4BE1A

Pfv intasome with inhibitor xz-116
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be1A03
5DMRA 4FLTA 1HRHA 4PLIA 2M0OA 4RW6A 1K6YA 3T1AA 2HNDA 3OYGA 4FJ9A 2BANA 3HP6A 4CEAA 3RMAA 1T03A 4I2QA 2R58A 3L3UA 5I42A 4J2DA 2HNYA 1XHZA 1MU2A 5KRTA 1ZBHA 1CXUA 2X78A 3V81A 3HT3A 4DTSA 3U3YA 4H4OA 3HXMA 5J2MA 2R57A 3HM9A 3FDRA 3PV8A 2LRQA 4O0IA 1C0TA 3RTVA 3ITHA 3OS2A 4KTQA 3V1QA 4CJVA 4CJTA 4CGIA 3NHGA 4DU1A 1Q8IA 3LP1A 1IH7A 1CZ9A 2RHUA 5KH6A 1S9GA 2HQXA 2RN2A 3VQEA 3E01A 1EP4A 4KB0A 3TR8A 3DM2A 3RRGA 1RNHA 4QCLA 4KTZA 4CJEA 2Z1IA 4GVMA 2O4XA 4DFJA 4KI4A 3TAFA 5J2PA 2BDPA 1RT3A 3BDLA 5FRNA 1FKOA 1U45A 3NGZA 3SNNA 2X4WA 3M9QA 3MECA 5J2NA 4QQ6A 2HHUA 4CF2A 2Y1IA 1RDBA 2XO7A 2VG6A 4DFPA 5K14A 1KCFA 2X4XA 4Y1CA 4DU4A 3OY9A 3V9XA 1SKWA 4XIUA 2XHBA 5HROA 2RJCA 4RW8A 2XY5A 3OYKA 2RHZA 1RTJA 3VQ6A 1JL2A 3LAMA 1WAFA 4DSKA 3TAPA 4B9WA 4N56A 1NJXA 4PA1A 2QQRA 2HHWA 2R5MA 3S3MA 3HPGA 4DF8A 1UOCA 4N4HA 4CJUA 2EQKA 4PL6A 3NBPA 3NAEA 4FJ8A 4Q5VA 3ASMA 3ZCMA 2F96A 5SWMA 3SV3A 5KCHA 3TARA 4KTWA 4CRIA 4HHTA 4LY7A 3VQ4A 3RWUA 2Z1JA 1NK5A 3VA0A 3NDKA 4PUOA 3I8DA 2K3YA 4OVAA 1REVA 2ZE2A 4F4KA 3LGFA 3UIQA 4OGCA 4JLHA 3QIPA 1TK5A 2KFZA 1WJSA 1WLJA 1Y97A 3ALYA 3K5OA 3M8PA 1VSEA 4B8CA 3HVRA 1S1UA 2QKBA 3KK1A 5CYQA 4C5IA 4W5TA 1TGOA 4DTMA 3QEIA 2HVIA 3ZSQA 4BE1A 2HQEA 2FBXA 1IO2A 2YHAA 3IS9A 2JGUA 2WACA 3LZIA 4Z02A 2QXFA 2P0KA 3HL8A 4KPYA 5HRSA 4IG0A 1YT3A 4OKKA 1QSYA 4KHSA 5M9OA 2O4XB 4M3WA 4E1MA 5D6YA 3S3OA 1LW2A 2G8IA 4CJLA 3VN5A 1IKXA 5HRPA 4DTJA 4A4FA 4CJ3A 4CFAA 3DLGA 4GW6A 4HUEA 4CHNA 3THVA 1TL1A 2KW4A 4J2EA 3ZSVA 1HNIA 4ICLA 4HCZA 3AVBA 2KZZA 1WSHA 1HPZA 2FBYA 1L3SA 4OPKA 1X9MA 4MFBA 3OYDA 2JLEA 1RT4A 1WSEA 4FJKA 3MEAA 1UWBA 3K58A 2VWJA 3DB4A 2EX3A 3H8ZA 2RI5A 5D6WA 2DY4A 5FDLA 2QQSA 3KD1E 1HQEA 4HVJA 4Z4GA 2R7YA 3BGRA 4CHPA 1VK0A 4N4GA 4RW9A 4N5SA 1TAQA 3L3VA 2IS3A 2WONA 4F8RA 1NK8A 3NF6A 5C0MA 1BCMA 1S1VA 4CGDA 1I39A 4WE1A 1ITGA 1WSIA 3NTIA 3SQ4A 3RMBA 2LVMA 3QEWA 2VWKA 4I9LA 1C1CA 1W9HA 5C42A 4M42A 1VSHA 1CXQA 1BCOA 2M1HA 4E0DA 2HHTA 4CFBA 3K5LA 4OKJA 1QSSA 1L3TA 1JXEA 3AVAA 2HW3A 3OYJA 4M3RA 4E19A 1VSLA 3VQ7A 2EFIA 1QTMA 2HVHA 1Q9XA 3DLRA 3MEGA 1VRTA 2EQUA 2HHQA 4KHYA 3AO3A 4CF0A 4NZGA 3DRSA 2MWPA 4DMNA 4CEZA 3MXMA 5C24A 3T19A 3S9HA 1U47A 3ULDA 1RTHA 4OLAA 4KHUA 4ZTJA 3SJJA 4ELUA 2X35A 3LPUA 1CLQA 2R5AA 1OZ2A 5I3UA 1MHNA 2FC0A 2CKKA 4DQSA 4DF4A 4OLBA 3B6OA 1GOAA 2RF2A 3KD5E 1X9WA 4DSIA 1ASUA 1RCHA 1KVAA 3KTQA 2P1JA 4E3SA 1IKYA 1C0MA 4C8KA 2RHYA 4CE9A 4DTNA 1S6PA 1RBTA 2GV9A 4CGFA 4KFBA 3TABA 3MEWA 3AO5A 3FFIA 3SV4A 3AVMA 1FK9A 4M3UA 3P8HA 2E6LA 3NF7A 3DRPA 4CK1A 4CEEA 3NH1A 3K57A 3DYAA 2L8DA 1RT7A 2L89A 1NOZA 2HMIA 2LDMA 2VYTA 4FLXA 1N27A 4DSFA 3AA3A 3TANA 4QOZB 1WSJA 2B6AA 4IURA 4BDZA 4N41A 4BDYA 2G3RA 3QO9A 4O5BA 2G8UA 1XWLA 1RT1A 1B9DA 1NK4A 3KJVA 4NYNA 3AVKA 4LSNA 2JTFA 5CY4A 3EYZA 4HUFA 4AILC 4FJHA 4DS5A 2O4IA 3VQ9A 4GY5A 5SZTA 4OVLA 5KRSA 1FKPA 3QNOA 4EZ9A 4Z4EA 3S6WA 2DTUA 1RBUA 1BIUA 1DTQA 1YVUA 3LDSA 2BIVA 4HUGA 1KHCA 2VG5A 2BKDN 1XC9A 3VQBA 1EXQA 3OYBA 4CCHA 1BISA 1B92A 3AVLA 2QK9A 4C5HA 2NLUA 3LZJA 3SUQA 2RJDA 1XI1A 4NCGA 1G15A 1T8EA 3TAMA 1WSGA 1RTIA 3AO4A 3EZ5A 1LWFA 1NKCA 2RKIA 1S1TA 2Z1HA 3CG7A 1L3UA 4ZHRA 2YNFA 3O4QA 4OPJA 2DIGA 4Z4IA 1J54A 5J2QA 3AV9A 1JXBA 3O3HA 2IC3A 3U6FA 2FBVA 3OJSA 4X34A 4B9MA 4BACA 2EQJA 1RDCA 2RO0A 3UT1A 4FK4A 4Q5WA 4DLGA 4O44A 1GOCA 3RRHA 3E9GA 4QVZA 2D0BA 2DAQA 4DSJA 3DOKA 1N5YA 4CHOA 4I7FA 1TV6A 1WGSA 1U49A 4Z4HA 1JLAA 4JRQA 4N4IA 1ZYQA 5C25A 3LLRA 1X9SA 3M8SA 4DTOA 4DTPA 5IN1A 2IAJA 3OA6A 3MP8A 4IFYA 3QLHA 1J53A 5HRRA 2X6SA 4I9QA 4E7JA 2G8HA 3AA2A 4FU6A 1J5OA 1HNVA 4KAZA 2E6MA 4CJFA 1TKDA 2WOMA 1NJYA 4CF1A 3TWHA 5IAYA 4IFVA 1EX4A 3H6ZA 4F3OA 4EDUA 3WNGA 3V9WA 2G8KA 3OMGA 4L59A 4FLYA 3SD4A 5KTQA 3VQDA 4HTUA 2YKNA 3ISNC 1TK0A 4IDKA 4FJNA 4AHVA 1SKSA 3K2PA 3LPTA 4PY5A 4J2AA 2GBZA 1RBSA 1LW0A 4NYFA 4YFUA 3CM6A 4R5PA 5CYMA 3OYEA 3DMJA 1TKXA 1WJRA 3MAQA 4DSEA 2P5GA 4H8KA 4IUPA 3KLHA 3VQCA 1NK9A 1A5XA 3FEOA 3PNWC 3V4IA 3OYNA 2YKMA 4EP4A 4E7HA 4K8ZA 1LWCA 2LSNA 3AVHA 2YNGA 1HYSA 4C8NA 3QESA 1QE1A 3OYMA 1BGXT 2GUIA 3IRXA 2L3RA 3LH0A 3RMDA 1D9FA 4I2PA 3M8RA 4W5OA 1VSIA 3E9FA 4HCCA 3OJUA 1TKTA 2OZSA 4B08A 1HMVA 1U48A 4Z4FA 1KLNA 3LALA 1HYZA 4FZYA 3LGLA 3KKRA 4FXDA 3K59A 4DQPA 2MWOA 2KZMA 1WSFA 1D8YA 1RILA 4DQRA 4K8XA 3O3GA 1BI4A 1C1AA 4E1NA 2IG0A 4IKFA 4FLVA 3SPYA 3AA5X 2KQ2A 3NTHA 4ID5A 3SCXA 4M3XA 5DK5A 2PQWA 4AHUA 3ZT0A 4MQ3A 1UAXA 2P51A 4AHRA 2F8TA 3PX0A 3U3GA 4W5RA 2ZD1A 3AVGA 3QEXA 4OGEA 4BE2A 3OVNA 1JLGA 1YTUA 4F3TA 3FC3A 3OYHA 1Z25A 1RT6A 4JRPA 3NH2A 4E89A 3T3FA 1OYXA 4RW4A 3ZSZA 4DTRA 2XY6A 1UA1A 3D0PA 3KLIA 3L42A 1WNSA 2BUDA 4CHQA 4CJPA 4CEDA 4LH5A 4Q0BA 5J26A 4BE0A 2F5KA 4IUTA 3O8VA 1WN7A 3OS1A 3LP3A 4NCBA 1S9EA 4CESA 2Z1GA 3NH0A 1L5UA 4DFKA 3MEDA 4AHTA 4FJLA 3LP2A 1LWEA 2A1RA 2RHXA 2ITGA 3L8BA 4N47A 3HVTA 3L2RA 4CJQA 2YNIA 3C6TA 4TSXA 4AHSA 4UQGA 1Q9YA 4CEBA 4LSLA 4QW2A 4CGGA 4CJ4A 4FJMA 4B9NA 2W42A 5HBMA 4G1QA 1VSFA 1SKRA 1RBVA 