA 4JUVA 1RT2A 1QVFS 3CC7N 2DDAA 3L3UA 4OLAA 4X65K 3VESA 1D9FA 4F55A 1RRQA 2HQRA 3QESA 1YJ9A 3ZX0A 1RDBA 3NRVA 2FG0A 1PUFA 3N5NX 5HY6A 4IHYA 2PVGB 2W85A 4F7UB 1TXQA 2JXBA 1YITA 4DK9A 4ATOA 2XPVA 1U47A 4BEHB 1AD5A 1R1VA 1G83A 4BQAA 4JKFA 1K78B 2LCLA 2DNUA 1S72Q 4LB5A 1GLNA 2X4JA 3TO9A 2J05A 1B9DA 5L3BA 4M78D 2QWNA 3O6BB 1GBRA 3ULRB 4NB4A 2DK8A 3HK2A 4O8KA 3VQBA 3M53A 3NF8A 2KVQG 4EJZA 1RBUA 1QW1A 2JPSA 4ID1A 4HRIA 2JSPA 5FKLA 2HXIA 3GUDA 2VG5A 4V19K 2RO0A 4N9IA 4JYAK 1BJZA 4LF8K 3EPZA 2DBKA 5J8FA 4LDVA 3ZBDA 1QQJA 2NRHA 4S0HB 2E70A 2XD0A 4UVAA 1H9TA 3CC4A 1GOAA 4OKJA 3CFPA 2IEKA 5HLTA 3BTCA 4DZJA 5D4RA 3QQAA 1VQ6Q 4AFSC 4G9ZA 1J54A 3VOVA 1XG7A 2QDYB 1PYVA 1S7EA 2DPUA 4CF2A 2KRSA 3KXTA 4OWRB 1NJZA 1QVPA 1ZBSA 4EIKA 3MK6A 4A93J 1ZBJA 1BYMA 2VQGA 2LTPA 2Z1DA 4J9IA 2CZ1B 3A0BC 2YHXA 3SBGA 3K70D 3PQKA 1VQ9N 2DI3A 3BG9A 4A3GJ 2F4OB 1N8RO 5KQDA 4FM1A 1YP5A 4NL3A 4BD3A 3DCFA 3L42A 4LUEA 2HBJA 4PJOE 4CJ3A 4A3FJ 4PNOA 2ASMA 4KPYA 3QU3A 4V2FA 1LWWA 1LOJA 3UA7A 4LIUA 2MG4A 4LH5A 4KHUA 4V2GA 2JOYA 3CPWM 4CJQA 1VQPQ 2NVXJ 3FB9A 2JVVA 3QETA 2BW3B 2MBFA 4JLGA 4F2SA 3MQ0A 2OPRA 3QYEA 3ER0A 1R77A 4CI0C 3VQ9A 4R1HA 1IXDA 4H0PA 3VDXA 4IKFA 1XJWB 2ATQA 3M0RA 4FLXA 3AVLA 4PJNA 4E70A 4C0FA 2OTJI 1QVGM 4A3KJ 2GIVA 2I7PA 2FLOA 2H1KA 2YT6A 1QS4A 2NZTA 2E7XA 4RAZA 4D5CA 2R7VA 3O80A 2R7DA 1J53A 1L3SA 3KLGA 1BBZA 3DEUA 4EPCA 1HC8A 2FSKA 1QQOA 3BCBA 4AHSA 3GFLA 4DLGA 5GANg 2OD5A 3PFIA 2GELA 4WE1A 1K8AU 3UR3C 4YDUC 2WAEA 4KI4A 3ZQFA 1MV3A 4UY8O 1P7IA 3HPGA 4BY1J 4M7AG 5GAN8 2HZYA 2RC4A 5HRPA 3BG7A 2DPPB 1W6XA 1TP4A 3I55T 5ADXA 4ENJA 4C8QD 3BGRA 3OMCA 3KLHA 2AO9A 5KYNA 3IH2A 2VGNA 2X35A 4DR1K 2Y75A 1GLFO 4OPKA 5AZJA 3O2PE 3TANA 2JGUA 1UG2A 5KE3A 4B48A 4RCBA 1I5LA 5JR3A 4F8RA 1X1DA 3PIPL 3I4PA 4DU3A 1W5TA 1OH7A 3QJYA 2M1HA 3L3VA 2X9DA 2JHNA 4KYWA 2EX3A 8AT1B 4FJNA 2CQNA 3MO8A 4J2BA 3SFZA 2XHKA 2EIKH 2G9WA 3K1NA 4A5AA 4KHPK 4N4HA 3ZQGA 5LGTA 4K25A 4M45A 2ECZA 3QKJA 4UQGA 2E8AA 5H20A 1B8IB 1WA7A 3U21A 3E3VA 2O61A 3WHBA 3R6MA 1TUGB 4M78E 3O4WA 2JTEA 2VC1A 2PY5A 4EGZA 2HL5C 5FKNA 4E9GA 2GF7A 3SUNA 1Z21A 3HOTA 2DA4A 1R59O 2LKSA 4CF1A 4I9LA 4CHUA 4B9NA 5JLFA 2OAZA 2HOTA 3F73A 4MTEA 3VA0A 2AZSA 3LMMA 5KAFC 2R5YB 4RW7A 4OIRF 4K43A 2OTJA 3HRTA 4Z4IA 2TCTA 4LGWA 1J5OA 2ISYA 2L2PA 4B1VA 3A1YA 3VS7A 3MECA 3NE6A 3HL8A 2F5TX 1NBWA 3ZQ7A 1QVUA 5AQZA 2X78A 2IBDA 4BE2A 4J6XA 1NG9A 2E34A 3FBIB 3LSGA 5E41A 3GWZA 1BJAA 2RI5A 4CJ5A 5KN8A 4LDXA 3U3YA 4IG0A 1XG1A 3CCUQ 3D5SC 5IYCJ 1KQ0A 1SVOA 3FZHA 4IPAA 4PL7A 2F1LA 2OZMA 1LDJA 3LDPA 2PJRB 4KH4A 4BJTA 2F48A 5KPRA 2QG9B 1UGPB 1GV2A 3HSCA 2VODA 4K8XA 2VT3A 4KMUX 3D45A 5TGTA 3V1OA 4RMNA 4QS8A 4IHXA 2DRMA 3EGXA 4NYNA 3FE1A 1BBYA 5D8KB 1TWBA 2EGEA 3OJUA 4DFPA 1T0JA 1GV5A 4MZMA 1KRPA 3JRBA 3QWYA 4M75B 4KRFA 1G99A 3ID6A 2DZCA 4M7DD 1WWXA 4P9UA 4JKGA 1WGXA 5B3SH 3CPWA 1IJWC 3CCST 3R61A 1MWKA 5CVVA 