3S3MA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/inhibitor/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3mA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3mA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3mA03
3VQPA 1RDDA 1T7PA 1IKYA 1RTHA 4KHUA 4KTWA 3HVTA 2RHZA 2HHUA 2QKKA 4M3TA 2R57A 4J2DA 3V9UA 2XY5A 1EXQA 2X4WA 3SZ2A 5K14A 1IKWA 1XHZA 3F70A 4C8LA 4Y1DA 3QNOA 3QINA 4B9MA 1JLCA 5CYMA 3NF8A 1QSSA 1OZ3A 4O55A 1RBUA 3MO8A 4FK2A 3OYAA 2FBYA 4CFCA 5HRNA 4DTSA 2KFZA 3S6WA 1L5UA 2P5OA 3K2PA 3SI6A 4B08A 2RJDA 4LD6A 1T05A 3WNEA 3SUPA 1A5WA 1TKZA 4PUOA 4Z02A 4CHZA 2IG0A 4NYNA 1S1UA 4C8NA 4IG3A 4AHRA 4KREA 1BCMA 3SPYA 2GFAA 4ID1A 2DFEA 3NF9A 4LSNA 4N76A 3S9HA 3NH2A 4O0JA 4RG2A 4KO0A 4CHYA 2JGUA 1NK6A 3KD5E 4FJMA 4DLGA 2EKOA 3K57A 3OYHA 3HYFA 2O4XA 3OY9A 2QQSA 2LSNA 4FJ9A 2LVMA 4M3ZA 5SWMA 3PNWC 4CJQA 3OA6A 1BHLA 1HJRA 2EHGA 3OYMA 3TAEA 4CF1A 4KB1A 1IKVA 2W42A 1S6QA 4NCBA 4W5RA 4E1MA 4W5QA 2QKBA 3MEUA 3V1OA 1C1BA 5CZ2A 3S3MA 1RI0A 4O44A 4H4MA 4JLHA 4RW6A 3HP9A 4CHPA 2G8HA 1X9MA 2GUIA 2GV9A 4QCLA 3VQQA 3KK3A 4HVJA 2WOMA 1NK0A 3AO1A 1OYXA 1KVBA 1JLAA 4Q0BA 2E4LA 4HCBA 4J2EA 3OB9A 3DB4A 3P8DA 1HNIA 2ZE2A 2FHDA 1JLEA 1ZBIA 4CCHA 2ZD1A 4FJGA 3VQ4A 1TK8A 4KV8A 2O4GA 1R0AA 2PY5A 1ASVA 1HNVA 1KTQA 4CECA 4FK0A 3UIQA 2F8SA 3S3OA 3U6FA 4F4KA 4DTRA 3DLRA 3L2RA 1I3AA 3LAKA 3OYIA 4OVAA 4AHVA 3EAEA 1DTTA 2E6NA 4CJPA 4DSEA 4C8MA 5HRPA 4F3OA 2D9TA 2KQ2A 4AILC 3SQ1A 1VSMA 3NH0A 3SQ2A 1EX4A 3L2WA 3BDLA 4OPKA 1L3TA 1EETA 4Z4FA 2RF2A 3PUFA 1C0MA 4IURA 2FC0A 3V4IA 3MXIA 2IGIA 5C0MA 3V81A 1NKBA 4B3OA 2P5GA 3DI6A 1UA0A 4HTUA 4ZTJA 4M45A 3WNGA 4I9LA 1LWCA 5HRSA 4B9SA 4LY7A 3PMTA 1C0TA 1VSLA 3RMDA 3G10A 2RJCA 2NUBA 3OS1A 3M8RA 1VRUA 3GOXA 1X9WA 4B9NA 5KTQA 4DFKA 4CK1A 4CK3A 4CF0A 3AVHA 3ZT2A 4FJHA 2X6NA 4QQGA 4CGFA 1VSEA 3ZCMA 2IC3A 2ITGA 4QQ6A 1Q9XA 1KSPA 3AVJA 3ZEHA 2YHAA 4R5PA 2KFNA 3VQ7A 1D5AA 4IUQA 3F9KA 3OJSA 4IUVA 3KKRA 3NFAA 1MHNA 4CJEA 3ZSQA 3LPTA 1D9FA 2BIVA 3AVCA 3K59A 4DQRA 4KPYA 4ELTA 3V9WA 1KVAA 4PA1A 1WAJA 5KCOA 3K5OA 3KTQA 1WNSA 3OMGA 3NCIA 2DTUA 2F8TA 1NK5A 2Z1HA 3CQ8A 1S9GA 5KRSA 2OPPA 2HB5A 2L89A 2DFFA 5KGXA 1VRTA 1ASUA 3PX0A 1U49A 1KRPA 2E5QA 3PV8A 5I3UA 4FLZA 2AJQA 3FFIA 4DQQA 3M8PA 2G3RA 3UWNA 3OYKA 2HQXA 3NF6A 1WGSA 1UA1A 4CIGA 2MWOA 2E6MA 1L3UA 3FEOA 1SL1A 1GOCA 4KKOA 1S9EA 3MEWA 3DRSA 1WSFA 1DTQA 3LPUA 4DFJA 2OPSA 1TL1A 4FLUA 3O8VA 4DFMA 3OS0A 2HHQA 1QSLA 2HQEA 1HRHA 4L59A 3AA4A 3HSTB 4FM2A 4E7JA 4E7IA 2R7YA 4CESA 5D3GA 2RJEA 3LAMA 1TK0A 2GFUA 4DTOA 1ZBLA 2RN2A 3O4NA 4FJNA 4F8RA 1HYVA 2NLUA 2XO7A 1JLQA 4KHWA 4KAZA 1CLQA 4DTUA 3DOLA 3NH1A 4DSJA 2HHVA 4PLIA 1SUQA 3VN5A 3D45A 2LCCA 5KE2A 3DM2A 5M9OA 1C1CA 3SCXA 4OKEA 3KK2A 3HPHA 4NS5A 3KJVA 4HUGA 2YNIA 4O5BA 2RJFA 2YNFA 3K58A 3PFSA 2BE2A 3O3FA 3C4SA 4E0DA 3QESA 1NJWA 4CF8A 1B92A 4PLLA 1XNIA 2RI5A 4CJ3A 3V9ZA 1NJZA 4BD3A 4CIFA 2YHBA 1U48A 4E7LA 4NCAA 3M8QA 2ATQA 1RILA 4W5NA 2BANA 1FKPA 1S1VA 3CM5A 1LW0A 1NOYA 4N4GA 3LANA 2HW3A 1DLOA 1T8EA 4Q5VA 4FM1A 2HVHA 4M3YA 3B6OA 3L8BA 4E19A 1ZYQA 4Z0UA 3V9XA 4CJTA 2O4XB 4AHUA 1JLGA 3K5NA 4BDPA 3H6ZA 3TAQA 3SUQA 2VWJA 5I42A 1RT4A 3NBPA 5C24A 4C8OA 1CXUA 3I0SA 1XHXA 4GW6A 1OI1A 4QVZA 4A4GA 1T03A 1YTUA 3SQ0A 3ULDA 4CEEA 4LSLA 3PY8A 4IFVA 3VQEA 3ZSZA 3L3UA 4KI4A 1HMVA 1W9HA 2F5KA 2VWKA 4Z4GA 4BDZA 3DRPA 3V9SA 5KI6A 3SUNA 3RMCA 3AO4A 3NTKA 3DLKA 4M3XA 4CJRA 1ZBUA 3E9FA 4CGHA 3PO4A 3SQ4A 3RRHA 4MQ3A 3M8SA 4BDYA 4FLVA 2HNDA 4QQDA 2X4YA 5J26A 4ZTFA 3NDKA 3U3GA 1N5YA 3MXMA 1X9SA 2HHSA 4ELUA 4CFDA 3AO3A 1TAUA 4Z4IA 3QIIA 3H8ZA 3L2QA 3OYBA 3MP6A 2RHUA 4CJFA 2G8WA 2HMIA 1HQEA 3ZT1A 1Q9YA 4RG8A 4PY5A 1TV6A 4XIUA 4FW2A 1CZ9A 1TL3A 3MAQA 2OYQA 3JSMA 3T3FA 4HHTA 3OJUA 3P1GA 2KW4A 2QK9A 3AVAA 5EU7A 4KI6A 2R5MA 1C1AA 1D9DA 5HRRA 3P83D 4FLWA 1ITGA 4FM0A 4B9LA 3META 2X35A 4C8KA 3KLFA 4H8KA 2QXFA 4M3UA 3OYJA 3THVA 3HL8A 2Q3SA 3TR8A 1UOCA 4EZ9A 1EP4A 4JS4A 4ELVA 3NNQA 5CIUA 4AHTA 4GVMA 1SSFA 4ID5A 1B9DA 2G8IA 4C5GA 4CJ4A 4CJVA 4A4EA 3ZT4A 2X4XA 1IH7A 3VQ8A 4KHSA 3MP1A 4I7FA 4JRQA 3SJJA 1SKWA 4F3TA 1JLBA 3BGRA 4CHOA 4CJWA 4Z4HA 4FYDA 4FCYA 2F96A 1WSHA 2M0OA 2ETJA 3B6PA 3QIOA 4II1A 2Z1JA 1JXEA 3LP0A 2HVIA 1WAFA 3QERA 4FJ8A 3LP2A 3AVLA 3G0ZA 1TKTA 3T1AA 1NJYA 4DU4A 4HUFA 4CFBA 1NJXA 1QQCA 1KCFA 5DMRA 4G1QA 2R5AA 2XK0A 4JRPA 4L8RB 3KLIA 1VSDA 1OZ2A 3ZSYA 3RMBA 5FDLA 1NK8A 1CXQA 3AV9A 1S1XA 2X74A 3LLRA 1XC9A 3KLHA 3SV3A 1YTAA 4C5IA 1H3ZA 5J2NA 1WSGA 2EX3A 4N4IA 4F2RA 4OGCA 2KZMA 5IN1A 4PQUA 4M3WA 3HK2A 4KHYA 2FBVA 4RW4A 2HHTA 1BIZA 4CRIA 4CJKA 2EQUA 2G8KA 2K3YA 3ZSRA 3NGIA 4K8ZA 1QHTA 4N4HA 1RBSA 1TKDA 2WONA 2JLEA 4CF9A 1BGXT 3NHGA 4DFPA 3QIPA 5J1EA 3K5MA 2L8DA 3LWLA 3PO5A 5C42A 2EQJA 2RPIA 4RW9A 3TI0A 2VYTA 3HXMA 4C5HA 1BI4B 3LZJA 3CYMA 3IRXA 3HVRA 3CG7A 2FBXA 2M16A 3AO5A 2IAJA 1EKEA 4DSFA 4LD0A 4CERA 5FRNA 4NYFA 4NCGA 1QTMA 4LH4A 3SV4A 5FRMA 3D0PA 1SL0A 1U04A 3ITHA 4CGIA 3RRGA 1TVRA 1UAXA 3SUOA 4CEZA 3CM6A 4FL6A 2YKMA 4DQPA 3TAMA 1U45A 2VG5A 1JKHA 4CGGA 3L2UA 3VQBA 3RTVA 5JS2A 2DIGA 1JL1A 1VSFA 