1HJRA 5KGWA 2QKKA 2Q3SA 4KKOA 1JKHA 1C1BA 3SQ2A 3KK2A 1W0HA 3ZSXA 2DFHA 3V6DA 3NFAA 3SPZA 4KHQA 4DWIA 5D6XA 3LYIA 1EKEA 3DI6A 2OPRA 5E41A 3AVNA 4RG8A 2LCCA 4CIGA 1JLQA 4DSLA 3O3FA 1BI4B 1IKWA 3MEVA 2RI3A 2KFNA 4FJXA 1RTDA 4CF8A 4CEFA 4O4GA 4O0JA 2D5RA 1OI1A 1H3ZA 4ZTFA 4LH4A 3VQQA 4IUVA 1O1WA 4FJIA 4J2BA 4LD6A 3OB9A 2DIQA 3Q1JA 4BWMA 5FROA 4FLWA 2YHBA 4BWJA 1BIZA 3B6PA 1NJZA 3C6UA 5KGXA 4Y1DA 3KLEA 1JL1A 5KI6A 1ZBIA 4FZXC 3KK3A 5JS1A 4CIFA 2EHGA 3I0RA 1NKBA 3CFPA 4E7IA 3O4NA 3EAEA 1JLCA 2OYQA 4CK2A 1F21A 1FXXA 2VG7A 3MEEA 4EP5A 3A2FA 3CQ8A 1KRPA 2BE2A 4FW1A 1T7PA 3RMCA 5KE3A 4C5EA 3QKJA 3V9SA 4RG2A 4CK3A 4M3ZA 4FZZA 3LWMA 3PUFA 3NF8A 2RI2A 1VSDA 3V1OA 1S1WA 2LTOA 3VQAA 2ATQA 5KCOA 4OJRA 2ETJA 3VA3A 1KFDA 3EY1A 3ZT1A 3ZSRA 4C8LA 3G0ZA 4FVMA 4FLZA 4KREA 3TAGA 4B9VA 1A5VA 4O55A 4DS4A 1QHTA 3ZSYA 1TVRA 2EQMA 1U4BA 3F70A 1G5VA 2D9TA 3C95A 3OQ5A 4IUQA 2FBTA 3SQ0A 3QEVA 1ASWA 5KE2A 1I3AA 3KKSA 4IBNA 1J9AA 4PWDA 2D0CA 4KRFA 2GFUA 1Z26A 3JYTA 5T7BA 2ZQBA 3HSTB 1KFSA 4C8OA 3HYFA 1VRUA 2I5JA 4QQDA 3SUOA 1BL3A 4FK2A 1RBRA 3HPHA 4M3YA 4PQUA 1U04A 5C6SA 3IG1A 3V9ZA 4LD0A 4B9XA 3OS0A 4KV8A 3OYCA 3I0SA 4CECA 4FJ7A 2X74A 3LANA 3L2VA 3F73A 3MXJA 3AO2A 4AH9A 1WJQA 3VQ8A 3DRRA 1KSPA 2B5JA 3DLMA 3DLBA 3K5NA 1QQCA 5CZ2A 4BD3A 1VSMA 1XHXA 3M8QA 4C5GA 4FM2A 2G8FA 4YNQA 3PX6A 3SZ2A 3PO5A 4DTXA 1RI0A 4DG1A 4DFMA 1JLFA 1NJWA 3LAKA 3P8DA 3S3NA 4H4MA 3SI6A 2AJQA 4CHZA 3VQPA 3F9KA 1QSLA 4FJJA 1DLOA 4CERA 3NCIA 2IDOA 1SV5A 2HB5A 2E5QA 4KHWA 1NK0A 2KTQA 5CIUA 1HQUA 3LWLA 3NE6A 3RR7A 2HNZA 3NTKA 4UC4A 5HP1A 3ZT3A 1X1PA 3G10A 4L8RB 1S6QA 4CIEA 3NGIA 2OZMA 1D5AA 3D45A 5J39A 3MP6A 4CEQA 4B9LA 2BGGA 3MO8A 2RJEA 3CYMA 3UWNA 3KIOA 4Z4CA 2E6NA 3IAYA 4B3OA 4KO0A 3ZSOA 4B9SA 4DQIA 4CJRA 2X6NA 4HCBA 1TAUA 3C94A 3C4SA 2RHIA 3AO1A 3OYIA 4CEOA 3MEUA 3QEPA 3CM5A 1DTTA 2PYLA 3KLGA 3ZT4A 4B9TA 3OYFA 2OPQA 4NS5A 1VSJA 1L3VA 4ELTA 3FLGA 4FCYA 3KUFA 4OKEA 3V1RA 2GF7A 1LAWA 2P5OA 1KTQA 4E7KA 2D0AA 3QIOA 4F2SA 3AVIA 2PY5A 2E4LA 3PO4A 3DOLA 4N76A 1N6QA 3L2QA 2O4GA 3TAEA 1ZBLA 5JS2A 1OZ3A 2NUBA 2HHVA 2HHSA 2DFFA 3CFRA 4DTUA 2RPIA 2G8VA 4CF9A 4CJWA 2XRIA 3K5MA 4EZ6A 1SL0A 2XY7A 3VQ5A 4Z0UA 1NK7A 3CEYA 4CFCA 3AVCA 2XDPA 3P83D 4A4EA 1RDDA 5HRNA 2YV0X 4A4GA 3MP1A 2B8AA 3HK2A 3SQ1A 4KHNA 4NCAA 1ZBUA 1JLEA 2OPSA 3NNQA 3DB3A 5HLFA 3SYZA 4IG3A 5CZ1A 1YTAA 3L2WA 3META 2K3XA 4CFDA 2JZ2A 3TAQA 1BQMA 1S1XA 1XNIA 1LAVA 3PFSA 3NGYA 4CJSA 1GOBA 5EU7A 1QS4A 3GOXA 4CHYA 4JS4A 1KVBA 3P5JA 3PY8A 3H08A 3BDPA 2PYJA 1SUQA 1T05A 3PMTA 3WNEA 1BQNA 4FYDA 3AVJA 3HPOA 3SUPA 4CJKA 5FRMA 2G8WA 3L2UA 4II1A 4ID1A 1UA0A 1TKZA 1NOYA 3OYAA 4CGJA 2X4YA 3DLKA 1ASVA 3ZT2A 1B9FA 3JSMA 4DLEA 2FHDA 1SL1A 4FJ5A 4IUUA 3RR8A 4FJGA 4KI6A 4RW7A 1A5WA 3AA4A 1ZBFA 1SSFA 4F2RA 3OYLA 3NF9A 4QAGA 1IG9A 2M16A 1KLMA 2HHXA 3QERA 3PX4A 3HJFA 4A4HA 1EETA 3HP9A 3P1GA 1R0AA 3ME9A 4M45A 1LV5A 2B4JA 2XY8A 3WNFA 4ELVA 3TI0A 1WAJA 2XK0A 3V9UA 4FM0A 4JS5A 4B8AB 4DU3A 2PZSA 1TK8A 4FL6A 1TL3A 1KVCA 2OA8A 4W5QA 1C6VA 4FM1A 1BHLA 3QBYA 3ZEHA 1RT2A 2RJFA 3QJ6A 1SL2A 2YRVA 3QNNA 4BDPA 1NK6A 3DLEA 2GFAA 4FW2A 1CZBA 5D3GA 1HYVA 4E7LA 1IKVA 4B9UA 3AVFA 3ZSWA 2DFEA 1C0UA 1S5JA 4DQQA 4KB1A 2IOCA 2IGIA 4QQGA 3LP0A 3QETA 4M41A 4PLLA 2F8SA 4FLUA 2OPPA 2A1SA 3QINA 3LX7A 3KLFA 1NKEA 4C8MA 3MXIA 4AHCA 2EKOA 3WNHA 1RT5A 4W5NA 3SUNA 5J1EA 4CJ5A 3ASKA 4GMJB 1RDAA 2Y1JA 2YNHA 3CFOA 3HO1A 1VSKA 4CGHA 3PMIA 3QIIA 3DLHA 4FK0A 1JLBA 3OMCA 4M3TA 1D9DA
chains in the Genus database with same CATH superfamily
4HKEA 2Q97A 3PFIA 4JKGA 2YUPA 3MX5A 1HRHA 1KXPA 1JHFA 1XOVA 4PLIA 4RW6A 2GM4A 3T1AA 2HNDA 4AM3A 4FJ9A 1VQ6I 2BANA 5ED4A 4YOWA 3HP6A 4CEAA 3CXCA 2EVRA 4FPAA 2RN8A 3AFHA 2R58A 3L1PA 1J75A 4A63B 3DPUA 2Y90A 1Z91A 4J2DA 1BIBA 2HNYA 2COZA 3UKRA 5JLWA 1MU2A 4CA0A 2X78A 3HT3A 2M45A 4CI6A 3TW7A 4Z2YA 2KI7A 4Y7NJ 2R3SA 2UZKA 3EH2A 3HM9A 2FNAA 3SAGA 4KUIA 1JHHA 2QASA 3CCLI 4XMYA 4JKBA 1JUSA 5LHHA 4M7AB 4TVRA 3X28B 2LRDA 5GPCA 4RLFA 5D5XB 3BFMA 2HL5C 1XMQK 4NDLA 4LB6B 4KTQA 3V1QA 2CSIA 4CJVA 4CJTA 1I5OB 3CQZJ 3GXOA 1WQ7A 2NVXJ 1CZ9A 4IVNA 2RHUA 4CC3A 2AZSA 2GTDA 2JVVA 3S32A 3JAMK 3G73A 1HD3A 1T44A 1U9OA 4QVCA 2ELJA 5JMVA 5KHDA 3CUQC 2HPIA 2O8DA 2Q1NA 5GIPA 3AKZA 1SD6A 2P0WA 4OMYA 2L5QA 2EIKH 3GCMA 1IV0A 3Q9SA 1YHQI 3BR1A 3IH7A 4KMUX 2EPDA 2FL7A 1RT3A 3FXMA 1S72Q 2WADA 1MMAA 2AO9A 3W6VA 2V79A 3K69A 2ECCA 1WXTA 3EKSA 4DKWA 3SNNA 3IH3A 2X51A 3M9QA 2R7QA 4JD2A 2HHUA 1LVKA 1Z3YA 5I9EB 1NEBA 2KIQA 2XROA 2HVQA 3P31A 4CCOA 4DFPA 4HYEA 5E1ZB 4V2GA 1K8AR 4HT9A 3CCUQ 4DBHA 3F3XA 2NNWA 4HVUA 1ZK8A 4CZEA 5A0GA 4RW8A 5AZJA 1B8IB 4OMQA 2RHZA 1RTJA 5FU7B 5GANg 3CCRN 1V1CA 1WAFA 3Q0VA 2FU4A 2JK3A 1VQ7Q 2IPQX 3EGUA 1QVGS 2PX9A 3CPEA 2O5RA 2QQRA 4BRPA 4NHJA 3HPGA 1IV8A 1UOCA 1PD0A 3FHNA 1PP7U 3QB0A 3HFOA 9ATCB 3I56A 3NAEA 1K8AO 4FJ8A 4XKBA 1XN7A 3O8MA 2F96A 2QW9A 5F64A 1JXSA 1D4XA 1NG9A 4IDHA 4FT4A 2NOGA 3TARA 5GAMf 4UOBA 4QIWN 4KTWA 4HHTA 5LJVA 3HI0A 4LF4K 2RQUA 4C0FA 2ZJPL 3NMZC 5ECAA 3M8FA 2NRAC 1W70A 3NDKA 3CWSA 3FR0A 4NO7A 