4BE1A

Pfv intasome with inhibitor xz-116
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be1A03
4CJSA 3JSMA 3LP3A 3NCIA 4IUQA 4NCBA 3NTHA 1NK6A 1WSEA 4EP4A 1SSFA 4LSLA 1K6YA 1BI4B 2EQMA 4H8KA 1ZBFA 1S1WA 4WE1A 3LAMA 1VK0A 1WJRA 5HP1A 4Z4FA 2K3XA 1REVA 3AO1A 2X35A 4O55A 2L8DA 4OGCA 1XWLA 2JGUA 3VQ8A 4M3UA 4RW6A 1J53A 2HNYA 5HLFA 3NNQA 1B9FA 3ASMA 3PO5A 4PWDA 2AJQA 4FK2A 3DOLA 4XIUA 3ZSVA 3NH2A 4M3WA 2IGIA 4F3TA 1BL3A 1WSFA 4CHQA 4IFYA 4CJPA 3META 1H3ZA 4KO0A 4DG1A 4FM1A 2F8TA 4FM2A 3VQQA 4NS5A 4FJXA 1UA1A 3SV3A 1WJQA 4C8KA 3UIQA 1DTQA 1X9MA 4DQRA 3T1AA 1U4BA 3CYMA 2HQEA 2WOMA 3MXIA 4QQDA 4FJMA 1RBUA 4B9VA 3KKSA 2KTQA 1Q8IA 4KHSA 2XDPA 3EY1A 1NOYA 4FJ7A 1VSDA 4PQUA 2NLUA 4OKKA 3JYTA 1JXEA 2G3RA 2RI5A 4DLGA 3OS2A 4JLHA 3PX6A 1SUQA 4M3RA 4OVLA 1QSYA 1UOCA 3HPGA 4ID1A 1TV6A 4FJGA 5I42A 4PUOA 4PL6A 4KI4A 1Y97A 2GF7A 3K5LA 1LAVA 1KLNA 4LH5A 4AHUA 4DU4A 3TANA 1ZBHA 4K8XA 3DLBA 4CFCA 1KHCA 1R0AA 3LPTA 4CE9A 4DU3A 2JTFA 3GOXA 2A1RA 2BKDN 4CJLA 4I2PA 2HNDA 4HUEA 4MQ3A 3BDPA 3NHGA 4M42A 3S9HA 3SYZA 2G8FA 3OMCA 5J2MA 3AO3A 3FEOA 2GUIA 3SV4A 3OYDA 4HCBA 4DSKA 3V1QA 4JRQA 1BCOA 1WSJA 3THVA 4II1A 1Z26A 2FC0A 4CJTA 1G5VA 3HP6A 4ELVA 3BGRA 4TSXA 3CM6A 3KTQA 3D0PA 2IAJA 4CEAA 4CK1A 3RMBA 4GMJB 3AVFA 1VSMA 1JL1A 4FL6A 4DFMA 1NK8A 3O4QA 4KB0A 3KLIA 3QEPA 4IUTA 4FJNA 1N27A 3NDKA 1JXBA 4N56A 1QE1A 4KB1A 3V1OA 1NKEA 2RJCA 3C4SA 1C0UA 4FW2A 4BE2A 2Q3SA 2XY7A 3TAQA 3TARA 3ZT2A 3SUOA 3PX0A 4IKFA 4CF0A 3QIIA 1HNIA 2L89A 3KUFA 3P8DA 1RT4A 4CJVA 4Z4HA 3HYFA 5KGXA 3M8SA 1TKXA 3F73A 3DLHA 3PNWC 4N5SA 3RR8A 2F8SA 2K3YA 4GVMA 3HVTA 4FLXA 3LGLA 4E1NA 1NK0A 2OPQA 3V9WA 3DRSA 2HHWA 2RJFA 3ZSWA 3OQ5A 4BWMA 3ZEHA 3AVCA 4O5BA 1TK0A 2IS3A 2RHXA 4RW9A 2BIVA 4FM0A 3QNOA 1XHZA 2G8KA 2DAQA 4HUGA 1D5AA 1RDCA 1NK9A 1UA0A 4FLTA 1RT6A 1YTAA 4NYFA 3DOKA 5I3UA 4OLAA 3U6FA 2E6NA 2PY5A 3MEGA 3FFIA 1SL2A 4KAZA 1S1TA 4FYDA 4CJ5A 3RWUA 4Z4EA 1BGXT 2X78A 4RW4A 3H08A 3P1GA 4F3OA 3DLGA 4CHYA 3OYAA 4R5PA 4FJJA 4W5QA 3MEAA 3TI0A 4B9MA 4BDYA 4CECA 2G8VA 3ZSRA 4PLIA 1NJZA 4FLVA 4J2EA 2VWKA 2HHUA 4DTPA 2YHBA 4YFUA 2HVIA 1L3TA 4FJ5A 2BDPA 3B6OA 4CJRA 3ZT4A 3VA3A 3NF7A 1S1VA 1T8EA 4FJ8A 2VG7A 1DLOA 4NCGA 4EZ6A 3G0ZA 1RTDA 2RJDA 3C6TA 5C42A 4FK0A 1X1PA 3O3HA 4DSEA 3ZCMA 4C5GA 3LZJA 4IURA 1BIUA 1TVRA 4IG0A 3NGIA 1IG9A 3DMJA 4LD0A 2Z1HA 3MP1A 4FJLA 2Y1JA 1KCFA 2QKBA 3TAGA 1NKBA 1LAWA 4DSLA 3PV8A 4N41A 4IDKA 3L2VA 1J54A 2KFNA 3VQAA 4AH9A 3QEWA 1W9HA 1HYVA 2GFUA 1VSKA 3SPYA 2CKKA 3DRPA 3OVNA 1D9FA 1VSHA 1JLEA 3DRRA 4QQ6A 1TGOA 3IG1A 3M8QA 4BE0A 1G15A 2GV9A 4HTUA 1TKZA 3K5OA 4DQQA 4BDZA 3ZT3A 3TAEA 4CGJA 5D6XA 1KSPA 4HHTA 3SCXA 1BQMA 1ITGA 3DB3A 4FLZA 3AVGA 1U45A 4C8NA 2R5MA 4X34A 2PQWA 3CQ8A 4M3XA 2KZZA 2LDMA 4CGHA 3HPOA 2QKKA 5IAYA 3NH0A 5HRSA 5J39A 3LPUA 4B9SA 1J9AA 3SQ4A 4F2RA 2YNFA 5SZTA 2L3RA 3IAYA 2KW4A 3AA5X 1EKEA 4FLWA 3VQ6A 4CK3A 3M8PA 4ELUA 1CXUA 2PYJA 2E6MA 2G8HA 5CZ1A 4NZGA 4DMNA 1RBRA 4K8ZA 3OYIA 3OYNA 2R57A 3L8BA 4KI6A 3V9SA 4QOZB 3NF8A 1HMVA 1OZ2A 4B9WA 2MWOA 4N47A 3U3YA 4RG2A 2LRQA 3P83D 4DTJA 2RHUA 5DK5A 2Z1GA 1L3SA 3OYLA 4CIEA 2ITGA 4DTOA 3MO8A 3KLFA 3QKJA 1ZYQA 3MP8A 1KVBA 2EQJA 1HNVA 2WACA 4E7LA 1IH7A 2YNGA 1BCMA 4Y1CA 4FJKA 2RHZA 2Z1JA 3O3GA 1RTJA 3NE6A 1UWBA 4DS5A 1SV5A 1VSLA 2ZE2A 4CJ4A 4E89A 3VQ4A 2ATQA 1VRUA 2F96A 3VQ7A 3BDLA 3NAEA 2OPSA 4FCYA 4CHNA 5D6YA 3M8RA 2P5GA 4C8OA 1X9SA 1RDAA 3QINA 1KFSA 1TAUA 1NK7A 2FBYA 1GOCA 4CF9A 2W42A 1BISA 1KLMA 2EX3A 4QW2A 4KHQA 3MEEA 3TAFA 1C0TA 3RMCA 2R5AA 3UWNA 1C1AA 3ISNC 3VQ5A 4CEZA 3CEYA 2VWJA 4GW6A 5J2QA 4DWIA 4C5EA 3VN5A 4UC4A 2R7YA 3HSTB 4DFJA 4KREA 4B08A 2PYLA 4DLEA 1A5WA 3PY8A 3M9QA 3DLEA 3L2RA 5C25A 2XRIA 4FK4A 2YV0X 3C6UA 1ASWA 2B5JA 3QEXA 2FBTA 3HK2A 5JS2A 3Q1JA 5KH6A 4F2SA 3UT1A 2G8WA 3DLMA 3RMAA 4RG8A 4M41A 3IS9A 5C6SA 4B8AB 4B9UA 2X4WA 4RW7A 5KCHA 4Q0BA 4J2DA 4IUPA 3QETA 3HT3A 3ZSOA 4KV8A 4FLUA 3P5JA 2QQRA 2RPIA 2HHSA 1OI1A 1OYXA 2YKMA 2JLEA 3DYAA 4J2BA 4ZTJA 4AHSA 4BWJA 4YNQA 2DFHA 2M16A 2RHYA 4H4MA 3K59A 4IFVA 5KI6A 5J26A 4E0DA 4AHVA 1TL3A 3TAPA 1XNIA 3ZSQA 4CGGA 2YKNA 1QHTA 3HPHA 4CF1A 1IKWA 3NGYA 2OA8A 3MAQA 3I0SA 3OYEA 4HCCA 3QEVA 4E3SA 5KRSA 4MFBA 4B3OA 3LP2A 3FLGA 1S6PA 3ITHA 4HUFA 4CGDA 4A4EA 3VQ9A 1RTIA 3TWHA 3U3GA 4DSJA 1QSSA 1HYZA 1U49A 3KD5E 3C94A 1TKTA 3SI6A 1HPZA 2F5KA 4ID5A 1CLQA 4CEBA 4DFPA 4PA1A 4CJUA 2LTOA 2YRVA 3EZ5A 4IBNA 4CRIA 4CCHA 1EP4A 3KK1A 2OZSA 4DQSA 2JZ2A 3LWLA 2BUDA 3KIOA 5HROA 1J5OA 4GY5A 1JLGA 3PMTA 1OZ3A 3LANA 3AA2A 1I39A 3TAMA 2RN2A 3PO4A 1ZBLA 2HHTA 1S5JA 2VYTA 4OVAA 4DSFA 4PY5A 4O0JA 4L8RB 2BANA 1GOAA 4CFDA 1NJYA 2XY6A 3VQPA 4N4HA 1FKPA 1MHNA 1TKDA 2QQSA 4I9LA 1Q9YA 2P51A 3ZT0A 3OYJA 1HYSA 2D0CA 4KPYA 2D0BA 2B6AA 3OYFA 3DLRA 4FU6A 3V1RA 1VRTA 3MEDA 1D8YA 4CF2A 3O8VA 4CK2A 2ZD1A 1I3AA 4DQIA 1RTHA 1C1BA 2BGGA 2FBXA 3AVHA 3K5NA 2HHVA 3LP1A 4BDPA 1YVUA 4A4FA 1IO2A 5IN1A 3LLRA 3QJ6A 1S1UA 4B9LA 1QS4A 4DSIA 3P8HA 5J2PA 3EAEA 1FXXA 2WONA 3ZSXA 3L42A 5CY4A 4Q5WA 5HRNA 1L3VA 2EFIA 4C5IA 3H8ZA 1A5XA 3HL8A 4W5OA 3E9GA 4DTMA 3KK3A 