3S3MA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor/dna
molecule keywords PFV integrase
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3mA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3mA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3mA03
4FZZA 4B8AB 2Y1JA 1C1AA 1NOZA 2XHBA 5J2MA 4PL6A 4FJ5A 3RWUA 1HMVA 1W0HA 2FHDA 1HYSA 3MXIA 1WJQA 1KSPA 4E1NA 3KKRA 1VSEA 3AA2A 4QVZA 2G8IA 1WLJA 4CHOA 3OYLA 4FJXA 3NGYA 4DTPA 3KK2A 3KTQA 4LSNA 1BHLA 4CJ4A 4L8RB 1D8YA 3O4NA 1ASVA 3LGFA 3PX4A 1NK7A 4IUUA 3AVAA 4FLTA 2HHTA 4DMNA 3H8ZA 4FLYA 1L3SA 2QK9A 3CM6A 3K57A 4PA1A 5KI6A 4EDUA 2EX3A 3KK3A 1JLAA 1Q8IA 2Z1HA 1CZBA 4F4KA 2FC0A 4OJRA 3HPGA 1KTQA 1LAWA 3PMIA 4B08A 3ITHA 4FU6A 3NGZA 4AH9A 1IKVA 4FLVA 1XI1A 4NS5A 4IKFA 4KTWA 3L42A 4ICLA 5HRRA 5IN1A 1C1CA 1NJYA 4DSIA 1LW2A 5KE2A 3VQ9A 3OYDA 3ZSWA 4KREA 4MQ3A 3K5MA 2PQWA 3SI6A 3ZT2A 4DSEA 4OGCA 2BKDN 4BE1A 3DYAA 2A1SA 1BQNA 1VSLA 2P5GA 1NJXA 3MEUA 3EY1A 2G8FA 3T3FA 4DSJA 3LYIA 4YNQA 4FJNA 2AJQA 1RBSA 2JGUA 2KFZA 2JTFA 3NTIA 4M3YA 1RT7A 2XY8A 4C5IA 3L2WA 2MWPA 3RR7A 3DLBA 1U49A 1JLQA 3AA5X 3L2QA 2DFEA 1EP4A 2F8TA 4QCLA 1VK0A 3KIOA 3SUPA 1CXUA 4Q5WA 1J53A 3QKJA 2JLEA 3V9ZA 3DB3A 5HRPA 1J5OA 4FLUA 1SKRA 1IKWA 2GF7A 1ASUA 4GY5A 5CIUA 2RPIA 3B6PA 4Q5VA 1S1XA 5J1EA 3SQ1A 2DIQA 2HNZA 1SSFA 3NAEA 4PY5A 4Z4IA 5D3GA 4CFAA 3O8VA 1TL3A 1ZBUA 2OZSA 1HYZA 1IG9A 2M16A 1LWCA 1OZ2A 4O0JA 1T7PA 3V9UA 4CJVA 4DTNA 2X6NA 2EQUA 4RW4A 4CHYA 3SV4A 3HXMA 2RJEA 2HHSA 4O4GA 4I9QA 4JRPA 4X34A 3ZT1A 1GOCA 4DFKA 1YTUA 2X74A 1BI4B 1RTJA 1ZBLA 3ZCMA 4CEAA 3VQBA 3OJSA 3SUNA 3WNGA 4JLHA 1TKTA 4IBNA 3ZT3A 3ASMA 4ZTJA 3AVBA 4ZTFA 4A4EA 1KRPA 4FL6A 3AO2A 1R0AA 1TK5A 5FROA 4CEZA 4E7KA 4CK1A 3ZEHA 1N27A 1VSKA 3ZSYA 4GW6A 3LZIA 4CJ3A 1BIZA 4DQPA 4ELUA 4HCBA 4RW6A 1RTHA 2YRVA 