4BE1A

Pfv intasome with inhibitor xz-116
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be1A03
4N5SA 2QK9A 3OVNA 3SI6A 4PLLA 3AA5X 1NKBA 3IAYA 2PYLA 5KH6A 4NZGA 3V1QA 3LYIA 1ITGA 1QS4A 1KFSA 1JLFA 1RDBA 4O44A 1D9FA 2DY4A 3OS0A 3OYBA 5KE2A 1N6QA 3NF8A 4BWMA 1S5JA 2Z1GA 4H8KA 3PUFA 3ZSRA 3OYHA 4J2EA 4BDYA 4GY5A 2HVHA 3QEIA 3AO1A 4I2PA 4FJKA 3V9SA 4E7KA 3S3OA 2HHVA 4CJVA 3DB4A 3DLHA 4E19A 4EP4A 1XI1A 3VQ4A 1T03A 5KCOA 3SUOA 4NYFA 4DG1A 3PMIA 4RW8A 3M8QA 4M41A 5CY4A 4BACA 1C0MA 3JSMA 1NK7A 3OYGA 2YV0X 4F2SA 1J9AA 3G10A 1ZBHA 4JRPA 4O0JA 1HPZA 3VQDA 2HHTA 1HMVA 1T05A 1C1BA 4ZHRA 5J2MA 3ZT2A 4M3RA 5FRMA 3NTKA 4FK0A 4KTWA 2PQWA 2IGIA 5JS1A 1ZBIA 4FU6A 3K2PA 2G8UA 1NKEA 2Y1IA 4CHOA 2YHAA 1BQMA 4C5GA 3NDKA 4FJGA 3WNEA 1VSEA 3HPGA 1ASUA 2QQRA 3L3VA 3L8BA 2B8AA 4UQGA 3VQ6A 2G8HA 3PNWC 2GBZA 1QHTA 2YKNA 2XO7A 1KVAA 1B9DA 4FCYA 3HVRA 3MXIA 3QEWA 4R5PA 2DFEA 4NCBA 2L89A 3VQ5A 4A4HA 1C1CA 4K8ZA 4DSIA 2DIQA 5C6SA 3DLMA 3OS1A 3LZJA 4CEAA 3HXMA 1WLJA 4FLZA 1S6PA 2EX3A 2G8WA 3QIPA 3DYAA 2HB5A 1C1AA 3IG1A 5EU7A 4BE1A 3V9UA 2YNHA 3V9ZA 1RT2A 1WSHA 1RT7A 4B9NA 3I0RA 4CEOA 1QSLA 3IRXA 1I39A 3QIIA 1KFDA 2BIVA 4LSNA 3DMJA 4AH9A 3THVA 3AA4A 4PQUA 2KFNA 3ZT3A 4CECA 3QINA 3GOXA 2Z1JA 4J2BA 2HHSA 1NJWA 2YHBA 3AV9A 2K3YA 3D45A 4DF4A 2I5JA 3ZSVA 4YNQA 3C6UA 1J5OA 3KD5E 4C8NA 4DU3A 2HQEA 1WAJA 5E41A 3MP6A 4AHTA 1RBSA 3SD4A 3PV8A 4CGFA 4C8KA 5IAYA 1G15A 3V81A 3FFIA 1GOCA 2R58A 3AVKA 4KHYA 1FXXA 5KGWA 2IAJA 4CGIA 4B9WA 3QKJA 4CF1A 1KVCA 5C24A 2LSNA 2L8DA 3TAGA 4KI4A 3OYDA 1OYXA 3NGZA 3VQQA 4EP5A 1HYVA 4OLAA 3KKRA 3OYCA 4Y1DA 1WSGA 4DTUA 3ULDA 5FDLA 4IURA 1VRTA 3E9GA 4DFPA 1SSFA 1KLMA 4A4EA 2NUBA 2Z1HA 4E1NA 4CJLA 4OGCA 5D3GA 3MXJA 4KHSA 5KE3A 1T7PA 1OZ3A 3FLGA 1BIUA 5HLFA 1C0UA 5IN1A 4I2QA 1HQEA 5J1EA 3OY9A 3VQ9A 4B9VA 4Z4HA 3QEVA 2D0AA 4N4GA 3QEXA 3SQ0A 4AHSA 1JLBA 5DK5A 3WNGA 3HK2A 1S1XA 5C42A 4ELTA 4BDPA 3NAEA 2EHGA 1VK0A 4KB1A 4CJTA 4IBNA 1S9EA 4DQSA 3AVCA 4CHPA 2EQKA 3DI6A 2R7YA 3OYMA 3VQAA 1EKEA 1RBVA 4B9TA 3PY8A 3NH1A 3PX0A 4CEFA 1SL1A 2Y1JA 4B9SA 4CGHA 2KW4A 4KHNA 4DTSA 1BGXT 4PY5A 4I9LA 3U6FA 5J2QA 3LLRA 4TSXA 1J54A 1LWFA 4FLUA 3MECA 4AHUA 3SQ1A 4FLVA 3M9QA 1SL2A 5I3UA 2HW3A 3MEUA 5HRPA 2R57A 4Z0UA 4JRQA 4HUFA 3RMAA 2BANA 2RN2A 2E6NA 2L3RA 4BD3A 4CHNA 4J2AA 3C94A 3DLEA 4E1MA 3C4SA 4ZTFA 5D6YA 5M9OA 3M8PA 3OYLA 3DRRA 3V6DA 1W0HA 4FLTA 2Z1IA 3ZEHA 4FXDA 4FJ8A 1A5XA 1F21A 2JLEA 3NHGA 2RI5A 2FBTA 3HYFA 3MO8A 1X1PA 5CYQA 1TK5A 1JLQA 2FC0A 3LP3A 2DFFA 4FJLA 3DLBA 1WNSA 4NYNA 1C6VA 1QSYA 2B6AA 3BGRA 3ASKA 4E0DA 1XWLA 1Y97A 4KI6A 2VWKA 2D5RA 1B9FA 2X35A 2LCCA 3SUPA 1CZBA 4KRFA 1XHXA 3P5JA 1L3UA 3DRSA 1HQUA 1KSPA 1DTTA 3DB3A 3KKSA 4FW2A 2LRQA 5D6WA 5CZ1A 1KCFA 3RMBA 3KK3A 3OYNA 3MEVA 3MEGA 3KLFA 1SKRA 3FC3A 3AVBA 4PLIA 3NCIA 1NJYA 4B8AB 3K5NA 1OZ2A 3EAEA 4CJSA 1RTHA 1RTJA 2X6NA 2F5KA 4DLGA 3VN5A 4FZZA 2ZQBA 3QNOA 1IKXA 3C6TA 4CJRA 1IO2A 3NH2A 3NF6A 3SJJA 1BI4B 1HYZA 3EYZA 1KRPA 3P8HA 1QSSA 2F8TA 4Z4EA 3HT3A 3I0SA 2FBXA 4NCAA 1L3VA 3OYAA 2OZMA 1FK9A 2RPIA 1UAXA 3LWMA 5KRTA 2M1HA 1RCHA 3B6PA 4DTPA 4N56A 4CK2A 3O3FA 4DTNA 3TAMA 3CM6A 3CEYA 4GW6A 4DFKA 1D9DA 4KPYA 3MEDA 3MXMA 3BDLA 3O3GA 4OKKA 1RDCA 2XHBA 3KLIA 1ZBLA 4FM0A 2VG6A 4I9QA 1N5YA 1CXUA 2QKKA 1SKWA 4CK3A 2OPSA 1YT3A 1WJQA 1BQNA 3O4NA 4OKEA 3HPHA 4LSLA 3ZSZA 4IUQA 1IH7A 4C5HA 4CJEA 2AJQA 3OJUA 3BDPA 4O0IA 3UIQA 1RNHA 3LGFA 1K6YA 1HNVA 4M42A 4M3XA 5I42A 3PX6A 1JL1A 3ISNC 4C8OA 3AO4A 4J2DA 4HTUA 4GMJB 4CFCA 3OQ5A 2GV9A 3MEAA 5K14A 2GFUA 4C5IA 3TAPA 3RRHA 4IFVA 3IS9A 3CFPA 1LW0A 2YRVA 1LWEA 5CZ2A 5CIUA 2ZD1A 3OYKA 1HNIA 3NGIA 4DFMA 1NK6A 2RF2A 5FRNA 3S9HA 2NLUA 2X4WA 3FDRA 2A1SA 4CIFA 4RW7A 3OMGA 3V9WA 4F3TA 3AVGA 1TK0A 4C5EA 4IKFA 3AO2A 4JS5A 4GVMA 4W5OA 3TAEA 1NK0A 1W9HA 3NBPA 1YTAA 2X6SA 3QO9A 4QVZA 1RBUA 4NCGA 4DQPA 4FJXA 3UT1A 4IUPA 4DQRA 3K5LA 1EETA 4F2RA 1GOAA 3C95A 1ASVA 1BISA 5KRSA 3KK1A 4DTOA 3MAQA 2OPRA 3SQ2A 3HJFA 1JKHA 1RT4A 1NOYA 3LANA 3MP1A 2HQXA 1VRUA 3TI0A 4O55A 1CXQA 2XY5A 4FLYA 1SKSA 2RKIA 2OPQA 3OYIA 3T3FA 4ICLA 2P1JA 3OS2A 3KLEA 1MHNA 3U3YA 3QESA 4EZ6A 4CGDA 4IG0A 1Z25A 4Z4CA 1TGOA 4E89A 4CJ3A 4BE2A 5J2NA 2WOMA 1Q9YA 4IUVA 4DSJA 4B9UA 2IDOA 2HHXA 4IG3A 2Q3SA 3QBYA 2YNGA 3DLGA 2GF7A 1LW2A 4FJHA 4FM2A 4L8RB 3AO3A 2RJFA 2PYJA 3TANA 1JLCA 2W42A 4OPKA 1FKPA 1UWBA 4PA1A 1NK8A 4CJFA 4EZ9A 4CEQA 1CLQA 4E7LA 4DQIA 1MU2A 1YTUA 4M3ZA 1U47A 4RG2A 2O4GA 4LD6A 3SZ2A 4CGGA 2K3XA 3ZT4A 3V4IA 1FKOA 3LAKA 2OYQA 1S1WA 1VSHA 2OA8A 4FK2A 1TAQA 5C25A 1R0AA 4AHVA 3O4QA 3ZSWA 3M8SA 4E3SA 2M16A 2KTQA 4CJQA 3P83D 2D0CA 4FJ9A 2MWOA 2JZ2A 5FROA 4CHQA 2EKOA 3LP2A 3EY1A 3AVNA 4BDZA 1WSIA 3LWLA 4Z02A 4B3OA 2EFIA 2RO0A 3AVHA 4F8RA 2IOCA 1EP4A 4CJ5A 4DS5A 3UWNA 4CJKA 4KKOA 2LVMA 4QQDA 3AA2A 3DM2A 4M3UA 2KZZA 2VG5A 2B5JA 1Z26A 4HUEA 1KTQA 4CCHA 4KHWA 3TABA 3AVMA 5JS2A 1BIZA 3SV3A 3CQ8A 3O8VA 2RHZA 2FBYA 3KTQA 3VQBA 1WSEA 1IKWA 1BCOA 4OJRA 2RJDA 4FJ7A 2RJEA 4XIUA 3HPOA 4QOZB 4FL6A 3FEOA 2CKKA 2LTOA 2X74A 3ZSOA 3RR7A 1TL3A 4A4GA 3AVAA 3QEPA 4CEZA 3NTIA 