3S3MA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/inhibitor/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3mA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3mA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3mA03
1WJQA 3EZ5A 1XC9A 4KKOA 3M9QA 2F96A 1JLGA 3AO4A 3AO2A 1B9FA 3KLHA 4FJIA 4HVJA 3V9WA 5D6XA 2DAQA 2F8TA 1KRPA 2LTOA 4CGGA 3MXMA 3H08A 3QNOA 2JTFA 3ZT3A 1S1UA 4DG1A 3TI0A 5DK5A 3K5NA 4DTXA 1S5JA 1JLQA 4FM1A 1ASWA 1UA0A 1S9GA 5DMRA 4CFBA 1UWBA 3VQQA 4CEEA 4CHYA 3KLFA 2OPQA 4M3ZA 1OZ3A 4CK2A 4FU6A 3VQBA 4OLAA 1TK8A 4KO0A 3V1RA 4E7HA 2OZSA 4B9WA 2DFFA 3MAQA 1W9HA 3LAKA 4BDZA 2GFUA 4FYDA 3LWMA 4QQDA 1WSHA 3SQ2A 4HUFA 4ID1A 4TSXA 5FRNA 3WNFA 2X4YA 1IKVA 2EQUA 5SZTA 3DOKA 4ZHRA 2WONA 4FJMA 1J9AA 2IDOA 1CLQA 1KHCA 2EFIA 4FK4A 4E3SA 2OPPA 2HQXA 3NGIA 1X9WA 4CK1A 1BISA 1RT3A 3QERA 1NK9A 4O0IA 3L2UA 4CJLA 4B08A 4QCLA 1EKEA 4JRQA 3DLEA 2QQRA 1X1PA 3ALYA 1JXEA 1RILA 5CIUA 4KI6A 4C8OA 2LSNA 1CZ9A 4CEFA 3MECA 1SKSA 3DM2A 2EQKA 1BI4A 4QQGA 5KCOA 5J26A 4CHQA 4IFYA 4G1QA 3M8PA 3VQ4A 4DQQA 2NLUA 4LH4A 3M8RA 1RT5A 1NOZA 1S1TA 3CQ8A 1SL2A 1QTMA 1WNSA 2EKOA 3WNGA 2O4XB 3CG7A 2OZMA 2QQSA 1RDDA 2M16A 4PLLA 2RHZA 3DRRA 3ZT0A 2Z1GA 4QVZA 1RT4A 4W5TA 4KAZA 2BUDA 4DSFA 4KHYA 3LAMA 1U45A 5D6WA 3HSTB 1TKTA 4CJEA 3SPZA 3TABA 1QS4A 3QESA 1BIZA 4B9MA 3ZSOA 2QKBA 3JYTA 3SQ4A 2IC3A 2AJQA 4KPYA 4F4KA 1RTHA 4FXDA 4O5BA 5HRNA 3OVNA 1FXXA 5T7BA 1VSKA 1U48A 4CJUA 2HHSA 4DU1A 1WJSA 3VQ8A 3RR8A 4IFVA 5KE2A 3H6ZA 4A4FA 3HT3A 2YV0X 2YHBA 1IG9A 4IG3A 2OPRA 3O3HA 3M8QA 4C8KA 4DWIA 3RWUA 2LRQA 1VRTA 4KFBA 1T03A 4KHSA 1VSHA 3EAEA 3MEVA 3NBPA 4CHOA 4F3OA 4CGJA 1DLOA 1SKWA 2E5QA 4CESA 3KKSA 4CFDA 4M3YA 3HP6A 4B8CA 2MWPA 3SCXA 3OB9A 2KQ2A 1FKPA 4CJFA 1FKOA 4FLZA 1HYZA 1RBSA 4I2QA 4H4MA 4GY5A 1T8EA 3LPUA 2HMIA 3PX0A 2KFZA 3TAPA 4J2AA 4KTZA 3L3UA 1D8YA 3CYMA 4HCZA 1D5AA 1F21A 5FRMA 1X9MA 2MWOA 1O1WA 1S9EA 2KZZA 3DB4A 2RO0A 3T1AA 3A2FA 1S6PA 1RT7A 4FZYA 4FLVA 2KZMA 3VQ7A 4FM0A 4OKEA 3AVKA 5C25A 3AVLA 4E7LA 3HJFA 4O55A 3O4QA 4CJSA 4FJ5A 1BHLA 4ZTJA 4E19A 4HUGA 4FJGA 3V9UA 3BDLA 4AHTA 2HVIA 1CXUA 4DQRA 3PO4A 4HCCA 4CGDA 3S9HA 2P5GA 3VN5A 4PQUA 3ME9A 4CIFA 2R7YA 3OYNA 1HQEA 3SQ1A 1KVCA 2D0CA 1JL1A 4AHVA 1L3UA 1R0AA 4Q5WA 4MFBA 1J53A 2QKKA 1ASUA 1ZBIA 3ZT1A 4CEQA 4GVMA 2FBXA 2L3RA 2X4WA 3OYFA 1HQUA 3CFOA 3OYIA 2R5MA 3AO3A 1YTAA 3KJVA 2LVMA 1LWFA 4K8ZA 4A4EA 3LALA 3NF6A 1NK0A 4DTUA 4NS5A 2FBVA 2G8KA 2E4LA 4M3UA 3OYHA 3DRPA 3QEIA 4B9TA 4BDYA 1I3AA 3G0ZA 1NKCA 3I0SA 4I2PA 4EZ6A 4EZ9A 2OA8A 2A1SA 3L2QA 1UAXA 3DLKA 5FROA 3DLBA 4ZTFA 2EX3A 4BD3A 3AVBA 3CM5A 3HPHA 4E7JA 3SYZA 4IKFA 1OYXA 4RW6A 3LZIA 1B92A 3PMIA 1XHXA 2BANA 4NCAA 4FJNA 3OYAA 1G5VA 2GUIA 4OKJA 4RW4A 1DTQA 4JS4A 1BL3A 3VQDA 2D9TA 2R57A 1HJRA 3QO9A 1WJRA 4N76A 3P8DA 5KTQA 1KTQA 4FL6A 3ZSZA 1IH7A 4YNQA 3QJ6A 4BACA 1BCMA 1CZBA 2X6NA 2PQWA 3AVFA 1ITGA 4M45A 3HO1A 1GOAA 4C5IA 4QQ6A 4W5OA 1HMVA 4EDUA 3Q1JA 4CFAA 4N41A 4DTSA 3AA2A 3IS9A 3U3GA 1OZ2A 4FJ7A 1U4BA 4B9UA 4Z4IA 3HP9A 3JSMA 4RG8A 2ZQBA 4LD0A 3TR8A 3K57A 1YT3A 5I3UA 1RTIA 4CK3A 3HPGA 4M41A 4CJVA 5KGXA 3HL8A 1ZYQA 3L3VA 1NJZA 4FJHA 1TGOA 4Q5VA 2RJDA 2DTUA 3RR7A 3U3YA 4CIEA 3T3FA 4KRFA 3KLIA 4DLEA 5HBMA 3TAEA 2RI2A 3SUOA 4HHTA 4MQ3A 2VG6A 2YKNA 2YHAA 1QHTA 3OYMA 3FLGA 1RDCA 2FHDA 2A1RA 3SUPA 1RBVA 3OYCA 3NDKA 1C6VA 1L3SA 3RMAA 4DTNA 2DFEA 5HRRA 3C4SA 4CHZA 4CECA 3TAMA 1L3TA 4FVMA 3BDPA 4CJWA 1B9DA 3AVHA 3ZSYA 3THVA 1WGSA 1KFDA 3PFSA 2KTQA 3LGLA 4W5RA 3KK1A 5J2QA 4KHQA 2XO7A 3L2RA 3S3MA 3QEVA 2RF2A 1ZBUA 5CYMA 4FW1A 3NFAA 3RMBA 4DFPA 4PL6A 4E7KA 2G8IA 2I5JA 2IOCA 1Q9XA 4CJ4A 4KV8A 3NCIA 4I9QA 1J5OA 3MP1A 3LX7A 4DTMA 5JS1A 1SSFA 1A5WA 3NH0A 4DTOA 3OYBA 4DFKA 3L2VA 4CHNA 4X34A 3DLMA 4L59A 2EQJA 3LZJA 4IUQA 1C0UA 2G8FA 1RNHA 2XDPA 4KB0A 4M3XA 1RBUA 3SUQA 4ELVA 4DSIA 3VQAA 3L8BA 2Z1IA 1WAFA 1NOYA 3SZ2A 3K5LA 2E6LA 4QOZB 3S3NA 4B8AB 1A5XA 4NYFA 3PUFA 2IAJA 4CFCA 4K8XA 2GBZA 3ZT4A 3P8HA 4Z4FA 4ELUA 4OVAA 4Y1DA 2RI3A 1BI4B 2HNYA 4H8KA 5HRSA 3SV3A 2P1JA 4AILC 4KI4A 4CJ5A 3KTQA 1KSPA 3LP3A 4FLXA 1JLEA 2YKMA 3OS2A 2M1HA 4PLIA 1NK7A 3OYKA 1C0MA 5M9OA 3V9ZA 1BGXT 4PY5A 4DSLA 2P5OA 2FBYA 3AO5A 3K58A 3F70A 4AHRA 4EP5A 3V9XA 3UT1A 1JXBA 3P1GA 3HK2A 4E1NA 1TKXA 1TVRA 4IG0A 3G10A 3L42A 3PO5A 4M3RA 3S6WA 2R58A 4I9LA 4RW9A 3WNEA 3LDSA 1EX4A 4C8LA 4DU4A 1JLAA 4CRIA 1FK9A 3QBYA 2YNFA 3TWHA 3TARA 3SNNA 4F8RA 2IS3A 4FK0A 4FW2A 3U6FA 4ID5A 2HB5A 3FFIA 3V1QA 1RT2A 3AV9A 3E9FA 3ULDA 4J2DA 5JS2A 3ASMA 3QIOA 1T7PA 3H8ZA 5HROA 3QEWA 4A4GA 4CJQA 4OVLA 5J2MA 2JZ2A 2ITGA 2F8SA 3AVMA 1IKYA 1VRUA 3PNWC 4B3OA 1VSDA 4DTJA 1QE1A 1SV5A 3C94A 3QLHA 4M3WA 1A5VA 1D9DA 3FDRA 4EP4A 4CEOA 4L8RB 3CFRA 4CE9A 4CGIA 1RBRA 2BE2A 2HVHA 2CKKA 1IKXA 4Z02A 1QSYA 4CF0A 4DTRA 3DRSA 3KK3A 2YNHA 1XWLA 3PX6A 3TAFA 1U49A 4IBNA 4CHPA 1KLMA 4DTPA 4YFUA 1KVBA 3DLGA 2QK9A 4IDKA 4CCHA 5K14A 4DF4A 1LAWA 1LW0A 1JLCA 4CF9A 4FM2A 1LV5A 3LLRA 1YTUA 2L89A 3SUNA 5E41A 1SKRA 3SV4A 3TAQA 1JLFA 5C24A 3VA3A 1SL1A 1HNVA 1NK4A 1C0TA 4DSEA 1UOCA 1Q8IA 3HVRA 3MEGA 3OYJA 