3DLKA 1QQIA 4JNEA 1Q81R 3DOKA 2RE2A 2COBA 2HBLA 3C6UA 2KDOA 4IHTA 4KH5A 1ETQA 5GANj 3JCMd 1HF0A 3OYHA 3TSQA 1HW2A 3T3FA 3HPOA 4A5NA 3NTIA 2W48A 4N56A 2LG4A 4CJRA 1G3TA 1R1UA 4BUGA 3G4ST 2DEUA 1RILA 2P9KB 3DLEA 3RTRA 2V8KA 4IG3A 3D4VA 2F2EA 4A3JJ 2AHQA 1RI9A 1D9DA 4OB1B 4OF1A 4HXJA 5LFAA 2JRMA 3DV8A 4AHUA 2QKLB 3IRRA 4CESA 5FFXA 5GAN6 1RFQA 4O8UA 2V9KA 5LHIA 4RTXA 4F3OA 1X3MA 1J5EK 1PP8F 5GANh 3CJ1A 2QWPA 3GYHX 2RKHA 3BPXA 4BDPA 4XBFA 1KQ2A 4J5YA 4J7FA 1TK0A 3NQOA 1A5VA 3TEEA 5KCHA 1U06A 3IS9A 1FTZA 2KE9A 5EGOB 3FMSA 5HRRA 3FHNA 1QQCA 1HNWK 3QPLA 1HU0A 3RIRA 1GLDG 3E5QA 4PLLA 4AIDA 4E7SA 1ZELA 4HBLA 3K2PA 2E5KA 1D3YA 4G94A 1LPLA 3IDHA 2ESWA 2O3FA 2ZPBB 1AWCA 5HP1A 4E7LA 5B8HA 3PJRA 2ELHA 1FC3A 2B6AA 3AFHA 2E1CA 2RHUA 2ECCA 1BR2A 3K4NA 2EYXA 3NNQA 3K5NA 2HWVA 1R71A 2OUMA 4P96A 4BQQA 1X3ZB 4NDLA 2EFNA 1D09B 2GQIA 3CC7Q 3CPWP 2BV6A 4LF7K 5GAHP 4CJKA 3F9KA 3KE2A 4AFQC 3VQ7A 4FJJA 4ISFA 1ASWA 1ABQA 2O8BB 1O75A 5DM7F 1QZ6A 2LCSA 1TH7A 1EV7A 3THXB 1OOTA 5AQIA 1MDMB 2VV5A 1CZBA 3BROA 1KU7A 4LLGF 3J81O 1DGWY 3BPVA 4IWVA 4B9TA 2GBYA 2QENA 5E3LA 1UFMA 3LW5E 4E7ZA 1JUMA 3ABMH 2L7MP 3H08A 2LP5A 1K4US 3CP8A 4FWMA 3Q9SA 3RKQA 1S5LC 3AAQA 1IXRC 4PUSA 1LAVA 3L4QA 1WH7A 3P9IA 1QVFM 2ZNYA 5DS9A 3ZN0A 5FKOA 3CG7A 1QMCA 1ZA2B 1VQ6T 1ASVA 4K8ZA 2O8DA 4UUVA 2XUBA 3UE5A 5LJ5f 1ACIA 2F8TA 3AVKA 4UC4A 2QA4I 2JSCA 4FX4A 1PUFB 3TSPA 3HSRA 1T2KA 2EJRA 3HGGA 5KYXB 5GAMd 1Y0NA 2FPFA 2FF4A 3JRCA 1F43A 2Z3YA 2LJ1A 5AQVA 2AXLA 3SUOA 4M75F 2EV5A 2L54A 4AIJA 1TKDA 2VGMA 5GAEP 1C1CA 2ID3A 1BC7C 5DUIA 2P9LB 2MIOA 5AQFA 4CW7B 4BQZA 2DJQA 4ZC3A 2A6TA 1OEBA 1VQ8Q 3V1QA 1JI8A 2RJFA 4CEOA 5AN4A 3O8VA 3RR7A 3PNYA 2QASA 3VS6A 3PO4A 4C92A 1KAZA 4NZGA 3RSEB 3GF5A 3P39A 1GXPA 1OH5A 4A57A 3M0SA 3J7AY 3BY7A 1VQPT 3ZT1A 1SMYF 1VQ9Q 2CUEA 3IFRA 2YS9A 2G8IA 2GBQA 3F8MA 2O01E 1Z26A 3F8BA 3A1PA 4CO8A 2A1SA 2E5NA 4R55A 3WNFA 1BR1A 2AS5F 1YQRA 2R7WA 2Q1ZB 3ZRGA 2W00A 3AO4A 4MZPA 2R7UA 2ZMEA 5LGNA 5GAN4 3J81Z 4WF9L 3HXMA 1RETA 3ASMA 4JJBA 1IZ1A 2EFIA 5L3FA 4IFVA 2LNBA 3P8BB 1N5ZA 1X4PA 4QW2A 1WJBA 2GQQA 3JCMb 5D6EA 1Y07A 2BTTA 3ZT0A 2YRVA 1BU6O 4II3A 1YW9A 4CH7A 2DFEA 1USSA 1W0HA 3CESA 5AQWA 4ENMA 3HOZJ 3PQJA 4JRQA 5CCAA 2MGQA 3C2GA 3H35A 2CP2A 3T1YK 2A37A 4CJPA 4C5HA 4FZZA 3M8RA 4HNVA 3KP3A 1J9IA 1KC8C 2LX7A 2X6NA 4CSWA 5LJ3f 5GMKl 1JXEA 2HHSA 1IBMK 5DLQE 3CMYA 2COZA 4ILHA 1TL3A 3LSKA 4C8QG 1Q86U 2NRRA 1FX7A 4TSXA 3E2UA 1TVRA 3DJCA 5HBMA 2HHWA 4ASNA 2LC4A 3MPUB 4IZ9A 3J7ZO 2JW4A 2I8DA 3G71N 4QTRA 4LUDA 3QBYA 3I55A 4FM4B 1BI2A 3QIIA 1O7LA 2UU9K 4UUTA 2ZAEA 2W04A 1I81A 4NL2A 2EK5A 3GMEA 5AZIB 1GOBA 2XF5A 1UAXA 4M3DA 4DTMA 3RKXA 2F5DA 4B9UA 3O1WA 2KHMA 3VRYA 2XRNA 3P31A 4M75C 4RBOA 5SZTA 4I2QA 2BH1A 3TAFA 4MIMA 3OS5A 4OP0A 1K73U 3OVNA 5KRSA 3QOEA 1Z3YA 2CREA 1O3TA 1VQKI 1RABB 3IKMA 2Z16A 4MTDA 2EQUA 1LFUP 1W0TA 4CJEA 1SRLA 3BFMA 3SDBA 5K5QA 2DAQA 