4BE1A

Pfv intasome with inhibitor xz-116
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords INTEGRASE
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be1A03
5KGXA 2WACA 3TAEA 2HHQA 3TANA 2D9TA 2X4XA 3LWMA 1HPZA 4KHSA 2KQ2A 3ZT0A 5CIUA 4C5EA 4IFVA 3AVHA 3MEVA 2JLEA 3HPOA 2MWOA 3A2FA 3KIOA 3WNEA 1RT5A 3ZT4A 4CHPA 2B8AA 4W5RA 1X9SA 3TWHA 3AA3A 3BDPA 4C8LA 3NAEA 3OYMA 2JTFA 3OS1A 1WSGA 3AVLA 3NBPA 4CESA 1UWBA 1RBVA 4JLHA 4DLEA 3VQ8A 2G8WA 2ZQBA 4CIFA 1RBSA 3VA0A 3MXMA 2RI3A 1S6PA 3MECA 4M41A 4M3WA 4BE1A 2F5KA 5HLFA 4OKKA 2O4XA 4A4FA 2XY8A 3AVAA 3SI6A 4IURA 3ISNC 3RMAA 3JYTA 2Y1JA 1SKRA 1D8YA 2F8SA 4C5HA 3G10A 3CFRA 1WSIA 5C6SA 1BIZA 4FZYA 3I0SA 2RHZA 1C0TA 4I2QA 4CJEA 4DFPA 4J2EA 3SQ1A 1U4BA 4B8AB 3F70A 4KB0A 2AJQA 4OKEA 3M8RA 3K59A 4DLGA 1RTDA 4FJ5A 1JLCA 1A5WA 3WNGA 1HNIA 3P8DA 1A5XA 2X4WA 1TKTA 4DTRA 3QEXA 1RBTA 1J5OA 1RCHA 4BWMA 3OJUA 4N41A 1XNIA 1LV5A 2EQUA 3Q1JA 2FBTA 3CG7A 4KO0A 4XIUA 3MXJA 4X34A 3K5LA 1S5JA 4W5OA 2VWJA 4DS4A 2XY6A 1BIUA 3HSTB 3RTVA 1A5VA 4DQPA 3AA2A 2E5QA 4O4GA 3NH0A 4B9LA 1VSHA 4FK2A 4B3OA 3SQ0A 2OPSA 3VQ7A 3LX7A 2HB5A 4E3SA 1C0UA 2LDMA 4QCLA 4N4GA 4FLWA 3DMJA 4BD3A 3HVRA 3KUFA 4M3XA 2RJDA 4CGIA 3QINA 5D3GA 2YNFA 5KGWA 1NK9A 4DTPA 1UOCA 3OQ5A 3VQPA 4IG3A 3NNQA 5HRNA 1S1VA 3O3HA 1S1XA 3PX6A 4CJSA 1QE1A 4DU1A 3L2RA 3S3OA 3K5OA 4DQQA 4CJ3A 3OA6A 5J39A 2GFAA 1KTQA 2R5AA 1WJQA 1FXXA 3AVMA 1S9EA 4ICLA 3CEYA 1O1WA 3SV3A 3ASMA 1ASVA 4DFKA 4DSIA 3DLRA 2OYQA 1LW2A 4FXDA 1RDDA 4F4KA 5SZTA 1KCFA 2ITGA 3LANA 2B4JA 2X6NA 1YTAA 3P5JA 4Z4FA 3ZEHA 3C6TA 3U3GA 3HVTA 1TL3A 3HPHA 4FJGA 2DY4A 4HUEA 2IG0A 2E6MA 2EX3A 2GF7A 3MP8A 1Y97A 1YVUA 2LTOA 1IKXA 1BISA 4Z0UA 1IH7A 4I7FA 3HPGA 3TR8A 3V1QA 3LH0A 1LAWA 3PX4A 4KV8A 5DK5A 4CJVA 4BACA 3EZ5A 3TAPA 4B9WA 1TK8A 4DU3A 4PUOA 3RWUA 4CHZA 2BUDA 2K3YA 1JLGA 4CEAA 5T7BA 3G0ZA 4KI6A 4KRFA 4W5TA 4FM1A 3O3FA 1LWCA 1NJYA 2MWPA 2YHAA 2P1JA 5KRSA 1KSPA 2G8HA 4HVJA 5C42A 3KLIA 1ZYQA 2G8UA 2KZZA 1VK0A 2O4IA 2BKDN 3UWNA 4W5NA 1NK0A 1YTUA 2DIQA 1IO2A 1WN7A 4OVAA 1VSEA 3AO3A 3PFSA 1HRHA 4H4OA 3KK1A 4DS5A 3LDSA 4DF4A 3RRGA 4NCBA 4UQGA 3SPZA 4PLLA 4HUGA 2X6SA 3SCXA 4KTZA 1FKOA 4O0IA 3LP1A 3KLEA 3P83D 1R0AA 3AVJA 5CYMA 2HHXA 4DWIA 3MAQA 4B9XA 4CJKA 1WGSA 3SJJA 3OYBA 1JLFA 1TV6A 4GVMA 4QVZA 1ASUA 1NKBA 4IUVA 4N47A 4FLYA 2JGUA 3QIOA 4KKOA 4IFYA 3AA4A 1NK8A 4DF8A 4CHOA 3S9HA 5FRNA 4CJRA 4DTOA 3QEWA 4FJJA 4N4HA 3VA3A 3AVBA 3PX0A 1N5YA 3V6DA 1TK5A 1Q9YA 1TL1A 3MP1A 1WSJA 3NH2A 4Z4HA 4FLZA 4G1QA 4M3RA 3LGLA 4DFMA 3SPYA 2XK0A 3AA5X 3QNOA 1GOBA 1LW0A 3LP3A 5KTQA 4O44A 4E7JA 2KTQA 2EQJA 3VQ4A 3OMGA 1QTMA 3NF7A 1REVA 2RI5A 3L2QA 5D6XA 1BI4B 5DMRA 3MEGA 2NUBA 3KK3A 5KCOA 3B6PA 3C4SA 4MQ3A 4TSXA 3SQ2A 3HT3A 3IRXA 4NYFA 2LVMA 3OYAA 4CFAA 5E41A 1UA0A 2BGGA 4BE2A 1IKWA 3T1AA 3CYMA 2BE2A 2D5RA 1QS4A 3L3UA 3K2PA 4FYDA 1HYVA 1ZBHA 3DLEA 4B9MA 4ELUA 3VQAA 4CFDA 4C8KA 3K5NA 2RF2A 3RRHA 4QQ6A 1L3TA 4JS5A 1TAQA 2KFNA 4KHYA 4KHQA 4DQIA 4JRPA 4C5IA 1RT3A 4M3YA 1S1TA 2IAJA 5C25A 4E0DA 3EAEA 4CHQA 3NTKA 4FW1A 3ZSRA 3KLHA 3L2VA 2DFFA 4KFBA 4LSNA 1BCOA 4CK1A 4FLUA 4DFJA 3NH1A 2IGIA 1JLEA 2RO0A 1CZBA 3LAMA 3DRSA 3THVA 3PY8A 4ELVA 3AVIA 4CE9A 3CM6A 4IDKA 1OYXA 2R5MA 4LD0A 1JLBA 1I39A 3ZCMA 4DTXA 5C0MA 1DTTA 2FBYA 3HL8A 4FJNA 3FDRA 1L3SA 2YHBA 2X35A 3OYLA 1CZ9A 1RTHA 5KE3A 2PY5A 3OYCA 2RKIA 2QK9A 1BQNA 1IKYA 1VSJA 4CEQA 3MXIA 1TVRA 4KAZA 4L59A 4OKJA 5KRTA 3SUNA 1TK0A 4JS4A 1Q9XA 4CJTA 1D5AA 1NJXA 1SL1A 1Z26A 4NCAA 4OGCA 1X1PA 2WONA 3TARA 1JLQA 3NF6A 3WNFA 1NKCA 3RR8A 3DRRA 2FC0A 4Q5VA 2OA8A 2RJFA 3ASKA 4GMJB 1XC9A 3IAYA 3DLMA 3VQ5A 3NHGA 3LP2A 4RW8A 2O4GA 2HVIA 2ZD1A 3DLKA 1SKSA 4M3ZA 4NZGA 4NS5A 4CJWA 4DTSA 3LZIA 2YNGA 3AVCA 1U04A 1XWLA 3VQDA 3V9UA 1KLMA 4DSJA 3VN5A 3VQBA 2X4YA 2YRVA 1B92A 3HYFA 2HHUA 2EQMA 4FM2A 1JL1A 3UT1A 2RHUA 1J9AA 2IDOA 2EFIA 3PUFA 2Y1IA 2HVHA 4O5BA 4KTWA 4K8ZA 3C6UA 2PQWA 3CQ8A 1IG9A 2LCCA 2IS3A 2F96A 2P0KA 4Z4GA 4B9VA 3ULDA 5J2QA 4IUTA 3OS2A 2ATQA 2GBZA 2VWKA 3NF9A 4OGEA 1EXQA 1XI1A 4HCBA 1JKHA 4KI4A 2X78A 2D0CA 5D6YA 5J2PA 2XDPA 5J26A 2LRQA 3TAQA 1NOYA 2E6NA 1G15A 4RW9A 3OYDA 3QEVA 3HJFA 4CIEA 4RG2A 1RTJA 3KD1E 3ZT1A 2B6AA 4CGHA 4BE0A 4E7HA 3L8BA 4E1MA 5CY4A 4Q0BA 1QSLA 4QAGA 2XHBA 3OYNA 3QETA 4ZTFA 4A4GA 3RMBA 3EYZA 1XHXA 2IC3A 1NK5A 3CFPA 3NTIA 2DFHA 3OYHA 1WSHA 1KFSA 4BDZA 4CEBA 3AVNA 4HCCA 1S1WA 1LWEA 2G8IA 2HHWA 2B5JA 4DTNA 3MP6A 4LH4A 2L8DA 4M42A 1VSIA 2YNIA 3KJVA 4DQSA 3BDLA 1KHCA 3FFIA 3V1RA 4Z4CA 3AVGA 4E1NA 3SQ4A 3HM9A 2DAQA 4UC4A 1VSLA 2RJEA 2M0OA 2Q3SA 3AV9A 3DYAA 4KHWA 3S3NA 4N4IA 2HNYA 4AHRA 2RI2A 5KCHA 2D0AA 2XY7A 1VRUA 2HQXA 4FU6A 1X9WA 4K8XA 1ZBFA 1OZ3A 1NJWA 4FJ7A 4CERA 3K57A 1LWFA 4KB1A 3DOLA 3LLRA 4A4EA 2Z1GA 1NOZA 3NF8A 4CHYA 4B9NA 2HHVA 4CGGA 2DFEA 4CK2A 3BGRA 2HHSA 1G5VA 3B6OA 4F3OA 4FK0A 4CEDA 4I2PA 2A1SA 2FHDA 2Z1IA 4CJFA 1VSKA 4B9SA 4AH9A 5CZ2A 2D0BA 4FJHA 5M9OA 4CF0A 3TAMA 4A4HA 1Q8IA 3VQEA 4FLTA 4ZTJA 4FLVA 2HHTA 1TKDA 3RMCA 5HP1A 3FEOA 3FC3A 3M8QA 1NJZA 4CJ4A 4CF9A 4J2BA 3OYEA 3SZ2A 3SNNA 4DG1A 1BGXT 3QBYA 