3QEPA 1WAJA 3VQ9A 3ZEHA 3K59A 3DMJA 2B8AA 3V9SA 3HXMA 4O4GA 2PZSA 1X9SA 4FK2A 1NKBA 1VK0A 1EP4A 3NTKA 2RN2A 4DSKA 4JLHA 1RTJA 3MO8A 4A4HA 4GMJB 1I39A 5KRSA 2IG0A 3C6TA 1J54A 4CJKA 1Q9YA 4KTQA 2HNDA 1NJWA 3SD4A 1RT1A 4E0DA 4CERA 5IAYA 5J2PA 1Y97A 3V4IA 3BGRA 3RRGA 3QNNA 1DTTA 4B9VA 4N5SA 4C8MA 3DOLA 2P0KA 4CEAA 2ZE2A 1Z26A 3LPTA 2RJFA 4W5NA 4FZXC 3HVTA 1TL3A 4OLBA 2RJEA 3AVAA 2XHBA 1RI0A 4CEBA 4FJ8A 1VSJA 4BDPA 3B6PA 3KD5E 3KD1E 4Z4GA 4B9LA 1SUQA 4ICLA 3NNQA 4KHUA 2HHTA 1LAVA 3DLHA 3O3FA 3ZT2A 2HHVA 5CY4A 2Z1HA 2RHUA 2WOMA 3LH0A 1S1XA 4IUUA 3L2WA 3V6DA 2L8DA 5C6SA 4DLGA 1XI1A 4PWDA 1ASVA 3DLRA 5D6YA 3LYIA 4DQPA 3OQ5A 3D0PA 2W42A 3C6UA 1WSEA 4CGFA 2LDMA 4WE1A 1REVA 3HPOA 4FLTA 2E6NA 4KHNA 5J39A 2ETJA 1XNIA 1L5UA 3HYFA 1IO2A 1VSEA 3ZCMA 2VG7A 2K3XA 3KLEA 1GOBA 3AVCA 2G8UA 2Q3SA 3V1OA 1KVAA 4CEDA 4N4GA 3CFPA 5C42A 2G3RA 3OY9A 3OYDA 4LSLA 3LP1A 3NGYA 2X4XA 4CJRA 4DS4A 1HPZA 1RBTA 1H3ZA 4UC4A 3OYEA 3OMGA 2YNGA 4CF2A 1UA1A 1WLJA 1MHNA 1LW2A 4AH9A 2YRVA 4QW2A 2KW4A 1BQNA 1RT6A 4AHSA 2G8HA 3E9GA 3FC3A 3KIOA 3NH1A 3OJUA 1VSIA 3RRHA 3QEXA 1ZBFA 3QIPA 4BWJA 4N4HA 2XY5A 1BCOA 2OPSA 1T05A 3RMCA 2E6MA 3V81A 4QAGA 2X6SA 3AVIA 4IUPA 1TKDA 1NJXA 1S6QA 2DIGA 4OGEA 2D5RA 3KUFA 1JL2A 1C1AA 3MXJA 3KK2A 2XK0A 4CIGA 1KCFA 4RW7A 1WSGA 3NF8A 2YNIA 3VQEA 3EY1A 3FEOA 3PY8A 2RKIA 1QSSA 5IN1A 3META 1EETA 1G15A 3KLGA 2O4XA 3KKRA 4NYNA 4JS5A 4LD6A 4Z4HA 4IURA 2D0AA 2PYLA 4M42A 3GOXA 3MEEA 3E01A 1WSJA 2VWJA 2VG5A 3ZSQA 4CF1A 2Y1IA 4JRPA 4IUTA 4LSNA 4BWMA 4LY7A 3AVJA 2RHIA 1RDAA 4IUVA 4C5HA 3SJJA 4DSJA 5EU7A 2QXFA 3RMDA 2X74A 2GFAA 3TANA 4Z4CA 5CZ2A 1N6QA 3ZSRA 1VSMA 3NF7A 3RTVA 4RW8A 1EXQA 2DY4A 1YVUA 3PX4A 2BGGA 4J2BA 2Z1JA 4BE1A 1D9FA 2RPIA 5KI6A 3VQCA 2VYTA 1WSIA 2HNZA 1BQMA 2RJCA 2B6AA 3AO1A 1S1VA 3DB3A 1IKWA 4DF8A 3MEDA 1NKEA 1TV6A 1N27A 4OJRA 1XHZA 1HYSA 4KTWA 1JKHA 2EHGA 4DS5A 1QQCA 4ELTA 2BDPA 2PYJA 3ZSXA 2P51A 3SQ0A 1KLNA 1KFSA 1VSFA 4CJTA 3EYZA 1TAQA 3MXIA 2G8WA 3P83D 1S1WA 4CF8A 2RHXA 4DQSA 4OPKA 2O4GA 4CEZA 3UIQA 1RDBA 3OJSA 4KREA 5J1EA 2HQEA 4O0JA 1K6YA 3LWLA 2GF7A 3TAGA 5KRTA 3PMTA 3ZSVA 2X78A 2B4JA 3K5MA 4O44A 4FLWA 1SL0A 3M8SA 2K3YA 3QINA 2RI5A 4RG2A 4OKKA 3NGZA 3HM9A 3PV8A 3F73A 1TAUA 4F3TA 2HHQA 1TK5A 1W0HA 4PA1A 2HHUA 2M0OA 1U04A 2GV9A 3NF9A 3O8VA 5KCHA 3SPYA 3O3GA 5KGWA 5KE3A 1LWEA 1U47A 4FLUA 3B6OA 3CEYA 4AHCA 3MP8A 2HHXA 2WACA 4FLYA 2JGUA 3MEAA 1TL1A 2LCCA 3IG1A 4W5QA 3NHGA 4HUEA 4DU3A 2XRIA 1HNIA 2VWKA 5D3GA 4NZGA 2O4IA 3MEUA 4FCYA 1RCHA 2B5JA 1QSLA 3I8DA 3I0RA 2BIVA 3ZSWA 1GOCA 4N56A 4HCBA 2NUBA 4R5PA 5CZ1A 3T19A 1ZBHA 2XY6A 4M3TA 3MEWA 5CYQA 1L3VA 2FC0A 4H4OA 4OPJA 1JLBA 2KFNA 1Z25A 4GW6A 3S3OA 3K2PA 3IRXA 3QKJA 2X35A 1NK8A 3QETA 1WSFA 3P5JA 3OYLA 5SWMA 2R5AA 3VQ6A 1HRHA 3K5OA 3AVNA 3LP2A 4B9SA 3OMCA 3NTHA 1BIUA 4Q0BA 4J2EA 1C1CA 2XY8A 3LGFA 4HTUA 3ITHA 4N4IA 3NAEA 4B9NA 2Y1JA 3VQ5A 3ASKA 3AA4A 4BE0A 2HHWA 3QIIA 3F9KA 3NH2A 4E89A 3UWNA 4Y1CA 4PUOA 1WN7A 1OI1A 5HLFA 3D45A 4N47A 5J2NA 1VSLA 4C5GA 3VA0A 4II1A 4FJXA 3DI6A 5I42A 3DYAA 1MU2A 2IGIA 1NK5A 1CXQA 4B9XA 4KB1A 3LP0A 4F2RA 3OYGA 4E1MA 4FZZA 2PY5A 3C95A 3MP6A 4DQIA 3VQPA 3AVGA 3IAYA 2DFHA 5FDLA 4CJ3A 4DFJA 4C5EA 2G8VA 1C1BA 1LWCA 4NCGA 2JLEA 3SI6A 4DFMA 4F2SA 4FJJA 3AA5X 3CM6A 1TKZA 3O4NA 2XY7A 3ISNC 1NJYA 2ATQA 4AHUA 4CGHA 1NK6A 1TK0A 3OS1A 5C0MA 3OA6A 4Z0UA 4KHWA 2ZD1A 4DMNA 4FJ9A 2EQMA 3LANA 3NE6A 2OYQA 4C8NA 1ZBLA 4NCBA 4E7IA 4BE2A 3OS0A 4Z4EA 4XIUA 1N5YA 2DIQA 2BKDN 3AA3A 1HYVA 5KH6A 4FJLA 5HRPA 4CJPA 1RTDA 4OGCA 3NTIA 2F5KA 2RHYA 4UQGA 2FBTA 4FJKA 2HW3A 4I7FA 4LH5A 3WNHA 2D0BA 5HP1A
chains in the Genus database with same CATH superfamily
1HF0A 1WJQA 2JXBA 4EATA 1ORPA 1JCGA 4WQ4A 4KKOA 1GVDA 3THKA 1AVZC 3M9QA 2F96A 5HLTA 3AO2A 4I01A 3KLHA 3LSPA 1W7PD 2EW3A 2M8EA 1SAUA 5ICCA 5D6XA 3GFJA 4ZDPA 5LJWA 3CJQB 1UHMA 1M8VA 4H4KC 4KH1B 3RSEA 1WJBA 3BJ6A 1KD1C 3H08A 2E2NA 1F1ZA 2HWVA 3HOYJ 2GA1A 1SVOA 4DG1A 1XG7A 5EG0B 3URGA 5DK5A 4DTXA 2ZJ2A 4R79A 2QLZA 4FM1A 1UA0A 5DMRA 1B34B 1WI7A 1UWBA 3VQQA 1YI2N 3QQAA 4H0XB 1UG1A 1PSEA 3F3XA 3WTUC 2UUBK 2OPQA 4M3ZA 3EGDB 5CHIA 1OZ3A 5C2DA 4CZCA 3VQBA 3JSCA 1KFZA 2IGMA 1Z9QA 1UGPB 3GE1A 3CCQT 2OZSA 3FMQA 2RQRA 3MAQA 2R7ZJ 4E7ZA 4Z6YA 2GGRA 2XSDC 4H5RA 2CH6A 2GFUA 1JXOA 4FYDA 4XKVA 1XDSA 3I9QA 1RI9A 3K4JA 3A8MB 4UV9A 4LUDA 2CSOA 2GXBA 3WNFA 1IKVA 2EQUA 3DOKA 5KN8A 3I4MJ 3GBGA 2WONA 2CH4W 3I4PA 3ZQ7A 2DXIA 3ZFJA 4FJMA 1YRNB 1E3MA 5J1UA 3D2FA 2A3ZA 5IPAA 4XNFA 1WKMA 3BTCA 1U8RA 1I1JA 4E3SA 2OPPA 1Q81R 2ACJA 1TUCA 3A5MC 4BC5A 1X9WA 3OGDA 2O8CB 1DGRM 2JJ9A 1QBJA 1ZSGA 1RLQC 3L2UA 2JT4A 4CJLA 4XSXF 5BN8A 1EKEA 3J8AA 4K41A 3A2KA 2XGXA 4A63B 1KJWA 1GL5A 4LD5A 3D1NI 2ZPBB 2QQRA 1IW7F 2E3IA 1D5VA 1RILA 4KI6A 2LSNA 3TCJA 2TCTA 2AS5F 5IY5H 3JAMZ 5TISC 1MDMA 2O03A 1JKQC 5KCOA 1G2BA 3W0LA 4G1QA 1FYKA 3TSPA 2I5WA 3VQ4A 4DBQA 5C2FA 4HAMA 3F22A 1FBUA 2CP7A 3D6RA 1RAAB 3M8RA 4JYKA 3RUXA 1WSUA 4JPBW 3J81Z 1NOZA 3BTJA 2QWWA 2GXGA 3VS6A 1QTMA 1P4AA 2O4XB 1IBLK 3CDIA 2W7NA 2QQSA 2Y4XA 3M59A 4Y91A 3DRRA 3ZT0A 4KAZA 2HD0A 