4AI4A 1TKTA 1NJYA 1JCEA 4IRIA 2UXCK 4DYQA 4H0YB 1PNJA 2MFZA 2XF7A 3AO1A 1GVJA 2DMOA 4C0GA 4CC7A 3A2KA 2KP6A 4H0XB 1CGPA 4ABZA 3VQEA 3W2AA 4XOTA 4EP4A 2NOBA 5M1FA 4LFUA 5M1KA 2BHZA 4IIMA 4IEIA 1KYZA 4DOVA 4XAXB 3CWAA 1IG8A 3LSPA 3CCQN 3PNTA 1MH4A 1W5SA 1HDPA 1N33K 1S6LA 3WXIA 4RTFD 1L3VA 4PIIA 2EBPA 2AK5A 3J7AP 4BI4A 3LAPA 3H3NO 4I09A 1AEYA 5C2DA 3T19A 3LGFA 4C0DB 1O3RA 3HKSA 3WXJA 1A6IA 1M90O 3FHZA 1JXOA 2DZ9A 5FFZA 1BA5A 1HJRA 1F5TA 2NYXA 1NYFA 2G8VA 1WKMA 4H5VA 1VTNC 2KRMA 3CLOA 2FD5A 4IIOA 2Z9OA 3RMQA 3HPWA 3DQVC 2XGEA 5SWMA 1UA1A 3A0HC 1ZR4A 5C15A 4GBQA 2HSTA 3TOBA 2PZSA 3PY8A 4WF2A 5HLHA 5M1QA 1MJAA 5JVHL 5EC7A 2YHYA 1X2MA 4NS5A 2BE7D 4M7DG 3ABUA 2BBYA 3WNEA 2HOAA 4B24A 1VSLA 4DS5A 1MNDA 1HJDA 4MDWA 3EFOA 4P1WA 3WE2A 4LJZF 3DB3A 1WH5A 4ZYGA 3OYNA 4PK4A 5C0YA 1YFHA 3K69A 5EG0B 1OCRH 1K9MR 2F5EA 3HOXJ 3DRSA 3LSJA 3DPTA 2IA2A 1C6VX 3B02A 2Q2EB 3GOIA 3FFIA 3F3XA 3BR5A 1R6RA 4L18B 2J4RA 3U4LA 4BQNA 3K59A 3UKRA 3B6PA 1CQTA 1OJLA 1UZCA 4FETA 1NTCA 3V4GA 1JKOC 1XGOA 4XN3A 4PWDA 2Q36A 1HKGA 4M9SA 1Y71A 3VYGA 3EY1A 3F23A 1PSFA 4ANJA 5FGMA 1G3WA 3ABTA 2J5PA 5KTQA 5F2RA 4AHCA 3JB9G 4ORZA 3RRGA 5CQXA 1OCCH 3JREA 3N4MA 1P7MA 1E17A 2VXZA 2L4AA 1M1EB 3PX4A 1QVFP 2JG6A 1WYXA 3FXMA 5AQHA 1U3OA 2FPEA 1YS6A 2J7IA 1IJJA 3BLYA 1TQMA 4L5IA 2VJ5A 2NOFA 1FJGK 2ZJQL 2LFBA 1NGHA 4AWXB 3UDCA 1KAYA 4CGIA 1JXMA 2AQFA 1YWOA 1VQ5N 3JAMK 3MEUA 4HF0A 4O4GA 3OH9A 1DPRA 5FWBA 3CD6N 3MKWB 4LFBK 4BRLA 3BCAA 3SQNA 2WA0A 2VKEA 3WU0A 5FB2A 3WXLA 2K5IA 1IG9A 1VQOI 3NAEA 1TTHB 1QCFA 1QSYA 2ZPEB 5CO7A 3CWUA 1K6YA 1S72A 2EB7A 4LF9K 1GCPA 2QWLA 4L6V5 2RKIA 5AR0A 3I5UA 1K8AC 4X62K 4O5FA 2XG8D 1DDNA 2F6CA 1VFCA 3CCLN 4HYEA 2K3YA 3WVDB 2CSQA 1STZA 3EFRA 1M2OA 2DTOA 3OGDA 1G3YA 4YIFA 1E4GT 3EH2A 1NYGA 3IUOA 2DYSH 1LFBA 3CVTA 3NTKA 3E19A 2EZIA 3P8DA 4I0AA 3PMTA 2X6YA 2XI9A 2G8FA 4M7AA 1S29A 5HK0A 3BR6A 3S2HJ 1HYZA 2NS0A 2XAFA 2IS3A 4EMKB 4CHYA 3W6VA 4A62A 2ZJ2A 3SCXA 2GA2A 5LBQA 2KT8A 3E01A 1BI1A 4RG2A 4C3IJ 3TTFA 1QO0D 2L4MA 3HXLA 2A7YA 1M3HA 1RLQC 2V1UA 1MZBA 1W4SA 3E5XA 3FBNB 1U48A 4FLUA 4XTUA 2R4GA 2O4XB 4B47A 3AHUA 3S15J 2QYOA 3C18A 4ISGA 3M3ZA 2VQCA 4PSWA 2MYSA 5IWAK 3ZN1A 6PAXA 5H6RA 3C6AA 1MMDA 1ON1A 3V8KA 1IDYA 2OZ6A 2RDPA 2ZSHB 3VTIA 3ZL7C 5A0DA 3DKMA 5TRDA 2ZF5O 1A35A 1YOVB 2Y69H 3BC8A 4B3SK 4AM6A 2BUDA 1RAFB 1VQ8T 2HAXA 3VWBA 1VQ4N 4IOAL 2W4SA 2M8GX 5EEAA 3N5BB 2EYWA 4Y92A 3RKWA 1VQPA 2HYJA 3VSLA 3EUAA 2FE3A 9ATCB 3WHCA 4M77F 3X20B 3SFIA 1VQ9T 1QPIA 1KK7A 1R36A 4BQOA 1FZPB 3HKZA 3L7WA 5L8RE 3ALYA 4F7UE 4BRNA 1E6GA 1S1XA 2LT1A 4OMZA 1JLAA 2PBIA 4CBUA 4JLIA 4OB3B 3HVRA 2VI6A 4WFNL 1VQOA 1KCFA 3AGKA 3GTMJ 4EDUA 4BQLA 2ME6A 3HSTB 1P7JA 2HW3A 2H8RA 1CKAA 2DN0A 4M63C 3LPTA 3CCEI 2ETJA 4YOUA 4FJIA 4E0DA 2XB5A 1B7TA 3GTOJ 1JXSA 4C0DC 1QP3A 5GAGP 1WIEA 4Z02A 4QQDA 1MHNA 3WTXC 1I5OB 1FMKA 2NNYA 3R6OA 4FT4A 2KJBA 4PFZA 3V7CA 