4ELTA 2OPPA 2Y1IA 3NFAA 4ZHRA 4CJEA 4IUUA 5KTQA 3AVNA 4ZTFA 2LSNA 5M9OA 4CHPA 1N5YA 2NUBA 3ZSYA 3QEIA 3OJUA 1RI0A 5KRTA 2X4XA 2O4GA 1SKRA 2I5JA 1LWEA 3ASKA 3OYBA 4UQGA 3L3VA 4KHYA 3PX4A 1KVAA 4C5HA 2M0OA 3SUQA 5T7BA 1GOBA 3SD4A 4E1MA 1KRPA 4CHOA 2X6SA 1CXQA 2RHIA 1C6VA 4DF8A 2HVHA 4FXDA 4B9NA 2E6LA 1NJWA 4CIFA 3MEVA 3AV9A 3OA6A 4OKJA 1NJXA 1XI1A 4I2QA 4NYNA 4CESA 2EKOA 4E7JA 2FBVA 5CYQA 1WSIA 2DIGA 3LYIA 2YHAA 4M3ZA 3QERA 2E4LA 3D45A 3DLKA 3K58A 3QBYA 4DTUA 1O1WA 2EHGA 3KLGA 3AO4A 3FC3A 1WSGA 4KTZA 1RBTA 1EETA 3DM2A 4A4GA 1JLBA 1WN7A 4FVMA 3E01A 4HVJA 3K5MA 4LD6A 5C0MA 4BACA 3WNFA 3OS0A 1SKWA 3SZ2A 4L59A 4CHZA 3AVAA 3LH0A 3KK2A 4LY7A 2XY8A 4EP5A 2P5OA 2OYQA 4B8CA 3V81A 4DS4A 3SUPA 3OB9A 3NF9A 4M45A 2YNHA 4CJ3A 3LAKA 1QSLA 5J2NA 1RT3A 3PMIA 2G8IA 4F8RA 3NF6A 3PUFA 4KFBA 5EU7A 3OMGA 3QESA 4EZ9A 4C8LA 5SWMA 4KHWA 4CFAA 1WJSA 1IKXA 4O0IA 3T19A 3AO2A 4EDUA 3B6PA 4PLLA 3ZT1A 2OPRA 4JS5A 4N4GA 2IOCA 2IC3A 3OYGA 4CEEA 4FJ9A 1S6QA 2QXFA 3AVLA 2O4XA 1WAJA 4QVZA 3DI6A 3V9UA 2YNIA 1LWFA 2P0KA 4Q5VA 4M3YA 3QLHA 5DMRA 3CFOA 4QCLA 2LVMA 3RRGA 4KHNA 2HHQA 2GBZA 4DQPA 2X74A 3HVRA 3OYCA 4FJHA 4IG3A 3O4NA 4CGFA 3T3FA 1WAFA 2DFEA 1RT2A 4OPJA 3MEUA 2HQXA 1BI4A 1Q9XA 1SKSA 3OJSA 4OKEA 1SL0A 4DTRA 4G1QA 3HO1A 2VG6A 3ALYA 2DIQA 2Z1IA 4KTQA 5CYMA 4AHTA 2HNZA 3CM5A 3KLHA 3SQ2A 3E9FA 2XK0A 4CGIA 4ICLA 2DTUA 4CEQA 3AVJA 3L2WA 3MEWA 3LGFA 1HRHA 1FK9A 4DF4A 3F70A 4LSNA 3PFSA 2ETJA 3LZIA 5KE2A 3RTVA 4CFBA 1BHLA 3F9KA 3RMDA 2RF2A 2BE2A 4NCAA 4E7KA 3H6ZA 2O4IA 1U04A 2D5RA 2M1HA 1HQEA 2PZSA 2VG5A 4OPKA 3HP9A 3NTKA 5KE3A 5HBMA 1EX4A 1VSIA 3QIOA 1W0HA 3MP6A 1CZ9A 4JS4A 2ZQBA 3AVMA 3A2FA 3WNGA 1N6QA 4DFKA 2B4JA 3SQ1A 3OS1A 2D0AA 1NOZA 3HM9A 1LW2A 1ASVA 2RI2A 3KLEA 4LH4A 2EQUA 3L3UA 4Z4GA 3V6DA 1RT5A 4DU1A 1VSJA 1UAXA 2RJEA 1JLFA 3EYZA 2XO7A 3OYKA 2HMIA 3ME9A 2P1JA 4I7FA 5J1EA 1S1XA 1XHXA 2X6NA 1TL1A 3LP0A 1L5UA 2E5QA 1RCHA 1RBVA 4Z0UA 1EXQA 3V9XA 5FROA 4Z02A 5FDLA 2XHBA 3VQDA 2R58A 3OYMA 3CG7A 3KKRA 1HJRA 1NKCA 1IKYA 4W5TA 3S3MA 3LWMA 3NTIA 1RDBA 3ULDA 4KRFA 4KHUA 4E19A 1SL1A 1NK5A 4IUVA 3QIPA 1XC9A 4N76A 4OJRA 4AILC 2RI3A 4Y1DA 3V4IA 2DFFA 3SUNA 3LX7A 3K2PA 1TAQA 3L2UA 3LDSA 3CFPA 1WNSA 3AVBA 4CERA 5CIUA 3SPZA 1T7PA 2X4YA 4Z4IA 2KFZA 2RKIA 1VSEA 2DY4A 1DTTA 4FZZA 1BQNA 5KGWA 3SQ0A 1IKVA 4CJWA 3KJVA 1LV5A 2FHDA 5HRPA 3I0RA 3AA4A 3IRXA 4C8MA 3AVKA 1TK8A 1U48A 2D9TA 1CZBA 4AHCA 5FRMA 2G8UA 1WSHA 3NGZA 5D6WA 1QQCA 1F21A 5D3GA 3NH1A 3O3FA 4OGEA 1TK5A 1T03A 3I8DA 3MXMA 3HXMA 2RO0A 3AO5A 3KD1E 4A4HA 4E7IA 4CEOA 4M3TA 1L3UA 3S3NA 3VQEA 2IDOA 3AVIA 4B9XA 2HW3A 1C0MA 4DTSA 3VA0A 2KZMA 4F4KA 1S9GA 3HJFA 3NBPA 1RT7A 1MU2A 3TABA 4FZXC 4W5RA 3CFRA 2MWPA 1T05A 4QAGA 3MECA 1D9DA 1KFDA 4OLBA 5CZ2A 3SNNA 2QK9A 1JLQA 2XY5A 4J2AA 1X9WA 2HHXA 5FRNA 3RR7A 2KQ2A 3LALA 3ZSZA 1VSFA 3FDRA 1B92A 1ZBIA 3RRHA 1LW0A 1WLJA 4CJKA 3S6WA 4B9TA 1S9EA 4DTNA 4N4IA 1BIZA 4CEFA 1U47A 4RW8A 4FJIA 1KVCA 2GFAA 3QO9A 4W5NA 4KKOA 1YTUA 5HRRA 4DTXA 4CEDA 5K14A 5E41A 4CF8A 4Z4CA 1ASUA 4O4GA 4CIGA 3MXJA 5KCOA 4O44A 1JLAA 5JS1A 4JRPA 2A1SA 4BE1A 3VQCA 1RILA 3V9ZA 1RDDA 1Z25A 4FZYA 4FLYA 1JLCA 4BD3A 1JL2A 3C95A 3S3OA 1RBSA 2LCCA 1HQUA 4CJFA 3SJJA 3VQBA 1A5VA 3OY9A 3OYHA 1KTQA 4HCZA 2EQKA 4FW1A 3WNEA 4AHRA 4I9QA 1C1CA 1YT3A 1JKHA 4E7HA 3QNNA 2OZMA 5C24A 2IG0A 1QTMA 3AA3A 3K57A 4H4OA 3G10A 1RNHA 2HB5A 1NK4A 1B9DA 4CJQA 1FKOA 3TR8A 4KTWA 2O4XB 3DB4A 3WNHA 1WGSA 1RT1A 1ZBUA 2B8AA 1LWCA 3L2QA 4QQGA
chains in the Genus database with same CATH superfamily
4CJSA 1WBBA 3ZL7C 2KAFA 3LP3A 4M7AD 1K9MU 4U0WA 3MN2A 1WSUA 1NK6A 1B34B 1FX7A 3LM2A 1XQSC 3IWZA 4JZ4A 4RMNA 4B24A 1HW5A 1D8JA 1BI4B 3JCMX 5GANf 3QBXA 1VAZA 1SMTA 3HC7A 3TDUC 4H8KA 4V19S 5F6FA 2FBKA 3SJMA 2YG9A 1WJRA 1TTYA 3E1YA 2ZBKA 2OTJT 1REVA 4XTYA 3OSSC 4XU0A 1BR1A 1HDPA 2JGUA 3VQ8A 4MLOA 2Q36A 5HLFA 3ZMZA 2QYZA 4J8FA 2ID6A 1M1GA 3VS3A 2O8DB 3KTUA 3ZQLA 4IRHA 2ZJQF 3HXLA 4V2FA 1M90O 4FK2A 2X0LA 4XIUA 3TP3A 3GLLA 4LDXA 3F2KA 3H0FA 2LJ1A 5H20A 2V1QA 1BL3A 5KN9A 2WSEE 1WSFA 4WQ4A 2O8BA 1Z7UA 3GP8A 2J6KA 2HI3A 2DYRH 2OX7A 2IA0A 1R5ID 4KO0A 2F8TA 2K3FA 5IT9Z 3BPVA 1NG9A 4FJXA 5FD6A 2A42A 3I54A 2EWSA 1OPCA 5CVJA 4M77C 2XV4S 3O1WA 1U4BA 3TTFA 2OTLQ 4BC5A 3A5OC 3CCRQ 4M9SA 1ZH5A 2KXCA 1OX9A 1XNRK 1PSFA 3MXIA 3HRSA 5L8RE 3ECHA 4DV3K 4HXJA 1Y71A 4R55A 1M1KO 4UXNA 3SFZA 2PTKA 3KKSA 1G3WA 2FJ1A 3EGDA 1Y0UA 1AWCA 3D5SC 3SDZA 1Q8IA 3JB9I 4CSWA 3EZWA 3RSEA 4S05A 2E70A 4M7AG 4BY6C 2PN6A 4CGZA 1PYVA 1G6NA 2DVEA 1JXEA 2F4OB 1K0XA 4EAHD 1JXOA 4KISA 2E2NA 1JKOC 4BC3A 3S1MJ 3CCRN 3C2HA 4NOYA 2XROA 1QSYA 4H0EA 1TV6A 4NQWB 3H0DA 5I42A 4PUOA 1EA3A 4FQGA 4IOAL 2F5FA 1A0NB 1IN6A 3LCNA 3VEOA 1KLNA 1ETWA 2A5YB 4LH5A 4AHUA 4KH1B 2K2VA 2FZGB 3JB9J 4O8KA 2X3XD 2VXDA 1ZBHA 4CCOA 2DMOA 2YJEA 2DPNA 2QCOA 1KHCA 4LDVA 3THWB 4ESJA 4YIRX 3LPTA 5GMKl 4CE9A 1A36A 5ICGA 1Z6TA 4DU3A 2JTFA 1F43A 4M77D 2JMWA 4I2PA 3QZ5B 2HNDA 4GBQA 1FYMA 2LKXA 2CW0F 3NHGA 3G6EA 3D4VA 3LMMA 1R8OB 1IN7A 2F5EA 2W6KA 5J2MA 3AO3A 3A8YA 3OYDA 1HQCA 4ZDLA 4JRQA 