2VG7A 3HPGA 4CFAA 3PX4A 3MP8A 3C6TA 4RW7A 3QKJA 4EP5A 1WSEA 3HJFA 1ZBFA 1RT7A 4DG1A 4Z4CA 1N27A 5D6WA 1RBTA 2DY4A 3LZIA 2PYLA 4ICLA 4CJLA 1BCOA 4GMJB 1YVUA 1MU2A 4I2PA 4IG0A 3P8HA 4CHNA 1JLFA 2HNZA 1QS4A 4YFUA 4N56A 1VSHA 1WN7A 1TGOA 3EZ5A 3VA0A 4B8CA 4DQSA 1JL2A 3TWHA 4BE1A 1KHCA 3HP6A 2RI2A 5KGWA 4M41A 5KE3A 1X1PA 2RHIA 2Y1IA 4FU6A 4J2AA 3DLHA 4FJ7A 2EQKA 2A1RA 4CGDA 4CE9A 3TARA 5HROA 2D5RA 1Z26A 3ZSOA 3RR7A 3PX6A 2G8FA 1BL3A 2D0BA 4PWDA 3KIOA 3DLMA 3QNNA 3NE6A 5JS1A 1WLJA 3AVNA 3LGLA 3MEDA 1RT3A 3OYLA 1D8YA 4DSKA 2MWPA 4CEBA 3DRRA 1XI1A 3ZT0A 3ASKA 5SZTA 1CZBA 4DU1A 3LP3A 3RR8A 3AVMA 3DLBA 4AHCA 3Q1JA 3CFOA 1N6QA 3L42A 1Y97A 3OMCA 2RHXA 3SD4A 4CJUA 5D6XA 4FJKA 4DTPA 5J2MA 4DF4A 4CIEA 4CHQA 1J54A 3ALYA 3QEIA 1FK9A 3ZSXA 4N41A 3DOKA 3SNNA 1TKXA 3AVKA 4FJLA 2DIQA 3OYCA 1NK7A 4BE2A 2PQWA 3ZSWA 1KFDA 1C0UA 2O4IA 3LDSA 3E01A 3AVFA 5CY4A 4BWJA 2K3XA 4CJ5A 3WNFA 4HUEA 3OQ5A 4FZXC 4UQGA 3MEEA 4FW1A 3VQCA 2EQMA 3VQ5A 4E7KA 1LAWA 5KRTA 2XRIA 3TABA 3OS2A 3NGZA 3MEGA 4AHSA 4DQIA 1VSKA 3ISNC 1VK0A 2Y1JA 4FLYA 4M3RA 4DTMA 2PZSA 3V1RA 4IBNA 4KB0A 1RNHA 1GOAA 4PL6A 4FZYA 4JS5A 1REVA 4Y1CA 1J9AA 4GY5A 3ASMA 2JZ2A 2IS3A 3OYGA 1VSIA 2YRVA 2R58A 1ASWA 2RI3A 4CEQA 4EZ6A 1L3SA 4K8XA 3C94A 4RW8A 3FC3A 1U4BA 4QAGA 3NGYA 3QEVA 2OPQA 4DS5A 2YNHA 1HYSA 1WJQA 1G15A 4Z4EA 2Z1GA 2VG6A 3FDRA 2YNGA 4DS4A 3C6UA 3QLHA 1YT3A 3NAEA 4CJSA 1G5VA 4IUTA 4WE1A 3O3GA 1K6YA 4FK4A 2E6LA 2OZMA 3DMJA 1NK4A 4IDKA 2Z1IA 1BQNA 3KD1E 2BUDA 3CFPA 3RWUA 3L3VA 1RTDA 3MXJA 2DAQA 3SYZA 5J2QA 2B4JA 1L3VA 1RCHA 4B9UA 1S1TA 4E7HA 3V6DA 5FROA 3TAGA 3LYIA 3AA5X 3RMAA 4BE0A 4NZGA 3O3HA 2X6SA 1F21A 4DLEA 3OVNA 5CYQA 4B8AB 2JTFA 3LWMA 4KHQA 4TSXA 4DMNA 3OYEA 3V1QA 1RDCA 1KFSA 4FLXA 3HPOA 1RBRA 2B6AA 4A4FA 4O4GA 4LH5A 3IAYA 2YKNA 4QOZB 1SL2A 1LWFA 4H4OA 4E3SA 4CEAA 2P51A 3TAFA 5J39A 3T19A 1WSIA 3DLGA 3SPZA 4DF8A 1QSYA 4IUPA 1NKCA 1WJRA 3KK1A 3KUFA 5HP1A 1NKEA 4A4HA 3CFRA 3QEWA 3E9GA 5E41A 3AVIA 2B5JA 4YNQA 4OPJA 1IO2A 3AVBA 4F2SA 1RTIA 1O1WA 4OVLA 1HQUA 2G8VA 1BQMA 4KFBA 2PYJA 3AO2A 4BWMA 1LV5A 1VSJA 1FKOA 1HPZA 1J5OA 3KLGA 2I5JA 1QE1A 3DB3A 1SV5A 3F73A 4FLTA 1S1WA 2KTQA 2ZQBA 1A5XA 2LDMA 2OA8A 2RKIA 2D0CA 3AVGA 5KCHA 5IAYA 1IKXA 1U47A 3VQDA 4B9TA 3M9QA 1RT5A 2GBZA 5C6SA 3H08A 4KHNA 2EFIA 2XY6A 2D0AA 4DSLA 4N47A 4IKFA 3PMIA 3NTIA 4I2QA 3DLEA 3LH0A 1RDBA 4OGEA 3LGFA 3ME9A 4DTNA 3BDPA 2P1JA 2YV0X 2HHXA 4N5SA 3VQ6A 4I9QA 3MEAA 3IS9A 4BACA 4CF2A 2XHBA 1KVCA 3AA3A 1Z25A 5D6YA 3LP1A 2CKKA 4E1NA 4EDUA 1HYZA 4FXDA 3C95A 1WJSA 1RT2A 4OLAA 3K5LA 5HBMA 4FJ5A 2LTOA 1S5JA 3VA3A 2KZZA 2HHWA 3OYNA 3ZT3A 3TAPA 4DTJA 4FJXA 4E89A 3MECA 4OLBA 4FVMA 3VQ9A 3WNHA 2A1SA 4AH9A 1WSJA 3HM9A 4FJJA 1A5VA 1KLMA 4CK2A 1NOZA 3HO1A 2RHYA 5T7BA 4CEDA 3I8DA 4HCCA 4IUUA 2IDOA 2XY8A 5KH6A 1RT1A 2G8UA 2M1HA 1IG9A 5HLFA 3VQAA 3QO9A 1S6PA 4DU3A 3P5JA 4M42A 3QETA 1FXXA 3AA2A 1C6VA 1ZBHA 4B9VA 3ZSVA 1BI4A 2X78A 2QQRA 1RTJA 3O4QA 5J2PA 2IOCA 3EY1A 4J2BA 3LALA 2GF7A 4W5OA 3FLGA 2WACA 4EP4A 1TAQA 4OJRA 1I39A 1TK5A 3I0RA 2OPRA 1SKRA 1B9FA 1LWEA 1RT6A 4DSIA 4Q5WA 3HT3A 3QBYA 3NF7A 3IG1A 4UC4A 4C5EA 3S3NA 5CZ1A 2XDPA 2BGGA 1JXBA 3CEYA 2DFHA 1RDAA 4HCZA 3UT1A 5C25A 1UWBA 4KTZA 2OZSA 2HNYA 3QJ6A 4DWIA 4QW2A 2BKDN 2BDPA 3MEVA 1BISA 3KKSA 2RO0A 3EYZA 3KLEA 1LW2A 4IFYA 3U3YA 3L2VA 4O0IA 3OYFA 4KTQA 3OYDA 3DYAA 1BIUA 4OKKA 4ZHRA 4DTXA 2FBTA 4B9XA 4W5TA 1Q8IA 1NK9A 4B9WA 4X34A 4KRFA 3QEXA 2B8AA 1SKSA 4FJIA 2LRQA 4CGJA 1KLNA 4MFBA 5DK5A 3QEPA 3TANA 1W0HA 3JYTA 4FZZA 2L3RA 2P0KA 4OKJA 4CEFA 1LAVA 4CEOA 1J53A 1RBVA 3A2FA 1XWLA 3LX7A 3NTHA 1GOBA 2XY7A
chains in the Genus database with same CATH superfamily
2VL8A 1FOXA 3K4KA 1ZC6A 3SK3A 5LEKA 4AG1C 3KEQA 3CW7A 1AD5A 2DLPA 3U9GA 3IKVA 1EH6A 2D45A 3FX3A 4M75F 4M3TA 4V19K 1K9MO 1EXQA 2DILA 3JCMW 1D5VA 3FF5A 2OTLQ 4XRMA 3OWTA 4D6WA 3OOUA 1XHZA 1HDPA 4C8LA 2E6ZA 4Y1DA 2L3PA 1BR4A 4BRDA 2YWWA 4A0XA 2HL3A 5LL6S 3NF8A 1DGWY 2Q97A 3CCJN 5HRNA 3OR2C 3S6WA 2VC0A 3DV8A 3SDGA 2ZPBB 4M74A 5F1RA 3K2PA 1YI2A 3B73A 2RJDA 2K9NA 1T05A 3ZRGA 1W36C 2L3QA 4NL3A 3SUPA 2DYIA 1A5WA 1TKZA 4EW0A 3OV8A 2P9NB 2XHCA 2RQVA 5LGNA 3GG4A 4C1NI 1P4XA 5ED4A 3TDUC 1XX5A 2GX9A 3M07A 1BOAA 5FU7B 5HDNA 2M4GA 2XSDC 1FNNA 1BUPA 2FEZA 1IV8A 3SPYA 2R7VA 3BR2A 1VQ9T 5KN9A 2QWLA 2DFEA 1QQJA 2ASPA 4OINF 4RTWA 2P9SB 4A4KA 2HNHA 3EYIA 2QASA 4N76A 3FISA 2ZXHA 2KE9A 4FWNA 4LG0B 2IEKA 1ARKA 2VE8A 3G6EI 4KO0A 4CHYA 1M2OA 3GBTA 1PP7U 1NK6A 3CVTA 3KD5E 3LH5A 3CCLN 1YQAA 1QVFA 3I59A 1M3BA 3BG9A 2CP0A 3RJPA 2ZMEC 5F0XA 4CI0C 2LSNA 2LVMA 3HOZJ 4M3ZA 4Y17A 1AVZC 4CJQA 1K8AO 1D1AA 1HJRA 3OYMA 2F4VK 1NGNA 2EZHA 4JYKA 3NFCA 1X2NA 4LOCA 4GCVA 1Q95G 5B8HA 3SFMA 3DP7A 1ODDA 3PL8A 1QU3A 3DJCA 3D5RC 2QKBA 3MEUA 1NNEA 2KRSA 1C1BA 4AUXA 3S3MA 5GAMd 3DBRB 2KZGA 3TEDA 3M56A 3S16J 3A1PA 2EQRA 4CHPA 2G8HA 3F8BA 3GF2A 3KE2A 1D3BB 2GUIA 4ZYGA 2F2XA 1WCMJ 2NNYA 3ZLJA 4J2EA 3DXKB 1H92A 1YS7A 2CO5A 1AKHB 3OB9A 3IV5A 1TLHB 1RNLA 2NOBA 3P8DA 4J6WA 1TC3C 1HW5A 4NC7A 1VYUA 2AHQA 4IVNA 4PJOA 1JT6A 1T0JA 4E4HA 1ORPA 3CC2T 2ZD1A 