1DLOA 3OYJA 4E7JA 1LAVA 4LH4A 4FZXC 1SV5A 3ME9A 1UOCA 4W5TA 4AHRA 4HCCA 2EQMA 4OVAA 1U45A 3L42A 2JGUA 2YNFA 3NGYA 3S3NA 2XY6A 4OGEA 2OPPA 5T7BA 1U48A 1RT6A 3K5OA 4ID5A 2RHIA 4Q5WA 3HO1A 4B8CA 1N27A 3ZSYA 3META 4H4OA 3O3HA 1RTDA 4LD0A 4B9XA 3ZT1A 2D9TA 1BHLA 1RTIA 2F8SA 3LPUA 3M8RA 2VWJA 3LP0A 5KGXA 3HP6A 3HP9A 1A5WA 2E6LA 1TK8A 3LH0A 1BL3A 2A1RA 3KLGA 2RJCA 1S6QA 3RR8A 3RRGA 2EQJA 1GOBA 1WGSA 4HCBA 2KZMA 3OYFA 1QE1A 1D8YA 4W5NA 4DSFA 4MFBA 3TWHA 4CFAA 3PX4A 3F73A 1VSMA 4M3WA 3CM5A 4FM1A 4DWIA 4F4KA 2WACA 4Z4IA 1LWCA 1XC9A 1KLNA 3H8ZA 3U3GA 1NK5A 4CIGA 5HP1A 3QETA 1U49A 2RHYA 2HVIA 1HRHA 2E6MA 3VQ8A 3JYTA 2ZE2A 5HBMA 1C0TA 1WJSA 2VYTA 4Q5VA 3F9KA 3AA3A 4NS5A 2BKDN 4KTZA 4CJPA 5HRRA 3KJVA 4H4MA 2E5QA 3TAFA 1RBTA 4DTJA 1RT5A 3LGLA 4C8MA 3G0ZA 4AILC 2DIGA 1VSFA 3L2RA 1H3ZA 2BGGA 1D5AA 2XY8A 4I7FA 3ASMA 4KTQA 3AVFA 3LPTA 4RW9A 3VQPA 2LDMA 4DTXA 2O4XA 1G5VA 4HCZA 1RBRA 4CF0A 4RG8A 3RMDA 1J53A 1Q8IA 3ZT0A 3AVIA 5SZTA 3E01A 1S9GA 3ZSQA 3S6WA 1NOZA 4M45A 1JLEA 5SWMA 2YKMA 4HVJA 4PUOA 4FVMA 4B08A 4IUTA 1NKCA 1RDDA 1S1VA 4MQ3A 4II1A 3KUFA 1LV5A 1L3TA 4G1QA 2ATQA 3CFOA 1TKXA 2KFZA 4W5QA 3LX7A 3OMCA 4CEEA 2RHUA 5DMRA 3DOLA 1RI0A 3K59A 4PWDA 4K8XA 3S3MA 2G3RA 2MWPA 3L2VA 4CGJA 3K5MA 5HRNA 3I8DA 5CYMA 2G8VA 1BI4A 5D6XA 2ITGA 3AVLA 4C8LA 2QXFA 2DAQA 4JLHA 4O5BA 4CIEA 4IFYA 1X9WA 2BUDA 1RILA 1VSLA 3PMTA 4AHCA 4FYDA 1IKYA 4QCLA 4CRIA 5HRSA 1LAWA 3SQ4A 4B9MA 1T8EA 1QQCA 5J2PA 1VSKA 4A4FA 3OB9A 4UC4A 1XNIA 2IC3A 2D0BA 3D0PA 1TKZA 1RT3A 3MEEA 4CF2A 3LDSA 2DTUA 1X9MA 3L2UA 4KV8A 3OYEA 4EDUA 5C0MA 3TR8A 3QERA 3QJ6A 1WSFA 4DS4A 4PL6A 3CG7A 4RW4A 2G8IA 3TARA 2B4JA 4N41A 2IS3A 4HHTA 3MEWA 3SUQA 4FJMA 4DSLA 3ALYA 1HYSA 1XHZA 1IKVA 4X34A 1NK4A 4CEBA 1JLGA 3AVJA 4ELVA 2ETJA 4CHZA 1KHCA 4L59A 2R5MA 1WN7A 3T1AA 3RWUA 4FLWA 1REVA 1CZ9A 2HHQA 1ASWA 4O4GA 1L5UA 1IG9A 3LAMA 4WE1A 3WNHA 1UA0A 3QNNA 2P5OA 3PO5A 1I3AA 3QLHA 3VQEA 2IG0A 3DLRA 3P1GA 1U4BA 4CERA 2X78A 1S1UA 1YVUA 4E7IA 2F96A 2JTFA 4M3TA 1VSJA 4E7HA 2RI2A 2HMIA 3TAQA 2PZSA 4OLBA 2FHDA 3T19A 4CESA 2KQ2A 3ZSXA 1EXQA 4RW6A 3VQCA 4LH5A 3LALA 3CFRA 1ZBUA 3NNQA 4CJWA 4Y1CA 4DTMA 1VSIA 3NH0A 4N4HA 3KLHA 3RTVA 3NFAA 1TAUA 1WJRA 2P0KA 2VG7A 2QKBA 3V1OA 4DMNA 4DLEA 4ID1A 1A5VA 3HM9A 3SV4A 3SYZA 4DSEA 3SUNA 3HL8A 3OA6A 4HUGA 3WNFA 1DTQA 3OJSA 3PFSA 3NF7A 4KAZA 1B92A 4KO0A 5J39A 4CF8A 4KFBA 3HSTB 1NJXA 3A2FA 5J26A 1QTMA 1TV6A 1SL0A 4KHUA 1TKTA 3AO5A 1L3SA 5KI6A 4Q0BA 2G8FA 1ZYQA 3P8DA 3RMCA 3KD1E 5KTQA 4FJ5A 3SPYA 4IUUA 2P51A 3F70A 3VA3A 2WONA 4ELUA 3Q1JA 3DRPA 2XRIA 3DLKA 1JXBA 2GUIA 4DF8A 2OZSA 2P5GA 3QIOA 4KREA 4CFDA 2E4LA 4M3YA 5HROA 4FJIA 3V9XA 1VSDA 2HHWA 3MP8A 1ZBFA 1HJRA 4N4IA 2O4IA 3H08A 4KHQA 1Q9XA 2BDPA 1KVBA 1RDAA 1RT1A 4OVLA 3K58A 4FLXA 4QAGA 1S1TA 4W5RA 1UA1A 2HNDA 3SPZA 4CJUA 4DTRA 1U04A 3HVTA 3KK2A 4CHYA 3K57A 4YFUA 4B9LA 4Z4FA 1NJZA 3VQ7A 1JL2A 2GFAA 3CYMA 1TL1A 4CJ4A 4FJJA 4FW1A 4DFJA 4CEDA 2EQUA 3E9FA 3PO4A 4FK4A 2XDPA 2X4YA 3SCXA 4BE0A 4IDKA 4DU4A 4CK1A 1OI1A 3H6ZA 2HNYA 4FJNA 2M0OA 2R5AA 1TVRA 2HNZA 3L2QA 4DQQA 2G8KA 4QQGA 1JXEA 3LZIA 3EZ5A 1NK9A 3DOKA 4CF9A 4DU1A 1EX4A 4OPJA 1JLAA 3ITHA 3NTHA 2DFHA 4DSKA 4N76A 3LP1A 2HHUA 2RHXA 4KB0A 2XK0A 3V1RA 2X4XA 2PY5A 1SUQA 4Z4GA 3B6OA 4FZYA 3KIOA 4CFBA 1TKDA 2YNIA 4N47A 2O4XB 3ZCMA 2FBVA 2BE2A 1WSJA 4BWJA 3SNNA 4LY7A 4QQ6A 2RI3A 3NE6A 3L2WA 3VA0A 2XY7A 4ZTJA 4QW2A 4CE9A 5KCHA 4JS4A 1O1WA 4F3OA 3L3UA 1X9SA 3NF9A 2QQSA 1WAFA 1BCMA 4OKJA
chains in the Genus database with same CATH superfamily
1YS7A 2QK9A 1KU9A 3GTGJ 4PLLA 4J00A 1NKBA 2F2EA 1K9MC 2R5ZA 1BB9A 8ATCB 1ITGA 3ZX0A 5FD5A 2CQQA 3T8RA 4DOZA 4O44A 3BTIA 2VXDA 4A12A 4OMNA 3OYBA 3Q9SA 3L0QA 1RRSA 5BN9A 3VEVA 1HSJA 3NF8A 3TSUA 1UE9A 1ZG3A 2MYSA 3I0XA 3M4YA 3VGLA 1OEBA 2D4WA 2IVNA 4EHTA 3CJQB 2K4BA 1RLPC 3RKWA 5I2MA 4J2EA 2R93J 2OTLT 4BDYA 4GY5A 2HVHA 4JN4A 3GNGA 3QEIA 4B21A 3A01B 5GTIC 3B6CA 3HUGA 5BNGA 3ZN0A 5F1RA 3DKMA 5EXWA 3CCEN 3DLLF 4PKIA 2VASA 1YNZA 4FT4A 5IHNA 1NU0A 4OIPF 3RR6A 1LPLA 1XI1A 5LJVA 3EGDB 1VYUA 1OR7C 2GA1A 2ZMEC 5BPDA 5KCOA 1NGIA 1XMXA 4LUEA 2OAWA 3TREA 2ZJRL 1P4WA 3S1RJ 3ZX2A 5H1SQ 3RERA 4HF0A 3VUBA 1SANA 1ZRFA 1AKHB 1KSWA 1LWWA 3OA9A 1T6SA 2JK3A 5CVUA 3W3DA 4M4ZA 3H0GJ 1DEJA 2QWRA 1UGRB 2E88A 4O8UA 4O0JA 2KL4A 1VQ9N 3QAHA 2X4HA 1UTIA 2HHTA 1RKWA 2D8HA 2D1XA 5J2MA 4DCHA 2XROA 2CDTA 5FRMA 4XLHA 4A3LJ 2PQWA 5JVGL 5JS1A 1MDMB 4FU6A 5AQHA 1N8RC 5H20A 4C8QA 4C5GA 3NDKA 4C8QD 2DKGA 2XPWA 4FJGA 5LRSA 1U3EM 3WNEA 3OSVA 3VS7A 1YW9A 3L3VA 2XVCA 3I5RA 3IDHA 3UKUB 1GVDA 5LBQA 2WV1A 1GDTA 2G8HA 2V7YA 3PNWC 1QW1A 5FJ8J 2QQ8A 2XGEA 4I6MB 4D8KA 2GBZA 1QHTA 2XHIA 3WODF 4JK8A 3OHRA 1KVAA 2ZMEB 3PFIA 5HY6A 3CWUA 2PJRB 3MN2A 5DEQA 4FCYA 1B07A 2DOEA 1VIEA 3QEWA 2YWWA 1M3BA 3J7AO 5F1JA 3K2AA 1ITYA 4UNOA 5BPMA 4A4HA 1C1CA 4K8ZA 2JPBA 3OS1A 3LZJA 4JI4K 4JI3K 2I7PA 1WLJA 4OPHA 5GAN3 2YG8A 5EG0A 4FLZA 4BQLA 5AIPA 1KJWA 3F3XA 1APLC 2G8WA 2ZXIA 2KISA 2KMUA 3ERMA 4UB8C 3EFOA 3HOVJ 2X85A 2JVGA 4BE1A 4N4OB 4C92E 2A41A 4GV6A 3LA7A 3J7AF 1Z7LA 