2O8FA 1BCOA 2E1OA 1QU3A 4II1A 4OPAA 4E1JA 3IL2A 1Z26A 2FC0A 4HVVA 1JT0A 1TW2A 1RPWA 2H8WA 2P9PA 2B7EA 3REBB 4ELVA 3SLCA 4R0KA 4HCKA 2IAJA 4CK1A 4EPCA 3NRVA 2F2VA 3AVFA 4M4ZA 3SB2A 2OTLT 5FPMA 4W97A 4B48A 3VTIA 3S1NJ 3CCRT 3E2UA 1OR7A 5GPCA 2IAIA 3BY6A 1K73O 3CF5L 5AT1B 2O9LA 3O4QA 1T3SA 3KLIA 3G25A 2K7LA 3RMQA 2ZWHA 3TMOA 4BBRJ 3WTZA 1N77A 4N56A 4B6MA 4M7AE 1N8RU 1FNNA 2XHKA 2XIGA 4HLXA 3VRYA 4FW2A 4BI3A 5J4YA 2LX9A 4QPOA 1X6BA 5ADXA 4KULA 1KD1C 1J9IA 1FYLA 1T0FC 1B1BA 1HA8A 3JCMe 2P4WA 4BYYA 1Z0XA 2CMPA 4AVZA 5HLHA 3CLQA 3PX0A 5I22A 3QOEA 4D5FA 3BG7A 1HNIA 3WEEB 4KGVB 2LT4A 3GNFB 1IHWA 3RQ4A 3M0RA 3OH9A 1U6GA 3GEZA 3M8SA 2QGGA 3GBGA 2KZGA 3UR3C 3CCVQ 3KPHA 3VESA 4BR4A 1E3HA 3KP6A 4NC6A 2F8SA 4BRHA 2K3YA 3BW1A 1YX5A 5C12A 2H27A 3HVTA 3WTSC 3BR3A 3CVTA 1FYNA 2E3HA 4ME7A 3N4QA 4B3RK 2QWRA 5MLCQ 3GTMJ 2DA3A 3K70C 3KCCA 4FE4A 4BJ6C 1TUGB 3WQTA 1K4US 2AHJB 3Q3SA 3J81O 2O9SA 4XSZF 2R7TA 3Q0UA 3I0XA 2GWKA 2K40A 1STZA 1M27C 4KGXB 4MLHA 3A1YA 1TK0A 3MKLA 3WTXC 5LHGA 3RMSA 4C2TA 2IS3A 4RW9A 5M5YJ 1BU6O 5CO7A 4U88A 2CUBA 1ABOA 3CCVN 4E2FB 4DV2K 4HUGA 4JN4A 1NK9A 3ELKA 1O7FA 3D5LA 1I27A 1YTAA 3VYUB 2UUBK 4OLAA 1QHGA 4LFCK 3CVSA 3U6FA 1RKTA 2DPUA 1KG7A 1OCCH 1T6CA 2E64A 3DU6A 1AWOA 2WY7Q 1DT9A 4IQ4A 2E1HA 3K0SA 3HEFA 1N8RR 4CJ5A 1AZGB 1MNDA 5DM7R 4Z4EA 1R4MB 2V1DA 4U0YA 4F3OA 4A0XA 3TTDA 4FJJA 3TI0A 1MMAA 5JVTA 3PFYA 1NJZA 4QT7A 4FLVA 1YUWA 4J2EA 1WFXA 2VWKA 2V7ZA 1JRIA 4A3BJ 1ZAOA 4DIQA 2XMFA 1UGQB 1BDGA 1H9GA 3VWBA 2GLOA 2BDPA 2GTJA 1KFZA 2EA4A 3ZT4A 2V8JA 3MZYA 3M8FA 3D7SB 3PIOA 5C10A 2E1MB 3EFRA 4M7AA 2IGMA 5J4VA 5DCMA 1QVGP 4IHSA 2K9GA 2HDDA 1QVUA 3ULEB 2RJDA 2OBPA 2Y90A 3C6TA 3VYTB 4FK0A 3P9CA 1N3CA 4CCKA 4C5GA 2Y4YA 1VQLI 1VQPI 1WEIA 2CS7A 5GAHJ 1XX5A 1WJDA 3O9TA 3OW2A 2V6CA 3CCVT 2JVVA 4MO4A 2V8KA 4FJLA 3CCMQ 2IEKA 5ADXH 1LAWA 1K8KB 4FWSA 3TBIA 4YDUC 3PO2J 1GFCA 1U2WA 2EYZA 3TPQA 5CVUA 4FWNA 1RC9A 2EIMH 2E36A 4D8DA 1NJIU 3B6AA 3NMZC 4DKWA 2BZXA 2WV0A 1JLEA 5E20A 2QASA 1D0XA 3S8PA 1XB4A 2DPPB 3M8QA 1YJ9A 1ACMB 4GFBA 2RQTA 4PSXA 3BJAA 3CCMN 3K5OA 2P5KA 3EFOB 3V8LA 2K9SA 2TDXA 1RAGB 4DQQA 4BDZA 2JA2A 3TAEA 4CGJA 3S2WA 2UWMA 1KSPA 5FB2A 1ILYA 1HSQA 3A01A 1FBSA 2KXDA 1LQ1A 4XR6A 5D4SA 4MO7A 1U8BA 4FLZA 1NYGA 1DQUA 1U45A 1E2XA 3H3ZA 2DMQA 2F5CA 4BRFA 2JZYA 1NGBA 1G59A 3E19A 3L4QA 3F21A 2LNVA 2ABLA 3MMYB 2LDMA 4CGHA 3HPOA 2OF7A 2RPNA 4F17A 2ZF5O 4RAFA 4F52A 5HRSA 2O3FA 3CPWP 1X3WB 4UOBA 2KJBA 3GIBA 2NOJB 1IUYA 3FJPA 2VASA 4B9SA 2VCPA 1MWKA 4BRDA 2YNFA 4G12A 1UGSB 1YQMA 2KW4A 4OWRB 2R7RA 3DKMA 1EKEA 5HVQC 1KQ8A 1A5JA 4M63C 4FLWA 3CC2N 3GMEA 2NUPB 4CK3A 4WF9L 2L9VA 1CXUA 4HA8A 1XDUA 4K8ZA 1I5LA 2CP5A 1ATRA 1MPGA 4QS7A 3JSPA 2IGOA 3M6GA 4KBOA 2V26A 3NF8A 1HMVA 3X26B 4B9WA 2OAUA 2KJCA 3VS0A 2Z9OA 1V1CA 3U3YA 1GLDG 4RG2A 2LRQA 1NJIR 1TYQA 1NE8A 5L23A 1VQKQ 1B8IA 2ZJ2A 1L3SA 3IP4B 3CCMT 2ITGA 2JVGA 1P6RA 3J7ZI 1REPC 3BQYA 3OR2C 3MP8A 1KO9A 2EQJA 1R1TA 1R59O 2P0QA 4F3QA 2PMZA 4HRIA 3I71A 2KRFA 1Z7LA 1T08B 5LJ5j 4FJKA 2DA5A 4JJBA 1X3NA 1RTJA 3NE6A 2E20A 5FKMA 2HKNA 3PLAA 4DS5A 4M73A 1BG3A 1ESVA 2K02A 2D1VA 3FXUA 4JK7A 4B22A 2ROLA 1HJDA 3DKYA 2F96A 3VEVA 3BDLA 3MMVA 1VQKN 3OIOA 3NAEA 5ICFA 3BTIA 1KXPA 4YOXA 4CHNA 1YI2A 1IXCA 2UXNA 5LJ3g 3V7SA 1B34A 2C6YA 2L2PA 1YITI 4C8OA 3JRHA 1T3LA 3HOZJ 1KFSA 1TNSA 3EN9A 1TAUA 1ORPA 3CC2T 1JCFA 1D1CA 4X65K 2KRCA 1VQMN 2M51A 1C0TA 2ZGYA 1V3FA 3UWNA 3BJ6A 1YO5C 3CCJI 2VWJA 1BI0A 3G71I 2OCEA 3DKWA 3HTSB 2NOEA 4IOAF 4UC4A 3SFIA 1QCNA 2FVUA 4ZGEB 3B6CA 2PUOB 3FDYA 2NVYJ 3ATVA 3OYYA 2ED0A 3DLEA 2O8DA 4AD9A 5D4RA 3L2RA 5C25A 3HYIA 3J8AA 1IW7F 3O1BA 1G3SA 1ASWA 2X9HA 4RDUA 3Q1JA 4F2SA 2G8WA 4MNUA 2VXEA 1N33K 4WCEL 3BCAA 3K4LA 3TDZC 5C6SA 4C1NK 3HKZA 5EJCA 3HRGA 1L0OC 2XVCA 2CH4A 1QZEA 2DPDA 4RB0A 3ZQCA 3EGXB 4Q0BA 1VQKT 2YLBA 4PL8A 1FMWA 2LP0A 3ZSOA 2EB7A 1M1KC 4CDGA 2QQRA 2QTDA 2FNAA 2NS0A 4JNEA 3OH6A 1OH8A 1VQ4N 1N8RC 3GE1A 3R2XC 4JKGA 4C9YA 1Q18A 1VQNA 4BXFA 2GEMA 1M4ZA 1ETXA 4ZTJA 2NVTJ 1MKMA 1VQMT 3CF5F 2XICA 1P59A 4C3HJ 1JKPC 5B3SH 2Y75A 4CGGA 3CBPA 3H3NO 3NFCA 4CF1A 2HGCA 2OA8A 9ANTA 2VWBA 2E3IA 3BR5A 3E5UA 3OYEA 4HCCA 4E3SA 5LJWA 4B3OA 2XKOC 3DU5A 4QSHA 4JKAA 4F91B 3O8HA 4Y28E 2E1CA 2RD1A 1LDDA 3U3GA 5D5VB 1VQ5A 1H641 2JPBA 5BRFA 4BS9A 2YT6A 1HYZA 1U49A 2ZPGB 4M7DB 4HQEA 5KCMA 2A3SA 1FJGK 4XU2A 3SI6A 2HQAA 2XASA 2XAFA 2F5KA 1CLQA 4HEA2 4Z88A 2WAQA 2HBPA 1SFEA 4CJUA 4FM4B 1B4AA 3EZ5A 2H3JA 4CCHA 4UY8O 2P6TA 1RRSA 2K9QA 1YRNA 3HHTB 2DKGA 1EP4A 1LKXA 2EFWA 1YIJI 1KSWA 1S3XA 2O88A 2R7FA 4ILJA 4I7HA 2ZMEB 2BUDA 4PIIA 5HROA 1JLGA 4A3KJ 3CCQI 3FFKB 2QGUA 1I39A 3TAMA 4V2GA 4DV6K 1S5JA 2KHOA 4J6WA 3CCUI 2VYTA 4R56A 3HOVJ 1VQ4T 2ASPA 2QW9A 4LF4K 1TUCA 2BANA 2HMPA 3JCMJ 4CICA 1R1UA 2J05A 4RGXA 1T33A 3VQPA 4N4HA 1FKPA 5E8IA 2QQSA 1HSTA 3SDBA 2VKVA 2D0QB 4EHUA 4EJOA 5EG0A 2D0CA 1U5TB 1WHMA 2E5KA 2D0BA 4CZLA 3DLRA 2OA4A 2AS5F 4JDSA 3K4BA 4BGAA 3EYIA 1YN8A 5LJ5h 2HYFA 3EHRA 1YCSB 3PVLA 4HNTA 3D1NI 3HOUJ 1TWCJ 5F08A 2JTEA 2H8HA 5HLIA 2GNCA 3FXMA 1NPRA 2HHVA 