3VQAA 1WSIA 3WNFA 2B6AA 5I3UA 2YHBA 1U4BA 3ULDA 1NK8A 1KVCA 4ELTA 4CJRA 2RHYA 3NGIA 4W5NA 3MXMA 3KLEA 1RDCA 4BDZA 3QIOA 3OA6A 2E6MA 2YNHA 4DFMA 4NCGA 2HHXA 4IFVA 1VRTA 5M9OA 3NCIA 3M8QA 5JS1A 1KFDA 1RBVA 2Z1GA 3SUOA 3D0PA 3ZSOA 3F73A 3HJFA 2HHWA 2HHQA 4UQGA 3UIQA 3OYHA 1S1VA 2IGIA 2YNIA 1SKWA 3DB4A 3OJUA 4FK0A 2BDPA 4I2PA 2KFNA 2YKNA 4DG1A 2ATQA 3KKSA 2E6NA 3AVIA 4F3OA 1X9WA 4FJJA 4KO0A 1C0MA 2BE2A 3L3UA 1HRHA 4E7HA 4DQSA 1HNVA 4LH4A 5EU7A 1D5AA 2O4GA 3RMCA 3S3NA 4GVMA 4DTJA 3NF8A 4FJMA 5C42A 2F96A 2DTUA 3OYMA 1L3TA 3OYEA 4II1A 2MWOA 4DFPA 3ASKA 3K2PA 2KZMA 3HVTA 1JLGA 4CEBA 2WONA 4AHSA 4EZ9A 4N56A 5K14A 4KI4A 4A4FA 2IC3A 3P8HA 3MEDA 1J54A 4KHYA 3T1AA 4B9TA 3MEGA 4KHWA 4NYFA 4FXDA 3KLGA 1TVRA 1UWBA 5C25A 2IS3A 4QW2A 5D6YA 4KV8A 4E19A 1LWEA 1YTAA 4FM2A 4DQIA 3QJ6A 3AVCA 2RHUA 3M8SA 1D9FA 2O4XB 4LD6A 3HT3A 3MEVA 2X35A 3V81A 2RJFA 3AO3A 4FLXA 5D6XA 1JLBA 4CJLA 4FK2A 3MEWA 3DOKA 4AHUA 2BGGA 3QEVA 4CEEA 2OZMA 5CYMA 3OMCA 3AO4A 3MAQA 2B5JA 4BACA 3LP3A 4JS5A 2NUBA 3MP8A 3QERA 4J2DA 1S5JA 3PX0A 1SL1A 3O3FA 1J9AA 1VRUA 1MU2A 1T03A 3LZJA 4C5HA 3OVNA 1WAFA 4AHCA 1HYVA 1RTIA 1U04A 2XK0A 1QSLA 3OYAA 2K3XA 1WSGA 2IDOA 4JRQA 4IG3A 4HVJA 1RBRA 4MFBA 3RRHA 1KLNA 4C5GA 2D0CA 2LDMA 3V1OA 3QINA 3JYTA 3IG1A 4E3SA 3PV8A 2GV9A 3G0ZA 3BDLA 3TAQA 4F2SA 3VQ5A 3OS0A 1WSJA 3PO4A 1VSHA 4DS4A 4DQRA 1TKDA 1I39A 3QEWA 1RTDA 4DTUA 3QETA 4B9UA 3SJJA 3VA0A 2GFAA 4PWDA 1TGOA 2M0OA 2O4XA 4CGDA 3AVGA 1NKBA 5CYQA 4KHQA 4M3UA 3PNWC 3OY9A 3L3VA 4OKEA 4CHPA 3NBPA 2XY5A 1NJWA 3EAEA 4LY7A 3NHGA 4Z4FA 4FJKA 3V4IA 4BWMA 2Q3SA 3MXJA 2D0BA 2EKOA 4L59A 4G1QA 1A5VA 2PYJA 3RMAA 1UOCA 2RN2A 4BDPA 2DAQA 2IOCA 3U6FA 4FLWA 4CCHA 1LAVA 3L8BA 3VQ6A 4HCZA 4CJQA 4B9WA 2RHXA 1KVAA 3DLEA 2RJDA 3V6DA 4M3WA 2O4IA 4M3ZA 1KHCA 2F8SA 3OYBA 4DLEA 1A5XA 3KJVA 