2GQIA 5BN8A 2NYSA 2LLKA 3I8BA 5GAOl 1QSLA 4EEFG 1I1JA 3CD6N 1G6NA 3S1MJ 1CKAA 1U1SA 5A2QZ 3AA4A 3CQZJ 3VEYA 3QZ5B 1KIKA 1SZ2A 4J2BA 2HHSA 2YHBA 2F7TA 1P59A 2I5JA 3ZSVA 2DL7A 3ZETB 3EGXB 3MZHA 3KD5E 4C8NA 4DU3A 5IT9O 1N34K 2DETA 1N25A 1D1BA 2CREA 1AD5A 1K4SA 1IGQA 2MMPA 3EGUA 3SD4A 2ZJQL 4IOAF 1YW8A 3QBWA 1X6GA 4CZIA 2VJIA 1G15A 3V81A 2ZPHB 3LH5A 4L5GA 3FFIA 4Y17A 3BR1A 3NVMA 1Z6RA 2R58A 3AVKA 1FXXA 2P81A 4YOVA 3UKRA 2VUBA 4CGIA 4IQ4A 4F55A 4M77A 2EZHA 2NRAC 2CW0F 5D8LB 3G3ZA 2MC4A 1VQPA 2FSNA 4H5VA 4JOMA 3R9PA 2VYPA 4C2MJ 5BQTA 2CGLA 4IXAA 2COMA 1VQMN 2BXZA 5EYRA 2RMOA 1MPGA 3NGZA 3QYFA 3KWGA 3VQQA 3TQNA 3CMEA 4ZZDA 2JN6A 2QDLA 3J80E 3OYCA 3HI0A 2CMPA 3LSKA 4IURA 2A07F 3M1EA 1MMGA 1PD1A 3G71T 2Z1HA 5LJ3g 1WHMA 5D3GA 3MXJA 1W7PA 4YDUC 4WF2A 4KHSA 2W0ZA 3CJ7A 1Y57A 5KAIC 1OZ3A 1M1KO 3GLLA 2M7AA 1GCPA 1Y64A 4K11A 4XORA 3CMAT 4A6DA 2QYOA 3D0SA 4H0PA 1GXIE 2DK5A 3I56T 4S05A 4OMPA 2ZXJA 2V8IA 1KG4A 4L6V5 2LMDA 1RFQA 4A57A 4H0XB 4GO1A 2FSWA 3HXLA 2ZB9A 3BTJA 4ELTA 2RVCA 5FD6A 1VQON 1ABOA 3BTCA 3CPWP 4LLNA 2PEXA 3L4QA 4YOUA 2LC4A 2E2NA 3PNVA 3D7EO 3VQAA 4IJNA 1IV8A 1SC7A 1VQ8A 4O6JA 1ZA1B 1USSA 4B9TA 3PY8A 1XOVA 1TQPA 1Z1DA 2DT7B 2F5VA 4BI8B 1I6HJ 5GAOm 4B9SA 5JMVA 2KW4A 2AS5F 1NG2A 3QDFA 1RDUA 1OCTC 4I9LA 2J6FA 3LLRA 1JUMA 1MJBA 4DYRA 4TSXA 4AM6A 4XSZF 1YW7A 4NUBA 2EYXA 4XRSA 3RCOA 3LSMA 4AHUA 2Y4XA 4OP0A 1MJAA 4XOTA 1ZBJA 3M9QA 1WJ5A 5GMKj 2FPFA 1F9NA 2H6CA 2V7ZA 4JRQA 4XKBA 1O3SA 2NNYA 2RM4A 2BANA 4KH4A 4GXOA 1O7LA 1DU6A 3FZHA 2YHTA 3C94A 1U5TC 1HSTA 2ZPEB 5GAMh 4FIBA 3S14J 3SMSA 3CCMN 2JPCA 1WHGA 3GF2A 3C4SA 3PQKA 4I01A 5D6YA 3VERA 4L9JA 3UATA 1GVJA 2NVQJ 1HKSA 4KT0E 2CSQA 3OYLA 4FLTA 2Z1IA 2KT1A 2YSRA 3ZEHA 3ZRGA 4H0OA 3REOA 1I81A 1X2MA 4JJDA 1K9MU 4Z2YA 1KD1R 1F21A 2CO5A 1UJ0A 1MWKA 5J1YA 2YX7A 2EYYA 1DGRM 2JLEA 2FRYA 3NHGA 5AQRA 2RI5A 2FF6A 1JLQA 3CCUI 4DGWB 3LP3A 2ELKA 1TYQB 5DM7L 1ETKA 3IRRA 1C6VA 4NYNA 1QSYA 1FJGK 3BGRA 4E0DA 4J7IA 4LITA 1P2FA 1XWLA 1OVYA 2NOJB 1OOTA 1USTA 1CZBA 4KRFA 4RTWA 2XSJC 2CP0A 1XHXA 1KQ9A 2DAOA 1VQ4A 3DV8A 4FYXB 2QEXI 3DRSA 1DTTA 1Q1HA 1QVTA 3DCFA 3DB3A 2M8GX 4LE9A 4LMYA 1VQKQ 2NRWA 4PGHA 3O8GA 3RMBA 3ABMH 3KK3A 4JD2B 3MEVA 2HOAA 1SKRA 3DTKA 3OW2M 3R6OA 3AVBA 4PLIA 1M2VB 2K2MA 1NEBA 1ZARA 2P9NA 1H8AC 1OZ2A 3FF5A 3EAEA 1RTHA 2X6NA 1VQ7I 4AG2C 3SAGA 3EHQA 4F7UA 4FZZA 1YHQN 2IS6A 3KTUA 2KGTA 4J83A 3CCLN 1IKXA 1IO2A 1YQLA 4BHBA 2JNGA 4B48A 4M3GA 4B47A 3WG7H 1BG3A 4FWLA 4CI6A 1E4FT 1E6GA 1KRPA 1E3MA 3LWIA 2KXCA 2F8TA 4P5NA 3M4GA 3CC2N 4BREA 1A35A 1QCOA 3E5UA 3JCMh 2VL8A 2K57A 1N8RU 3M58A 3M9AA 3MHXA 2P4WA 3KX2A 4J19A 1FK9A 2H56A 3CJ9A 2RPIA 3LWMA 2NWMA 2M1HA 2HKXA 3K4CA 3MWMA 4NC6A 2NUPB 4OMQA 4DTPA 1ZREA 3C1DA 3H0FA 2FVUA 2HZDA 3CEYA 3SHWA 1VTNC 1FYKA 1N75A 1KQ8A 4KPYA 2ME0A 2BY2A 4GYIA 4HVUA 3FKIJ 1FN7A 5IT9K 3O3GA 2ZJRF 1VQNN 2PJPA 4F17A 1RDCA 2OANA 1HPMA 3G4ST 1ZBLA 3L6QA 4FM0A 2P9UA 4I9QA 4RDUA 1N9SA 3GTKJ 1YN8A 1CXUA 1ZYRF 1RAFB 2DXCA 3EH2A 5ILVA 4OFAA 5LHHA 3K0LA 1SFOJ 2OCCH 3A5NC 2MGQA 3OIQA 3OV8A 2HS5A 1ON1A 3H5NA 2CFXA 3Q0WA 3LSIA 5JVGF 1P7IA 4OKEA 3G7ZA 3HPHA 1IH7A 4CJEA 3CC4T 3BDPA 2MIOA 2XDDA 2MLKA 4CYCA 2VWBA 1SHFA 4M3XA 5I42A 3G6EN 2VJ5A 4DOVA 2XGDA 1DPUA 2DBKA 4H03B 4AIKA 1W4MA 1ZUUA 2LY1A 2ZC2A 2K5IA 4WFNL 1HKQA 4M71A 4J9HA 4HTUA 4I98B 4GMJB 3M07A 3P9KA 1Y56A 5FLXK 3MEAA 5K14A 2GFUA 1P92A 1BBYA 4IFVA 3JB9I 3IS9A 2WTUA 3PE0A 4GLKA 3IC7A 3OW2S 4LDXA 3PLAA 2LDUA 3U2RA 2LKPA 1Q7YO 1HNIA 2R7WA 3NGIA 4DFMA 1NNEA 3K1PA 2OJ2A 1FBUA 5E1XA 3SDZA 1EH7A 4KJZA 2NLUA 3CCUT 3DTEA 5F0HA 3EFRA 4PKGA 4B1WB 2KKOA 1ZR4A 4II2A 4F3TA 2Y9YA 3AO2A 4W5OA 3A01A 1OH8A 2DL3A 3TAEA 1NK0A 1W9HA 3NBPA 1YTAA 3K4MA 1XB4A 2M0MA 2QEXT 4NCGA 3G1OA 3EG2A 4BS9A 1YJ9I 4X64K 3HRMA 4FJXA 3EGDA 2EJRA 4IRGA 4LF9K 1I1SA 3K5LA 4ILHA 5IXFA 2FUG2 1GOAA 2DPDA 2CW8A 3MN9A 1G3TA 4ZC3A 1W2BS 3ABTA 1REPC 1XC5A 3AG1H 1AKHA 2P5KA 2OPRA 1RT4A 2JWTA 4V2FA 4F14A 2K9SA 2HQXA 4B1VA 1S9HA 3TI0A 2R4GA 2NS0A 3WTTC 1CXQA 1FSHA 3PGGA 3ATUA 1SKSA 1IC8A 4A2UA 2ZJQF 4IQJA 2BE7D 2HKQB 3EEQA 4FT8A 5F0XA 4OU0A 4ICLA 3NWTA 1VUBA 3F2KA 2M3AA 1ACMB 3WT0A 5LJWA 2RNJA 4E6RA 1MHNA 1YWPA 4JX5A 2VBZA 1SD4A 1YJNI 2EGAA 1AWCA 1NGJA 4CGDA 2OTJQ 4ME7A 3J7ZO 1A5JA 1W36C 4Z4CA 1WVRA 4H5TA 4CJ3A 5J2NA 2WFBA 4ZDPA 2ZJPL 2WY7Q 2GBYA 2QG9B 3SBGA 2CYYA 3FXMA 5C2FA 2OF7A 4IG3A 1ZELA 3QBYA 3UKUA 4IFEA 1K0XA 3KK7A 3DLGA 4HG2A 3VF2A 4I6MA 1LW2A 2ZMEA 2RQRA 1YQAA 2VGNA 4R0KA 1VQLA 2PJRA 3SEZA 4RLQA 1X27A 2Y2ZA 1QU3A 2RGVA 4KT6A 1EQYA 4MO4A 5EVZA 2HHHK 4XTXA 1OLTA 1M27C 1UWBA 4LOCA 4EZ9A 3F21A 4MTDA 4C1NK 3JR9A 2KEAA 5AR0A 3DWLA 2J4RA 1VQ9T 1ATRA 2GCXA 2KR3A 2IS2A 4RG2A 1JJ2S 4N0BA 5FKOA 4LD6A 3KEOA 4ZNXA 4MO5A 2XKPA 1VQ6N 3WG9A 2ELJA 2Q1NA 1A04A 2HXOA 3ZT4A 2DXUA 1JGSA 2Q0UA 1FKOA 3T0YA 3OL4A 2EFQA 4N0AA 1F1BB 3TSWA 2YCHA 3CF2A 5JICA 4ENJA 3X20B 3JW4A 1VQOI 2K9QA 4J7FA 4BRAA 2XPUA 3BY5A 4XEIA 1Q86C 4RB2C 1C6VX 2QZ8A 4FJ9A 1M5Q1 2UUAK 2EKOA 3O9TA 1K8AO 1M90O 3ZETA 3M53A 1D8KA 3BJ6A 4CSWA 3MQ0A 3VF4A 3DBRB 3F10A 