3NGZA 4PA1A 4CJUA 2KW4A 1RT7A 1SL2A 4PWDA 2QQRA 3M9QA 4EZ9A 1ASWA 5HBMA 3AO2A 3LP0A 1SKWA 4DSLA 4R5PA 2OPQA 3CM5A 1CXUA 3QEPA 3QO9A 3CFOA 3T19A 3SV4A 5KE2A 4DQRA 1LAVA 2QKKA 2CKKA 1BCMA 1EP4A 2HNDA 2R58A 4C8MA 4FK4A 3PNWC 3MEEA 3LYIA 1ZBUA 5FDLA 1X9MA 4CK3A 4IG0A 4FM0A 4B9UA 3QJ6A 1TKXA 1CLQA 1W0HA 4RW4A 3HXMA 2VYTA 2R7YA 1C1AA 4M45A 4AHUA 5HROA 1CXQA 4YFUA 1RT6A 2Z1JA 4I9LA 2IOCA 1RT2A 3K5MA 3RMDA 1NK6A 1JL2A 1HQUA 1GOCA 2DIGA 3QIIA 4LSLA 3L42A 1RDCA 2BIVA 4WE1A 3AO4A 1KFDA 2G3RA 4O0JA 1BI4A 4NYNA 3TI0A 4OLAA 2M1HA 1RT1A 4L8RB 1JXBA 1KVBA 2VG7A 2F8TA 1QHTA 3DI6A 4AHSA 1QSYA 4M3TA 1MU2A 1SSFA 4CHNA 4DSFA 1T7PA 3PV8A 2E4LA 1HMVA 4F2SA 3LWLA 1I3AA 1BL3A 1H3ZA 1JXEA 1JLAA 1QQCA 3QIPA 4CIGA 3SUPA 3PMTA 3U3YA 2P51A 3VQQA 3V9SA 2EHGA 3S6WA 3KD5E 4FZXC 3TAGA 4ZHRA 4CEEA 4BDPA 1W9HA 2XO7A 4N5SA 3QESA 2G8KA 2HMIA 5CZ1A 1VSDA 3C94A 3TABA 5EU7A 3MO8A 1C1CA 3T3FA 4J2DA 4ID5A 1WSEA 3OYFA 5KH6A 3C95A 3OJSA 4E7KA 3QERA 1RDBA 4HTUA 3OYIA 1U45A 1DLOA 4FJKA 4HCZA 2X74A 3MEDA 3JSMA 3NGIA 4II1A 5FROA 5J2MA 4F3TA 2RHXA 4J2AA 4CEOA 1S9GA 5K14A 1ZBLA 4I9QA 2A1RA 3AO5A 4DMNA 4M3UA 1GOAA 4EP4A 3QEIA 4N56A 3OY9A 4CGJA 3ZT2A 4PY5A 2HQEA 1D9FA 2OZMA 4QOZB 4QW2A 3ZSVA 4E7IA 4CGFA 2YV0X 1EETA 2G8FA 3NGYA 2QXFA 3VQCA 4FJ9A 1SV5A 4QQDA 4B8CA 1C0MA 2L89A 3AO1A 1WJSA 4OPKA 3ZSZA 3U6FA 2P5GA 3NTHA 3HP9A 3H8ZA 4LD6A 5HRRA 1FK9A 1UAXA 3S3MA 1J53A 3QNNA 4Z4EA 3DRPA 1L3UA 4OLBA 2GUIA 2OPPA 4AILC 3V9XA 3IG1A 4HUFA 3TAFA 2W42A 3VQ9A 5I3UA 4FJ8A 4AHCA 3KTQA 4CJQA 4B9TA 2RN2A 3O4QA 2OZSA 1L3VA 1ZBIA 1WJRA 3LPTA 4IKFA 2OPRA 3I8DA 3I0RA 3OB9A 5JS2A 3META 2I5JA 3KKRA 3L2WA 1FKPA 2VG5A 3SD4A 1RTIA 1ITGA 1WNSA 2GFUA 5J1EA 4HHTA 3RR7A 3UIQA 4DSEA 3MEUA 3E9GA 3LAKA 3OS0A 3M8PA 3PO5A 1HQEA 4MFBA 4OPJA 4JRQA 1QSSA 3DLGA 3V81A 1SUQA 4FJLA 4KHUA 3DLBA 2E6LA 4Z4IA 3HP6A 4EDUA 2HW3A 3KLFA 1TKZA 4CF2A 3OVNA 4E7LA 1RDAA 1SL0A 4RW6A 3NFAA 2PZSA 3ME9A 4FW2A 3M8SA 3LZJA 5FRMA 2YKMA 3OMCA 4RW7A 3ZSOA 2XY5A 3PMIA 4Q5WA 5CYQA 1NK7A 4DTJA 3D45A 2R57A 4FJMA 3OYKA 1RILA 3PO4A 1MHNA 4ID1A 2FBVA 4AHTA 3SYZA 2QKBA 4YNQA 1XHZA 1NK4A 5HRSA 4CCHA 4ELTA 2KZMA 3GOXA 3V1OA 4E19A 4DTUA 4Z02A 4KPYA 1B9FA 4PQUA 2PYJA 2EKOA 3ZSWA 3V9ZA 3ITHA 4CJ5A 3SUOA 4N76A 4DU4A 3OYGA 4H8KA 2ZE2A 4CEFA 4KHNA 4FL6A 2KFZA 1WAJA 1N6QA 1HNVA 1U48A 3D0PA 4F8RA 3MEAA 4IUPA 4CJPA 3NDKA 3NCIA 3SUQA 3ALYA 5IAYA 3FLGA 3VQ6A 5I42A 3DM2A 4DSKA 2YNHA 3KLGA 4KREA 5IN1A 2ETJA 3QKJA 1U47A 4BWJA 1B9DA 4CFCA 1HJRA 3LPUA 5C24A 3DB4A 1UA1A 1BQMA 2M16A 1K6YA 2XRIA 4CF8A 4LH5A 5J2NA 3H08A 1OI1A 3EY1A 2RHYA 2RJCA 4FJIA 4RG8A 3HK2A 1EX4A 2Z1HA 3AVKA 1RNHA 1T03A 3E9FA 1RT4A 3V9WA 3V4IA 3DB3A 3OYJA 2G8VA 3QLHA 1TAUA 1YT3A 1KLNA 5HRPA 4Y1DA 3WNHA 4EP5A 4FLXA 1KVCA 2EQKA 3H6ZA 4IUUA 2NLUA 2JZ2A 1VSFA 2LSNA 3P1GA 3ZT3A 1WAFA 3NE6A 4C8OA 3MEWA 4CRIA 2BDPA 3F73A 1HYSA 1KRPA 2RPIA 4GY5A 4DTMA 5JS1A 2FBXA 3DLHA 1TGOA 2PYLA 4KTQA 4OJRA 2DTUA 3L3VA 3DOKA 3LGFA 4FCYA 1C1BA 1VRTA 4PLIA 4B08A 1L5UA 1D9DA 4EZ6A 1BHLA 4NCGA 2QQSA 1KVAA 3O8VA 3L2UA 3ZSXA 1J54A 4E89A 1VSMA 3P8HA 4CGDA 1U49A 1F21A 2WOMA 4O55A 3HO1A 5SWMA 2L3RA 4H4MA 2HNZA 4CF1A 1S6QA 2BANA 4C8NA 1T05A 1RI0A 1DTQA 4IBNA 4Y1CA 3AVFA 3IS9A 1WSFA 1RBRA 1S1UA 1N27A 1WLJA 4QQGA 4CECA 4CFBA 3KK2A 4FJXA 3O4NA 3ZSYA 3F9KA 1C6VA 2YKNA 3E01A 4AHVA 1NKEA 2P5OA 4IUQA 3ZSQA 4W5QA 2GV9A 1T8EA 5D6WA 2O4XB 1RBUA 3KKSA 1OZ2A 1IKVA 2K3XA 4GW6A 5KI6A 4CEZA 3O3GA 2RHIA 4C5GA 4FZZA 4PL6A 4OVLA 2VG6A 1EKEA 1Z25A 3K58A 4CJLA 1HYZA 4BDYA 4LY7A 3LALA 4FVMA 4F2RA
chains in the Genus database with same CATH superfamily
1R8OB 1ZGJA 1X9SA 3BJ6A 1YW7A 2NOLA 2XRNA 3TTCA 2YUOA 2G8WA 4DLEA 1ZSZC 3HIFA 3EQLF 4BE1A 2XY8A 2V7FA 1W7PB 2O8CB 1ATNA 2RHZA 1C0TA 4CJEA 2F48A 1K9MR 5L3EA 2DYSH 4DLGA 2X4WA 2W24A 2QQAA 4CDGA 5GAOq 3HSCA 3MXJA 2FSKA 4E9FA 3HSTB 1UE9A 3SHWA 3F72A 4FK2A 5GAHP 3LX7A 4E3SA 2LY2A 2MCNA 5AYFA 2CZ7B 3N4MA 3X20B 3CMEI 4DTPA 1H9TA 4CJSA 5FFXA 3L2RA 2OFKA 4CJ3A 4YTLA 1S9EA 4DFKA 1ASVA 2I8DA 2Y0SA 2OYQA 1ON2A 3LANA 2B4JA 4PFOA 1OULA 1DGKN 3F6OA 3HVTA 4X64K 4F7UA 4CE9A 1YP5A 4NUBA 3CCLA 4B9WA 4OF1A 1IZ6A 2FEZA 1LWCA 1H3HA 4I2OA 1NK0A 4BY9C 2PBDA 2QTVA 4DS5A 2EA4A 2HZTA 2HS5A 2XIDA 3SCXA 4KTZA 2OU2A 2ZWHA 3QWYA 5LJ3e 2RDPA 3GTKJ 2JUGA 2PTKA 4Q47A 2CH6A 1UG1A 3RR6A 2KDSA 2Q0OA 4DTOA 1D1AA 1U9OA 3AVBA 2KT0A 3FR0A 3H5AA 1PKSA 1XDSA 3MP1A 3K0SA 2K4JA 4A57A 3E6DA 4JI1K 1FT9A 2KDOA 3T8TA 4NYFA 2VGMA 1J3TA 3JR9A 5CJ9A 5IT3A 1QQMA 2D5RA 4M7DE 3GNFB 4IHTA 3P38A 1N6AA 3RKXA 3RRHA 4DYRA 3DBHB 4DIQA 4DQIA 4JRPA 2DJIA 3VS6A 2CP0A 2VYPA 2I0NA 3PIOA 3WTVC 1K9MC 2XGEA 3PY8A 5L3GA 4OB1B 1KQ9A 5LJ5g 3HOUJ 2C0OA 3O08A 2CUJA 3BTJA 3ZLJA 5LJVA 2R5MA 4UB8C 5DM7F 1QHAA 3FDRA 1RTHA 3O8HA 2QQ9A 1ZLMA 1IGNA 2KPMA 1VAZA 4L59A 3SUNA 3UR3C 4PKHA 1JLQA 5L3FA 2ACJA 3DLMA 2ZNYA 2KYMA 4NZGA 1UB9A 3LZIA 1VQ9A 2FZCB 3HBTA 2M51A 1KLMA 4LDXA 1OVYA 1JL1A 2O01E 1NJIO 3WHCA 1KG1A 2KLOA 3CQ8A 2LCCA 8AT1B 5A2QE 1NWKA 2HD0A 5LJ5f 3SBTA 2DYRH 4OB0B 4B3TK 4Z89A 4RW9A 4FT4A 4BE0A 3DBRB 4HW0A 2IGNA 5TISC 