1FLIA 3ZGKA 3E6MA 4Z4EA 4F7ZA 3E5UA 3VS1A 1NGGA 1O4XA 2E60A 2RPNA 3H9QA 1IREB 2FBIA 2QTVA 3RR8A 3WUHA 4MQ3A 4C92B 3D7EO 5GAN5 4DV4K 1HNVA 2UXBK 2F5CA 5IH2A 5BPIA 1KC8O 1RDCA 4WXDA 1RZ4A 1U49A 2VQFK 3HHHA 5F27A 3OBWA 5GPAA 1BU1A 1YJWI 2DEQA 5GAN2 2K9GA 1BW6A 5E79C 4DV3K 2FZGB 1KYWA 5DUKA 4RUGA 2X9HA 2WOMA 3FZLA 3I59B 4FZYA 1EZZB 5BPMA 3ZT3A 3CBOA 4JAXA 2DIGA 1MDUB 3TOAA 4WXCA 2H8WA 1XOVA 4B3AA 4DQQA 3AA2A 3G71Q 2Z5UA 3KJVA 2FL7A 4RM3A 1WZOA 3CCMI 5E17F 2DOFA 5BRFA 2E1MB 4WX9A 3E1YA 4CJLA 3BDUA 4F3QA 5CVIA 1H8AC 2LT4A 3GBGA 1PD0A 4M75D 2EV6A 5HDNA 1WXUA 1FT9A 4OX9K 4M3WA 4C1NI 4NC6A 3ME9A 4I98B 3DU6A 1KSWA 3H46O 2IG0A 5LMUK 3FXLA 2F4VK 5ECAA 2KIUA 4FJKA 1QWEA 2YSRA 3M9QA 4ELUA 2EA2A 5GANd 2ADUA 1SF9A 2EWNA 1B9NA 2KISA 1ON2A 2Y2ZA 1NPRA 4OVLA 2MA3A 1PRMC 3HZJA 5JMVA 2QSHX 2EYQA 3CHWA 1IG7A 1V4SA 4HVUA 2A42A 5FU6B 1WSFA 4HTLA 4DR7K 4BY9C 3E1SA 3QUIA 1Q8IA 3BQYA 1CF7A 1Q82U 4J2DA 4ZHRA 2GLOA 1WSEA 4MGRA 4UUSB 5EEHA 1WHGA 3NMUA 1YHQN 2QEXI 1KHCA 2D1XA 2HTJA 4MFBA 4JKEA 4HVVA 4Y91A 1RT1A 3NH0A 2CGJA 1YQAA 4NCGA 4K2EA 2PQWA 5JHFA 5I9EB 5CHZA 2DA9A 3CCQQ 3CCUA 1DT9A 2HZDA 4L9TA 2LQWA 4AMCA 3ZX3A 1LKXA 4IDKA 4E7KA 1GLEG 3HP6A 1B92A 3BJAA 2F2XA 5AQPA 2ZPGB 4XSXF 2O4GA 4DGWB 1VQMI 2HBPA 3JCMf 3Q7CA 1A5WA 4NNJA 2QQSA 3JRZA 3DMJA 2H3JA 3ECOA 2Q1NA 3Q0WA 1LWYA 4FASD 5HRSA 3ZSZA 4IZZA 2BE5F 5B1AH 3O8MA 1LDDA 4FWKA 5EXWA 1U4BA 3KYLA 3CMMA 1C6VA 3KBGA 4B9WA 4C8NA 4J2AA 2K6DA 4EJYA 4CGFA 2W57A 1EO1A 1MIJA 3RESA 5GAN7 3O9TA 3THKA 4CJSA 1JHFA 5K1YA 2NUTB 4EMKC 3IKTA 3ZT4A 1GLBG 2QXLA 3R0JA 2QUFA 1NJIU 3E7LA 3CMEN 1GL5A 3IQLA 1U2VB 1YTAA 4JD2B 2QQRA 4KGZB 4LD0A 4C92F 1GFCA 1PKSA 3P5JA 1W7AA 1KG6A 3LL7A 2FNPA 1UHSA 1IB8A 3KK3A 3V9WA 2HVIA 1ZSZA 3OA9A 2E2IJ 3J80E 3VS4A 1ETXA 2PYJA 3V8JA 3SDGA 3CUOA 1ESVA 2QGGA 3SMPA 3CCVN 5A2QK 2HDWA 5AQJA 4AVPA 1WJ5A 2YUSA 2XKPA 2X1CA 3KP6A 1Q1HA 3EFOB 1ZGWA 3GFMA 3W3DA 3L1PA 2FSWA 3LWIA 1AWOA 4RCHA 4CFAA 5JI6A 4QS9A 4ZN3A 1M1KO 1QZZA 3LQRA 1T3SA 1KQJA 3QERA 1IGNA 4M6YA 5E84A 2RN7A 4MDBA 3QNNA 4L5JA 4G7OF 2QF7A 3EKSA 5TKWA 3W0LA 4EAHD 2QEXA 1RAAB 4C2MJ 3AA4A 1ZGAA 3BT9A 5HLGA 3UKRB 3PLAA 3OS1A 3SQ1A 2XC7A 3WEEB 5KK1A 4KNYA 1PVSA 3MMYB 2Y0MA 2YRDA 4IXCA 3CC7A 1KG1A 1Q86C 5GMKh 2CH6A 4FL9A 3A8GB 2ZGZA 1VQ5Q 2A08A 4M3YA 2Y31A 1VQKT 2RAEA 1ZC6A 4BB7A 3VGMA 3CD6Q 3GBQA 1SPKA 3WTVC 3I56N 3NDKA 3NVKA 3JYTA 2VQHA 4EW4A 1ERDA 4JPBW 1IXSB 3OV8A 2P9NB 5M1OA 4M75E 5AFUA 3PL8A 4LFCK 3AG2H 5C4JJ 2HS5A 4I6MB 4GNIA 1VQ7I 3R1XA 2W84A 3ZCOA 4LG0A 3KZYA 1UG0A 3JAMO 3ENOA 1MUDA 4YIIA 2VWKA 4IUTA 3ABLH 5GAMf 4DW6A 3GG4A 2GA1A 4IFEA 2EFQA 2RN2A 3JRGA 5AQMA 4C92C 5AQNA 5HS8A 1K73C 1Y39A 3H3OB 2ELJA 5GIOA 4F2RA 4W5NA 5IT9K 4X9CA 3LPUA 2P7VB 2GQVA 3PO2J 1M3QA 3L2CA 3ZETB 4BS9A 3MEAA 1ATRA 1WGSA 4KIGA 1WHHA 3I8BA 4J01A 4LN2A 1VA7A 2PNIA 2FJ1A 3MD2A 4AD9A 2HF4A 5E3NA 4LDWA 3UF4A 3DTEA 2WADA 3HOVJ 3ZSQA 