2X6XA 1A6IA 2P81A 2PY5A 3J7AY 3GL1A 3K1MA 3VUBA 1VI0A 1B9MA 3J7ZO 1A31A 1HOMA 3CMAA 3X26B 1FBUA 5D5VB 1GVDA 4F4KA 4ELYC 3LAKA 3H41A 4AHVA 3OYIA 4OVAA 2JRMA 4EIKA 4CD3A 2EJGA 1IN7A 4A53A 1I1SA 3C7NA 2R7XA 4IHSA 1PJRA 5GINA 2QGGA 3GTJJ 2UZKA 4XL9A 1X75C 3TOBA 3H92A 3I4MJ 4OPKA 4DUYK 1L3TA 4Z4FA 3MXIA 1P90A 4RA2A 4CCOA 2XKOC 3CCEQ 3V81A 2MFZA 3W3CA 1MH3A 4J9GA 4BH9A 1BL0A 3KXTA 5LLQA 4EM0B 1X4OA 1LWVA 1YS6A 4CCNA 3CIPA 3WNGA 4I9LA 4RB3C 5HRSA 1I5LA 2PAVA 3PMTA 1NG6A 3RYRA 1YI2I 2XAJA 2LBFA 3K70C 4FOEA 5AQJA 2YR2A 3RMDA 2RJCA 2NUBA 3OS1A 3BLYA 3W6JB 2QWQA 5J6XA 1GXIE 1JKOC 3GOXA 5KTQA 4ZZLA 1S72T 1K73C 2OI3A 2GXBA 2R7SA 5CVUA 3AVHA 1V5EA 4FJHA 4B3MK 2D0QB 2X6NA 5D8KB 3HOVJ 5HDGA 4J9HA 2H3EB 3BTIA 3T7ZA 1BBZA 4RTYA 2NRAC 3ZCMA 2BXZA 5IWAK 5AQQA 4ESRA 1G99A 2JM9A 3QB0A 1Q9XA 4KIFA 3JW4A 4IOAF 4RAFA 3FK7A 4OMFB 4R5PA 4WQ4A 1IB8A 5GMKm 4JJBA 3BZ6A 1FMKA 5L3DA 4JP0A 4CBUA 1CGPA 1FOWA 4HF2A 3FHFA 1XCBA 2EYZA 3NFAA 2PBIA 2R7WA 3CJAA 3PIOF 2HQRA 3GOIA 2CZ6B 1D9FA 2AT1B 1TH7A 4L9NA 4XEIA 1N6AA 3H0GJ 5KCOA 3K5OA 2FF4A 2F8TA 5J3BA 5JMVA 4V19S 4N4OB 2Z1HA 1WHJA 3CCVI 3G2BA 3ZOBA 4Z94A 4GKKK 2M8GX 1LVAA 1SZ2A 4K42A 2HQ5A 2ECZA 2XIGA 2NS7A 3JTGA 1OCCH 1VQ6A 2F2EA 3VPZA 1R49A 4DQQA 4J9EA 4I99C 2E2PA 4Z2YA 3DFGA 3A01A 4CYCA 4CXFA 4CIGA 1USSA 4NOYA 4ZYAA 3MPUB 3DCFA 4XLCA 3MEWA 3VYRB 3C6HA 3O8VA 1Y8QB 4GGGA 1QZ5A 3OMYA 3G7ZA 4CC4B 4JLIA 2W84A 2HQEA 4CA0A 4L59A 3AA4A 4CZZA 3M8JA 5C4XJ 4DR3K 5F27A 2MCNA 5D3GA 1TQIA 3WQUA 1BC8C 1X9JA 1AOYA 4IOCL 5LY3A 2DL8A 1NGCA 3OS5A 2MD0A 1ZBLA 2Z2SB 4DIQA 2RN2A 3DF8A 1E4GT 1K8KA 4OU0A 2RQQA 5EY4A 3CCSA 1HYVA 4F8RA 2LJ1A 2NLUA 3QDKA 3JCMJ 3ZEUA 4KRTA 1P9QC 3VJPA 5GAMe 3QZ5B 4D1QA 3Q5FA 1H8AC 4ANJA 1HJDA 2ZM6K 2XG8D 3GCMA 3DOLA 3HOYJ 1UB9A 3PSIA 1KG4A 2GGRA 4FYWB 5ILSA 4PLIA 1D8KA 1U1SA 1RR7A 4EA5A 3VN5A 5AONA 3I55T 1HNWK 2HZTA 1YI2N 1JXMA 2PFBA 2CW8A 2NOGA 3SCXA 2KQWA 5GMKe 4OAYA 4XRSG 2WA0A 1X01A 2HF4A 4BROA 3KJVA 4LUDA 3A8GB 4YEJA 2YNIA 3B6AA 3W6KB 1QQMA 4JK8A 5LHIA 2DU9A 4HQEA 5GANd 3K58A 2FL7A 1XTDA 3CDIA 2EZIA 2J06A 5L8RE 3C4SA 1RAIB 1W2BM 3CJNA 2KMUA 2YX4A 2CV0A 3V9ZA 4XTYA 2YHBA 4M7AF 1U48A 3TW6A 4NUBA 3M8QA 2ATQA 1U1TA 1ZBXA 4KITB 2FZGB 4CUGA 2FNPA 4AIHA 3KYDB 5KYWA 1JB0E 4J7FA 3QHSA 4K11A 1X69A 2Z0WA 2XC7A 4N4GA 3LANA 1OX9A 2HZDA 1F1ZA 4C92A 3EG9A 2NS0A 2HVHA 4Z89A 4IO8A 3I59B 3I5UA 2DF6A 2QWPA 2YI1A 1ZYQA 3SWNA 3WTSC 1UDLA 3CF2A 4AHUA 4BDPA 2HQNA 1JJ2S 4H4KC 4B3RK 1XGMA 2QXLA 5I42A 3K4CA 3NBPA 3G71Q 2RNGA 4BC2A 1CXUA 1XNRK 3ZR8X 3I0SA 3X24B 1ETYA 3BG5A 4S04A 4QVZA 2JW4A 1YTUA 2A36A 1IF1A 5KAIC 3ZMTA 1FIPA 3CERA 4L5JA 3UKUA 5DEQA 1XSDA 2IGMA 1UELB 5KK1A 4C9YA 2MW8A 1W9HA 1NLPC 4Z4GA 4HNVA 1X3NA 6AT1B 4RAGA 1OVQA 3AG1H 4FYYB 3DRPA 3R0JA 1MPGA 4FSVA 3AO4A 1W7AA 1BKBA 2V1UA 4LUEA 4G8XA 3C0BA 1YJNQ 4MGRA 1ZRCA 2OTJT 5AJ3K 2VI6A 1M1KR 2HNDA 1YW9A 3KTUA 4QQDA 1N8RR 4BR9A 2QQ9A 1NPRA 1WXUA 5J26A 2E5LK 3CHWA 3MXMA 5JVTA 1FPQA 2W10A 3TTFA 2OU2A 4CFDA 4PJOB 3H8ZA 3L2QA 1OULA 4W1UA 2RHUA 3RPUD 2RQUA 1RC9A 5KAFC 3CMAN 5B66C 2ZNZA 2HKQB 2RKHA 4YOWA 5C44J 2VQCA 2O01E 2F4IA 1JI8A 2YLBA 1CZ9A 1QGPA 3OW2A 2ZJRL 3ENBA 1R5ID 1HCRA 1U2VA 3CCUQ 3BFMA 4KI6A 4QT7A 5HRRA 1PD1A 3M1FA 4KMFA 1RL2A 3CCSI 3C7NB 3CXCA 1MMSA 4XN0A 3D7SB 4FM0A 4B9LA 4D5FA 2DL4A 1W1FA 5CQXA 3AHUA 2KXCA 4H8KA 1QVGM 4A61A 4LFAK 3FSPA 3FXJA 2DAOA 4ELVA 3ASOH 2HS5A 3MD2A 4WQ4C 1MW7A 1NTCA 1HF0A 4OFHA 4LDVA 1GLBG 3VOEA 5LGTA 3VEZA 2W41A 1ZHFA 3HL2A 1NK3P 1MA9B 4CJ4A 4CJVA 4A4EA 3QPLA 4CI6A 3CDLA 4JRQA 1H9GA 3SJJA 1WOQA 4DV6K 4CHOA 4EQQA 1BI3A 1WLPB 2L9NA 3T1YK 2F96A 5HLHA 3JB9H 4J5YA 2M0OA 2ETJA 2V6CA 1PRMC 3KP3A 2QEXA 2Z1JA 1KYWA 4RGRA 4HF1A 1JXEA 4BHBA 1SFXA 3WUHA 4J8FA 4FJ8A 1YITA 3JCMb 3AVLA 3K1NA 4CCJA 5K7ZA 4IRIA 1M2VA 3C3WA 3BEXA 3HHTB 1BN5A 4U0VA 1WHKA 2E7XA 3GWZA 2YSQA 3G1MA 3CMEQ 2R5AA 2XK0A 3U8XA 3U21A 2M3AA 2OFKA 3SDBA 4MDBA 5AQRA 5FDLA 1JUPA 2JMWA 1QP3A 3ZCOA 1CXQA 4L9TA 2H1KA 2WSCE 4ISEA 1Q7YO 3VS2A 3AV9A 1H0MA 4XRSA 3FXOA 3QXEB 3P39A 2PX9A 2YT6A 4CZCA 3TL4X 5C2FA 5J2NA 1QPMA 1WSGA 2J4RA 1VQNQ 5GAMj 4F2RA 1YFNA 3U1KA 2O8FA 1YYVA 2ABLA 2YHYA 3IH4A 4PQUA 2CUDA 2ZZDA 3TCJA 1OKRA 5GANe 1B4AA 3NRVA 3KCCA 2FU4A 2K3YA 3ZSRA 3DWLA 4K8ZA 3LSKA 3D2FB 4OPHA 4EA4A 4N4HA 1U5TA 4ENNA 2HQHA 4MDWA 2XPUA 2JT4A 5GMKj 1VQ6N 3HSFA 2Y90A 4DFPA 1BW6A 2PEXA 5GAN3 2YUQA 4LF4K 4XQFA 3IKTA 3VTIA 3LA7A 1ZA1B 2W00A 1QMCA 2E60A 2DRMA 2EQJA 2VXDA 2W48A 3HXMA 1ACMB 4DOWA 1ZH5A 3A01B 3SXYA 3CG7A 2CGLA 1RI9A 2XAFA 4PSXA 2FBXA 2OAUA 3PVLA 2NRWA 4X1EA 1NJIR 1WJEA 3HTUA 1Q82R 4XRFA 2QM3A 5FFXA 3KWIA 1JCGA 3SV4A 5FRMA 4KBMB 2LYCA 3V42A 3VRYA 3RRGA 4N4NB 4CEZA 3CM6A 2V7ZA 5DY9A 4DQPA 2FLOA 4BUPA 3TAMA 2BW3B 4I02A 2A69F 3CCSN 4FWOA 3EQLF 3GW2A 2NUZA 2CRGA 2Y30A 2LTPA 1NM1A 3VB2A 2VE9A 4MIMA 3HBTA 3L2UA 1YN8A 1S3XA 5JS2A 2DIGA 3C0CA 1K8KB 3PX4A 3JSCA 3EHQA 3HJFA 1M9SA 4X1VA 3ZEUB 3R4KA 5GAN5 2DTHA 4DG1A 4AFUC 4BS9A 1WVRA 4JI6K 1RBTA 4A2UA 3KBGA 5GANf 3LQRA 2PYLA 5TISC 3O9TA 4DHYA 2YJFA 5ADXH 1BCOA 5BR8K 3VGMA 1Q86C 2IBDA 5AQGA 4FSSA 