3S3MA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/inhibitor/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3mA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3mA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3mA03
3ZT2A 2OYQA 1VK0A 4PUOA 4PL6A 1Z25A 3DMJA 5CZ1A 5HBMA 1HRHA 4CF2A 4CHYA 1L3UA 1WJQA 1SL1A 3H8ZA 3A2FA 4E1MA 1VRUA 4M41A 1S1TA 4KREA 3U3GA 3CEYA 2GUIA 1XNIA 4E7HA 1DTTA 2RN2A 1SL0A 4C5HA 1VSLA 3MEEA 4L59A 5CIUA 4Z4GA 3KJVA 4I7FA 3PO4A 3ZT3A 4DF4A 2X78A 2DIGA 4BE0A 2E5QA 1FKPA 1ZBLA 3HYFA 3KD1E 4KB0A 4CJQA 2EQKA 3HPGA 3G0ZA 1ASWA 3AA2A 4O55A 4DTPA 3TR8A 4DG1A 3BGRA 1N6QA 1QHTA 4QVZA 1VRTA 1ZBFA 5EU7A 2YNHA 3CFOA 2L8DA 3ZSOA 1LWFA 2EKOA 2P1JA 5C6SA 2XY7A 3L3VA 1X9WA 2IC3A 4LY7A 2GV9A 4CEQA 2KTQA 3UIQA 2RKIA 3RMDA 4FK2A 1NJWA 4B9XA 3HJFA 3BDPA 1RTDA 3SV3A 3TABA 2RI2A 1JLQA 1GOBA 1QQCA 3PMIA 1A5XA 1RDCA 4KHQA 1O1WA 3SPYA 3TARA 3OQ5A 1X1PA 3FDRA 1TAUA 3B6OA 1S1UA 2DFHA 1Z26A 4FLXA 3MO8A 3TAMA 1JLBA 3P8HA 4HUFA 4DTRA 1NK9A 4OLAA 1TV6A 2RHIA 3MXIA 3C6UA 2GF7A 2OA8A 3AVNA 4M3TA 3AA4A 1BGXT 1CXQA 4N4IA 4CHPA 4CJTA 4RG8A 3LX7A 4IFVA 3U6FA 3U3YA 4M3YA 3KUFA 2RF2A 1KSPA 4Z4FA 4KKOA 3DLGA 1TKDA 4W5TA 4DFJA 4ELVA 3QNNA 4CJ4A 1RBUA 2IAJA 4FJIA 4H8KA 2A1RA 3OYKA 3RMCA 4FJGA 4CFDA 5FDLA 2D5RA 4CERA 2WOMA 4E1NA 2G8FA 2RPIA 3AV9A 4J2BA 3CYMA 5FRNA 4DTSA 3QEWA 3D45A 4E19A 3NH0A 1D5AA 4OPJA 1NKBA 2MWOA 3OS0A 4W5RA 3KLFA 3SQ2A 4CCHA 1CLQA 3ME9A 3NF7A 3KIOA 4CESA 1TKTA 3PX4A 1IKVA 4CJVA 4E7JA 2DY4A 4Q0BA 4FJMA 2X35A 4I2PA 3ISNC 3P5JA 3AA5X 4RW8A 1SUQA 2HMIA 3IS9A 4NYNA 3VQPA 4B9WA 5E41A 3SJJA 2G8WA 4M3UA 3OYJA 2P5OA 3NHGA 3AVBA 1QSYA 4RW6A 4FJHA 4AILC 4H4OA 4HHTA 3FC3A 4JLHA 4YNQA 1KRPA 4RW9A 2PZSA 2RHYA 4E7IA 1BQNA 4O44A 3V9WA 3KTQA 3UWNA 4LD0A 4FYDA 3LGLA 2HNYA 1VSDA 3V1QA 1X9SA 3ALYA 3HM9A 1NK4A 2RJEA 4KHWA 1CZBA 2RI3A 2QK9A 1L3TA 4QQ6A 1RBRA 3NF6A 4DTUA 5KRSA 1U49A 2EFIA 1RDBA 3NTIA 4CHQA 3AVHA 4IG3A 3ASKA 2B5JA 4CEOA 3L2VA 1BISA 3B6PA 1G15A 4OVAA 3S3NA 3DB4A 1IKYA 4PY5A 3SUQA 4Z4HA 1SL2A 5J2NA 2B6AA 3QESA 4FJXA 2KFNA 2FBTA 4FM2A 3MECA 1SKSA 5J39A 3QIIA 4E3SA 3ZSWA 1JL2A 3QEIA 4OKKA 4BACA 3GOXA 1B92A 4EDUA 2YHBA 4H4MA 3O4QA 3ZT0A 4B8AB 3SUOA 3AVMA 5K14A 3ULDA 3KLIA 4F8RA 1ZBIA 4JS5A 4PLIA 3RRGA 1RCHA 5KCOA 2XRIA 1NK6A 1ZBHA 2F5KA 1J54A 3C6TA 4IUQA 4CFCA 1IO2A 2M16A 3C4SA 3OYBA 2JLEA 4FJLA 1ZBUA 4MFBA 1HQEA 1TL1A 1NJXA 4FU6A 3LH0A 2OPRA 3M8RA 1MHNA 3OYAA 3QEPA 5I3UA 4KI6A 3VQ5A 4AHSA 1BIZA 3S9HA 4C8KA 5HROA 4FJ8A 2QQRA 3LDSA 4CJFA 3TI0A 3VN5A 2ZE2A 1WJRA 5HRNA 3RMBA 2PYLA 5J2PA 4J2EA 3SNNA 4NCBA 4Z4CA 1KVAA 1C0TA 4Z0UA 4CJKA 4DFMA 1C1CA 1KLMA 3V9ZA 1KFDA 2KZMA 2KFZA 3AVCA 3OYMA 2GBZA 4Z02A 4J2DA 4W5QA 4HCCA 2DIQA 2NLUA 4CGIA 1D8YA 3NNQA 2BDPA 4A4GA 4FLVA 4Y1DA 2RJCA 4DTJA 4PQUA 3QIPA 3V81A 2B8AA 3AVFA 4FL6A 1ITGA 2Z1JA 3NBPA 3T19A 1NOYA 2VWKA 3NCIA 2G8HA 4R5PA 2IDOA 4FZXC 4L8RB 1EETA 3DLMA 1C6VA 4DS5A 2R5AA 4CIEA 1OZ3A 1RDAA 2Z1GA 3S3MA 3LAKA 2Q3SA 3L2RA 3OS1A 1S5JA 1BI4A 3THVA 2YNIA 1TAQA 4IUTA 2EQJA 1C1BA 5HRPA 3LZJA 4FLYA 3LANA 3KLEA 1JXBA 3VQ8A 1TK8A 2G8UA 2G8IA 2ITGA 1F21A 3EAEA 3EYZA 2G8VA 4E7KA 1S9EA 1WLJA 4FCYA 4XIUA 3CFPA 4OPKA 5KTQA 1RBSA 1SKWA 2X4XA 3DLEA 3KLGA 5HLFA 2RI5A 3E9FA 3ZSZA 2W42A 5SWMA 2BGGA 3LP1A 5CYQA 3ZEHA 4I9QA 3SUNA 3OS2A 2XDPA 2HHQA 2DTUA 4NYFA 4QCLA 1REVA 1HQUA 3QLHA 4CGHA 1EXQA 2WONA 1J5OA 4QQDA 1OYXA 3F70A 1XWLA 1BIUA 2OPSA 3NF8A 1H3ZA 5JS2A 3VQAA 3QEXA 3O4NA 1WNSA 1RBVA 2RHZA 3TAQA 3OYFA 5DMRA 3MXJA 5C25A 5D6XA 2F8SA 3LWMA 3AVIA 3UT1A 1L3VA 4FLWA 3QBYA 3TWHA 4C8OA 3M8PA 4KI4A 2KQ2A 2LSNA 3WNHA 4QOZB 3VQCA 3PV8A 1RILA 3VQ9A 4N56A 3O3FA 4EP5A 4DQRA 4F2RA 4DU4A 2L3RA 1HYSA 3DLRA 3AO5A 3NFAA 1EX4A 1EKEA 2E6NA 3OYLA 2XK0A 1KVCA 1TK0A 4MQ3A 4ZTJA 4AHUA 3F9KA 2XY6A 4CJ5A 2P51A 4CJEA 2OPPA 4B3OA 2ZD1A 5FRMA 2VG7A 3LGFA 2XY8A 4TSXA 2QKBA 1LAWA 4AHTA 4DMNA 4O0JA 3AO4A 3T1AA 3CG7A 1JLFA 4M42A 3C95A 1JLAA 4CHZA 1WSFA 3IRXA 2G3RA 3HXMA 3D0PA 3DLBA 3Q1JA 1R0AA 3FEOA 4FLUA 3I8DA 4ID1A 1WSEA 3AO1A 3K57A 1OZ2A 1U45A 5IN1A 3SPZA 1BQMA 4KB1A 4Q5WA 4IURA 2BKDN 2HVHA 4FK0A 1UAXA 2QQSA 1I39A 2Z1HA 4CJLA 5D3GA 4FXDA 4KRFA 1JL1A 2P5GA 2O4GA 3CM6A 1RT3A 2LCCA 4DTNA 5D6YA 3HSTB 4I2QA 1X9MA 1N5YA 4O5BA 2HHWA 4NZGA 4A4EA 1J53A 3LAMA 2R57A 3JSMA 2EQUA 1NKEA 5HRSA 3LYIA 1IG9A 4EZ9A 4AH9A 4BD3A 3I0RA 1K6YA 2WACA 2D0BA 1WSJA 4JS4A 4UC4A 2X6SA 1XI1A 3VA3A 4B9TA 5J26A 1T8EA 4C5GA 2LRQA 1JKHA 3G10A 4ID5A 3VQ7A 3QO9A 4LSLA 3VQBA 4CGJA 4E0DA 5C42A 4DSKA 1GOCA 1HNVA 1LWCA 2X74A 4OJRA 3MP6A 5KGWA 4BWMA 3RRHA 4A4FA 4Y1CA 2E6MA 4ZTFA 1QTMA 1NJYA 2FBVA 1NK0A 2YNFA 3DOLA 1W0HA 2JZ2A 1ZYQA 4DQQA 4LH4A 4HUGA 1UOCA 4CJSA 4OKJA 2HB5A 3AVLA 3DYAA 3NGZA 4DQPA 3NAEA 3FFIA 3PUFA 4M45A 1U04A 3P1GA 2VG5A 2LVMA 5D6WA 3DRPA 4CEAA 1BL3A 1TL3A 4M3ZA 3AO3A 1QSLA 4N41A 4N5SA 3PFSA 1WAFA 4OVLA 4OKEA 4FJNA 4B9VA 4AHCA 3V1OA 4CK3A 2E4LA 1Q8IA 5KE2A 1B9DA 3L2UA 1BI4B 5J1EA 4DTMA 3QNOA 1XHZA 1Q9XA 4B9SA 1QSSA 2VWJA 4PA1A 4DLEA 4KV8A 1HPZA 1RT4A 3K5OA 3H6ZA 4KHSA 3BDLA 2LDMA 3V1RA 4J2AA 4FJJA 