1VQNI 3AVAA 5KRTA 1LCKA 2MLKA 1VSFA 2E1MC 4CA0A 2DW4A 1JT0A 4FE7A 1A5JA 2FBXA 3PIPA 2M7BA 2KIFA 1VQ9A 4FO0A 4GV6A 3JCMW 5GTHC 3M57A 1SKUB 4BE0A 1BK2A 1P90A 3IUCA 3TR8A 4U0WA 1QWFA 3SAGA 1S1TA 4BBRJ 2F4IA 3OYDA 2A41A 3TTCA 5JLXA 2H27A 4KN4X 2GXAA 4E7IA 1VQ4Q 3JAMZ 1KC8R 1LVAA 4JJDA 2QCOA 2ZSIB 5IYBJ 1BW5A 1I6HJ 5FU6C 2H94A 2P9UB 3ZQIA 1REVA 1MBKA 2WBNA 3LSMA 1S3JA 2XAGA 3FDYA 1WI3A 5D5VB 4XK8E 4IJNA 4M3GA 2PVOB 3VETA 2IJLA 4RDUA 1NE8A 3HDDA 4ELZC 5EDNA 4ME7A 4M7DA 4BRPA 4QSHA 2BANA 3K57A 5BQTA 4F92B 5EU7A 1XSDA 2DFUA 2E6ZA 3J80K 1KQ1A 1NK9A 4F4KA 3MZYA 2GTOA 1TL1A 3ZP5A 4BHCA 1AWXA 2HPMA 1HR0K 2LX9A 2DU9A 1TWAJ 2R5ZB 4KV8A 4ETSA 1H92A 3QPHA 4Y17A 3THWB 3NGIA 1A31A 4FOIA 3R3LA 4DU1A 4B6MA 4ZZDA 3FJPA 4RTUA 3GNFB 1T6CA 2OTLI 4Y52J 2BVMA 2D45A 4N4GA 3K9JA 4B9SA 2OPSA 3DB4A 5GJVB 3MCZA 2E4LA 4JX4A 2UXXA 1DPUA 1N77A 4XU1A 4CGJA 1UE9A 1KXPA 2DLLA 2V7YA 4B3TK 4AM7A 4AIKA 4H0VB 4L5GA 2VBWA 4DEXA 3DLLL 4DV7K 1AWJA 2P5OA 2Z1GA 3SPYA 1UJ0A 2QTXA 2KYBA 2MAMA 3AA5X 3NCIA 2P1JA 3L2WA 4Q4ZF 3GXOA 2O03A 1EX4A 3V7SA 1BOAA 1SL0A 4CHPA 1HYOA 4ILGB 2CUFA 2M51A 1PCXA 3LDQA 4EIAA 2KTQA 4DWIA 3SEZA 3AG1H 3TAMA 4Y1CA 1NU0A 1YBYA 4B08A 2L9NA 4K0KK 5MLCQ 1RGIA 1RCHA 3X2QH 4H0TB 1TKXA 3F21A 2CGLA 4DTNA 2HVHA 3AVHA 1QQMA 1IRXA 4CC2A 2UUZA 2KGTA 2VOPA 3EEQA 3N4QA 2HHXA 4R79A 2ZCFB 1K4SA 2DFFA 4M7AF 4C3HJ 2F4MB 2A69F 4QPQA 1YCYA 1TWFJ 5HLIA 7AT1B 3CCQT 2HNDA 2Q2RA 5DK5A 3HOYJ 5GAOq 2ELKA 3QEIA 3QFPA 2JUFA 4IO9F 3AVGA 2VBZA 4KH6A 4X9DA 4H03B 1WQ7A 5HL7L 4PJJA 1YHQQ 4C5EA 4G7HF 1RKTA 1UOCA 5D3GA 5E26A 3H0FA 1RBTA 4B4CA 1Y0UA 4BRKA 2OPQA 5D6FA 4FJ5A 1U6ZA 1VF9A 2A36A 2HEQA 3CJ9A 1JKQC 5GAOn 1GLJO 2HNYA 1C0WA 3FEOA 4YHHK 3MXIA 3BW1A 4BVOA 4QT7A 4YY3K 4O5VA 2E1ZA 4OFHA 3H5AA 4U7BA 4JI7K 3EO3A 4X34A 5HK3A 2Y0SN 2G8WA 2O8EA 3U9ZA 2E64A 4DYCA 3CMAN 1FP2A 2MLGA 1WJDA 3CJNA 2JLEA 3M1FA 4E1MA 2L7FP 1RBSA 4LE9A 4GCVA 4G6QA 2L01A 4P55A 4V2SA 1GRIA 3T5XA 4BREA 1UCRA 3HFOA 2KFNA 2LYCA 2QGFB 2DXBA 2E6NA 3UPUA 1VYVA 3JCMc 4HHTA 1Z91A 3Q5FA 3LWLA 4H4KC 2NOZA 5F1RA 2DL7A 2FVUA 2VC8A 4QQGA 3GNGA 3I5SA 3CDHA 4KULA 3VUZA 4JHDA 1JEGA 3G6EI 2RHXA 4E4HA 1C0FA 4DV5K 1BC8C 2NOIA 4FPBA 1QGPA 2LSNA 1MBGA 3CMEQ 4O44A 1HQEA 4K41A 2KMTA 1UDLA 1YQMA 2W41A 5LD2C 3GOXA 3WQTA 3TO7A 2K9SA 5DCMA 1XSVA 3ESWB 5ELZA 3BR0A 5L23A 4N41A 1NWKA 3JCMQ 4XR6A 2EFPA 4JKCA 3ZMZA 1IZ6A 4AILC 1VQLI 3BEXA 1DUXC 2P4TA 3L6QA 1P8ZA 1N6AA 3MEDA 1K8AR 2WONA 2MC3A 3CCVQ 3M59A 2LLKA 4M7AC 4GVEA 3RQ4A 2YHBA 4ENNA 2QGUA 2VVKA 1YJWT 1SD7A 3V42A 2FXAA 3CDLA 1HQCA 1T98A 3CC2I 3N05A 4XLPF 1U78A 1USTA 1FOYA 2XK0A 2P0WA 2QWRA 4HTUA 1AHDP 2JJ9A 2F2WA 2D0NA 2A0FB 3I0SA 3DXJF 4DJAA 1QHAA 1F1BB 5A2QO 3M58A 2LY9A 4M6VA 1B4AA 2OBPA 1S7AA 4I2OA 1MWMA 4YOWA 3CF5F 4CK2A 4ZYAA 3CETA 1JJ6C 1WCMJ 3MXJA 1SHGA 3CM6A 5AQXA 3WNGA 3F0ZA 4YOVA 3O9SA 3TU4K 3V4IA 2VJJA 3K2ZA 1Q86O 4ZDPA 2R5MA 4JX6A 