2QGFB 1IJWC 3FZKA 4DHYA 1K9MO 3LP1A 1ZBJA 1IO2A 3LLRA 4B9LA 5I9EB 3P8HA 4C8QF 4JZ3A 3EAEA 2YX6A 3GDQA 4UUVA 4Q5WA 1QVGS 4AIAA 4TV7A 3WEEA 2RKHA 1QA6A 1YS7A 3JRDA 1Q7YC 4L18B 3T1BA 4CW7B 3T7ZA 2OPPA 1WRJA 2XDDA 1QHAA 2Y1IA 3CC4Q 3PNTA 2AKKA 3DPUA 4UNFA 2ECBA 3AY9A 3BG5A 1K8AU 4CHPA 2OAZA 4G7HF 3CCSA 2A6TA 3LL3A 4IXCA 2NXNB 3ASKA 5AQZA 5L3BA 3OYBA 2E1ZA 3FBIB 1K78B 5CKTA 2H56A 3HHHA 3HFOA 4KHYA 1E6HA 3BF1A 3CC4N 4F04B 1ATSA 1FW6A 2JUGA 4N9HA 3KK7A 2M0OA 2LT1A 4IIOA 1GOBA 3O5ZA 1SHGA 1UB9A 2EV6A 5TGTA 4CHOA 2X6SA 2M45A 1CXQA 2P0PA 3A0IX 3F8BA 4XLPF 2MH2A 1KIKA 5AQUA 3QZ9B 1AEYA 5DEQA 2E6LA 1P2FA 3GPLA 3MEVA 3AV9A 4LB5A 2L01A 3CBMA 1Z6RA 1IBMK 4M9ZA 1ZR4A 2NYXA 3P9IA 5LJ3e 3Q5FA 1R0CB 2RK1A 2W04A 1E6GA 4EMKC 1W4MA 3CPWS 2RA2A 5CYQA 1UHSA 2DIGA 4B1ZA 3OR1C 4M7DF 2VT2A 4U87A 2YHAA 2OZUA 1GLFO 3WXKA 4M3ZA 1K9AA 2F2WA 3DLKA 1FYKA 3RKQA 1N78A 2EHGA 4GKKK 2EJGA 1KG2A 3VFZA 4AU7A 1H92A 4A4GA 4AIHA 2V51B 3CJ7A 3FXJA 4LK0F 1JLBA 5BPDA 3E3VA 3JAMO 1S72I 4BACA 2X85A 3OS0A 4CD3A 4CZHA 1S1NA 4L59A 1VYVA 1IRFA 5TKWA 1TC3C 1VIFA 5GAOr 1WOQA 1JT6A 2FX0A 5GAOq 4EP5A 3JTGA 3SUPA 1IRGA 4FT4A 2CV0A 3CC4T 1LCKA 3ZBDA 1JJ2M 4UUSB 4JX4A 2IP2A 3NF9A 3EG3A 4M45A 2YNHA 1QPMA 5FLXK 2W82A 3LDQA 2PJPA 4H5RA 1RT3A 4Y33A 3ERED 2BHZA 2NOZA 1JU5C 1LJOA 4YORA 3GNGA 2W84A 1D09B 4IOCL 3T8TA 5HDKA 2CYYA 2EZIA 5LGTA 4NB5A 5GMKm 1DP7P 2IPOB 2DTHA 3R6OA 3QWLA 3CWSA 1SPKA 1VQ8I 3H45C 4EDUA 1RDWX 3VGLA 1QCFA 4N4GA 2EH3A 2IC3A 4WQ5C 4ESRA 3CMAI 2E2OA 2OTLA 3CCRA 4CEEA 3MAJA 4BRPA 4LK1F 4OB3B 3EFOA 5AJ3K 3DXJF 4RLQA 1USSA 8AT1B 2HAXA 4KICA 1S8NA 2ISZA 1BL0A 4QCLA 4H0YB 2CH5A 2HHQA 2GBZA 4H5WA 5FD5A 4E7SA 3VGMA 3OYCA 1KU9A 1IN4A 1O75A 4ZYEA 4M3DA 2LH9A 1ZA2B 3T3FA 1SEMA 3EFSA 2L7FP 2DFEA 4IHVA 1K79A 4JQFA 2QAZA 5IP9J 2VQCA 2KE9A 1Q9XA 1ZYRF 3HO1A 2G7UA 4BL0B 5BR9A 4HVUA 4O5FA 1P92A 2Z1IA 3KP2A 3VUBA 3THXB 3W2VA 2KPMA 2HF4A 3VRZA 3KLHA 1Y0MA 1JQQA 4R1HA 3SQ2A 1ZRCA 4WWCA 3E9FA 4A6EA 4H0OA 5AQWA 3GW2A 4JK1X 3L2WA 1DJ7B 2L0AA 3EKSA 1QP3A 4JI5K 1YJNQ 3ENOA 4DF4A 1W5CC 3PFSA 4ZC3A 4OMYA 4AM3A 2JTMA 3DLLL 1Y57A 1S7EA 2ETJA 1BHLA 3CUOA 2CUJA 4YFNF 4CC7A 2IRFG 2BE2A 2A6HF 4KYWA 3H6ZA 2YX4A 1HLVA 2CZ7B 3JTHA 4ORZA 4KH5A 3DPTA 2O6GE 3T8RA 2M1HA 3TSWA 3X20B 4K25A 3HP9A 1VQOI 3DBLB 1XJWB 5BRHA 1GXIE 2DL4A 1Z77A 1LFBA 1EX4A 4K42A 5JFRA 3FHFA 3MP6A 1GVJA 4DBFA 3J7AY 2HZDA 4OU0A 4EATA 3JV3A 4B47A 2ZQBA 2Q1NA 4DFKA 2V9KA 1BC8C 3SQ1A 3OS1A 3SWNB 2YRDA 4MQVA 1ASVA 1BOBA 2HQHA 4VUBA 4I6MB 2VPLA 3EE9A 3GBTA 1K7AA 2CW8A 3MKWB 2MA3A 3C65A 3D0SA 4YOVA 2VBWA 4CVNE 4B23A 1PM3A 3UDCA 3CO7C 1VI0A 3G4SI 2FUG2 2DEUA 1UAXA 1SSHA 1WVRA 3WTWC 3REOA 3OYKA 3INZA 2OJ2A 3H0GJ 2LF8A 3VYGA 1NGFA 3ZMDA 1L5UA 4A54A 2KKZA 3LA7A 1RCHA 2P5LC 1IAWA 1MBKA 3L09A 5FDLA 3CUQC 2VT3A 3TO6A 3LSIA 4MDBA 2KVQG 2J5PA 2EYYA 4KGZB 1LPLA 3KP5A 4EW4A 1KQ1A 2W85A 4G9YA 2UUAK 4W5TA 3S3MA 5HDNA 1H3HA 2F6CA 3NTIA 2K4JA 4NUBA 3DKXA 2JHJA 4QVCA 2EYWA 4KHUA 2A07F 1LWYA 2H3EB 3H1CA 1VUBA 2Y9YA 4CZIA 3C18A 3ZXSA 4NLCA 4FPBA 3A2KA 2JS0A 5GAMd 3RDIA 2RNAA 2E5ZA 3BROA 3ABMH 4AILC 5ICCA 5DM6L 2RI3A 1PD1A 2VC8A 4BXUA 3LX7A 2GBQA 3K2PA 1OLTA 1TAQA 4MFEA 3JSCA 1YJNT 1J75A 5LJ5d 2Q0UA 3EGXA 2RVCA 3DCFA 3X28B 2F1LA 2MOXA 1VSEA 2GELA 4FZZA 2PEXA 1DDNA 2LJ0A 3C0BA 3SQ0A 1IKVA 4CJWA 5J6XA 3RR6A 1YIOA 3R1XA 2QWOA 2HL3A 1U48A 2VIXA 3L4IA 3B02A 1UELB 3GXOA 3O3FA 4HSBA 1E4GT 1BR4A 3CMEI 1S9HA 4F7UB 1WJFA 2RE2A 4HT9A 5BN8A 4M3TA 4DZJA 2M4KA 2IDOA 2G0EA 2MC4A 1LEBA 1OH7A 3BCBA 1XTAA 2QQAA 2E60A 4DTSA 1JO8A 4XU3A 1PDNC 3I33A 3NBPA 3FM5A 1KQSS 6PAXA 3U9DA 1Y56A 1P7IA 2CT3A 3BR0A 4EGYA 3QXEB 4FZXC 1WHGA 3SAGA 4F7ZA 4HAMA 1BK2A 2AKLA 5CZ2A 2QK9A 2P9SA 4CZMA 4L9NA 2ED1A 4FWLA 1XS9A 4YOUA 4J7IA 4WFBL 2EIJH 3ONQA 4JYKA 4ZDPA 3QG1A 5FRNA 4RWTA 3V7CA 3RR7A 1JUPA 2UXBK 1VSFA 1PVSA 2ZMEA 1ZBIA 2ELHA 5ECAA 3M0SA 1BR2A 4Y0WA 4OF1A 3A8GB 3QYHB 4B3TK 5M5WJ 3CI5A 3CCMA 5AZJB 3S6WA 4B9TA 5DY9A 2GTOA 4CEFA 2JOYA 5ED4A 4YEJA 4JLGA 1HKQA 1S7AA 4C0DB 2YHYA 1DGWY 3HM5A 4O4GA 2VLAA 4Q48A 3MXJA 5KCOA 5JHUA 5AFUA 5HLGA 3DFGA 1JLAA 3HSFA 3IDHA 2A1SA 3VQCA 1WZ2A 1Z25A 4M78B 4PGHA 1V4SA 1JLCA 4BI4A 3VMFB 3S3OA 3KFVA 2FG0A 5C2FA 4PJOB 3SJJA 1M1FA 3E9OA 1UECA 3MZHA 1E3MA 4N0AA 3WNEA 4IRIA 1YJWQ 2NUZA 2X3WD 3CP8A 3FISA 3WE2A 4EVIA 2MAMA 2A61A 1X43A 2GM4A 1FT9A 2CRGA 5H2FC 5AQSA 3QNNA 1LOTB 5CKEA 5C24A 3G6EI 1MSFC 3GG4A 4DK9A 2HCKA 2YX7A 3OMYA 4FWKA 4IRGA 3J7YJ 1GDTA 1VHXA 1PG5B 1UG0A 2IVOA 4H4OA 2KHMA 1S22A 5IT9E 1NK4A 2V1NA 4CJQA 2L7ZA 2Y31A 3TR8A 2FZCB 4B1YB 1TP4A 2PJRA 1WGSA 1R49A 1ZBUA 2E1MC 3TP0A 3WG7H 4O6JA 4RAZA 5LEKA 4QQGA 4EVVA 5LRRA 4BHPA 4MZTA 3ABLH 1U9NA 3G4SQ 5KK1A 4H03B 3ZLJA 2MSYA 3QDKA 2KKOA 4RB2C 4PSWA 3EEQA 1POGA 1VQ7I 2DOEA 1FY7A 3S14J 3LDLA 2I5WA 1K6YA 4AYBN 1LE8B 3LFKA 1MNMC 3IHOA 3MZ8A 3QYGB 2XKPA 2FF4A 1K78A 1V5GA 5JLXA 1OEBA 1W2BP 1S1WA 3LAMA 3M57A 2DI3A 4Z4FA 2K3XA 3AO1A 4KITB 1IXSB 4ETSA 2L8DA 4IOCF 2QA4Q 1EV7A 3E9PA 1JCGA 1XWLA 3QYBA 1Z9ZA 1F5TA 4RW6A 5EXWA 1QO0D 3R4KA 1WEFA 1T6SA 4RTWA 3NNQA 3ZN1A 