4JI6K 1K7AA 4CCLA 1QZ6A 1D3BB 3I8DA 2ESHA 1ZGAA 1EFNA 1REVA 4QKUA 3HSFA 3ZETB 1KO9A 2ZE2A 4ESRA 1QMCA 3K1PA 4OGCA 2NUTA 4JLHA 3QIPA 2V7ZA 4KH1B 1B34B 1WLJA 3O8HA 1ZC6A 3VOVA 4JAXA 4KUDK 4F55A 1O57A 4C8QD 4XH4A 4BG8A 1OCCH 2Z1DA 1MMGA 1S1UA 3CCRT 1S8NA 3VERA 5L3CA 4PJOB 3KK1A 5CVUA 1EO1A 3FJPA 4DTMA 3QEIA 4J9IA 3ZSQA 2F2VA 3HEFA 1RAHB 1MBGA 2YHAA 2HBLA 2JGUA 3P9IA 1SAZA 4AM6A 1SEMA 1SRLA 4F3QA 2JQ7A 2P0KA 4JNEA 1ZSZC 5HLTA 3R60A 4OKKA 1DP7P 3DEWA 3DEEA 1KQ1A 3D5SC 3DKYA 2W85A 2DRMA 4E1MA 4UV8A 1AWXA 1R5HA 4G8XA 3QYHB 4A4FA 2DZCA 4GW6A 1T3LA 4CHNA 1LFPA 3K1NA 2EZKA 5LL6Z 3ULEB 1R00A 5J47A 3GBTA 3QMLA 3CCUA 1TL1A 1JU5C 3AL0C 3NQOA 3WEEA 3JCMd 3FMSA 2RK1A 3HGYA 1HYOA 1NTCA 4BNCA 5TKYA 3U8XA 1EWQA 2NOEA 3OYDA 3LDLA 2LR8A 2BE7D 2H56A 1D5YA 1VQ7A 4F52A 1M1KR 2QQSA 5ICGA 4LDUA 3KD1E 3DJCA 2RMOA 1JO8A 1WQ2A 2AXTC 3E9OA 2X6WA 2F48A 2DL3A 3L3VA 3AG4H 2WONA 4KH4A 1VQLN 2CP6A 2X1DA 2V1UA 5GAMe 1NK8A 1ITGA 3K4NA 2CP5A 5IYBJ 5EGOA 3GZ5A 2MH2A 2VWKA 3FISA 4JEPA 1W9HA 1QBJA 1VSHA 1R0CB 2L2PA 2ACJA 4IEJA 2VODA 3KNTA 4F7UG 2JW4A 4CFBA 4M7AD 3CCEQ 4PKCC 1UFFA 5AZIA 1R6RA 3GTLJ 2FVUA 3AVAA 4E19A 1T95A 3O9SA 2PMZA 2HQ5A 1R0BG 3ZMDA 1QTMA 4H5TA 3T1YK 2LOOA 1HLVA 4RTXA 1YOVB 4GLKA 4XRSG 2JVGA 2YG8A 4AIDA 2JPCA 2EQUA 3ENHA 1GLNA 1G2BA 3DAWA 3AO3A 1VQOQ 4DOVA 3CI5A 2MWPA 4CEZA 1KG6A 3N4PA 3MXMA 4H5VA 5LJ5j 2RD1A 1VQLT 3S9HA 3TTCA 3HGGA 2F69A 4M78A 2Z0WA 1WDXA 2X35A 4PFPA 3K9JA 4ZZDA 1HCRA 3R8EA 2B0LA 4YORA 4BHCA 5I3UA 3PIPL 1AZGB 2MPXC 3CD6N 4GCVA 4C8QC 4CZIA 4ZN1A 4C8KA 4DTNA 2A36A 3TPQA 2QEXN 1HX1A 1HQCA 4N4NB 2ED1A 4GXOA 1SAXA 2LT4A 1Q86U 4CGFA 2YG9A 1Y1WJ 3TABA 1NPPA 3MEWA 3AO5A 1SHFA 1J5YA 3DU6A 2ZM6K 1A04A 2UXXA 4EMSA 1FK9A 4M3UA 2BW3A 3DRPA 4CK1A 2RA2A 5ADXA 2F2WA 4L3QA 3K57A 3HDDA 4ISGA 2HMIA 4X9DA 4RTYA 1ZN2A 2I2LA 4YDUA 3ZN1A 4FLXA 2A42A 4A93J 1N32K 1WSJA 1UG2A 1ETOA 4IURA 5CYVA 4BDYA 1VQ4A 5DM7F 4IXCA 5C44J 4F7ZA 1XD7A 4B8XA 3CD6T 2GWJA 1R4NB 4NC8A 5DM6L 3CF5F 4C92B 1MMNA 5JVGF 3AVKA 4FJHA 4DS5A 1YP5A 2QEXT 4EMHA 5SZTA 3QNOA 2M9UA 4O3MA 2OD5A 3CCQQ 4J9EA 4PJOD 2DTUA 1RBUA 5F0FA 4EMKB 4PUSA 4LG0B 2VVKA 2QGFB 2YX6A 4ZYHA 3CMYA 4YIFA 2BIVA 5D4SA 2WSEE 1J09A 1XQPA 2IS2A 1ATNA 1T0JA 4CCHA 3CJ7A 2QK9A 1PWTA 3TQ7P 5KQDA 2KRMA 3HTRA 2YHXA 3H41A 1J3TA 5CHIA 2RJDA 4XKWA 4NCGA 4UUSB 1G15A 2Q2EA 3TAMA 1WSGA 3OOPA 5LRSA 1RTIA 4M7AC 4WCGA 4K42A 4WFAL 4XKVA 1NKCA 2HU9A 2Z1HA 3CG7A 1PNJA 4ZHRA 2YNFA 3O4QA 4OPJA 4J7FA 3HKZN 2G0EA 3BP8A 1K73U 1I1JA 1HNZK 4AFQC 3OSSC 3OJSA 5HS7A 2XDVA 4GGGA 5HCKA 1BC8C 2BZ8A 1NHAA 4HWIA 1VRLA 2IVPA 5DUKA 1WQWA 2YU3A 4XK4A 4DLGA 1N3AA 2K85A 2NOBA 4PKHA 3RRHA 3E9GA 5D6FA 4A6EA 4QVZA 2A6EF 2DAQA 3I59A 2LBFB 1UGSB 3DOKA 1B9NA 2LFBA 1XGMA 5CLSA 1OVQA 4H0XB 2ZJQL 1Q81C 2DL8A 4MO4A 2MD5A 2ZC2A 5BN8A 1JLAA 1KFZA 1W2BA 1UZCA 1NGGA 1ETQA 3LLRA 1ITYA 5GP9A 1SSHA 1K79A 1W1FA 1X9SA 4B1RA 5FLXE 4DTPA 5IN1A 2FQ4A 2QF7A 3MZYA 4H0TB 1RABB 5F1XA 1E2XA 3FXKA 1YG2A 5GAOp 5IP6A 1TOVA 1J53A 2X6SA 5HRRA 2G8HA 3DLAA 3ZLJA 2DLLA 2L02A 1T39A 3O5ZA 1FMVA 3S93A 3WHCA 3ZYYX 1D3YA 3UE5A 4DZPA 3GTKJ 2E6MA 2DTIA 4CJFA 1TKDA 2QXLA 2JM9A 3QPLA 5GMKm 4N4OB 1WGXA 1VQMQ 2L3QA 2LF7A 2FO0A 4FLYA 3SD4A 3KXTA 3RR6A 5KTQA 2IS6A 2LMJA 3CZ6A 2FRHA 2FPEA 8ATCB 2E6ZA 2FSWA 4BR4A 4C2TA 3CCSQ 4Q47A 2W57A 3JW4A 3L9FA 4LFCK 4XTWA 1LW0A 4YFUA 3L09A 3CM6A 1YFHA 4G9ZA 3GUDA 1YJNQ 2O0YA 2HNIA 5FLXK 5CYMA 3UATA 1Z21A 1HJDA 3CC7I 2ZJPF 4B3SK 2WWYA 2Y0SN 1FIPA 1A5XA 1HKBA 4E7HA 4B3AA 4S04A 2NUZA 3C12A 2LSNA 3AVHA 1GLLO 4C3IJ 3VS2A 1QE1A 4A6DA 2RQRA 1N9SA 4PGGA 2OQRA 2A07F 2VGMA 1WSUA 2L3RA 2F2EA 3OSFA 3ZMZA 1NNEA 2YI1A 1JKRC 4DJAA 4V19K 2H6BA 3WTVC 4JK1X 1HMVA 2V1NA 3AY9A 3LALA 1HYZA 3LGLA 3A4CA 4FXDA 2CSOA 5L23A 2UUZA 1HF0A 1YIJN 2KZMA 3OW2A 4B1YB 2VWBA 5J4VA 1VQ5I 4ANJA 3O3GA 1C1AA 4E1NA 2JUGA 2IG0A 1GFCA 5JVHL 4FLVA 2K3PA 4IPAA 4H5RA 2DTHA 3G4SQ 1T38A 4M3XA 5DK5A 5EOYA 3M9AA 4KICA 1WA7A 5LJ5e 4AHUA 1PJRA 1T8IA 2E19A 1UAXA 4AHRA 2F8TA 3PX0A 2V4JC 4C92D 2ZD1A 2XAQA 5GAMd 2ABLA 3FBIB 4FIBA 2XKPA 3W6JB 2QBYA 1SZ2A 1YTUA 5JLHA 3CCVQ 3SYTA 2X4HA 3OYHA 1IZ6A 1Z25A 2M9HA 4OIOF 2DT5A 2FRWA 3CCSA 5ILUA 3HG9A 2HSTA 4MDXA 1KQSM 1K6OA 1FYNA 3ZSZA 1X2MA 1Z7UA 2BE5F 3GWZA 4BJTA 1QKWA 3D0PA 3KLIA 2OZUA 4KBOA 1N39A 3QUIA 4M75B 1X3MA 2V9VA 3HBTA 1FOYA 4Q0BA 2VPLA 3VF6A 2EQRA 2RNJA 4JX6A 2R5ZA 5KAIC 1YIJT 1RKTA 2OJED 2Y9ZA 2NOIA 5EYRA 3HYIA 4F93B 3EHRA 5M1NA 4K41A 3C0BA 5E1WA 4YELA 4BC4A 2A3SA 3WGGA 3MEDA 4AHTA 1A6QA 4CDGA 4A0YA 1MJBA 2GOMA 2RHXA 1KA8A 3EPZA 3L8BA 1OH6A 1NGNA 3L2RA 2FZGB 1VHXA 2JRMA 1X4PA 3C6TA 3D2EA 3KP7A 4AHSA 3CTAA 3PQJA 3HL2A 3OBWA 4LSLA 3HRSA 1S7AA 1RPWA 4FJMA 2JMAA 1P92A 5HBMA 4G1QA 1VSFA 2M8EA 1O3QA 3EUKL 4Y17A 2AS5F 1E3MA 3P7NA 3HRMA 3CC4N 2RKHA 1MUDA 3DQVC 1PUFA 3SQ2A 4BL0B 3OH9A 1N75A 3QICA 3TTFA 2KISA 3V6DA 3CMEQ 2QWQA 2RM4A 4ESFA 3JCUC 2E1YA 3ZQGA 4LF6K 4DBQA 3PIPF 2KT0A 1VQPN 1SPKA 3WU2C 4J8OA 2IRFG 5D8LB 3U9DA 3QYFA 1IKWA 1DT9A 5ADXH 4ASNA 1EH7A 4CD1A 1H3HA 3E97A 3RTRA 3W2AA 3F9MA 1I94K 5FJ8J 3CLQA 