4J6YA 2EFIA 2OCEA 2MLGA 3HIFA 1K76A 4MZMA 4IHTA 4F8RA 1R59O 3A2KA 4Z8AA 2IOCA 2ZM6K 2L3QA 1RDWX 4RGRA 4JLGA 4D5CA 3UA6A 2A5YB 4UVCA 1G4DA 3EH1A 3NHNA 2MI6A 4HZFA 1O13A 1FP2A 2H09A 1MGQA 2KZZA 2VG5A 2A3ZA 4HUEA 2COZA 3UA7A 5JS2A 1BIZA 1IZ1A 3KZZA 4PJOE 5B5EC 3IH4A 2RHZA 1FC3A 5IP7J 3J8AA 2JG6A 2E2JJ 3CCJQ 3AL0C 4HOBA 3CD6T 1BCOA 1WBDA 4FJ7A 1YJ9T 2RJEA 3HPOA 3CBMA 4QOZB 1BIAA 2DPUA 1FP1D 2OTLA 2CKKA 1QPIA 3AG3H 2ITMA 4LC9B 2QF7A 1N3AA 4CEZA 4E7JA 2KFDA 3ME9A 4XLFA 3KP7A 1UOCA 1HU0A 3SJHA 2MD5A 3I53A 3I35A 4OVAA 4JI0K 3DEEA 3PIPA 2A40A 4M7DD 3FIFA 3GX4X 2YDLA 3CC7N 2R7OA 2NRTA 2A42A 2HXIA 4YTLA 3JCMJ 3LM2A 3WQUA 2K7AA 2C6YA 1N33K 4ID5A 2H27A 4GLMA 2PN6A 2M5WA 1YCSB 5HS8A 4HEA2 5DM7F 1GCQC 3ZQ7A 2RK2A 3THXA 5FFZA 4MZTA 3WVEB 4LD0A 3GTQJ 1RTIA 2F8SA 4Q47A 2D0PA 4DV0K 3LPUA 4BXXJ 4M75B 1VQMT 2YLBA 3JTHA 1G3WA 3MKZA 2A3LA 3HP6A 1W4SA 2CH4A 1KZHA 1F5TA 2V1DA 1WFWA 3LH0A 2RNAA 2RHKA 2IJLA 3A8LB 5AIQA 1BL3A 1K73O 1ZSZC 2RJCA 4RTFD 1S6QA 3M8JA 1IGUA 3VS3A 2W4SA 4U0WA 2EVRA 1VYTA 1X2QA 2WAQA 1X19A 1YHQI 2HDCA 1NGHA 2L2OA 3CCLI 4MFBA 3QUIA 2YX6A 3R60A 3KBGA 3PX4A 3MN5A 4ENNA 1FOKA 1LWCA 3UNGC 4E7ZA 5KYNA 1BO5O 2FSKA 2WC9A 1KQSP 1NKUA 3CCQN 3ZEUB 4L5JA 2Q1ZB 3QETA 1U49A 2QWWA 2D5VA 2RHYA 2E6MA 1SQKA 1UAAA 4HA8A 4RB1A 2YHWA 4M6XA 2VYTA 2IGKA 1HW2A 1VQOT 4GDFA 3HHTB 1KU3A 2JWKA 1EV7A 2BKDN 1B34A 2FBHA 2EFOA 2E1HA 1KQ1A 4NXMK 3CDHA 4KTZA 5HRRA 3QSUA 4GYGA 1R71A 1ZSZB 4H4MA 1Y8QB 2RK1A 2E5QA 1S22A 5DUIA 1D5YA 5LJ5d 3G0ZA 3BF1A 3CCRN 1VSFA 1B59A 5JHFA 5C4JJ 3I3LA 2H6BA 3LSRA 1GLCG 2E2OA 2XY8A 2JHNA 3IV5A 2M34A 3TDUC 4JZ4A 4XH1A 3RMSA 1DUXC 2L7KA 3HSRA 1TYQA 5HLHA 1XGOA 2NRHA 3M0SA 3FISA 2RNGA 3RMDA 1QZZA 4XIDA 4JHDA 2KAFA 4DR5K 1BOAA 4Y92A 2RQVA 3ONQA 1S9GA 2DMNA 3ZSQA 3D7SB 1HKCA 3KYDB 1SFEA 4IEJA 1I4K1 3I58A 1JXSA 4DR4K 3ZGKA 2WBNA 4B08A 3G6EI 1E3OC 1RDDA 5HODA 1XNQK 4JD2A 4QPQA 2X4JA 4II1A 4EAHD 3GTMJ 3KUFA 2F1LA 4AUXA 2FNAA 3CFOA 2HD0A 1TKXA 4EV0A 2W40A 4EVVA 2HVSA 3K59A 2LF8A 1DU0A 3O5BA 2JM9A 4CGJA 3K5MA 5GTHC 4CD1A 1KQSA 3P39A 5DTDA 3BR2A 3G25A 1T0FA 2FO0A 4EFHA 2O88A 1RILA 3A0HC 1IKYA 4PKHA 3HSEA 3CXCA 1YUWA 3SQ4A 1JXMA 2QWMA 5L3BA 4A3FJ 3HKZA 1N9RA 2NNWA 3WXMB 1V76A 3L00A 4WXDA 2HBWA 2IC3A 3CMAA 3I56A 2GELA 5D5XB 1RT3A 2E2PA 3FK7A 4CZGA 1X9MA 4CDGA 3L2UA 2CGHA 2MCNA 3E6BA 3MZ8A 1P7MA 2PFUA 4EDUA 3TR8A 1IBMK 2VN2A 4DR7K 1T3VA 2HSTA 4JKEA 2YUSA 2E1OA 1BA5A 4N41A 3CTAA 3HRGA 2ZF5O 5GAOp 3K70C 3QYEA 2KXDA 1YHQT 4FJMA 3ALYA 5CQXA 3CCLT 3JCMQ 1XHZA 2IGNA 1IKVA 4CJ7A 1U9OA 3WEEA 2EZLA 3ZLJA 3FXQA 4M77E 3VRZA 1YF5L 3H5RA 3CPWM 2QVOA 4RAYA 4JX6A 3CC2T 4G9ZA 1BL0A 3ROUA 3VTHA 2GIVA 5FGMA 5GAMg 3FJ5A 5IT3A 1YITA 1TQIA 3IH2A 3KE2A 2ZJPF 3LAMA 2IAIA 3HEFA 1UA0A 3AG4H 2GWKA 1N5ZA 3I55Q 4JJNK 2EBPA 1I3AA 2MBFA 2HNIA 4EMKA 5L8RE 1ZK8A 5AZJB 4GVEA 2GOMA 1Q86U 3HRSA 4HT9A 3J7YP 4FL9A 4L0YB 1J9IA 3KYLA 1S1NA 4AI5A 1QVFA 3CF5F 4XU1A 2HZTA 2X6WA 4OLBA 2IW5A 1QO0D 5HS9A 1VQNT 2DO7A 3U4LA 4E47A 4ITVA 4RW6A 1TU0B 1WGXA 4M3DA 2EKHA 1GLAG 5ICCA 1M9SA 2O8XA 3ISPA 4I99C 4DOWA 4BEHB 1VQ8N 4X65K 3RSEB 2CYZB 4A5AA 1R1UA 2NRRA 3NFAA 4DR6K 2P0PA 1VQ6I 5E8IA 3K4JA 1SKUB 4B22A 3MKLA 2DEUA 2QKBA 3WE3A 4DLEA 5LY3A 3SYZA 1R0CB 3SUNA 3F8BA 3OA6A 3WNFA 2L7ZA 2ZSHB 2M7BA 1DTQA 3EYYA 3PFSA 5K7ZA 1B92A 5J39A 1JJ6C 1XQPA 4KFBA 1E6HA 2BZYA 3E1YA 1GV2A 1I1GA 3G6ET 3LCNA 2AHJB 4X1VA 3AO5A 1WXUA 1I0CA 3E6MA 4GY2B 1DJ7B 2Y9ZA 3G73A 4IUUA 1L0OC 2P51A 3S17J 2W82A 3J7AP 1SD6A 3JB9J 2ROTA 3LQRA 3OIPA 1IV6A 3IAM2 2WONA 4DA4A 2GEMA 5IWAK 3T69A 3QDKA 2P9SA 1V5FA 1JXBA 1XDSA 5GAN5 1X3UA 3QIOA 2LX9A 3CWTA 4QIWN 1E2XA 1WXTA 2E4LA 4M3YA 5FU6C 4JUVA 4FJIA 4HNVA 1TWCJ 3TOAA 3INZA 2CV1A 1KG1A 4H0EA 1S6LA 1AWJA 2DE0X 4IWVA 2JMWA 2ZJ2A 4HAMA 1Q9XA 4A4KA 1RDAA 4FLXA 5GP9A 3CPWS 1QVGP 4J9CA 3SPZA 2BVLA 1U04A 1HBXG 3H41A 3OSFA 1H9TA 1DGKN 4NHJA 4CD3A 2OFIA 5E3LA 2O31A 4YFUA 4CHUA 4B9LA 1UJYA 1NJZA 1NLOC 3VQ7A 1B8IA 3O1BA 4OO1J 3CYMA 5AZIB 3MZYA 4RAZA 1A31A 4FW1A 4DFJA 1FPQA 1PU8A 3PL8A 3E9FA 4J9IA 2Z1DA 3ZQQA 1KHIA 3X2QH 3SCXA 4DV6K 1YJWQ 4MDAA 5C2DA 4IDKA 3CCUQ 4CK1A 1N77A 5ICEA 2K6DA 3QXEB 2ZBKA 3CC7I 1WHLA 4ILJA 2FLOA 1W1FA 3F8NA 3L2QA 2HNZA 1Z77A 3JB9F 2X3XD 3EZWA 5DM6L 4CF9A 4KH6A 3CJTB 3KNTA 2E1ZA 2QBYB 4C92F 1JLAA 2EQRA 2X1EA 3LP1A 2QEXQ 1R1VA 1WYXA 1XQSC 5J4VA 2E19A 5KYWB 1QPMA 3TMOA 3Q3SA 1JE8A 1SUQA 2W1OA 1PRMC 1VI0A 4EMHA 3KIOA 4AVZA 3LFUA 3F9MA 5ADXH 1PU6A 1KC8O 1UMQA 3E9LA 1U2WA 1RI9A 2FBVA 3OS5A 4BY6C 4O8KA 2BUPA 4F7UE 4MLHA 1VQ7Q 4M78A 1I6XA 3D2FB 1X4PA 4M78D 4ESJA 4L5IA 4HPQA 4JKHA 3G1MA 4BWJA 4LY7A 1ZBSA 2FZKB 3FHGA 2RI3A 3J80O 4ZTJA 2V1UA 1VHXA 2XB0X 1IXSB 2KP6A 1MNDA 3GWZA 1RAAB 3BW1A 4YPRA 1KG6A 2CSIA 1WAFA 2VIXA 2HQ5A 4MLOA 3SI6A 1XCVA 3AA5X 2PYLA 1VQ6T 5KH6A 3JRGA 1YIJN 2O8FA 3LYIA 4MNUA 1FWZA 4D9JA 2DY4A 3OYYA 1CF7B 3GW2A 4OB2B 3NAUA 2GGRA 4LGWA 3SQNA 4J9DA 4FSSA 2WSFE 5KE2A 1N6QA 4XRFA 3N5BB 4A3BJ 4BY6B 2LNVA 3IWZA 4IPAA 2ISYA 4V19S 3ZSRA 2YU9J 3DFGA 2P4RA 3A02A 3OH6A 5L3FA 5L3GA 2IA0A 2FPDA 1JKQC 3SBTA 3V9SA 2Y4YA 