1NK0A 3AVHA 4CK2A 4CFBA 3VQDA 3IS9A 1RBUA 1XWLA 4CJKA 4C8LA 1QHTA 1TV6A 2R5MA 4DTXA 2YKMA 1CZ9A 3C95A 1NK5A 3EZ5A 3P1GA 1L3UA 3DOLA 3QNNA 4NYNA 2LSNA 5J2QA 4DF4A 4I2QA 4BD3A 1T05A 4FVMA 4DS5A 3SQ4A 2GBZA 3OYGA 1G15A 3CG7A 1BISA 1RT2A 2QQSA 3P8DA 4LH5A 5KTQA 1OZ3A 3QO9A 3E01A 1WGSA 3JSMA 4FJIA 4OVLA 1Z25A 2X6SA 4CJTA 4FJGA 3HSTB 3O3HA 1HNIA 3T19A 3FDRA 5DK5A 4CEOA 2P1JA 1QE1A 1SUQA 2XRIA 3LPUA 5CZ1A 3VA3A 2RJCA 1N5YA 1RT4A 3VQ8A 4FZXC 3VQCA 3HK2A 3ZSQA 5T7BA 1MHNA 2R57A 4FJ8A 3M9QA 1JLCA 2EQJA 1HQUA 3NTKA 2VG5A 1UAXA 3FLGA 4UC4A 4CK3A 4H4OA 4A4HA 3LWMA 4Z02A 1JLEA 2HHVA 1BL3A 3U3YA 2YHAA 2HVIA 3DLMA 3NDKA 1XNIA 3OYKA 4CF2A 3K58A 4RG8A 4KB0A 4TSXA 1CXQA 2BANA 4EP5A 3VQPA 3VN5A 3TAPA 4FYDA 1OI1A 4FJ9A 3LGLA 1VSFA 1SL2A 1RDAA 4DFJA 3S9HA 4Y1CA 1UA1A 4J2AA 3PX6A 1L3VA 3KLIA 2R5AA 3PUFA 4C8NA 3FFIA 3Q1JA 1TK8A 1B9DA 4AHTA 2HQEA 4IUVA 4DU3A 3PO5A 4CGGA 4W5OA 2RO0A 3KK1A 2XY7A 3HYFA 4QQGA 3PMTA 4DU1A 2X78A 3TARA 4E0DA 3QNOA 1KVBA 3V9XA 3C94A 4W5QA 3AV9A 1GOBA 2G3RA 4AHRA 2EFIA 2DFFA 3CYMA 4CECA 3NTHA 1ASWA 3ZSRA 3P83D 1TL1A 4H4MA 4C5EA 3QIIA 1G5VA 4KHUA 4E89A 3OYFA 3WNEA 2VYTA 3TABA 3BDPA 3NH1A 3THVA 4HTUA 3VQ4A 2FBVA 2HMIA 4IG0A 3MO8A 1IH7A 4HHTA 1RT6A 4PLIA 1L5UA 3NH0A 3IAYA 1RDDA 3MECA 1QQCA 1FKOA 3QESA 4K8XA 2HQXA 5HRSA 3H08A 4O44A 1BCOA 1YT3A 4CJWA 2RHZA 4OPJA 3TANA 2PY5A 2F5KA 4KFBA 1QSYA 5HROA 3AVLA 3L2RA 5FRNA 4AHVA 2HW3A 4KB1A 4LD0A 2M1HA 2B4JA 5SZTA 3TAGA 2K3YA 1KCFA 4CHZA 1QSSA 4QOZB 4CFCA 3HP6A 3O3GA 2HNYA 1XHZA 4KKOA 5CY4A 3I8DA 4FJLA 4KTQA 1NKEA 2IG0A 3I0RA 1F21A 1QS4A 4DF8A 3UWNA 4F3TA 3MEAA 1OYXA 3NF7A 2L89A 5KH6A 5C0MA 2QKBA 4N5SA 4CJPA 1RCHA 3OB9A 1C6VA 4RG2A 4ELVA 3OQ5A 3VQEA 1Z26A 4BE0A 1ZYQA 4Z4CA 4PLLA 2Z1IA 3CFPA 4CJSA 4B8CA 1WJRA 3S3MA 4PQUA 3SUQA 3SZ2A 3I0SA 5CZ2A 4DSKA 4CHQA 