2SRCA 4DSFA 3MFKA 3ZX3A 4KHYA 1V4SA 1N39A 3U1DA 5KYYA 3M3YJ 5D6WA 4HSBA 1V4TA 2DILA 4CJEA 1YQAA 3SPZA 4AVZA 3OSFA 2YCHA 4O8UA 4LFUA 3A0HC 1EJ9A 3TEDA 2KT0A 4B9MA 3TTCA 5TRDA 3J80Z 4M77A 1YITT 2YG8A 2M1BA 5E3LA 3CCEQ 4Z88A 3OL3A 5ERIA 2CGKA 1BJAA 3TKYA 5J4YA 4M7DG 2CGJA 4EMSA 4EIAA 3EUHC 3CC4N 3OVNA 3LSMA 4FL9A 5T7BA 1S3XA 4A2AA 2JOYA 2KYMA 4JDSA 2EWSA 4PDKA 2P9NA 3CMEN 4LB5A 4IFVA 2DTIA 3CCMQ 1T33A 1K8AU 1J3TA 2UUZA 4A4FA 5HOOA 2YV0X 2OJ2A 2EYYA 5CVUA 1I1GA 3H5NA 4IG3A 1WJAA 3L4IA 3EFSA 2A5WA 4HX4A 3ABTA 3S93A 2E6ZA 1VQOA 1BJZA 4KFBA 1X3UA 4JKBA 3WG7H 3EAEA 4CCMA 2NVQJ 4M71A 8ATCB 5E1WA 4CHOA 3L2CA 2WAFA 3EFOB 3KK7A 5GINA 3BUZB 1P8ZA 3N4PA 1DLOA 2EA2A 1Q86C 3I33A 1BM9A 3H92A 4O5VA 5IHIA 4WFAL 1C0GA 1XMQK 4B8CA 1HKSA 1JXMA 1QZ6A 1TQIA 3CC2A 3S8PA 4X65K 3CCLT 4J9DA 1BC7C 3T8TA 1JXSA 3CCSA 4C23A 1VQ7N 2BW3A 4P96A 3S41A 4FLZA 2DXUA 2WA0A 3JCMd 5HL7L 5LD2C 3GG4A 3LSGA 3IH7A 2K9GA 4GY5A 1T8EA 3PX0A 4BQQA 1IRGA 4HG2A 1P59A 4J2AA 1D8YA 4B1UB 3CYMA 1R5GA 2RH2A 4HCZA 1WOQA 1LNWA 3ISPA 3HOTA 2FVUA 1D5AA 3L7WA 2Y69H 3C2HA 5CVRA 3F8BA 2L7ZA 3EQLF 2M7AA 4NLBA 1O1WA 3CMAN 3DB4A 1R49A 4BRMA 1KK7A 2RO0A 1K73R 3T1AA 1WVRA 4ISFA 2NRHA 2FBKA 1G6NA 1BU1A 3A2FA 1D8KA 2GNCA 4AI4A 4RLQA 4OMZA 1LKXA 1MH3A 2KZMA 2W24A 2KEAA 2EJRA 1MV3A 3VPZA 5EZGA 2C0OA 2RM4A 2YXYA 4C2MJ 3IUOA 3QBWA 4E19A 2DA7A 2XF5A 1RL2A 3G6EA 3V9UA 1LNXA 3VW4A 4OB1B 1CXUA 3GBQA 1FP1D 3CCMI 1UJYA 2FRYA 1D3YA 1U5TB 1YG2A 3PL8A 1VQLQ 1V76A 2BE9B 1RAEB 3QYEA 4EIKA 1Z0XA 4CIFA 2A6AA 4IRIA 1PNJA 1KVCA 1JL1A 1L3UA 5DM7R 4NQWB 1E6GA 1MWKA 2JVHA 1VQ5A 2QKKA 2FSNA 1ASUA 5CLSA 4J01A 1ZBIA 2L7MP 1X1AA 2X85A 2R0QC 5GPAA 4LC9B 2OUMA 1QHGA 2RK2A 4EVVA 3OYFA 3CFOA 2R7DA 4NC6A 3MKWB 2R5MA 3KJVA 1S8NA 3RESA 1VQNT 4A3GJ 4A4EA 2XDVA 2KJCA 4LE9A 3ENBA 1K8KB 4JK8A 2PBDA 1KQSM 4M3UA 1QHHD 1P4XA 3OYHA 3HTVA 2IJLA 1K9MC 4YHHK 4YDUA 1VQ6Q 1ZBXA 2OA8A 1XJWB 1I50J 3VDXA 3L2QA 3K9JA 3BJAA 3U2RA 4C3IJ 2IT0A 3TTFA 4BD3A 2I5UA 4M7AG 5AQSA 3HPHA 2DD4A 1YQMA 3LZIA 2KRFA 3MJXA 1M90U 5AONA 1EIFA 3PMIA 1TQMA 4A12A 4NCAA 4FJNA 4MEYF 1ZA2B 2UXDK 5ILVA 3T69A 4C1NK 4RW4A 2KMUA 4JS4A 1BL3A 3SEZA 3H36A 3I58A 2D1HA 1HJRA 3RQ4A 3P8DA 3G1JA 4FL6A 3GTKJ 2LCSA 1IH7A 4UB8C 4AIAA 1KD1R 1FIPA 5LJ3e 4KDPA 2K5CA 2QGFB 5J1YA 3THXB 1CZBA 4EM1A 1Q86O 2E8AA 2X6NA 2X4JA 1VQLI 4PNOA 1ITGA 1UHWA 2NS7A 2PN6A 1BB9A 1YJNT 2NUPB 1QZ5A 2DA4A 1P4WA 2VE9A 3KBGA 2P9PB 4EDUA 2E2PA 3OOPA 4PK4A 3SFZA 5IH2A 1X75C 4PHTX 1BA0A 4UUSA 2KIMA 2JT1A 4CD1A 4CCJA 1CSKA 4DGWB 2QA4N 3GFLA 3W2VA 3SHFA 4BY1J 3GPLA 1RETA 3CBPA 4LD0A 3TR8A 3K57A 1YT3A 2I7PA 1T98A 4UUVA 4C8QD 1ZBJA 1RTIA 3UKUA 1TW2A 2QEXQ 4V19S 5LHHA 3N97A 1LE8A 3HL8A 3L3VA 3BG5A 3M8JA 1NJZA 3IH2A 5DUKA 1E2XA 2X1DA 4C92D 4YEJA 2QWRA 4KIBA 1TGOA 4UY8O 4PJOC 5D7UA 2XB5A 2HDDA 3RR7A 1LMZA 3U3YA 2ZB9A 1WH7A 5AQGA 2V26A 3KLIA 3M0SA 4FWRA 1OX9A 1M4ZA 1HDPA 4RAGA 1GV2A 4XLCA 4BU2A 4C92B 1SHFA 4XM3A 4GYIA 5CVVA 3PNVA 2NS0A 3WTWC 1M1FA 4G94A 4EMKB 5LRRA 3M1FA 3EUKL 3BWGA 1VQPN 1QZZA 5C15A 1Q81U 2FO0A 1C6VA 2CH4A 3NDKA 1B72B 1Q1VA 4J9HA 4DTNA 2CP3A 4CCOA 5HRRA 4FTHA 2YUQA 4ZC3A 3JAMK 2GAUA 1PP7U 3TAMA 1NG9A 1B9DA 3GWZA 3O5BA 2FRWA 4BBSJ 2BEOA 4OX9K 1TP4A 3K4CA 1Y8QB 1S72N 4M9SA 4QS7A 5D8KB 2MA3A 3BG7A 1U78A 3J81K 2OC6A 5GAMe 1O13A 4W5RA 2P84A 1NGGA 5J2QA 2XO7A 3L2RA 1OKJA 2FZCB 3H0IA 3MCPA 2DODA 1ZBUA 5CYMA 1KQSA 3RMBA 4KFCA 3ROUA 2G8IA 1HCRA 4ASNA 1K9MO 4BR9A 3O9SA 4ENMA 1Q9XA 1SPKA 4KV8A 4RBOA 3H0DA 2BTTA 1KU3A 5C10A 1WHHA 5M3MJ 2H1LA 3NH0A 2HS5A 2E7WA 3TMOA 3L2VA 4CHNA 4L59A 1RR7A 4AFUC 2PI0A 1FTZA 4IUQA 2M87A 4HCKA 1YJ9I 1C0UA 2G8FA 3O8MA 4TVRA 5M5YJ 4OP0A 1UZCA 4NYFA 2ASMA 2DL8A 3TW7A 4OMPA 2IAJA 2E2IJ 2M7BA 4IF4A 3K4NA 4XR6A 4K8XA 2O7OA 1ORNA 3EG3A 5LJ5j 1LFUP 3BQYA 2MBFA 2ZBKA 2HBWA 5LGTA 4ELUA 2H6CA 4OVAA 1E0EA 1RRSA 4EV0A 1ZRDA 2H27A 4Y1DA 3CUQA 2FOWA 1FBQA 2EH3A 5HRSA 4QWQA 5FD5A 2FMLA 1CF7B 1W36C 4RKUE 1MMGA 1R6RA 2M1HA 1H1VA 3ZBDA 3I0TA 2P4TA 5AQZA 4OAZA 2P4RA 3M1CA 5M9OA 3L6QA 4XSZF 2NNNA 1YJWI 4NBQA 4DIQA 2K5IA 2P5OA 3AO5A 4AHRA 4N9IA 3UF4A 3H6EA 1JXBA 1QQIA 2A37A 2KYBA 2CFOA 1IGNA 1NTCA 2HI3A 1T08B 1W0UA 1QCNA 3G10A 5ADXH 1KG6A 1QU3A 3N05A 2YDLA 1EH6A 4H0PA 2R58A 4I9LA 3LDSA 1MW7A 1FOYA 5F04A 2OX7A 4HVWA 2YUNA 4ZJZA 1JLAA 4KT6A 4M6YA 3C12A 4AMCA 2FXAA 4MFEA 4RAFA 3IRQA 2HNHA 3O6WA 1QGPA 3ZMDA 3JRDA 2UXNA 4B23A 3TWHA 2VKEA 3JB9F 3TARA 2GQVA 3TW6A 1X4PA 4L3QA 1FY7A 2VOPA 4FW2A 2TDXA 4A0XA 4AG1C 1ZR2A 2P5VA 2HB5A 4JRKA 2K9QA 4QS9A 3AV9A 1R5HA 4RTWA 3MN7A 2VGNA 4HF0A 3ULDA 1FOXA 3M8EA 5JS2A 2STWA 3A01B 3VMFB 1T7PA 4KULA 2QXLA 3QEWA 3EUHA 4V2SA 2JZ2A 3CCUI 5DCFA 2C0IA 3E6CC 3AVMA 4Z2YA 2DT6A 5FKKA 4F92B 2RN8A 1QA6A 1VQMA 3TVTA 5AQQA 4U0WA 4KBMB 5FU6B 3DU5A 1QHAA 3FZVA 1BUPA 4XN0A 3ZCOA 1V4RA 3CFRA 3E66A 4CGIA 2BE2A 1M1KC 3JCMc 1W5SA 2QBYA 4YOVA 4E9FA 2K79A 3UKGA 4N0BA 3FLCO 2E65A 1XUPO 4DV1K 1XN7A 2OCEA 3VOVA 1NEBA 3RDIA 3KP4A 4MDWA 2L4AA 2R5YB 5HS7A 3PX6A 3M0QA 1FJLA 4KUIA 1RPWA 3M07A 2YHWA 5AQWA 3JRFA 4BGBA 1LAWA 2DL3A 2OFIA 5F08A 4XLNF 4FM2A 4FT2A 