1Q82R 4LG0A 4H0YB 5K5RA 4UUVA 3M55A 2HHVA 5EEHA 4F3QA 3VEWA 4CZFA 3TW6A 2QGUA 2KRFA 4EJVA 4WTOB 2ZXHA 1LOJA 1POGA 4L5EA 1VQKA 2MF2A 3JSPA 2K9MA 2JVHA 2BTTA 1A0NB 3EQLF 3BP8A 1HNZK 5AQFA 3M8QA 5CY4A 4BACA 5ED4A 4JP0A 4ZN1A 3JSMA 3HSBA 2XKOC 1ZBHA 2OZ6A 5JLFA 1RNLA 2M9HA 4M75A 4M75D 3VGMA 4DW6A 1C1BA 4B1ZA 4ZHRA 3HFOA 1B9NA 5AQNA 1K73C 2LJ1A 3NTKA 1KG5A 3FDYA 4FK0A 4CC4B 1ZBIA 1T33A 2Y1IA 5GAEJ 1R23A 2EW3A 1BQMA 3S93A 1IXDA 1BC7C 3HTRA 3CCEA 3HPGA 4D1QA 4XH5A 2B8AA 3X28B 3VQ6A 1GBRA 3CC7T 1KG2A 2XO7A 4XK4A 4RCHA 3CBPA 5AQMA 1B9DA 3A5LC 4BRPA 4JYKA 1TUUA 5EG2A 3MXIA 2A5WA 3ZEUA 4R5PA 1GCQA 3KCCA 3H3OB 4LF8K 1FTTA 1HNXK 1RAIB 1V4SA 1JTYA 4EIKA 4BQNA 2MSYA 1VQ9A 5C6SA 5FKLA 2X6YA 1YJ9Q 4CEAA 2QWQA 4DR2K 1N36K 2EH3A 4IRIA 2BBYA 2EX3A 2EPDA 2W00A 3LW5E 4FPBA 4GKKK 2L0KA 1KFZA 2HB5A 1JO8A 3IG1A 4J8OA 4OIQF 5ICGA 4G6TB 2DTZA 2BY1A 3MFKA 4CW7B 3MN6A 3V9UA 1WKMA 1VQPI 1RT2A 2QQAA 2H3JA 5HK0A 4XTYA 2A6HF 4WQ4C 1XPXA 2DA1A 4U7BA 4RMNA 3PIOF 1I39A 4EGZA 1KFDA 3CMEI 4LSNA 2FEIA 3THVA 1G83A 2KIFA 2Z3YA 1XSDA 3QPSA 4WWCA 1ETYA 4PQUA 3VW4A 2KFNA 1U06A 3ZT3A 5GAGJ 1IO6A 1YJNQ 1GT0C 2EK5A 4PHTX 4PFOA 3D45A 4DF4A 2EFWA 2GWRA 3CCYA 3AG2H 3CCQT 1TW3A 3WGIA 4M7AC 2Z16A 4BRCA 1NYFA 3E5QA 4Y3OA 4JI2K 2KI7A 4JI5K 3MP6A 1KONA 5GAMf 2EV6A 3I0TA 4AHTA 2WY8Q 2P9LB 3QZ9B 3PV8A 2E1YA 1TQMA 2R7XA 1MMAA 3JS6A 3BPXA 2HU9A 5IYBJ 4PJOG 3NPFA 5B1AH 3HYIA 5LEJA 3FRNA 4HX4A 2NUZA 2XUBA 5I11A 2JS2A 4B9WA 4M7DG 2MW8A 2DMTA 1HW5A 5KYXB 4HWIA 2DRKA 5C24A 3SEQA 4ZGJB 2L8DA 3TAGA 2O5RA 4RM2A 4KI4A 1I94K 1C0FA 3CCRT 5HL7L 5HDKA 3URGA 4BHPA 3KKRA 3OR2C 2X1DA 5GAN2 4DTUA 3MWTA 1SMTA 1R0BG 1E17A 2ECBA 1SSFA 1KLMA 1VQ8I 2QWPA 1IF1A 4MEYF 5JLXA 2MA3A 1Z91A 3CVSA 3GTOJ 4M7AB 4CCLA 3S15J 3FLGA 2CGKA 1KAXA 3S8PA 2JZYA 2LCLA 3ASOH 5IN1A 5D7UA 3THKA 1UHWA 5FKNA 3IUOA 2ROLA 1Z9CA 1S29A 4N4GA 2O8CB 2V8JA 3QEXA 3SQ0A 1NLPC 2R7QA 1Y0UA 3E1SA 5E84A 4KGVB 1R49A 2P9KA 3J80K 3I64A 4YY3K 3LDOA 3HK2A 2RQTA 3BG9A 5GAMj 1S1XA 5C42A 4BQZA 3FR0A 1YI2N 5DYMA 3E6CC 3NAEA 2EHGA 2DMPA 1XGMA 5GAMd 5GAOq 3RZOJ 4KB1A 5D4RA 1ZLJA 4DQSA 1XQOA 5JR3A 2KLOA 3DI6A 1PP7U 4K25A 1TP4A 2O6GE 5GANe 1G2HA 4PNOA 2QASA 2H8WA 4BGBA 2E64A 2HL3A 1OJLA 3JCMf 4DBHA 1JUSA 3PX0A 1XG7A 3TDZC 5GIPA 2HQAA 2JPSA 1VQ5N 1W5TA 4UB6C 5CVVA 4DTSA 3H35A 3C0CA 1BGXT 4PY5A 4IO9F 3O9RA 4P5OA 3TKYA 3BFMA 3R1XA 8AT1B 1LWFA 2HPMA 3FBNB 2TRTA 4FLUA 2HOEA 3SQ1A 4BRDA 5DCFA 2Y90A 3K0SA 3BCAA 2DJIA 5K5QA 1P9QC 3MEUA 2AQEA 3CETA 4A0ZA 4A3MJ 4OPAA 2DBMA 1JT0A 4ISEA 2FG0A 1NTCA 1VQPT 1M1KR 4E2FB 3FZFA 1QZYA 1NGBA 4BD3A 1KQSM 3VEZA 2NAZA 1JCGA 1XSVA 1VQ4I 4E1MA 4ZYDA 2GX9A 2FQ3A 1JKOC 1XDUA 1FT9A 2A36A 4B3MK 4CUGA 2B9SA 1LFBA 2MAMA 4BEHA 3RSEA 4FSVA 4PFPA 1W0HA 2J05A 4ZN3A 4C8QC 4FXDA 3FX3A 5LL6Z 4XTVA 3HUGB 4YIIA 4I0AA 1LVKA 2WAQN 4RTZA 3A5OC 2DMUA 1TS9A 1ZG1A 1EA3A 2ASOA 2YHYA 5IOYA 4HV5A 4KULA 3JCMV 1TK5A 3M4OJ 3K7AJ 1KD1C 3H5AA 2B6AA 4OINF 5LJ3h 2DCEA 1WNLA 5FO5A 1Y97A 4IJAA 1HXDA 1B9FA 2D5RA 3JCMd 2LCCA 5JI6A 1YHQQ 3ULQB 3CCLQ 4G7ZF 3P5JA 1JTXA 1LWVA 3JRHA 3CCMA 2QGGA 2I2LA 3W6VA 1X3MA 5CZ1A 1KCFA 1IBKK 2WSCE 4YELA 1IN6A 3PSFA 3KLFA 3CCJA 3FC3A 5FPMA 2KRSA 3WHBA 1VQ8T 4B8AB 1YQRA 3VS6A 1J59A 4FOIA 1PG5B 2F5KA 4DLGA 3VN5A 4BR9A 2XAQA 3QNOA 3C6TA 4RS8A 4CJRA 3NH2A 4HV6A 4I7HA 3NF6A 3SJJA 3E19A 4IO8A 2VC8A 2GOXB 5AN4A 1NJIO 4RM3A 2QQ9A 3CDIA 4XLAA 4AIDA 3AFHA 4U87A 3P8HA 4X9CA 4A3GJ 1QSSA 5AQQA 1YP5A 4BRNA 2UUBK 3C6AA 1K73U 5AZIA 2TCTA 3DBHB 2ZO4A 2MOXA 1QQMA 1GV5A 3IKVA 3ZQFA 4P96A 4I76A 3N4QA 4XONA 2CWEA 3HM5A 5KRTA 4MMLA 1ULYA 3QP5A 1JKRC 4EVIA 1HK9A 3B6PA 5AQZA 4HYEA 1IUFA 4XNFA 3O3FA 2H3GX 2R5YB 3G1JA 1BA1A 1DT9A 3BF3A 3CM6A 5CQGA 4FX4A 3Q7BA 4GW6A 2A6EF 3M5RA 4F7ZA 2QBYA 3MEDA 2GQQA 1W70A 3MXMA 2HBJA 1R5GA 4OKKA 1BWFO 3VU3C 3SZTA 4Y0WA 1MBJA 3CESA 2VG6A 4JV5K 1S5LC 5KYWA 2KKZA 5FLMJ 4G9YA 2RA2A 1GFDA 1WJDA 2P9IB 1N5YA 3Q7CA 2QKKA 2O8DA 5FPNA 2PBDA 4LK1F 1OISA 3EKUA 4I6ZA 1DP7P 2LQWA 5AQGA 4A61A 3H0IA 3CC2A 1YT3A 1XCBA 2DA2A 2ASMA 3D2FA 2IVOA 2KRMA 3HKZN 4LSLA 4FWNA 3OJUA 2P5LC 1MH4A 3UIQA 1K6YA 4M3BA 1VQ4T 2DFIA 4ZGDB 1JL1A 3ISNC 1EWQA 4DZJA 1QZEA 3TO9A 3A8HB 4GRIA 2XC7A 3HOZJ 2SRCA 5ICFA 3L9FA 4FWRA 1DGWY 4H0VB 5E26A 2IP2A 4F04B 4A6EA 1VQNA 2GV9A 1IJWC 2F5CA 2AIRB 4WYBA 3RRHA 1PC0A 1W1WE 1G3SA 2YRVA 3FHFA 4ENMA 2W24A 4PJOF 2A0FB 3FB9A 2ZD1A 3OYKA 1CF7A 4FWOA 4C9YA 2XICA 3CJRB 3IFRA 2RF2A 3S9HA 1UJ8A 3FDRA 1TL8A 2M1BA 4M63C 1D1AA 2A1SA 3O2PE 4CIFA 1NGDA 4RW7A 3TU4K 5H2FC 1AWXA 4LB6B 3OMGA 4RBOA 1W2BP 5AQPA 1MKMA 3F8MA 4X6AJ 3QO3A 2E1CA 2NRXA 1YITN 2DTHA 3ER0A 2QYZA 2JT4A 3ENBA 2GQVA 1FMWA 3BR3A 2GXGA 3UB5A 2LZ6B 3NMUA 3FMRA 4IUPA 1UGSB 2DPPB 2W04A 2FOKA 1OCPA 1AVZC 4F2RA 1VQLI 1BISA 5KRSA 1FYMA 4R8HA 4DTOA 3M3YJ 1HLVA 3ENHA 3C0BA 3SQ2A 2IRFG 1JKHA 3C18A 2QAZA 1YIJT 4YIRX 4BKXA 4C2TA 3LANA 4CC7A 1C0GA 1VRUA 1IHWA 2I5WA 2QLZA 2EIKH 4FLYA 3SWNB 2HFHA 2RKIA 4B1RA 2OPQA 1NBEB 4BRQA 4OOIA 3D6RA 3OYIA 4CO8A 2D6FA 2L2PA 2KIUA 4BC2A 3OW2A 3KLEA 1OQYA 3CHWA 3JV3A 2W10A 4KGXB 3TP0A 