4FJ9A 3OYCA 1RTJA 1YTAA 1NKCA 3TAPA 2FBXA 5CYMA 4CECA 4HUEA 2KZZA 3JYTA 1T03A 1WN7A 3WNFA 2HVIA 4IG0A 4OGEA 4RW7A 2Y1IA 1RT6A 4NS5A 1LV5A 1RT5A 1VSEA 4GY5A 4G1QA 1VSFA 3P83D 3NH2A 2BANA 3SQ4A 1WSIA 4B9MA 2HHTA 3IG1A 2O4XA 2X4YA 2ZQBA 5SZTA 1KLNA 1CZ9A 1KCFA 3NTKA 3TAFA 3OVNA 1W9HA 1HYVA 2X6NA 1YVUA 4CIGA 4DS4A 3CM5A 4B9UA 3NTHA 4HCBA 1QS4A 4IUVA 3ZSXA 4BWJA 2HW3A 4NCGA 4CJRA 5KE3A 4KFBA 1WSGA 3AA3A 3LP3A 5CZ2A 4KHYA 2VG6A 3QINA 3QETA 3EZ5A 4W5OA 4KAZA 4CEEA 3K5LA 3OYHA 1VSMA 3ZT1A 4CF8A 4B9LA 1TKZA 3AVAA 4DSLA 4CE9A 3O3HA 3SV4A 2IS3A 3ZSQA 3DRRA 3SYZA 1JLGA 2ATQA 4IUUA 2HQXA 2MWPA 3CFRA 1S9GA 3RMAA 3SZ2A 3V6DA 3L2WA 4RG2A 4CJ3A 2G8KA 3IAYA 3LALA 4DSFA 3SI6A 4M3XA 1EP4A 1RBTA 4OLBA 2RJFA 3HP6A 4DFPA 3QIOA 4GMJB 4KHNA 5J2MA 4FJKA 3DB3A 2M0OA 2NUBA 3DLKA 2DFEA 4CFAA 4DTXA 3E9GA 1L3SA 2PY5A 3ZSYA 4FJ7A 3DRSA 4FM0A 1TK5A 3NF9A 4DU1A 4GVMA 4BDZA 2P0KA 2PQWA 1U47A 1RI0A 4LD6A 3QEVA 1U4BA 3RR8A 4C8LA 4FZYA 4QQGA 1TKXA 2XHBA 1UWBA 3HT3A 2OZSA 4DU3A 3AVKA 1SSFA 4CHNA 3K5NA 2DFFA 3K59A 4JRPA 4EZ6A 1TGOA 3DI6A 4B8CA 3MP8A 1J9AA 2OPQA 4N4GA 4AHVA 2HNDA 3ASMA 3MAQA 4CF1A 3DLHA 4DSIA 4FW2A 2R58A 1HYZA 2RHUA 3HPHA 4DFKA 3SQ0A 2BUDA 3V4IA 2EHGA 3VQDA 1GOAA 2CKKA 1VSKA 3ZCMA 2M1HA 4ZHRA 1JXEA 3L42A 3QKJA 3SD4A 3ZSVA 3AVJA 4A4HA 5HRRA 1RNHA 4N4HA 1WJSA 3P8DA 2IGIA 3ZSRA 2FBYA 5T7BA 1LWEA 4IFYA 3HVRA 1XC9A 2LTOA 2EQMA 1XHXA 3VQEA 3PO5A 1SKRA 4M3WA 4BDYA 1DTQA 4C5EA 2BE2A 1LW2A 3MEAA 4IBNA 3MXMA 4DSJA 4F2SA 3HK2A 3L3UA 4B08A 3KK2A 2JTFA 1IKWA 2QXFA 1WAJA 3ITHA 3LP2A 4M3RA 3PMTA 3VQ4A 3RR7A 4HCZA 4F4KA 2VYTA 2R7YA 3K5MA 2HNZA 1RTIA 3EY1A 3F73A 1LAVA 2IOCA 3WNGA 3KK3A 2D9TA 1JLEA 4BE2A 1S6QA 1BCMA 1YT3A 3ZT4A 1Y97A 4CIFA 3NDKA 4DLGA 1T7PA 4QAGA 1B9FA 1VSIA 1NJZA 3LLRA 3OMCA 1JLCA 3NE6A 1NOZA 3OYGA 3PNWC 4K8XA 4FJ5A 1BCOA 5CY4A 2IG0A 2HHUA 1U48A 1MU2A 5C24A 1VSHA 3QJ6A 4QW2A 4N47A 3KD5E 4FK4A 3PX0A 2HHVA 3LP0A 3PY8A 4X34A 4CHOA 1KFSA 4JRQA 1NK5A 4C5IA 1HNIA 2YKMA 3OY9A 3WNEA 1LW0A 4KTZA 3TANA 3QERA 4FZZA 2K3XA 1RTHA 2F8TA 4KTQA 1T05A 3TAGA 1C0MA 1RT1A 1Q9YA 1QE1A 3K58A 4PLLA 4E89A 5KCHA 1D9FA 2YRVA 2O4IA 3O3GA 3OJUA 1UA0A 5JS1A 3M9QA 3MEDA 3SUPA 3DM2A 1HJRA 3RTVA 5I42A 5FROA 3E01A 3C94A 4I9LA 2FHDA 1TVRA 3L8BA 2YHAA 3HP9A 4KTWA 3OYIA 4CEFA 4CGDA 4LH5A 4OGCA 1UA1A 2RJDA 4HTUA 1HMVA 3MEWA 2BIVA 4Q5VA 3HO1A 4BDPA 3T3FA 4CRIA 5KGXA 1WGSA 2GFUA 2HQEA 4DF8A 2HHSA 4FLZA 4DSEA 5IAYA 4W5NA 3LWLA 3H08A 4KPYA 2YNGA 3AVGA 2XY5A 3SQ1A 4K8ZA 1ASUA 3K2PA 4HVJA 4II1A 4WE1A 3SCXA 2JGUA 3S3OA 2B4JA 1KVBA 4ICLA 1I3AA 1WSHA 4ELTA 3MEUA 4Z4EA 1FXXA 4CGFA 1D9DA 3DOKA 2PYJA 3META 3M8QA 4DTOA 1C0UA 4CF0A 1KHCA 3OA6A 3M8SA 4IKFA 3OYNA 1S1VA 4CK1A 3KLHA 2GFAA 2EX3A 3NGIA 3VA0A 4E7LA 2RO0A 2A1SA 4IDKA 4KHUA 3FLGA 3VQQA 3I0SA 4FVMA 2Z1IA 2O4XB 5C0MA 1S1XA 2XO7A 2YV0X 4CJWA 4DWIA 2F96A 4F3OA 2KW4A 1IH7A 4F3TA 1RT7A 1VSJA 4ELUA 3KK1A 4RW4A 4O0IA 4UQGA 1G5VA 4KO0A 3LZIA 2X4WA 3S6WA 1S1WA 4FW1A 3HL8A 3NH1A 5M9OA 4C8NA 4CGGA 3V9SA 2I5JA 2HHXA 2D0CA 4GW6A 3HVTA 1FKOA 4AHRA 2Y1JA 1DLOA 3OMGA 3V9UA 2K3YA 1KTQA 4Z4IA 2RHXA 1S6PA 4C8MA 3VQ6A 1A5WA 1L5UA 1FK9A 2E6LA 3PX6A 1IKXA 4O4GA 4BE1A 3HPOA 3KKRA 2QKKA 5J2QA 1ASVA 2R5MA 3TAEA 4DQSA 4B9NA 4PWDA 2AJQA 2OZMA 1BHLA 4FLTA 4FM1A 4CJUA 5KRTA 2YKNA 1N27A 5KH6A 2D0AA 2DAQA 3MEGA 3KKSA 3MEVA 4EP4A 2ETJA 1C1AA 3L2QA 4N76A 2L89A 1RT2A 1A5VA 1SV5A 3OYEA 4CEDA 4CFBA 3AO2A 3LPUA 3NGYA 4CEBA 4CK2A 4CEZA 1CXUA 4CF9A 4YFUA 3CQ8A 3O8VA 3V9XA 5HP1A 1NK7A 1NK8A 4LSNA 4CJPA 3RWUA 1YTUA 3OB9A 4NCAA 5DK5A 2FC0A 4IUPA 1RDDA 3MP1A 3LPTA 3OYDA 5KI6A 4DQIA 1OI1A 3OJSA
chains in the Genus database with same CATH superfamily
4K41A 3I59A 2R5YA 1WGXA 1N3CA 4OPAA 2K2VA 5AQLA 2WTUA 1NGIA 1YS7A 3HPGA 3V4GA 4DTPA 3RSEA 4ELZC 3M0UA 1J5YA 3EL2A 5F27A 1M2VB 1LWFA 2EKOA 1X9WA 2HQAA 3JSOA 2ELJA 4ZNXA 1YIJT 2E8AA 2GTOA 3NVKA 2PMHA 3HRMA 1VQ7Q 2BBYA 4FX0A 3WTTC 1PDNC 3C65A 1KYWA 1ABQA 4FIBA 4QKUA 1ZHIA 2CUZA 3ZETB 4H8KA 2BY2A 4M77E 4E1NA 4GRIA 1MV0B 1RRSA 4E19A 1IXDA 4W5RA 3GTOJ 3FBNB 4E7JA 1SUQA 4HWIA 1QSYA 3SFZA 4S0HB 2FXAA 1KRPA 2LC2A 1IDZA 3LGLA 2HXIA 3HOYJ 3BE3A 3NF6A 2VKDA 1HSJA 2WV1A 4CEOA 3L2VA 3W2AA 3M8JA 1MDMB 3VS3A 1IKYA 4BJTA 3L0QA 1LE8B 4H4MA 2MF2A 3VRYA 3MX2A 3G73A 2FPEA 2F5EA 3K4NA 3ROUA 2IS2A 4A2AA 3E97A 1ZBUA 1N8RO 4IWVA 2AP1A 1NE8A 1ZA1B 2VBXA 4PDKA 4HSBA 1RFQA 2ASPA 3CJ7A 3CMEQ 1IUFA 3KZIC 5TGTA 4EIKA 2I2LA 1KFDA 1PSEA 1YAGA 2FSNA 3KFWX 4YOTA 4M77D 1KG7A 2DBMA 3NCIA 1ACIA 4JI7K 4ZYHA 4IIMA 1K73O 3THVA 1WEGA 3JB9G 4FJHA 1WOQA 2KKZA 3G4SQ 3EH2A 3G1JA 5KTQA 3KLGA 3SAFA 2RI5A 3ZSZA 1FJLA 1BK2A 1G3TA 1XWLA 4F04B 3ZQQA 3CPWP 3M0QA 3SEMA 2XSJC 2I8DA 1B6AA 3UT1A 4C8OA 1A31A 3EFOA 4XU3A 3QDKA 4M78E 1EH7A 4DQRA 3S15J 5AQWA 2K9NA 2L3RA 3AO5A 3SWNA 5KYYA 1BJZA 4CJ5A 3NWTA 1IGUA 2OPPA 2DTHA 3M53A 3EGUA 4AM7A 2M7BA 1K76A 3WXLA 3DLBA 2O2OA 1D0XA 2G3RA 1FIPA 4KNYA 4LDXA 1Y0UA 2EFQA 3EG9A 4IURA 2JN6A 1I39A 3R6MA 3GF2A 2P5GA 2HWVA 5DLOA 2ZXHA 4NZGA 3RIRA 1FYMA 1M90O 5J26A 4UVAA 1YG2A 5HKCA 2QA4A 4YDUA 1STZA 4FOEA 4J7FA 5BPNA 