2TDXA 3CFPA 2LK2A 1WSHA 1SD5A 1OCZH 3GTGJ 1XJWB 2A08A 2Q3SA 3S3NA 1KD1C 2D0AA 1S72Q 4N9HA 3M7GA 2YX4A 2JQ7A 4CEDA 2RQWA 5M9OA 2BEOA 1Q8IA 2V9PA 2L4MA 3RMCA 4CF9A 1YIJA 2R5YA 3IKTA 3AY9A 3LP0A 1IDZA 3CFOA 5FFZA 1VQ8I 3BUZB 4OPAA 1ZR4A 4IQJA 2HCKA 3HXMA 1DGWY 3EGXB 1JL2A 3ONQA 2BIVA 1NBWA 3AO4A 3TI0A 2CSQA 4OLAA 3ECHA 3B6CA 2X6WA 3IH2A 3PO2J 2FF6A 1HKBA 4DSFA 2K9GA 2W84A 2BTFA 3H3UA 3BZ6A 2EHGA 1DP7P 5GAEJ 4EJWA 4I76A 4FPAA 4J2DA 1FP2A 4WX9A 3C95A 5KYUA 1U45A 5C4XJ 4LB5A 3J80E 4HWIA 5FROA 4CICA 2O8BA 3HHGA 4K41A 5CYVA 2PFBA 1PUEE 1JJ2S 3CZ6A 2VBWA 4NNJA 4F55A 2FSNA 1XGNA 2YV0X 2PLYA 3K2ZA 2RK1A 3DTKA 4AILC 3O5ZA 3QDFA 6PAXA 4A2BA 2KRHA 2L9RA 3THKA 2RN2A 3VS0A 4KGXB 2EBIA 3HOZJ 4C92D 5GANf 4BRCA 3KK7A 4HHTA 1OFCX 2R0QC 1HQEA 3E1YA 5JLHA 3DLGA 4PFPA 4PJNA 4E7LA 2L0KA 3K2AA 2FXUA 3I3LA 5AQLA 4WCEL 1GLJO 1K0XA 3CQTA 2J5OA 3FBIB 4M72A 1I0CA 2K27A 1KJWA 4FJMA 1MHNA 4A12A 4EW0A 3HKZA 5M3MJ 4ELTA 4CUGA 2HL3A 1NLPC 1V4RA 5CQGA 2EKOA 3H5NA 1M3BA 3EPZA 4DU4A 1JKRC 2JRMA 2MW8A 1TNSA 1KQ8A 3HRGA 1U48A 4IUPA 5I42A 4DA4A 3JRIA 3KX2A 1RRQA 1UA1A 4UNFA 4L6V5 1FZPB 1RNHA 2OTJI 3E9FA 4C30A 3OBWA 4J8FA 1MPGA 2CGHA 1RRJA 2GOXB 2JZ2A 3NVKA 3S6IA 4A3LJ 4B43A 2K3BA 3NGPA 2FBXA 1FP1D 2XVCA 2IA0A 2LDUA 1VRTA 1S3JA 4YDUA 2MAMA 1IGUA 5KYNA 4E89A 1S29A 4YELA 3M5AA 3MCPA 4IBNA 4DB3A 1WXUA 3AVFA 1ATSA 2CQXA 2A40A 4P5NA 2NOHA 2E7XA 2WSFE 2WC2A 5EJCA 1YIJT 3F9KA 1JEGA 4IUQA 2A0FB 5IT9Z 3QO3A 5CHIA 4C5GA 4PL6A 3H9NA 4LY7A 3U2RA 2D9TA 3RKYA 3QP5A 2CW8A 2DMOA 2JNGA 1MW7A 3ZEUA 2I5WA 1GL5A 2KMTA 1ESVA 2RI3A 3AL0C 4ENKA 3RMAA 3TSWA 4C5HA 1B72A 5IHNA 4J2EA 3EH2A 1QU3A 3M8RA 3WNGA 2RQUA 2YUNA 4RTXA 2DPDA 2LY9A 1RDUA 4LJZF 2DNUA 3M53A 1KC8C 2XASA 3QMLA 2XPUA 2QEXN 2VJ4A 2QYOA 4IIOA 4MDBA 1TT0A 3HBLA 3D5LA 3O4WA 4BQZA 3DKYA 3HSFA 3OA6A 2YU9J 1TW3A 1WJQA 2YUQA 1OJLA 3SV3A 4FXDA 5SZTA 4LOCA 2IIRA 4BRFA 4CCJA 2DLLA 4LFBK 3K4JA 2AIRB 4LUEA 4MEYF 9ATCB 3GBGA 3QWLA 1VQPA 1REPC 3I59A 5K7HA 3D4VA 3LSRA 2K3YA 1OCTC 1RUWA 1YJNI 4GGGA 1TWCJ 4HVJA 2G8UA 1IN5A 4Y0WA 4ZDOA 2KK4A 5DLQE 4MDAA 2CT4A 2P9SB 4HUGA 1BIAA 4MZMA 2RREA 5CYMA 1VQ5Q 2H3EB 4ESFA 3OW2M 3AGRA 1ZA1B 3QIOA 4IFYA 1I1SA 1J7KA 4DOWA 1NNEA 1I3QJ 2IA1A 3SPYA 3EYYA 3TW7A 3CCSN 2KTQA 5AQNA 2VQCA 3HEFA 1OPLA 3R8EA 2MK5A 1MSFC 1H641 2PNIA 2WBMA 1KQSP 2BE2A 1USSA 3K9KA 2DT7B 1MUZA 1SQKA 4JN4A 2HHHK 4HV5A 4V2GA 4OINF 4IF4A 3A1YA 4KFBA 4CK1A 4FLUA 5GANe 3TMOA 3TOAA 2A42A 3KP3A 1JLBA 2AQFA 1GBQA 2L02A 1S72T 1BQNA 2OF7A 1TK0A 4DHYA 4LIVA 1Z26A 2VQGA 3SFMA 1ATRA 2LNBA 1XMXA 6AT1B 3IAYA 1Y39A 2V8KA 3HOSA 4M7AA 1FC3A 2MD5A 3G1MA 2Z5UA 3OSFA 1M3AA 1FY7A 4L0ZB 2FA5A 1RKTA 3P4IA 1J9AA 4RM2A 4BNCA 2CRGA 1KD1O 1T6DA 3CC7Q 4UV8A 3PNTA 3EUHC 3K4NA 1J9IA 3H1VX 2LKSA 2XI9A 4OMMA 2A07F 3O1BA 3U9ZA 2HDCA 3OYHA 2JG6A 2JPSA 1FW6A 3LSGA 4K11A 1QQOA 1C6VX 1WQWA 1T6CA 2L4AA 5ICFA 5IYDJ 1YJNN 2D0NA 4EMKC 1S72I 3VF4A 4MIMA 4G9ZA 1VQ6N 3DYAA 2K2MA 1NJWA 2RHKA 3JCMW 3QXEB 2VBYA 4B1UB 4I2PA 3IMXA 4KH4A 1GLCG 1TWGJ 2HHTA 4Y33A 3FEOA 3VEWA 3OSGA 3TP3A 1JU5C 2HOTA 2QQRA 5BPIA 3O6BB 4AC0A 2EIFA 3S1MJ 4PJMA 2AZVA 3HZJA 5F0FA 3JRBA 1AWXA 1NTCA 4LF8K 3CCVQ 3KWGA 3GDQA 3MK6A 3L42A 4BRAA 3H0IA 4I01A 1B1BA 1ZBXA 3NMZC 1VQ4I 1VQ7T 1TQPA 2UXDK 1ZG3A 3ABLH 1X2NA 4HEA2 3U1KA 1C1CA 1KO9A 1VQ4T 2JTEA 3O6WA 5HK0A 2UUZA 2RHXA 2P4TA 1R49A 4M3UA 2LKPA 4N56A 4CZGA 2CFOA 2XDDA 4CGJA 2P9LA 3NGYA 4Y3OA 4EA5A 1MD0A 1Q7YR 1LWVA 4JZ4A 1W0UA 3LDOA 2OZSA 4XRSG 4ZN1A 5DM7L 3OR1C 3LFUA 2R5ZB 1PRMC 5CO7A 2V1UA 3VYUB 4FW2A 3M8SA 3GBQA 1YIJQ 3MWMA 2F5CA 1K73O 1HKTA 4PKGA 2ZZDA 3ZEUB 3CCUT 3GOXA 3G1OA 1BA5A 3SJMA 3RESA 1VQNN 1JCFA 3RNJA 5HS9A 1SD6A 3H45C 1OCPA 1G3SA 1WHGA 4LDUA 1NHAA 2YNHA 4PSXA 3SDZA 2Q0RA 4BQQA 1WBBA 1EX4A 3S2WA 3CUQC 3WNHA 5EEGA 2O5RA 1R1UA 2BZTA 3GOIA 3EG9B 2HDAA 1YJNQ 4K43A 3F73A 2RC4A 4KTQA 2YHYA 3DOKA 4F7UG 3HTVA 1TTYA 4PLIA 3TKYA 1YXQA 1HNWK 1FBQA 4LDYA 2NNYA 4YIFA 2H6CA 2F5EA 4CGDA 5EZHA 1U49A 5M3FJ 2Z9OA 1T05A 1Q82C 2HNZA 2W6LA 4YFNF 3FB9A 3FGUA 3QFUA 1P92A 4CYCB 2HEOA 4EJYA 2QKMB 4QT7A 2BTTA 1WX6A 5D6WA 1RLQC 1BWFO 5DM6F 1G2BA 4H5VA 1VQ8T 4M77E 5AQHA 2D0PA 4P9UA 1N77A 4HV6A 3VWBA 4LG0B 2CG4A 3MCAB 2Y9ZA 3NBPA 1MWMA 4M7AD 1SFOJ 1UWBA 2ECCA 4NLBA 3HHHA 2H8RA 1ZRCA 2ASOA 1WSIA 2COWA 3ZQLA 2CW0F 3S2HJ 3I0SA 4I2QA 1RI9A 2NXNB 4M3BA 1J5EK 1RTDA 3UKUA 5JLWA 1HNIA 3P8DA 1AA7A 3OJUA 4QPQA 2M30A 2W1OA 2NRZA 4B9LA 2DA4A 2JN0A 1ZBSA 4B3OA 2LCLA 1MIJA 1SFEA 3LM9A 2GQIA 2FQ4A 4UNOA 1YITQ 1VQMA 5J40A 3X28B 3BJOA 3S3OA 1QCOA 5GTHC 1FXXA 1Q95G 2GUPA 3JSCA 2EYWA 5D4RA 2RD1A 3P5JA 4Z4FA 4I0AA 2M7BA 3C6TA 3QODA 2J6FA 2E6MA 3H92A 2M8EA 2ESNA 3MKWB 1AWCA 2RQTA 2CH0A 4KI6A 3BY6A 3AL0B 1AOJA 5GAOm 1ENHA 2KZZA 2CGPA 4CZHA 3M8EA 1VQNQ 1YTUA 4M7AB 5LJ3j 2PJRB 1XGSA 3ZRGA 2G0EA 1Q82R 3QBWA 3QBXA 3LSPA 3CCRQ 1YHQI 1O3SA 1TV6A 4ZYGA 3JB9G 4IUVA 1M1KU 4M7XA 2Y75A 2ZXIA 1BOAA 4HDUA 4CJRA 1U6GA 1FTTA 4H4KC 3WODF 3FHGA 1WGXA 1UHWA 3FF5A 4XKVA 1QCNA 2QGGA 3BZKA 1DIZA 4XSXF 3FIWA 1LQ1A 2BBYA 3C4SA 1XTDA 3HT3A 4EEFG 3I4MJ 1Q81U 4AG2C 2NOBA 