3AVKA 2JZ2A 2D5RA 3AVMA 1JKHA 3ZSXA 1X9MA 4NZGA 4OLBA 3LP1A 1B9FA 1N6QA 1WSHA 3ALYA 1JXBA 4CJUA 2BIVA 2YNGA 1LV5A 2KTQA 4CJFA 3EYZA 4XIUA 3RR8A 4J2EA 1S1TA 2Y1IA 3KLHA 4OLAA 2VG6A 2ZQBA 4ZHRA 4M3RA 4FLZA 4DQQA 4B9VA 1ZBFA 5KCHA 4M42A 3S6WA 3OYJA 4E7LA 1W9HA 3L2UA 2EHGA 4ID1A 3LWLA 1JL2A 4CJEA 3NNQA 4OPKA 1S6PA 2D9TA 3ZT0A 3SQ0A 1RILA 4E7JA 4C8KA 3DRRA 4AILC 3ZT4A 4KPYA 1C1BA 3K5OA 4FK4A 2XDPA 4I9LA 4FCYA 4J2BA 1CLQA 1IKXA 3E9GA 2L3RA 1S9GA 1KLMA 3OS1A 4QQ6A 1HPZA 2ZE2A 2GFUA 1S9EA 3V1QA 3AO1A 4CF9A 2ZD1A 1C0TA 4CJ5A 2E6LA 4KTZA 1WNSA 3LAKA 3QEXA 2G8UA 1DTTA 2OPPA 4OKKA 4K8ZA 1REVA 2RI2A 4CEFA 2OPQA 4N47A 4Y1DA 3SQ2A 1NOYA 3SCXA 4CRIA 5C6SA 3DI6A 1Q9YA 1DLOA 1U45A 3LAMA 4RW9A 2KZZA 5KRTA 4KRFA 1GOAA 1EKEA 3TAMA 4FM1A 4EZ6A 4CEDA 4CF1A 3HVRA 4Z0UA 1T8EA 1BGXT 3ME9A 3LH0A 4CGHA 1HJRA 1X9SA 5SWMA 3LALA 2X4YA 1RT3A 1ZBIA 3C6UA 4DTMA 1S1WA 3CQ8A 4FW1A 1JLFA 3MEEA 2R58A 4B9SA 4Z4GA 1U47A 1SKSA 4W5TA 1I3AA 4DLGA 3DMJA 5DMRA 2P51A 2EQMA 1EETA 1RDBA 2OPSA 3QEIA 3HM9A 2W42A 1ITGA 3K5LA 3DLKA 4CEQA 4HUGA 1TK0A 3KUFA 1BIUA 3HL8A 4QAGA 2YV0X 4DTRA 4JS4A 4DU4A 4CGJA 4HUFA 5J39A 3HP9A 1C0UA 1WAJA 4QQDA 1EXQA 4RW7A 3DRPA 1XHXA 3NF6A 2VWJA 2FBTA 3LDSA 3DM2A 3QIPA 2G8KA 3AA4A 4OVAA 5KRSA 1S1UA 4HUEA 4BWJA 3SV3A 1XC9A 1NK6A 3BGRA 3RTVA 1DTQA 5J2PA 2QQRA 1NKCA 4ID5A 1NJZA 1SV5A 4GMJB 4N4HA 3LANA 4KAZA 3NE6A 4M3TA 1A5WA 2HB5A 1BCMA 2XY6A 4RW8A 3FC3A 1FKPA 5KGXA 3QLHA 4M45A 3S3OA 1TAUA 3OYCA 5KCOA 3VQQA 2GUIA 5I42A 1VSMA 1Q9XA 2RI3A 4CIFA 4N4GA 1D9DA 3OMGA 3KD5E 3QBYA 2NLUA 3B6OA 4Z4HA 3OYNA 3DLHA 4FJ7A 3M8PA 4N4IA 2PZSA 3AVJA 4N41A 3UT1A 2X4WA 3DRSA 4DWIA 3DLGA 2R7YA 4C8OA 3SYZA 3AO5A 4IFYA 2OPRA 4KHNA 3FEOA 3PFSA 5KGWA 3C6TA 2B8AA 4DSFA 3AVNA 4CGFA 1NK9A 2I5JA 4DTOA 4Z4EA 5IAYA 2DY4A 4BE2A 2LVMA 3LPTA 1QTMA 1U48A 1RT5A 