4LF6K 3HBTA 4WWCA 3HOWJ 2P5KA 1ZYQA 5EOYA 1YJNQ 2DDBA 2EZIA 1U04A 1YIJI 3VMFB 2FPFA 1WXBA 4NC6A 1BI4B 4NUBA 2LDMA 1VAZA 4XLEA 4E7ZA 2W04A 4KULA 3NH2A 2ZXJA 2R7UA 2W84A 1VQ8I 3VS2A 4LJZF 5IXFA 1W7PD 1EWQA 1OCTC 4U87A 3KNTA 2L9RA 5L3GA 3CCVI 4J5YA 1TWGJ 1Y07A 1RR7A 7AT1B 1AHDP 2QAZA 1K0XA 4P5OA 3SQNA 3L2WA 1Z9ZA 4M77B 2RDPA 2DERA 4X0GA 3WU2C 1IN8A 2IVMA 5H6RA 2UXXA 3PVLA 4WXHA 1QLYA 1DDNA 1HKGA 2E6ZA 4M7DA 1ORPA 4M7XA 2MD5A 2JA6J 4YOYA 4M75C 4M9ZA 1N9RA 5GMKh 4DSIA 3HPHA 3ZCMA 3KLOA 3N0UA 2QEXQ 2FBYA 3MCPA 2DVEA 3EUAA 4F2SA 4CVNE 3JCMe 1VQ8T 5D5UB 3CC2A 2NRZA 3KK2A 1TBXA 2DI3A 3LP2A 4HCZA 5CKEA 2VYTA 3HKZN 1VYUA 1X3ZB 3KK3A 5CKFA 4JKFA 4CIFA 4DLGA 2F5TX 1B9FA 3LLRA 3NE6A 1U2VA 3HRUA 4FJ5A 3ZPLA 1U48A 4IOCF 4QW2A 4JZ4A 3J7AF 5DCMA 2PJPA 3HTRA 3KP6A 5GAMf 1LW0A 5JVGL 3QERA 3IL2A 5ILVA 2FO0A 1RI7A 5JMVA 4IJAA 3M56A 3RTVA 4KH4A 3HP9A 4LH5A 2BIVA 3VGMA 4M7DC 2MCNA 1YW8A 2MOXA 2W85A 3PSIA 2Q2RA 2O0YA 4L0ZB 2P0QA 1FXXA 1BBZA 3BR0A 4CZLA 4OPHA 4DW6A 2HOAA 3OYNA 5CHZA 4H0TB 5GANd 3MK6A 2EX3A 1GLNA 3I0SA 2O9VA 1KQ2A 4CJWA 2UUAK 4ELUA 5EF6A 1G5VA 1OCOH 5M9OA 2I5JA 3MQ0A 1P7JA 5HCKA 1FK9A 2Z33A 4FETA 2FXUA 1BI3A 5GPCA 5KRTA 3F10A 4EP4A 1KD1R 2DBBA 2F4IA 3CQ8A 1G8XA 3F21A 3OHRA 2QGGA 5K5RA 4BYYA 3UA6A 5DK5A 4LITA 3DKMA 3OYDA 4XMYA 2DXTA 5K5OA 2X1EA 4QS7A 3ZMVA 4P55A 2DMPA 2AQEA 3H8ZA 4ANJA 4DV3K 4KN7X 3WHCA 3SZPA 4KUDK 3WXIA 1ZBLA 3HYFA 1Y96B 1RABB 4GCVA 4LUEA 4DHYA 1XQOA 1N6QA 4UOBA 3A8YA 4QVZA 1WQWA 3LWIA 3TBIA 5GAN5 4OFHA 3F8MA 3SV3A 1NMDA 3BFMA 3FDRA 2G9WA 1QVPA 1S1UA 3MXIA 3C6UA 2D8JA 4KMUX 1NBWA 3KUFA 1YITN 4E47A 4C23A 4KISA 3OYKA 3CC2T 3VS7A 1YO5C 2OJED 2P6TA 3IRRA 1JE8A 4KH5A 4DTSA 1T56A 3OS0A 1PC0A 3OMYA 2LX9A 3JRFA 4FSXA 2XAFA 1Q81U 2ELHA 3AG2H 1K73U 5FWBA 3JCMQ 1R9TJ 4BRCA 3PIPF 2QUFA 1FY7A 4UV9A 3PJRA 3J81Z 1CZBA 2EBIA 1W7PA 1U49A 2NUPB 3E9PA 2A42A 5LGUA 1SVOA 2HYGD 2QQ9A 2MG4A 2KMTA 4PNOA 3U2RA 3SUOA 4YIFA 5GINA 2ISYA 2ZJRF 1AWCA 3ULDA 3NGPA 2LQWA 4J6YA 2E2NA 1ZX6A 2VXEA 2Z5UA 5HNHA 3CCJN 2ZPFB 5BS6A 1KK7A 4PJOF 2EYYA 3CC2I 3F0ZA 2DODA 4HLXA 5MLCQ 2Z1DA 2V1UA 1ZG3A 4Z4CA 1BA5A 4U7BA 2ZFWA 4OP0A 1VYVA 2NLUA 2CP3A 1N33K 3M3ZA 5DEQA 2LCLA 1TUDA 4EJWA 2VASA 3A0HC 3OS1A 3I0WA 5AQOA 1YBYA 1S72I 2YRCA 1R5ID 1KONA 1ETQA 4RB0A 5JHUA 4AFSC 2BGGA 3BF1A 4QCLA 1REVA 2Y2ZA 3TAQA 2JTMA 5C25A 4L9JA 5GAOm 2KPMA 4RTUA 4N56A 1FBQA 2HMPA 2XGXA 3OYLA 3VS5A 4CD1A 1R36A 3DEWA 5AQRA 2XY8A 3LGFA 3KEOA 1Z67A 4AHTA 3S2HJ 1JXSA 1JLAA 2R7RA 1IBLK 2GBYA 5C4JJ 1BQMA 2DA3A 2VWBA 2QSHX 2IXSA 3KYCB 2DL7A 3D7SB 2XV4S 2PTKA 2O4GA 5DLQE 1RT3A 3EH1A 1ZAOA 2N8GA 1P90A 2PBDA 3DTIA 3DCFA 2LR8A 5E8IA 3ZR8X 3I0XA 3CXCS 1JT0A 5EEGA 2DFUA 1IN4A 2GXGA 2QA4I 4A4FA 4IZ9A 4E2FB 3CCLI 1O7FA 1IGNA 5AIQA 5F0FA 3SZGA 1FT9A 1M90R 2O8BB 5M3MJ 4R0KA 2E4LA 1Q9XA 3H36A 4EJOA 3FXJA 5EX5A 4KV8A 4ZZDA 2DA9A 2QWLA 4A3KJ 1C0FA 2OI3A 5KPTA 5BR9A 1Y8RB 2RAEA 1TOVA 3GEZA 3EYYA 3OVNA 4DS4A 8ATCB 2CGKA 3HKZA 1SSHA 3M0TA 2R7OA 1V3FA 2EFPA 4YDUC 2KQRA 3HOTA 5I2SA 2R7SA 3GFIA 3IAYA 1Y71A 3MN9A 4UUVA 4J00A 4KRTA 1RBTA 2W6LA 2XRLA 4ENMA 1GV2A 1HKTA 1V5FA 3HM5A 2P9IA 2DFEA 3FHGA 3NF9A 3ZLJA 5FLXE 4JKGB 3CMAN 4DU3A 4EZ6A 1M1KR 3RDIA 4UNOA 4D8DA 4AHVA 2MIOA 4FW2A 4FPAA 3SQ0A 5C4XJ 2CQ7A 2L5QA 2CREA 5AZJA 1T0FC 2L2PA 1HKQA 2DD4A 3CCSN 4I98B 5J6XA 1XGSA 2H1LA 1R0BG 1TWHJ 1QVUA 3LA2A 2EA4A 4BY9C 3S2WA 4ILHA 4F4KA 3EY1A 3OV8A 4BI3A 5JLFA 2O8BA 2H09A 3CBOA 3LMMA 3NFCA 3OYGA 1V5EA 1JQQA 2YDLA 3ERMA 3T9NA 5AFUH 3VKIA 1ON1A 4KTZA 4RTTA 1SFEA 1DU6A 1D9FA 4F7UE 4RGRA 2ESHA 2IEKA 3BDUA 2LQKA 5DPKA 3I5SA 3JCMJ 5KYUB 3CCLT 4MQVA 2YX6A 1KD1U 1ASUA 2DCEA 5LLQA 4UUSA 3I55T 4XH4A 3MEUA 2V6CA 4GNIA 2DOEA 1E17A 3E9OA 5JVGF 2E60A 1PRMC 5DDGA 3T8RA 2VQHA 3CCQI 1R23A 3CXCP 2QXLA 4H5TA 2HD0A 1PU8A 2KVQG 3S6WA 3KFVA 4GW6A 3DU6A 2FB7A 1PHTA 4BY1J 4CC2A 4N9HA 3X20B 4EJVA 5AT1B 3KKRA 4A3EJ 3QWXX 1Q7YR 1UEBA 2P7VB 1MKMA 5EY4A 2RF0A 1P9QC 1W0UA 4N76A 4M7DB 2QA4T 4MZMA 4H0YB 1R71A 1P7IA 4JRKA 3LA3A 2BUPA 2FRHA 1NLOC 2PZ1A 4HV6A 2HS5A 2Y9YA 4KREA 1N5ZA 5CVUA 3QU6A 4MMKA 3W2VA 3DXJF 4I6MA 3WTZA 2BGCA 1E0EA 2W41A 2YRDA 1VRTA 4WCIA 3GOIA 2IGKA 2P1JA 4L18B 1N8RC 4L3QA 2A69F 4A59A 2XG8D 3SPYA 3TPQA 1MNMC 5KN8A 2DFHA 2CYYA 3PT9A 4Z4GA 1WHMA 3F8BA 2DYRH 1TWBA 2GF7A 2J4RA 4BR7A 4AI5A 5K5QA 5FPMA 3KYDB 2IAJA 1B9NA 2Y9ZA 2M34A 2J6FA 3G6EN 1GCQA 2OFKA 3D45A 1ILYA 4NXNK 3A01B 4KUIA 2EAYA 1X1AA 2LNVA 4RW8A 5I11A 2P9NB 1VQ6N 1VQ7T 3FZHA 4RW6A 4OO1J 1JXOA 5AQYA 4JLHA 3MFKA 1VQMT 4XEIA 1BQNA 2D1VA 4JD2A 2X4HA 5F64A 2JM9A 3OR2C 3CCRT 4PCQA 1M3HA 5KRSA 3RYPA 3CCRN 1BISA 1M3BA 1EIFA 4BUPA 2EGCA 2L2OA 2DY4A 4MDXA 5KYYB 3DQVC 3CCEA 1BN5A 5F1JA 3RKYA 2F5KA 2W4SA 1GLCG 2M16A 2MMPA 2JLEA 3X26B 4BC4A 2NOGA 3EE9A 3CPFA 4OB0B 4C8QC 3I5RA 4FJ8A 1RZ4A 1QZZA 2X3WD 1YQAA 3BC8A 3CCST 3SDZA 4DFMA 2CUEA 2H1KA 1V4SA 2DJZA 4C92F 2HZYA 4FISA 2DMOA 2ZXIA 3D1NI 1JKQC 1K7AA 3CMAQ 2WSFE 1P92A 4IPAA 1C6VA 2XC7A 3IRQA 1XTAA 2YS9A 1BKBA 1BC8C 4AUXA 3LZJA 1TK8A 3QUIA 1YJ9T 1BI0A 2NVYJ 3FKIJ 1K83J 1RAGB 1K8AC 1FSHA 1VQNI 4JK1X 2L0AA 