3JCMb 4HF2A 4OOIA 3E66A 1O3TA 3TEEA 5HLGA 4BHBA 4D5FA 4LH4A 1YW8A 2Y30A 1ACMB 5F6FA 1O1WA 3ZR8X 4J2BA 4HVWA 1HW5A 3PIOA 4EGZA 2JVHA 3M4GA 1FJGK 2DIQA 3NEUA 3CC4T 3Q1JA 1CF7A 3LSGA 4FLWA 4BWJA 2NAZA 1FP1D 2DA6A 3G2BA 3WG9A 3OW2S 1QVGP 1UUEA 1NGJA 5JS1A 3FXOA 3U23A 4CIFA 4WF2A 5DV5A 3JS6A 1VQPT 4E7IA 2BVLA 1D0ZA 1KGSA 2L7ZA 4C92C 2DRKA 2OJ2A 1X6GA 5C0YA 2IIRA 2LY9A 3L2ZA 5BPDA 2NVUB 4M71A 1I27A 2R7WA 4EP5A 2DILA 3CQ8A 2RQWA 1NG6A 4FW1A 3RMCA 2JT4A 2IS1A 3QKJA 1IHVA 2O03A 1BIAA 4RBOA 3M55A 1PU6A 4A5NA 4HX7A 3GF2A 2JG6A 2RI2A 2O8BB 2LTOA 1K73R 2ATQA 2PQ8A 4I6MA 1HR0K 4PJ0C 2E3IA 4OJRA 4B4CA 2K4YA 4YIRX 1RESA 2ETJA 3VA3A 3EY1A 3ZT1A 1M27C 3RMSA 1QCFA 2P9UA 3FZHA 1NGCA 4L5GA 4FLZA 3GTPJ 1GT0C 4KREA 1LNXA 1U8BA 3PGGA 4OB0B 4O55A 2VT2A 4OFHA 4L9NA 2EQMA 2VUBA 1ILYA 2R7DA 1G5VA 2D9TA 4XU3A 2DDAA 2FBTA 3QPSA 3CDIA 3SQ0A 2EWNA 3G1LA 3QEVA 1KONA 2CT4A 2ZJ2A 4WFBL 4ESJA 3RYPA 2XICA 4XEIA 5IT9Z 2D0CA 4WQ4C 4KRFA 1P6RA 3C18A 3SWNC 5KNLA 3JYTA 1WWXA 2Y48A 5CE3A 2FNPA 3D7EO 4AFUC 1H9TA 4M7DA 3CCRA 2I5JA 3SUOA 3O2PE 1WEFA 3HPHA 3HOYJ 4I6ZA 5C6SA 4J6WA 3EKUA 2J05A 2MAMA 3EFOA 2QSGX 2H8HA 2ISZA 4LD0A 4BRKA 2DQLA 3TO7A 2NS8A 2M1BA 1NJIU 4M75D 3CXCM 4HQEA 3L2VA 3MKWB 2LP0A 4C1NI 4V19S 2EGEA 1IN4A 1H89C 4M7DG 2F6CA 1UEBA 5AQSA 3VTHA 1M5Q1 3C0CA 3PO2J 2X48A 1XGSA 2DI3A 1QQCA 5HK3A 3KPHA 3PNTA 4EJZA 3K70C 2Q0OA 1HKCA 2DXIA 3GF5A 3SZ2A 4DV2K 5EG0B 4D7MA 1ARKA 5GAN4 4FE7A 5GTIC 3J81Z 3JRCA 3LAPA 4OB2B 4CHZA 4DNCA 2XGCA 3EFRA 1KG2A 1WJCA 3F9KA 1R77A 2QWNA 4DR5K 1DLOA 3DXMB 2OV7A 3NWSA 2GQQA 2QSFX 3QWXX 3K4JA 2ID6A 3UKUB 3LWLA 1DQUA 4M78E 1TTYA 2DN0A 1K83J 3EH1A 4J83A 4CIEA 4PKGA 5CVJA 5E20A 2EK5A 3CC7N 2O88A 3D45A 3VS0A 1IF1A 3SBTA 2QDYB 2VN2A 3LOCA 1ZREA 3CYMA 3KIOA 3MMVA 3IAYA 1KQ8A 1XCBA 4JX4A 4B9SA 1J59A 1WVRA 4II2A 3JCMc 1LDKB 1QP3A 1RUOA 1FSEA 4XTUA 2X6NA 2GBYA 4L0ZB 4HCBA 3A0IX 1E7OA 4JKCA 4XH1A 1O13A 1RIOH 4GRIA 3AO1A 4I01A 5EDNA 1KAYA 1U2VB 3MEUA 4DV1K 2HEOA 2K5IA 2O8EB 2LCSA 4MDBA 5K5OA 5HOOA 4ILJA 3ZT4A 4CUGA 3CC2I 5AR0A 3SMPA 1R23A 2CUEA 2CQ7A 3WVDB 5LJ5d 3V8LA 4OKEA 3H0HA 1DPRA 1S5LC 4NL2A 4UHTA 2GF7A 1D8JA 1EH8A 2KEAA 3WHBA 4JJCA 2VOPA 4ESBA 1LAWA 2PZ1A 2IA0A 1X69A 3JREA 4M7XA 1VQ5N 4A57A 3S1QJ 4FT2A 4F2SA 3F5TA 2L3SA 2E5LK 3PO4A 3QYEA 2UXDK 4EVVA 2NOHA 1KYZA 2QWRA 3MDQA 2RAEA 2OANA 1OEBA 2LQNA 2XF6A 3M7GA 2RPIA 4LDVA 1DGWY 2XRIA 1AT1B 1IW7F 2XKOA 1H8KA 3DKMA 1JGGA 3WXMB 3CEYA 5FWBA 4K2EA 3GIBA 3P83D 1U8RA 3A8LB 2P9SB 2X3XD 1RDDA 5HRNA 2HPMA 4M9XA 1FP2A 1E3HA 5EZGA 3FHZA 1B3QA 2V6CA 4PCQA 5CO7A 1ZBUA 4CHUA 3H45C 1WHUA 1J7KA 4N0AA 4LLGF 4C0GA 4ZDPA 2OPSA 3KZBA 1VQ6Q 3S14J 3LSRA 1VQ5T 4A5BA 2PU9B 4J7IA 3KTUA 2L54A 3G0QA 4BVOA 5M3MJ 2LD5A 3META 2K3XA 2FRYA 3PFSA 1GCPA 1NK3P 3DKWA 3UR3C 1Q82U 5F0XA 4QPQA 3SDZA 4CHYA 2VGNA 2YX4A 4AYBN 1AWCA 4EA4A 2F5VA 2IIMA 2EYXA 3H08A 3CCLQ 2ZPHB 3AVJA 2LNBA 2HXIA 2RQPA 1I81A 3EO3A 3CMAQ 3HPOA 3MZHA 1QQNA 4B1VA 5AQMA 2QEXA 2PFBA 5FRMA 5A2QO 2MG4A 4KULA 2R5YA 3L2UA 3IRQA 1UA0A 1MPGA 2YJEA 2WV1A 1PKTA 4DR2K 1BJAA 1QA6A 4DV7K 5AQGA 4PIIA 2X4YA 2V1QA 1PDNC 1ASVA 1G4DA 4BQZA 5GTHC 1S72I 1T2KA 2VKEA 4YFXF 4IUUA 4RW7A 4W1UA 3CCMQ 1A5WA 1USSA 4U88A 2QA4N 3CLOA 2LDUA 3EGXA 1M2VB 2WAFA 1BI0A 2LKXA 1SSFA 2KROA 1P7MA 3S2WA 3PL8A 4FETA 1YHQQ 4WFNL 1X27A 4NNJA 1KLMA 3OHRA 3O1WA 4MNUA 5BQTA 1AU7A 5AQRA 3CBPA 4M45A 5D6EA 3WNFA 3RDVA 4GBQA 1AZEA 4DCHA 4LNPA 1KEAA 2OTLQ 2P5KA 2GEMA 1VQ8N 2NNNA 1ZG3A 1R1VA 2KQRA 1YJ9N 4OAZA 3F8BA 5BREA 4H0PA 4OU0A 2E71A 2I0NA 3WTZA 2R4GA 2V9KA 3WU1B 2K7AA 2EYQA 1C6VA 3AG2H 5CVVA 3VYHB 4M4ZA 2KJCA 1KIKA 4IXAA 5IHNA 1X1AA 1Y6IA 1I6XA 3QBYA 1VQ6A 4P5OA 3ZEHA 3JB9J 1VQNI 2RJFA 5KN9A 1JKOC 2K2VA 2R7XA 2DYRH 2E5KA 5AQPA 2R7TA 1SL2A 2OTJQ 3QNNA 2QA4T 2CQKA 4UUVA 2VOOA 3JAMO 2DODA 1H92A 3C1DA 1DU6A 3F21A 1IKVA 4B9UA 4KH0B 1QZEA 1SVLA 2DFEA 1FYKA 1BO5O 3SEMA 1C0UA 1S5JA 4BJ6C 3MHXA 4DQQA 2EFNA 3VSLA 1VQ8T 2IGIA 4PKIA 1HDDC 4BU2A 1K76A 3QETA 4PLLA 1YJ9T 3PUBA 5K5QA 1TSFA 2MLKA 4BGAA 2KY9A 4NQWB 3QINA 4FSSA 4BY6B 4M78F 3LX7A 5E8GA 2E3HA 4PGHA 1NKEA 1UCRA 2CS3A 5IT9E 1UHWA 4CC4B 3WG7H 2LKSA 4W5NA 3L00A 3X26B 1PU7A 4L9VA 1G6NA 3SUNA 3JRZA 2E2PA 5FU6C 3TREA 4EQQA 1YHQA 5GAEJ 2E1OA 4WCEL 1UE9A 2PVOB 2YNHA 2HGCA 3E6CC 2YRCA 1T0FC 4CICA 2X9HA 5CQYA 3A1YA 4IEEA 1NJIR 4FU6A 1D9DA 3VEYA 4IO9L 4IHXA 5DMRA 2JA2A 5H1SQ 5DM7R 3TO6A 3RDIA 2LTPA 5CJ9A 1VNDA 4BRMA 4G7OF 2O31A 3G6ET 3D6RA 3PVQA 2HTSA 3J80K 4OB3B 3RJPA 3BWGA 4KT0E 3CCJN 2LCLA 1ZBHA 1RUWA 3NAUA 2O2OA 3H3OB 2EV6A 4XICA 3U3YA 2KSSA 5LEJA 1NJIO 1D3BA 3ZETA 3FDRA 3J81E 1Z3XA 2EGAA 5B1AH 4O0IA 2H1LA 3BG9A 1B34A 2X1CA 4JJDA 3BY5A 5L3DA 3PQKA 4BS9A 2QWLA 3ITHA 5BOXA 2EILH 3I55Q 1V29B 2QM1A 4PJOA 3UA7A 4YIIA 2JSPA 5KH6A 1S9GA 4IHWA 3ASOH 1IUFA 2RN2A 1HKGA 2C06A 3CCEI 4BRQA 4AIKA 2JRTA 1XDUA 2Y0SA 1NE8A 4V2FA 1T6SA 2X1EA 3RRGA 3ABTA 4CC2A 5TGTA 2HKOA 4KTZA 4CJEA 3K9KA 2Z99A 4J6XA 2Z1IA 4GVMA 4BRFA 2DMNA 4DFJA 1VQ9N 2EBIA 2LQKA 4KI4A 2BDPA 4A12A 4KFCA 2HS5A 4IOXA 1U5TC 5FRNA 3BDLA 5D4RA 1FKOA 1SMTA 3CCJT 