2ETJA 3KLFA 2QKKA 3SPZA 3KD1E 1VSDA 3PY8A 1K6YA 2CKKA 4OGEA 3NH2A 4E7IA 2G8HA 4PUOA 2HNDA 4H8KA 1TAQA 2BUDA 4B9NA 4FM0A 4M41A 1IKYA 1IO2A 4KHSA 4W5RA 5J2NA 3K59A 3DLRA 1VSIA 2WACA 2RHIA 5JS2A 4CIGA 3LP2A 3P5JA 5KE3A 4CESA 3U3GA 3OYIA 5HP1A 4FJHA 3CM5A 1RNHA 4CHNA 3SNNA 3MP6A 3HPOA 2WOMA 2IAJA 4CERA 2RKIA 4OKJA 3M8RA 2X4XA 2RF2A 3NF9A 5E41A 4B9LA 3AA3A 3C4SA 2L8DA 3NFAA 5HRNA 2DIGA 2P0KA 3SPYA 4KI6A 2QXFA 3META 2HVHA 2HHUA 1WJSA 3A2FA 3H6ZA 3SD4A 3CFOA 3TI0A 4DSLA 4C8MA 1RT1A 1RI0A 4N76A 1NK4A 4WE1A 4FW2A 3VQ7A 3MP1A 1ZBHA 4NCAA 4F8RA 1S6QA 4F2RA 3QEPA 2VG7A 4IDKA 1KFSA 1O1WA 4IUQA 1BI4A 2E4LA 2P5OA 2LRQA 4FZYA 1BQMA 4CGIA 3RMDA 4IUPA 3LLRA 3V1RA 3G10A 3AVFA 3ZSVA 3V9WA 4IURA 4BDYA 2DFHA 1H3ZA 2KQ2A 3V9SA 2EQKA 2Z1JA 2G8VA 1Y97A 3RRGA 4CE9A 2FBYA 4DTSA 3TR8A 1HQEA 3L2VA 2PYLA 4LSLA 2RI5A 2FBXA 3CFRA 2OA8A 1UA0A 1FK9A 4Q0BA 3E9FA 4NCBA 3D45A 2YNFA 4CF8A 2LCCA 4O0IA 3F9KA 4B9MA 1JXEA 4CFDA 3TAEA 2VWKA 2OYQA 2E5QA 5HLFA 2ITGA 5D6WA 5FDLA 1RBTA 1JL1A 1WSEA 5J26A 3OS2A 4I7FA 2G8WA 4YFUA 3O4QA 3GOXA 4M3XA 1B92A 3TAFA 1WN7A 2KW4A 4E1MA 5C24A 4O55A 1EX4A 3HO1A 4CIEA 4EP4A 3RMBA 1TKXA 1SL0A 1FXXA 2A1RA 4R5PA 2LTOA 4IUTA 1TKZA 5HBMA 3CEYA 1WSFA 3K5NA 3IRXA 4O5BA 4B9XA 4HCCA 3LX7A 1LW0A 3F70A 1YVUA 3HPHA 3ZSZA 4B3OA 1LWFA 2XO7A 5FRMA 4CF0A 1X1PA 4A4GA 3ISNC 1VSJA 2D0AA 3TWHA 3LP0A 3WNHA
chains in the Genus database with same CATH superfamily
4J19A 3UKRB 1WJFA 2RNGA 2ID3A 3I0WA 2IVPA 4FJ5A 3VUBA 4CZZA 3HL2A 3EG3A 2PVGB 1Y56A 3HOSA 4XRSG 1VQ7T 2FNAA 5J8CA 3AA2A 1NHAA 5JLHA 2RA2A 3C0CA 2L9SA 3GTOJ 1VNDA 3O9UA 3OYLA 2FF3B 4FJXA 1N8RO 3KTQA 1W36C 2OANA 2BZTA 2KHOA 1ZSZC 4N4NB 4CJ4A 4L8RB 1Q95G 4ZGEB 2FO0A 4FYVB 2HQ5A 2COBA 1XNQK 1KQSS 3V7SA 3PX4A 1NMNA 2JWLA 3AVAA 4FLTA 3K1NA 4I6ZA 2LF7A 2LC4A 2JW4A 5HK3A 