1V3FA 3JRHA 1MU2A 4I2PA 3P8HA 2RAEA 1N25A 2DPPB 4RTTA 1OU9A 2OAWA 3KNTA 5FWBA 3KYLA 3EG1A 1WQ2A 3E6CC 1RUNA 2GCXA 1YJ9Q 1NBWA 4ZN1A 4E7SA 4UVBA 1UG1A 2JHNA 1QPIA 2Y1IA 3F72A 3NVMA 3FJPA 2KT8A 3ZMZA 1O57A 2BGCA 5DM7F 2EQKA 2A1RA 1JO8A 2YCHA 3TARA 3BY7A 4IEIA 1YTYA 2TCTA 1ZLKA 3ZSOA 1EA3A 4IJNA 4A0ZA 1NLOC 3HTVA 3GLLA 2QEXI 2LNBA 5KYWB 3RR7A 2LC2A 3D5SC 3PX6A 1YITI 2HOTA 4RTXA 3M57A 1TS9A 2D1VA 4PWDA 4M3GA 5BPNA 4HT9A 3MDQA 4M77D 4RLFA 3NE6A 4C92B 2JUCA 1U8RA 3EG9B 1WLJA 4U7DA 1B9NA 3ZX3A 3T8TA 4QPOA 1FYMA 3WXLA 3SWNB 4DSKA 4MO5A 1IXCA 1VQMA 4RB1A 3DRRA 4DBHA 2PMHA 5FU6B 3I58A 4CBXA 1BI0A 3CCET 3JB9J 1Y97A 2NYSA 1LDKB 1YHQA 1S29A 3SD4A 4FJKA 5GANg 4DTPA 4XR6A 1YP5A 1K78A 1DUXC 4BY6B 1P7MA 4DF4A 2QWOA 1K4SA 3UKUB 3K9KA 1F5TA 1ULYA 2KRFA 4N41A 3OL3A 1FSHA 1TKXA 2CP7A 3QICA 1NK7A 3G4SA 2PQWA 2K27A 1I0CA 1T8IA 3ZBDA 1X6OA 1I1JA 1C0UA 4OMOA 2Y9YA 5CY4A 1TWAJ 3CC4A 4EEFG 1NGHA 4CJ5A 5DUIA 3ZN1A 3W3DA 2QA4A 1WKMA 1AT1B 1DQUA 2RNAA 4UQGA 2HMAA 4UV9A 4F55A 2V7FA 2A37A 3O4WA 1WRJA 1S7AA 1W2BP 1YBYA 2A6TA 4X9CA 4IHYA 1TTYA 5I22A 3ZPLA 3G1LA 3SDZA 2XRIA 1Q1HA 4PKIA 1DEJA 2NUPB 4F9OA 5TGTA 1MBGA 2CS3A 4OB0B 4WCEL 5AQXA 5FKMA 2KFDA 3ISNC 1QVFM 2JTMA 4B1VA 4FLYA 3M9AA 3UB5A 3H3ZA 1IXRC 4X64K 4IO9F 1M3QA 2PZSA 2AQEA 1TNSA 5F6FA 5FPNA 1IUYA 3TP0A 2ENMA 1RNHA 3TGNA 1NYFA 1U2VB 2ZSHB 4PL6A 1S7EA 4FZYA 2LMDA 4A3CJ 1LCUA 4RTUA 5HODA 3M0TA 1J9AA 4I7HA 4CCMA 3ASMA 4NNJA 4E6KG 2JZ2A 3CD6Q 1VSIA 2YRVA 3Q0UA 3RDIA 4EZ6A 1VQ4A 4NB5A 1FX7A 2PUKB 4OX9K 2QEXN 2EZKA 1H3HA 2Y31A 4MFEA 1YITN 3K2ZA 1C0WA 1KQ9A 4DS5A 2IXSA 1M90U 1WXTA 3BP8A 2DEUA 5J3LA 5AQMA 4UB8C 2OPTA 3AG3H 1U5TC 4HSRA 4WQ5C 1G15A 3VF2A 3FDRA 4UNFA 4KNYA 2JJ7A 1M2VB 4LFUA 1TT5B 1VQ8A 2P4TA 3C6UA 4PKGA 4Q48A 3PO3J 1YT3A 3NAEA 4B8XA 5IPAA 3JB9D 1HX1A 3KVGA 2KISA 1O13A 4IUTA 4JDSA 3VGKA 1K6YA 2EYXA 2DFIA 3CLQA 4Z8AA 5ICFA 4KBOA 5AN4A 4LFCK 3UDCA 3KD1E 4RLQA 4EMKA 5BPMA 1RTDA 4A59A 4C23A 3RERA 1WJCA 4C8QB 3SYZA 5J2QA 3AAFA 2JA6J 2B4JA 1XJWB 1HBXG 2F5CA 3TBIA 3R3LA 3H9NA 3OH6A 3GXOA 4B9UA 2O8FB 4CYDA 4E7HA 3V6DA 2CUEA 5LD2C 5AQSA 2DD4A 1FLIA 2BY2A 3CJCA 4BE0A 4KGVB 5EYRA 3O3HA 2CS7A 4BC4A 5M5WJ 5LJ3f 2E2HJ 3F0ZA 2KIQA 3PE0A 3OA9A 4DMNA 4DBFA 1D5YA 3F21A 5CVJA 1ZQ3P 3CCMA 1SFOJ 1YCSB 2B6AA 4M7XA 2HHHK 1BYMA 4AI5A 3JB9G 3IAYA 3A03A 4HTLA 3MKWB 2O88A 4DBQA 4QOZB 2AO9A 4XAXB 2DZ9A 1SL2A 1QVGP 4F7UA 2PLYA 5EOYA 3R6OA 3TAFA 1WSIA 2FNAA 4KUMA 2VLAA 2QM1A 3SPZA 1TZLA 4CBWA 1V5FA 4XLFA 5D6FA 2RMOA 4M3FA 2DVJA 1U06A 5B3SH 4XTWA 4KDPA 1VQPQ 1WJRA 5GTHC 3CC4I 1W7PD 3DKWA 1SD6A 2I0NA 1FBQA 3C2BA 5DCFA 3FMRA 5HP1A 4F3QA 1XTAA 2W85A 3L2CA 2V9PA 3CPFA 3QEWA 2QA4I 1EWQA 2D1KA 1VTNC 5L3CA 1KYZA 5E41A 3SHFA 1MSEC 4OPJA 1M1KO 4LLNA 3HGYA 3SBTA 2NAZA 1N8RO 2D0PA 2FF6A 3PGGA 3G71T 4OVLA 3OBYA 2FRHA 1VOMA 2KI7A 3BY6A 2P7CB 2X4HA 3BJOA 1RUOA 3CWSA 1K73R 2PYJA 4M77F 4RCBA 1D0XA 2NVXJ 1D0YA 5KCMA 4DOZA 3AAPA 3ZGKA 3F10A 1NBEB 4JPBW 2XGCA 2I5JA 4NLBA 2O8KA 1S1WA 2KTQA 1KU2A 1M1GA 2ZQBA 3PIPL 2OA8A 2IS2A 2UWMA 1KC8U 2DERA 1BU6O 1PUFB 4H0OA 2Y0SA 1V1CA 1IKXA 4B9TA 2FPFA 2XKPA 3LDNA 5KPRA 2D0AA 4OMNA 3VU3C 1W0TA 5LJ3g 1WFXA 5CKTA 3D4VA 1Y1WJ 2VONA 2ZJPL 1MJ9A 3LH0A 1XDSA 3TO6A 1M1EB 4M7DA 2BE9B 3I56Q 2P1JA 3CCLQ 1VQ4I 3VQ6A 4I9QA 3MEAA 3WTXC 3R60A 4BACA 2I5WA 4BXFA 1Z0XA 1YW8A 5CR2A 2XF5A 1BA0A 3D5LA 4CF2A 3UKGA 4XTUA 1KVCA 3AA3A 1M1FA 4XKVA 2CKKA 1BK2A 1HYZA 3WQTA 5AT1B 3C95A 1WJSA 3K5LA 5HBMA 1TT0A 3BPXA 3VA3A 4A69C 3EEQA 4GV6A 3DXJF 3TO9A 3JCMX 2KZZA 4XN3A 2HHWA 1VQ8I 3ZT3A 3W6VA 1VQMN 1U78A 3PIOA 3CWTA 3CCUT 2DBBA 1LE8B 1RUWA 3VQ9A 3WNHA 2CQQA 1SQKA 5GAOl 3IAM2 3FRNA 4B47A 4J9FA 1WSJA 2A5XA 2DL5A 2LREA 3OIPA 4FJJA 4DV5K 1GBRA 4RGSA 3B8AX 2JVGA 1YHQN 5T7BA 4XBFA 3F23A 3I8DA 4E1JA 2HZYA 3S1QJ 4IUUA 3WU2C 2V79A 2COZA 3JAMZ 1LVKA 1ON1A 2HU9A 2XY8A 2GEMA 3QDRB 1RT1A 2M1HA 2G8UA 1M90C 3DPTA 3P5JA 4JKAA 1K78B 4ME7A 2KIUA 3G4SN 4H0XB 3ZSVA 1BI4A 2QQRA 1FSEA 3P7NA 3CC4N 3H36A 1WHGA 4M9SA 2IOCA 3A8LB 5JICA 1R9TJ 3EY1A 2EW3A 2DTZA 3IAS2 3LAJA 2GF7A 1KU7A 1V55H 3CCMI 2QA4N 3H3OB 4RCHA 3GLXA 5ERIA 1KG3A 3FWEA 2O3FA 5JLXA 1TAQA 3CMET 1R22A 3P4IA 4OJRA 3ULQB 3CC2A 1SG5A 4ILHA 1GLDG 1IZ1A 1S6LA 1U6GA 1LWEA 1X43A 2XF6A 4LDUA 4ABZA 3LSPA 2AZSA 2DTRA 2LRDA 4OIRF 1Y7XA 3FGUA 3L6QA 4QVDA 4IJAA 4KUDK 3QBYA 1SAXA 4M75B 3GDQA 4BVOA 3X25B 3N5BB 1K83J 2BGGA 1JXBA 3JRIA 3TREA 1VQNT 2KHOA 3CEYA 4EJUA 2MIOA 1RDAA 1OCPA 2OZSA 2GM4A 2KKZA 4IHVA 1H89C 1MBHA 3JV3A 1X4PA 3QJ6A 5KYUA 1NGJA 1NJIO 2XGDA 4QW2A 1FW6A 1EWRA 4BC3A 2BV6A 3KLEA 5K7HA 4BNCA 2Q0OA 3LMMA 2B86A 5IP6A 2FXAA 3OYDA 3T1BA 3DYAA 3WT0A 2RK2A 3G6EQ 4C30A 4DTXA 1MBEA 5A2QZ 2MAMA 1Q8IA 2UUAK 1VQ4N 3K69A 1I81A 4EMKC 4M7AA 1SKSA 2F69A 3FJ5A 3EE8A 2I2LA 3VOVA 4YTLA 1FY7A 1WGXA 1O3TA 3HZ6A 3JYTA 3OR1C 4R55A 4FZZA 1T95A 1TU0B 2EPFA 5E8GA 2YUSA 1S72A 3ZQQA 1J53A 3IH2A 1RBVA 3A2FA 3RKXA 2BY3A 1GOBA 2YU3A 2K79A 4LJZF 1VQ8N 2XY7A 4BRLA 4B24A 2QENA 4X66K 1RTHA 2FMYA 3BJ6A 5CCAA 3HVTA 2CT3A 1Y96A 1YFHA 1WDXA 2PZ1A 2K5LA 2V9KA 2QKKA 3TTDA 2R57A 4FPAA 2M0CA 1VQKI 