2CW7A 4C0DB 3NF8A 5D5VB 3IV5A 2BXZA 2P9SA 3FBIB 1Q95G 3C7JA 3CMYA 4M75D 2A08A 2XAJA 2EYZA 2P9SB 4MHGA 3NHNA 4A61A 3PV8A 1NMNA 2CW0F 5LJWA 3I56N 3O8MA 2H8WA 4AHUA 2XY6A 1M30A 5FRMA 4CD3A 3T1AA 3CG7A 1VYTA 4EVVA 4V19S 3J7AY 1ORNA 1D4XA 4R56A 4IJNA 4CJLA 1VQ6A 1JL1A 3QP5A 2GX9A 2ZJPL 1I4K1 1J53A 1IG9A 4OWRB 1K6YA 3P9CA 4XRSG 2HL3A 4CZMA 1T8EA 4E0DA 4KFCA 4FE7A 1YIJN 2PLYA 2H56A 1X9JA 3JCMd 4OFEA 2YX4A 4UVBA 4D7MA 3BY6A 3CCEN 4QSHA 4E9EA 3PFSA 1FC3A 4GY2B 1XCVA 2E2HJ 2LQNA 4BC3A 4DR2K 1VQMQ 5A2QZ 4AU7A 4KHSA 2ITMA 4NOYA 1NHAA 4QS9A 4F93B 4RW7A 3TOBA 2DTOA 2O8XA 1RT5A 2E64A 1E7OA 2UZKA 4AM3A 2HHTA 3IG1A 4LFUA 4XTUA 1A5JA 3GP8A 3ZSXA 4KHYA 2JSPA 1TKZA 2HVSA 3A5ZB 3AVAA 4JK9A 2ISZA 2DO3A 8AT1B 4IUUA 1GXPA 2HQXA 4M7AF 1W2BS 1S72A 2E2JJ 2VOPA 2AXLA 5D6EA 1M27C 3CCMQ 1R58A 2KXCA 3KWIA 3OBYA 1UTIA 2XHBA 4P1WA 4BRNA 2VT2A 3GBGA 3MZHA 2KFDA 3K59A 1KU2A 1Q81C 3OSFA 2VWFA 1JJ2M 4MMLA 4ETSA 4DQ8A 1M2VA 2FL7A 3KTQA 1B7TA 2MC4A 2GA2A 4DSJA 2XPUA 1DGKN 3N97A 2HBKA 3VQ4A 3NMZC 4BRMA 3ASOH 4BE2A 4EHUA 4MFEA 3KPHA 3JRHA 3K7AJ 1QVGP 5C24A 3QJ6A 5J1YA 2QEXT 5J4VA 2VXFA 2K85A 4JRQA 4D9JA 4OMFB 5D5XB 2YRVA 4E6RA 3M9QA 3CCUN 2K9MA 5TRDA 1LVKA 4HTUA 3FJ5A 2W10A 1JGGA 1DPRA 5GAEJ 2FNAA 1B72A 3V7RA 1TUUA 1SAUA 4MGRA 2QZ8A 4ZDOA 2F6CA 2B4JA 3JREA 1FYNA 4A3CJ 2JHNA 2OAZA 3K70C 4ISEA 2PYJA 3LM9A 3RI4A 3M8SA 4PK4A 4UY8I 2FBHA 3QU3A 4XBFA 1KGSA 4O5VA 3K9JA 4JBAA 1U2WA 4O0IA 4DR3K 3GVAA 3KP3A 2BTTA 1FMVA 3CDHA 3JXUA 2CH5A 3OTOK 4IOAL 1HW5A 3ZYYX 3LSPA 1K8KA 2DBKA 3VU3C 1FBSA 2V8JA 1MA9B 4BE1A 3VWBA 2X6YA 2K3FA 1F36A 1P8ZA 2OZMA 4CJUA 3MEVA 4YFXF 3A01A 3ZMDA 1ZBSA 2OZUA 3CWSA 4FT2A 3OYEA 1U45A 2ZM6K 2HI3A 1NK8A 2VJ4A 3KXTA 3OB9A 3UKUB 4RGUA 3QBXA 3CQYA 2XD0A 3ZMZA 2E1YA 1K73R 2L7KA 3MP1A 4DQIA 4BG8A 3HC7A 3OJSA 2OYQA 1Z25A 4OINF 4S05A 3CEYA 3H0GJ 1VSLA 1Z0XA 4K2EA 3A5NC 4PL7A 1FKPA 2QSGX 1NU0A 3CC7T 3THWB 1G3YA 3TR8A 2HF4A 2UU9K 1NGEA 3WQTA 1SZ2A 4AC0A 2LC4A 2ZJQF 4R79A 4CCJA 2IC3A 3CCVT 2RKIA 3RMDA 1YVNA 4BVPA 4B9XA 1TLHB 3ERED 3HIFA 4BB7A 1R1VA 1QQCA 1FWZA 3TAMA 2RREA 1MPGA 1QQMA 4BG9A 1Z21A 2X9DA 2ECZA 2YR2A 3F3XA 4A62A 3E0JB 1RBUA 4UY8O 4CFDA 3LSHA 4RTYA 2G8FA 2BW3A 3QYHB 1KC8R 3CYMA 2LVSA 3ECOA 1RAHB 5KQDA 3LQRA 4MLOA 1I1JA 4JUVA 2EVRA 2V52B 4FWRA 1K9MC 1W1FA 2DE0X 4CESA 4CJVA 2HMIA 5KPZA 3KLNA 2IGMA 1UGRB 3BQYA 1HKSA 3ID8A 2NNNA 4MLEA 4LE9A 3S93A 2CV0A 4C1NK 3B6PA 3A1YA 4OVAA 4PY5A 1SL2A 2Y48A 1S5LC 2ZPIB 1NEGA 4M7AB 1UAAA 5K14A 1RCHA 9ATCB 1J59A 3JCMc 4RKUE 5ADXA 1N78A 2AIRB 3CBPA 2BE5F 1F1ZA 1S22A 2KY9A 5DD8A 1NG6A 3OYAA 4Z88A 4J2EA 3K1NA 1WI7A 1VQLT 4N0BA 3EUHC 4Y3OA 4FLVA 3OW2A 2DA6A 2L54A 4BXUA 2NAZA 3NBPA 5F0CA 2O8CA 3E5XA 1RC9A 1X01A 1OCCH 1S5JA 2G8IA 1G3SA 5JVTA 1F21A 4E7KA 3PVQA 4XIUA 3CF5L 3DBLB 4G94A 1ZLKA 2RQWA 3LW5E 1Y64A 2CG4A 2Z16A 4FYYB 2DTUA 2DA5A 1M90U 3TL4X 2RK1A 2X6OA 2NUPA 5LFAA 1R59O 3GUDA 4JKHA 3PQJA 2KQ2A 3ML6A 2BEOA 1RACB 1G2HA 1WNLA 1K78A 2M8EA 2O8EA 1GVDA 4RAZA 1P6RA 3EUKL 3K1MA 1YUWA 3UB5A 4CZKA 3KYLA 2YPRA 1OZ2A 5IN1A 3CCUQ 1R5GA 2Z1HA 3E1YA 1P59A 2EBPA 2QSFX 3ABTA 3DEEA 2LCCA 4KT6A 4XAXB 4A3JJ 4A4EA 4L6V5 3L00A 5FPEA 4UC4A 4CGZA 1SFUA 3IFRA 3VQ7A 3N4MA 1IXRC 2EILH 2A07F 2M7AA 2V7FA 3IWZA 1TG0A 3CCLA 3FE1A 3NGZA 2ICWG 3EGDB 3NAEA 1KHIA 3VF6A 3VEYA 1YITT 3VSLA 2HKOA 4DTMA 3ULRB 2NS7A 1UE9A 1SHGA 1LEAA 3SWNC 4DLEA 1RAEB 2XVCA 4ZDLA 4CBXA 1IHVA 4XONA 1RT6A 3K10A 2H94A 3FZVA 3CCMT 3SQ4A 2NXNB 3TSUA 2ZSHB 2O4XA 1PUFA 1W9HA 3CWAA 1YVUA 2LX7A 4KFBA 4YY3K 2ZAEA 2COMA 1TUCA 4BQLA 4DSLA 3ZSQA 2CP5A 1QQOA 3KHYA 3V6DA 1EP4A 4B4CA 5A2QK 4M73A 2VE9A 2M1BA 4LN2A 3QODA 3CCJQ 1B9MA 2WWYA 2HHHK 4CA0A 3LSMA 2O8KA 1D09B 4LD6A 1U4BA 1HX1A 1Q7YO 2IGOA 1DT9A 2UUCK 5GMKm 1GL5A 3E6MA 2HNDA 3ASMA 2ZZDA 3DPUA 2L3SA 4CZIA 4V2FA 1IJWC 1J75A 1GOAA 1Z9QA 4OOIA 2WV0A 1I3QJ 2LTOA 4BR9A 3FJPA 3JB9H 2HOTA 3MXMA 3GZ6A 3PMTA 4M7AE 4MNUA 4EJTA 1PVSA 3F22A 1YX3A 2VGNA 4BGDA 5LL6Z 4DEXA 2NRTA 2JPCA 2NVUB 3S1QJ 2OTJN 3BJ6A 4IXAA 5DY9A 1RTHA 2B9SA 4KTQA 1YIOA 2OUMA 5E3OA 1KQ9A 2CQQA 3FXUA 1YJWQ 1FP1D 3GTGJ 2FHDA 3CCSA 1UA1A 4XTZA 5D6FA 2LRDA 2KHOA 4BDPA 3UNGC 1WGSA 1RIOH 2L9VA 2GFUA 4HNTA 4DR7K 1BW6A 3FXQA 4J8FA 4KDPA 2Q97A 4ZGDB 4AI4A 4ZC3A 1PP8F 1KVBA 1ERDA 4CZHA 2ZMEC 2HL5C 5AQNA 3NPFA 3OL4A 3META 1W2BA 1C0UA 1SMYF 1Q7YC 2KDSA 4M72A 1YJNN 2F4VK 2YV0X 2OAWA 4F3OA 3L4IA 2JWKA 3FK7A 3CJTB 1S1WA 4CGGA 3VYRB 3I55Q 3LSGA 3V9UA 3PTAA 3THKA 1YITQ 4JI6K 3HSEA 4XORA 4EPCA 4GLKA 5GAHP 1A36A 3ZBDA 3HHGA 1BHLA 5D4SA 1RLPC 4CICA 1N27A 2HKQB 4F17A 4CFBA 2GWKA 1KEAA 2E88A 3BCBA 2OX7A 4CJPA 2E3IA 1TUYA 3DLAA 4U88A 1QP3A 3DBRB 3BG7A 3KETA 3RBBB 5KI6A 2ZCWA 3QINA 3L6QA 4N0AA 3DMJA 2Y31A 2HSTA 3VS4A 2RC4A 4GKKK 2EZKA 5CQEA 2RN2A 2A68F 5HODA 2HR3A 5DM7R 1AOYA 3CXCM 2V1RA 1YHQI 4KJZA 2NYSA 4HEA2 1H92A 2YNHA 3JB9I 4FM4B 1VQ7N 3GW2A 5GAEP 3K4MA 1RTDA 2LD5A 2JPBA 2D1KA 1AT1B 1NGAA 2W82A 2LJ1A 1Z26A 1V29B 5CCAA 1MBEA 3ASNH 2OA8A 5IPAA 2FYKA 3CCJA 1KU3A 2GIZA 4ELVA 1G3WA 3TU5A 5BNGA 1JKPC 5LHHA 1ETOA 1NKBA 3LSTA 2CUBA 5CE3A 1VNDA 4PKCC 2QVOA 