5F0CA 5LD2C 3ERED 3MECA 3ULEA 5KYNA 3U21A 1X75C 1AKHB 3GEZA 1KZHA 1GXPA 2Z2SB 2I8DA 1MWKA 5AYFA 1ZKGA 2MFZA 2Y1IA 1UECA 4B1WB 1QHGA 3ASNH 1LWYA 2VG6A 1IC8A 5HY6A 2NNYA 4RA2A 4F17A 2CMPA 1N25A 1W2BM 3V9XA 4MTDA 1SKWA 3SJHA 2M02A 4J9GA 1MJAA 5HROA 4DV5K 2RJCA 1KYWA 1YIJA 2QYZA 5M3FJ 1POGA 3VQ6A 3CETA 1JL2A 4IOCL 1C6VX 3TAPA 4R1HA 1X6BA 3IKMA 3B8AX 4XLHA 4N56A 3V42A 1NJXA 2MH9A 2R5MA 3M0UA 3BDUA 4DF8A 3OWTA 4CJUA 1W7PB 1UJ0A 3NBPA 4A0ZA 1MH4A 2KL4A 3H1QA 3EUHA 2FSNA 1VQ9T 3AHUA 4AWXB 3M3YJ 2OI3A 2PLYA 3L4QA 3ASMA 3FK6A 4Y28E 1ZAOA 1IZ1A 1PU8A 4GVEA 1YI2Q 2NRXA 3EG1A 2TRTA 4LY7A 3VQ4A 3RWUA 1IBMK 3O8GA 3J7AO 4LITA 4HV6A 2AHQA 2IGKA 3UKGA 2J6OA 3HTUA 4RTUA 4PDKA 2WBMA 3FBNB 1O7FA 4ITVA 2D1XA 3B02A 4PUOA 5GAOn 2K3YA 4OVAA 5M1FA 3BG3A 3LGFA 4C3JJ 1FJLA 3CJNA 3WGHA 2EWSA 2QWOA 2KFZA 2P4TA 2X9DA 1QQIA 1Y97A 4OIRF 3ECHA 3K5OA 2NOLA 2DL5A 4CC7A 2KVQG 2L3DA 1VSEA 3EQLF 3HVRA 2JS0A 2XF7A 4XTZA 3BY7A 4FWPA 5GANh 3OW2P 3THXA 2DA3A 1PSEA 4C5IA 4M6XA 2DT7B 1BWFO 5IH2A 2VXZA 3TQNA 2HVIA 4BE1A 2HQEA 2DA1A 3G71N 1H8AC 2XSJC 2WACA 3LZIA 4ILHA 3D5LA 4C0ZA 2PVGB 4QSHA 2QXFA 2M8GX 2H3EB 1MDMB 3ZPLA 3CCQI 4DBFA 4UB6C 2GXGA 3JSCA 2Z16A 4P55A 1QSYA 3A0HC 4LOCA 4BEHA 4CZHA 2P5VA 5M9OA 1U2WA 4B1ZA 2W7NA 4BXXJ 2COYA 2DBKA 5D6YA 1LW2A 2G8IA 5GIOA 5E3NA 5HRPA 4G6DA 4ZYEA 3M4OJ 2MK5A 1NLOC 1FX7A 1GLFO 5JLFA 1W0UA 4JKEA 3THVA 3CC4A 2E64A 4J2EA 3OS5A 4HCZA 3UNGC 2VXEA 3AVBA 2KZZA 1WSHA 5GINA 3L4IA 1HPZA 1L3SA 1YTYA 4OPKA 3VW4A 1Y1VJ 2EJRA 4G7ZF 2JLEA 4BI3A 1GLBG 1WSEA 4FJKA 3K58A 4NXNK 2JXBA 1SMYF 2L01A 2KXCA 1ETYA 3FMRA 1QVFA 4D6WA 2C0TA 4OPAA 2BGCA 3R2XC 4Z4GA 1R49A 4LUEA 4CCKA 4AVPA 3G71T 4CHPA 2E70A 1I5ZA 5FW9A 4RW9A 4N5SA 2A68F 2GIVA 2NUPB 3ZQIA 1DGKN 1QRYA 1X1BA 4P9UA 2ZPEB 1APLC 4M7DE 1BCMA 3LNQA 2W25A 2ZSHB 1GCQC 3N4MA 2DK3A 3NTIA 3SQ4A 4H0EA 3HM8A 3CDHA 3KYLA 2YUOA 5IYCJ 2LVMA 4XAXB 3O1BA 2ZO4A 4XU0A 1C1CA 3RMQA 4M42A 1KC8O 1CXQA 4YHHK 4C92A 4GO1A 4E0DA 1Z67A 1FSHA 3A5MC 2HHTA 3WTWC 3I56T 1ZA2B 3VKIA 1YQRA 1QSSA 3TCJA 2C0OA 2ZMEC 4HA8A 4A5AA 3Q0WA 2BVMA 1XSDA 3KWGA 4KT5C 5HS9A 3V7SA 1TH7A 4EMKA 4LG0A 3IL2A 3DLRA 4QS8A 3A5ZB 3CCUN 1KG4A 1VRTA 4HF0A 3ESWB 2HHQA 2WB1A 1MSEC 2W41A 3GLLA 3HHTB 1IDYA 1YQKA 4CF0A 2E36A 4DMNA 2FSJA 2O6GE 1VQMI 5C24A 2V6EA 1XQHA 4UUSA 3ULDA 3C2GA 2AA4A 1VQ7N 4KHUA 4ZTJA 3E7LA 2BTFA 2RC4A 3LPUA 4DR7K 2COBA 4DQ2A 3K4BA 5EZHA 4A3IJ 2R5AA 3P39A 1OZ2A 2PUOB 4ISFA 2KRHA 2XPWA 3TBIA 3R3LA 3KD5E 2F7TA 1YJNI 1UJYA 1AOYA 1ASUA 4DSIA 3ZBDA 1Q7YC 3KTQA 2P1JA 3K4CA 1C0MA 3IUOA 2DVEA 3GZ6A 2DQRA 2EIFA 4YEJA 4M77B 5FPNA 3BZKA 2F4VK 5L3EA 2GV9A 2PEXA 3IWZA 4KFBA 1DUXC 3SV4A 1C0WA 2CZ7B 4DQ8A 4RCBA 3CCUT 1FMKA 2YHTA 2DF6A 2K5FA 2E7XA 5FFXA 4E6KG 2AZVA 2A40A 5AFUH 4DR1K 2E8AA 3IDHA 1WJAA 4O6JA 3KETA 2E2JJ 3DYAA 1KK7A 4XLEA 1RT7A 3OL3A 3N4QA 3CVSA 2E2QA 2BV6A 4R56A 1FLIA 1IRGA 3MAJA 4BY6C 1GLCG 2LDMA 1VQ7T 3JRBA 3IUCA 4FQGA 1TQPA 1VA7A 3AA3A 3TANA 4QOZB 2EZLA 2B6AA 3H5AA 2IGMA 3QO9A 2GELA 2VC0A 5D5VB 3HUGB 3BCAA 2ZJRL 4O5BA 3PSIA 3I58A 4OIQF 4XLPF 5C12A 4OMNA 1XWLA 1RT1A 4KH6A 1B9DA 4F04B 2ME0A 4IOAF 4A2UA 4NYNA 1KSWA 3VETA 3N05A 2ZB9A 3K0SA 4AILC 3F0ZA 4UXNA 3VQ9A 3T8RA 2A5YB 4GY5A 1QVFS 1FKPA 4GYIA 1EQYA 1K8KB 3S6WA 2OUMA 3TP3A 1YLFA 4HBLA 2XSDC 5C4XJ 2XRNA 5CQXA 3THWB 1TWCJ 1PHTA 3PIOF 2KGTA 1MBKA 1EXQA 3OYBA 1NH3A 3MN6A 2DNUA 1B92A 2DAOA 5FLXO 4HRIA 3A1PA 1BBZA 1Z7LA 2AK5A 3RERA 4BAYA 4WYBA 2E88A 3DPLC 2CYYA 3C7NB 1RADB 4BREA 4Z4IA 4FASD 2JPBA 3AG1H 2CZ6B 1JTYA 1GBQA 4IF4A 4LD5A 2VE9A 2FBVA 4X34A 4D8KA 1OU8A 2CS7A 3O9TA 1F1BB 1PKSA 5LHIA 3UT1A 5CKEA 3RESA 3CC7A 1ABOA 3CCEN 5AN4A 3QPTA 1ON1A 1R58A 1FY7A 3T0YA 4U87A 4EM1A 4EJTA 4XU2A 4CI0C 3AGKA 3ZMUA 4L9TA 3HSBA 3AAPA 2XAJA 2D0BA 1QKXA 2DPNA 1VQLQ 1GRIA 4DSJA 2CH0A 1F9NA 3JTGA 1IG8A 2RNGA 1DPUA 3T7ZA 1N33K 1TV6A 1WGSA 1U49A 1WEGA 2M4KA 3A8GB 2O8CB 4JRQA 5CVRA 2CUZA 1P59A 2K57A 1ESVA 2IGNA 1VI0A 1WCMJ 2P81A 1VQON 2DCEA 1QQMA 5IOZA 1WJBA 5E3MA 3W3DA 1XTDA 3OA6A 1P8ZA 2E5NA 5GAN6 4E7JA 3CMEI 1KG5A 2FBKA 1MJ9A 2ZWHA 2M7BA 2C6YA 3AA2A 2IBDA 3HOSA 1J5OA 1ODDA 3CUQB 3GYHX 2NOJB 2WOMA 2DU9A 1H9GA 3H6ZA 1JKQC 4IOCF 1STZA 1SS6A 4EDUA 5H20A 3WNGA 2M2EA 1VQ5A 3SB2A 1NGFA 3LL3A 2M0CA 2MF2A 3IH4A 1Z9QA 3VQDA 4HTUA 4RM2A 5BN9A 1JUMA 3OSGA 3QFUA 4IDKA 5C3EJ 3E1YA 4AHVA 3K2PA 3LPTA 4M75A 2RPNA 4PY5A 1X4OA 4XBFA 4Y0WA 3JTHA 4M7DF 3KP6A 2D5VA 2IVNA 4DV0K 5LGNA 1QVPA 1NYFA 2D1HA 4NYFA 5LHGA 2YS9A 1VQOT 4DYQA 2K9QA 1WJRA 1OULA 3MAQA 2W40A 1TUDA 2STWA 4H8KA 5F1JA 3FEOA 1LCKA 1Q81U 3V4IA 2XC7A 1IJWC 4RMOA 2JZYA 2XASA 1LWCA 1C0FA 2LNVA 3FZMA 1V5FA 1WOQA 1HYSA 3QESA 3VGMA 3BCBA 3VTIA 2XHIA 2QWWA 4IX7A 3L6QA 2AXLA 1YX5A 4NC6A 4X6AJ 3LH0A 1K8AU 3RMDA 2L2OA 1J5EK 2H27A 2CUJA 2R7ZJ 3OJUA 1TKTA 4JV5K 2DBBA 5KCMA 3SDBA 4Z4FA 3FXUA 4XU1A 2N8GA 2P5LC 2A61A 2O8DB 2QYOA 3P8BB 2WFBA 2QM3A 3SDGA 4XK8E 2MYSA 3REAB 1OH8A 1S1NA 4JX5A 5GJVB 3JCMJ 5AQWA 1YX3A 4IKFA 2MLGA 4DYCA 1VYVA 4ELZC 1M30A 3PNYA 2ZFWA 3SPYA 3AA5X 2HR3A 5CKHA 4CZGA 3FDYA 4ID5A 3SCXA 3KK7A 1H641 