1B9FA 1OCOH 3CWUA 1Q86U 5IXFA 3TTCA 4MIMA 2FPEA 5GAN5 3PO5A 1OKRA 2R7WA 2EYXA 3C7NB 3DOLA 4QKUA 5EGOB 3ZSVA 3NH2A 1N39A 2CP6A 2HQRA 2K3PA 2WY8Q 4OIQF 4YTLA 1AWXA 3DWLE 2QEXN 3I59B 3WXMB 4UB6C 4JI1K 5IHIA 1RR8C 1NM1A 1NGCA 4DG1A 1PKSA 2MBFA 3JSOA 1SF9A 3M0TA 3VQQA 2AQEA 4NS5A 2W0ZA 2NOGA 3OSVA 2BV6A 2FF6A 4GV6A 1YWPA 3K9TA 1PP7U 5J3BA 3KE2A 4BI8B 5AFUH 2KI7A 3WQUA 1HYOA 3CYMA 2HQEA 1Z1DA 1JXSA 1OPLA 4DQ2A 4B9VA 3CXCM 2JMAA 3M1CA 4XTZA 3EG1A 2R7XA 2RB6A 4O5VA 4K41A 5A2QZ 1RAHB 4KHSA 1NOYA 1JJ8C 2KIQA 5IOYA 4FJ7A 5BOXA 4P9FA 1OFCX 4GXOA 2NLUA 1K4SA 2P4RA 4OKKA 4EQQA 4AI4A 2JW4A 4ZYDA 1MH3A 2G3RA 2VPRA 4B3SK 2GWJA 1XMAA 2CQKA 3OS2A 2D0PA 1UJ8A 4JLHA 3H9NA 4M78F 5CE3A 2IBDA 1SUQA 3PX6A 3DLLF 4DA4A 1UOCA 2NRRA 1KG4A 1OOTA 1P90A 1F36A 4LG0B 2NUTB 3D2EB 4F7UG 3LDNA 1MMSA 1WHUA 2ZXJA 3M55A 1JE8A 3CETA 2DT5A 1IF1A 1Y97A 2ZFUA 3VW4A 2QEXT 5KYUB 3ENHA 3QP6A 3DP7A 1I50J 1BJAA 4NBQA 3TANA 1ZXOA 3HGYA 1FMVA 2GA2A 1ORKA 4M75B 2HSPA 1SQKA 3DLBA 5IT9K 4FIBA 3PL8A 2OANA 5GTHC 3F8MA 5CQGA 2EZKA 1WI3A 3COAC 3EYYA 1M2OA 2P5VA 2OFKA 2BKDN 2LKPA 2OC6A 2ME6A 2A5XA 2DU9A 1IBLK 1IXRC 2UUCK 1B7TA 2VKNA 1KG1A 1YHQN 2FBIA 3QU6A 3FEOA 2GUIA 2JSCA 4L5GA 4HCBA 2D1KA 4DSKA 3DBHB 3SAFA 2D8HA 1OPKA 4J9FA 2EJ9A 2RQUA 2CSQA 4DCHA 1X4OA 4PFOA 2DA4A 1YJ9I 1VQPN 1M3CA 2XB5A 4B1VA 1EH7A 1NYFA 1GLJO 4OP0A 1CSKA 1WPKA 1UDLA 3H5RA 2K5CA 5J1UA 3A0BC 1QBJA 3BDUA 3WVEB 1VSMA 4FL6A 3EUHA 4DFMA 3LWHA 3QEPA 3NDKA 3H1QA 1U78A 5LGNA 3PFIA 5M1FA 2CZ0B 3V1OA 5EYRA 2RJCA 1C0UA 3FZMA 1K8AO 5GAGP 3U1KA 2JS2A 2XY7A 2CGHA 1LNWA 1OVQA 1TOVA 2EPFA 4PJOG 2KR3A 5DM6F 1IRZA 2B0LA 1GHCA 1S5LC 4DV7K 3MEXA 1K76A 2HZTA 3IKTA 1IHVA 2RMOA 3ZETA 3GCMA 1G2HA 2Q97A 1NGEA 3KUFA 4RAGA 1QLYA 1RT4A 1OMIA 1DIZA 1HXDA 5FWCA 1UG2A 1WA7A 3GBQA 1NMDA 3BZKA 1DU6A 5EZHA 3DBRB 2GQVA 4C92G 1IV8A 2ESNA 3CCLQ 5BMZA 2RN7A 3JCMd 5K5QA 5F0CA 3IH7A 2WSCE 3KLOA 5D5XB 1W1WE 2YU9J 2VBZA 2QQ9A 5HKCA 1YHQT 4JOMA 2YU3A 4E1NA 4BQLA 1AZEA 4WFAL 2ESWA 4I6MA 4IJNA 3VS5A 2OPQA 3V9WA 3M5AA 4JKEA 3OQ5A 2PU9B 2IIMA 4BWMA 1VQPT 2EQRA 4XK8E 5A0LA 3AVCA 4O5BA 3KWIA 2X4HA 1QCOA 5GIOA 3FSPA 2ROTA 3PGGA 2BGCA 3CZ6A 3CCLN 1MV0B 5TJJA 3VV0A 2O9VA 4LDYA 2NOIA 4PKHA 4NYFA 2TRTA 5B8HA 2VODA 1X1BA 1MH4A 3CDHA 2A41A 4C8QD 1QPIA 2V9PA 4AWXB 2PY5A 1J5YA 2ETHA 3VODA 3I55I 3RWUA 4XH5A 3E1SA 4M7DC 1BGXT 1O3SA 2CGPA 1YI2I 3RCOA 2V8IA 2E6ZA 4CHYA 4M6VA 4BGBA 5D7UA 3NHNA 2DE0X 3C6HA 4R5PA 2DMNA 1Q81U 1XGSA 3AHUA 3ZSRA 2O7OA 1XD7A 2Z1DA 2R7ZJ 4DTPA 3QYEA 4KIFA 2YHBA 3QWYA 3CQXA 4YFUA 3I58A 2K7AA 4RMOA 1P9QC 3QFPA 3NVKA 2WB1N 4BREA 4BG8A 4CJRA 3AARA 3VA3A 2Q0RA 3IUOA 3T0YA 3K9KA 3NF7A 1JJ2A 2NVQJ 2JWKA 4FJ8A 2V6EA 2GOXB 2K85A 2Q2EB 1Y8RB 1DLOA 4NCGA 4EZ6A 4LUDA 2LNBA 2DZ9A 1GLEG 1OQYA 2OV7A 3A8MB 4DSEA 1NPPA 1J0RA 3LZJA 2XRNA 4HZFA 3KP7A 1BIUA 5F27A 1TVRA 1U5TC 1EZZB 4LF5K 4LC9B 3CCLT 4QWQA 4X6AJ 4Q4ZF 2GXBA 3MP1A 1FIPA 1KCFA 4F7UA 2CFXA 1KQ9A 1KU7A 1YVNA 3TAGA 3D2FA 4YFKF 1IUFA 5E1XA 2O03A 2R5YB 2KFNA 3F8NA 2LNHB 3QEWA 3X24B 3G71N 5F1XA 3LFUA 1VSKA 3SPYA 3GVAA 3RTRA 2XGXA 2PVGB 3VEZA 4HDVA 2LCLA 3TOAA 5B66C 3HRTA 1D9FA 2XHCA 2CZ6B 4M7DD 4CXFA 3UNGC 3DRRA 3OW2P 1ORNA 3R6NA 4BY7J 4A5NA 4C8QG 3W6VA 4BE0A 5DLOA 2GV9A 1TWGJ 2DLLA 3J80K 1NG6A 2AP1A 1VQ9Q 1VQNI 2O8BB 2EZLA 1E17A 2EFQA 1BQMA 3M5RA 4GLKA 5DS9A 1MMDA 4WX9A 1I1GA 1QVTA 1B07A 1IDZA 2DF6A 3M0PA 4HWIA 2R5MA 4X34A 1GCQA 1W2BS 1DGRM 2PQWA 3O9QA 2KZZA 1RI7A 2RAEA 5AZJA 3NH0A 2CYZB 3K2AA 1G3TA 3FXRA 5HS9A 3M54A 1OH6A 2ELJA 1PSEA 4F2RA 5SZTA 3IRRA 1VQ5I 4CYCB 2FQ3A 3CJ9A 1YOVB 1KAXA 2W1OA 4DNCA 4OMMA 3RSEB 3M8PA 4EFHA 4ELUA 1NKUA 4DR7K 2MC3A 2UV1A 2G8HA 4H0TB 5CZ1A 4PJOA 4P1WA 3ZMSA 3HL2A 3G71T 4RGRA 3OYIA 2KL4A 2ZCFB 2X1DA 2QENA 4CH7A 3RPUD 1Z21A 1NNEA 3V9SA 4QOZB 4DR3K 4RBOA 2MWOA 2E8AA 2WFBA 2YG8A 1YCYA 4IVNA 1HU0A 2RK2A 4C92A 4DTJA 1ETOA 1ZG5A 4E6KG 2KZVA 4CIEA 4L5EA 4DTOA 2OPTA 1ZRFA 5BREA 3KLFA 1MUYA 1A31A 4WXCA 2YNGA 4Y1CA 1ZSZA 4B43A 2RN8A 3W3DA 3O3GA 2IS1A 4EMSA 4NLBA 1KJWA 3DAWA 1ULYA 1SV5A 1VSLA 5H6QA 1Y64A 3FHGA 4C8QE 1AKHB 4CJ4A 1YIJN 4E89A 2ITMA 4JKDA 3O3KA 2ATQA 1VRUA 4LDUA 2QUFA 5LJVA 2EGCA 3FRNA 1RL2A 1ZHIA 2QKLB 2OPSA 4FCYA 2E71A 2PLYA 3CCUN 5HLTA 4DUYK 1RETA 5D6YA 3T1YK 1VQ9T 2P5GA 5FO5A 1RDAA 4CZCA 5HCKA 3U23A 2Y48A 1OU9A 4XOPA 1ZSGA 2FBYA 1R7JA 1YJNA 4CF9A 1WI7A 2EX3A 4QW2A 1E3OC 2V75A 2QWWA 3GZNB 1O4XA 3RMCA 1RZ4A 3ISNC 2HR3A 4UY8I 3I55Q 3MCAB 4D7NA 4GW6A 1MWMA 2BH1A 4JKFA 1Z91A 5J2QA 5J8FA 2GAUA 2LCSA 4DWIA 4OAZA 2RHKA 1YQKA 5GAN7 4L0ZB 4B08A 4DLEA 1A5WA 3WUHA 4RB1A 1Y0NA 4LG3A 3AFHA 4BAYA 4CC3A 1ODDA 3C7NA 2GXGA 4HQMA 3GOIA 1WX6A 1YQLA 3CCSI 5EGOA 3C6UA 4PK4A 2B5JA 3HK2A 5JS2A 1OCPA 4IJAA 4A3FJ 5CVVA 2FBHA 3I59A 3UT1A 3DLMA 1VQ6Q 3RMAA 2AO9A 3IS9A 4DBRA 4JRIA 4B8AB 1RNLA 5J1RA 3Q7BA 2DK5A 2HNHA 1YIJT 4B9UA 2IVWA 4FWRA 3CD6Q 5JLHA 2PX9A 4YFXF 2FL7A 4J2DA 4D0PA 2JXBA 1MBJA 2E19A 2GZWA 5F1JA 3CHWA 4YOTA 1FTTA 2DILA 3CCUT 4B1XB 4RTZA 1Q82O 2FD5A 2RPIA 1LDKB 4EJWA 2HHSA 1V5EA 3FMSA 2M34A 5C15A 1OI1A 2QBYA 1OYXA 3KYLA 