3C12A 3OYJA 2OF7A 4PUOA 2LREA 3FGUA 1IW7F 1IG8A 3IUCA 2LKSA 2X51A 3MCZA 5KAIC 2LBFA 4IHVA 4DTUA 2HNIA 3HOUJ 3D4VA 2Q0RA 1UJ8A 3S3NA 3TTCA 1YWPA 4U7DA 4E3SA 4G8XA 2HYJA 2A40A 3ZT0A 2GTJA 1WHLA 3KLIA 1G99A 1XQPA 4PLIA 1K9MU 4X9DA 4C3IJ 4WCEL 1H9GA 3ZEUA 3OIPA 2R7QA 2QGUA 5I3UA 4OAYA 1R77A 4LDUA 1ITYA 3CCQQ 3JRDA 2P5LC 1QVFA 5K7ZA 1QP2A 4M7DG 1MBHA 2VBYA 1C1CA 3OYMA 1BOTO 3NNQA 2L3DA 3BR6A 2D6FA 4B1XB 3QMLA 3EUHA 3M54A 2Z1JA 4FZXC 1MIJA 2G8HA 3S1MJ 2DOAA 1VQNN 3L2RA 1VQ4Q 3F9MA 4I0AA 4LIUA 2GWJA 4B09A 1GBRA 1M3CA 2C6YA 1ZK8A 4DGWB 3ENOA 1ULYA 5IP7J 2DZ9A 4J9DA 1EXQA 5JS2A 1S7OA 3W6KB 1GBQA 1LPLA 2COZA 2Z0WA 3IAM2 5E79C 1IV8A 1DP7P 2X6WA 4XRSA 2LMJA 3WEEA 1E3MA 2WAFA 1PU6A 2QYOA 1BI1A 2CQXA 2EYXA 1TK0A 1RLQC 5FLXO 1MMAA 4B3OA 4TSXA 5HY6A 1X69A 4LDYA 3K6GA 3KZBA 3C95A 1N6AA 1VQNA 4F7UA 1TWCJ 3AO1A 1ETKA 2PFUA 2HFHA 2D4WA 4HW0A 4FXDA 5C3EJ 2GOXB 5E8GA 2PEXA 4FX4A 3QB0A 2ZPBB 4FWSA 1W97L 5GTHC 2LRQA 4EHTA 3NEUA 5KGWA 4OIQF 2RVCA 2FBVA 4MZPA 4LH4A 4HUGA 1FLIA 1JHFA 2KEAA 4BR4A 3OL3A 1C0WA 3WT0A 2VL8A 1VZ0A 3FM5A 4C30A 1YI2A 3RCOA 4B9VA 1LWVA 4AF1A 3FFKB 2LF7A 2VJIA 5GJWB 1UZCA 4A5NA 4FJJA 1IV0A 2OPTA 2KZZA 1XPXA 5FB2A 5EZHA 2Y1IA 2XSDC 1Z3YA 2FMYA 1T2KA 1KLNA 2X6NA 3UKGA 1RI9A 2IS1A 3R3LA 1YIJA 3QG1A 4XQFA 1YX5A 1WSGA 3ISPA 3AA3A 4KAZA 1Y1WJ 2WAQN 4BRPA 4XKWA 2SRCA 3O3HA 3SV4A 4QVCA 3KBGA 2P9UA 2FMLA 4MO5A 1YJ9I 1X3UA 3CPEA 1IN7A 4GMJB 2NUBA 2VCPA 5IT3A 4JKBA 4DU1A 3CDLA 2ZPHB 1YN8A 1KQ8A 2FRWA 4F55A 2VN2A 1TGOA 2YHWA 3HXLA 3MP8A 3CO7C 4LLNA 3MAQA 1VQOA 5IP9J 4BRHA 3V4IA 3G4SI 5DM6L 4ZHRA 2V1QA 2MABA 3WXMB 1RNHA 4N4HA 5T7BA 3KVGA 3ZRGA 2ENMA 1MJAA 3VQEA 3IUOA 3HK2A 5CVJA 3JTGA 4B08A 4DV4K 1XMOK 4WQ5A 3K70D 1QZ6A 4HF1A 1KG6A 1GCPA 2RH2A 4JI5K 2YJFA 1AKHB 5M1PA 1YJ9N 3MWPA 1VSHA 5C12A 2R7FA 1AVZC 4Z94A 1KFSA 2DA2A 2YKMA 3I4NJ 1D8KA 3BP8A 4Z89A 2E2PA 4XSZF 2GUPA 4PGHA 5KCHA 1UA0A 4HZFA 2ME0A 5CLSA 3MEWA 2VE8A 1Y8QB 2J6KA 1KXPA 3M4GA 3SAHA 4WE1A 1VQOT 2GA1A 3KTUA 3PNVA 1BIAA 2KGTA 4IKFA 2R7XA 4NQWA 3KLHA 2G7HA 1LCKA 1TL8A 3TMOA 2GELA 1KQ1A 3VF4A 5GMKe 4PJJA 1RPWA 5EGOA 1K8AU 5FKMA 1RT7A 4LB6B 4B1ZA 3LZIA 2X4WA 1XB4A 3V9SA 2HHXA 3CJ9A 1HPMA 2K3YA 2P9IB 3VQ6A 1A5WA 4C0GA 4OB1B 3S1RJ 3JB9J 2YKNA 4ENKA 2ETJA 1K9MO 1RT2A 1ZSZB 3AO2A 1AZEA 3OH6A 3ZL7C 1YTUA 3MCAB 1PM3A 4NCAA 3G6EA 4I6ZA 2NRWA 5CQXA 1RDDA 2DILA 5K7FA 4JKAA 2EWNA 2HKXA 2QEXA 2UWMA 1SF9A 3A2FA 4Y28E 4M41A 3MMVA 1Q86R 2EIFA 2Z9OA 4MLHA 2X78A 4BE0A 2CSQA 1WCMJ 2PVOB 3E1SA 2OFIA 1ZBJA 4F52A 1W36C 1NJWA 2QW9A 3FR0A 3ABKH 3PNYA 1ABOA 3R1XA 5D7UA 3HRSA 2CW8A 3H9QA 4IEIA 3MO8A 3GPLA 3MZYA 4E1JA 4M9SA 3JRIA 1Y0NA 3WGGA 4M4ZA 1TKDA 3EG0A 1OU9A 3G71N 4XM3A 4FJGA 2R7TA 2UUBK 5D8KB 2D5RA 3QBWA 5EVZA 5FRNA 2UXBK 2A36A 3THXB 1CLQA 2JVVA 4NL2A 2OTLQ 2DEUA 5JFRA 1X27A 4WF2A 3EO3A 4M74A 3WE2A 5GAMd 3IS9A 5CQYA 5M3FJ 2I10A 4H4OA 1VQLN 4E7IA 3UWNA 2JZYA 3M7GA 3EGXB 1VSDA 1BBYA 5GPAA 2VGMA 3H3OB 3D2FA 1OPLA 3U1KA 1OYWA 5ICFA 4FL9A 1HYOA 2NUZA 3DB4A 5L3CA 5J2NA 2P81A 3MECA 3WTXC 3H6EA 1EV7A 5FU6B 2J6OA 3OIQA 1B3QA 2FG0A 1QKXA 2VC0A 4D1QA 4F92B 3P39A 1MHNA 4KI6A 2XMFA 1FYLA 1NGNA 3IHOA 4EMGA 1H89C 5LEKA 2GTDA 4BRIA 5GAHJ 3QOEA 2ZE2A 3TTDA 5J2PA 5BMZA 3UKUA 1U06A 3EEQA 1I81A 4XL9A 2WC9A 1WHUA 1SFOJ 1VI0A 1QQJA 4KBOA 2XIGA 4PQUA 4A5BA 3KP2A 3QP6A 3O2PE 1S3JA 4GYIA 3HL2A 5CYVA 3LAKA 2LG4A 3HOXJ 4NQWB 4QS8A 2I5UA 3F8NA 4B1UB 2HF3A 5H2FC 2HEQA 2LBFB 2W42A 3IKTA 4X6AJ 2CZ0B 4I02A 4CGHA 3F70A 1BIUA 3LM2A 3VEWA 2JA7J 2DW4A 2P9PA 3QPLA 4NC7A 3IDHA 5CK9A 3TWHA 2CZ6B 2V7ZA 5GANh 5IOZA 4A2BA 1HYSA 3JCMV 2WSCE 3BOQA 5IOYA 1X75C 3O1BA 1WSFA 3J7YJ 1R0AA 3BPXA 1Q81R 3E5UA 1UAXA 1OU8A 3QOPA 2O03A 1ETWA 4GLMA 2H6BA 4ESJA 4NB5A 1GCQC 1TS9A 1MSEC 2HGCA 2RPNA 3RKQA 1VQKA 2FA5A 4M6VA 2X1CA 3WGHA 1LWCA 3ABLH 4CHUA 2JT1A 4CYDA 4Q47A 1FOKA 4HNUA 3EZWA 1SVMA 2J5PA 2IS6A 4O6JA 3CCQN 2HB5A 2ESNA 5AZIA 1VQ9Q 2HPIA 4RMOA 4N5SA 1WAFA 4ON0A 4HYEA 1QZYA 3FK6A 3CCET 2RQQA 1XMQK 3LL7A 1XDUA 5E84A 3NAUA 2P9KA 1YTAA 3QO3A 3ELKA 3JYTA 2P0PA 4OGEA 4J9EA 3CCMA 1J3TA 3QDFA 5LBQA 2OQGA 1OKJA 2K3BA 1CZ9A 3CCVA 4YG2F 1YW9A 2CFOA 3QYEA 1HNZK 1JUPA 1B34B 1JI8A 1YJ9A 2VODA 2HMAA 2G8KA 3VPZA 2OA4A 4M78C 1NTCA 1XSXA 4KHNA 4DTXA 2E3HA 3VOEA 4M7AA 4BEHA 2DM1A 3L9FA 1UWBA 2ECBA 3AVKA 4QIWN 4RTZA 3DI6A 1ESVA 4B8CA 5GAMe 3G71T 4YIIA 2OPQA 1Z6RA 2FSJA 4B3RK 4GBQA 1XSVA 1T6DA 4K43A 5ILUA 4UV8A 3AVJA 3L7WA 1S72Q 2EQMA 1BW5A 3MEAA 3G3ZA 2DZCA 1WAJA 1VTNC 2HNZA 1OLTA 2AKLA 2IA2A 1Y1VJ 1BCMA 1T7PA 3FMSA 1WA7A 5AQZA 2XHCA 4C8QD 2IIMA 1L0OC 1TH7A 1MU2A 3QYBA 4LF9K 2JUGA 4MDAA 2Q2EB 3OY9A 1U5SA 2KI7A 4YPHA 3IAS2 2K3XA 3LA7A 3SB2A 3IH3A 2EW3A 2M51A 3OS5A 2IT0A 2HKNA 2XAHA 5I42A 2VVKA 2R4GA 1D8YA 1KG2A 5LD2C 1VQ5N 3CMEI 2ACJA 1B59A 2VKHA 1FMKA 3FSPA 4ZJZA 1EA3A 1YQMA 1ZLMA 5EEHA 1JJ2A 4ICLA 1N25A 3M8QA 2XAQA 3TGNA 2GIVA 1Q86C 4E7LA 3A5LC 2NOLA 4ASNA 2O4XB 4IFEA 4DWIA 2VPLA 1IH7A 5JLXA 3FXRA 2BY3A 4UB8C 5EJCA 3OA9A 2O01E 4C8NA 3HVTA 4ZYEA 1OH8A 4AYBN 3RZDJ 5HLTA 1TUGB 1RUOA 3CCEQ 3TAEA 3HFOA 2KJCA 4PWDA 2KRCA 1BM9A 1VF9A 