3WE3A 2XB0X 2P51A 3GFLA 2P4WA 2UYTA 3U3GA 2GXAA 4HXJA 4W5RA 1KC8C 4CZCA 4ME7A 5I22A 4G12A 4KRTA 2A7YA 1RC9A 3I4PA 4F3TA 2H8WA 2VBWA 1AA7A 1ZSZB 2K9SA 1NGIA 4X0GA 1MGTA 4JRPA 3NH2A 2V26A 2XD0A 4G94A 4E89A 1OYXA 2MMPA 2JHNA 3M1FA 3WQTA 4HAMA 2XY6A 2ZCWA 3Q9VA 4CEDA 3QP5A 1RGIA 2O8XA 2DOAA 1TS9A 5BR8K 1Y8QB 5J26A 1SKUB 3JRFA 4EHTA 2DD5A 3AL0B 2P9LA 3OS1A 2STTA 3LP3A 4QPOA 1RETA 1BW6A 1XQOA 3I33A 3NH0A 4DFKA 4PHTX 2KRNA 3H1VX 3REOA 2HYGD 4N47A 2DEUA 4IRHA 1RAGB 4PJOE 1YITI 3EG0A 4A3KJ 4CJQA 4LK0F 3R1XA 2YNIA 1Q9YA 2DFUA 3MPUB 2O8BA 1OISA 4CEBA 3H0IA 1LUJB 4UY8I 2QQAA 3U1KA 2PN6A 3HSEA 2ZF5O 4FX4A 2YUQA 4FWSA 2CFXA 3CBMA 1QU3A 3GNFB 1U0JA 3MCPA 3N5NX 4CXFA 1JKHA 1VQMN 3ZMVA 2BOLA 4OFAA 2CP2A 1HBXG 4J6YA 2ZPIB 1BR2A 5AJ3K 1SEUA 1TWHJ 3BTIA 2W0ZA 3ZN0A 5BS6A 3CCSN 2DXBA 3DI6A 3L0QA 5B66C 1QCNA 2BE9B 5E41A 5HL7L 2IPOB 4C8QF 5GMKh 3AVNA 4RG8A 2DA9A 4D5CA 3J7YP 2LCCA 2LNHB 1JLQA 1YJNN 4DW6A 2OA4A 4N9HA 4DSLA 4HSBA 2P9NB 1BI4B 4FVUA 4LDYA 1DP3A 4I0BA 4K43A 4CF8A 1ONVA 5K7ZA 4DK9A 4NLBA 4MTEA 3JCMX 4O4GA 4I7HA 2LX9A 2VQHA 1R59O 5FKNA 2D5RA 4OFEA 1OI1A 2QQ9A 3ELKA 4ZTFA 3EUAA 3UA6A 4B21A 1BN5A 3CPWS 2FOWA 4J5YA 1HNWK 4BR2A 3S1RJ 4LD6A 1PD1A 3RI4A 5M5WJ 1E0EA 3O3KA 4BWMA 3JB9F 5FROA 2CUDA 2YHBA 1BIZA 1NJZA 4Z89A 1IXSB 1REPC 3KLEA 1N9RA 1JL1A 2FJ1A 4OIPF 1FYMA 5KI6A 3KK3A 3K2AA 3CCST 3E5QA 4F7UB 4EM2A 3JRDA 2GLOA 3IHOA 5GADJ 1NWKA 4A59A 1NKBA 2ZJRF 3NPFA 3A2KA 3O4NA 3KP4A 1JLCA 3RNJA 2DLPA 3BR6A 1OU9A 1XSVA 2HOAA 3H3ZA 5EG0A 1JXMA 4X66K 4I99C 3ZX0A 1JKPC 1QVTA 3HZ6A 1BI1A 3VOEA 1QO0D 1KRPA 3CC2Q 1VIFA 4OAYA 5KE3A 4BRLA 1J2XA 1JJ2S 1HNXK 3L7WA 3G4SN 1FMWA 4CK3A 3DXMA 3LWMA 1MSFC 3NF8A 4P5NA 1HA8A 2H94A 4RB2C 3VQAA 3BF3A 2IS4A 3GO5A 2DETA 3KVGA 1HOMA 4BHPA 3UKUA 3SMSA 3M07A 3CCVN 1KFDA 2K9MA 1IGNA 3LM2A 3G0ZA 4FVMA 2JHJA 3A02A 3B6CA 2IVMA 3BTJA 1BOTO 4B9VA 4X1EA 4AVZA 3MKYB 1R5ID 4KT6A 1YRNB 2QTDA 1LMZA 4DS4A 2DMUA 4AD9A 2I7PA 1ZHFA 4XL9A 3ZSYA 3MJXA 1XX5A 4A2BA 2A08A 4FTHA 3HSRA 3KE2A 3GTOJ 3M0QA 5HLIA 1M3HA 3OQ5A 2AKKA 2M3AA 4JHDB 3HHHA 1Y0MA 4XRFA 1K61A 5AQNA 3HRTA 4OO1J 2DM1A 1LE8B 2VC1A 1U2VA 4N9IA 2GFUA 4KUMA 2O8EA 2Y69H 3G4ST 1I8FA 5CKTA 4XLAA 5ICFA 5EXWA 4IHSA 3ERMA 4HNTA 1XNRK 4QTRA 3GPLA 1OR7C 2CDTA 4Z88A 1BUPA 4B43A 4BGBA 3FM5A 4AI5A 4FK2A 4M3YA 1VQ4I 3CMAI 3ZOBA 3CCVT 3V9ZA 3EYYA 4B9XA 3DEUA 3OS0A 3OR1C 4KV8A 3RSEB 3X20B 3OYCA 4KITB 2DVJA 3LANA 1EF4A 3F73A 5E3LA 4OMLA 1UTIA 2K2MA 5M1QA 1O9SA 4YOYA 1RLQC 3V7CA 1KSPA 1PM3A 3CMEN 3KZZA 5FD6A 2V8IA 1CQTA 4M63C 3VODA 1N34K 1BA0A 3DLBA 3K5NA 1AVZC 3CCMI 4GYGA 3H1CA 3M8QA 2F5DA 4C5GA 3M6GA 2G8FA 4YNQA 1X9JA 3WODF 3PO5A 2JMWA 1A31A 3BZ6A 1NJWA 3P8DA 3QO3A 4Y13A 3S3NA 5AIPA 2OC6A 4H4MA 3TU5A 3AAQA 1Q81R 1T56A 1YBYA 3OOUA 5KYYB 2P9SA 2DL7A 3AGRA 3HTVA 4BQNA 4CERA 3NCIA 1SV5A 2E5QA 2HZTA 4KHWA 2OTLI 5TKWA 4I98B 3SBGA 3H46O 1NK0A 3VS4A 5IY5H 5DD4A 3H5RA 4E4HA 5CQEA 3G71A 2XAUA 4MLOA 3NTKA 4UC4A 2E1MC 4L8RB 4AIAA 1Q81O 3P38A 3VYSB 4CEQA 5CR2A 1Q18A 4PJLA 4JUVA 1YQMA 1NK2P 3MO8A 3O9RA 5GAOl 4KDPA 3SFIA 4PJOF 2E6NA 4Z4CA 1L3LA 5ICEA 4BH9A 2Q2EB 3ZSOA 2QSHX 4AFSC 3GDQA 4BI8B 2OTJI 4A3GJ 1QLYA 4CJRA 1TAUA 2E12A 1G3SA 1M8VA 1H0MA 3MEXA 4Q5SF 1KU3A 1VQNQ 4CEOA 3ZGKA 2DPDA 3QEPA 2K27A 2CV1A 3LMMA 3CM5A 4LIUA 3FZVA 5B5EC 3GOIA 5I2MA 3LWIA 5JVTA 3HKSA 5GAOm 2OPQA 4GV3A 4NS5A 8AT1B 4D9JA 1VSJA 1L3VA 1JJ6C 1VAZA 1LWVA 4H5WA 2W03A 3V1RA 1XCVA 4A0XA 2CH4W 2H3GX 1M2VA 5LMNK 2VB6A 1U6ZA 2RQVA 1YQLA 4OP0A 1XJWB 4NB5A 4RMNA 2HZDA 2QQ8A 4LFAK 5LJ3h 3DCFA 3OH6A 2EIJH 2HAXA 4KNYA 4ZZLA 4CBUA 4PL7A 3ZQLA 4RGSA 1K9MC 4N76A 1N6QA 2O4GA 2HXOA 3KP2A 1U6GA 4U7BA 2HHVA 2M5WA 4JYKA 1S72A 5EF6A 2DFFA 1GLAG 1T08B 4JYAK 1HKSA 2E65A 3E6BA 3DXKB 2G8VA 3ZXSA 2XY7A 2MSYA 5FGMA 5C10A 3V8KA 4Z0UA 2VBZA 2DA4A 1HSTA 3AVCA 2CWEA 1HSQA 1OH5A 2BZYA 4A4EA 2D8JA 3QDRB 5D7UA 2A41A 1TXQA 1LNWA 4E7ZA 4M73A 1WPKA 3CJQB 1QVFP 2FZCB 1WBDA 3KEYA 2YSQA 5LJ5g 1YO5C 4NLCA 2NRZA 3QYGB 1ON2A 3IHUA 4P96A 2ATCB 2QWPA 2KIMA 2EYYA 2H8RA 3DB3A 4CZLA 3SYZA 4IG3A 3I35A 3SZGA 1ETWA 4LDXA 4L5EA 3VYGA 3TAQA 1BQMA 2VC8A 1S1XA 1LAVA 2RHKA 1WNLA 5BRDA 5IXFA 4J00A 4X64K 3CJBA 4M78D 1DJ7B 4CJSA 2Z5UA 2AT1B 1IUYA 3CHWA 3I55I 5EU7A 4R79A 1YQAA 4JS4A 5DUIA 3A8HB 3HOXJ 1SUQA 2TCTA 2HOEA 2QKLB 3PMTA 1LFBA 3WNEA 4FYDA 4EW0A 3SUPA 4CJKA 2VXFA 1XMXA 4NQWA 2ROTA 2K4JA 1TYQB 4ID1A 1UFMA 3CQXA 4RTVA 2HBPA 4DV3K 2Q36A 3EGDB 4BC2A 2FUG2 2XAGA 4Y91A 3BDDA 2GGRA 1G2HA 3L1AA 3ZT2A 2E2NA 4A62A 2FHDA 1IGUA 3MN9A 2JT1A 3FKIJ 1U9NA 1E6GA 2NXNB 2EGCA 3OTOK 2KE9A 4F2RA 1QPMA 3SEZA 3NF9A 2D1VA 2NWMA 4GNIA 2M16A 2HQAA 2HHXA 3PX4A 3HJFA 1PG5B 1EETA 5BPIA 2CH6A 5AQXA 3HP9A 1E3PA 3P1GA 2PMHA 1HC8A 1ORKA 3ME9A 1KD1R 1I1GA 2NVTJ 2B4JA 2L3PA 3BY6A 1MUZA 2BZXA 4KN4X 4ZGEB 3ABUA 3HIFA 2XK0A 4CZKA 4FM0A 3J80O 5GAOr 4JS5A 2JS2A 3QSUA 1IREB 1M1FA 4FHTA 2M0MA 1JUPA 2DE0X 2FEIA 4DU3A 2PZSA 3QOEA 3I4NJ 4LE9A 4M75E 4EVIA 1TK8A 2FF3B 2YUSA 1TL3A 2QBYB 1WPYA 1KVCA 2OA8A 4FM1A 2LMDA 4KIGA 2X4JA 4XQFA 1KD1O 2ZPGB 1XG1A 5IP9J 3B6AA 3LQRA 4M78G 