4CZIA 2WAFA 4LG3A 4B09A 2JUCA 1R9TJ 4IJNA 1IN7A 4KHQA 4LD9K 4KHYA 4PJ0C 2EYXA 2ASPA 4FASD 3EYIA 2O8DB 4IHXA 3THVA 1JXSA 1U06A 5FPNA 3MPUB 1OYXA 4M78B 3WXJA 4M78C 2FBYA 4IXAA 3CXCS 2G6FX 1TVRA 3PQJA 3I64A 1GXIE 3VU3C 2WTUA 3WNFA 3QICA 3DRRA 1Z9CA 2IS6A 4X65K 3NHGA 4LF7K 1XWLA 3QWXX 4DSJA 2DXTA 1KYZA 1YI2I 1TG0A 5ERIA 2HNHA 2IDOA 3MZ8A 3FHFA 4HVUA 2FO0A 2ATQA 2QVOA 4F91B 2XDPA 4HVWA 1K8AU 2OFIA 1W2BP 2OANA 1KQJA 2PMZA 5KYXA 1W5TA 2HOSA 3FBNB 3FZVA 1KQSM 1KEAA 3I0TA 3VS1A 2IPQX 3MFKA 1S1WA 1O75A 4XTXA 2B5JA 3JAMZ 1BU1A 3FFIA 2LNVA 3VS4A 2QA4T 1X9WA 4KB1A 1LWFA 1KC8U 4CHYA 4D5FA 1NOZA 3F8BA 5GINA 3RPQA 4C92E 4F7ZA 1VQ8Q 2Z1IA 1T98A 4UV9A 1MZBA 4A53A 1TKDA 4ISFA 1ETXA 5FLXE 1LKXA 1BGXT 5F08A 2DK3A 1RT7A 4IHYA 4CZMA 2FD5A 4NDLA 3LDPA 4A3EJ 5LJ3h 3QEPA 1HBXG 3LMMA 5KE2A 5CR4A 1Q82O 4M9SA 2AKKA 3R2XC 3QJ6A 2EWSA 4CCNA 4MO5A 2KE9A 3TDUC 1VQ5T 3QIIA 1ONVA 4JJCA 5D8KB 4AF1A 4NYNA 4B3SK 1XB4A 3VEYA 5JHFA 2AA4A 4WFNL 3ABKH 4CIGA 4KIBA 1Y8RB 1YJWI 3OTOK 1LFBA 5HL7L 3KD5E 1OH6A 1R0BG 3CC7A 2HBPA 5KQ8A 1VQ6I 1SRMA 3PIPL 5C44J 4QSHA 1UUEA 1Q18A 4K0KK 3MEDA 3NGIA 4J2AA 5K14A 4A4KA 1X2KA 1Z9ZA 4DMNA 4FVUA 5KHDA 5E79C 2ENMA 2K2VA 4QOZB 5M1NA 1Q86R 2FUG2 3V7RA 1WJSA 3BROA 1T8IA 5FKNA 1NG9A 2GXAA 4J83A 3I55N 2UUBK 4DR5K 1HW5A 3F10A 1M8VA 4PZJA 2E8AA 1D0ZA 2LRDA 1Y0UA 4F93B 4B44A 4AYBN 5LJ3d 5JS2A 1R23A 3BDDA 4C9YA 4MEXF 4DSEA 3KLOA 2C0IA 4OPJA 4WWCA 4TVRA 3CCSA 3OIOA 2E6LA 4EDUA 2NUPA 2MI6A 1RDAA 3JXUA 3GFJA 3CIPA 1B07A 3LZJA 3GF5A 2BOLA 2FEIA 2LJ3A 5J1UA 2XY5A 4BRMA 3WTTC 4BI3A 4OIQF 1VQMN 1M1GA 4CCHA 1YJNA 5D8LB 4E19A 3FISA 2QAZA 1F1BB 3V9ZA 3EZWA 2CREA 3PT9A 3M1CA 2ZE2A 3Q3SA 4IX7A 2D1HA 2WADA 5AQYA 3BQZA 3DM2A 2P9PA 3O8MA 4BXUA 1Y64A 1IRFA 5FPEA 4AFQC 4C8QB 1T95A 1XUPO 3JCMJ 1KU7A 2Q36A 4Y1DA 2EQKA 3A01A 2UV1A 4BR0A 2F2EA 2UXBK 3OW2S 2RPIA 2PYLA 2P9SA 1NM7A 3LGFA 1NGNA 1C1BA 4EZ6A 4PL7A 2CQKA 2GM4A 1MKMA 1VQPQ 4QS8A 1QWFA 3F0ZA 4DV1K 4E7ZA 4L9VA 1DGRM 2FZGB 5GMKi 5DUKA 4IZZA 1QVTA 3MX2A 1MNDA 3W6VA 2DMPA 3E9PA 2O4XB 2K3XA 4FZZA 2VJIA 2HAXA 3F8MA 1MDMB 2QLZA 3FZFA 2HHQA 2KXDA 2XB0X 1BKBA 5JVGL 5E18F 1UB4A 2E2IJ 3IV5A 2NOZA 3MD2A 3WNEA 3EUHA 5GAN3 1RABB 5E3OA 2CV2A 1TQMA 2DYBA 4XTYA 4C3IJ 1SEUA 2Y2ZA 3NRVA 1FYLA 4FYDA 5IHKA 1PUFB 2P9KB 4DFPA 3LA3A 2L0AA 3K59A 2NRHA 4ZDLA 1JT0A 4W5OA 2LOOA 4NBQA 2PJRA 1NLVA 4O4GA 2OTJA 4OFEA 1WEIA 2HB5A 3DWLA 3WEEA 4F14A 3N5NX 3LWHA 4J9HA 4WQ4A 1R4MB 1O3QA 5HRNA 3O3HA 1G59A 4MLHA 2QUFA 3LFKA 4XLHA 3KHYA 1GDTA 2FJ1A 1RDDA 4M7DA 1X43A 2NUTA 1SEMA 2UXCK 3LQQA 3U3GA 3DXKA 4DR7K 2CP5A 1Y97A 1YVUA 3TR8A 3W3DA 2OTJQ 2ABLA 2UXXA 4XQFA 4DU3A 3DAWA 4Y4RA 1SG5A 3V42A 2MWPA 1VQ6Q 5GMKl 1NJIR 2BKDN 3LSKA 2XROA 3AO3A 3CJ7A 4F3QA 2OAUA 1Y0NA 4AM6A 3RKQA 5CQXA 4UVCA 1TC3C 2HHXA 5HS7A 1NGIA 1I5LA 3X24B 2MLGA 2PBIA 2H1KA 2JGUA 3G2BA 4JOMA 2YCHA 2VONA 2VWFA 5M5XJ 3EFOB 4WF9L 4FWOA 2JA6J 4Q5SF 1GOBA 2BHZA 3CERA 3OMGA 3A5MC 4AFZC 4W97A 4MZPA 5DMRA 3CJCA 5KCOA 4M6XA 2HZYA 4CC3A 4DGWB 4DV0K 1MBGA 4CFAA 1WLPB 3DXKB 1XQHA 3S1NJ 3F5TA 3HM8A 1WXTA 4ZC3A 1S1TA 2F9WA 4M3YA 4DYCA 3VRZA 5AIQA 2RV8A 3R6MA 3NH1A 3VTIA 2JT1A 3QJYA 3ER0A 4NOYA 4XOPA 3CW7A 4KT0E 5K7FA 5J1RA 3SMSA 2XICA 1YI2A 1QVFS 1BU6O 4OKJA 5BPNA 1D5AA 2HKOA 2WSEE 4ELYC 2PVOB 4KA4A 2W00A 5DY9A 1ZTRA 1LFUP 1SZ2A 1MJBA 4HG2A 5HLIA 3V9UA 2IGKA 5BOXA 2FPDA 1ZC6A 5E8GA 4JYAK 1GVJA 4XORA 2IS3A 1TP4A 2XSDC 4Z4GA 2EYYA 3CUOA 3IAM2 1LPLA 1XNQK 3I55A 1YAGA 3HJFA 3FXRA 2VKNA 1D5YA 1ULYA 2QDLA 1D0XA 5DTDA 2CH4W 1VQ5N 5LGTA 3DPTA 2DFHA 1N33K 2VQFK 1BW5A 2G8IA 1YBYA 2OTLI 2O88A 4LH4A 3EFSA 1VSLA 4EV0A 3GLXA 1JXOA 4QLCU 3JCMP 3CCEN 1VRUA 1OZ3A 1ZREA 4CERA 5AZJA 1X19A 2E1HA 4JRIA 5AZIB 5M5WJ 4A4HA 1ORNA 2Y48A 3TSZA 4OMYA 5HP1A 3VFZA 3HL2A 1WZOA 4J2BA 3D7SB 5HS8A 1ZUKA 2JS2A 4CJUA 2KW4A 1T6SA 3CLQA 2A6TA 5LHHA 3G4SI 2NOFA 1S6LA 2OQRA 4OMPA 3SV4A 4M77D 4JLGA 4DV5K 4C1NI 4ATOA 4P1WA 3WHBA 2C06A 2BE7D 2VYTA 4C92C 3OL3A 1P8ZA 4YFUA 5AQSA 3CHWA 2G3RA 3VGKA 4BGAA 2IRFG 1T3SA 5HK3A 5EY4A 3JRGA 1Q81R 3H3NO 3PMTA 3S6WA 1G4DA 2VXFA 4RTTA 1YE9A 1XQSC 3W0LA 3T3FA 1IXCA 4XTZA 5KH6A 3OJSA 1IN8A 4C92B 2EPDA 4JX5A 5F1RA 5FB2A 3DLLA 4XRSA 2W85A 3CPWA 1LVAA 3A01B 2GA2A 3WTZA 2RN7A 2V26A 1K9AA 5FLXK 2RNJA 2VJ5A 4IEIA 4E7IA 1A04A 2LQ8A 1EETA 4IHSA 1R5HA 3JTGA 2DD4A 1X3NA 2P5GA 2XKPA 4LD6A 5L3CA 5L3DA 4KIFA 3ISPA 4IDHA 4GNIA 4CJQA 1HQCA 1X3WB 3DXMA 2NLXA 2P5LC 1N8RC 1JT6A 5AQRA 4ILGB 3KXTA 2ID6A 3QZ9B 2BUPA 4CF2A 1FIAA 4CCMA 2PZSA 2QQBA 4CI0C 3R0AA 1WJBA 2EKHA 2RM4A 4C23A 1XMQK 1SMYF 4RB3C 3V1OA 3ZQGA 4C92A 3ITHA 4NXNK 5JVHL 2KFZA 1WAJA 4FYXB 2F2VA 4X1EA 5AQXA 4DSKA 1HXDA 3DB4A 4EMSA 3H08A 5M1QA 2Y90A 1VQMQ 4JKGB 1FYKA 4H0TB 4IOAL 4XLCA 2CU7A 5F0XA 3UE5A 4FLXA 4QCLA 1QQIA 2GAUA 2X1DA 1TLHB 1L5UA 1QPIA 1G3TA 1D9DA 3WTYC 1BHLA 4DR2K 2FQ3A 3BW1A 4F92B 3G7ZA 1S6QA 3CDHA 1RI0A 4RAYA 3KK2A 4M75C 2GXBA 1FX7A 3JB9D 1POGA 5EVZA 1EKEA 3K58A 1VQLQ 2EV6A 3HZ6A 4IG0A 5KGXA 1NGDA 2X4XA 2WV0A 2R7UA 1WEGA 3MKDA 3RMQA 2MBFA 3CC7N 3ZT4A 5E3LA 1YFNA 1MMAA 2G7HA 1RBVA 4XH4A 1M1KO 