3DYAA 4BGDA 4J2BA 1VQ6N 3SZGA 1PVEA 4A2BA 2K2MA 1NGJA 2DFHA 2M16A 2RHYA 3K59A 2ZO4A 2A68F 4IFVA 3M0QA 3CD6N 5K7FA 1P8ZA 3TAPA 1FMKA 5L3FA 3ZSQA 4IEJA 4CZFA 2B63J 3HPHA 1ZG3A 1IKWA 3NGYA 4C8QA 4IIMA 3DLAA 4ZZLA 4IHTA 4DJAA 2X9DA 4LITA 2HEQA 2YHWA 1JI8A 3QEVA 5KRSA 1D4XA 4B3MK 2HF3A 2EFOA 2L7KA 2NUTA 3D2EA 3SHWA 1PP8F 4CGDA 4D6WA 3TWHA 4OFEA 2JT1A 3FZLA 4DSJA 1R77A 3HJEA 3FMRA 4CBWA 1QSSA 3A4CA 1UHCA 5LGUA 1B72B 5KYUA 1ZTRA 3C94A 1TKTA 2XUBA 4KDPA 4FWQA 4OB2B 4DFPA 4M75A 5JVGL 2YRVA 2X48A 2OU2A 1HX1A 4CRIA 4IBNA 3TSUA 2OI3A 1HCRA 2YUPA 2Z16A 2BW3B 3ZX3A 3OOUA 3VU3C 2RQVA 3KK1A 4RLFA 1G4DA 2R3SA 1O3QA 3EG2A 3KIOA 3SWNC 1E7OA 3PMTA 1OZ3A 2ESHA 5FWBA 4L9TA 2O2OA 2DMUA 2RN2A 4CBXA 4OVAA 3WHCA 1ZBSA 4DSFA 4M7AB 2ZSIB 4PY5A 1KD1U 4RAYA 1VQ8A 1Z9QA 4RM2A 1VQ6T 4ESFA 1IC8A 5IOZA 2F4MB 1R22A 2A40A 3AL0B 4XH4A 1KU2A 3CD6T 5JMVA 2OTLI 2E2JJ 3SXYA 2ZM6K 2GA1A 1FSHA 3CCRI 2BBYA 1CKAA 4J9IA 3M7GA 4YOQA 4H4KC 3FX3A 3TSQA 2B6AA 3PUBA 2GGRA 5GAN3 3CCEQ 3QUIA 4CF2A 3I56Q 3CQYA 3GFIA 2L4AA 1I3AA 2ZD1A 5C0YA 5FPEA 2A6AA 4FE7A 5JHFA 2RV8A 2D4WA 3AG4H 4A2UA 1FP2A 3AVHA 5GANe 1Z9CA 2NOFA 1HOMA 3QDRB 1QZ6A 2VC0A 2JNGA 4HX4A 1YVUA 5IN1A 5AQPA 3H0IA 3FM3A 3BT9A 3J81Z 3ZSXA 3L42A 3F0ZA 3WU1B 3ID8A 1W70A 3A02A 5K5RA 1EF4A 5GTIC 3CCEN 4PJNA 5GIPA 2FXAA 1RR7A 3H8ZA 2DO7A 4W5OA 2AHQA 3E9GA 2HKXA 3EE8A 4ELTA 3CC7Q 2K57A 1R6RA 3SHFA 3A01B 1X2QA 4M7YA 2LQWA 4IOXA 2AK5A 3H0HA 4ZHRA 1A04A 1ONVA 4H0VB 4MZMA 4NL2A 3IQLA 4GYIA 5KTQA 3PO3J 4BRQA 3AVNA 5J8CA 3OBWA 2DK8A 1PCXA 2C0OA 4EJUA 1SRMA 4PNOA 2OTJQ 1IREB 5BR8K 2YUSA 3ZEUB 1I8FA 2NUBA 3ZSYA 4MZPA 3QEIA 2LK2A 3OJUA 1PUFA 1Q86O 3VEWA 1HKBA 5KRTA 1EWRA 2V7FA 2X4XA 2R5ZB 1KG3A 1SKRA 3A5ZB 1YJWA 1NM7A 2I5JA 3AAFA 2SRCA 4JUVA 3SYTA 2CV1A 3CC7N 4AM6A 4JX5A 4JD2B 5F0FA 2PMHA 3OW2S 3OGDA 4E1MA 4XSXF 3NVMA 1H1VA 4OMOA 2RHIA 3O9SA 1I5OB 4CZKA 4DF8A 3ERMA 4A59A 1LNXA 1AWWA 2D6FA 2VUBA 2R4GA 4OB0B 4CIFA 3OA6A 2F5VA 1L3LA 3I35A 4OKJA 1NJXA 4G6DA 2R7VA 3ABTA 4JI0K 4YPRA 3CCET 3H36A 3I56T 3G4SA 1XUPO 2KDSA 2IVPA 1UTIA 4BY9C 4OPHA 2DBMA 1WSIA 4PCQA 3RYRA 1QRYA 1DPRA 1ZQ3P 3QERA 1G99A 4XBFA 2MYSA 1USTA 4KT5C 1SHFA 3AO4A 1Y7XA 1SD7A 1SAXA 1RBTA 5LJ3d 4MO5A 2FRHA 3DM2A 4KN4X 3M3YJ 4FVMA 4B3XA 2AXLA 1X1DA 1Y8QB 3E01A 3CPFA 2QA4A 3K5MA 2Q2EA 5C0MA 5CQXA 2IJLA 3BE3A 4MEXF 1SKWA 5KPRA 4CI6A 2EKHA 4EM1A 2A6EF 3M4GA 4CHZA 4L6V5 2LY9A 3NARA 3VKIA 3CCVI 2KSSA 1IV6A 3CC7T 4M78C 4B8CA 2CDTA 4DS4A 1KK7A 4JKCA 4LJZF 5IP7J 2HTJA 3FZVA 2EPDA 3M4OJ 4CJ3A 4EJTA 2NOLA 4J9BA 3PMIA 3N0UA 2R5YA 1NLVA 4H5NA 2I7NA 4Q47A 4F8RA 3NF6A 3PUFA 5EU7A 4X9DA 2CS3A 1SFUA 3O08A 2FOWA 2H09A 1RAFB 1HLUA 2DA2A 3T19A 1P4XA 4ANJA 3ZT1A 4BEHB 3SBGA 1U5SA 1TTHB 2IOCA 2A08A 4WCGA 4WYBA 1WCMJ 3HM8A 4FJ9A 3AVLA 4DYCA 2O4XA 1WAJA 1W7PA 1QVFM 1KQ0A 1N25A 3CMEA 1ZN2A 1V5FA 1LWFA 4Q5VA 4DR4K 4M3YA 4BJ5C 2XF5A 3CFOA 3CJQB 2LVMA 3RRGA 2XSDC 4U0VA 1UCRA 1APLC 5BQTA 4IG3A 3O4NA 1YYVA 1HD3A 1WAFA 3ZQQA 5LFAA 2EBIA 1SS6A 1RLPC 2K5LA 3L6QA 3BC8A 3MEUA 3I9V2 2PVOB 1SKSA 3OJSA 4OKEA 1SL0A 4KFCA 4JKGB 4M78D 3VS2A 4CYCA 1Q1VA 3FBNB 3TEDA 4KTQA 4FYXB 1M2VA 2DZCA 5D8KB 3GWZA 1ZKGA 3CM5A 4NNJA 3TL4X 5HNFA 2KK4A 3BY5A 2LBFB 2DETA 3TCJA 4M74A 2DTUA 3MEWA 3VS7A 1A35A 1FK9A 1QP2A 3L9FA 2DBBA 5GADP 2QSGX 3CCMI 4LSNA 1MBGA 3BTJA 5FW9A 4HLYA 3SEZA 3LZIA 1QWFA 3RMDA 2RF2A 3VEYA 4IFEA 4BR5A 4U67L 2JG6A 2CT4A 1I3QJ 4I09A 2ASOA 2FXUA 2VG5A 2VYPA 2CP0A 4ZN3A 4OPKA 4C3JJ 3NTKA 3K4CA 2HBLA 1Y1VJ 5HBMA 4XKVA 1T95A 1YRNB 1W0HA 1AKHA 4J01A 1WJAA 3FXQA 5B1AH 3LA2A 4II2A 1BW6A 5CCAA 2B4JA 3QODA 4B1UB 4GVEA 4FYWB 3AG2H 2XPUA 4OAYA 5AQHA 4Z4GA 1FZPB 3A8OB 1RT5A 3IH4A 1NLOC 5GAN2 1VSJA 3R3LA 1QZ5A 2NNNA 1JLFA 3OV8A 1Q81O 3VSKA 2XO7A 2Q0OA 1GUUA 5CYVA 1SVOA 5EG0B 1UFFA 3BTLA 2E2HJ 4X1VA 1S1XA 2X6NA 3QHSA 1TL1A 3TSZA 5M1OA 2A05A 2WTEA 2DAOA 3UKRB 1ZLKA 4YIIA 1YF5L 3SJHA 1F1ZA 2A37A 1RBVA 4UNOA 3ROUA 2IS6A 3A5NC 1M1KU 3O5BA 2CQNA 2EWNA 2OQRA 3KKRA 1G8XA 3CTAA 3PIPA 2HBMA 1B3QA 3MN6A 3TKYA 4B3AA 4OMQA 2V1UA 3CCLA 4ABZA 3ULDA 5JVGF 1VQ7A 1FEXA 5IYCJ 4KRFA 3B8AX 1OJLA 5CHIA 4M75C 2EGAA 3K4MA 3BTCA 2RNGA 2EBPA 3NWTA 3S2HJ 3QIPA 5HNHA 3KLNA 2DA6A 2YLCA 3V4IA 3CDIA 2EA2A 3O80A 3L7WA 2FRWA 5DTDA 2OJED 1VQKI 4NC7A 4BRCA 3L2UA 1T6DA 3ZQIA 3RYPA 3V8KA 1NH3A 2HBKA 2KFZA 2RKIA 3M3ZA 1M90R 1DTTA 1G83A 4MDAA 3H92A 5LL6Z 2Y30A 1M5Q1 3F23A 2BE9B 4RKUE 5FU7C 5EG2A 5HY6A 3KJVA 2RQQA 4BKXA 4BR0A 5HRPA 3MX5A 2DBKA 1TQPA 5E18F 3IRXA 5KYXA 2DXCA 1QQJA 1CZBA 1VQMI 3TVTA 2G8UA 1OU8A 4M77G 3IAM2 3NGZA 2O61A 1QKXA 3QU3A 1F21A 3H1VX 1TNTA 2ELKA 2KGTA 4OGEA 5FLVA 4FWOA 2XPWA 2MABA 3AO5A 3M58A 1HJOA 3C2GA 3S3NA 3VQEA 5IYBJ 4I98B 4PJJA 4XN3A 2K6DA 1YLFA 3A8HB 3F3XA 2AA4A 3DJCA 2HW3A 1M1KR 3OOPA 2LKSA 4BVOA 3VA0A 3OTOK 4F4KA 1S9GA 3HJFA 2LZ6B 5LL6S 2JQ7A 4P55A 3RUXA 4QLCU 1JGGA 2NYSA 1NTCA 5L3DA 1ZUKA 2MWPA 1B72A 2VKEA 4M78E 3MECA 3BFMA 4RCHA 2ME0A 1D9DA 4J19A 1KFDA 4OLBA 2CUEA 1JLQA 3JRCA 2CFOA 4M3GA 5D8LB 4ESBA 1HNWK 3J80Z 2BW3A 1IB8A 1HUXA 2KIUA 4L9JA 2GQIA 3VYSB 5HK3A 2DA1A 2YR2A 