5LJ3g 2RPNA 1ZRCA 1YTUA 2L89A 5H1SQ 1R4MB 3HRSA 2IS4A 3KCCA 2R7TA 2OQGA 3FMRA 2ED0A 3M0TA 4H03B 4C3JJ 1B59A 3SV4A 4J8FA 3TAQA 4XTXA 1HK9A 1JLFA 3VA3A 1HNVA 3HSFA 3FK6A 4C0FA 1NK4A 1XTDA 9ATCB 4F3QA 3OYJA 2JN6A 4PJOE 4XN3A 1GLJO 3IH4A 1V5EA 5EJCA 1YI2Q 3QPSA 2KI7A 3JCMQ 1FMVA 1F9NA 4H5VA 3QFPA 2ZPFB 2MG4A 3HXMA 2W41A 4O4GA 1KAZA 1YQRA 1FOKA 5LJ3d 5L3CA 1VK0A 2MOXA 2D0NA 1HW5A 2DDBA 2F4OB 2M0MA 2L4MA 1AHDP 1M2OA 4JLHA 4ENKA 1UECA 4H0EA 3MO8A 4CZZA 2VPLA 2OAUA 3K1MA 4U0YA 3IAM2 3D5LA 1X19A 3M0RA 1KD1U 5J8FA 1VYTA 1U84A 4E0DA 2IGKA 5E3NA 4M7DC 2V9KA 1N75A 5KNLA 4BC2A 4U0VA 3QNNA 1DTTA 4B9VA 1YF5L 3TPQA 1TSFA 2P0KA 4CEAA 3CC7I 1Z26A 1RZ4A 2RJFA 4FZXC 2SEMA 3HVTA 8AT1B 5DD8A 2CH5A 1X01A 4C0GA 4FJ8A 2AK5A 2L0KA 5JVGF 3QP6A 2EGAA 2L9VA 5KAFC 1HKTA 3NNQA 4KHUA 5EEHA 5AQFA 1YIJT 3KPHA 3SWNC 3A8LB 3M0PA 4I98B 2HHVA 4MEXF 4C1NI 3PGGA 3R61A 2WOMA 3HUGB 3VF4A 4J8OA 2NRAC 4EM0B 3L2WA 2BOLA 3F8FA 2P81A 4XU3A 1I5LA 3MKLA 5GAMg 1AWCA 4JI3K 5K1YA 3DLRA 3Q7BA 3DQVC 3OIPA 1NGAA 1NE8A 5E1ZB 2OTJT 5GAHJ 1Z3XA 3HRTA 3I56T 3B6CA 3C2GA 2PG4A 1YI2I 2VC1A 4CYCB 3EGDA 5J39A 1XNIA 3V42A 4GV6A 2LLKA 3RYPA 3NFCA 3LDQA 3DKXA 3LSTA 3MX5A 1GOBA 2YS9A 2KY9A 2K4JA 1Y0NA 3P39A 1EWQA 3EH2A 1M30A 4RTUA 4CEDA 3WG9A 2AP1A 1T95A 2E71A 3CCEA 1B8IA 2VUMJ 4U87A 4DB3A 2EFNA 3QP5A 3OY9A 5GAMd 2DA2A 2HSTA 2W6KA 4HF1A 3QSUA 3SBGA 3Q0WA 3HBLA 2YNGA 1M2VB 4CF2A 3CCMA 3BC8A 1LW2A 2GQIA 3K1NA 1GLCG 2F7TA 3CC4Q 1IV8A 2O31A 1BQNA 1LFPA 1STZA 3ERMA 4OPAA 1K73O 2O8CA 3NH1A 3CMEQ 4CH7A 4M75G 2EV5A 2WV1A 3QIPA 1VQON 1IXRC 1N33K 3PIPA 2BXZA 5A2QZ 4QAGA 3FIFA 2JJ7A 3N0UA 4IUPA 4JI8K 5JLWA 1NJXA 3EYYA 4F17A 3I59B 5LJ3f 5KCMA 3JRBA 2RC4A 1T8IA 4PJOA 1GUUA 1WSGA 3PUBA 2NOFA 3CC2N 3NF8A 3VQEA 4KNYA 1XQOA 4ZNXA 1UFMA 2CRGA 1QSSA 2DPDA 3META 2F5CA 5HKCA 1JO8A 1G15A 4OIOF 2O4XA 5GIPA 5GAOq 2K9NA 1VQ7Q 4LD6A 4JK1X 3ABKH 2D0AA 3MVPA 3TSUA 2JA2A 2Q0UA 3S16J 1X3WB 4HW0A 1IHVA 1WSJA 3MDQA 5BREA 2VG5A 2Y1IA 3GTJJ 4BWMA 4BY6B 3SDBA 4Y52J 2RHIA 5HNHA 4MLEA 3WGGA 2Y9YA 1X69A 4X1EA 4HT8A 3HOXJ 5EU7A 5CKDA 1O3RA 3MQ0A 2RQTA 2VXEA 3FE1A 2VODA 3TANA 3CMAQ 5CZ2A 1N6QA 3M5AA 3VS0A 4M7AC 3ZSRA 3NF7A 1J09A 1ESVA 3D2EB 2DY4A 3M0UA 2C06A 3ZQQA 1QKXA 3BR2A 4BE1A 2CQ7A 2KE9A 1D9FA 4CDGA 2EQRA 3CC4I 2F1LA 5GAOp 1T3LA 1VQLA 4AIJA 2V1QA 4OMFB 3FXRA 1BQMA 3DCFA 4MO5A 1IKWA 3MEDA 4NHJA 1TV6A 3MWMA 5AQUA 4OJRA 3S2DJ 1HYSA 4KTWA 2DQLA 2ATCB 2W40A 2FPEA 3LFKA 1HW1A 4LDWA 2O8FB 1JEGA 3GZNB 2BDPA 2A61A 3SQ0A 5FLXO 3V8JA 1EWRA 2V79A 1VSFA 2JUCA 5GMKj 1UUEA 3EFOA 1WEGA 1TAQA 2G8WA 3AFHA 1HYOA 1J5EK 4BUGA 5GAMf 2DQRA 1M1GA 1UGVA 2H09A 3UIQA 1FZPB 3VTHA 5JFRA 2DEQA 3OJSA 1P7JA 3JCMh 2VYPA 3VYTB 4KREA 2XHKA 3PT9A 1IF1A 1XGOA 4MNUA 3DTEA 2A36A 1M3BA 1VQ6A 2P9SB 3LWLA 1HNZK 1UELB 4A6DA 4JZ3A 2X78A 3K5MA 3TSZA 3MN5A 3K6GA 4FWQA 1OEBA 2KHOA 2K3YA 2IA1A 1R22A 3QDFA 1QVTA 3WVEB 1M1KR 3NGZA 2V8JA 2HHQA 1FW6A 1TK5A 4PA1A 2GIZA 3HRUA 1JJ2M 2HHUA 4BGAA 2PUKB 2GV9A 2Y0MA 2Z2SB 2WB1A 3SPYA 2DVEA 2EIJH 3BFMA 2J6OA 2HHXA 1JKOC 2QTXA 4XLPF 4A3EJ 2JGUA 2ZCWA 4M7DE 1DEJA 4F14A 1ULYA 2LCCA 3JREA 2HCKA 1HPMA 4XIDA 4W5QA 3NHGA 1K0XA 3CLQA 2FPDA 3O9RA 3I55N 3KP7A 3D7EO 2JA8J 2XRIA 2KDZA 2FSKA 2WC9A 4E6RA 2RA2A 2ZMEC 3CD6T 3QO3A 2VWKA 1BW6A 4EHUA 3RBBB 1U5TA 2KQRA 3IL2A 5CK9A 1K9MU 4WYBA 3ZSWA 2HHHK 2CQQA 5AFUA 1TTHB 4HCBA 4G9ZA 4R5PA 5CZ1A 1IC8A 1FOWA 2F2WA 2HSEB 2WSCE 3CJCA 3CPWS 4NQWA 3HFOA 1DGKN 1PUFB 3VRYA 4FYYB 1X58A 3QWYA 2VT2A 3GZ6A 1WA7A 2JM9A 2CS3A 1A6IA 2LY2A 1Z25A 1VQ9I 1N6AA 3K2PA 2QEXA 2OAZA 2QA4Q 4XBFA 4IHYA 5FLXE 1XMXA 3LDPA 2KPMA 3QETA 2GA2A 4WQ5C 3K10A 5JMVA 5SWMA 3BW1A 3FISA 1HRHA 3VF2A 1Z21A 1EQYA 3OMCA 3NTHA 1BIUA 1JTXA 3VKIA 2YI1A 2ENMA 3LGFA 2XY8A 2KRSA 2NS8A 4B1WB 4B9NA 3CQXA 5FO5A 1ZLMA 1T6CA 5DM7F 3H45C 3LA3A 2WWYA 3O9QA 3CJRB 3QIIA 3F9KA 4WXHA 2DMUA 2CMPA 4OMNA 4KBOA 5AQXA 1QPIA 4Y1CA 4PUOA 2OZ6A 4RCBA 2K3PA 5HLFA 3Q3SA 2H3JA 1BOTO 1IG8A 3WODF 4N47A 5J2NA 3LH5A 3GTPJ 4II1A 4KN7X 3QODA 4BRCA 4FJXA 3F6OA 2KNBB 4JRIA 5FKOA 3DI6A 1OCZH 2MAMA 2E41A 1MU2A 2Q1ZB 5B8HA 3KEOA 1CXQA 3SK3A 4B9XA 1GV5A 4HT9A 4ZGDB 3HDDA 4IJAA 2D0PA 1VQPQ 4XOPA 4C92F 2GIVA 4ZZLA 1U3OA 3G71N 1VQ8N 1RKTA 3KHYA 2FG0A 2KDSA 2M3AA 3VQPA 1BA5A 3IAYA 2DFHA 2V7ZA 4CJ3A 1K6OA 4DFJA 2W03A 3WXMB 2G8VA 3DKWA 1LWCA 1SKUB 3THXA 4OFEA 4WFBL 2IVOA 5L3FA 1JRIA 4FJJA 5HLGA 3IDHA 3NMUA 3AA5X 4BI8B 4HOBA 1S72Q 4X64K 1NJYA 2DOAA 1KG1A 4FHTA 2Z99A 2P9PA 3OA6A 4KHWA 3EETA 2EQMA 5M1NA 3OW2M 4C8NA 2QM3A 1CGPA 4LDXA 3PVQA 3SAFA 1YIOA 4BE2A 3OS0A 4FWMA 3JAMO 2HF4A 4A3JJ 2ELKA 3VB2A 3F9MA 1B6AA 2VKNA 4Y7NJ 1WXTA 4W97A 2FB7A 1EZZB 2JA5J 3ZLJA 4HF2A 1MGTA 2RNJA 2QA4I 3OL4A 5BPMA 1BYMA 1U06A 2NOHA 1LVKA 1JJ2A 3RVCA 2LQ8A 3J81O 4EEFG 2HBLA 1DKGD 2FBTA 2OTLA 4FJKA 2XRNA 2HW3A 5TJJA 1ODDA 4LH5A 3WNHA 1T0JA 5AQPA 2ESHA 3NRVA 4MLHA 3M56A 2PFUA 2XB0X 2OFKA 1MBKA 3GZ5A 3SB2A 5IWAK 3EZ5A 1Q7YO 4GY2B 2DF6A 2LRDA 4LF8K 2A42A 1IHWA 3KFVA 5KYXB 2EGEA 4MO4A 1UGQB 1B9FA 1DPUA 4PKGA 4AYBN 5DM6F 4FJIA 2NYSA 2DO3A 1HX1A 2AT1B 2YX4A 3V9WA 4M7DD 1E17A 4M7AE 