5J6XA 3AGKA 4A4FA 3AVAA 3JYTA 4IHVA 4LC9B 1ZRDA 1JJ2A 4XMYA 2DFIA 4DTRA 3HHTB 4BWMA 5MLCQ 5ILSA 3WE2A 3VEOA 3CG7A 1DDNA 2P5VA 1S5JA 2RE2A 1QVFA 2HDWA 2OPSA 4C3JJ 4JRKA 2X9HA 2E3IA 1C0UA 2F6CA 2VT2A 4NL3A 3KUFA 3CWSA 2H56A 2IVPA 1N3AA 2IVNA 1Q81C 1IRXA 2NVTJ 3FZMA 5M1OA 5GAN4 4BR9A 4ICLA 4DSIA 1SHGA 3DLRA 1UG0A 3L4QA 1TL3A 1U5TA 1VQNI 2YSQA 5IXBA 2XB5A 1BM9A 2NZTA 2M1BA 3K1PA 1G83A 2YUSA 3FXQA 1V55H 4RCBA 1TXQA 4CD1A 3PIPF 1HRHA 3RRGA 4NCBA 5GAGJ 1R00A 1NMDA 4UQGA 3T69A 4ITVA 3TO6A 3CP2A 2OJED 3FKIJ 1X2QA 1KAYA 4M77B 5CLSA 4KKOA 3CCMT 5KN9A 1PU7A 3VA3A 1TK5A 4RB2C 4JI0K 3LGLA 4JUVA 4JKDA 2Y9YA 4M3EA 3M4GA 3CPWS 1QTMA 2LT4A 1ZK8A 1F43A 1HKGA 2DQLA 1VYUA 3OR2C 2IIMA 1GT0C 4FYVB 3T1AA 1JKPC 1WVRA 3FSPA 4B9MA 3K5NA 1FSHA 4JS5A 4J7FA 3LW5E 5LJ3f 1A5JA 4D9JA 4K42A 4QPOA 2Q31A 3Q7CA 1VHXA 3CCLI 3LAMA 3X25B 1OCCH 2GIZA 1T2KA 1XX5A 4C8QE 4QVCA 2RMOA 3CCQN 3OYLA 1SRLA 1N36K 5GAOp 1MJAA 5KYXB 1K79A 3D0SA 1LEBA 4C92F 5LGUA 1NJXA 2KAFA 3NPFA 1LNWA 2FC0A 3WVEB 2KQRA 2QEXI 3VQ5A 3WU1B 5TJJA 3JCMh 3VJPA 3AVCA 4RWTA 3H6EA 1B72B 1B92A 3A8YA 2DQRA 3UT1A 2Q2EB 3VYTB 2YHTA 1IV0A 4KTWA 3AG1H 2CUBA 3NF9A 1WHMA 4D5CA 5HLHA 1FOXA 2LRQA 5J26A 5E8IA 3R6OA 2BV6A 4B1YB 4MQ9F 2E3HA 4C2TA 3IP4B 5KNLA 4KMUX 2P0PA 5DV5A 3NTIA 1X3MA 3RUXA 3JRZA 5GP9A 5CKFA 1KG6A 2ROTA 1CKBA 3AVGA 3D2FA 3A5LC 4AHRA 4XBFA 1TOVA 1OYYA 2DCEA 2HQXA 5EEHA 1OKRA 3VS7A 3VERA 3HOXJ 3K9JA 4RTFD 3A4CA 1BI3A 3BTIA 2D0BA 1Y1VJ 3TAMA 1P4XA 2CUEA 1X3ZB 5EEAA 3CCVI 1GLLO 1KGSA 1WSUA 1EZZB 3C7NB 3NGZA 5HODA 3CO6C 1RIOH 3T19A 1LAVA 2FOKA 3M3ZA 1VRLA 1WA7A 1YJWQ 3PVLA 1CXQA 1NK6A 2XC7A 1QCFA 2E41A 1JXBA 1YJWN 4P5OA 1QSYA 1H8KA 2LSOA 2LNHB 1HMVA 1I3AA 3SUPA 3U3YA 2BE9B 4CEEA 5FJ8J 2FBKA 5EF6A 4N5SA 4J9FA 3J7ZI 4GCVA 5FLXO 2ESWA 3QPLA 1K8AO 5KCMA 1HD3A 3HGYA 2EFQA 3J7YJ 4EHTA 4D7MA 4CZZA 2QXFA 2EGCA 4RBOA 4QQDA 3C2GA 4BUPA 1QZ6A 3S93A 3SAHA 4Z2YA 2DTIA 3V9XA 3L2ZA 4BG9A 2QWNA 1VQ9I 4Z6YA 2I5JA 1B8IA 5FKMA 5M1PA 2FG0A 1EV7A 3TO7A 2L5QA 1LB2A 3V81A 1SUQA 5D7UA 3GP8A 1G99A 1BK2A 4XAXB 4C8QF 3TQ7P 5GADJ 3GX4X 4CXFA 3MCZA 2R4GA 4A54A 2BZYA 3UKRA 2KI7A 2K4BA 2VL8A 5EGOB 3OSVA 2EV5A 2BGCA 1HNVA 5JHUA 3IH4A 4KREA 2A3SA 2PN6A 1UHMA 2F2XA 2XPWA 1VQ7Q 2RJCA 3CF5L 4IQ4A 5J8CA 3LL3A 3FHNA 1VQ8N 3H35A 5IY5H 4V19S 4FX4A 2KIFA 1JRIA 3W2VA 1UCRA 3QDKA 3CWUA 2ATCB 4KJZA 2O8EB 4XR6A 4FCYA 4J7IA 2KY9A 3L0QA 4B08A 4JJBA 1S22A 3SJHA 1EIFA 4MFDA 2QQSA 3L2UA 4KH0B 2DEUA 3G6EI 4RA2A 2A61A 1FTZA 2EJGA 2YS9A 2DA6A 4CECA 1SD7A 3NWSA 3VEZA 1NKEA 4XK8E 2NS7A 1W6XA 4A93J 2Z99A 3FIFA 4B3MK 1TW2A 1MGQA 1I81A 1MBKA 3BTLA 1HPZA 1Q1VA 4JQFA 3O1WA 2E2JJ 2W7NA 4CC7A 3L1PA 3OYMA 1SD4A 4XKWA 2KT1A 4JLHA 4CA0A 4UY8I 1M90U 1Z21A 4HXJA 3NFCA 1NE8A 1WNLA 3L00A 3JCUC 5JMVA 5A0DA 2HDDA 5BRHA 3CCQA 1RBTA 1Y96A 1M2VB 3OA9A 4I6ZA 4BRLA 3Q0VA 3SNNA 3K5LA 4HBLA 5C15A 2CO5A 2FNPA 4LLGF 2M0YA 2RB6A 3KBGA 3CC4I 1HSJA 4CCKA 3A0BC 1UGPB 4JKHA 3D5RC 4A5NA 1SPKA 1RL2A 4AVZA 4IG3A 1WKMA 4DU1A 1IG8A 2V1RA 3ABTA 1M3CA 2Q8KA 3ASMA 4BC4A 1XMKA 2YJFA 3NAUA 2ITGA 4AIHA 4FJGA 5AQFA 4ENNA 3RMSA 1B4AA 2EX3A 3SYTA 5CVIA 1LCKA 4ISGA 2H8HA 4CJVA 4PUOA 3EH1A 5HNHA 2EWNA 3CCMQ 2ETHA 2VJJA 4GYIA 1D4XA 2NOIA 4J9DA 3KEOA 4HX8A 3THYB 1LOJA 4B4CA 1VSEA 4DF4A 3N0UA 4IOCF 4A59A 4YRVA 4FT2A 5EXWA 2ABKA 3KLEA 1K1ZA 3NARA 2ISYA 5BREA 4DWIA 3WGHA 4CJKA 2F4VK 5DEQA 4PJOB 4PJOC 5FKOA 3THYA 4FLYA 5A0LA 3CCMN 3A0HC 1TL1A 3NH2A 4XU2A 5GMKm 2E1ZA 2VCPA 3LP3A 4DEXA 2RI5A 1TU0B 5GANj 2WB1N 3VW4A 2Y31A 3CF2A 3KYDB 2J06A 1VQ7I 2ZAEA 2DRMA 3VQAA 4CFDA 3PFYA 1UGVA 4ZYAA 4B22A 1ARKA 4CHQA 3ZSRA 5GAMh 1VQ4N 5E84A 4M4ZA 3OW2A 3L1AA 1QBJA 3VODA 1IO6A 3F22A 2QI2A 2F1LA 4AFSC 4DR6K 3NF6A 1PVEA 4II3A 4RGSA 4DTSA 3P9IA 3V7CA 1W7PA 4I6MB 2QEXA 2O8XA 3QPTA 4U87A 3SXYA 3CI5A 4XSZF 3QU6A 1FBUA 2JN6A 3FFKB 4OGEA 1EXQA 3KYLA 2EZIA 3BR5A 1WH5A 2XU8A 4DR3K 3I4NJ 2K5LA 2JWTA 5EGOA 1PCXA 1E6HA 1RTJA 1XG1A 4XH5A 2BXZA 2A68F 2EGEA 3DTIA 3J81O 4KGZB 1NJIC 2CZ6B 4L0YB 3AVNA 1NKUA 4DTNA 3WXIA 3M0UA 5B1BH 1VQPN 1R1TA 1N5ZA 5GANh 2YX7A 4VUBA 3JAMO 1ZBFA 3ID8A 4B47A 3K57A 2COYA 2DFEA 3RZOJ 2HHSA 2NUZA 3L9FA 5LHIA 4E7SA 4AH9A 3CC2I 4E2FB 5DM7R 1NJZA 1HDPA 4RTZA 4DZJA 4HQMA 4PNOA 3RVCA 5HBMA 4KITB 3VB2A 1KD1U 4DQRA 1V4SA 3H0FA 5HLGA 2HKQB 1NGJA 1TKXA 2HOEA 5GAMj 3EGDB 4WCIA 3M3YJ 4Y92A 3K5MA 1V76A 3FXUA 1X3UA 3OW2P 4FJNA 1KFDA 1XMOK 5DUIA 1PUFA 4H0YB 3H46O 1MU2A 5GMKj 2X48A 2HYFA 4DKWA 4R79A 2E4LA 4F2SA 3QIPA 3VQQA 4O3MA 3GFIA 1FWZA 2XO7A 2CP3A 3WXLA 2A6HF 4CZJA 1IN4A 5BR8K 1Y07A 3RSEA 4HCZA 4II1A 4ETSA 5J1YA 1WJ5A 1GOAA 2E2HJ 2ZBKA 3ZT2A 2OZMA 1BA1A 1QNTA 1RNLA 4MTDA 3FLCO 4JI4K 4FJ9A 1SV5A 2O8KA 2DL5A 3HSRA 5HVQC 4IRGA 1ACIA 3IG1A 5FKKA 4RDUA 3O4QA 1L3VA 2FSWA 3R1XA 3OMYA 2P7CB 4PDKA 4HNUA 1IB8A 2KT8A 1TUCA 1Y71A 3LAKA 3M8PA 2EJRA 3KLFA 1SC7A 2X3XD 2YU3A 3NFAA 1XOVA 5FRMA 1I5OB 4QS9A 3VF2A 5ECAA 1EO1A 3OYKA 2DA7A 3SYZA 3QPHA 3SAGA 2QCOA 2DL7A 2QWWA 2DA1A 2W4SA 4KH5A 3RBBB 1M3HA 2JUFA 1HOMA 3J7AP 4CYDA 2PAVA 4CJPA 1BBZA 1U47A 4L9NA 1MGTA 3I0WA 2IVOA 3TTFA 4J6XA 