2P81A 3H0DA 4JI3K 4M41A 3NFCA 2IW5A 1LDKB 2DJNA 3ZSRA 4EFHA 1HW1A 5KYUA 3I56Q 4M77E 3I35A 5DMRA 3H92A 1T08B 4EM0B 3KX2A 2A61A 3JCUC 4BR0A 2M0YA 1MSFC 4CEDA 2E6MA 3M0PA 1QKXA 2V8IA 3I0TA 4MQVA 3VODA 4DTRA 4EMGA 1YW7A 3CCRI 1SVMA 5JVGF 2LQKA 1BL3A 3GVAA 5FO5A 4OGCA 2HEOA 2PMHA 2EHGA 4XU3A 4C92D 1MJBA 3KHYA 3JTGA 1XCVA 4NXMK 2Q8KA 4B3XA 1LFPA 3TSZA 4MLHA 4CFCA 2DOAA 2HNHA 5HDGA 2K9NA 1I27A 4BR5A 2VOOA 2EIMH 3O4QA 4H5RA 4II2A 3HI0A 4TVRA 2JM8A 4B9VA 4FYYB 2HSPA 1T6SA 1ZG5A 5A2QZ 2CWEA 4XTVA 3CCSN 1Q82C 3KLNA 3DTIA 1YX3A 3S14J 4DKWA 5IT9O 5M3MJ 2R57A 4JI1K 4DSFA 4WTOB 2BZTA 4PY5A 1LVKA 5HDKA 5CJ9A 4PKGA 1R4NB 2IGMA 4IUQA 4DTJA 3SJHA 3GLXA 4DSJA 1IN8A 2MH9A 3AO2A 3EGDA 2XDDA 4A0ZA 3TWHA 2YX7A 3TW6A 5IOZA 1VQ4T 3CC2A 3QU6A 5J40A 1M4ZA 2A1RA 5FLVA 3LH0A 3K4CA 4FW2A 2MMPA 2WTEA 3VFZA 2LJ0A 1YX5A 3P38A 3J7AO 4CEBA 3QEVA 2YDLA 3I4MJ 4FU6A 2O8CB 2E20A 4PA1A 4UXNA 1Q7YU 3HJFA 4PFPA 3JB9J 2NUZA 2E1NA 1YIJI 1SEMA 2CMPA 2C6YA 1QSLA 2F8SA 2WSCE 2Z99A 3SBTA 3TMOA 1K78A 3DKWA 3L9FA 1KD1C 3TU5A 2CFXA 4OPAA 4DFJA 3NH2A 4Q5WA 2QM3A 3CTAA 4BWMA 3BY5A 4CI6A 4QCLA 3JXUA 3S1MJ 4PJMA 2M4KA 1NJIC 5LRRA 1X1BA 1T44A 3DYAA 2M9HA 2CV2A 1SD6A 5DPKA 4CJVA 4KHYA 4PJOA 3REBB 3G71A 3JS6A 5HRNA 5IT9Z 5CKFA 2HKOA 2HNIA 3S93A 1FYNA 4IO8A 3DF8A 1Q18A 3DRRA 3DLHA 2LKXA 1D0YA 5GANf 4BRHA 3THVA 4EJWA 1M90U 4A12A 1YI2N 1FSEA 1S9GA 2XIDA 1T0FA 3SFMA 2H1LA 3NPFA 1KU9A 2YJFA 2R7QA 1YVUA 1YJNN 1BI0A 3S1QJ 1VIFA 3KP7A 2XVCA 3NWTA 4HT9A 4CF8A 3VYRB 2ZJRL 2JS0A 1QZ5A 3KEOA 3NFAA 4LG3A 2V6EA 4J83A 4OJRA 3NMZC 4KBMB 2LDMA 4FJGA 4NOYA 3U8XA 4BRCA 1X27A 3CCJI 2IS2A 1VQ6N 2WV0A 4FJXA 2P0PA 1I5ZA 1JKRC 3HUGB 4BC5A 2QAZA 3CBMA 5CY4A 2VQEK 3K58A 1SC7A 4O5BA 5E3MA 2VKNA 2BW3A 2PVDB 3M8PA 5HROA 1BDGA 2IVPA 1BIAA 1DQUA 2OQGA 4C8QF 2Z1HA 1AHJB 2LP0A 2KRCA 1SFXA 4KREA 3SZPA 1Z6TA 2HZTA 1GLCG 1YITN 3KZIC 1N8RC 3LWMA 3EETA 5IHNA 1TW3A 4KISA 4DHYA 4C8OA 1ZXOA 4C92E 3FZVA 3VQ5A 3OYLA 3SI6A 4JS4A 3AVCA 5F6FA 2STTA 5HNFA 2FXUA 2KRFA 1YHQT 3W2WA 2L9VA 2IXSA 1JBMA 5H6QA 2IA1A 3RKYA 3CWTA 3LDLA 2YHAA 5GAOr 1D1CA 3IG1A 4CFBA 3ZQCA 3TAPA 3Q7BA 3HEFA 5BR9A 5LJ5g 4Q5SF 1ULYA 5FRNA 3DXKA 5LEKA 2RF2A 1KJWA 3CCLI 2N8GA 3TAGA 2DMPA 3GZ6A 1OV3A 3T7ZA 3AAPA 3R6SA 3K4BA 3CC4N 3U1KA 4K11A 4LOCA 1YTUA 1XHXA 5KCOA 3IWZA 3TSWA 4Z4HA 4EVIA 4E9EA 5BRHA 3VOEA 2XKOA 4WQ4A 1OU8A 4J19A 4OMMA 3S6IA 4WWCA 2D9TA 2STWA 4KUIA 3WT0A 3C1DA 1KLNA 2CH4A 1C0UA 1KU3A 2VYTA 4PDKA 3PIPF 2WFBA 2OA8A 2FUG2 4DSLA 3A03A 4MLOA 1B34A 4JOMA 3ASNH 2CFOA 3PNVA 4XIDA 3X25B 4XLAA 5LHHA 1V76A 3CO7C 1W7PB 1VSMA 2DD4A 1KVCA 3CMAQ 4KT6A 3G7ZA 5LL6S 1IKWA 5DM6L 2DMTA 1ZUKA 1X2NA 1UGVA 3CQXA 4RTVA 4WCIA 1ZQ1A 3BE3A 5M5YJ 3PO5A 5CQGA 1B8IA 3P9KA 1X6BA 2OAWA 5ICEA 3UB5A 1WXBA 3EG2A 3O4NA 4CBWA 3WU2C 1HOMA 2K40A 3GTKJ 3M8QA 5GTIC 1M30A 2ZXJA 2O8EB 2K27A 2I5UA 1W0UA 2XHCA 1XNRK 2DO7A 4CCLA 3CCVT 4FLWA 4DA4A 2DETA 