2JUFA 2NVXJ 5L3DA 1UFFA 3TTDA 4JZ3A 3LL7A 4BG9A 1AHDP 3K4NA 2CJJA 4OIOF 2FRWA 3O6BB 1QQOA 2WOMA 3ATVA 4DSJA 1R4MB 3DU6A 2IDOA 3PM1A 1Q95G 2ELHA 2F6CA 4AYBA 1Q7YR 1T95A 2P0QA 2YNGA 2DMOA 1FOXA 5AQOA 2ADUA 1JJ2P 4FETA 1BI0A 4FM2A 4L8RB 4LIVA 4JPBW 1QVGM 2H94A 1VQ6Q 1H1VA 2RJFA 3TANA 4XTWA 1JLCA 1A6IA 4AD9A 3J7AY 1D5VA 2W42A 2JMAA 5J8FA 1T2KA 1QA6A 3N4PA 1H8KA 3FMQA 2LCSA 2XKOA 4CJFA 2DTIA 2BTFA 2EIJH 4LDUA 1H89C 2QTXA 4N4NB 1NGAA 5CKHA 1K4US 4OX9K 5AQTA 5C3EJ 2A08A 1MU2A 3BC8A 1QBJA 1W2BA 5AJ3K 2GA2A 2ESHA 1FYLA 2L9NA 2XU8A 2CS3A 1FJLA 2CUFA 3VYSB 2LMJA 3VESA 3SZ2A 4WX9A 3IH3A 2X9DA 4CGGA 2K3XA 5FKMA 1X69A 2DXBA 1FMKA 1X2NA 5EX5A 4U88A 2QGFB 1C0WA 2OA8A 4FK2A 3N05A 3THWB 3NRVA 1QNTA 5C44J 2H3EB 3M8SA 4E3SA 3UKGA 2V4JC 4CJQA 4XLPF 3P83D 1D8JA 2DVEA 4C8QF 1O57A 5FPEA 2OTLI 3I55A 2JZ2A 3JRFA 4DV1K 4UY8O 4CHQA 3LP2A 5A0GA 3EY1A 4BRFA 3E0JB 3GDQA 4E7SA 4BDZA 1FBSA 1X6BA 2FXUA 1NZ9A 4R55A 3OGDA 4Z02A 4IEIA 1OKRA 1V55H 4A5NA 2F9TA 2P9LA 2P7CB 2CP5A 3QWYA 3AVHA 4S04A 1ORNA 2JUGA 1EBMA 1EP4A 3UWNA 1K4TA 3GEZA 3AA2A 3DM2A 1UFMA 4OWRB 1PHTA 4A5BA 3M0UA 3CPEA 1RRQA 1B3QA 2QWOA 2PZ1A 3HC7A 5CCAA 1V54H 3ZMVA 4A63B 2B5JA 1LKXA 3SJMA 1KD1U 1SG5A 1Z26A 3TEDA 1KTQA 5CO7A 4RUGA 5KYXA 3NARA 4KHWA 3GYHX 1WHJA 1JJ2A 1XSXA 4WQ4A 4YOQA 1KYZA 2RAEA 1QKWA 2X0LA 4DNCA 1IDYA 3QODA 3CC7Q 2FBYA 1TTHB 3K9JA 1YO5C 1IKWA 4L0ZB 4KA4A 4DYQA 2AQFA 2HWVA 4XIUA 5GJWB 1ZUYA 4YOYA 3HBLA 3M0QA 2LTOA 3RR7A 2IS4A 4A4GA 3QEPA 1X1CA 1MJ9A 2WV0A 5F04A 3VEPA 3ZQHA 3NTIA 3OYJA 4FZXC 4MQVA 2E36A 4AHRA 2EQMA 1QVGS 3E5XA 3H1VX 4DV2K 4C0FA 4HT8A 2DDAA 4IHVA 3EN9A 1T56A 2GNCA 1LNWA 1MSEC 3L42A 4B44A 2JRTA 1JJ8C 1W0TA 2YNFA 1M2OA 4ZJZA 1U48A 1ETVA 1RT6A 2VJ4A 3TTCA 1RI7A 5FU7B 3H36A 3O5ZA 1BOTO 2O8CA 3MMVA 2RHIA 1HNWK 4Q5WA 3HO1A 3I9V2 2NUTB 4Z88A 4X62K 2GM4A 5D4SA 2A5XA 1N27A 1UHFA 4IXCA 5AFUA 4JI1K 4ISFA 2XAHA 1K8AR 1M90R 1BHLA 1R36A 1Q1VA 2Y69H 1ETXA 2VWJA 2F4IA 2NOZA 2VE9A 3M1FA 5J3BA 2KHOA 4D5FA 3LP0A 3K9KA 1GLBG 1A5WA 4M77F 2E6LA 1TK8A 3IHUA 3H92A 3AGKA 4UUSB 2DTOA 4JI6K 3CJ1A 2COYA 2RQWA 2IPOB 4LF4K 4J9BA 3V7CA 3BWGA 3VYTB 1HF0A 4YPHA 1WGSA 4HCBA 4XN3A 1Z0XA 1HLUA 4WCGA 3F23A 3TWHA 3H1QA 2HEOA 2CUDA 4F4KA 3EUHC 2WACA 4QS7A 4Z4IA 1YJWA 1X1BA 2X6OA 5J1RA 3KZIC 3BZCA 5CQYA 2YSQA 1VQKN 3T9NA 4OAYA 3R0JA 1V4TA 4B1XB 4M3EA 2EBIA 3BG6A 2HBMA 3JAMZ 4BI4A 3VQ8A 5CKEA 5GMKe 2MC3A 2ED1A 5CKBA 2YS9A 1WJSA 1AZEA 4BR7A 3F9KA 3QPLA 1YI2T 2KT0A 4NS5A 1T6DA 1FOWA 4IOCL 5KHDA 3FGUA 2NVTJ 2VE8A 5KK1A 1FX7A 1WZ2A 3OIOA 2OZUA 1RBTA 2CZ1B 3SMPA 1RT5A 4G8XA 4B43A 1Y0MA 4RMOA 1VQ5T 4H5WA 3TSQA 1UHMA 1X1AA 2D8JA 4I7FA 2UWMA 3GG4A 4AQYK 3ASMA 3H3UA 3G71I 3LPTA 1RETA 1NGFA 3VFZA 3CCQA 2O4XA 5J47A 3QMLA 3BR0A 2PVDB 1G5VA 2COWA 2HL5C 1RBRA 4CF0A 1N32K 4RG8A 3CWAA 1K73R 1J53A 3ZT0A 1MMDA 3IL2A 5I9EB 3CMAI 4HW0A 5HDNA 2VCPA 3I56I 4Y52J 4FHTA 1TWGJ 1TTYA 1JLEA 2QTVA 2YKMA 4QWQA 2LYCA 3K4KA 5GANg 3DKXA 2QSGX 4G1QA 1WHHA 2F4OB 4I09A 2LR8A 3LX7A 3VS1A 1OH6A 2UXDK 3CCRA 3BDDA 2DI3A 2RHUA 4J5YA 1RI0A 3EO3A 4N0AC 1WOQA 4L18B 1QQJA 4PWDA 1GLLO 1D0ZA 1KYWA 4AIHA 3M0RA 2OPTA 1X58A 5CVJA 2JTVA 3IP4B 4CGZA 3AVLA 2DX1A 2QXFA 4O5BA 1YIOA 2L9VA 4CIEA 4AFQC 3EUKL 1S72A 2YHXA 1YLFA 1VSLA 4A59A 5F27A 3PIPL 1OYIA 4CRIA 2O61A 3V4GA 1T8EA 1VQPQ 4A69C 1VSKA 4XU0A 4UC4A 3D5SC 1WJBA 2D0BA 1Z05A 2P4TA 2MABA 1TWHJ 2STWA 2E34A 3CMEQ 2ZWHA 2L54A 2K9GA 4R1HA 1YITI 4CC2A 1Y39A 2QKMB 1T39A 2RN7A 5H6RA 3CBOA 4CF2A 2XDVA 2C0TA 2R5YA 3OYEA 5C0MA 3Q5FA 2RH2A 5BOXA 3QJ6A 2KSSA 4BRKA 3ABLH 1WSFA 2P9PB 1FZPB 2LT1A 1X9JA 4OB0B 3CG7A 4RW4A 3TARA 1RZ4A 4HHTA 1OU8A 2HBLA 1LOTB 2NZTA 1VF9A 2LTPA 3CQXA 2P9IA 2NOHA 3ECOA 4C92D 3WHCA 4C3IJ 3VKIA 3AVJA 2EFNA 4KBMB 2E70A 2VPLA 2ETJA 4CHZA 2NOLA 1X3NA 2WUSA 4F7UF 4L59A 4XKCA 1WH7A 1GXQA 2X48A 3BDUA 1WN7A 4KUIA 2DA4A 3RWUA 2FEZA 2XSDC 1SRMA 1REVA 4M7DC 2IPQX 1W5SA 3V8KA 2AKKA 2O9VA 5CYVA 1Y1VJ 2VXZA 2UXXA 4A3CJ 3D5LA 3WNHA 3K1MA 4DV7K 4KH1B 4BG8A 2PI0A 2YXYA 2J06A 1RL2A 3P1GA 5AQSA 3FXUA 1U4BA 1TZLA 1MUYA 4CERA 3HOTA 1GLFO 3F0CA 2X78A 1JUPA 3EDPA 1Z9ZA 2LQKA 4KRTA 4E7IA 2F96A 2HF4A 3SB2A 2VT2A 2PVGB 1STZA 3ZQGA 1VSJA 1ZGWA 2RI2A 2HMIA 2PZSA 4XKVA 5DS9A 2FHDA 2OTJN 2FNPA 2UXBK 2KQ2A 1EXQA 2CT3A 3SFMA 3VQCA 5GADJ 3CFRA 2PU9B 4Y1CA 4J9EA 4YOWA 3W3CA 3S2DJ 2R7SA 2X51A 3KLHA 3RTVA 4GV9A 3QWLA 3RPUD 1TAUA 5FLXO 1GUUA 1P4XA 1VNDA 4E9EA 3HL8A 3CJNA 4M7DB 4XICA 3GTLJ 4HUGA 1YAGA 3M6GA 4P1WA 2L0AA 4FM4B 4CF8A 2WBMA 1PDNC 4JEPA 4WQ5A 4JQFA 4WK8F 4CZJA 3RIRA 1L3SA 4DHYA 5KI6A 2G8FA 3P8DA 3THXB 2Q97A 4KMUX 4WFBL 2CP7A 5LMUK 3GPLA 1WI9A 4ELUA 3DRPA 4CBUA 2JA2A 5E1ZB 2GUIA 3LSGA 3VEOA 3EG9A 5M1KA 3SWNA 3TVTA 4CFDA 1U3OA 2HHWA 3MP8A 1ZBFA 4FPAA 1HJRA 1RUWA 2O4IA 1WZOA 3EUAA 4HTLA 1UELB 1J5YA 1H88C 3W6KB 5D5UB 4KHQA 3G4SI 2VI6A 2K5LA 1KVBA 2Z99A 1X01A 1VQ4Q 3H9GA 2M2EA 3QOEA 1YFHA 1K9MO 1UA1A 1G8XA 1YITT 2OU2A 3GNFB 3BY6A 1HJDA 1GLNA 3HVTA 3KK2A 3CCVA 1WUAA 1XUPO 2QUFA 3I4NJ 3GFJA 2HQRA 2VB6A 4G7HF 2ED0A 5CPRB 4Z4FA 1R77A 1JL2A 2EJGA 2GFAA 4LIUA 3VS4A 3CC4I 