3SWNB 2ESHA 2Z33A 1A35A 2RPNA 4J5YA 1T03A 3PGGA 3QLHA 1NEBA 1TT5B 3N4QA 3K1MA 2LSNA 1WCMJ 4XLPF 4JI6K 2CQ7A 2YWWA 1ETVA 5BPMA 2CS7A 4M6YA 2HVRA 2R93J 1ZQ1A 2E5ZA 2W10A 4CH7A 2BYVE 3DEEA 2I7PA 2P9UB 2O61A 1BJZA 3L2CA 1T44A 3O4NA 4C8QD 3M0PA 4YPRA 3JB9I 3ZSQA 1T8EA 1K78B 1RBUA 2EIMH 2V4JC 1YFHA 4JHDA 1GXQA 1XSVA 4P96A 1RAFB 1SVLA 2L9NA 3GTLJ 3G3ZA 3U8XA 3FXLA 3CCJT 1V4TA 1E3HA 3CCLQ 2DI3A 1JJ8C 4O8KA 3ATVA 1GCQC 2F5KA 3C1DA 4OO1J 4LIUA 4I6MA 3I8BA 4CYCA 3SQ1A 2AXTC 4U7DA 1YIJN 1CSKA 3LWIA 4M7DF 1YRNA 1XNIA 4ELZC 2PU9B 1LV5A 3ELKA 2EQUA 2DMQA 2XPVA 4LB6B 5GAGP 1QLYA 2KZVA 4CW7B 5KPTA 3SQ0A 2LREA 3OBYA 3C6AA 3C0CA 4LLLA 1P2FA 4XONA 2YNFA 3DF8A 1UOCA 3NNQA 1OEBA 3K5OA 3KLNA 1ITYA 3LL7A 1KTQA 2ID3A 1MBEA 2BZXA 4LF9K 2RQRA 1LW2A 4EHUA 3CJTB 1ORKA 1BL0A 2F2WA 4LITA 4OMFB 3K4KA 2GF7A 3AG3H 3PX4A 3UKRB 4JAXA 5DK5A 1BA0A 1LWWA 4BQLA 4C8QG 4W5TA 3GCMA 4AIKA 3IUOA 4XLNF 2NRXA 2ZMEB 3WQTA 2A69F 3LDSA 4XOTA 3H5RA 1FSEA 1XD7A 1FKOA 1X1DA 4ORZA 3VYHB 1WGSA 4QVZA 3OL4A 1SF9A 2Q0UA 2ZSHB 1IXSB 3F3XA 2QDYB 4DQ8A 4KISA 3JRAA 1NH3A 2ED1A 5C10A 1RZ4A 4E7JA 3VQ4A 1QVUA 1PWTA 4WCGA 3VSLA 2BGGA 3RKWA 3I55Q 3ERED 1LOTB 2Y30A 4CCLA 1HYVA 2L7MP 1R22A 2NVYJ 2E2QA 4AM7A 2RQVA 3CMAI 5TKWA 4E0DA 4PFZA 3GNGA 1LJOA 4ELVA 2DBKA 3SDGA 3GWZA 4C0DC 3CCEA 1OISA 3LCNA 1U78A 5C0MA 5IT9E 2JA7J 2CSOA 1FPQA 1SMTA 2XKOA 4OMLA 2GTDA 2P9NB 5KRTA 3HYIA 5AFUH 4R56A 1WQ2A 4V2FA 1V54H 3K70D 3C7JA 2O4GA 2RVCA 5DM6L 1YX5A 1FOWA 4WK8F 2ASMA 2A36A 4O5BA 4DBQA 1IG9A 4PGHA 2E5LK 3CDIA 2F96A 2O8DA 3RJPA 3ULDA 5CVVA 5GJWB 4JX4A 5J2PA 1M5Q1 2Y69H 3IKVA 1S8NA 2K5FA 2IT0A 2M2EA 1H0MA 2EINH 3ZT1A 4E1MA 3R0JA 2GLOA 3SDBA 3P7NA 1XHXA 1LJ9A 4U0VA 1WHLA 4M78D 2HVSA 1X6GA 3VPRA 2FYKA 5CR2A 3LAPA 1Y6IA 2QM1A 2L8DA 3SWNA 3VUZA 5KYYA 5DPKA 3BCAA 2HNYA 3H36A 2RI2A 2MIOA 1WOQA 1QA6A 2EA2A 2K3PA 2KZGA 2YXYA 4A4EA 4B9NA 1YOVB 2QWPA 2NOGA 1VSKA 4LFUA 1VQNT 1T3VA 1Z0XA 1O7FA 3CCQI 5IYBJ 5LJ5e 4RKUE 3FHZA 4PA1A 2CWEA 1MV3A 1Z9QA 1K73C 4IZ9A 2NVXJ 1DJ7B 1HCRA 1JO8A 2CV0A 3KTUA 2R7DA 1RDWX 2HNDA 4C8MA 2PEXA 1PSFA 2EYZA 3OYYA 3KFWX 1KG2A 1M1FA 2JVVA 2UXNA 3I56Q 4Y91A 2AHQA 4KT5C 3RMDA 4I9LA 1RT2A 3RPUA 2GCXA 5JVTA 2QKLB 2VG7A 3G25A 4G94A 5C4JJ 1JE8A 3I9V2 1R59O 1QQCA 1JXEA 3HJEA 3OH6A 2FX0A 1BC7C 3F8FA 2YHWA 3COAC 2Q1ZB 2F4MB 4A3DJ 5CZ1A 1B8IB 3MO8A 1WZ2A 3AFHA 3FMQA 1HSTA 1KU3A 2M02A 4Y7NJ 3D5SC 3E19A 5IT9O 1ILYA 2JMCA 1JQQA 4AIAA 1GBRA 3ZGKA 4ISEA 2Q2EA 4B8CA 2IVMA 2OZUA 4Z4EA 3VEXA 4RAGA 1UFFA 2M3AA 3A8LB 5BPLA 4AFUC 4IJAA 2LG4A 4UOBA 4IKFA 2M87A 1K4TA 2Y0SN 4ZH4F 4MFBA 1HJDA 2ELHA 4BHPA 4RW6A 5LL6Z 4YOXA 3X2QH 3CCJI 2KMUA 4Q5WA 5BRFA 2V7ZA 2P9UA 3PO4A 2V79A 4ID1A 2FBVA 2L9SA 4J9BA 4JKAA 3H1CA 4PQUA 2YT6A 3VS2A 1XN7A 1YJ9I 3LDNA 5KYWA 1SVMA 5GIPA 3ESWB 2CV1A 4M7AF 1LEAA 3FJPA 3ALYA 1NG2A 4NB5A 3CCYA 2XUBA 3BTCA 1VQLN 4CF8A 4LH5A 2DOEA 2ZPIB 2RHYA 5H6RA 2Z1HA 4BXXJ 2K9LA 2J4RA 1KLNA 3IAS2 3QEWA 4IUUA 2W82A 2IS1A 3ZT3A 2WC9A 3ZMZA 1ABOA 2VKEA 4UUSB 3GTPJ 1R0CB 2ZFWA 2K5CA 3GYHX 3CBMA 3T1YK 2IS2A 2DD5A 1QZEA 4KIGA 2DA9A 3A2KA 1S1UA 4XKCA 1WLJA 4QQGA 5AQPA 4FJXA 4J01A 3HOVJ 3KKSA 2IGOA 1IRZA 2E5KA 2RHIA 2ZCFB 3TANA 3LWMA 4B23A 4KHSA 2KQ2A 4C5EA 4ILHA 1UFMA 3PVQA 1V3FA 2KHOA 1Q86C 2B8AA 4QVDA 4FWNA 5DCFA 3HOWJ 2KR3A 1E0EA 3VQ8A 3T7ZA 2ZQBA 3J7AY 3THXA 1RBSA 3VA0A 4M41A 2NNWA 1IN6A 4OAYA 1K0SA 3ML6A 1SFXA 3TOBA 3ZETB 3L4IA 4B8AB 2VIXA 2BY2A 1GLFO 4DQPA 4LLNA 4AI4A 5CVRA 2EIKH 4IOXA 4YDUC 2R7OA 5FLMJ 1RKWA 2F5DA 1EQYA 4R0KA 4M3XA 4DOVA 1K78A 1I1JA 3BR1A 4IEEA 1LNXA 2X6XA 2IJLA 4FHTA 1VQKQ 4A0ZA 3BPVA 2HR3A 3ZMTA 1I8FA 5EDNA 1MUDA 4OIRF 3V4GA 1YTAA 2DPPB 3N97A 3HPHA 2FBIA 5FU6B 4DG1A 2EZLA 3CMEQ 4JJNK 4I7FA 4YOVA 2UUCK 4CC2A 3SQNA 4KV8A 3TAPA 1Q86U 2W40A 5JICA 1X27A 1W7PD 1UZCA 2IA2A 1GLDG 2P1JA 3CCJN 3QYBA 1M90C 1X6BA 1VK0A 2O4IA 3F2KA 3CCUQ 4FSXA 1KQSA 3WU0A 1IDYA 2H1LA 4F7UB 4ZGJB 2IGMA 3LP1A 1TZLA 3AVJA 4IVNA 2EIJH 4D0PA 2RK2A 1G2HA 4FJJA 1LVKA 4BQNA 3UF4A 1Q9YA 2HSTA 2XHKA 3AA5X 1Q81O 2Y0MA 5KTQA 2FRHA 4HX4A 1REVA 2D8JA 2CS3A 3KP4A 1QVPA 2E4HA 5E41A 3OYAA 1UA0A 4GXOA 1D3YA 3CYMA 2DT6A 1VFCA 4KYWA 4GKKK 1XSXA 1Z7UA 3CQXA 3BR3A 1M1KC 4A0YA 3KFVA 4QS7A 5GAMd 1VUBA 5J8FA 3ZQCA 3FK6A 2DFFA 3BT9A 3VDXA 3DRSA 1ZHIA 1SAZA 1GVDA 1D1CA 4JK7A 3IHUA 5E1XA 1S72N 2VBZA 1IKYA 4HT8A 3Q7BA 4S04A 2KYBA 3ID6A 3J80K 1KU9A 2OA8A 4PJOG 3CXCA 5EG2A 4A6DA 1NJIU 2YLBA 3CC4N 3VQDA 2J5PA 1MH3A 3M55A 1AU7A 4YY3K 1GCQA 2PQWA 3G4SA 1RFQA 2EB7A 1ZSZA 1RC9A 2H6BA 4BY6B 2GBZA 2VWKA 2D0CA 3VV0A 1NOYA 4CIEA 4RG2A 2FRWA 5B8HA 2DKGA 3JV3A 1QSLA 1JTXA 3OYNA 1VQ4A 1AEYA 3WG9A 2DXCA 2HMPA 3JRFA 2IC3A 4DUZK 1NK5A 1DQUA 1ZR2A 1U8RA 2EQIA 1E3OC 4BDZA 4S05A 4XQ3A 2QEXQ 4L3QA 2GIVA 3REAB 1DPUA 3G73A 5GAMe 3BZCA 5B5EC 3HTRA 4FU6A 1ODDA 1TSFA 1TH7A 5AN4A 2FMLA 5AQMA 3TSPA 1KC8R 3KEYA 4B1XB 4U0YA 2HXOA 1ZHFA 3T8RA 2YX6A 3SZ2A 1OH7A 4N9IA 2JVHA 1FJLA 4EW4A 1Z1DA 3J80Z 1APLC 5IOYA 1ASWA 3PLAA 2LP5A 2QKKA 4XTVA 1VQOT 1IZ1A 3H0GJ 2IXSA 1UJ0A 3A0IX 5GMKh 1W0HA 4BAYA 4M45A 3M0RA 4YOUA 4AI5A 1X75C 3PTAA 