4CD3A 3BWGA 4M7DF 4J8FA 5LJ3g 3KD5E 1SEUA 4JI4K 2OTLT 4RB0A 4KT0E 2WSFE 1FMWA 4C5GA 3C95A 2EIJH 3OSSC 2V4JC 5J4VA 1K9AA 3SWNA 2IDOA 5CZ2A 1VQ5A 1FY7A 3D7SB 2V7ZA 2CV0A 4M7AD 1EJ9A 3CD6A 2AKKA 2KKZA 3ZQLA 2PBDA 3MFKA 4A61A 2XF6A 2P0KA 1DU0A 3PSFA 1OFCX 3S3NA 2EJ9A 3A8HB 2YU9J 4A2AA 1KTQA 3MCAB 1K73R 2XDVA 3TDZC 4HDVA 2LBFA 1PC0A 4RAYA 3MZ8A 1SANA 3K2AA 4RLFA 3A8LB 3OWTA 3SK3A 2K3XA 3CCLA 2IGOA 3O9RA 2WUSA 4P5OA 1J3TA 3CZ6A 4FVUA 1BQNA 2NOJB 3LM9A 4RGXA 1QSSA 1FOWA 2VN2A 2IRFG 3S8PA 3HYFA 5CQEA 4F93B 1YT3A 5K7ZA 3PUFA 3JB9F 3D5RC 4ZN1A 3ZMVA 2E5LK 1ZR2A 2BY2A 4EP5A 4FK0A 1T56A 1V3FA 3VB2A 3KYDB 5DCFA 1IW7F 4B3MK 5CLSA 1OVQA 5FROA 3LAKA 2YHWA 4F52A 3K4KA 2M2EA 4L9NA 2J06A 1R5ID 2EFWA 4BR2A 3M8JA 4E47A 4FM2A 3N97A 4QPOA 2CG4A 2D6FA 1ZUYA 1YJ9I 2YHTA 2NWMA 4JJCA 2NS7A 5EYRA 4WQ5C 2P9KA 3O9QA 5CVUA 4LNPA 2DA1A 4FVMA 3SV4A 3C7NB 4NC7A 3L0QA 3FDRA 3LSTA 2O2OA 2D1HA 3MN7A 5D8LB 1W4MA 1C0GA 2YLCA 1EWRA 5BRDA 1VYTA 4CJWA 2XASA 3D2EB 5DD8A 5LJ5h 3D5LA 1W2BS 1X9WA 1K0XA 1UGRB 1V4TA 2XV4S 1ZG1A 4CZHA 4QVCA 4Q0BA 1GXIE 2Y1JA 1HKQA 3BG6A 1KQSS 5EGOA 4PSXA 3SQ4A 4DOWA 2OTJN 4YFNF 1Q82O 1BA0A 3VS3A 3HT3A 5BPNA 3DFGA 3MWMA 1JTXA 2R3SA 3L09A 3MEXA 1TYQA 2RMOA 5CIUA 3C0BA 1M8VA 3R0AA 3JTHA 2E6LA 2C06A 2DK5A 2G3RA 2VJ4A 2KPMA 4XTYA 5AQSA 3K0SA 1GCQA 1R23A 1Y7XA 1ACMB 2CP0A 2ZJPL 2E41A 3WTTC 5F08A 1PUEE 2ASOA 3RBBB 3G6ET 2FX0A 2FBTA 3OL4A 3EG1A 3OOPA 2W42A 1E3MA 1IGQA 4DB3A 4CD1A 4Z4FA 4LSNA 1SL2A 2VIXA 4FJ8A 3ZQHA 1NEGA 3MVPA 2CKKA 4BG8A 2HVQA 3O6WA 1QVTA 1Y56A 4RGSA 3EGDB 3H8ZA 1HKCA 3GFJA 4BY6B 3ZPLA 5IP6A 1D3BA 1WB9A 2MABA 3AAFA 1DLOA 2D0CA 2HQXA 3VN5A 5I11A 2XU8A 1DP3A 2WWYA 1HYVA 3NGYA 4C30A 3P8HA 1HK9A 1YRNA 5AONA 5LJ3h 2PUKB 9ANTA 1CXUA 1T38A 1BISA 1NJIO 4D7NA 1ZH5A 3RZOJ 2FZKB 2W1OA 1TWGJ 1JUSA 3L2QA 2FB7A 4ICLA 1XMQK 4BWJA 1B72B 5IXFA 5KVRA 1UELB 1AKHA 4B22A 5KYXA 4JDSA 2D4WA 4B3OA 4M7AE 2DTHA 1WHKA 3RPQA 1EA3A 2F96A 4BR9A 3VQ6A 1I3AA 1ZBFA 1D5AA 3UKUA 5DDGA 2D5RA 5JLHA 1LUJB 2RHKA 2FOKA 4ESRA 2K7LA 3ONQA 2P9LA 3QODA 1WQ2A 2Y30A 4N47A 1YI2Q 1RC9A 3LP1A 1M2VA 1NK5A 4A4GA 4BUPA 3S1NJ 1ZLKA 5K5OA 2KROA 2BOLA 3QAHA 4EATA 2P84A 5EZHA 3LYIA 2YLBA 3WTSC 3PE0A 1YJNQ 1O7FA 4DQ2A 4Q5VA 3RSEA 2NRAC 5HLFA 3SEQA 1WHUA 2DVJA 2KBTA 3E66A 2PMZA 1X3NA 2RVCA 4PJOB 2K9MA 2P6SA 1U5TA 4O0JA 5BNGA 4DV1K 4XRSG 1JT6A 4XL9A 1KU2A 1MMGA 3GTLJ 2BKDN 4UHTA 4QIWN 4M3FA 2HHHK 2PZ1A 4BHPA 2DX1A 3K5MA 3CCRT 4KGXB 5CQYA 3K1MA 1QBJA 3TQ7P 2BUPA 1VQ8N 3ID8A 2AJQA 2P4WA 1QZEA 4IUUA 2DTZA 2VASA 3SNNA 2COMA 3AKZA 1VSEA 4EQQA 3OW2S 3WGHA 4BJ5C 3G0ZA 1YWPA 3ZQQA 2RH2A 2LJ3A 2FBYA 2KT1A 5GAOl 2V7FA 4ELVA 3OS2A 4NCBA 1EH8A 3FXKA 1FTTA 3LA2A 1QKWA 2HNZA 4H0EA 2E35A 2W7NA 1WAFA 5CYQA 2ZFWA 4IX7A 1YITQ 4ILJA 1NGNA 1U6GA 5AQLA 4JZ4A 4CK3A 5GADP 5KQ8A 5FWCA 2E3HA 3VF2A 1JLEA 2L3RA 4HSBA 4UB6C 4HLYA 1D0XA 2D5VA 3M07A 4GMJB 3Q3SA 4DSKA 1L3TA 