1I5LA 2A05A 3QJ6A 4C92F 1A35A 4KGVB 1YI2I 4FISA 3H35A 4K0KK 1RRQA 4BDPA 2DXUA 3DLEA 2QTVA 1YJWI 2EYZA 3PTAA 1I4K1 1MZBA 5EEGA 4E7LA 5LGUA 4PJJA 3BROA 2RN7A 1UGRB 2CV2A 5A2QZ 4ZJZA 4KB1A 1SVOA 3BPXA 2HKXA 2EBPA 2BY0A 2KR3A 2F8SA 4F91B 1AKHA 3KBGA 1FZPB 4FLUA 4J9DA 2A1SA 2YXYA 3CCEA 4CGZA 3MK6A 1HKTA 2HQHA 4C8MA 3MXIA 2FF4A 4V2SA 1IBLK 3EG2A 4AHCA 2EKOA 1N5ZA 4GDFA 3VEPA 3M4YA 3DTIA 1UGVA 2FEZA 1GBRA 1EJ9A 4M78C 3MN5A 4A3CJ 4KGXB 4HQMA 4CH7A 3CFOA 1Z9CA 3HO1A 3IFRA 1E3OC 1VQOA 4UNOA 4Z6YA 2JA8J 3O08A 2V52B 2E4LA 3SZTA 1VQ6N 2PNIA 2XHCA 3BJ6A 2M0OA 4J9CA 1WX6A 4RWTA 3HTSB 2NS0A 1QHHD 1W7PA 5B8HA 2FBHA 3OYGA 2ZBKA 1BYMA 3Q7CA 1DIZA 1R22A 1ZA1B 3RMAA 1VOMA 3L3UA 2XPVA 2ASMA 1X1DA 1XHZA 1FEXA 5LMUK 4NOYA 4PNOA 3L2CA 4DTSA 3CCLN 5CKBA 1N6AA 1ATRA 5M1PA 5J2MA 3CMAN 2GNCA 2R57A 5H6RA 2GQIA 3PV8A 2LRQA 1IRFA 3CBOA 1J0RA 4OMZA 1KAZA 1V55H 4QS7A 2V7FA 3EE8A 1WFXA 3K1MA 1C0TA 2ETHA 4A53A 3RTVA 1P4XA 3OS2A 1YCYA 4CJ7A 3EYIA 4YDUC 4CGIA 2DK8A 4DU1A 3LP1A 1IH7A 1UHMA 3F72A 2Q1ZB 4HG2A 3BQYA 4BQQA 2HQXA 3VQEA 2HSEB 3SWNB 3I4MJ 3E01A 3CCMN 4JQFA 3TR8A 1VQ6T 1WIEA 1BL0A 2K86A 3E0JB 1RNHA 5AQUA 1MDMA 4QCLA 1YHQN 2OAZA 2F4OB 4ZDOA 5GMKl 5HDGA 1OKJA 3U4LA 3CVTA 5ELZA 5LGTA 2RQTA 1SANA 2MOXA 1MNEA 1VQKQ 3TAFA 5J2PA 1IV6A 3ID6A 3DLLA 1F36A 3OIOA 5GAN3 2HNHA 4YY3K 3IRRA 3NGZA 2CREA 2A3LA 2RB6A 4BI4A 3CCLT 5J2NA 4QQ6A 3CP8A 3ATVA 3MX2A 4MMLA 4W97A 2A6TA 5J8CA 3GBQA 5LBQA 3T5XA 5LJ5f 2X4XA 4BRNA 4CVNE 1OV3A 4Y1CA 1GL5A 3OY9A 3CCQA 4BQOA 4XIUA 3OSVA 2XHBA 3E5XA 2QWMA 2M30A 3E3VA 1M4ZA 3S41A 3JCMP 3M0TA 1DEJA 1NM1A 2DZ9A 4AM7A 3LAMA 2KBTA 3ENBA 2K6DA 2IVWA 3M57A 4DSKA 3ZP5A 4B9WA 4FSVA 5GMKi 3CCRI 1OCTC 2MI6A 1T3VA 2NUPA 4BGDA 4PA1A 1GFDA 4G7HF 2KPMA 1YHQT 5KK1A 1QHAA 4CZMA 4JI4K 5H6QA 2KKOA 1YJ9Q 2K02A 4N4HA 2EQKA 3O9QA 4ZYGA 4M9SA 2JMCA 1M1EB 4Q5VA 1T33A 3K9TA 4BY9C 2CYZB 3FXLA 3K0LA 3SFZA 5SWMA 2NRWA 3VGLA 1XMOK 3I53A 4JOMA 2ITMA 5CR4A 5LRRA 3RIRA 2PI0A 1FN7A 1NK5A 1GXIE 5CHZA 2ICWG 5BPMA 3VA0A 2DD4A 1HLUA 4M7DB 3CPWP 1DGRM 1X2QA 4LMYA 1RFQA 4CCMA 2JTVA 2KXDA 1S22A 1TK5A 1YIOA 2BY3A 2VKDA 2WTEA 3LSIA 3NARA 3ALYA 3M8PA 1RAAB 2HDWA 4LUDA 3M54A 4I02A 1ZBXA 3CUOA 4M6VA 1QW1A 1TGOA 3WXIA 3N97A 2HDDA 1UHFA 2FBXA 1IO2A 3G6EQ 4BXUA 2FBIA 3IS9A 5AQYA 1QVUA 4KPYA 5HRSA 4M75F 2WY8Q 3E19A 4IG0A 1YT3A 4KHSA 3IWFA 1TT5B 2O4XB 4WQ5A 3VUBA 4M3WA 4PZJA 3S3OA 4ZYAA 4CJLA 1JJ2P 4E70A 1O75A 3VS5A 2L0KA 4CJ3A 4XORA 4CFAA 2QTXA 4HUEA 5F0HA 3FF5A 4ILGB 3E9PA 2KW4A 1GUUA 1LDDA 4M77A 4AG1C 1HNIA 1VQMA 1OH7A 2DO3A 1NG7A 1IXCA 3VPRA 3CWAA 4B23A 5DPKA 1WI9A 4OX9K 4B3TK 1X9MA 1T6CA 3VFZA 4JI7K 4RB1A 2GWRA 2HZYA 3MEAA 5DS9A 2A37A 3DB4A 3M56A 2EX3A 2V51B 2VWJA 1KHIA 1WJ5A 1F4KA 2RI5A 2DY4A 3KFVA 1N8RC 2BBYA 3RCOA 3QFPA 4C3HJ 3CO7C 3I55N 2D45A 5LFAA 1WJDA 1YJNA 3W2VA 5GAHP 2F4MB 1TAQA 2IW5A 2IS3A 4EJYA 1W4MA 2B86A 4LFBK 2P9PB 1X2KA 1S1VA 4CGDA 3VDXA 4WE1A 3HM5A 1WSIA 2IVOA 1VQLI 4Q4ZF 5IWAK 5KPRA 1CKAA 4Y33A 4I9LA 1UGQB 2W1OA 2LT1A 4XLNF 1BCOA 2M1HA 3PNVA 1S3XA 2P7VB 1WI7A 4RDUA 2HBJA 5M1KA 1BU6O 1LJ9A 4EJWA 1L3TA 1ABQA 2JM8A 3A03A 4LF7K 4M7YA 3D1NI 3O6WA 3OYJA 4MFEA 1VSLA 5JHFA 3VQ7A 1K8KA 5GADP 1KD1C 1R1UA 2B7EA 4FOIA 5AQLA 2NYSA 3F0CA 1HK9A 1Q9XA 4AQYK 3M58A 3BPVA 3BW1A 5LJWA 2XDDA 1MUNA 4B24A 3Q5FA 4KHYA 2DA5A 3QU6A 2JWTA 5F04A 2OX7A 4NZGA 4HSTA 3M59A 4RB0A 1MKMA 3T19A 4D1QA 3MZ8A 1E4GT 3VYTB 1LPQA 3SJJA 3MKLA 3IMXA 3G4SA 3CESA 1QGPA 3C7NA 4JZ4A 1M90R 1OYYA 1N78A 1MHNA 3LL7A 2FC0A 3A5NC 2CKKA 1FOWA 2CJJA 1RR7A 5A2QE 4FWOA 1BI3A 2A69F 4OLBA 3CJAA 5JICA 1X9WA 1RCHA 4CSWA 2VKVA 3EHQA 1KVAA 1B1BA 3CCVA 1X43A 1YI2N 4E3SA 1IKYA 2E35A 2RHYA 4CE9A 4QWQA 3JCMh 3TL4X 1BJZA 3K70D 3CD6I 3X2QH 4ZGDB 2D0QB 2KIFA 5D5WB 4RLQA 2Y9YA 4HOBA 3P9CA 1FIAA 2QEXI 3AVMA 2WAQN 3ZFJA 1KQSS 1M90O 2EV5A 3HOTA 1ZQ1A 1J9IA 5HKCA 5DCMA 4CEEA 3NH1A 3T8TA 1MH3A 3OIQA 2O8CA 4NL3A 2J7IA 2YHYA 2L8DA 4FYVB 2L89A 1W36C 2H3JA 2OPTA 4OB1B 2RNAA 4DGWB 4FOEA 4E1JA 1S9HA 4DSFA 1KQ0A 2WB1N 5DM6F 1ZLMA 4BDZA 4N41A 3ZCOA 1I6HJ 2EFQA 4Y15A 2KHMA 2WC2A 3VF2A 3ZMSA 4R55A 2G8UA 4XH5A 1X58A 3CUQA 3RVCA 1ERDA 3KJVA 3KP5A 4M7DD 1D1AA 4LSNA 5CY4A 4HUFA 1XPXA 3GFIA 2L7FP 5DM7L 1MDUB 4BR9A 5KRSA 5HDNA 2QCOA 1RAIB 2P0QA 3M5AA 3CF5L 3ATUA 4Z4EA 5FO5A 3I0TA 2A28A 1Q7YU 4JRKA 1BA1A 3CMEA 3IH2A 2A0FB 1DTQA 2G7UA 3PM1A 1QVGM 5TJJA 3LDSA 2WAEA 3GFMA 4HUGA 5I2SA 1KHCA 2VG5A 3S6IA 1WI3A 2BKDN 2R92J 3REBB 1BISA 3AVLA 3MD2A 1ZR4A 5FKOA 4FWMA 4J9BA 2NLUA 2P9KA 3LZJA 3SUQA 1XI1A 3TKYA 1T8EA 4O5FA 5FU6B 3EZ5A 1BI2A 3I56Q 4A2AA 1U3OA 2RKIA 2QG9B 4JDSA 3ABLH 3F23A 3I64A 2CW8A 4H4KC 1JB0E 5J2QA 4ZC3A 3AV9A 1GVJA 3GE1A 4LK1F 1JXBA 4ENJA 3TSQA 2IC3A 2BUPA 4B9MA 4MEYF 4BACA 3QRFF 1K0XA 1G3YA 3M5RA 1JT6A 4C0DB 2RO0A 2FLOA 2WTUA 4FK4A 4YFKF 1BK2A 4Q5WA 3PFYA 4O44A 3NVMA 2ZJQF 4MLEA 2P6TA 1Z6TA 3CQYA 3R0JA 5F27A 3URGA 2GTJA 2A6AA 4JK9A 4JK8A 4P1WA 4FT8A 1V4RA 2L4AA 4CHOA 4Z4HA 5HS8A 4XLCA 3D7SB 3VESA 3GVAA 5M5XJ 1YITQ 4UV9A 4WX9A 1AHJB 2PUKB 2CGJA 3JRHA 2V8JA 1GLJO 2DOFA 2HQNA 2KNBB 2IAJA 