4BQOA 5BNGA 1IKWA 5IP9J 3QNOA 2HBWA 4ILJA 3SEQA 4RMNA 2EAYA 4O55A 1RBUA 3E0JB 2GWRA 4DTSA 5ICCA 4BYYA 1I50J 1SANA 2Q2RA 4B23A 1CKBA 3KEOA 2JWKA 3CJBA 4L5EA 2P5OA 3HIFA 3C18A 3OW2M 2P4RA 4MLOA 5JVGF 2JXBA 3WXJA 2E2IJ 1KQ1A 4CHZA 2V4JC 4NYNA 5ELZA 1QVFP 3ERMA 3QWXX 4BRNA 4EJZA 2PVOB 3CXCM 4EIAA 3JAMO 3G1JA 2P9LA 3CCMN 2O31A 3J80Z 4AHRA 3LSTA 2QQAA 1BCMA 1YJ9T 1PDNC 4ID1A 2K9GA 3NF9A 3GIBA 5CVRA 1APLC 2V8IA 1R00A 4LK0F 1TL8A 3S9HA 1ETOA 1YWPA 4LXCA 1VQLA 1M27C 2VQFK 5IYDJ 2ZKZA 1UZCA 2GXAA 1WHHA 2MC4A 2CUJA 1U84A 4C3JJ 3D2EB 3M53A 2DPUA 4AYBA 2O4XA 3OY9A 4DZPA 1WIEA 4FJ9A 2XGEA 5SWMA 4BRQA 3X20B 4ZGDB 1BHLA 1TG0A 2VKVA 3CC2I 1VIEA 3VEXA 5K5QA 4BI4A 4CF1A 2NVTJ 1IKVA 1HNXK 1M8VA 1VRLA 2DVEA 4M7DC 1S6QA 3VGLA 4E1MA 4W5QA 2LY2A 4XU1A 4KHPK 1YI2Q 1QA6A 3JCMf 5CZ2A 1RI0A 2E2QA 1Z9CA 1JKQC 4L5GA 3FE1A 2QAZA 3O5ZA 5ILUA 3Q3SA 3QJYA 3RYPA 2FBIA 1R23A 3WVEB 2CFOA 1EF4A 2MLGA 2UV1A 4EATA 2P0QA 2MLKA 1DPRA 5M1PA 2ZNYA 2Y0SN 2WOMA 1BWFO 2ESNA 2FEIA 5EC7A 4XTXA 4PGGA 4EM2A 2E3HA 5A2QO 3LOCA 3O8HA 3ROUA 2VQEK 1OEBA 1ZG3A 1F4KA 3M8EA 5I2MA 5GMKl 3BQYA 3A8MB 4PJ0C 1W5CC 3CF5L 3ZMSA 3BT9A 4QPQA 1YRNA 2RVCA 3JCMV 3OL4A 3KZBA 4JD2A 1ZUKA 4KV8A 4EGYA 4JUVA 2O4GA 1SD7A 5E20A 3VS3A 3NHNA 1ASVA 3I54A 1HNVA 2LJ3A 4FK0A 3UIQA 3M8FA 4A12A 1S72I 1JHFA 2GQVA 3AG4H 2KY9A 3FHZA 4EVVA 1I3AA 1R1UA 2V26A 1ZKGA 3F9MA 4DV7K 3CCVQ 5GAN7 1XGNA 2E20A 1GLNA 5H20A 4CC7A 1LFPA 2STWA 4EHUA 5KVRA 2D9TA 3WODF 4ZZDA 3FMQA 4L0ZB 2KQ2A 5TKWA 3VEYA 4AILC 2DA1A 3KZIC 3TMOA 3CQXA 3SQ2A 1EX4A 1R8OB 3L2WA 3BDLA 2R7UA 2EFWA 2G7HA 1O7FA 2LFBA 2HOAA 1ZR2A 2IGIA 3A5ZB 3SZGA 2DMUA 5C0MA 2DE0X 1HQCA 1D4XA 2QWNA 1NKBA 2P5GA 3RQIA 3DI6A 3CD6T 4LF5K 4UV8A 4HTUA 1YUWA 2M9UA 4JK9A 4ZTJA 3W2AA 3JCMg 2WUSA 1TXQA 3K9JA 4GNIA 2NRTA 4KH4A 4B9SA 3LDOA 3JAME 3THWB 2HKNA 1NGBA 3J80O 1VQ7I 1X3WB 2ZC2A 2HTSA 2H8RA 3G10A 1O75A 4RB2C 2FX0A 3M8RA 2OTJA 3P38A 4B9NA 4MNUA 4DFKA 4CK1A 2VKDA 4CF0A 5ICEA 2C06A 2EKHA 5C12A 1UJYA 3JAMK 2QW9A 2UXXA 2HVSA 3CC2N 4HCKA 1VSEA 3MX2A 4NC8A 3QYEA 1ZBJA 2XRNA 4IRHA 1VQLI 3CVSA 1Q86R 3M59A 1KSPA 3AVJA 2K9LA 5A0DA 3BZKA 4HF0A 3TU4K 3BCAA 1SFEA 5JLHA 1BOBA 1RDUA 4IUQA 1Z1DA 1BOTO 2LF8A 2Y4YA 3OJSA 1WJBA 4IUVA 3JRGA 1GBQA 2P8TA 1AWOA 3JSPA 1R59O 3EUHA 2JS0A 4I09A 1RKTA 3ZSQA 3ZMUA 1KIKA 3LPTA 4M78F 4BRAA 2BIVA 2E65A 4KPYA 2VC1A 1Q81U 2DPNA 4PA1A 1WAJA 4PL7A 2CZ0B 4GKJK 2GA2A 2DTUA 2DODA 4E70A 4YOVA 3GTMJ 2F9TA 1H8KA 4D0PA 5KYUB 1ZA2B 1R4NB 2QTVA 3FZMA 4BAYA 1P6RA 1VRTA 3MVPA 4AG2C 2WBNA 4XH5A 2UUZA 1KRPA 4B48A 5I3UA 2AJQA 2W57A 4ASNA 5B1AH 1JJ6C 5A2QE 2BZYA 3PIPF 3UWNA 4AIDA 2RA2A 2HQXA 4UVAA 2K4BA 1UA1A 1TYQA 2MWOA 4PL8A 2BUPA 3FEOA 3CO7C 2MGQA 1S9EA 4M7AB 3DRSA 2HKXA 1W36D 1K73O 5F04A 1TWBA 1DTQA 1MWMA 4DFJA 1S72N 3J8AA 4RGUA 4DFMA 3DXMA 2DMPA 5A2QK 3ZQIA 2HHQA 2PVDB 4G7ZF 4DZJA 2OZ6A 2EFNA 1VQPT 2JWLA 3QBWA 2DDBA 5K5OA 2W0ZA 1ZSZC 5FGMA 2P6SA 3LAMA 1TK0A 5LJ3h 4DTOA 2I7PA 2LDUA 2E1CA 2JJ9A 4QIWN 3O4NA 3CQYA 4FJNA 3QG1A 1N32K 4BY1J 1JLQA 3IUCA 3CUQC 2ID6A 2QSFX 1KSWA 1CLQA 5FFZA 4CZFA 1ON2A 2ETHA 4LD5A 4DTUA 2V6EA 5GJVB 4DSJA 2A5WA 4GV3A 1XGOA 1UGRB 1YJWT 2A6EF 2HGCA 1IW7F 2L3DA 1VQOT 5LGUA 2KAFA 4LK1F 4Y52J 2NRRA 1N78A 3KLOA 2NRXA 3DM2A 4LC9B 2QUFA 4CW7B 2EYQA 4OKEA 2JSCA 3HPHA 1GLEG 3FZFA 1LUJB 2VCPA 4HUGA 1KQSA 2ED0A 4O5BA 2RJFA 1HC8A 4L3QA 4J7IA 3PFSA 2Y75A 4BR2A 2IPQX 2BE2A 1W4MA 5HCKA 3UA7A 1DDNA 3WU0A 4E0DA 4G6DA 3J80E 5DS9A 1N36K 3RVCA 4BD3A 1RFQA 1T3SA 4NCAA 2YHWA 4ZNXA 4F7ZA 1VQLN 2W6LA 4W5NA 2E2JJ 3TQ7P 3I56T 3CCLT 2ZAEA 2L7FP 4EVIA 4C3IJ 4WF2A 1FKPA 3O3KA 3CMMA 4MEYF 1D0ZA 1JKRC 1DKGD 5FLVA 4R56A 1LW0A 3J80K 1NOYA 3M7GA 3INZA 3Q0VA 2R7DA 3FFKB 4MQ9F 4FYVB 3CCSQ 1DLOA 5M1OA 4C1NK 2NZTA 2DOFA 4DJAA 1XSXA 1HKBA 2O8CA 2M0MA 3V7SA 3L8BA 2ZB9A 4YPRA 4E19A 4Z0UA 3V9XA 4CJTA 2O4XB 2XICA 2DTIA 4HQMA 2PG4A 1ZHIA 2AQFA 4FWQA 3H6ZA 1ZR4A 3TAQA 3SUQA 4B44A 2EVRA 2VWJA 1RT4A 1T6SA 4LLGF 2KR3A 2F6CA 3QYGB 2DOAA 2K9QA 4AI4A 2D5VA 3ULDA 4CEEA 4AF1A 5A0GA 1W2BS 2DMNA 2TDXA 4IFVA 1H1VA 3IHUA 3ZSZA 3V7RA 4BREA 1B8IA 4KI4A 2XPVA 3CCQA 3LCNA 5BRFA 5CHZA 3C65A 2JWTA 2X0LA 1OV3A 2ZBKA 2VWKA 3LFUA 4M9ZA 2ZPIB 1NU0A 4AFZC 2IA0A 5KI6A 2OFIA 4K0KK 1X2KA 3NTKA 3WTZA 2HYJA 3DLKA 4M3XA 3L00A 4WFNL 1X1AA 4OB1B 3PO4A 4NC6A 3SQ4A 2XSJC 1MNEA 2VV5A 1J6ZA 2O8XA 4BDYA 3OW2P 4G6TB 4RDUA 2X4YA 4HLXA 3U3GA 1X9SA 3L1PA 3O8GA 1IG7A 5LJVA 3OYBA 3LSMA 2VJIA 3HDDA 2HI3A 4PSWA 1YRNB 3E5UA 2DYBA 4JD2B 3VYSB 4E2FB 4KA4A 4L6V5 3A1YA 1SVMA 1Q9YA 2P4WA 1SAZA 1Q81C 3NMZC 5IT9O 1WUAA 3REBB 1TV6A 4JI0K 4FW2A 3MAQA 4XMYA 3T3FA 3OJUA 3BC8A 3AL0C 1TUYA 2KW4A 2QK9A 2QDYB 3AVAA 3HFOA 2O8DA 3H0IA 1D9DA 3V8JA 3E3VA 1KD1U 2XVCA 2JRTA 4OB3B 4YY3K 2ZPGB 4AFSC 4LE9A 2WADA 2O9SA 4G12A 2QXFA 2DW4A 4HNTA 2JVHA 3OYJA 3THVA 3RQ4A 3HL8A 5H6RA 5MLCQ 4JS4A 2ID3A 3CCEA 3FZLA 1U9OA 3FM3A 1YQKA 3G6ET 3FZHA 2EQIA 3WVDB 3F6VA 2BVLA 3ULEA 2AZVA 5JFRA 1ZBSA 1TWCJ 2YHTA 4C5GA 3CPEA 4G94A 1Z9QA 1LWYA 2X4XA 2P9IA 3EUHC 3PNTA 3KLNA 3MP1A 3VQ8A 3HOTA 2WFBA 4F3TA 3JTHA 1JLBA 2E1OA 4JZ3A 1OLTA 