5DYMA 4AFQC 1PNJA 4IZZA 1ZARA 1O3TA 2NVTJ 3V9XA 2CU7A 4OMQA 4JHDB 3FISA 3OOUA 5BR8K 4B1RA 1X2KA 4JKCA 1Z6TA 3ZT2A 4L5GA 3LDPA 4PJNA 1PD1A 2IVPA 1WEFA 2W7NA 1E6GA 3GTPJ 2FSKA 3A8GB 3BWGA 4C5HA 2ROTA 1FBUA 4L59A 3KJVA 5TISC 2E5QA 3JRBA 4O55A 4HAMA 3HGGA 3B6CA 3INZA 4E9GA 1EO1A 5CO7A 2BYVE 3THYA 3SDGA 2E19A 3S32A 5D4RA 1BA1A 4DIQA 3A2KA 3CO6C 2CGJA 4ENNA 2AHJB 4CJTA 3FDYA 5I9EB 4HF0A 2NS8A 3WXJA 4GV9A 4M77A 2DN0A 5FDLA 4J2BA 4J9GA 2MWOA 5GANg 5LGTA 4FJMA 1FEXA 2O8CB 2XF7A 3JAME 1MMSA 4LD0A 2DTZA 1FN7A 1NK4A 3VYUB 1P4WA 4L9VA 9ANTA 3PO2J 3AVHA 3HYIA 4RAYA 2NNWA 2OTJT 2JXBA 1K79A 2B6AA 4BRFA 1WYXA 3ZP5A 3FHZA 3GOXA 3MN6A 3OSVA 2W25A 3GFMA 5EGOB 4ATOA 4Q48A 1VRLA 5FJ8J 4BBSJ 3JAMZ 3OYBA 1HQEA 1W2BM 2OPRA 4C8KA 1MBFA 1HSQA 4JI3K 4MEYF 2KZMA 2BZTA 3TSWA 4ZYAA 4AIAA 1ETXA 4J2DA 2LF8A 2HQNA 2Y0MA 5A0GA 4YOQA 4N4OB 1YF5L 2G0EA 3V81A 3B73A 4IO9L 1NOYA 2VWKA 1E2XA 1HSTA 4L8RB 1YITI 5DD4A 1QW1A 1BI4A 4AVZA 5HRPA 4FLYA 3VQ8A 2I7PA 4OPKA 2HQRA 2XAGA 1RBSA 1SKWA 2CQKA 1IBKK 2EQIA 1X6BA 2ASOA 1ZH5A 1ZR2A 1YJWT 4II2A 5GAN6 3PIOL 1KC8C 2EFWA 1ORKA 1MUNA 5DMRA 4WQ4A 1BR2A 2O8DB 3M8PA 5AQFA 1QO0D 1HUXA 3NFAA 3HGYA 1EX4A 2CP0A 4LXCA 1ZA2B 4Z6YA 3FHFA 1ODDA 3AO4A 4CUGA 1SFKA 3CWTA 3VERA 3HTSB 2QQSA 1BWFO 1GLBG 1XN7A 3C2HA 4R1HA 4FSSA 4LLGF 1ZN2A 1ZHFA 3D2EB 4X1EA 2XAUA 4NLCA 1J2XA 4XLPF 3M57A 1IN5A 3RRHA 3EGDA 5GANf 1VQPQ 5E1WA 4X65K 2HU9A 3THYB 1W0HA 1N8RR 4CBWA 4ZZLA 3TO9A 1MNDA 4OKJA 2NWMA 1D0ZA 3K4BA 2UXNA 3GTQJ 2A0FB 1BL3A 1TL3A 1X19A 2E7WA 2KDOA 4CO8A 3WHBA 3SAGA 4RGSA 4W97A 4FK2A 1SVLA 1FSEA 4Y13A 4LB5A 4EVIA 5GMKj 2K4BA 2UV1A 5M5WJ 4LC9B 4MTDA 5SZTA 1WX6A 4BR5A 2YT6A 1MJ9A 3NTHA 2JUFA 1V76A 3FWEA 4NCGA 4B3SK 3LP3A 1HKBA 2VG6A 5FFXA 2ME6A 1VSMA 4HG2A 4JLIA 4PJOD 3MD2A 3CFRA 3IWFA 3SZ2A 3LALA 2E2OA 3I9QA 4A12A 2F1LA 3I5UA 5F0XA 2PQWA 1LCUA 3CF2A 4I76A 2V8KA 3H1CA 1FW6A 4M7AC 1KD1C 4H0OA 2F5CA 3IH4A 4CI0C 2EHGA 2O8FB 5E26A 2EIKH 2OQRA 3QKJA 3SD4A 2VOOA 1MNEA 3VPRA 3NWSA 1K0SA 5AQSA 4IFYA 2XPWA 1MSFC 1VQNQ 2K3PA 2R92J 3M0PA 1IKWA 1WJDA 4M3RA 2IJLA 2R7YA 5F6FA 2ZJ2A 3NDKA 1JLEA 1U8RA 3SHFA 5LRSA 4K8XA 2CV1A 4OF1A 1KQJA 2DRKA 4FK4A 2COYA 3O9TA 5C44J 3H0FA 4CHOA 4C92E 4C5IA 1FPQA 2A5YB 4E89A 2P6SA 4RTXA 4KYWA 4RAFA 4Y92A 1UELB 5BPLA 3L8BA 4OGCA 2BXYA 4Q5VA 5J47A 4M77F 1YRNA 4FYWB 4B3AA 4W1UA 3A02A 5CKHA 2Y4XA 3CC4Q 3S3OA 4JJNK 3O80A 4EM2A 5E17F 2VXDA 4CYCA 1KAZA 4GDFA 1CF7B 2VJJA 1X3NA 3CIPA 4K25A 4BNCA 5GTIC 2CRGA 3S17J 2KIMA 2GFAA 3NGIA 4AG2C 4CDGA 3KCCA 5I22A 1R1UA 5C0MA 3GWZA 1WUAA 2DXBA 5JLHA 2MFZA 3VB2A 4DEYA 1M90C 3WG9A 4FWMA 3EHQA 5GAMg 4Z4IA 5GAN2 3FZLA 1T3LA 2E6LA 2OTLN 1IKXA 2D1XA 4O4GA 2RN7A 3MN5A 3CBMA 4J7IA 1HJOA 2IA0A 3AFHA 1BU1A 4DUYK 3KP4A 2K9SA 1NKUA 4GV3A 1KQSA 3X25B 2KR3A 4MEXF 1H1VA 3I54A 4ISFA 4J9HA 2JK3A 5HBMA 3CJAA 1HW1A 1YFNA 4NHJA 4KH1B 3CETA 2JA2A 1QNTA 3JCMh 4I7FA 1FYKA 4KB0A 4DJAA 3LNQA 1NH3A 2ZC2A 1XTDA 2BV6A 1W7AA 4DG1A 5D5WB 4XLFA 1LB2A 1F9NA 2DT5A 3RJPA 1JBMA 3BZKA 4KICA 3I59B 1HW2A 3E6DA 4B6MA 3GFLA 1MH3A 3KP7A 1M3QA 1A5XA 4KHQA 2NOHA 3ZQGA 2PNIA 3B6OA 2V7YA 1O3RA 1XMXA 2RHIA 3AA4A 2QF7A 1BGXT 1S7EA 1OQKA 4RG8A 4C8QB 1UGVA 4IF4A 5HNFA 4KKOA 3VEVA 1ZELA 4DFJA 4ESFA 1OR7C 4CJ4A 1IUYA 2AZSA 1VQ8A 1O4XA 3GTKJ 4O5FA 2DTIA 4RUGA 1W5TA 3SQ2A 5FU7C 3KIOA 2CFXA 3CCUT 3PX4A 3EFSA 4Q0BA 3VTHA 1KG5A 3P5JA 1XGNA 4BR0A 5E41A 4M3UA 2RB6A 3JW4A 1KG3A 4KIFA 2HYFA 4ABZA 4HOBA 4KHWA 3ZCOA 3E7LA 1Z91A 2XB5A 1J9IA 4MTEA 4PJ0C 4EW4A 3M59A 1Z3XA 3C7NA 4PJLA 2JMAA 5GAOl 3QEIA 4HQEA 1WJCA 2ADUA 5GAOr 2MC3A 4O3MA 5E1ZB 1QHGA 3WTWC 4IUQA 2DPNA 3VEPA 1D1BA 1Q18A 2P4TA 4A2UA 1BIZA 3LQQA 2H8RA 4KMFA 1FTZA 3TI0A 5LJ3g 2PG4A 2GNCA 4J6XA 1IBMK 3DJCA 4I09A 3DP7A 5E18F 4D5FA 4I7HA 2B8AA 4PFZA 4R5PA 1EETA 2M2EA 2DLLA 3I9V2 1X58A 2D0OA 3RPQA 5M1QA 1TAQA 3KLEA 3EDPA 2G8UA 1DKGD 4LD9K 3EN9A 4PIIA 5M1FA 1K78B 3JCMW 3GLXA 2RNJA 2K6DA 1V55H 4I9QA 5GADJ 2YUSA 2XDPA 2F9WA 2HHQA 1I94K 2CH6A 2EV6A 2AK5A 1AWWA 1VQ6I 3KP5A 4XOTA 3D2FB 1Z77A 1U78A 2A61A 2QEXI 2XKPA 3CC4I 4NL3A 5CKDA 3AKZA 3CLQA 1N34K 2XHIA 4HPQA 4F7UB 1VQ4T 3CVSA 1X4PA 3HXMA 1A6QA 4KHPK 3FEOA 2KLAA 4AG1C 1K73C 4OMPA 1WI9A 1LE8A 5KAFC 1DJ7B 5BOXA 2OCCH 3SEQA 4O5BA 4AH9A 5FO5A 3C2GA 4FWNA 3CPWA 3G10A 2OV7A 3H46O 4LSLA 3VFZA 2V8IA 1QVTA 3J81O 3GMEA 4AIHA 1Y57A 2IA1A 3O3KA 3ZMTA 1YXQA 2YCHA 5GMKl 2Y69H 2Y90A 3AVLA 3DYAA 5D6WA 3K9TA 2QK0A 4IHWA 3G1LA 3M8EA 3IMXA 2QG9B 1XHZA 4B9SA 1HPZA 3BDLA 4EQQA 3TAPA 4FWOA 1VQ8Q 4HUEA 3CC7Q 3LSRA 5GAOq 3BTLA 1VSFA 3P83D 3L1AA 5BPIA 3NTKA 5GAOn 4F7UF 3QHSA 5AQIA 1B1BA 2C06A 3ULEA 3EZ5A 5A0LA 3QXEB 3FIFA 2XGDA 2QENA 5FKNA 2IS3A 4UUSB 1W7PB 3B6AA 3QPSA 1WZOA 1A6IA 3BR5A 3LWFA 4H03B 1ZRDA 2Q8KA 2CGPA 4II3A 5J2MA 4G9ZA 2K7AA 2VB6A 2M0OA 1SKUB 3N5NX 2GLOA 1TKXA 3TQNA 5GAMh 2LMDA 3HT3A 1LVAA 3OW2S 3K5NA 2VI6A 2KE9A 4DBQA 4JHDA 3BCAA 4N4GA 4LLLA 3BROA 1NM7A 2LH9A 3EFRA 2RHUA 1YHQQ 1KU9A 1OEBA 3CD6Q 1JXEA 3O9QA 5HRRA 1TU0B 1QQNA 3VYHB 1JU5C 5ICGA 1XHXA 3LH5A 4AM6A 5EC7A 2YU3A 1RUWA 5I2MA 4CC4B 5JHFA 4L9TA 2DYBA 4IO8A 3F73A 