2DAQA 1A0NB 1KRPA 3BG3A 3Q7CA 2LTOA 5GMKm 1TYQA 3Q9SA 1RAHB 2DTHA 2P9UB 1XS9A 2ID3A 1WHJA 3RKQA 2QQAA 2LYCA 3OSGA 2A28A 3J80O 4CZIA 4XTYA 4J7FA 4A2UA 3E9LA 2CQXA 4RGSA 1VQPI 4CA0A 4Z89A 3R6MA 2XDDA 2NRZA 2XV4S 4CC2A 3K2ZA 1JLQA 3SWNA 1ASWA 2J5OA 3FK7A 1H3HA 4CFBA 4HYEA 4EJOA 2GTDA 4A57A 3JCUC 3CCQN 1SD7A 3T1BA 2CUBA 4FU6A 3VUZA 4J83A 4HV5A 4ZGJB 1QVFA 2MC3A 2PMZA 2GZWA 1S72I 2HBMA 3C3WA 4IOCL 4B9WA 2RNAA 2D0OA 1O7LA 2DAOA 3JTHA 2B9SA 3JB9J 3LWMA 4P5OA 3K0SA 1JU5C 4CBWA 3SQ2A 2ZCFB 3CHWA 3HOSA 1BU6O 3FSPA 4ZHRA 1FSEA 2VASA 1H92A 1CKAA 3LM9A 1UJ8A 4VUBA 4MTDA 3NARA 4I6ZA 3M57A 2DPNA 2VBWA 2W82A 3I35A 5A0DA 2DLPA 2P8TA 2QKLB 3RNJA 2EFIA 4QT7A 5BNGA 3JAME 3NGIA 4CK1A 1BISA 4NC7A 4JKCA 3QERA 1XMKA 1XGMA 2LC2A 4XTZA 4IOXA 1NK9A 2NOBA 2PFBA 1VIFA 3J81E 4B08A 2AIRB 4QCLA 4JRQA 2KQWA 2LT1A 1OYYA 4XONA 3KZBA 2VC0A 2D6FA 1BN5A 3ALYA 4B3AA 1YW8A 1JXEA 4JAXA 3EUAA 3GIBA 2O8KA 5CIUA 2V4JC 2QWQA 4C8OA 4C0ZA 2FEZA 3HHTB 3U9DA 2FZGB 3EG9A 2DEUA 2HKQB 3T5XA 4QQGA 2V1XA 3K2AA 3FGUA 2HZYA 2VKVA 2RNGA 3M8PA 3UE5A 1KQJA 3LSKA 1CF7A 4LH4A 3BP8A 3F72A 4BS9A 4NB5A 1KG5A 5BPNA 3IKTA 1SL2A 1NK2P 3A1PA 4G12A 2KXCA 1K61A 1WNSA 2DX1A 2EKOA 1R00A 4LF4K 4ON0A 2HZTA 1PYVA 4BC3A 2QWNA 2OZMA 2CGPA 1RDDA 3MWTA 2RHZA 2IEKA 3A5LC 4CYDA 4W5TA 1EO1A 3HEFA 4PFPA 1YJ9T 2LC4A 1U45A 3ZEUB 4JI7K 3CQZJ 2DU9A 3HSTB 3MWPA 3RKYA 3R3LA 2ZZDA 1TKTA 3TABA 3SZTA 3J7AP 3ONQA 1YITN 2OANA 3S1NJ 1R5ID 3ZSOA 3CMMA 2ED1A 3EHRA 3VGKA 3BQZA 2ZAEA 2QKBA 4AIKA 3JYTA 3SQ4A 4F9OA 4ABZA 1O7FA 2KK4A 1BI0A 3GTMJ 1RTHA 4BXXJ 4OIRF 2ECBA 2NVYJ 3ZETB 1FXXA 1YI2A 2FQ3A 3KZYA 4CJUA 3ZGKA 1AA7A 1Y7XA 2HHSA 5F0CA 4DU1A 2DYRH 3VQ8A 1M1KU 3IHUA 1GXPA 4H5WA 5KE2A 4M7AA 4BG9A 3R60A 2KROA 3A01A 3HT3A 2YHBA 2CU7A 2OPRA 4IPAA 4DQ2A 3M8QA 2ROTA 1YJWT 4BQOA 2O61A 2AA4A 4DWIA 2A5YB 4GCVA 1Q82R 2L7KA 4OB2B 3EGXB 4LF7K 4J9BA 1V54H 1K9AA 1X3NA 2ZPHB 1TWCJ 4OIQF 5EG2A 1R58A 1E3PA 1RNLA 2DD5A 1SKWA 2LNVA 3KKSA 4M3YA 1G3SA 3HOWJ 4ZZDA 3CCLN 1HBXG 4JYAK 2KKOA 5A0GA 4BYYA 3SFMA 3BR0A 3I54A 3F21A 4FETA 4DBFA 5KYNA 4I6MA 5GAEP 1RUNA 1K4US 2YWWA 1FKOA 2G7HA 3S2WA 5GAOl 3IUCA 1DGWY 2QSFX 1BKBA 4I2QA 2BE5F 2EYQA 1M3CA 1SC7A 4R55A 1TC3C 4BUPA 2HL5C 1MUDA 3PSFA 4M75C 2W0ZA 2HQ5A 4Y92A 3DKYA 1P7MA 5FRMA 2LT4A 3V8LA 2EJGA 4I76A 1WCMJ 2GTOA 2MWOA 3EH1A 1S9EA 1XPXA 4KHPK 2EB7A 4EJYA 2CV2A 5AN4A 5LL6S 2MFZA 3CCUT 3ABMH 1TUUA 1Y56A 4OKEA 3HJFA 4ESBA 4R0KA 4FJ5A 1NM7A 1BHLA 4ZTJA 3H9NA 3H3VK 3WTSC 5LGNA 2L9RA 3WU0A 1Y0MA 3BDLA 3RQIA 4AHTA 3N5NX 4D5CA 3OSVA 2F4VK 4DEXA 4DV4K 3PO4A 4HCCA 1GLNA 3T0YA 4CCNA 5GJWB 2P5GA 1ILYA 2HKOA 5LJ3h 1IGQA 3VERA 3VESA 2M30A 3T1YK 2VL8A 2R7YA 1X3MA 1HQEA 3FZMA 1X2NA 4BRQA 4PJJA 3TGNA 5EGOA 2K27A 2KIUA 5LFAA 3CMYA 2PJPA 1RAFB 1R0AA 1K1ZA 1XCVA 2ZMEA 4YOYA 5GANe 4FWKA 1JHFA 2ZGZA 3ZT1A 2K6DA 4RDUA 4CEQA 2LX7A 3U9GA 4GVMA 1W5TA 3CXCA 3DPTA 2WAQN 2L3RA 2JWLA 4LNPA 3CC4A 1Y57A 1YTAA 3JB9H 4NOYA 2DXBA 1YS6A 5GADP 1NK0A 1NG7A 3CMEA 3X20B 2HZDA 5HCKA 4BJ6C 2G8KA 2E4LA 1OMIA 3DRPA 2FLOA 1VI0A 4DV0K 1MGQA 2IVPA 4GGGA 3B6AA 2IBDA 2ZNYA 2JMCA 1U1SA 3I0SA 1OH8A 5J3BA 2LBFA 2JM8A 2V6EA 1HU0A 3IV5A 1UAXA 1VQOQ 2Q0OA 1XGNA 4NO7A 2VKHA 3K9KA 1KIKA 1NLOC 3AVBA 5F64A 4WQ4C 3HRMA 1OYXA 1B92A 1Y96B 3IHOA 4EJVA 3HUGA 3OYAA 1LVAA 1OU8A 3CJ7A 5CAIA 1VQ7A 3HL2A 3FX3A 2CV0A 4ETSA 2R57A 2LQNA 3QPHA 2O9VA 1N3CA 2Q2RA 3ZMZA 4LK0F 5LGUA 2ABKA 5KTQA 3P7NA 4GLMA 1IJWC 4BACA 4J9EA 2MIOA 2CSQA 3ZYYX 2LR8A 1YJNN 2VBZA 4M45A 3HO1A 2M4GA 5DCMB 4QQ6A 4W5OA 1VFCA 3BDDA 3Q1JA 3CMAA 4CFAA 3CC7T 3PIPL 4DTSA 4DYRA 3U3GA 4N4OB 1I6XA 3H1CA 1KG2A 1OZ2A 4FJ7A 4KUMA 1MBHA 2V1RA 3VEYA 1RR8C 5F1JA 5EC7A 1D3BB 4Z4IA 3OS5A 3H3UA 3JSMA 3JRGA 3SEMA 1R36A 2FE3A 2ZQBA 4QPOA 4XRSA 5I9EB 3BR3A 1M2VA 3MN2A 4YOXA 5CQGA 4AVPA 5J40A 4CK3A 1BI2A 1MSEC 4WTOB 3ELKA 5KGXA 2E2JJ 3EKUA 2Z16A 4XU2A 2COYA 4E70A 4Q5VA 2RJDA 2C6YA 3R6SA 4IVNA 2LY1A 2DTUA 2KKZA 1DIZA 3T3FA 4KRFA 1VQOI 3SUOA 1MUYA 1ZTRA 3C65A 1I6HJ 3FWEA 4LDYA 2YKNA 3OH9A 2RN7A 3PFIA 1B3QA 3DEWA 3L9FA 4CZHA 3FLGA 1RDCA 2IRFG 4M78D 2A1RA 3JB9G 2ZM6K 4HNVA 3TU5A 4GDFA 3UNGC 2DJIA 3CC2I 1YN8A 1U3EM 1ON1A 3GLLA 2R7WA 4FWOA 3CCSI 4CZMA 3ZQHA 3RMAA 1VQ6N 1WFWA 2X6YA 4CHZA 2JMAA 3DLLL 3I53A 3FZKA 1L3TA 4M78B 4FVMA 4B24A 3UA7A 5L3DA 4CC7A 2JSPA 3THVA 2HYFA 1PKTA 4BRKA 1X9JA 1R9TJ 3VS4A 1WGSA 1JUMA 1HKBA 3AHUA 3QICA 3QU6A 1A35A 1XNRK 2EIKH 2KTQA 3VRZA 4D8DA 1MBFA 2DPPB 2KRHA 2DLLA 3F8CA 2HFHA 3S3MA 4IX7A 5FD6A 2RF2A 1IXDA 3WXLA 2JG6A 1WEIA 2M0CA 3N5BB 3HC7A 4BRHA 4I9QA 1FNNA 5L3GA 1IXSB 1YBYA 3W3DA 4DTMA 4DTOA 4UXNA 2LP5A 2R7XA 3E9OA 1XC5A 2EQIA 3L4QA 4J9FA 3I55Q 1RNHA 1OCRH 5M1QA 2DE0X 4KB0A 3WXKA 2E10A 4DSIA 4L6V5 1NOYA 1YFHA 1WAFA 1ETQA 3OIOA 1W7AA 4M75E 3K5LA 3S3NA 3FHNA 4LLGF 4HLYA 3GNFB 2IPOB 2V7YA 2BXYA 2O8FA 3LWFA 3FXMA 2GCXA 2FL7A 5LHGA 3QUIA 2QA4A 2RI3A 2ZXHA 3U4LA 1OQKA 2WY7Q 2P1JA 2OD5A 1GBRA 1OH6A 4KI4A 4CJ5A 2VT3A 3CDHA 5ADXA 1RESA 3C0BA 2O8DA 4CO8A 5GAN6 4L5IA 2UXXA 2LX9A 1WJEA 3ABUA 2E1YA 3EPZA 3FBNB 1CQTA 4EA4A 4IOAF 2P9SA 2CUDA 4PY5A 5JLFA 3WHBA 