4Y7NJ 4CJWA 2X3WD 1UHSA 4FCYA 3M4GA 2DXCA 2OTJN 5F0FA 1WFWA 4OIQF 3ZQHA 3B6PA 3TPQA 1BO5O 4JN4A 2DJNA 4J01A 2HKOA 2KBTA 4XU0A 3LP2A 3T1AA 3GE1A 3GTLJ 1NJYA 3O9UA 4XU2A 3LDLA 4A93J 1QQCA 1R0CB 4BRGA 4AIKA 1MD0A 3WTYC 4JRPA 2E1MC 1E6HA 8AT1B 2C0IA 3MAJA 4IOAL 4JI1K 4Y3OA 1OZ2A 1Y71A 4H0YB 3ZSYA 2DA3A 2GBYA 5CKEA 3QWYA 3TSWA 1S7OA 1ZG1A 1ORNA 2DPDA 1N75A 1QVGS 2GA1A 1XC9A 4GDFA 1OX8A 3SV3A 2GZWA 4C5IA 3PIOL 2IJLA 1V4TA 4AD9A 1MMDA 3E19A 4CZGA 4M3WA 3HK2A 4FM4B 4RW4A 2V75A 4A6EA 1LPQA 4OMLA 2ISYA 4CRIA 4CJKA 2EQUA 3IWFA 2EV5A 4HYEA 5J1UA 1OISA 4JKDA 1D3BA 1KFZA 2JZYA 4CF9A 5M5YJ 5GAN2 2YS9A 1BGXT 1LFUP 3K5MA 1A5JA 2K3BA 2CYZB 4PUSA 3LWLA 1RZ4A 1IXSB 3A0BC 5C42A 3CCQI 2QEXQ 1J9IA 3TI0A 1VA7A 1YITQ 4C5HA 4PKCC 5E3LA 2NRZA 4BHCA 2QWRA 4XLPF 1J7KA 4CC3A 1LDJA 2VT3A 2OANA 1AWXA 4ZDLA 2DA9A 1CF7B 3GBQA 3AO5A 1KG1A 2IAJA 4MZMA 2WC9A 2RN7A 2WC2A 4JV5K 3AGRA 3COAC 3CC7A 4EGZA 1J5EK 5LBQA 4NCGA 2D0OA 2E35A 3ULRB 2DT7B 3DXMB 5CVIA 3SUOA 1QW1A 1S1NA 1Y0NA 5AQHA 3ERED 3FIFA 1OH8A 4CJ7A 3MJXA 1U45A 4J9CA 3IUOA 1KAXA 2PBDA 1IDZA 3NEUA 3K4BA 1NM7A 1M90R 3CI5A 1VSFA 2HXIA 4X6AJ 1YIJA 2IRFG 3HTSB 4EJTA 4RW7A 2CG4A 1UE9A 3LL7A 1C0FA 1ZBFA 4PJOE 3HYIA 1JT0A 3LZIA 2Y2ZA 1J09A 3A2KA 2K5FA 1QWEA 2NRVA 1IRFA 5IT9K 1IC8A 4BI3A 4MDXA 2ZO4A 1YVUA 5IP7J 3CP8A 2HNZA 3R9PA 4QTRA 1PUEE 1QS4A 1OJLA 4B09A 2JG6A 4FASD 5CAIA 4YFUA 3SYTA 4PJOD 1WN7A 3EZ5A 3BTJA 3CCJI 4A3DJ 3CETA 3VESA 2PMZA 3FM5A 1DGRM 4C0GA 3SBGA 4M3EA 1KAZA 4BE1A 2W1OA 3HP6A 2RI2A 5KE3A 2DX1A 4A3JJ 3ML6A 5F1XA 5DM6F 3DLHA 4FJ7A 1MJAA 2X51A 4CE9A 3PFIA 1K76A 2P9PB 3JCMh 3GEZA 1TP4A 2VT2A 4DYRA 3ZXSA 1IBLK 5E79C 3KPHA 3ESWB 2R5YA 2V1NA 1JHHA 1NK2P 1BDGA 2DT6A 3UPUA 1BL3A 1IV6A 2WY8Q 2P84A 3E9PA 3KIOA 1KD1C 3ZQLA 2L9VA 2FBKA 4KFCA 3CCVT 2CGPA 2O8CB 3T1HK 3MEDA 2ZPHB 1RT3A 1MUDA 4IHXA 4QWQA 3VENA 4PJOG 1X3MA 3HM8A 2MWPA 4BRIA 3CZ6A 4AVPA 2DN0A 1KU9A 3PFYA 3ZT0A 5I11A 3ASKA 2E2OA 4DU1A 2OZUA 3K10A 1YG2A 3RR8A 3DLBA 5FKOA 5HS7A 2OJ2A 3CCQN 3WGGA 5EEGA 3MKYB 1Q86O 3K4LA 1LCKA 4UB6C 3KHYA 4QSHA 3LNQA 3F22A 5D6XA 3EE9A 1DT9A 2EB7A 1EH7A 2O9LA 2MK5A 1OH5A 5J2MA 2A40A 4CHQA 1FBSA 3QEIA 3LA2A 3FHGA 2CREA 1G8XA 3NWSA 3SNNA 4FJLA 4IQJA 3OYCA 1W1WE 3BQZA 1KQ0A 2GQIA 1VQ5A 2YLCA 3BCBA 3EGXA 2O4IA 3FXLA 3RKQA 3AVFA 2LZ6B 4BWJA 4FT8A 3GZ6A 3WNFA 2LVSA 3IL2A 1ZELA 2XD0A 1I07A 1JBMA 4X9DA 2LQNA 1P4AA 2CGJA 1FN7A 5LHGA 5FU7C 2YUPA 1OYIA 4RAZA 4BGAA 4XNFA 5GAN6 1FT9A 1J2XA 3SQNA 3IKMA 5HKCA 1LAWA 2R7RA 4I98B 1ERDA 5E1WA 2KYMA 3TABA 2JMCA 3CC7I 3OS2A 3MN7A 3EUAA 3S2HJ 2K85A 4IIMA 1PVEA 3VETA 2JUFA 1Y6IA 3NWTA 4M3RA 3G3ZA 4Y91A 4DTMA 2BOLA 2IS1A 3CCUA 4L18B 2O61A 4FOIA 3G1OA 4MTEA 2O8DB 2LP5A 1REVA 1YIJI 2M02A 3JRBA 4Y1CA 3VEVA 3FBIB 3CCEN 3LSHA 3S15J 3EG3A 3QAHA 2IS3A 2I7NA 4P5OA 4HX8A 3WEEA 3J7AF 3DLLF 1BR1A 1ZG5A 1SAUA 3ULEB 2QSHX 4B3XA 4K8XA 1Q1VA 2IVMA 3L0QA 2CZ1B 3T9NA 1ZK8A 3EFOA 1Q7YR 4ATOA 2P9IB 2H6BA 2QA4Q 4KYWA 1UUEA 3FC3A 1QZ6A 1N9SA 2YNHA 2EFQA 3CCRA 1MIJA 3GFIA 3BY5A 2W25A 2Z1GA 1QVFS 4HV6A 4D7MA 3VEOA 2LT1A 5DYMA 3QLHA 3CMEA 4JQFA 5M1FA 3A8OB 4AT1B 1BJAA 5ILVA 4KMUX 4JYAK 1XC3A 1G5VA 3MK6A 1UTIA 4WE1A 3O3GA 2VQHA 3H9GA 1WJFA 3MMYB 1FP2A 2VGMA 1XS9A 2W04A 2HYFA 2RQRA 5EF6A 5E84A 1MNDA 4ON0A 3L3VA 4BR0A 1I6HJ 1VQNA 3MXJA 4PJNA 2DAQA 1Y07A 5CHIA 2NRHA 1RCHA 1ORKA 1RESA 5GPAA 3O6WA 1PNJA 2GIZA 1S1TA 4GYGA 1N5ZA 7AT1B 4M77B 4LDYA 2O0YA 4A63B 2F1LA 4NZGA 4C92E 1WEIA 2QI2A 2X6SA 3S41A 1EV7A 1ZUUA 2JM8A 2IVWA 2JTFA 3HPWA 1W97L 1VQ4Q 4MLHA 4MMLA 3KK7A 4MHGA 1NGGA 4TSXA 4H0VB 3OYEA 1XSVA 4FLXA 3H6EA 5DCMA 4A4FA 2TRTA 1ETQA 4O4GA 2H8HA 1T56A 4C92D 3N97A 3ABMH 3F8FA 3M1EA 3GP8A 3LDQA 1DIZA 1IZ6A 4CEAA 3DEWA 2DETA 3R6SA 4YOUA 5J39A 1T98A 3T19A 3EGDB 3CC7N 2NNNA 3QFPA 1VQ8Q 4IXAA 3DLGA 2E3IA 2KLAA 2DI3A 1QSYA 1VQ5I 5A0LA 2IVOA 2HBLA 5CKFA 1QHGA 3CCST 3KK1A 3P9KA 5IHKA 2I5UA 3KUFA 4AU7A 3KZYA 3K4MA 2ABKA 4J9BA 2L9RA 2HSPA 3E9GA 3B02A 2R0QC 2F4OB 2B5JA 4YNQA 5DDGA 1UEBA 4NHJA 4YFXF 2DCEA 4WX9A 1YIJN 1FYNA 3KFWX 3RDVA 3ZMVA 2VBZA 3AVBA 4F2SA 4A3MJ 2DO7A 3GYHX 5IXFA 4PFOA 2G8VA 2QCOA 4A5BA 5B5EC 5CQGA 2C6YA 3RBBB 2W4SA 4XKBA 3JRFA 3HOXJ 1VSJA 4C92G 4JAXA 5GAOp 1DJ7B 1X2MA 3U23A 4MO4A 5EEAA 1QE1A 3DB3A 1SV5A 2JPSA 5J1YA 3IRQA 3F73A 1PD0A 1IRXA 4YPHA 1M3HA 3CCMQ 2LDMA 1A5XA 3U4LA 1HKQA 1WHMA 2O8EB 2D0CA 3AVGA 4ZGJB 1WX6A 1T0FA 3O8MA 4H5NA 2PMZN 3SAHA 3VQDA 3M9QA 2ZGWA 1RT5A 5CE3A 2OCCH 3H08A 4ZN3A 1WI7A 1UAAA 3VKIA 2E1HA 3VS0A 5DUKA 4DSLA 1WI9A 3E5QA 4IKFA 2X1EA 4BY9C 4CZJA 4J6XA 3NTIA 5DM7L 1Y57A 5IOYA 1QHHD 1C6VX 1RDBA 3LGFA 2EJFA 2V8JA 3HRUA 2FE3A 2VQLA 1GV2A 2NNWA 4ZYDA 4F92B 3CPWP 5M1NA 2PUOB 1SRMA 4CDGA 3GTQJ 3DAWA 2FBHA 1MBFA 2QG9B 2RK1A 5D6YA 1RDWX 1NE8A 5GIOA 4FXDA 3HSBA 3CCRI 5D4RA 5BQTA 2GTOA 4JZ4A 5F1JA 4HA8A 2R5YB 2EH3A 2QQ8A 1H9TA 4CICA 1DU0A 4M71A 2CFXA 2D2WA 3OYNA 1XMKA 3HJEA 4M78A 1H88C 1HNZK 4FVMA 4C0FA 5F2RA 4LF7K 2P9UA 1M1KU 1V4RA 3VS4A 1SD5A 3TDZC 2HMPA 2XMFA 4JI8K 3HM9A 4J83A 1N8RU 4K43A 1Z77A 3LSRA 4BEHB 4BU2A 1LQ1A 3OTOK 4BRCA 3D2FA 5IXBA 4UHTA 3MZYA 