3DLLA 3ZT4A 1T3SA 1H88C 2OTJQ 4BC5A 1PUFB 3I4PA 4QAGA 4B48A 4RGXA 3B02A 2IRFG 5CY4A 3MKYB 4C92A 3R60A 3JCMg 3GZNB 2WADA 1AOJA 2X9HA 1R8OB 2D2WA 1Q9YA 2O4IA 1VQKQ 3P9IA 5AIPA 3MEXA 1I5ZA 3VSKA 4KTWA 3OYIA 5IY5H 4DF8A 4LF4K 2JHJA 4H5NA 3GYHX 3O6BB 4M78A 1BYMA 1BU6O 2TRTA 5HS8A 1WJAA 4HX4A 1P4AA 4JAXA 2FZGB 2O8EB 2FUG2 4M78B 3CC2N 2A1SA 1D3BA 1OPCA 1S1XA 5CR4A 1WSUA 5EG2A 1OV3A 4I01A 4AQYK 4LG0B 4RW4A 4UQGA 3F23A 1I6HJ 2FLOA 3NH1A 3ZMUA 3H35A 2I0NA 4KT5C 3EG2A 4M77G 1FKOA 2O3FA 3M58A 2EFOA 2RQTA 2WBMA 3TSPA 1ZREA 3K1PA 1M8VA 2QKKA 4XTYA 4QT7A 3AAFA 5FU6C 4EGZA 2FF6A 3T8TA 4D7NA 4XICA 4CEZA 2GGRA 2QDLA 4EJYA 4BROA 2QQAA 2GCXA 2CS3A 1MWMA 2A5WA 1U2VB 4ZYGA 4OB2B 3PO3J 3LPTA 3HHHA 3E66A 1HRHA 2I7NA 4XTXA 4UVCA 5J1RA 4PJOA 3CP2A 1PKSA 4S04A 1LWWA 3G4SA 1BOBA 4C2TA 5LJ3h 4BQZA 4BI4A 2ZGZA 2DOFA 3JS6A 5M5XJ 1Z05A 1MV3A 2KK4A 1QGPA 1X3MA 3R0JA 4DQPA 2XY7A 3VEOA 2IGNA 1IF1A 1MGTA 2DL8A 3ZXSA 1YCSB 3OQ5A 3HUGB 1HDDC 1I0CA 1NEBA 3V8JA 1GLLO 1MW7A 3CPWM 1SANA 2SEMA 1KQSP 2VJ5A 4CCNA 1KQ0A 4B43A 4DKWA 4PSXA 1Z9CA 4BH9A 1B8IB 2JWLA 2DXUA 3QEWA 3NH0A 2JG6A 1Y56A 5H20A 2XI9A 3UF4A 4G6TB 1EJ9A 4HVWA 5IT9E 1S1NA 4AILC 3FC3A 1WQ7A 5ILSA 2EYQA 3TP3A 2DK5A 4Q5SF 2DYIA 2HZDA 1R7JA 4CHQA 3HJEA 4Y7NJ 1KSWA 3CCMI 1G15A 3AGKA 3K4KA 4JV5K 1NGBA 4BACA 2JWTA 1ZBIA 3AVMA 1RKTA 3WG7H 5A2QE 2EV5A 3W6JB 4XN3A 2KRSA 4YIRX 4CFCA 4H0VB 2EH3A 1OULA 1J5EK 2MBFA 3UATA 4FJLA 4QWQA 4MFBA 1NJXA 2YXYA 2DU9A 4TV7A 2QQRA 4D6WA 5AZJB 1WJRA 1JTXA 4NCBA 4EMKA 4BC2A 3W6VA 1GRIA 3E2UA 4CGIA 3LFUA 2HNHA 1VQ5T 4Y1DA 4DTJA 2W57A 4EATA 4PL8A 1WHHA 2AS5F 3HG9A 2K4YA 4WFNL 3G4SN 4H0EA 3PFYA 2Z1GA 2Q3SA 2R5ZA 1W5SA 2YNIA 3HTVA 2AZVA 3EAEA 3R0AA 4BQOA 1Q86U 2E1ZA 4GFBA 4LG0A 3OS2A 3CJBA 1O13A 4JYKA 3QLHA 4XQ3A 1X2QA 3DLLL 3GIBA 4D0PA 2K5CA 4DCHA 1P4XA 2CT4A 1NGDA 1VQKI 3C2BA 2P51A 2NUTA 1LAWA 3VF2A 1RRQA 3MAJA 3Q1JA 1WJBA 2FEIA 3DXKA 1E4GT 3S1NJ 4KB1A 4ENJA 3SDBA 4JPBW 4RM2A 3AG1H 3J7AO 5D6YA 1SHFA 2NZTA 3VGLA 3S41A 3JSMA 4HA8A 1WDXA 2HDAA 5F1RA 4YOWA 1WSJA 2F2VA 3VQBA 1JKHA 4CGJA 1YFHA 2F7TA 3RERA 4OJRA 2KL4A 4M75F 1QTMA 3C7NB 2QCOA 2A6HF 1LEBA 4DQQA 1LDKB 3HOVJ 3DXMB 4DZPA 3H9GA 3DRPA 1WEIA 4B3MK 2YSQA 2M0YA 2AHQA 1Q8IA 1ENHA 1IDYA 2KRNA 2L4AA 1NKCA 1LOTB 4XLHA 4PUSA 1OX9A 2DEQA 4G1QA 4GY5A 2LJ0A 4CI6A 1WBBA 4JDSA 5B5EC 1B34A 1NJIO 4M6YA 4W5OA 4PKGA 4WQ5C 1IN6A 2ZPEB 1U0JA 2HBWA 2WAEA 2ED0A 4LFAK 3RDVA 3JRGA 1YHQT 3Q7CA 2F9TA 1IREB 2VC8A 4FYVB 2FOKA 2L9SA 5LGNA 4PKIA 4FM0A 1FOWA 1RI0A 5BN9A 2BE9B 2DMUA 3BG6A 3LSJA 4A3GJ 1XMKA 2KIQA 2YI1A 2ECCA 4FTHA 2R58A 4L5EA 3VQDA 3RMQA 3K9KA 2E5KA 2DL5A 5AQPA 4A4HA 4RCCA 3Q9VA 2GOMA 4BDYA 4WTOB 3ITHA 3AG3H 5IYDJ 2HOEA 3K5MA 4XRMA 3WNGA 3EQLF 1YT3A 4ORZA 2AKKA 3OMCA 1OYIA 3CMMA 2BZXA 1JB0E 4X34A 4XTWA 4XTVA 1HNIA 2MYSA 1BJAA 3JB9F 3MN7A 2F2EA 4R8HA 1RDWX 1HJRA 3THWA 3D5LA 1XS9A 1DPUA 2E1NA 4U0YA 2RJDA 1K61A 4KN4X 2X4JA 1IV6A 4DSEA 4B21A 4W5NA 1YI2Q 3HZJA 4HVJA 1IRZA 1UG0A 3ZQIA 2M45A 4CF0A 3OA6A 3HSCA 4EFHA 2BY1A 1NJIU 1I8FA 1D1CA 4OX9K 2YX7A 2RO0A 4HX8A 3VQQA 2DDAA 4WF9L 3BY5A 4F3TA 3CWUA 4FW1A 2NOBA 3G6EI 2D0CA 2VT3A 5E1XA 5BRDA 1DLOA 5ECAA 1XG1A 3D2EA 3C18A 4C8MA 3GLLA 2J7IA 4J83A 4B9NA 1J0RA 1CKAA 3MEGA 1NJIC 2K7LA 2EJGA 4HSTA 2H3GX 1G2BA 2L89A 1VQMN 2BY0A 1R4NB 1YQKA 1MBGA 2M9UA 2YUNA 2J06A 1HDPA 3CCUI 1T6CA 2MLKA 2OTJI 5GIPA 2YUQA 4KGZB 4U0WA 4CF2A 1JJ2S 4JI1K 4E1MA 4X62K 1XNIA 1TZLA 1ARKA 5DTDA 4BXFA 1SL0A 3GF5A 2H8HA 5E3MA 3CCRQ 3DEUA 1I1SA 5BREA 3G0ZA 4I99C 1ASWA 4Y91A 4B24A 3ZSOA 3O5BA 3BTCA 4XOPA 3K0LA 2GV9A 4CEQA 3U1DA 1UGSB 1TYQA 1WZ2A 4BI8B 1YE9A 1JLBA 4DV2K 1PRLC 4BHBA 1VQ7I 3AVNA 3A5MC 2CH4A 2CGHA 3C3WA 5CVIA 4JOMA 2AXTC 2L3QA 1OCPA 1X6GA 1D5AA 3P4IA 2HDCA 2CH0A 3ME9A 3NF7A 1TKTA 3CQZJ 3ISNC 2AQFA 3VQPA 3SJJA 3CQXA 1JGSA 2V1XA 1SRLA 2XGEA 2KRFA 3V1QA 2FF4A 3ALYA 3CUOA 3GO5A 1RR8C 5FW9A 2YHYA 1HJDA 4QQ6A 4P96A 3NTIA 3Q0WA 2XKOC 1HNWK 2KP6A 3SUQA 1ZLJA 1W6XA 1PSFA 4C8QF 1RETA 4BY6C 3MWTA 3QIIA 4HDVA 1NGCA 1B92A 4B9UA 5CPRB 5GP9A 1E3PA 2B86A 1OR7A 5F2RA 3EKSA 1WPKA 4FWLA 1POGA 1VQ9T 1J54A 4H5WA 3CTAA 2M30A 2QKMB 1TC3C 3O9SA 3VQ5A 2IAIA 1OPKA 1KAYA 4BQNA 1KFZA 1FOXA 4CJFA 3PFIA 1WHKA 5BQTA 2F69A 3LOCA 5JI6A 3CCQT 4H0XB 3H9NA 1R22A 1TNTA 4R55A 2DIQA 2BDPA 2RJCA 3V7SA 4PSWA 3T19A 1ZR4A 2IDOA 2DK3A 1UJYA 4CIEA 2HXOA 2PN6A 2EQJA 1UG1A 2CZ1B 2CT3A 1YJ9Q 1OQYA 4BVOA 4WXDA 5ED4A 3CFPA 3O8GA 3DLEA 2YG9A 2FEZA 4LD5A 1CKBA 4QQDA 2CUDA 3Q7BA 2ZJRL 3ZQFA 5FWCA 2F8SA 4J8OA 2KIFA 2Y4YA 2E1OA 3VQ9A 1I50J 3FHNA 2CP6A 1HF0A 1KJWA 3CERA 2ZD1A 2VG7A 1B8IA 1R5HA 2AA4A 3TREA 3FMRA 2EZHA 2L01A 1BB9A 3K57A 1Q82O 2FX0A 2R7ZJ 2GXAA 2BW3B 2A28A 5HS9A 2Q1ZB 1K4US 3CM6A 1CSKA 5LL6S 1X9MA 1YYVA 2WBNA 2C0OA 4EZ9A 2R57A 4DB3A 2ZMEB 3SXYA 3I0RA 1XC3A 3LAPA 3JB9D 1X3WB 2MA3A 4EAHD 4BQAA 1HNVA 2P9KB 2QWQA 2E34A 4ILJA 3PE0A 4RB2C 3JRAA 3I71A 4U67L 5GAN7 4CCKA 1UOCA 4CJSA 2VG5A 4PKHA 4A63B 3IQLA 1M1KC 3HOSA 2P5VA 3PM1A 2D1HA 2O9SA 3N05A 2E1CA 1H0MA 4P5NA 2WSEE 1EQYA 2JVHA 4LFBK 1QSSA 2BHZA 4E70A 4LNPA 4M3FA 4CJ7A 4G9YA 