2JUFA 4ATOA 4EP5A 4CXFA 4J9IA 5BRDA 4E1NA 2HNIA 5F6FA 1Y71A 2V8KA 1IB8A 4EHTA 4L0ZB 1DPRA 3HM5A 1NU0A 2JZYA 4YTLA 5LMUK 4G8XA 3WNEA 2HOEA 2W84A 4LB6B 4DU4A 4RAZA 1VQPA 1QWFA 3GTQJ 4RB2C 1WJFA 2BBYA 4BRGA 3A8HB 1NJIC 3SNNA 1TU0B 4KUDK 1D1CA 2EBPA 2V51B 3TDZC 3G71Q 2XGCA 1VQ8Q 4BHBA 3HGGA 3R8EA 1DU0A 3FMSA 4K25A 2QYZA 3I55I 1ZG5A 3V1QA 1HA8A 5KPTA 1S72A 3PM1A 4G6DA 1R7JA 4CI0C 4J2DA 1K8AR 2G7UA 2LNBA 2XD0A 2HU9A 1Y07A 2WUSA 1UG2A 1PHTA 3LAPA 4A4GA 5I11A 2AXLA 4RTZA 5J2MA 3BG9A 1JI8A 2HTSA 4X1VA 2GQQA 4DR3K 1TUDA 5DYMA 4JKFA 4LGWA 1W2BA 2L2PA 5EF6A 1PUFA 1QP2A 1UHCA 1SV5A 3WE2A 3KYLA 1ZR4A 2A6HF 2CW7A 4XKCA 1I0CA 4Y28E 1Z6RA 5B66C 3FDRA 3KFWX 4L8RB 4CE9A 1D4XA 2OTLN 2HDWA 4CSWA 1G4DA 1O9SA 2EINH 1KYWA 5D6FA 4YOWA 3PVLA 5GANd 1W4SA 1Y6IA 4B47A 4XLFA 2KRNA 1IKXA 3O5ZA 4JI0K 6AT1B 1VRLA 1QSYA 4DTRA 3CVTA 1EBMA 1USSA 2YNHA 3KWGA 3FKIJ 1U49A 4IBNA 4NB4A 2VOOA 2HSPA 3UB5A 3DLGA 4U67L 4CCHA 3M1EA 5HLHA 4M63C 1EFNA 2ZJPL 4YDUC 3ML6A 3WT0A 3JCMe 3W6JB 1OOTA 3GXOA 4C3HJ 5GAN5 2IIRA 4ME7A 5HODA 3DTKA 1YP5A 2ZJRL 2A3SA 3DJCA 3G25A 1HLVA 2BUPA 1E3OC 5ED4A 3KVGA 4M3EA 4E6KG 2DBKA 1SKRA 1GCPA 1QP3A 2KHMA 3J7YP 2X9HA 2DBMA 2PU9B 1UOCA 2UXCK 1VQ9T 1Q8IA 1QQOA 4JHDB 1NBWA 2K57A 2DJQA 3VQ9A 3ZEHA 5L23A 3DLAA 3CCQQ 2Y9ZA 2JVGA 3L1AA 3K59A 4F7UG 4PCQA 2FOKA 3QFUA 2E7XA 1X9SA 3SAGA 5A2QO 1PUEE 4FK2A 3ZRGA 1NKBA 5M1PA 1EP4A 1I94K 4EMHA 5F0HA 1IZ1A 3KYCB 4YFKF 2LF8A 5KAIC 2XPVA 1I39A 1YCYA 1IGUA 4K43A 5L3EA 2EPDA 1Q9YA 2HNDA 1HNXK 4A69C 1NMNA 4KT0E 3SD4A 1RT1A 2KIFA 4L5GA 2JTVA 2F5FA 4JK7A 3RRGA 1R59O 2QCOA 2ZE2A 2QTVA 3LPTA 2JN0A 4C30A 4B43A 1KU7A 1XQSC 4OLBA 3DBRB 4A3FJ 2M5WA 3NAUA 3AVAA 4IHSA 4CEBA 5IXBA 3RPUA 1YIJN 3B6PA 1Z9ZA 3M6GA 5M1OA 4RAYA 3TU4K 1KEAA 5CY4A 2Z1HA 5J4VA 2HBKA 4JQFA 4A93J 2HDAA 2P9UA 3LH0A 2O01E 1PM3A 1M90R 4FPBA 1XCBA 3V6DA 1J0RA 4DLGA 2W04A 2EFWA 2OTJN 4PWDA 5E26A 2YG9A 2M34A 1S6LA 3D0PA 3M4GA 1FTTA 3I56N 2ZWHA 1D5YA 1Q82O 4J7IA 3TP0A 4CJ7A 5CHZA 4OB0B 1WSEA 3AG1H 5HS9A 4H5TA 1REVA 1OX8A 1RDUA 3HPOA 4H0VB 1ENHA 5GANf 4KHNA 3H35A 3H9QA 2ETJA 2BHZA 4E9HA 2GWKA 3CETA 4KISA 2DI3A 3CESA 3FHZA 1L5UA 3HKSA 1T38A 2JW4A 3CCQI 2DTOA 1VSEA 1IDYA 3F10A 2VG7A 3C1DA 4IXAA 5CE3A 4B09A 1LDJA 3FXJA 1XNQK 1RIOH 3AVCA 2Q3SA 3V1OA 3GF5A 4AQYK 2G8UA 4WX9A 4XLHA 1JBMA 4QIWN 2RQQA 1OVYA 5FU7C 4HX7A 4N4GA 3I5RA 1JJ2S 1W7PB 2FYKA 5C42A 2X0LA 2G3RA 2E60A 4LSLA 1YITQ 3RZDJ 3NGYA 2RK1A 2VJIA 4WCIA 2L7FP 3FM5A 2C0TA 5AQMA 4DS4A 1HPZA 4OMLA 5A2QE 1OYIA 1H3ZA 1TOVA 3OYEA 3CP8A 3RSEB 3MN9A 4EFHA 2ZSIB 1IRXA 1MHNA 4DV2K 2O9SA 4AH9A 2KW4A 4B1RA 1RT6A 1QVPA 2G8HA 3E9GA 4R56A 3O1BA 2LG4A 1VSIA 5F2RA 1T44A 1MNEA 1O57A 4PJ0C 3LL3A 4BWJA 2NZTA 2OPSA 2EZIA 1N8RO 3RMCA 3HIFA 1S22A 4NDLA 1K79A 4L9VA 5J47A 4OU0A 1WQ7A 3AVIA 2MMPA 3GF2A 1VQMI 2DIGA 3WTYC 4ELYC 1GHCA 2D5RA 2ROLA 2GXAA 1QMCA 3DAWA 1AWJA 4BKXA 1F36A 3G1MA 5M3FJ 2Y31A 5EZHA 4JJNK 2IPQX 3HI0A 1N77A 3CCLQ 2ME0A 2RKIA 3AL0B 1X27A 1QVFS 1AKHA 1EETA 2KMTA 3CUQC 1NYGA 2W1OA 2ZF5O 4NYNA 2LTPA 4W1UA 3CCJT 4IWVA 3JRCA 5BPDA 4M3BA 3D2FB 1PG5B 2PYLA 1KC8R 1HXDA 1QKWA 5CVJA 4CC4B 5CQXA 4CF1A 4JRPA 4B6MA 2XF6A 4IUTA 1UE9A 2XAJA 1RAIB 2E2OA 3LA7A 4L5JA 4KH5A 1MH4A 1JB0E 4JI1K 2MLKA 3FFKB 3JB9I 3SJJA 2FQ4A 2QI2A 4P9FA 2GFAA 1TNTA 1ZQ3P 4S05A 3PX4A 2BGGA 1J5YA 5GMKl 1X1DA 1GLBG 1WIEA 3H0HA 1MDMB 4DR7K 3ZETA 3TOAA 1JE8A 3QPLA 1B07A 2HNZA 1VZ0A 4DJAA 4P1WA 2FU4A 4UY8I 2O8BB 1U0JA 2BV6A 4DF8A 1XGSA 3W3CA 3IC7A 4MQVA 1N27A 4BR7A 1NJIR 1K4SA 2E1MB 3CCRT 1SS6A 2PYJA 1BA1A 2P51A 3G4ST 5F0XA 4IQ4A 2G0EA 2D8HA 3BY6A 2MABA 5ICGA 4C8QG 3KX2A 2F2XA 1KFSA 4M77D 3MMVA 1PJRA 2HL3A 2KT8A 5KYYB 4Q48A 3MXIA 5I22A 4OF1A 4RGUA 4C92G 2EYXA 2P5LC 4EGZA 4J6YA 4CEZA 2GELA 1Q95G 2BVLA 3ZQCA 3RKWA 2NOGA 2Z3YA 2HVQA 5J1EA 4M77B 3L1PA 4C0DB 4F7UB 1K6YA 3C7NB 3JCMg 4RCCA 3OH6A 3TAGA 4M73A 5KRTA 2IAIA 3PMTA 2QWOA 2MPXC 5E1XA 4IIOA 2A68F 2UU9K 3FZFA 3M8SA 3D4VA 2FF6A 1EH7A 2K5LA 1G3YA 2VVKA 5GAN8 2MD0A 3DFGA 5I2MA 3HM9A 4BRAA 3F73A 3E5XA 1X43A 4NL2A 1KU9A 1W0HA 2MCNA 1U04A 4KA4A 3NF9A 1XSXA 4I09A 4XK4A 5FKNA 2BZTA 3O8VA 4B1YB 2JK3A 1U47A 1ZH5A 4LLLA 1KG3A 2F4IA 3B6OA 3CEYA 1WJ5A 1WBDA 1JKPC 1IV0A 5E8GA 2WACA 3CCVT 5H6RA 4FLYA 2GBYA 2EJ9A 3SDGA 1TL1A 2NOZA 5CR2A 2Z1DA 2VCPA 1RABB 5GP9A 2V8IA 4MZMA 3REAB 4IHWA 2CP6A 1GFCA 2O0YA 2QZ8A 3CD6N 2ISYA 2DJNA 1HNIA 2VJ5A 2R93J 3LWIA 2E34A 1QRYA 1LCKA 4P55A 2E20A 4NZGA 5F1XA 2O4IA 2LKPA 2V7FA 4FCYA 4UUTA 3TQNA 2E19A 2PMHA 2B5JA 1YJNQ 3GTGJ 1QSLA 1VQ4A 5CKHA 2W48A 1CKBA 1GOCA 3LQQA 4N56A 2K5FA 1WQWA 2E1CA 1LCUA 1X1BA 3GTLJ 3CCEI 1LFBA 1H9TA 2RQVA 1UHSA 4AFZC 2XDBA 2HAXA 2DMQA 3MEWA 1L3VA 5FLXK 4HA8A 3X25B 2FC0A 3H5AA 4JN4A 3IMXA 1TS9A 2FF3B 1P2FA 2KFNA 4GW6A 3S3OA 3KTUA 4FSXA 1YX3A 3IRXA 5BR9A 3EG2A 2M02A 1A36A 1NK8A 1T0FA 2NOIA 3CPEA 5FLVA 2YHYA 5IYBJ 2D1KA 3W2WA 5FWBA 1SEUA 2O8XA 3K5OA 1I5OB 2HMAA 2V6CA 3CF2A 3AVNA 4B9SA 5DDGA 1C1CA 5GAN4 4HTUA 3ITHA 5EEGA 4N4IA 3NAEA 2OZUA 3VQ5A 4IZ9A 4WFNL 4BE0A 3IKMA 2ECCA 1PP8F 1LEBA 1LWYA 4E89A 4DHYA 1VIEA 3UWNA 4CVNE 4LG0A 