5AFUA 1T7PA 2P51A 2CQQA 3VOVA 3G71Q 4ZHRA 2NUPB 4H5RA 5GAOn 1NGGA 1DUXC 1LMZA 4FE7A 4FJKA 1NU0A 5J2MA 1M2VA 3HTUA 5AQVA 3F23A 2VXDA 2Z16A 2JHNA 4BJTA 4JKGA 1S1NA 3RTRA 1JXMA 3BY7A 3CCMA 4LN2A 1J53A 1RI7A 4LUDA 4LGWA 2W42A 5I3UA 4KUDK 2DYIA 1GXPA 4RGXA 3CLOA 3BF3A 2DF6A 1WJEA 3S1RJ 1RAIB 3JRHA 3UIQA 2CGLA 1OU8A 2P8TA 5E17F 1QSSA 3MDQA 2HBMA 3HP6A 1TKZA 3CCRI 1Z3YA 4AUXA 1W2BM 1X1BA 4NC8A 4JV5K 2O9VA 1JUPA 2YKMA 1JGSA 4BVPA 1UDLA 1NK7A 3HOTA 4OIOF 4H5WA 5ADXA 4AQYK 1SANA 4G7HF 4RAFA 4XNFA 2X0LA 3RSEB 4N76A 4ZYHA 3AHUA 2KRSA 4XICA 2VUMJ 4JKFA 4BRHA 3NCIA 1UECA 3VQ6A 3QKJA 2H94A 1BQMA 2M16A 1AWWA 1RT4A 3DB3A 1U1SA 1TBXA 2ZKZA 2VASA 3QHSA 5LRRA 2P0QA 2HYJA 3H9GA 2DTZA 2IP2A 4JI2K 1VSMA 1N39A 3KP5A 3AG2H 1YITA 2G9WA 2J6OA 3MN6A 1FYMA 2COZA 3CD6T 5TRDA 4ZNXA 1OPCA 2YKNA 1I6HJ 3I55T 1QVGS 2FRYA 4Z8AA 3DU5A 2F9TA 4XU1A 3SBGA 4PK4A 2BVLA 5KYWB 3I59B 4MHGA 2QW9A 4CJLA 1HYZA 3CP8A 1BDGA 1VQOA 3CBPA 2TRTA 3MN7A 3A2FA 4ELUA 4CHPA 1XMAA 3WXMB 4YOWA 4B3AA 2EQRA 4HCKA 3HSEA 1DPRA 1S6PA 1X6OA 5BRDA 4RAZA 2O4XA 3CC4Q 1QVFM 1DP3A 2DTRA 1BIZA 5AONA 2F5FA 3R4KA 2MOXA 4IO9L 1J09A 4OIPF 5IPAA 4FJ5A 3QEXA 1K9MO 1DU6A 4CCOA 4LF6K 3K1NA 1EBMA 1G3WA 2E1OA 4DS4A 3CCRT 2FPFA 2E5QA 3VQ7A 1YJ9A 4B1WB 1AWOA 4N4GA 2GOMA 2VQHA 3ZX2A 5KGWA 1S1VA 1BUPA 2ZM6K 4DQQA 3IH3A 2R5AA 2CMPA 5GAMf 2FZKB 3EEQA 3EO3A 1W70A 3PX6A 4V19K 3V1QA 5GADP 3HRSA 3OWTA 2QQ8A 2I7NA 3F0CA 2P9KA 2ADUA 3C18A 3PFIA 4DW6A 2PX9A 3I4PA 2L01A 1KSPA 2VC1A 3IWZA 3K69A 4C0ZA 3KLIA 3KNTA 1OV3A 2DIQA 1Q7YC 2AK5A 5LHGA 1OQYA 4BHBA 1S3XA 1IV8A 1K8AC 3HG9A 2R7ZJ 1HR0K 2QBYA 2BVMA 5LEJA 4FWKA 3OYBA 1JLFA 2ZGZA 1BIBA 1CKAA 2DL4A 2KKOA 2E12A 1LDKB 4BKXA 5D4SA 3OOUA 4LK1F 4D1QA 2R7VA 3MVPA 3BEXA 4FLZA 1MH4A 4FWLA 4FWPA 4G1QA 1NEGA 2XK0A 2KJBA 1HKQA 4MDWA 1XGOA 2L7FP 1TUDA 5AQTA 5ELZA 2LVMA 5H20A 4ZDPA 1C0FA 2F5VA 2O0YA 2ZPGB 4A3KJ 3L3UA 2DFUA 5LD2C 3I56A 1WHUA 3ASNH 4ABZA 4JPBW 3ZMVA 4C8KA 1R71A 3CJAA 4IEJA 5CKTA 3D2EA 1K76A 5HNFA 3MWPA 2E64A 1KFZA 1JJ2P 3KLHA 5C3EJ 1F1ZA 1O4XA 3GIBA 4M9ZA 2RO0A 5GAN8 2CP7A 3CM6A 4AIDA 1JUSA 2OCCH 1H89C 4YPHA 2JT4A 3ZCMA 4MTEA 1RR7A 3HL8A 1CZ9A 3REBB 1VSJA 1Z6TA 4JS4A 3M57A 1QVGA 3KVGA 3JRDA 2QSHX 1VQLA 2EVRA 2FF3B 3PQKA 3ASKA 5AQIA 4CC4B 4L5EA 4CJWA 5IH2A 1K73U 1U04A 4CZLA 2E35A 1B3QA 2X6YA 2V7YA 4HSRA 4FX0A 4PJOA 2O6GE 5CVJA 3OS2A 3U1DA 1JKHA 1MMNA 3MKLA 2WAQN 3LSJA 3CC2Q 3FRNA 2XHBA 2PQ8A 4JNEA 1YJ9T 2G7UA 2K9SA 4CEBA 1VQPI 3LDQA 3TL4X 4E1JA 1KHCA 1YI2N 2XSJC 2BXYA 3WQUA 2RJEA 5AR0A 3C65A 4K8XA 4FJ7A 2JZYA 3LLRA 1NGEA 2LBFB 3CPWM 1VA7A 2HTSA 2DJNA 3GBTA 5CZ2A 4ILJA 4JI8K 2XAQA 1YITI 1Z05A 2V75A 4CJ4A 2UWMA 2LMDA 3J7AO 1O57A 1ORPA 3UKGA 4EZ9A 4NL2A 5EG0A 3AO2A 3SFIA 2STTA 2VT3A 4G12A 3TDZC 2ZJQL 1B7TA 2CKKA 2R7TA 2R58A 3G4SN 2FMYA 4PKCC 2DDBA 3CMAQ 3VTHA 4AHUA 4UY8O 2WAQA 4IXCA 5A2QO 4WE1A 4IIMA 1XC3A 2DZ9A 1KVBA 2X9DA 1DEJA 2DTOA 1B9NA 3QOEA 1G8XA 3MMYB 1H3ZA 1YCYA 4EMKB 2NAZA 2GXGA 4XLEA 4L9TA 3QESA 2HMIA 1VSDA 5D6EA 4H5TA 3HUGA 3QYGB 3QERA 4ZZLA 1AWJA 4LFCK 3U21A 4V2SA 4F3TA 1YHQQ 3CMEN 2P5KA 4CEOA 3I33A 4I9QA 2ZFUA 2W0ZA 3CCJA 1ACMB 1VQ4Q 2D1KA 4EAHD 3FXJA 1W1WE 3LSTA 2HBKA 5FPDA 3TO9A 1T39A 3HI0A 1AZEA 2L89A 4JD2B 1IXRC 3HP9A 1RR8C 3DRPA 1YQMA 4BC5A 3EG3A 3TAFA 1BB9A 1RAEB 2HBLA 3OB9A 1Z67A 1HPMA 2V9VA 3L2WA 2VG5A 3RR7A 2GFUA 3G6ET 3HTSB 1VQLT 1PU6A 4DYQA 3E1SA 4P9FA 4R55A 4M74A 2HQ5A 2QWLA 5EX5A 3CJNA 1MUNA 4B21A 4E70A 3QZ5B 3V7SA 3S1QJ 4AMCA 2KRNA 4A3FJ 2AQEA 2DJQA 1UHCA 2OPTA 3ZQIA 3S2DJ 4NO7A 4CEFA 2DU9A 4M73A 4FL6A 1MDUB 1N6QA 3M1EA 3D0PA 5IAYA 3J7AF 1SHFA 1YWOA 5BS6A 1K6YA 4M78F 3CC4T 2ZB9A 1J6ZA 5TKYA 4HSBA 1P90A 2M5WA 1HNZK 3V9WA 4ENMA 1TAUA 1X4PA 5A2QZ 2M0CA 2DRKA 2NLUA 4EIAA 4XM3A 1KRPA 3M0QA 4IOCL 2HI3A 2Z1DA 2P81A 2COBA 1FEXA 5AJ3K 4LFAK 4NCGA 3KEQA 5M1FA 3S14J 1VQOQ 3W2WA 1VQLI 3HO1A 2MFZA 2BANA 1GCPA 1HJOA 3HPWA 3FXKA 3R60A 2LKXA 1VQ5I 2D2WA 3O8GA 3E01A 4W5QA 1P7IA 2KJCA 3O3GA 2DZCA 1A31A 2O31A 3WXKA 4LNPA 1D8JA 4JZ3A 1JCGA 2E1CA 2B63J 5CIUA 4Y15A 3V8LA 2MWOA 2A3LA 4X6AJ 4HA8A 1V29B 3FM5A 1WSGA 4KH1B 3FMRA 4XLFA 5CPRB 4M3WA 4M7YA 2GBQA 3S17J 2OX7A 1W36D 2LJ1A 4FZYA 3K4MA 1RAGB 1NPRA 3EG2A 1U6ZA 1QZZA 1JLCA 1QQNA 1KONA 3MKYB 4XIUA 4NQWB 3S41A 1VSHA 3A5OC 2CUFA 5CQYA 4U0WA 2OUMA 3GUDA 5BPDA 3VQPA 3OQ5A 5HOOA 1ETOA 2LZ6B 3ZX0A 2VLAA 1HX1A 3AG4H 3CEYA 1K6OA 3ECOA 4HYEA 4NC6A 1HW2A 2CGKA 4HUEA 3MP8A 3GEZA 2LTOA 4MMKA 2M4GA 1V5GA 2M34A 1EA3A 2AZSA 3RWUA 4N4OB 1C0WA 3EG0A 5T7BA 1QMCA 2YHAA 1NGBA 1KQ1A 1VQ6T 2MABA 3TTDA 3P9CA 3EETA 1IO2A 1ZKGA 1AHDP 1T0FC 2IPOB 1N8RU 2X6SA 2KIUA 4MQVA 2DK8A 1NKBA 2KISA 3TCJA 4EFHA 4RCCA 3CMAT 4CHOA 4R1HA 1S7AA 3P8BB 2WTEA 3TSQA 1WSJA 3CC4A 3D7EO 1MNEA 3RSNA 1VF9A 3BFMA 2EFNA 4C0FA 1QHHD 2IS4A 3GVAA 3RZDJ 2LCSA 1D09B 3RDVA 4RCHA 3ZP5A 2A5XA 4BE2A 4HLYA 2OAZA 5GAEP 2AT1B 3ZBDA 2ZGWA 1L3TA 1O13A 5F04A 4A62A 1YJ9Q 3ULEA 1QZ5A 1U0JA 4B3RK 2HU9A 5H2FC 4FW1A 1MA9B 3CCSI 4DNCA 4DBRA 4LE9A 2LD5A 3AVIA 1IF1A 3ENOA 4G6QA 3CWAA 3K4LA 1VQMI 1K83J 4O6JA 1L3SA 3E3VA 5M5YJ 3OYCA 2GWKA 