3IDHA 1NGIA 1NMDA 2RHYA 4CEDA 4EV0A 1Z05A 4HCCA 3VS6A 2QTDA 2KXDA 2PI0A 2IDOA 3RMSA 5M5XJ 2KMTA 2JA2A 2PJPA 4V2GA 3CO6C 3PIPA 3VS5A 2HOSA 1IG9A 5HLFA 3LL3A 3TSPA 1K0XA 2Z16A 3QO9A 1IG8A 2ZCFB 1I5OB 1HKSA 2MG4A 3C7JA 2STTA 2K5IA 3AA2A 2EZLA 1G59A 1PVSA 1VQ5N 3VDXA 2X78A 4JOMA 1KQSM 5J2PA 1UGQB 4JX6A 4J2BA 3DTEA 4PCQA 4C2MJ 1KA8A 1B34A 2COWA 3RI4A 4WCIA 4M7YA 4PJMA 2BHYA 3HEFA 1FIAA 3VS1A 1VQKQ 1MWKA 3EGXB 5GAEP 4QVCA 3DWLE 3EFRA 1X3UA 3VFZA 1I39A 2RV8A 3I0RA 5KYYA 1B9FA 5AFUA 2VPRA 5I21A 3FHNA 2BW3A 3M6GA 2HVQA 1A04A 3I0TA 3SZPA 3UNGC 1FJLA 5M1QA 3DU5A 2DL3A 3KFVA 3M4YA 3HT3A 1AA7A 3TKYA 2XDDA 3MN5A 1QCFA 3NF7A 1IHWA 4BQZA 2KRHA 2NLXA 5BN8A 3S3NA 3A02A 4IO9L 2KZVA 1MDUB 3CMYA 3OBWA 2H8WA 2P9KA 3CCUN 4FL9A 3CMAI 4E7ZA 1NGDA 2F2VA 1FZPB 3C2HA 1GLLO 2QQBA 4EJYA 2ZCWA 3WTTC 1RADB 2RO0A 2K3FA 1PKTA 5FKKA 3U3YA 4O0IA 3OYFA 4KTQA 5LRSA 4U87A 5LJ5h 1KG5A 2OCEA 1ZLMA 4JI2K 3CD6A 3IMXA 4ZHRA 4DR7K 1K4TA 1I27A 2M4KA 1PRLC 1BM9A 4B9WA 1M90O 3QEXA 3MEXA 2B8AA 3WEEB 4FJIA 1YITT 2RE2A 4CGJA 3K1PA 1XB4A 1KLNA 5DK5A 3QEPA 2YRCA 2LKXA 3X2QH 5FPDA 1SSHA 2KDOA 5J40A 2L4AA 1K4US 1YX5A 2K2VA 5EX5A 3CC2Q 3CCRN 3PSFA 3EFOB 5CK9A 4BVPA 2DJZA 2DA6A 1NGFA 1REPC 3M0QA 3CWUA 4JBAA 3VYGA 3GO5A 4KICA 3CMEN 3EKUA 4PK4A 4HXJA 3VQPA 1J75A 2CQ7A 3HFNA 1XG7A 1O3QA 4KHUA 2BXYA 3BG7A 4HOBA 1RAHB 3ZMDA 2HHUA 2XY5A 2X4WA 3SZ2A 2I8DA 4BC5A 4OWRB 5K14A 4N9HA 1MGQA 3F70A 5C10A 5GAMf 3KP5A 2ZXWH 1M30A 4JRKA 1MNMC 3OH9A 5FPEA 1JLCA 1HSQA 5DPKA 4PJOC 5AQOA 4HV5A 1WXBA 4FK2A 2FBYA 4CFCA 5CKBA 3FKIJ 3CESA 1L5UA 1OR7A 1FMWA 1U3OA 4B08A 4LD6A 2KIFA 4WYBA 3WNEA 2CUFA 1Q82U 4PUOA 5K5RA 2CUBA 2DNUA 2JMAA 2E36A 4BRPA 3IH3A 2K4YA 1XN7A 2QZ8A 1S1UA 3CQZJ 4C0DB 4C8NA 1W70A 3O5BA 3WXMB 2JOYA 4KREA 3I5RA 2OC6A 2UUCK 2DYRH 3D0SA 1V76A 1Q81R 4JLGA 4JJCA 2N8GA 2LCSA 1S72Q 5DCMB 2PVGB 2QK0A 1WH5A 4A57A 4O0JA 4RG2A 1VQ6I 2JGUA 2DK8A 1YO5C 2LP0A 1YAGA 1T33A 4FJMA 3SFIA 2EKOA 1GFCA 4EAHD 1W5TA 5L23A 4XTZA 3OYHA 3HYFA 5HDKA 1SEMA 4DUZK 1T0FC 1VQPA 5M3FJ 2QQSA 2X85A 3S1NJ 2NUPA 1J3TA 5FJ8J 2Q31A 3PNWC 1IAWA 5GADP 3E6BA 3RTRA 3W2WA 3OW2S 3TAEA 3BR5A 4KB1A 1KQ8A 1XDUA 2AXLA 2RPNA 2LOOA 1MV3A 1ACIA 4W5RA 4JKBA 1VYTA 1ATNA 1J5YA 1R1TA 3ELKA 1VQ7Q 3V8KA 1KC8O 4B21A 2EYYA 1YJWA 1TWFJ 4Z6YA 1ABOA 3PM1A 2OA4A 3QP5A 2EA2A 4H4MA 1R4MB 1VQOA 5GAMg 1GXQA 5JHUA 2MC3A 5HNHA 4RW6A 3HP9A 1ETXA 2G7UA 1DPUA 2VGNA 3H45C 5JR3A 2X48A 3E2UA 3NVKA 2K40A 2GV9A 4QCLA 3KK3A 2KRCA 1XQOA 1NK0A 3AO1A 3GNGA 2A5YB 1KVBA 1JLAA 4Q0BA 3GTPJ 4M78C 1VYVA 5EEHA 1VF9A 1VQLQ 3WTVC 4ZYHA 2G9WA 5E1XA 4ENJA 2KNBB 3DB4A 2IGNA 1UGVA 2L2OA 1Y0UA 4TV7A 2JN6A 3KEYA 1R5GA 2FHDA 2BTFA 4FE7A 3I56A 4CCHA 4FJGA 3VQ4A 2GELA 4CO8A 3WXIA 1TK8A 4A3LJ 1IDYA 3A98A 1BW5A 5FWCA 3M54A 3QOEA 3I4PA 2L5QA 1KTQA 4CECA 3JREA 4BQQA 3S3OA 2WAQA 3U6FA 4QS8A 3L2RA 2HEOA 3EAEA 2VJJA 2E6NA 2QTXA 4CJPA 4DSEA 1U2WA 4C8MA 2DBKA 1S8NA 5HRPA 1F36A 2OTLT 1QO0D 4C8QA 1NLVA 2HBJA 5BR9A 3M0UA 3VEPA 5ECAA 1R7JA 1XG1A 5AQUA 1NEBA 4M78B 1EETA 2X1CA 1A36A 2UXDK 4I0BA 3V4IA 2P9UB 3NARA 1YLFA 3FIWA 3FK6A 2VB6A 4LGWA 1IRZA 1O9SA 4H0PA 4BRFA 3GUDA 5GPCA 4M45A 3H9JA 4ENMA 4MO7A 1NZ9A 4BRKA 2JTVA 3MHXA 4OFEA 1PYVA 1KAYA 5JLFA 1BI1A 1G2BA 2DO3A 1YIOA 3GPLA 3OIOA 3ID6A 1PSEA 2M7AA 2QA4T 1ENHA 2RM4A 1VRUA 1X9WA 4HNUA 5HL7L 5F64A 4CK3A 2Q36A 2M8EA 4LDWA 3ZT2A 1RPWA 2LKSA 1QKXA 3TW7A 4QQGA 4CGFA 4C2TA 4H5VA 1KZHA 1B34B 2DOEA 2FF3B 2E12A 1P4WA 2QWMA 2CSOA 4D9JA 4ZDPA 3PTAA 1OPLA 3HHGA 3HOWJ 2KGTA 1MUNA 3ZEHA 4G7HF 5KYYB 3ZQ7A 5E17F 2KFNA 1MMAA 1ZAOA 1D5AA 1BBYA 3L4QA 1NG9A 3H1VX 3F9KA 1R1VA 4BR5A 2RREA 1R71A 2VN2A 1BIBA 3KKRA 1JKPC 4F7UE 4IZ9A 5AIQA 1MHNA 1Y56A 3QODA 4CGZA 1VAZA 2JA5J 1Q82C 4FO0A 2VKHA 3M0SA 3AVCA 2HQAA 3K59A 4DQRA 4AM3A 3V9WA 1HXDA 1WZOA 3IQLA 3FR0A 2VBYA 3KTQA 2P9KB 4JI4K 1AWCA 2ZJQF 4EMSA 1NK5A 2BBYA 5AYFA 3CQ8A 1S9GA 5KRSA 2EV6A 1XD7A 1N3CA 4C92C 3TEEA 2HB5A 2C0OA 2L89A 3CD6N 3WE2A 1PUFA 4ITVA 1YJWI 2E5QA 5JI6A 3SWNC 1VQOI 5KQ8A 3GTGJ 3G6EA 2LCLA 1RABB 2G3RA 2VQGA 1WBBA 2XASA 5L3EA 4O3MA 4XTVA 1KD1R 4EJOA 3OYKA 1G3YA 3NF6A 4D5CA 1WGSA 1S22A 5FU6C 5K1YA 1IRGA 3JRAA 3TO7A 2GAUA 3SAFA 1SL1A 2COMA 4KKOA 3A8HB 5HK3A 1OR7C 3O2PE 5BMZA 1WSFA 3LPUA 2OPSA 1TL1A 4FLUA 4ISFA 1VQ8T 2LY9A 4ESFA 4N9IA 1LMZA 4ILGB 4A2BA 1QSLA 4O8KA 2AKLA 3QO3A 4JK1X 5DV5A 2HR3A 4BY6C 1M3CA 5FW9A 1HRHA 2NVQJ 1EO1A 2XKOA 1HA8A 5LJ5j 1FC3A 3RSEB 2VBXA 1CKAA 3DQVC 2EK5A 2GQQA 5E3MA 1NWKA 4LDXA 1TSFA 2GFUA 1KQSP 5GAOr 3DU6A 2J6FA 4JKHA 5BPIA 4F7UG 4KHWA 4KAZA 3MKZA 3AFHA 1U8BA 2BY1A 1T0HA 1RRJA 1LE8A 5FD5A 5C0YA 3R1XA 3NH1A 4I6ZA 2BZ8A 3H3NO 4M7DE 4YIRX 1SUQA 2LJ0A 3S17J 1KQJA 3D45A 1XUPO 2YHXA 4YFNF 5JVGL 2VODA 5GAEJ 3OYYA 4JKGB 2RGVA 2VXZA 1H641 2RHKA 5M9OA 1C1CA 5TJJA 3SEZA 2CV1A 1TW2A 5KQDA 4NS5A 5FD6A 3U9ZA 3CCMT 2NS8A 1JJ8C 2QF7A 5EZGA 5BS6A 2YNFA 4FYXB 4M7DD 3F8MA 3O3FA 2OUMA 1I8FA 3QESA 1NJWA 4CF8A 2O03A 1B92A 4KH6A 2HTJA 2RI5A 4CJ3A 1NJZA 4CIFA 3VPRA 5L3BA 4E7LA 2OAZA 1RILA 1X6GA 4KGXB 3QYHB 2BANA 3M3ZA 3WHBA 1V4SA 1UHMA 4FE4A 4BJ6C 3ZX0A 2YRDA 1XCVA 