3S93A 2EK5A 3RRHA 2HOEA 3NMUA 2ISYA 3RSNA 1OKJA 2A5WA 4CJKA 3HUGA 1S9EA 3BEXA 4C2MJ 4N4IA 4DTNA 1BIZA 1U47A 4XH1A 4EM2A 4RW8A 3BG9A 1KVCA 3K70D 1IRXA 4W5NA 4CEDA 1T38A 4CF8A 1ASUA 2Z2SB 1T39A 4RM3A 4YG2F 3G3ZA 3I64A 4J9HA 3C1DA 2HBJA 1Q7YU 2L4MA 3GO5A 1LOJA 4FLYA 3I5UA 1X6GA 3CERA 1JL2A 3L2ZA 3BR1A 3MJXA 2BE5F 5KYYB 3P9KA 2Z3YA 1K4TA 4LN2A 4ZN1A 3X2QH 1A5VA 3VQBA 1KYZA 4ELZC 4HCZA 3TQNA 1VQ9A 3KHYA 1AHJB 4AHRA 4M77E 3W6KB 2W03A 4X0GA 1YT3A 2KT1A 1S3JA 3H3VK 2HYGD 2Z33A 3MN5A 1JKHA 4K43A 5AQJA 4EW0A 1X2KA 2E88A 1J09A 2CP7A 2P9IA 1QTMA 2BTTA 1NK2P 4H0XB 4K11A 3KETA 4XRMA 1XPXA 1B9DA 4OIOF 3UKUB 3BUZB 3L00A 1S7OA 1OV3A 3EO3A 1WWXA 1RT1A 3C12A 5KAFC 3MKDA 3IAS2 3CC2Q 2D8JA 3RKXA 1XQPA 1BI1A 3JSMA 2VXFA 2SEMA 3G1OA 4EHTA 3WHBA 3CO6C 3NCIA 4M6XA 2M30A 3VOVA 3ZEUA 4NCBA 3ZRGA 1UHMA 3NTHA 5A2QE 2I8DA 4L5JA 3S32A 1XMOK 2R5ZA 1ZX6A 4A53A 1WSEA 2UYTA 4PJ0C 4LB6B 1SSFA 3FMQA 3K1NA 1U06A 3OSGA 2EQMA 2MCNA 5IYDJ 3MWPA 1XQOA 4WE1A 4M3FA 3EUAA 1B59A 4JD2A 1YJ9N 1KG5A 1Q7YR 3K4NA 4O55A 4OGCA 2KDOA 4U7BA 5DD8A 1J53A 2HNYA 4RGUA 4XU1A 2CSIA 2A36A 2W24A 3CDLA 1B6AA 3MFKA 3ZFJA 4BQOA 1KAZA 4OMNA 1IG8A 5E3MA 3JAMZ 3UA7A 2Y0SA 1PKTA 1MIJA 4NXMK 1BOAA 2A0FB 4M3WA 2IGIA 4WQ4C 4F3TA 2QG9B 1R1VA 4LF6K 2QK0A 5GAMj 5CKHA 1DKGD 2AXTC 3LAPA 2DX1A 4FM2A 3LH5A 1UA1A 3V42A 1KC8O 2XG8D 4LOCA 1X01A 2HMAA 2IA2A 3QQAA 1WJQA 4C8KA 3UIQA 1WEGA 4M77A 1VQMQ 3P38A 1RKWA 3BZCA 1WJ5A 3Q9SA 2WOMA 2PUKB 5I21A 3FWEA 1YW7A 1YAGA 1BIBA 4XRSG 3PE0A 1O3RA 3I55A 4QQDA 4JJDA 4FJMA 1RBUA 4KUDK 1M3AA 2W6LA 2HSEB 2C0TA 3T5XA 3CC4I 2KTQA 2K4BA 2VQGA 4HG2A 3URGA 3EY1A 5CVRA 4LLLA 2EV0A 4F93B 4DYRA 4WF2A 1ABQA 3VETA 4P9UA 2RI5A 3O2PE 2PMZN 1SFKA 4DLGA 1X69A 1FSEA 3WTTC 3WU2C 1J2XA 4G7ZF 1JKRC 4G7OF 3HPGA 4EJVA 1RUWA 5GAHP 1M90C 1J6ZA 4I0AA 2XAUA 3CD6A 5D6FA 1CQTA 4KI4A 2JMCA 4UV8A 2Q31A 1KD1O 2UXXA 4BEHA 1YG2A 3K5LA 1LAVA 4DU4A 2JRTA 5GANj 4R79A 3DXMA 3BQZA 4NXNK 1VQ4Q 4CFCA 3KEOA 4RTFD 4ZGJB 1QVPA 2JPSA 4XICA 3JCMW 1R0AA 4AM7A 4ZYAA 2DYIA 3EPZA 4J9GA 4HNVA 3CPEA 2A1RA 2E2QA 3H9JA 3QP5A 1BI3A 3GZ5A 4M42A 3S9HA 2G8FA 1UHFA 1RABB 4L3QA 3PM1A 2XAGA 2P81A 2BOLA 3AKZA 3TO9A 4ZH4F 4L9VA 2D1HA 1WLPB 5A2QK 3GZ6A 3V1QA 1WSJA 3THVA 2A3ZA 1SANA 4GGGA 5CQEA 3CJAA 5GMKe 4CJTA 1I81A 1C0FA 3HP6A 2A3LA 2FPDA 1LFUP 3BGRA 4LD5A 3D0PA 3PQKA 3J7AO 3LW5E 4HKEA 2VVKA 1G3YA 1W5TA 1OR7C 1U1TA 3JW4A 1VF9A 4AQYK 3E9LA 5GAEJ 4WCIA 1NK8A 2JRMA 2LBFA 4KB0A 4M3EA 2DLPA 4BRKA 4FJNA 1GVDA 2IS2A 1UJYA 2XDBA 2F9TA 1JXBA 2J4RA 4KB1A 5HK0A 2MFZA 1NEGA 5AQFA 3WT0A 4BE2A 2D0NA 2Q3SA 1W4SA 2LMJA 2HDWA 2HOSA 2KRSA 2EV5A 3TAQA 2V1RA 4BRAA 4KBMB 2Z0WA 1T0FA 4YOYA 2BE7D 4NO7A 2CZ1B 4AFZC 1XGNA 2GBYA 2YSRA 5E79C 4IKFA 4LLNA 1Y96A 3QIIA 1OULA 4I2OA 2L89A 1R4NB 2P9SB 2NRWA 3P8DA 1VQNN 3HYFA 3HOTA 5KGXA 3QICA 1IN8A 1TKXA 3F73A 4MEYF 2DD5A 1EFNA 3LAJA 2FZKB 4MHGA 3R9PA 1GL5A 3RR8A 4GVMA 4QPQA 5KYWB 1ERDA 4MDWA 2I5UA 1K83J 2JM9A 2P9LB 1JB0E 3CCEA 1K6OA 4FLXA 4CI0C 1Z67A 2A28A 3TU5A 3I56A 2JA6J 1U8RA 2K86A 2W00A 1OQKA 2JM8A 5EX5A 3REAB 2E65A 3DRSA 2HHWA 3ZSWA 3OIQA 4NHJA 3ZEHA 1FOXA 3RKYA 1I5ZA 2DDAA 2RHXA 5AQOA 2BIVA 3ENBA 1WBDA 3A5MC 5GAMh 3QNOA 2OQGA 3C7JA 1D5AA 2CH0A 5FLXE 1K73C 4XTVA 1X3ZB 2VOOA 4PL7A 1UA0A 3SBTA 4FLTA 3K1PA 2WAQN 4JHDB 3UKRA 4AUXA 1RT6A 2VV5A 3E97A 3DOKA 1VNDA 2O31A 2JT4A 2ZXHA 2HXIA 1XGMA 3WU0A 1RFQA 3JRIA 1SL2A 3GF5A 4FYDA 5GPAA 3EQLF 1O13A 4RW4A 2P9KB 3DLGA 3LWIA 5GAN8 4AT1B 2MI6A 2QXLA 4W5QA 2OTJA 3CWAA 4OIRF 2G8VA 5B5EC 5GP9A 4PLIA 1GBQA 3HGGA 5EEGA 4ZJZA 2JSPA 4XRSA 1YJNI 4G94A 2PFBA 4JX6A 2YWWA 5FLXO 2LJ3A 4MMLA 3DQVC 5C3EJ 2HVIA 4FJ5A 2PJRB 2BY0A 2YPRA 4A0ZA 3B6OA 3L0QA 5FU6C 1X58A 3EETA 1DU0A 4IEEA 2ZJRL 1KQSP 3H3OB 4M7AC 2HSTA 1S1VA 3G73A 3WXLA 4HDUA 4GDFA 2J7IA 3A0HC 2VG7A 2D0OA 3BY7A 2F9WA 1RTDA 3FXLA 2E1YA 1X1PA 3O3HA 1IG7A 5GAMf 5B1BH 3L1AA 1MUNA 4XEIA 4IURA 3DEWA 1F4KA 3CJNA 3FIFA 3MCZA 1IG9A 5KYNA 4LD0A 2RQWA 3G0QA 2CP2A 5LJ5f 5GANh 2Y1JA 1CF7B 3DTIA 3VPZA 3ZQGA 3VF2A 2QKBA 3I53A 1NKBA 1QZZA 2QF7A 1JJ2P 3PV8A 4N41A 1ON1A 2DO3A 1J54A 2V7YA 5E3NA 4YDUA 1RLQC 3VQAA 4UHTA 1QVFA 1W9HA 1SZ2A 1NGDA 1HYVA 2C0IA 2GFUA 2XGDA 5AQYA 2M9HA 2VBXA 2ZNZA 1AU7A 4X9CA 3OVNA 2VI6A 3GL1A 3K0LA 2DFIA 2D2WA 1TGOA 3IG1A 4RTUA 1G15A 4HTUA 2ECZA 3CCSN 2ZB9A 4DV5K 4HHTA 3SCXA 4DW6A 1MZBA 2E7WA 3R60A 1BBYA 1SRLA 3DB3A 4HSRA 2QVOA 1EH8A 1JHHA 2LQNA 3JB9F 1D3BA 2DERA 5E8GA 1X3MA 4XK4A 1NHAA 3CQ8A 4S04A 3WXJA 3ASOH 4JLIA 3SQNA 4YELA 2R7SA 2BY1A 2B9SA 1TT5B 1D1AA 1RESA 3IKVA 1RRJA 2VL8A 3E6DA 4D5CA 4A3EJ 3SQ4A 1MJ9A 3WODF 1RUOA 3EL2A 3VEPA 1O57A 5GJWB 5EZGA 3AA5X 1S6LA 3H9QA 1SD4A 2TCTA 1K0SA 1YW8A 3VERA 2E6MA 3ZCOA 5KYYA 1JKQC 3WTYC 4XN0A 2FF3B 1RBRA 3RVCA 1XMXA 4Y4RA 3W3CA 2KIFA 3OYNA 4EA5A 2P7CB 1NG2A 2R57A 2KLAA 1D5VA 2XF6A 4IF4A 3L8BA 3JCMP 2NNYA 2BHYA 1PJRA 5H1SQ 4CD1A 3M8EA 2P9UB 2P9NB 4C23A 1XG7A 5K7HA 1PWTA 1HW1A 2Z1GA 5IWAK 2PNIA 3HBLA 2IGKA 5IXBA 3PVQA 3CCST 1WJBA 1QQOA 3RZDJ 4BRLA 2QTVA 4XOTA 3QKJA 1ZYQA 1KVBA 1HNVA 4UVCA 4E7LA 1V76A 3H46O 1LDJA 