2RKIA 3LA2A 1VYTA 2F5TX 4UUTA 3DEWA 4CJTA 3VEPA 2CUZA 3UA6A 1SL1A 4QWQA 2K85A 1GFCA 2GWJA 4Q5VA 2FOWA 4NS5A 3UDCA 4IFEA 2VPRA 5KAIC 2QWOA 3CC2A 2HHUA 2X4YA 3PIOF 2Y1IA 2EFIA 3PUFA 2ZPEB 3CC2N 1HDDC 3C6UA 2P0KA 5DDGA 1YIOA 5CKEA 4HCBA 3CMMA 2QM3A 3TAQA 1HLVA 3A8GB 1GV2A 4MNUA 3ZQHA 5A0GA 5ILUA 3QAHA 4E4HA 1U5SA 2HSPA 4ZTFA 3AAPA 3RMBA 3EYZA 2HZDA 2WBNA 3NVMA 4HCCA 1Q86O 3B02A 2DVJA 1S7EA 4CSWA 2DN0A 4F9OA 4KHWA 2M9UA 3E6CC 3DOLA 2Z1GA 2STWA 1R77A 2XMFA 1WFXA 5FO5A 2X1CA 4WQ5C 1G5VA 1ZX6A 4IHWA 5AQQA 4FK0A 2HEQA 4M63C 2HTJA 3OYEA 2P6SA 4CO8A 3L09A 1M27C 3Q0UA 5A2QK 2OPQA 4R5PA 2XD0A 2A5WA 3BG6A 4OPHA 2P4WA 1XC5A 3MEEA 2QGFB 5I21A 4FT8A 4RW4A 1C1AA 2HQHA 2Z1JA 2WB1A 3NWTA 2DIGA 2CZ0B 4UHTA 2JMWA 5LGNA 4M75F 4HNTA 2F8TA 1ETQA 2ISZA 1BI0A 4WXDA 2XGCA 3KPHA 2QYZA 4FZXC 1IJWC 1YO5C 2HNIA 4M7DD 4ME7A 4NB4A 5E3MA 3M8JA 1TTHB 1MMDA 3CXCP 1OR7A 4U7BA 2Z2SB 4HLXA 1U8BA 4E9EA 4CGFA 2JA8J 2OTJN 4HKEA 3IRRA 1TWHJ 4JKBA 3NTHA 1BR4A 1ZELA 3S3MA 3S15J 1RRSA 2OPPA 4EIKA 4HUFA 3I55I 4BRGA 4ESJA 5KN8A 3ZL7C 1WJRA 1PJRA 1YW8A 3I8DA 4KBMB 3CCSQ 4G7ZF 1H1VA 5F0HA 1EJ9A 3OS0A 2D5VA 3UATA 4FJLA 2CGJA 2XDVA 4LMYA 4PKIA 1ETWA 1OX9A 4RUGA 2M7AA 4Z02A 1M8MA 3IRQA 2B9SA 3OYGA 2AS5F 1IG7A 4EJOA 1WWXA 3SUQA 5L23A 2WAEA 3CCVT 2KHMA 2LMJA 2AXLA 5JFRA 3C2BA 1W4SA 4EA4A 3EFOA 4GVEA 1R5ID 1E2XA 4C8OA 4BREA 2V1QA 1Y1WJ 2BDPA 4EVVA 5JS1A 1HYSA 1YYVA 4DTMA 2DTUA 2IEKA 2CYYA 2JA2A 2ROLA 1I4K1 2EH3A 3DCFA 2H3JA 1LDDA 5LY3A 1K8AR 2DVEA 2FF4A 2A3ZA 3F8CA 3ZMUA 3I9QA 5FD5A 5E1ZB 4JBAA 2OV7A 3FM3A 1VQKA 2LF8A 4CGZA 2ZNZA 3CC7I 4RTUA 4WF2A 3HPOA 3C6HA 4MGRA 4M77G 4W5RA 2E65A 4FQGA 3SB2A 3AA3A 1KZHA 2B7EA 2CH4A 2NVQJ 4CIFA 1XGMA 3MECA 1VNDA 4C8QC 3JCMd 1NG6A 2AJQA 3K10A 2A6EF 4E47A 3O9UA 1J5OA 1FOKA 4F7UE 2CQNA 2VKDA 3Q1JA 3EUAA 2DDAA 2NOJB 3AA2A 2V51B 3NH0A 1Y56A 4M3GA 1T3LA 2XAFA 2LDMA 1EH7A 3A98A 4BD3A 3HVRA 4RM3A 4HZFA 9ANTA 4C0GA 4BEHB 3BLYA 1QE1A 4AD9A 4DQ2A 3DQVC 3C0BA 2GFAA 4L5IA 2QA4A 5JLFA 2ZJRF 3G4ST 1O1WA 1R6RA 1WHHA 1YCSB 2WWYA 1QKWA 4OWRB 3ZEHA 1NGAA 1NBEB 1M1EB 2DOFA 4DJAA 3SK3A 1N3CA 2BUDA 4BRKA 4KRFA 2OQGA 1KK7A 2M0MA 3VF6A 2B0LA 4KGVB 1T08B 3CPWP 1TWAJ 3WTSC 3RDIA 3G71A 1P4AA 3TVTA 4PSWA 3SPZA 4PLLA 2EPFA 2L3SA 1JGGA 1OH8A 3QPSA 3MAQA 3A8HB 1NGCA 1WB9A 3HRUA 1ASUA 1AKHB 1NK8A 1MBHA 1P4WA 4H5NA 3S9HA 4U67L 2NYSA 1EH8A 4A3IJ 3V6DA 4M3RA 1PC0A 2HSEB 2EFOA 2EFPA 3CF5F 3L2QA 1BI4B 2D0QB 3WTWC 4A63B 3JB9J 3IRXA 1D0YA 2K9NA 4LD5A 1KG3A 3K2PA 3CVSA 1U5TB 5FKLA 1UG2A 1IAWA 4BC3A 3JSPA 1M3QA 1TYQB 3A02A 1RT3A 4DFJA 3L2VA 2O3FA 1WIEA 2H8WA 2IGIA 1R7JA 4BR2A 4B3XA 1TNTA 2V6EA 4WQ4C 2IW5A 5AZIA 3IWFA 3OIQA 3URGA 2QK9A 5KE3A 4HRIA 4CEQA 3CCLT 1VQ8A 2EGAA 3CD6I 1KQ2A 3EL2A 4OGCA 1OLTA 3THWB 1XC9A 2BH1A 1EWQA 2ZD1A 2EQMA 4FPBA 4FM2A 4K8ZA 2LLKA 3E6MA 1A6QA 1LE8B 4B9VA 2DL3A 3M0TA 3A5ZB 2LC4A 2JSCA 2XG8D 3PIPA 2LR8A 2DMTA 3ZQ7A 3TBIA 3MQ0A 5GPAA 4E7HA 4A0XA 1J59A 4A4GA 1M4ZA 5LMUK 3RCOA 3HFNA 1U2VB 2JTMA 1W5SA 2QA4N 1KHIA 4HNVA 2J05A 1P6RA 4M42A 2Q2RA 3V1RA 3I56I 1FOYA 2M0OA 3D1NI 1Q7YU 2MSYA 4N4IA 1WJCA 3JW4A 2VQEK 2XY7A 1OH5A 1FIPA 2HHVA 1N9RA 2DW4A 4A3CJ 1MWKA 4CK2A 1R1VA 1I07A 4M7DB 5BN9A 1ON1A 1RUOA 2HBJA 4EMKA 5L3BA 4RLQA 2A41A 1ETKA 3VYGA 3SEQA 2AKLA 3QO9A 1UHSA 4XTUA 2AP1A 3WUHA 2FU4A 5FDLA 4CK3A 4MLOA 2K02A 2YI1A 4AT1B 1ZSGA 5CAIA 2PFUA 1RT6A 3P39A 2IOCA 5BNGA 2E19A 2ZPBB 4L8RB 4Y17A 4KH6A 2E1MB 2M45A 2E1MC 1SSFA 3R61A 2E2NA 4B1ZA 4I0BA 5EZGA 3EKUA 1VQON 1AT1B 1A36A 4BY6C 4BDPA 1KG7A 2K7LA 3T1BA 1Z77A 3ABMH 4Y13A 3F8NA 1EWRA 3GL1A 3EHQA 2LBFA 1RACB 2HKNA 5FU6C 2HWVA 2GX9A 2LY1A 3RPUD 3K9TA 2Z3YA 5CKBA 3S32A 3CJBA 4EP4A 3H41A 1S9HA 2DK5A 5LJ5j 3H3OB 4CZKA 4QW2A 2BW3B 1QRYA 1D1BA 3N05A 4KT6A 3B6AA 2XDBA 2X4HA 1SKWA 3H8ZA 1PM3A 3QNNA 1L3UA 2GNCA 4RS8A 3CJQB 4B9TA 3LPTA 2OPRA 2DILA 2ME6A 1WEFA 1FKPA 1ITGA 5FLVA 1UGQB 3LSMA 5GAN2 3B8AX 4BR4A 4TV7A 5ED4A 2COMA 1BBYA 2V1NA 4E9HA 3ZXSA 4QKUA 1FMVA 3CMEA 4MO7A 5M1KA 4PJLA 2QK0A 3P9KA 3TW6A 5J4VA 1RAAB 3BCBA 1FMKA 4BBSJ 1Q82U 4N4NB 2SEMA 1N75A 3KLGA 3GG4A 1B9DA 3UPUA 1OYIA 2XRIA 2DA2A 2XAJA 1LE8A 3O80A 5DCMB 2DPNA 5J2NA 3LSHA 3ROUA 1HC8A 3BF1A 4XEIA 3FMSA 4II2A 3BR0A 3P1GA 1QKXA 2LF7A 3MEWA 2ICWG 2MA3A 2GZWA 4N0AA 3HC7A 4Y52J 2DAOA 3B73A 4B24A 2CJJA 3IQLA 1J54A 2DLPA 1NPPA 3JTHA 1JKQC 4J19A 5SWMA 4H4MA 4A5AA 4C8NA 3OGDA 2D0OA 2Y4XA 2QZ8A 2TCTA 5AQWA 2XAGA 4UVAA 2GTOA 3FJ5A 5BR9A 3FK7A 3C2HA 4AYBA 3I56N 3V8KA 3NHNA 4PJOD 3JRCA 4BDYA 5CKDA 2WACA 3M5RA 3HRMA 4BRQA 4YFXF 4H0OA 3TWHA 3PM1A 3NAEA 5AQGA 4DUYK 1NGHA 4KULA 4RTYA 1ZN2A 2MC3A 4DCHA 2A5YB 2R5YB 1W7AA 3CFRA 5C6SA 4JJDA 3CCUN 2OJ2A 3F70A 3ZCOA 5GIOA 1A5XA 4N41A 3VYSB 1U3EM 4C3HJ 1H8AC 2M4KA 2P6TA 5BN8A 3K4CA 3BDUA 2VWJA 1WHJA 2EYQA 1A5VA 2OTLT 2KRCA 4BRNA 4LDWA 2C0TA 1O3RA 1YW9A 2MD0A 3D2FB 1VQ9T 3CWTA 2VXEA 2VI6A 2YHXA 4FOIA 3G1LA 5GANg 2NOEA 3RYPA 1VQKN 5FWCA 2YLCA 5J39A 4YIRX 3Q9VA 1KSWA 5E26A 3BY5A 3PIOL 4LK0F 2SRCA 3W6JB 5IXFA 1JLGA 4CEAA 3G0ZA 4DV3K 3SAFA 2JA5J 4BH9A 1XQOA 2G8HA 4AIJA 3NQOA 4C0DB 2ED0A 2PJPA