2EYWA 2CQNA 4L18B 3MP8A 3A01B 5FPEA 4IFYA 4I9QA 2FF6A 2X6YA 2CG4A 1RACB 4ZYDA 2ZXJA 1X1CA 5EVZA 1K4US 2IT0A 3P9KA 3CP2A 1NJYA 2W6LA 1W1WE 3JCMV 4CF1A 1ZSZA 3TWHA 1MMSA 4KJZA 1ZG5A 3V9WA 2G8KA 1WXBA 1X3NA 4L59A 1TZLA 2HVRA 4A61A 3GNGA 2NOZA 2TDXA 1U5TB 5LL6S 1SKSA 4FYXB 1P2FA 3H9QA 3VEZA 5FLXZ 2F1LA 2MD0A 2GBZA 2NLXA 1K78B 5J3LA 3EG9B 1RBSA 2P7CB 1R5GA 4CYCB 5AQIA 1RAEB 3VMFB 3H3VK 3OYEA 1A36A 1TKXA 4RGRA 3LSTA 4DSEA 4M7DC 3KLHA 2VJIA 2WV0A 2W04A 1JRIA 3PNWC 1B7TA 3OYNA 4EP4A 5DYMA 4K8ZA 2YNGA 3RQ4A 1TP4A 3A8OB 4E9HA 3WGIA 4ON0A 3OYMA 4BC3A 4DA4A 2AQEA 4ORZA 4E6RA 3CQTA 4XQ3A 4CD3A 5ILVA 2UUAK 3IRXA 2YUNA 3G25A 9ANTA 1D9FA 2RVCA 2M7AA 4I2PA 4W5OA 4BY1J 2O9LA 3E9FA 4HCCA 4I76A 4C30A 5CVIA 2Q31A 1D1CA 2K9LA 4B08A 1FPQA 4B3RK 3DLLL 2RQQA 4UB8C 1KQ2A 1U06A 1YITA 3CXCS 4HZFA 2VONA 1KLNA 2FSKA 3KKRA 3CC7T 3OGDA 4DQPA 2MWOA 4LG3A 2O7OA 2ZXHA 1YWOA 1D0XA 1D8YA 2R7VA 4NB4A 1W7AA 4K8XA 3IP4B 4ZGJB 4NUBA 2P9NA 1YIJI 1BI4A 2LYCA 1Q1VA 4E9FA 5GANj 2OAUA 2PG4A 3GX4X 3ZEUA 2PQWA 2UUBK 2Y2ZA 2O8KA 3ZT0A 1TNTA 4AI4A 4MQ3A 4JKDA 3H36A 3JB9D 2KMTA 5BNGA 1V54H 3AVGA 3CJ1A 3BJOA 2Q0UA 3BE3A 4BE2A 1SD7A 2NRHA 4JI1K 3E5UA 2DJNA 2K7LA 1XC3A 4HF1A 2OZ6A 2XGXA 2DERA 2KP6A 2AKLA 1KU7A 3KWIA 1RT6A 4AMCA 2EFOA 1X01A 2F5CA 5IP7J 4RW4A 3C2BA 1DDNA 3WTXC 1XSXA 5B3SH 4KIBA 4EMGA 3ID8A 1JXOA 3L42A 1WNSA 2JJ7A 2BH1A 4CJPA 2DJIA 3ZQ7A 4C8QA 5GAN5 3CJCA 2W00A 4HPQA 4F7UA 4BE0A 1RDUA 3E1SA 1G59A 2XAHA 3WXKA 4BR7A 3HBLA 1OJLA 2VKNA 1S9EA 1MUYA 2DPPB 2ESNA 1QP2A 1W5TA 1L5UA 1AWOA 1ZG1A 4FJLA 3LP2A 1LWEA 1M1KO 2VE8A 2NZTA 2A1RA 4C8QG 1FTZA 4F16A 3ABMH 2F4IA 2DYBA 2D6FA 2QLZA 4XRSA 3HVTA 1XB4A 2LC4A 4EATA 1UJ8A 2H1KA 2WUSA 1VQ4Q 5BR9A 4TSXA 4UQGA 1Z1DA 4D8DA 4CJ4A 3RPUD 3V8JA 2EB7A 1DU0A 1A0NB 5IHKA 2IGOA 4B9NA 3JSPA 3U9GA 4RKUE 1VUBA 1RBVA 1HW1A 4S05A 1HJRA 5KGWA 4KKOA 5F08A 2KRFA 2Y0MA 3LSKA 5CKDA 1ZUKA 4OWRB 1KC8U 4B44A 4BY7J 1RI7A 1C1BA 1ZH5A 3KK2A 2HYJA 1ZX6A 5KYXA 3THXB 2A5WA 4HW0A 2BTTA 4ELYC 2DMQA 3CC4I 3NFAA 1ZUYA 2XKOC 1M90C 3SPZA 1YRNA 1VYUA 4KHQA 3CJ9A 3LQQA 3A8MB 5D6XA 3TSUA 3LYIA 3JB9G 3A5LC 1ULYA 5J1UA 4P9FA 2ZMEB 4R0KA 4DOWA 5KYUB 3KLNA 1QQJA 5BRFA 3ISPA 1D09B 4BEHB 4JHDA 4CIGA 5EY4A 5AQOA 1VQPI 1I3QJ 3IAM2 3RPQA 2L0AA 5DCFA 3MEVA 2ADUA 4UVAA 2KFNA 1LE8A 4B1UB 2I5UA 1FBSA 2PJRB 3GTMJ 4A3LJ 1RTDA 4H0OA 5E3OA 4N0AC 4II3A 5CKFA 3BEXA 1RRSA 4O0JA 2QDLA 5GAMh 5FKLA 1TQIA 3QJYA 3I5RA 3FLCO 3VQQA 3ZRGA 1FYLA 1OVYA 2LJ0A 4ISEA 3J7AY 1S6LA 4M7AA 3V7RA 3D0SA 1YN8A 2DTOA 4EIAA 3OB9A 3RSEA 5FD5A 5ILSA 3HPWA 2PFUA 5KGXA 4Y1DA 1Q7YR 2NRVA 1U1TA 4FZXC 3LW5E 3O9UA 2EHGA 4M7AG 1OMIA 4Y52J 1IJJA 3U9ZA 4U0WA 3THKA 2OYQA 4M9ZA 1XUPO 4BRCA 3CCLA 4CK2A 4CZJA 2EIMH 1F21A 1FXXA 2GWKA 3H9JA 3CMAA 2VG7A 3MEEA 3H92A 3G1MA 1N77A 3FXJA 4IJAA 3GTGJ 3A2FA 1U84A 3I3LA 2LKPA 5JHUA 1T7PA 1Y96B 1RDWX 4C5EA 1RL2A 5KYYA 3V9SA 5LEKA 3MFKA 1QZZA 1Q7YO 4EEFG 1CGPA 2HFHA 1VSDA 3V1OA 1S1WA 1F1ZA 3DPTA 1CSKA 2DT6A 3ZMTA 3K10A 1QQOA 4RS8A 2ROLA 4DIQA 5KCOA 3J7YJ 2HCKA 5AFUA 3J7AP 3CCMA 1SVMA 5GANf 1HKQA 3F2KA 5HODA 2COWA 2L9NA 4XN0A 2FD5A 4C8LA 1QZYA 1B8IA 1PVSA 2FPFA 1ZGWA 3VYRB 3M0SA 3SHFA 2BXZA 2ZCFB 3TU4K 1KU9A 4Y92A 4A4KA 3SQNA 2DA2A 3OA9A 2JA6J 4ABZA 3R6SA 1WXUA 4M77E 2OTLA 3F70A 2WSFE 3I0XA 4H0VB 3A0BC 2KT8A 1JCFA 4IUQA 1OQYA 2H09A 3F6OA 3ML6A 1M2OA 4C0DC 1BU1A 1ASWA 5KE2A 4BROA 1QPIA 3QDKA 4IBNA 1UB9A 1X3ZB 1J9AA 1SQKA 2QKMB 4PWDA 4BYYA 1U3EM 3B73A 2CP0A 4WF9L 2YSRA 1IXRC 2WSCE 1NBWA 2OFIA 2ZQBA 1KFSA 3VENA 2K79A 3HYFA 1VRUA 4HLXA 3G3ZA 4Y3OA 3Q7BA 5IT9K 3I54A 1JT0A 4FPBA 2LQWA 2EJ9A 2P8TA 4PQUA 2YLBA 2OTJA 3IG1A 3W0LA 1TUGB 2CP3A 3AG3H 2FPDA 4IRIA 2FMYA 4EM0B 3I0SA 1I50J 4FJ7A 3VSKA 2VQFK 5EEAA 2Q0RA 4JKAA 2X74A 4JJNK 2HBKA 1ZXOA 3MVPA 3DU5A 4LFUA 3HJEA 2OF7A 1NMNA 4JI5K 1FBQA 5GAGP 2E34A 5E18F 4Z94A 1QWEA 3GL1A 3MXJA 4FWKA 4AH9A 1WJQA 1ORNA 3VQ8A 3N0UA 2B5JA 3ENOA 4EAHD 3H5NA 3I5UA 2KLOA 3RBBB 3O6BB 2CGHA 2MC4A 4OF1A 2JWLA 4HV5A 3J7AF 1R4MB 5IYDJ 2XMFA 1XHXA 1K8AC 3DXKA 3PX6A 2V75A 1SG5A 4XNFA 4PJOG 4RCCA 5FLVA 1GXQA 4DG1A 3VJPA 4JI8K 5FU7C 3QP6A 1PC0A 5AQZA 3VQPA 2LREA 2VPRA 4OMOA 4G6QA 5GANe 3EE9A 5F2RA 2IDOA 1D8KA 2HB5A 3J81K 2X6OA 1D5VA 4DUZK 2A6HF 2GAUA 3JRGA 2WBNA 1BBYA 2P84A 1HQUA 3NE6A 2HNZA 1N36K 5EEHA 3NRVA 1S6QA 2OCEA 3NGIA 3QZ9B 1W0TA 1D5AA 5J39A 4D7NA 3MP6A 2PTKA 4KN7X 1Z6RA 2BGGA 3ONQA 2RJEA 3UWNA 2GX9A 4B3OA 4LJZF 3K4LA 1SD4A 1GLDG 2NRTA 2J6KA 4KO0A 3M53A 5AQFA 5DY9A 4DQIA 3GLXA 3C65A 3O80A 1WBBA 4CCJA 3FHFA 1I0CA 1OYWA 3DTEA 4CW7B 3WTUC 1F5TA 2DFIA 3C94A 1MNDA 3C4SA 1TYQA 2RHIA 4PJOC 3FB9A 3OYIA 2CGPA 4DUYK 1GV2A 4B3MK 3EGDA 4MQVA 3CC2N 1DTTA 1PSFA 2V1XA 1ZLKA 3OYYA 2Z33A 1V5GA 2D4WA 3DLLF 4B9TA 3OYFA 2W84A 4IFEA 4ELTA 3KX2A 3FLGA 3UB5A 3I55A 3KUFA 4HSRA 1YJWQ 1LEAA 4J01A 4CZFA 3H9GA 1KQSP 5J4YA 3SFMA 1TG0A 1NGAA 2O61A 3RZDJ 3F8NA 2P5OA 2ZNYA 1S7EA 3GW2A 4E7KA 3LDOA 4IHTA 3GTQJ 1H1VA 2D0AA 3RYRA 3AVIA 3BTLA 2PY5A 2MC3A 2OCCH 4YPHA 2MIOA 4KISA 3LDNA 2LY1A 3DOLA 2PVDB 3C6HA 2GUPA 3L2QA 3TAEA 2KHOA 2NUBA 2LZ6B