1TL1A 4CJ4A 4A54A 4B3SK 3S16J 2JT1A 4CEDA 2PUKB 4FK4A 3C2BA 1HUXA 2XDPA 1HKTA 4II3A 2X4YA 2NXNB 5GMKl 4DU4A 2BW3A 5E8GA 2NOBA 2Q2EA 3H6ZA 1B34B 4BXUA 2HTJA 2EJFA 4FYVB 2R5AA 4AI4A 2UZKA 4ENKA 1IHVA 2KVQG 1LDJA 2EV0A 2F48A 3GTJJ 4PUSA 3KP4A 2DZCA 3CCJN 2EAYA 2F69A 4RGXA 4EGYA 4QQGA 3JAME 5KCMA 1SHGA 5F0CA 2YPRA 2LJ0A 4DBFA 2HBKA 4DU1A 1PP8F 1EX4A 4C23A 4OPJA 1X6OA 3O80A 1MUNA 4HNUA 1ETOA 2BZXA 4DSKA 4N76A 2DYBA 3THWA 1NGEA 2O8EA 2XK0A 2UXNA 1KO9A 1FW6A 1H641 1BIBA 2EIFA 3FBIB 1T3SA 2DJQA 1TKDA 1T0FC 2YNIA 1IRXA 2FJ1A 3L4IA 4N47A 4B8XA 3GP8A 3CPWA 1Q18A 3PIOA 2GLOA 4JHDB 4XLEA 4A3DJ 3TQ7P 1B9MA 1H3HA 4A53A 2IXSA 4XH4A 3CCSA 1BR4A 3NE6A 3VA0A 2XY7A 1N8RO 3UDCA 1P90A 4QW2A 4CE9A 1IRFA 5JFRA 3DPUA 3RNJA 4JS4A 2FU4A 4PZJA 4F3OA 3L3UA 4BB7A 1XTAA 1A36A 1MA9B 3LSTA 1U6ZA 3OVNA 1KA8A 1PU7A 1VQKI 3IRQA 5LMNK 2OBPA 4NZGA 3V1QA 1QS4A 1KFSA 1JLFA 1RDBA 3CJBA 3BEXA 1D9FA 5AQYA 2UU9K 2WB1A 1TNSA 5EC7A 1I8FA 5C4XJ 3X24B 3VB2A 3RDIA 4E4HA 3D5RC 3KLNA 4BWMA 1MBEA 2O8BB 2V9VA 1TUCA 4IOCF 3WGHA 3OYHA 1D1CA 1LCUA 1ETQA 2G7HA 5DDGA 4C3HJ 2B7EA 1GLDG 2DVJA 2VKVA 2JHJA 1FMVA 3AO1A 4I2PA 4WXCA 4IDHA 1IN5A 4E7KA 3CCEI 2QA4A 4A0XA 3I5UA 1W2BM 3D1NI 3HOUJ 1TC3C 4CJVA 3ULRB 1WEIA 2AXLA 4XTUA 2FSJA 3JRZA 4JK1X 3CXCS 4EMKC 4E19A 4EP4A 2IA2A 3HHHA 2KJCA 2PMZA 1T03A 1V1CA 1Q82C 1IN8A 3OSSC 1KC8R 2LKXA 3SUOA 1LWYA 2E10A 2NUTA 4HSTA 1YIJA 2DLLA 2CT4A 1MBHA 4DG1A 4LK0F 1ZBXA 4M41A 4XU2A 2XRLA 5AFUH 2JTEA 1C0MA 2ETHA 2VQEK 5GMKm 2YV0X 4F2SA 3QB0A 1VQ9I 4JRPA 2VBXA 3VQDA 3WEEB 1HMVA 1T05A 2OJED 3IAS2 1LEBA 4HX7A 4EJOA 1QGPA 4BJ5C 1U9NA 3KVGA 4A62A 4Y15A 1E0EA 4KTWA 2IGIA 4UUSA 1R22A 3K2PA 4XM3A 1WI7A 2G8UA 1NG9A 5LHIA 2BHYA 4CHOA 1EZZB 5HK3A 1W97L 4A93J 2CFOA 3ABUA 5A2QE 3IKTA 3MCPA 4L9NA 3U9DA 5LJ5h 4Q5SF 4A3KJ 4LG3A 3RTRA 3TEEA 3GMEA 2W85A 2EILH 2NNNA 2CZ6B 4UV9A 4EMKB 4BU2A 1ZLKA 2BOLA 4FWPA 3DXJF 1Y7XA 2VQLA 3WXIA 2O7OA 2E1MB 4QS8A 2VLAA 3HVRA 3VYGA 2DFEA 4K43A 1QKXA 3PIPF 4NCBA 1JJ2M 3T1YK 3HOWJ 2VC0A 4WXHA 1P8ZA 2FMLA 2L4AA 4DSIA 2DIQA 2WSEE 1ZAOA 2F4MB 1ERDA 4EJUA 2JWLA 4CA0A 4KISA 1S6PA 5AQJA 4U7DA 1VQLQ 2V1XA 3DBLB 3QIPA 4ZDOA 3WVDB 4YORA 4WCEL 1SFUA 1MBKA 5LJ5e 1SPKA 3LM9A 3H9JA 2BY0A 5LGUA 2FZGB 1WSHA 1RT7A 4B9NA 3K4BA 3CD6I 3HZ6A 4AYBN 3IRXA 4BYYA 3QIIA 3DPLC 3UR3C 2FA5A 1M1EB 2BIVA 1U5SA 3BTLA 2AP1A 2IS1A 2A6TA 1BW5A 5DPKA 3EUHA 1AU7A 1FBQA 3O8HA 5GANj 1TXQA 1BR1A 2HYGD 3QINA 3VMFB 3GOXA 2Z1JA 1I5LA 4IHSA 1NJWA 2UUZA 2E65A 3AV9A 3WU0A 3ZR8X 2K3YA 1Z3XA 1WQ7A 1VQKT 5I21A 3LA3A 2RB6A 2ID6A 4ESBA 4AG1C 3CUQC 3EHRA 2P9SB 3WTZA 1XGNA 1LEAA 1R9TJ 1ATNA 4ZYAA 2XMFA 3L1PA 2DA7A 1FSEA 2G9WA 1SEMA 4CGFA 4C3JJ 4CZZA 3NEUA 3JXUA 2L3SA 2XAGA 1GOCA 4JBAA 1FIAA 4EMGA 3LFKA 3RYRA 5HS7A 1R7JA 1ZXOA 1R5ID 1QWFA 3FZLA 2XB5A 2O01E 2IAJA 1IN4A 4JK7A 2PAVA 2NOIA 1I3QJ 3QKJA 4JRKA 4CF1A 2L3DA 2LNHB 3P9CA 3J81Z 1ZX6A 4F92B 4XRMA 4OMYA 4F16A 1VQMI 2HZYA 4AVPA 2M02A 3CCET 2ZFWA 5IXBA 1B1BA 1WI3A 2HVQA 4ATOA 1J5EK 1HYVA 4AT1B 4OLAA 4QVDA 5M1NA 4WFAL 1ZN2A 5FDLA 2LG4A 1B8IB 3TL4X 3H0HA 4DFPA 1YTYA 1ZR2A 5LJ3f 3I55N 4A4EA 2NUBA 4E1NA 4CJLA 4QTRA 4CZKA 4OGCA 3JCMc 4M78C 1YQKA 1MV3A 1WH5A 3KPHA 4AF1A 3RMQA 3CUQB 5KE3A 1T98A 1IN7A 2PTKA 2ECCA 2A37A 4ILGB 2AA4A 1HW1A 1MBFA 5HLFA 1C0UA 4YG2F 3GTPJ 2YR2A 4HQEA 5KQDA 2OTLQ 3BG7A 2K4YA 2XV4S 4BBRJ 1YYVA 4Z4HA 4X0GA 3QEVA 2D0AA 3K6GA 4PJJA 2P9PA 4DBQA 1R58A 2LP0A 1JLBA 2K3FA 2FOWA 2XAFA 5DK5A 5ECAA 3MD2A 1RAHB 3JB9H 3ENOA 1VK0A 5ADXA 4N9IA 2RF0A 4CJTA 4CHPA 4U67L 4GKJK 5KN9A 2EQKA 3M3ZA 3VPRA 3F6OA 2LVSA 4JX4A 2JS0A 3HKSA 1EKEA 1RBVA 4M78B 3R0AA 4PFZA 5KYUB 3J80Z 2F5FA 3G0QA 2DDBA 4EJTA 1W6XA 4XBFA 5E3NA 2E41A 1SL1A 5CVIA 5K7HA 3K9TA 1LDKB 4KHNA 3EYIA 1ZA2B 2ICWG 1IB8A 2A68F 5TISC 3VTIA 4E1JA 3ELKA 1BOBA 5HLTA 3GE1A 1J54A 3MX2A 2J5OA 4RAGA 2ZGWA 5HNHA 4M7AE 5KQ8A 3MECA 5LJ3j 1ORKA 1WSUA 2NOEA 2P8TA 2VQCA 3S2HJ 4FLVA 5LJ3d 2L7FP 3LWFA 2M8EA 2O8FB 3IKMA 1YWOA 4BRIA 2FF4A 5HRPA 2FL7A 4HUFA 4J6WA 3RMAA 1XMOK 2RN2A 4BRHA 3CZ6A 2E6NA 1YI2A 1RKTA 4CHNA 4M75C 4NB4A 4J2AA 6PAXA 3CCMI 4M72A 3R2XC 1HX1A 3DLEA 2P6SA 1U6GA 4ZTFA 2VXFA 1VYVA 3CLOA 1NMDA 1M1KC 1SMYF 4EIAA 1PYVA 4PJOA 4NBQA 3ZMDA 3CCJI 2CW7A 4PJOD 1ON2A 3LSHA 3V6DA 4GGGA 4ISGA 2HOTA 4FT2A 2OFKA 4FJ8A 1AOYA 4PJMA 1VQ5A 3MX5A 1TWFJ 1XX5A 3I59B 1JB0E 1K83J 4M7DA 2KMTA 4LG0B 5TKWA 3H3NO 1U2VA 1NPRA 4DZPA 1OCOH 2KDOA 4OIRF 1IUYA 3HYFA 3MO8A 1X1PA 1OCZH 3SXYA 1YJWN 2DFFA 4FJLA 1P7JA 1WNSA 4KDPA 3LAJA 1N6AA 1Y71A 1MW7A 2QXLA 4KI6A 2ZAEA 2OD5A 2X35A 3SUPA 2F5EA 1FIPA 1YFNA 1L3UA 2OTJT 1AHJB 1HQUA 3RPQA 2OQRA 2P7VB 3A8OB 4AMCA 5D6WA 3AGRA 3M54A 3J7ZI 3SEMA 2XAJA 3PUBA 2YT6A 1NJYA 1SD7A 3RI4A 3H9NA 4NL3A 4PJLA 3K5NA 1RABB 1QCNA 1Q82U 3ZPLA 1VZ0A 4FASD 2F9WA 1VQ7N 3EPZA 2ZQBA 4P55A 1ARKA 2VOOA 4OMMA 2FBIA 3FM3A 1JGGA 3MEXA 3J7YJ 2COBA 1BI4B 2CRGA 5F08A 2W03A 1QQNA 4GV3A 2QSFX 3T7ZA 2M9UA 3CC2I 5AQIA 1QRYA 2VKDA 5HNFA 3JB9G 4Z4EA 3OTOK 1YS6A 3KP3A 5TJJA 2HBPA 3ZX3A 2QM1A 3OL3A 3VUZA 3S32A 3HTSB 2CZ0B 2KK4A 4C92G 3OYAA 4YEJA 4YHHK 