1GXQA 2GOXB 2L3DA 3F8NA 1N36K 1VSLA 2D45A 3CJ9A 1UB4A 2ITMA 2ISZA 2MH9A 3AKZA 2V1UA 1DU6A 2EGCA 4LG3A 1U8BA 4F2RA 5ILUA 4E1MA 1YHQN 2P9LA 3JW4A 5JICA 1MNDA 3O1WA 5DV5A 4DUYK 2PX9A 4OMOA 4N9HA 2FNPA 4HQEA 1HC8A 2DTZA 2Q31A 4AU7A 3JV3A 4MDBA 4NCGA 3QWLA 2O2OA 3SI6A 3MZHA 4DFMA 4M3GA 1ORKA 1EA3A 1BI1A 3CM6A 4B3TK 1D0YA 2XY7A 2ATQA 3OBYA 4M78F 4N0AC 4CGHA 3PIOL 5FPNA 1LPLA 1TK0A 2EAYA 5DLOA 2GM4A 3OS1A 3CXCS 1JJ2P 1ETVA 2HYGD 4B44A 1TZLA 2OYQA 2YSRA 1ZBLA 2FZKB 1PU6A 4E7IA 4DR1K 2Y0SN 3I8BA 4HVUA 2PTKA 2ZJQL 4XIUA 1FEXA 1D3BA 2DA1A 4A6EA 1BWFO 4I2OA 2BKDN 4PL7A 1OVQA 2R5ZA 5KH6A 3ZQGA 5CQEA 3NEUA 1SF9A 5HRPA 3S14J 3I55A 4BQLA 1R8OB 1LJ9A 2RHYA 3JCMf 1P7IA 4IJNA 4CI6A 4EQQA 2M45A 3CP2A 2KGTA 3E6BA 1PRMC 2DPUA 5IXFA 4AI5A 3Q9VA 3HJEA 1ABOA 4P9UA 1DJ7B 4FIBA 4AM7A 4HVJA 5IP7J 3SEQA 2A69F 3R9PA 2NVUB 2F8TA 3A98A 5EOYA 2H94A 1VUBA 4CGGA 3E3VA 1AWOA 3MXMA 3QNOA 1IRFA 1K8AO 4JUVA 4XU1A 5ILSA 3ZQLA 3G3ZA 4LF5K 2AQEA 5C0YA 1QVFP 2A7YA 4RB3C 5AZJB 3ZPLA 2QAZA 1S1UA 1GRIA 1FBSA 2I7NA 5DEQA 4A3BJ 3TI0A 3K5NA 5BPIA 2E5NA 1VQ6I 1S9GA 4YPHA 4CEEA 2XIDA 4NNJA 4C8QB 4CW7B 2H6BA 3HBTA 1N78A 4HTLA 4CHYA 3KLFA 2Y4YA 3V8KA 3UKUB 5CJ9A 4OLAA 3VGMA 1YE9A 4DUZK 4A3DJ 2VQCA 1NHAA 1LE8B 2NRWA 5DS9A 3V1RA 4E7HA 5LJVA 4LN2A 2KL4A 2DFFA 1AZEA 2DT7B 2J4RA 4JJDA 3LAJA 7AT1B 4JJBA 4H0TB 1A04A 1PU8A 1J6ZA 4QQDA 3ESWB 3WGIA 2HKNA 4LJZF 2KAFA 4HUFA 4ZN3A 4ID1A 1RC9A 4TSXA 1VQOT 5FRNA 2X4YA 2F6CA 1IUYA 3V7SA 5KN9A 3ZQFA 1ZSZB 3G71A 1VQ8A 1GCQA 2JA7J 1X2KA 1CLQA 2L0AA 2WY8Q 1KC8U 4FK4A 2HVRA 5TGTA 3WVDB 2HQXA 3LSJA 1ZGAA 3CC2T 2NAZA 2AHJB 1KZHA 2A08A 3CCST 3ABLH 1N25A 4L0YB 1JCFA 2F5VA 3TREA 3VJPA 5FWCA 3BZ6A 2P0WA 3DLEA 2RGVA 4BREA 1X1PA 1YXQA 2K9LA 5FPMA 1TT5B 3O9TA 1P92A 2NYXA 2VXZA 1YUWA 1N3AA 1X2QA 1L3LA 2RREA 5GAOm 4AM6A 1JT0A 1CZ9A 3BCBA 3M4OJ 2MK5A 4NLCA 1HQCA 5J26A 3VENA 4CHQA 4IFYA 2QEXI 3BROA 4A3LJ 5ECAA 4X62K 4RUGA 3J80K 2X6WA 4AD9A 1ZUUA 1RT5A 4UVCA 1OPLA 1ZQ1A 1S1TA 3CQ8A 2DFIA 4FQGA 3CWTA 2KZGA 4D0PA 3F0ZA 3HPWA 3QOEA 2OTLQ 1MBGA 1NJIU 1H0MA 2COMA 2JSCA 4LIVA 4BROA 1QVGS 4PLLA 4HNUA 1QO0D 5LLQA 4IO9L 2Z1GA 3LSHA 4QVZA 1YJ9N 5BR8K 1LJOA 4FWPA 3G6ET 4O5FA 2IVWA 4AYBA 1SEMA 2BUDA 1IO6A 1MMSA 3K1PA 3JRHA 1MKMA 4M6VA 4JKGB 3R4KA 4KYWA 3EDPA 1LB2A 2M4KA 3FXQA 2BZXA 3ULQB 1UDLA 3JCMP 1BR2A 4JI4K 1BI3A 1BIZA 2DMTA 5I21A 2G9WA 4BGDA 2ZKZA 1UG0A 4D7MA 2BE7D 1WH5A 3K7AJ 4FSVA 2IC3A 3E97A 2AJQA 3PQJA 4G7ZF 3QPTA 1VQ5T 2K40A 4FXDA 3SBTA 4K0KK 4O5BA 1Q86R 5HRNA 2BYVE 2QSGX 5HK0A 2K3BA 4DQ8A 1VSKA 2ZPGB 1U48A 4GKJK 3O8HA 4XRSG 2P5KA 4FYVB 3CCQA 3FXLA 4PFZA 1WJSA 3RR8A 4NL3A 3H6ZA 3CUOA 1BC8C 1ZC6A 1YJWN 3MK6A 2B0LA 1VQKN 3IAS2 2XHCA 4C8KA 2VUBA 4B4CA 2LRQA 1VRTA 4KHSA 3O3KA 1OKRA 1YQLA 1VSHA 1U5TC 3NBPA 2FSJA 4EMGA 1JCEA 2NOEA 2CT4A 2IXSA 1RRQA 4F3OA 4BRPA 2E5QA 1PDNC 3F23A 2XPUA 1N32K 1I5ZA 5GANh 2MWPA 3HFNA 3RKXA 2XKOC 1ETYA 3LDLA 1REPC 9ANTA 3J7AY 2OTLI 3WU1B 3KP6A 5CPRB 1JGSA 1HYZA 1YO5C 2NRVA 2YU9J 4H4MA 1R71A 4YRVA 3TP3A 2KFZA 4MDXA 3TAPA 3VSKA 1Q18A 5HDKA 3MHXA 5IYDJ 1QLYA 3L3UA 3CO6C 3ZP5A 3BDUA 2WBMA 3RZOJ 2GUPA 1F21A 1RI7A 4AFSC 1J7KA 4B3RK 4S0HB 2BVMA 4HDUA 1SVMA 1YIJQ 2CP5A 1X9MA 3CF5L 1UMQA 3HSEA 3CCUN 3OOUA 1AOYA 2RD1A 3EKSA 4A5AA 3NHNA 4FLVA 2CZ6B 2DA3A 4YPRA 3VQ7A 3MCZA 1BIAA 3AVKA 5C25A 4LFCK 3AVLA 2EZHA 2XMFA 4GBQA 1D1AA 1MMAA 4J6XA 4O55A 1WLPB 5EEAA 3VSLA 3E0JB 2OTJQ 1M9SA 2YRDA 4FJGA 3EHQA 3I56Q 4JHDA 3ECHA 2PUOB 4KGVB 5FFXA 3N4QA 2RE2A 2MH2A 3HTUA 4M7YA 1W2BS 2QBYB 2K2MA 3S9HA 1Y8RB 3VN5A 1H88C 3CXCP 2EIMH 4ZN1A 1NGIA 1K9MR 4B1VA 4BR0A 1K73C 3OYNA 1Q81O 2KBTA 3NVKA 3ZMTA 1NBEB 4LXCA 5JI6A 5AIQA 4XRMA 2D0CA 2HVSA 3GCMA 1YITA 3S1RJ 2AO9A 4OMQA 4BI3A 2MYSA 4MFBA 1J53A 1IXCA 1FP2A 4QLCU 2FBHA 2E12A 3JRIA 5AZIA 5FW9A 3SYTA 3PO2J 2EFPA 2YUPA 2X4WA 2XASA 1HOMA 4Q5SF 2DXTA 3OYIA 3PLAA 3HOZJ 1MDUB 2F5TX 3LALA 3NF6A 2JTMA 1S7EA 4NS5A 2YT6A 4BRFA 4HQMA 3UA6A 3QEIA 4JP0A 2DMNA 4B9TA 4ILHA 4B48A 4BDYA 3M8FA 2M9HA 1K78A 4G6TB 1ZGWA 4JD2A 4I2PA 5D5XB 4EZ9A 4EZ6A 4DR4K 2A1SA 2JHJA 4CC3A 1PU7A 2CW8A 1V29B 1SANA 3FJ5A 1R1VA 1RDWX 2EX3A 4XLAA 3BCAA 1YIJI 3E1SA 4PFOA 4E7JA 3SYZA 4IKFA 3HTSB 3WEEA 2D1XA 4RW6A 3HSBA 2L5QA 4H0OA 3CCLA 1XSDA 4G9YA 2P0QA 1FN7A 3E6MA 2WBNA 3SZGA 4OKJA 1DTQA 4BR4A 4C92C 3R2XC 4A2BA 1HSJA 4NXNK 2EZLA 2OTJI 2H3GX 5AQOA 4EMKC 4BL0B 2RAEA 1ZG1A 4N76A 1KTQA 4HBLA 3ZSZA 1U6ZA 2DJZA 1ATSA 4YNQA 3WE3A 4ISEA 1HNWK 2DYSH 1AZGB 1BCMA 3ULEB 1OPKA 2PQWA 2E2QA 3CO7C 3AVFA 1GOAA 3NMZC 3CC7N 3PE0A 1SZ2A 1HMVA 4A5BA 4F7UE 5FB2A 4RM3A 3AA2A 3IS9A 2LSOA 1H89C 2FD5A 3LMMA 4XL9A 3I0XA 1W7PA 1KU2A 3ZL7C 2DZ9A 4BB7A 1JQQA 2J6KA 2UUAK 1FPQA 2BTFA 4B9UA 1B4AA 3QMLA 2VGMA 2XI9A 3VEZA 2HBJA 2FRHA 5EG0A 4RG8A 1RACB 1ZREA 1B34A 4N0AA 1GLEG 2CV1A 3C6HA 4ZH4F 1QNTA 1U9OA 1MPGA 4JX5A 3B8AX 2XUBA 5D4SA 1D8JA 5I3UA 1WNLA 4M41A 4GFBA 1XC3A 4CJVA 2W10A 4LOCA 3RDVA 4I02A 3HG9A 4UOBA 4FASD 4B9QA 4FJHA 1UJ0A 4LFBK 2ASPA 4U88A 3A8GB 1KAYA 4QS8A 4IXCA 2HDCA 1OV3A 5HBMA 1BOBA 1OCCH 3DBHB 3AAFA 2CGLA 4BQZA 2I2LA 2VG6A 2Y90A 4M74A 5BS6A 