1GOCA 2Y1IA 1M1KU 3EE9A 3LDOA 2W82A 1OYYA 5AZIA 1ORNA 5LLQA 3DLRA 2ESHA 2P9SB 4LD9K 4FK2A 1JKPC 4CCJA 5CKTA 2J6KA 3KETA 2LTOA 2NRZA 4XU2A 2QTDA 3TVTA 2PTKA 1IN6A 3FJ5A 5GMKm 4RAGA 3CC4Q 2GXGA 5HOOA 1LWEA 3CMAT 2X3XD 4A3LJ 4L8RB 3P4IA 3CMEA 3VF4A 3DPLC 4DV6K 3RSNA 3TGNA 1T3VA 3I9V2 2O9SA 3VUBA 1NK6A 1RDWX 3OY9A 1SKSA 1JCGA 4XICA 1KQ8A 2EQRA 3OIOA 5TISC 2VLAA 3J8AA 3OH6A 3CJTB 2BZ8A 1W1FA 1AWWA 3LOCA 3DXKB 4FWSA 3S41A 2ZBKA 2IVNA 1SSHA 2GTJA 2F5FA 1RAIB 2V1XA 1XB4A 4CXFA 1U9NA 5J39A 1ZREA 2COYA 1BO5O 5M9OA 3FMQA 4BC3A 4F7UF 2YCHA 1Q7YC 3OYCA 2DKGA 2V26A 1D1AA 3MN6A 2MI6A 1SFKA 3FXJA 2LR8A 3HGYA 1G2HA 5IHIA 2KIMA 4CFDA 4RB2C 5I2MA 3H6EA 1B34B 4FSSA 2DA6A 4XLHA 3KCCA 2X4XA 4XQFA 1ZUUA 4Z88A 3FKIJ 2GCXA 2XY5A 4NLBA 2RHZA 4EVVA 1XQHA 1SKRA 3S2WA 2KLOA 4OIOF 4CC3A 3A5NC 3WQUA 2KQRA 1TK8A 3IHUA 2PEXA 4QS7A 3AV9A 1PHTA 2LF7A 4J9CA 4EGYA 2B86A 3DLGA 3CEYA 3VGLA 4ZGDB 2LY1A 1UECA 3GDQA 3I56A 4KUMA 3VMFB 3FXOA 5CAIA 1SL1A 1Y96A 3CCJT 2YUOA 4DSIA 1WJAA 3OYBA 4BHBA 3VV0A 2YX4A 3KPHA 3C94A 1HNXK 2QA4N 3A5OC 2QK9A 3ASOH 1M90C 2GAUA 5EG0A 3KVGA 5F04A 1MUYA 4RTYA 1VI0A 3JCMP 2DCEA 2Q2EA 3VEOA 4OINF 2W0ZA 3QFUA 3TQNA 2KT0A 4BY6C 2QW9A 3SWNB 2DFIA 4CRIA 3F6OA 1Q82R 3ZSYA 2K5LA 3C3WA 3QWLA 4XKBA 2ZPIB 1UHCA 1QHHD 1UWBA 4I7HA 3FK6A 4NXNK 3VEWA 4ZTJA 2H09A 2UWMA 2LBFB 2G7HA 2RK2A 4RTTA 3RYPA 1LWCA 2X6XA 1H8KA 5KYWA 3SAHA 1JJ2S 1NGEA 4OKEA 1IKXA 4PZJA 3P9CA 1OCTC 4KN7X 1LEAA 1GLAG 2GFUA 1GLLO 4H5WA 4DS4A 1W97L 4M7XA 1GFDA 3DLLA 2HYGD 4OOIA 1ZBIA 5J2PA 1HQUA 2PQ8A 4E19A 2O7OA 4A53A 4OU0A 3KWIA 1R1TA 1OU9A 4Z0UA 3VQ8A 2HFHA 3KD1E 1TG0A 3FM3A 1H9GA 4KH0B 1O9SA 2Q0UA 1NHAA 1KD1R 1KEAA 2IVMA 2KIQA 2HOEA 1T8EA 4PJOC 2ITMA 4M72A 4HV5A 1QP2A 1HDDC 3NWSA 4UV9A 2AA4A 2EZHA 2KFZA 2C0TA 3CDIA 2LVMA 2OTJQ 3F10A 4J9DA 3SDZA 1QVGA 2LD5A 1Q1VA 2HKNA 5C2FA 2WC9A 3H1CA 1T0FC 3AVMA 1ZN2A 3IH3A 5A0LA 2DFHA 5HKCA 4DBHA 4MFEA 5C3EJ 3PM1A 3BDPA 3K5OA 5E1WA 2YPRA 5J1EA 3L2RA 1X6OA 4B3RK 1W2BM 2ISZA 4W5QA 1YCSB 2XROA 4GLKA 1FOKA 1Y97A 3BR1A 3JB9D 2KZZA 2PX9A 4EMKA 5F0FA 5K7HA 1KQSM 2HDAA 4LY7A 1ODDA 4AVZA 1O3QA 3M8SA 3OYMA 4MO7A 1F1ZA 2E5ZA 2VE9A 2AZVA 3F5TA 1VQKN 5DYMA 1NG7A 3ZSVA 3VRZA 3VEXA 2BE9B 4C8QE 4GW6A 5E18F 1TYQB 1K83J 3DEEA 5FU7B 1CXQA 3DBHB 4RA2A 2O4XA 3X24B 1D1BA 3FX3A 3U6FA 4Z89A 3M8FA 3H41A 2RB6A 2FEIA 3GTGJ 1XWLA 1RESA 2M34A 1G2BA 3OYIA 1PU8A 1DJ7B 4MLEA 3CERA 3QDFA 4CEQA 2HQHA 3G1OA 2K57A 2EH3A 2K4BA 3M55A 3JSCA 1F4KA 3HBLA 2R7TA 1YI2T 1FP1D 2OC6A 4WFBL 4I7FA 4LIVA 2YNHA 1N8RR 3RMBA 5JFRA 2D0AA 2LQNA 1YJNT 4DR4K 1E0EA 1W7PD 4BRFA 4Y13A 4JK1X 3K4JA 2E2HJ 3QINA 1QVGP 1KG4A 3MWPA 2NOEA 1D3BB 3CVSA 3AVBA 3I55I 3JCMV 2VWBA 1RT5A 4HT8A 3E6DA 1U5SA 3K1PA 4DU4A 4KRTA 3G3ZA 1YRNB 4JLHA 1TUUA 3LLRA 1BHLA 2DVEA 2XKOC 2RHYA 2QXFA 3FIFA 2O0YA 4LK0F 1MBHA 3BY6A 4A6EA 5ICGA 4WQ4C 3GBTA 2JA8J 1AKHB 4QVDA 5F0HA 3R6NA 2ZFUA 4Y33A 2ZKZA