1K6OA 1UAXA 2R7TA 3TO6A 5LFAA 1RCHA 2A7YA 3G71Q 1IREB 1Y0NA 5CKDA 1J09A 5GJVB 1WHUA 2HTSA 4BRGA 1BI1A 2XHKA 4RTXA 4DFKA 1AA7A 1D9DA 3T1HK 5M1PA 4FISA 2KIQA 1HYOA 3BDLA 1VQNI 3CMAQ 3IQLA 3U1KA 3I56Q 2XHBA 4KIFA 2Y31A 2L02A 3LNQA 1K0SA 3NWSA 1LVAA 2EA4A 5KYYB 2UXCK 4A3IJ 5MLCQ 2XPVA 1HA8A 4C8QE 1TNTA 4DV5K 1L3LA 3W2VA 1S72N 1SKWA 4CK3A 1B6AA 1GLEG 3QBXA 2QWLA 1BQNA 1S7AA 4LDWA 1EF4A 4KICA 3D4VA 2FD5A 1JKPC 4IUQA 1IJJA 3KP5A 2AJQA 2CV2A 3DEUA 5AQXA 4MFEA 4O0IA 4UVAA 1D4XA 2WA0A 2KRHA 4KITB 4M42A 3CCMT 3WU1B 3SHFA 1R8OB 4C8OA 1Z7UA 3AO4A 3FJPA 5IYCJ 1NJIR 1WJFA 1RIOH 1G3YA 3JRCA 3CCJT 1AEYA 4OB3B 3OQ5A 2O03A 1H9GA 5AQKA 3A98A 1NE8A 4NLCA 1D3BB 1YITQ 1LW0A 5L3EA 5CZ2A 2Y0SA 4DYCA 3SAFA 3ABKH 2GTJA 5CIUA 1MUDA 1EO1A 3HL2A 1E7OA 1NK6A 3R6SA 1N78A 5FRNA 1I07A 2O8BA 3NFCA 4QPOA 4ORZA 2EGCA 1V5GA 3J81E 2J6KA 3W2WA 5LHGA 1TK0A 4IKFA 1NM1A 3MWPA 4HF2A 2LQNA 4GVMA 1MUZA 1JHFA 4D7NA 4QSHA 1UUEA 3OBYA 3QO9A 1T8IA 3I71A 4DQPA 1YJ9N 2IVMA 4M78F 3M8EA 3UT1A 4DQRA 2HPIA 1EETA 4UOBA 3BG3A 3EFSA 3ZCOA 2DMQA 1DQUA 2FZCB 1Q86O 1SVMA 2P9KB 1CGPA 2W6LA 4JI8K 1TUDA 1NOYA 1TUGB 4DJAA 2RREA 5GINA 4O55A 3EL2A 4A2BA 3O1WA 2XY5A 1AT1B 3LOCA 3U23A 2IVPA 4K41A 1OH5A 4ELYC 3OS2A 5K1YA 1WEGA 4Z6YA 3GL1A 4KUMA 3F72A 3KZYA 3QESA 5J6XA 2D2WA 3R61A 4LUDA 4IG0A 1YJNN 1Z25A 2KZGA 4E89A 3PNYA 1KAZA 4PIIA 4M77D 1Q9YA 3HGGA 4IUVA 4B9UA 4BL0B 4NDLA 4CH7A 2EQIA 1TWAJ 2HHXA 2ABKA 2Q3SA 4JKGB 2MH9A 4UV8A 2R0QC 2ZXWH 4DK9A 2LFBA 3V8JA 2GF7A 4FJHA 2LQ8A 3AO3A 2PYJA 3M0TA 3I55I 4RTVA 3MKYB 3C2GA 1Q7YC 1V3FA 3A1PA 4OPKA 1W7PD 3M1CA 1WDXA 1MMSA 4ZZLA 1BI2A 1PUFB 1CLQA 2KE9A 2HDWA 2DK3A 2E12A 1EH8A 4DV4K 1XGSA 4K42A 4D0PA 1SEUA 1R6RA 1LMZA 4H5RA 1GHCA 2ZZDA 3BUZB 5HLGA 2EGEA 4AWXB 2AO9A 1X4OA 2VXEA 1KXPA 4ELZC 1J75A 3V4IA 1UG1A 4M75F 3LAKA 2OYQA 3PQJA 1WLPB 1TAQA 5DLOA 5C25A 3QYBA 1R0AA 4AHVA 1LNXA 3O4QA 5DD4A 5HOOA 3ZSWA 1JQQA 3QYHB 1BYMA 3CCVN 5BRDA 3BZKA 3DKYA 1RC9A 1ZC6A 2ZFUA 5GPAA 3DLLA 2EB7A 3T5XA 2D0CA 1PSEA 3E7LA 1HOMA 1DKGD 5FROA 1HDDC 4RTYA 3G4SQ 3AHUA 5AQVA 1M1KU 1TUYA 5GAN6 4XU3A 3AVNA 1Q81O 4UHTA 1S3XA 1K9AA 2KYBA 3LWLA 4B3OA 3EG1A 2A69F 9ATCB 2DN0A 4FE4A 4J01A 1K7AA 1D09B 3OH9A 3GUDA 2KNBB 2AZSA 1T0HA 4OB1B 5GAOr 1EWRA 1IG8A 5DUKA 2LY9A 3QP6A 2LVMA 1WX6A 1TSFA 5D5WB 5AYFA 3EE8A 5E18F 4ON0A 4XSXF 1HQCA 3WTVC 2DXIA 3CC4Q 1V4RA 1K8KB 4AU7A 4CCHA 3DPTA 3TABA 2CGJA 2DF6A 3CQ8A 2GBQA 1M8MA 4KHPK 2MG4A 3ML6A 4N9HA 5BMZA 5I22A 3RJPA 5GAHJ 4F93B 4FTHA 1MSFC 3KTQA 5LRRA 2DQLA 2M45A 2LF7A 3VS5A 4OJRA 2RJDA 3DF8A 5ERIA 2VV5A 4FL6A 2LOOA 3F22A 3CP2A 3CW7A 3HOXJ 3E9PA 2FE3A 1ESVA 4LD9K 3TSZA 3CUQA 3BJOA 1LAVA 3JRAA 1SV5A 3G1LA 2M4GA 5IY5H 3MDQA 3CCSN 2L4MA 1PKTA 4HCCA 2GWJA 1YRNB 3S1QJ 2JGUA 3NGYA 4OGEA 2OPPA 1K61A 1F4KA 1ZKGA 4WF9L 1YJWI 3K5OA 3G2BA 3FK6A 2VC1A 1WFXA 2I5UA 4LLGF 4DQ2A 2P0WA 4BVOA 3VYRB 4B8CA 5LJ5g 2IGOA 1F43A 3ZSYA 4H4OA 5KPTA 3A8GB 3O3HA 1J6ZA 3ZT1A 2K02A 1BDGA 2WB1N 1MWMA 2O8DB 2KJBA 3H6EA 3M8RA 3E2UA 1U5TB 4IHWA 5GAMe 1K8AC 4JKDA 3NQOA 2Q2RA 1M90C 2DT6A 3C3WA 3NMZC 1SFKA 4JI7K 2WAEA 2D0NA 1E3HA 3ZQCA 2A1RA 3I55T 2GAUA 5KYUA 2R7ZJ 5D5VB 4F91B 2QSHX 3FE1A 1GOBA 2X9HA 1B4AA 2M4KA 1JRIA 3HOYJ 3A1YA 1QE1A 2QA4N 4LF6K 4BHCA 4AM3A 4AFZC 4EJYA 4CFAA 3JCUC 3THYB 2WTEA 2TDXA 1VSMA 3CM5A 3H9QA 2PMZN 5D6FA 1QVGA 1S3JA 5GAN4 1SVLA 4JRIA 5CR2A 4EM2A 3O8MA 3CCQI 4HCKA 3U3GA 3U21A 3FIWA 1NK5A 4EW0A 1YXQA 5HP1A 2NS8A 3WU2C 5GADP 4E6KG 3CCEQ 1D0YA 1M3QA 1HRHA 1NK2P 2AHQA 1YCYA 5HBMA 4PJ0C 2VUMJ 2K5FA 5JLHA 2YRCA 4Y91A 1KEAA 4Q5VA 3IHOA 3I5SA 3ZXSA 4MGRA 2XG8D 3QPTA 5C12A 4UXNA 3KJVA 5IHKA 2W48A 4HNTA 3TAFA 3H46O 3AY9A 4DTJA 3BPVA 1VQ9Q 3CCRI 1MIJA 2A61A 3I59A 2DIGA 4KMFA 2XIGA 1B72B 4JKCA 2KPMA 5FW9A 2DTRA 3A0BC 2BGGA 3SDBA 2JXBA 1D5AA 4PL8A 4M9ZA 5F6FA 5HVQC 2KRCA 4JKAA 3Q0UA 4BR2A 2XI9A 4RW9A 4BJTA 1S72I 4YFNF 1PUEE 2DZ9A 4BC5A 3DP7A 4IOXA 4MQ9F 1YBYA 3CO6C 3ECHA 2HYJA 2E2HJ 1X1DA 4CVNE 2KIMA 4PKCC 5M3MJ 4KNYA 5SZTA 2LJ3A 3JCMe 1LDDA 3HBTA 3E01A 3CJCA 2XAUA 3S6WA 5M5XJ 5BR8K 2RKHA 4JJCA 1KU2A 2HI3A 5SWMA 4KFCA 2E5KA 2A3SA 4FVMA 4PUOA 4IUTA 1NKCA 1P6RA 1S1VA 2K9NA 4MQ3A 4LF7K 1LV5A 9ANTA 3KWIA 2YRDA 2CH0A 2KFZA 4L9VA 4W5QA 2YI1A 4CEEA 2AXTC 3GZ5A 5DMRA 5EJCA 3DOLA 3T8TA 4K8XA 3VSLA 3S3MA 2G3RA 4BY9C 4NC8A 3M59A 2M0YA 3VWBA 4X9DA 2HDDA 3I8DA 5CYMA 2G8VA 1BI4A 5D6XA 2ITGA 3VOEA 4C8LA 3X26B 4O5VA 4ZYHA 2PLYA 3JAMO 4Q48A 4QT7A 2E7XA 5M1FA 1OX9A 5KN8A 4IFYA 2CQXA 1JBMA 2BEOA 2FX0A 1YJWT 2HYFA 2MPXC 2Q8KA 3PMTA 5ELZA 4AHCA 2WAFA 3KEYA 2C0IA 5HRSA 1NWKA 1LAWA 3DXKB 4B9MA 4Y7NJ 1QQCA 4B4CA 3GFMA 5B8HA 5BS6A 1XNIA 3CD6Q 2AT1B 2LP5A 3WQTA 3LDLA 1J2XA 4JKFA 4EJWA 3VETA 3D0PA 1TKZA 5HLIA 1ACIA 3MEEA 3LDSA 3N5NX 4LD5A 1FOYA 3PSIA 1JCEA 3QERA 2DL8A 1QCFA 5F64A 3H3VK 3JRDA 1TOVA 5E20A 4DS4A 4DB3A 3ZMUA 1RPWA 2G8IA 3CJAA 2JA5J 1TBXA 4BROA 3BZ6A 1Q7YU 3S41A 2JW4A 3MEWA 1ATSA 1D3YA 2BZTA 4IVNA 4LF5K 2F2XA 1VQ7T 2E8AA 4DSLA 4EA5A 5KYYA 2IIRA 4OMLA 2JQ7A 4MLEA 2OQGA 2W41A 3BR6A 1OPLA 3PTAA 4B1YB 2N8GA 3SZPA 1WHKA 1KHCA 1SVOA 3RDVA