1BCMA 3UKUA 1NG7A 1RGIA 1JXMA 3UF4A 3QPSA 4F16A 2ID3A 3WG9A 1UWBA 4ZZDA 3I4MJ 4AIDA 2DTOA 4QTRA 3W0LA 4B21A 2CQ7A 3VQ7A 2EILH 1K9MR 1FN7A 2Q8KA 3S17J 3HTVA 4ISGA 1JCEA 2IT0A 2PBIA 1N8RO 3Q0VA 2H3GX 4FASD 5FKOA 1Y07A 2O8EB 1CZAN 1GOCA 2YHTA 5GAOn 1KLMA 2XD0A 4KHQA 1XC3A 2NLXA 3HDDA 3G7ZA 3LOCA 2OTLN 2W48A 1H0MA 1C1AA 5GAN4 3BG6A 3CEYA 4J83A 5M3MJ 2DXIA 4YPHA 2YJFA 3VN5A 4B4CA 4KUIA 2X6WA 3CUQB 2WAEA 2M0YA 4DFJA 4KA4A 4KREA 3LSTA 2PYLA 2VXZA 3LSHA 3PY8A 4B8XA 3H6EA 3ZQHA 3AGKA 1F9NA 3N4PA 2Y0MA 1N36K 3VYRB 1Z3YA 4FK4A 4XTUA 1ZBXA 3G1MA 3K6GA 2FBTA 3QPTA 1YJWI 1N5ZA 5FGMA 5E17F 2M02A 2RH2A 5KH6A 4LD9K 1P4WA 4M41A 1KC8C 1BW5A 2E7XA 1WNLA 1YWOA 3ZETB 3VENA 1FP1D 4ENMA 4JI6K 2O8CB 2X4WA 5JLFA 1P7MA 2HDAA 4IUPA 3SK3A 4WFNL 2M8EA 1FWZA 2FEZA 1ZQ1A 4JI3K 1WH5A 3WVDB 1X27A 2GCXA 2HS5A 2KDZA 2DEQA 4KV8A 3P5JA 2LR8A 2LY2A 1ZR2A 1XMKA 1R5HA 3LWFA 2JLEA 4IHXA 4FSXA 3ZQFA 2VBYA 4H4MA 1BKBA 4ITVA 4DZPA 1EIFA 4BROA 4AHVA 4AG1C 1RADB 1J7KA 1RAAB 3QYFA 1KONA 1QHTA 5LMNK 1EH6A 2KYMA 1JGSA 3BWGA 4LFAK 3ABUA 3MAQA 3QPHA 4MFBA 1H89C 3LP2A 1S6PA 1FBUA 1N9SA 1R71A 2XKOA 3ITHA 1TL8A 2QEXI 3J81E 2QA4I 3CCVA 3PSFA 4C0GA 2L9NA 3WGHA 2EVRA 4ID5A 2AQFA 4CEBA 3QB0A 2C06A 3RBBB 1WYXA 3JR9A 2ZJPL 2FMYA 2RF0A 1WJEA 1Q7YO 2OZSA 5LEJA 3EH2A 1MUZA 3I0WA 1UZCA 4GY5A 2BXZA 3QSUA 5CJ9A 1QGPA 1ZBLA 2HHTA 1XGOA 2NVUB 3VS1A 4E4HA 4Z6YA 2ZPEB 1HF0A 4O0JA 3VGKA 1ETKA 4L8RB 1FOWA 3C2BA 1NJIO 1NJYA 1TKDA 3JREA 2KBTA 1ZK8A 2M3AA 1Q9YA 2GQQA 3MN9A 5DPKA 4BNCA 4ELYC 3OYJA 1HYSA 4DOZA 3U21A 1PRLC 4Y15A 4KPYA 5KAIC 4FVUA 4A62A 2F2EA 3V1RA 2E34A 1VRTA 3MEDA 1D8YA 3VF6A 3W6JB 3O8VA 3D2FB 4CK2A 3Q7CA 3SFMA 1KQ2A 4MTEA 1YS6A 2FA5A 1LPQA 3FR0A 2JVHA 2OZ6A 1C1BA 2BGGA 1KYWA 1OCZH 3JCMh 4PDKA 4F92B 3LL7A 5CLSA 1KA8A 2UZKA 2X6OA 1MJAA 1S1UA 3TU4K 4J7FA 4DSIA 4HF2A 3LNQA 5J2PA 1FXXA 5CY4A 4BBSJ 2MG4A 3KZZA 3I5SA 2M8GX 3P39A 5FPNA 4CCMA 4Z89A 2EFIA 1V29B 4W1UA 5LBQA 4HPQA 4C5IA 5GANd 3F22A 2ZJRF 5AQXA 4Y92A 2Y4XA 3KK3A 1YHQI 4K0KK 4XMYA 2MD0A 3FKIJ 5F04A 3VS4A 5GAN6 5KYWA 1G2BA 4ZTFA 5E3OA 2LSNA 2P9LA 3CJ1A 1FIAA 1N5YA 4ZYGA 1JJ2S 3M07A 5EVZA 1JBMA 1V4TA 1RI0A 2LP5A 1GXPA 2V4JC 4JI2K 1SFXA 1LWEA 3CF2A 3OSFA 3D6RA 4BRGA 1JTYA 3FE1A 1T44A 2QQBA 2IIRA 3CQTA 4UQGA 3SDGA 3L3VA 2G7HA 1R00A 3EKUA 3ZYYX 3HSCA 3PX4A 1KVAA 4C5HA 3JCMf 3SUQA 2Z99A 4Z2YA 2MK5A 1JTXA 4JHDA 3GTLJ 1WHHA 5AQRA 5M1PA 4P96A 3BJOA 4JI4K 2XB0X 4HYEA 4GRIA 4CO8A 1K9MC 4B9NA 1NJWA 1OYYA 1NLPC 2JA7J 1W6XA 3GTJJ 1WB9A 1D0ZA 2P9KA 2CU7A 3CC2A 1VYTA 3J81K 1IDYA 4I2QA 4CESA 4C92B 3RZOJ 1ENHA 2W4SA 4E7JA 2CG4A 4EMKA 4YIFA 3LQRA 5H6RA 2HPIA 5AQLA 3LYIA 3TOBA 5HDGA 1NGGA 1ZSZB 1RACB 2RQPA 1WKMA 3T69A 3D45A 3K58A 3QBYA 2HU9A 3FC3A 1QVGM 1WSGA 4KTZA 2HZYA 2DYSH 3KFWX 5GAOp 1WN7A 4DV0K 4BRNA 3ATUA 5EOYA 4FT8A 2K5FA 3RPQA 1PU8A 5EDNA 3LM9A 1YBYA 3SZ2A 4JAXA 1ZHFA 3CBOA 4XTXA 1J5EK 3LH0A 2QLZA 2YSQA 2M1BA 3H3UA 3CCLI 3CXCP 2P7VB 4BJTA 3K4JA 2F2XA 4DV1K 2JPCA 3HKSA 5IT9O 5DDGA 2LTPA 1CF7A 1XG1A 3BP8A 5J2NA 1VQKA 5FJ8J 2WC9A 5GMKj 2QEXQ 2G6FX 3MWMA 3QBWA 4KFBA 2DXUA 3OMGA 3QESA 4C8LA 2COBA 1GLLO 3QO3A 4JJCA 4F7UF 4CFAA 2KNBB 1IKXA 1SC7A 2JUFA 2D1XA 4JS5A 4M9XA 2OPRA 2M87A 1ETVA 1VQMA 4XIDA 4WQ5A 3OYGA 1ZREA 2P0WA 1BA1A 1S6QA 1TUDA 1KZHA 5L3CA 2QXFA 1XOVA 2I2LA 2W41A 4FHTA 4GCVA 3V9UA 1HNXK 2YNIA 1M1EB 4R8HA 2P0KA 3HPWA 3QLHA 2EIKH 4YHHK 4KHNA 4DQPA 4KT0E 2X74A 3HVRA 4BR2A 4FJHA 1U2VB 3CPWM 4ON0A 3CW7A 4CGFA 3C6AA 2PMUA 4GO1A 3OL4A 1RT2A 1TLHB 2ADUA 4FOEA 2M7BA 2X6YA 1BI4A 2YHXA 1CKBA 4DTRA 5BS6A 2V1XA 2QBYB 1QQIA 3FHNA 3IRQA 1T98A 1CGPA 2VG6A 3ALYA 3AAPA 4H5TA 2DIQA 4H0PA 4CCNA 3GLXA 5CYMA 3R0JA 4KRTA 2COZA 1YQRA 2DNUA 2BTFA 3HSRA 1IGUA 1GV2A 4XKCA 2AIRB 5ILUA 1BIAA 4CHUA 1EBMA 1ZLJA 4LDWA 4YRVA 4BUGA 4BU2A 1TXQA 2XK0A 4CGIA 3LSPA 4E6RA 3DPLC 3H5AA 3W2AA 4CEQA 1VQ4A 4C8QB 3A1PA 4NDLA 1T0JA 1RIOH 1T0HA 3P8BB 3CJRB 3F70A 4D8KA 1LEAA 4PJOF 4QS8A 2P9UA 2P9NA 4IQJA 4RTYA 5AYFA 4BQQA 5KE2A 3THYB 3RTVA 4CFBA 1OX8A 3KYDB 4BG9A 1N9RA 2L02A 2O4IA 4XLHA 1U04A 4AFQC 1YHQQ 9ATCB 1D1BA 1HKGA 4KH0B 1HQEA 2PZSA 5AR0A 1ZGJA 4C92F 3ID6A 3MD2A 4E9HA 1MGQA 2E12A 2IVNA 2K3BA 2FB7A 4HV5A 3CJBA 1VQLQ 1VQPQ 3AVMA 3SEQA 2D45A 3WNGA 3O6BB 1N6QA 3HOWJ 3DEUA 5M1QA 4RA2A 3J7YP 3HG9A 1NOZA 4QS9A 1VQ9I 4GNIA 2DOAA 4FTHA 3FK6A 1M3HA 1J59A 3KLEA 4LH4A 2JN0A 2EQUA 2CH6A 5I11A 3MDQA 1UUEA 3U8XA 2FPFA 2O8EA 3OA9A 5D6EA 4DU1A 2P84A 1ITYA 4Y7NJ 3DWLA 3EYZA 3LA3A 1VQLN 2HMIA 2COYA 2DTRA 3ME9A 2JTVA 5DUKA 5CAIA 4IEIA 3LP0A 2E5QA 2ATCB 3N05A 4GKJK 4NQWA 3V9XA 3C0CA 1HKSA 1IGQA 1KU3A 3VQDA 2R58A 2R7UA 3CUQA 1WH7A 2HL5C 3CG7A 2QKMB 2LD5A 1NKCA 4KN7X 3RDVA 4XLAA 2STWA 2F4IA 2NVXJ 4JYAK 2J5OA 4Y13A 2VWFA 2STTA 2HPMA 4OFAA 5GAOl 5AZIB 2ZJPF 1SD5A 3AAQA 2E10A 3MQ0A 1SL1A 2OCCH 2M0CA 2M4GA 3JCUC 3J80E 3RJPA 4IUVA 1OYIA 4Y3OA 3THWA 4N76A 2EFNA 4Y1DA 2JA8J 1NK3P 4MQ9F 2FSWA 5DV5A 2DFFA 1QWEA 5F0HA 2BUPA 2Y2ZA 3FLCO 4M3BA 1FLIA 2O8CA 5LRSA 1WNSA 3AVBA 4CERA 2DK3A 2KYBA 4CYDA 3GF2A 2D5VA 5LJ3j 1T7PA 2X4YA 5GMKh 4Z4IA 5DD4A 2I0NA