2JPSA 2JT4A 3WNFA 2HVIA 2Q31A 3T7ZA 2OANA 4IXCA 4M78F 2G6FX 3DXKB 1HYVA 1N36K 2P4RA 1RKWA 4A4KA 4HRIA 3CI5A 4CJRA 3LSIA 2P4WA 3THXA 1SD4A 3BG3A 2HSEB 4CXFA 4MDWA 3FXKA 1JLGA 4XLNF 2DA1A 2DYSH 2IVWA 3MPUB 4OLBA 2PMZN 3HP6A 3WXKA 1RNLA 4M3EA 1L3SA 1P7MA 4CFAA 3E9GA 1D3BB 4F14A 3DRSA 3VETA 4RDUA 4GVMA 1UUEA 2P0KA 3RR8A 5EG0B 3PGGA 3TU4K 2E1MB 1G83A 3ZEUB 1GLJO 2MH9A 4CHNA 3O9RA 4JJBA 3G71Q 4C8QG 1S72N 3DLHA 4ZDPA 5CR2A 1JJ6C 1KAXA 4CYCB 2H27A 3CVTA 5JR3A 2JMCA 5KHDA 1VIEA 2CH4W 2WB1A 1IHWA 1USSA 1AD5A 4RWTA 4M3WA 2JJ7A 5H6QA 3ABUA 2JTFA 2YSRA 2QXFA 1M1GA 3P31A 1UECA 1FX7A 1RTIA 2E1MC 1F5TA 1H9TA 3NMUA 4IOAF 2MGQA 2RQVA 2XICA 1IZ1A 4F7ZA 2IG0A 3ER0A 1SS6A 1XC5A 1XQSC 2HHVA 1ZSZA 2A6AA 3ZQHA 5HDNA 1T05A 3O3GA 2OU2A 3R6NA 4JKDA 1M1KU 1WVRA 5LEJA 2ZKZA 5GIOA 4B47A 1IG7A 2YNGA 4K8ZA 3I56Q 3S6IA 2YHXA 1I3AA 4Z4EA 1Y7XA 2ELKA 3HM8A 5AZIB 2HVQA 2KLOA 3VA0A 5FKKA 4DOZA 4V2GA 2XO7A 2F96A 3KK1A 1Z7LA 4KO0A 4L5IA 3S16J 1WXTA 4J9IA 4LK0F 2CV2A 5LJ3e 2BVLA 2FVUA 1MWKA 4FT4A 3M5RA 2DQRA 1BI2A 4NNJA 4IEJA 1WJFA 3RPUA 1UB4A 1RDUA 4NB4A 1A35A 4FLTA 3E6CC 4JX4A 4CW7B 3O8HA 3NGYA 4YFUA 1O7LA 4CEBA 1NK7A 4CF9A 4HDUA 1EF4A 1VQ8N 4A3LJ 4IRGA 3QAHA 2UUZA 5KYWB 3O08A 1R1TA 3TEEA 2FE3A 2E12A 2OAUA 1GLDG 2NRHA 1PJRA 3VRZA 5JS1A 4C0DC 3A8OB 4RLQA 5CZ1A 1IRFA 2FSWA 3H1QA 4BEHB 1W5CC 4MDBA 3OYYA 2K9QA 4P9UA 3K2AA 4B22A 3KD1E 1M1KO 4JEPA 4CJQA 3BW1A 1EH6A 2PAVA 2MW8A 5IH2A 3K2ZA 5C6SA 1U5TC 2OTJA 1RDCA 3TARA 2E2IJ 3RUXA 1O9SA 1HXDA 3P8HA 1TV6A 2LJ3A 1NLPC 1SQKA 3CCRA 4A3FJ 2RF2A 3DBHB 1LFPA 1ZSGA 2KROA 3RMCA 2FNPA 4CERA 2WOMA 2A05A 3HOZJ 2DA4A 2LK2A 1OISA 2O7OA 4EW0A 4JN4A 3R61A 5J3LA 3VODA 1AU7A 4IRIA 2DAOA 2ABLA 2G8WA 1TT0A 1JCFA 4WFAL 1H641 3OH9A 2PZSA 3PQKA 3RQ4A 4O44A 1U8BA 1NGGA 3WU0A 2RJEA 2IIRA 1RDBA 3ASKA 2B5JA 2M4KA 3RMSA 2XDBA 3CW7A 3BR1A 3DTKA 3QDRB 4M9XA 4EDUA 1YS6A 1GHCA 1FOYA 4JS5A 5GAGP 4C0ZA 2XRIA 2K86A 2FD5A 1ZQ1A 3LH0A 2GQQA 4CSWA 2V75A 3WTVC 4DNCA 4WXCA 3BQZA 3CCSQ 1JJ8C 2E2QA 2RA2A 3CC2Q 4CJKA 3T69A 4I2OA 5J8CA 3G71I 4OFAA 1MDMA 1HLVA 3I56A 3QPTA 1IO6A 1RADB 3JV3A 5AQUA 1NYFA 4B1WB 3TO6A 3DLMA 3ZQ7A 3SK3A 2R5AA 2WY7Q 1CGPA 3F6OA 3WU1B 2DJQA 2G8VA 2XUBA 1VQ4I 1RGIA 2PX9A 3H41A 2RM4A 5HLFA 5FD6A 4NYFA 5AQMA 1T33A 2DF6A 3U4LA 2O8DA 1T6SA 2E4HA 4FE4A 1RBVA 2RHZA 3OYFA 1JCEA 3PIPA 4G12A 3TCJA 3LDLA 3N4QA 2L9NA 2LSNA 1RILA 1OOTA 4LG3A 3N4PA 4EP5A 2XK0A 4MQ3A 4NC8A 1YNZA 4CJEA 1T0JA 5DV5A 4O0JA 5EXWA 2IW5A 4HCKA 1WSEA 2BKDN 2HVHA 2RNGA 2A3LA 4A54A 4C9YA 3RYRA 4DTNA 4JX6A 1U6GA 3TOAA 3GTMJ 2CUFA 1OCRH 5IHIA 2X6SA 3VA3A 3H3ZA 1KC8O 2K40A 3DPTA 3SNNA 4GXOA 2X74A 5LMUK 2M5WA 1QVGS 1S7AA 3CCUA 2QWMA 2TDXA 2YNFA 4UXNA 3JSPA 3SBTA 1G6NA 2D0NA 3KZYA 5E3NA 1XOVA 3FFIA 5GAN8 4IRHA 1W4SA 1ZC6A 4B44A 1ATNA 3G25A 4N41A 1M4ZA 2KT8A 4FJNA 4BUGA 5KE2A 5J1EA 5B1BH 3F8FA 3OW2P 3QWLA 3OYCA 2FBXA 4HXJA 3TW7A 1WN7A 4A0YA 1BR1A 4WX9A 1VSEA 2KQWA 4JD2B 3SHWA 2PMZA 3CM5A 4IUVA 4BWJA 2HBLA 3X28B 3D7EO 1PVEA 1WRJA 4DYQA 2ZB9A 4B9LA 1VQKN 3CMAA 1B07A 1H8KA 4CJ3A 3ATVA 4BS9A 2ZGYA 4FJKA 3DB3A 4RB3C 3X24B 3A1PA 2OZSA 4M7YA 3J80K 2QKLB 2K79A 2WFBA 4JRPA 3VEZA 2HQ5A 5FFZA 1ZGWA 1QHAA 2WA0A 1NJIR 1HBXG 1T0HA 4C8QE 2VQEK 3UR3C 1QVFP 3WEEB 5TJJA 1NNEA 3HPWA 1SKRA 1DTQA 3WTYC 2DMNA 2LQ8A 3IH7A 3GCMA 4YTLA 3RR7A 2W03A 2V1DA 1ATSA 2O6GE 2DJNA 4RB1A 2IOCA 1XNQK 1VFCA 4M78D 5ADXH 5B1AH 2WB1N 1HOMA 1X6OA 3DU5A 3WODF 1K4TA 4B1VA 3BPVA 4LIVA 4OU0A 4O8UA 1NK5A 1WBDA 2ROLA 2A6EF 3BG5A 1C0MA 1QE1A 3K58A 3HTUA 4CC7A 1I1GA 3E01A 3C94A 4K0KK 3TQ7P 2JA8J 3HO1A 4IO9F 1BL0A 3H0HA 5IAYA 1YJNA 1N39A 1UMQA 3E19A 3SFIA 3EKUA 2CZ7B 4ITVA 5FLMJ 3J8AA 2LNBA 4A0XA 5D8LB 1PU7A 4A69C 1GLEG 2B63J 4XR6A 5AYFA 1JKOC 4KHUA 1W1WE 2EJRA 3FLGA 2CDTA 2FPDA 3QJYA 2DL3A 1AWXA 4LF5K 3C6HA 4AFZC 3DWLA 5JICA 2K57A 1TWAJ 1QZEA 1BR4A 1W0TA 1U9NA 4PFOA 3N5BB 5KYNA 1UG2A 2M0MA 4DZJA 3L1PA 2DKGA 4X9CA 1U1TA 2ZNZA 1ASVA 1QZ5A 4DR1K 2JQ7A 3P7NA 5KH6A 2DAQA 3EETA 3AHUA 4ZGEB 1A5VA 3SBGA 3W2WA 1NK3P 4BQQA 2ZPGB 2DLPA 3HRTA 1TW3A 1OI1A 3CJRB 3GBQA 4CC3A 4PL6A 1BUPA 2NOZA 5KK1A 3CJQB 5DCMB 1VQOQ 1S1TA 4E7HA 1K1ZA 4ZGJB 1R6RA 3MMYB 3CJ1A 4BRKA 2DIGA 1AWJA 3TEDA 3LDOA 4RTFD 5C10A 2W40A 5EU7A 5HLIA 3L3VA 4A0ZA 2Q0OA 1MMDA 1DGWY 4BKXA 4A3MJ 1NGHA 1GOBA 2JJ9A 2JS2A 4EMKB 5ELZA 1VQ9I 1C0GA 2EIJH 2LY1A 2LY2A 5K7HA 4OMLA 4FLXA 4GGGA 2GQIA 1NK9A 1CQTA 4PJOG 4WCGA 3EFOB 3U9DA 3LX7A 4M3YA 3U6FA 1V54H 1YHQN 1BOAA 1QCNA 4FJIA 1VQNT 1IGQA 3CD6N 3CC7A 1KYZA 4EJUA 3J7AP 3VUBA 3T1BA 5B8HA 1IKVA 4IHSA 4JLGA 3COAC 3NHGA 4C2MJ 3SFMA 2RHYA 3V9WA 3FXOA 2LOOA 3L09A 5ICEA 1DEJA 1VQKT 1L3TA 4AD9A 4UUTA 3QFPA 3M1FA 3V8KA 2EJ9A 1ZG5A 3AY9A 1WHGA 4CZEA 2GM4A 4KT0E 4JI0K 2JVGA 5GADP 6AT1B 1APLC 2VKEA 2R3SA 1TNSA 1NK6A 4JJDA 3H3VK 3C6TA 4MZTA 1YJWN 1HD3A 2EINH 2KYBA 3WTSC 2YHTA 5HRNA 1C0TA 3IKVA 3M07A 2GBZA 4Z02A 3U8XA 4DV0K 1PYVA 3TSQA 1USTA 2VQLA 4EV0A 4J01A 2DT6A 3G6EQ 3QIPA 1KG1A 3A8LB 1LQ1A 1WI3A 4BAYA 4UB6C 3OR1C 5M5YJ 3RPUD 4BRAA 4EA5A 1C6VX 1LJOA 2BE7D 1S6LA 4BJ6C 3G4ST 4BGBA 3ZFJA 4A6EA 1TWFJ 1U5TB 4LF7K