3CM5A 3I3LA 2IIMA 4BRHA 2I10A 2VKEA 1IO6A 2L7KA 3QOPA 3TSUA 1K73U 2LLKA 3RNJA 2RNJA 1VQPN 9ANTA 1D1BA 3MWMA 1LB2A 3KP7A 1T8EA 5FLMJ 4OMQA 2VWBA 4Q5VA 4FM1A 2H56A 2HCKA 4M75A 3MN6A 5K7FA 3CJRB 2R5ZB 1ABQA 2D8HA 4B3SK 4F16A 2D1HA 2FQ4A 1YNZA 4K25A 4PJJA 4M7DG 1ZARA 2ADUA 1WSUA 4XLEA 1U9NA 3GX4X 2AS5F 2IS6A 1VHXA 4II2A 2LNHB 1YJWN 4P9FA 3A5LC 4A4GA 3SQ0A 2CQNA 1IUFA 1VQON 5GAHP 4LSLA 1KEAA 1TBXA 1ETWA 3PY8A 3L3UA 3FB9A 5LJWA 1RGIA 1HMVA 4M6VA 1CSKA 3DLLA 1WYXA 4AVZA 2NXNB 1FTZA 4OF1A 3QPSA 4BDZA 3SUNA 5J47A 2GIVA 1MBKA 1ZBUA 4YOYA 4C8QC 4MQ3A 2F5EA 1YX3A 4FLVA 3LSGA 2OJED 5GAOq 1EH8A 4O8UA 4EMHA 4ZTFA 2ZXIA 1VQKT 1WEGA 4JX4A 3I56N 2GBQA 3RZOJ 1RACB 3AO3A 2VOPA 4Z4IA 1I1GA 2QYOA 1HQEA 3ZT1A 3TSZA 3I8BA 2WAQN 4IF4A 1HKCA 5GAGP 2E1ZA 3HUGA 5J8CA 4E6RA 4M7AE 2UXNA 1WJAA 4XIUA 3CBOA 1JTYA 2WAEA 2DMTA 2Q1ZB 3CCVA 1UJ8A 2JQ7A 3P1GA 2L7ZA 2EA4A 3GZ5A 2DD5A 4ISGA 5EU7A 5I9EB 1B72A 5LMUK 1C1AA 5IYBJ 4HX7A 1HPMA 3A4CA 1B07A 3ISPA 1RKWA 3UATA 3CCQQ 2KP6A 2X35A 3EUKL 2MH2A 3KLFA 4M7AD 3IRRA 4M3UA 1ZQ1A 2DL7A 1PHTA 4IEEA 4U0YA 2Q3SA 3TR8A 4EZ9A 1EP4A 4YRVA 2PJRA 1VQMI 2MH9A 2L2PA 4PJLA 3NNQA 5EGOA 2KHMA 4DYCA 4GVMA 3EL2A 1F43A 3F8CA 4A2AA 1SSFA 1WZ2A 1ITYA 3S32A 1X3ZB 2LG4A 4IQ4A 3KETA 2FYKA 2O5RA 2OV7A 2CV2A 4KHSA 2GWJA 1SKWA 5GADJ 2L4MA 4DV4K 1SMYF 2ZMEB 2CSQA 2K5CA 4Z4HA 1YHQI 1WSHA 2F2WA 1RRQA 4O5VA 3IFRA 3EYYA 4F7UF 1ZRDA 2H94A 2MPXC 4II1A 3QIOA 2WV1A 2HVIA 1WAFA 5AQYA 3QERA 2D6FA 2M34A 5JVHL 4DU4A 2CQKA 2WWYA 1P7IA 4HUFA 4DQ8A 2COBA 4CFBA 1KCFA 2YJEA 1A35A 3D2EA 5DMRA 3KP2A 4J8OA 3VODA 2IS4A 3G4SI 1ZGJA 1VSDA 3RMBA 4M7AG 1IHVA 5CPRB 2Y48A 1QZZA 1ETVA 1Q81O 2BE7D 5H2FC 2X74A 2P0PA 2QKMB 2K57A 3KLHA 3CJQB 4G7OF 5IH2A 3O9SA 1H3ZA 5C15A 4NDLA 2L01A 1D1CA 1STZA 2VXFA 4OGCA 2KZMA 5IN1A 4LB6B 3CCJQ 5CQYA 9ATCB 1RAAB 4M73A 2VVKA 1QWFA 4XLAA 2IIRA 3F0CA 3I0XA 1BIZA 1B3QA 3MN9A 1GFDA 4YOXA 3KX2A 2VJ5A 1IN4A 2M87A 3MN2A 2X6OA 1TKDA 1UHFA 4XLNF 2RH2A 2JLEA 1OVYA 2ECBA 3G6EN 2MI6A 3MFKA 3NHGA 1JTXA 3QIPA 3TTCA 3L09A 3F6OA 2IPOB 3VRZA 4FT4A 4RW9A 3LWIA 1YJNT 3D7EO 1O4XA 1FEXA 5EVZA 5GAMh 3FBNB 3CYMA 3RCOA 1XQSC 1QLYA 1I3QJ 3HVRA 5D5WB 5EJCA 1VQ9A 2EGEA 2M16A 4M7DF 2NVYJ 3ER0A 1WI3A 4A54A 2ACJA 5FKLA 2E8AA 1R0BG 4DSFA 1PU7A 4LD0A 1P2FA 5FRNA 2XPWA 2R4GA 1JUSA 4LH4A 1QTMA 1NGAA 3ITHA 4CGIA 1WJDA 3GFMA 1TVRA 1UAXA 1ZREA 1LWWA 2E88A 1R58A 3CBMA 3ZQCA 4J00A 5GMKh 2RB6A 5GIPA 1W0UA 2LQWA 2NOZA 3WGIA 1FYKA 2VG5A 3M55A 4MZTA 4CGGA 2DA2A 4JI5K 3RTVA 1USTA 3HPGA 3QMLA 4CFAA 5M1KA 2O6GE 3E5XA 3MP8A 3C6TA 5AQLA 3NAUA 2QBYA 5BOXA 4IIOA 4R0KA 1N27A 5D6WA 1VQ7T 3CPWS 2DY4A 3K9TA 1LNXA 4ICLA 4HAMA 2L0KA 2BTTA 4EPCA 1OCTC 2VYPA 2DMOA 2UXCK 3S93A 3DKYA 3MWPA 3JCUC 4IG0A 2CH5A 2KT0A 5EG0A 1JLFA 2CP5A 4CHNA 4M75C 3FDYA 1GT0C 2ELHA 3CJ9A 3WTWC 2CJJA 2WAFA 1VSHA 4N56A 3THWA 3VA0A 2BHZA 3HRSA 4DQSA 1PG5B 1VQLT 2VUBA 1SRLA 1K61A 4JJNK 3TWHA 1K79A 5KGWA 1QNTA 2XF7A 4LMYA 1X1PA 3CC7Q 5F08A 4FU6A 3H1QA 1B7TA 3PJRA 2HSTA 4CGDA 2DLLA 5HROA 4GLMA 2D5RA 4BQAA 4FWLA 2QSGX 2XAQA 4WF9L 2V52B 4N0AA 1QVTA 3IHOA 3AGKA 4B1RA 2G8FA 2ED1A 1P8ZA 4BJTA 2DA7A 2D0BA 4EFHA 4N0BA 2CH4A 1YIJQ 2NYXA 2X9DA 3QNNA 3AG2H 2LSOA 3AVNA 3LGLA 2A28A 1SPKA 2UXBK 1ZSGA 1TNTA 3OYLA 4E9FA 5LFAA 1D8YA 1UG0A 2NOLA 1NPPA 4FSXA 2LC4A 1Y8RB 2ZJ2A 5KYXA 1XI1A 4BXXJ 3TVTA 2B9SA 2WSEE 5SZTA 1CZBA 2PNIA 5AQZA 1X1CA 2UYTA 4H5TA 4BG8A 2R3SA 3P31A 3JB9F 3AVMA 5EG2A 1N6QA 3VYTB 3OMCA 1VZ0A 2D4WA 2M7BA 2RHXA 4A5AA 2JPBA 3X28B 4CJUA 2FB7A 2Y69H 4M63C 4LF8K 4YOQA 3N5NX 1GLAG 1K7AA 2PN6A 3K4NA 1SMTA 4BR7A 3QUIA 3REOA 4UY8I 4HT8A 1UJ0A 1FK9A 1GUUA 3BF1A 3LQQA 2E5ZA 3HRTA 4PKHA 2MD5A 1YQLA 2CQXA 2GOMA 1KFDA 3BG6A 3O6BB 4BHPA 1SD4A 3LDSA 2R7ZJ 4BRMA 4HSBA 1HUXA 3ZYYX 4FX4A 1HK9A 4HUEA 3JSOA 3GTOJ 5AQFA 4A6DA 4NO7A 4QLCU 3ABKH 4KJZA 2HBKA 1LDDA 4RKUE 1VQ9I 3IH7A 3I0WA 3VQ5A 3GMEA 4DR4K 4MTDA 4AIAA 2JA7J 1SF9A 1KD1O 1AZGB 4AHSA 1FYLA 4P1WA 4DQIA 2DT5A 2EINH 4G9YA 5AIPA 2ASMA 4D7NA 4KIBA 3CCVN 1POGA 1JJ2A 1VSKA 1MKMA 1JCFA 1VK0A 1AZEA 2Y1JA 3HUGB 1HKGA 1SVOA 2HVRA 4IBNA 4KB0A 1GOAA 3N4MA 1QRYA 4ZDOA 4GO1A 2A0FB 1B72B 2L02A 2QGFB 1KC8C 4DR1K 3WU1B 2A6AA 3NQOA 4GY5A 3SLCA 2NOHA 3PQJA 3K7AJ 2R58A 3VS7A 3BPVA 3I9QA 1Q86U 4YORA 2P6TA 3DBHB 3SB2A 4CEQA 2PJRB 1JU5C 1VQ5Q 4JK7A 4NLCA 5GAN4 3BF3A 4A3BJ 5EGOB 3Q7CA 5CO7A 2JPCA 2W40A 2DYSH 3C94A 3OSGA 2B0LA 3VYUB 2HXOA 4RW8A 1QZEA 4UXNA 5C2DA 1U4BA 4KH5A 3LFKA 3QEVA 2AA4A 2A7YA 3AARA 2LX9A 4GFBA 1T6CA 3U9DA 4Z4EA 5GANh 2IGKA 5GAHJ 1NEGA 3THKA 2AP1A 2YNGA 1GLCG 2WB1A 2P5VA 1X2QA 1PU8A 2M0YA 4HRIA 4ESJA 3C12A 1AHDP 2BEOA 4I01A 4L9JA 2XDVA 4BJ5C 5AZIA 2A3SA 4FK4A 3ABTA 1I4K1 2E6LA 3DMJA 2OZMA 2EIJH 4U7BA 4M9XA 1KG6A 2JHJA 4YELA 1NH3A 2Z1IA 1KU3A 1WHLA 5I2SA 1YXQA 2UU9K 3CFPA 3RWUA 1UB4A 1K9MU 4II3A 2NOFA 1L3VA 3QQAA 5J4YA 2WBMA 2IA2A 5FROA 2EBPA 1IGNA 3LYIA 2E4HA 1RAEB 1F21A 4DLEA 3OVNA 3CJ1A 3I55A 4B8AB 4Q5SF 2SRCA 2M9HA 1DU6A 1MZBA 3SAGA 3ID8A 4LIVA 1WBDA 4CZIA 3FZVA 1QCNA 2C0TA 4X62K 3HPOA 1D3YA 5GAGJ 5LHHA 1RBRA 1N3AA 3N05A 4DR6K 2IW5A 2LBFB