1QHTA 1KQ1A 1YRNA 5LJ5e 3CPWM 3SAHA 4DKWA 4XTUA 2FHDA 2WAQA 2P9IB 1VQNA 3SUPA 5FLMJ 1RBVA 1B8IB 4JKDA 3MMYB 1D1BA 1L3SA 5HVQC 1O3QA 3CBOA 4BH9A 2DFEA 4RMNA 1Y39A 5CKTA 1QVGP 2XICA 5LJ3j 3BDPA 2QWMA 4AM3A 4CJWA 4CHUA 2HGCA 4HX8A 4HPQA 3U1KA 2VQLA 3ZSYA 1FX7A 4XH1A 2ZPIB 1XOVA 4CZKA 1S7AA 3KZIC 3PFSA 1W0TA 4M77F 2EYZA 3LGLA 1MBEA 4F7UF 1CZAN 4KHQA 4B3SK 1OCPA 4KMUX 2VN2A 4BY7J 2VIXA 3VGLA 3UR3C 1VA7A 1O75A 3R0AA 3QEVA 4FW1A 4PJOD 3W2AA 1ACMB 3J7AF 3BE3A 4V2FA 1MUNA 4PL6A 5D5VB 4UVAA 4I99C 4E4HA 4WCGA 4CJ4A 1XMOK 3G7ZA 3NCIA 4PJMA 3BY5A 4V2GA 1U2VB 1J5OA 3LX7A 5HY6A 1VQMT 1SSFA 1A5WA 4PJOB 3OYBA 2VQFK 4X34A 4RTXA 3DLMA 2EQJA 3LZJA 4HZFA 1T3VA 3H3OB 3CD6Q 1YJNA 2O8BA 1RBUA 1VQ4N 3RMQA 3L8BA 2E6LA 4QOZB 4B8AB 1A5XA 3H1VX 3A5NC 3FF5A 4CFCA 1BR1A 4RGRA 5FKLA 2VXDA 4Y17A 5FPEA 1WHGA 2GBZA 3ZT4A 5FPDA 2JUGA 1PD0A 4DOWA 4DR2K 3LM2A 1KG4A 1OH7A 1Q86U 1AU7A 1ZARA 2VE8A 1BI4B 2HNYA 3GTOJ 4H8KA 3SV3A 1ETOA 4I7HA 3KTQA 2CYZB 1KSPA 4UV8A 4YFNF 1SFKA 3JCMb 1ZHIA 3BY7A 1JLEA 4JI2K 4PLIA 3TEEA 2IS1A 3FM3A 5GAGP 4II2A 3CMEI 4F7UA 1XQPA 3Q0UA 3C7NA 3OYKA 1C0MA 2M0YA 5FU6C 2LY9A 1H8KA 1BGXT 4DSLA 2FBYA 2CUFA 5EXWA 3UT1A 5GAMj 3P1GA 4RLFA 4M3FA 1B7TA 3I64A 3I71A 2Y30A 1TKXA 3E5QA 2XAQA 4IG0A 5BQTA 3O4WA 3HKZN 4XAXB 2W4SA 2VLAA 4BXFA 1KD1O 3PO5A 4B3XA 2KRMA 3MD2A 2KDOA 3QWXX 4IRHA 4RW9A 3CQTA 1S7OA 4C8LA 3MN6A 1H641 1BOAA 4DYQA 1APLC 4CRIA 1FK9A 3JCMW 3ZN0A 3KZZA 2F2VA 4L5EA 2YNFA 4OAYA 1VQ7I 4HNTA 2GOMA 5JLXA 4ESFA 2EV6A 5KYWB 3LDOA 2IS3A 1YHQQ 3ZMSA 3U6FA 4JX6A 3U9ZA 4JJCA 3CPWA 1GLAG 3CD6I 3FFIA 1W2BP 2O88A 1RT2A 5F1RA 1W36D 1I8FA 4DOVA 1AEYA 3DF8A 3K4MA 4BEHB 4YELA 2BHYA 1HR0K 5HROA 5E79C 4BRDA 2L3SA 4CJQA 2DYIA 4O3MA 1NGCA 3CMAI 4OVLA 3TTDA 1TUGB 1OYWA 3DP7A 2ITGA 1OCOH 5HDNA 2EVRA 5CKBA 2F8SA 4K2EA 1Q7YC 1WHMA 4C8QE 1ZAOA 1VRUA 4YIIA 1VSDA 2MLGA 1UGRB 5JHUA 4DTJA 3R1XA 1Z05A 2OU2A 5DD4A 2A5XA 4C92E 3QLHA 3HTRA 1Y1VJ 2F5EA 4ZYEA 2E5ZA 4HXJA 4CEOA 3LSIA 2Q1NA 1RBRA 2O9LA 1HUXA 3KLOA 2HVHA 4F93B 1I1SA 4D1QA 1PRLC 3FR0A 2A05A 2CKKA 4MMKA 2UV1A 2QK0A 1NYFA 4PKHA 1QCOA 4Z02A 3RPQA 4O8KA 3O2PE 4CF0A 2YLCA 3X24B 1XWLA 3G73A 4N4NB 3AG2H 3TAFA 5D5WB 3BR5A 2E1OA 2XKOA 2Z33A 4DTPA 4YFUA 2JMWA 1KVBA 4HKEA 5GJVB 2NUZA 4IDKA 5K14A 4QKUA 2QQ8A 5AQYA 1LW0A 1IAWA 1JLCA 1UFFA 4CF9A 2CH0A 3BF1A 1PVEA 4KIFA 2CQNA 1O4XA 4AUXA 5AQKA 3LLRA 3S17J 1X6BA 1XG1A 3HB9A 1RADB 1AWXA 2LH9A 1R0CB 4ESRA 3CCET 3CIPA 3SUNA 1K8KA 3R0JA 1PVSA 5E41A 1MJAA 2YUOA 1VQ9N 5C24A 5GTIC 2XF7A 1YHQI 2J06A 2KP6A 1AT1B 1ABQA 4MTEA 3PNYA 1C0TA 3GVAA 4DSEA 2AQFA 2H56A 4G7OF 5F0FA 3MEGA 5ICEA 3GW2A 4PGGA 3QEPA 3TBIA 3BZKA 1T3SA 3CCMT 4XKBA 4D5FA 5TKWA 4FVUA 4E47A 4XU0A 3DMJA 4L18B 2B8AA 2Q36A 5E84A 2ID6A 1ZUYA 2PZSA 4C8QF 1ATNA 4O6JA 3TDUC 4JZ4A 4LDUA 2CO5A 3NTKA 3ASOH 4DSKA 3A0BC 5BPLA 4NC8A 3ZN1A 2A0FB 1RTJA 4GMJB 3D7SB 2DKGA 5KRSA 3C6TA 4HSRA 1J54A 5GAGJ 4CJKA 4KTQA 4BI4A 4KH4A 1NJWA 4GYGA 1ZLJA 4B22A 2MGQA 2J05A 2D1VA 4EAHD 4DR6K 4F7ZA 1GLDG 1LUJB 3RR6A 5J2PA 2Y48A 3V4IA 1OCTC 2X6XA 5LJ5g 3DOLA 2NUPA 3B73A 1TQPA 2VI6A 5BMZA 1IRZA 4PJNA 4W5NA 2BZ8A 4BAYA 1TL3A 2RJEA 2XHBA 3DTIA 1RI0A 3FDYA 2LJ3A 2DRMA 1OPCA 4ILJA 1IV6A 2ZO4A 4Z4GA 2DA6A 1W97L 1SUQA 4ICLA 2HHTA 5H20A 4LMYA 3DLHA 1KAXA 3ZT2A 4JEPA 2RHUA 5JVHL 4Y4RA 1S1XA 3GLXA 4IUUA 1WX6A 5K7HA 1BG3A 5AZJA 3LCNA 3EFRA 1ASVA 3VEXA 1ONVA 5D6YA 3P31A 3NGPA 4DQPA 2DN0A 5LJ5d 1XTAA 4YOUA 1WRJA 3BG6A 1NNEA 3CQYA 4FLTA 4C8QA 1ZX6A 1ETXA 3GUDA 1ZK8A 1A6QA 4FWSA 4J6WA 3HYFA 1IO2A 4OFHA 3ZCMA 3GBTA 1YJ9Q 1VQLT 1VTNC 1KQ8A 1F5TA 4C92A 3O9UA 2CZ0B 4B3MK 4BHCA 3MKZA 1SVLA 4EMKA 2HBPA 3ECOA 2ZPEB 2E1NA 2YRCA 3G1OA 5A2QK 4KGZB 1B72A 3E1YA 3OYDA 4BY6C 1TTYA 4M7DB 2OV7A 1XB4A 2ESNA 2BGCA 2LJ0A 2E2HJ 1ZSZA 2X4XA 4DV3K 4IOCF 2LD5A 1RBTA 1TYQB 5J6XA 4A3IJ 1ERDA 5EX5A 4GV9A 3OMGA 2D8JA 1UA1A 4ILGB 5KPZA 1WLJA 1TWBA 3CDLA 1KO9A 5IT3A 3WTZA 1T6DA 3NQOA 1ZN2A 2M51A 5CO7A 4QW2A 4AHSA 1FMKA 3FC3A 3TOBA 3KIOA 5E20A 3OJUA 1QVUA 2KXDA 3K9TA 3SWNB 1ZBFA 1VQ6T 1YJWQ 1BK2A 1VQKQ 2XY5A 1BCOA 1J75A 4DZJA 1S29A 2PNIA 3RSNA 1T2KA 2E6MA 3IH3A 2O3FA 5C12A 1PKSA 1QQMA 2X6SA 1Y1WJ 3CBMA 1TL8A 3O6BB 2QENA 4YOQA 3EE9A 1TKDA 1S6QA 3TSWA 1SSHA 4OGEA 3KUFA 1C1AA 3MXJA 5GMKe 3VEVA 2IP2A 4CIGA 3I9V2 4RW7A 4XOTA 4EVIA 2BY3A 2YNIA 4X6AJ 3W6VA 3EY1A 4F52A 3VTIA 2JS0A 3HHGA 4F04B 3CCJN 2JRTA 5IT9Z 5KHDA 3KLGA 4UNFA 4BVPA 3OA9A 2HKXA 2EPFA 3HXLA 3DPLC 4JS5A 2W00A 1Z7UA 4BR5A 4OOIA 4IURA 4JKEA 3FKJA 3OWTA 2ELJA 1VF9A 3DWLE 4M42A 3GOXA 3MEEA 1KYZA 1YIJA 3ZSQA 3DV8A 1FJGK 4JKGA 1SD6A 1A5JA 3D5RC 1XD7A 2I10A 3S1MJ 4IUVA 4C5HA 2QXFA 2XU8A 4PSWA 2Q0RA 5K5OA 2ICWG 4ZDOA 3CCUQ 1TUYA 1G8XA 1MIJA 1VSMA 1W70A 5AQTA 2QM1A 5IP6A 1WYXA 2A41A 5L8RE 4D8KA 2OTJA 1EXQA 3OW2A 1IZ6A 1N34K 4GKKK 4E7SA 2XIGA 3I56A 2Z1JA 3EG9B 1R77A 3J80E 5CQYA 1KQ0A 3LNQA 3SMSA 1KQSS 4XRFA 2F4MB 2CREA 3VQCA 2QEXT 2VYTA 1WSIA 3SJMA 5LJ5f 3DXMB 2B6AA 3I3LA 1S1VA 1IUFA 3DB3A 1NKEA 4BRNA 2OI3A 4DYCA 1NMDA 1K7AA 2XHIA 3CCRN 5K7FA 2R7UA 1JKHA 3G4SN 1VQKI 2LQKA 2WV0A 1NLVA 2RV8A 4DS5A 3KP3A