1L3SA 3R6NA 4JI5K 4PA1A 4OINF 1JKOC 2EX3A 1RETA 4ORZA 4A0YA 3QZ9B 5FD5A 3MCPA 1JLAA 4QS9A 4F4KA 1CZBA 5CKBA 2FC0A 3JRDA 4GV3A 3HPGA 2E70A 1ZHIA 3HSEA 3PMIA 2M87A 1KQJA 4FLVA 1BC7C 2QQBA 3WG7H 3ZPLA 1K0SA 1FSEA 2PBIA 4WWCA 4UNOA 1B34A 1NJYA 1BR2A 4CO8A 3QAHA 5HDKA 2K85A 5KE2A 2V7YA 4HVVA 3G1MA 3CCET 5J4VA 4WQ5C 1ON1A 2DLPA 4PKCC 4MQ3A 2PQWA 5B8HA 3VGKA 4DSEA 1WJEA 4OGCA 4WF9L 1QZZA 3LM9A 3MX5A 2P81A 4X9CA 4RUGA 4BE1A 1NE8A 4PJLA 3FHZA 2DX1A 1O3SA 1T8IA 3JSCA 4ISFA 2A1SA 3DJCA 2E2IJ 2JOYA 1M90O 2LT1A 2WY8Q 2O9SA 3LSPA 2GXGA 3I58A 2CV2A 4GYGA 2STWA 2XY8A 2ZPGB 3HRUA 2JUFA 2DMUA 4PJOG 3RR7A 1TT0A 4BXUA 3R0JA 1U49A 1JLQA 3GFJA 2E6ZA 2DMPA 4RTXA 1JXSA 3GZ5A 3U9ZA 1CXUA 5K5OA 4ILJA 4DOWA 1XQPA 3A5OC 2B7EA 2VUBA 3CCJQ 3EHRA 3CCMQ 4PIIA 4HF2A 3D7SB 1HC8A 3CCVI 3PNYA 3ZETA 1J5OA 2FBHA 1S3JA 4XN0A 4H5NA 5BRFA 2EJ9A 4JRIA 2FSKA 1WPKA 2I7NA 2RPIA 4B1VA 2L4AA 4Q5VA 2DN0A 1A31A 3GP8A 1AA7A 3SQ1A 2JUGA 4U0VA 3GFMA 4PY5A 4J9BA 2XF7A 3M8JA 1ETOA 3O8HA 2MH9A 3BR1A 3WT0A 3LSMA 3H9QA 4YIIA 2DOFA 2ZJQF 3W6KB 1LPQA 2M16A 1VQMQ 2Q31A 5C2DA 3CUQA 1U06A 3CCJN 1KFZA 3VS4A 3CLQA 3CCMN 2Z99A 3QQAA 4GLMA 3ONQA 3GTGJ 4HX8A 2HMAA 3NGPA 1AWWA 3K69A 2L9NA 3SV4A 4MLEA 1HUXA 3IRQA 2RJEA 2F1LA 3KEQA 3UKGA 3BTLA 4X34A 4H5WA 3HDDA 3SMSA 4DFKA 3EUHA 2X74A 2GWKA 5E84A 4EJTA 8ATCB 3FXLA 4B1RA 2ASOA 2HBPA 2E3IA 1RTJA 1VQMN 3ZCMA 4HLYA 3OJSA 1MV3A 3M56A 3QPTA 3WNGA 2YHYA 4JLHA 1JHHA 3RMQA 4HSRA 1HCRA 4C8QF 4N9IA 3CBPA 5DM6F 2DXCA 3E2UA 1LFPA 4ZTFA 2DA9A 2CZ7B 5EGOB 4DQ2A 5FROA 1TK5A 1JCEA 2V26A 1AOJA 2NWMA 1OU9A 4E7KA 4CK1A 3ZEHA 1N27A 3ZSYA 3C7JA 5JVGL 2AHQA 4YFXF 4M7AG 2QK0A 4DQPA 4M4ZA 3CWAA 1D09B 1RTHA 4IEJA 2ZKZA 4GY2B 4NQWB 1RUOA 1ZG3A 2CGHA 3IKTA 1B1BA 5HNFA 1KVCA 1KYWA 2AZVA 1JUMA 2RHYA 5FU6B 3DLLF 1QA6A 3KLEA 4CBXA 1K76A 1GLAG 1T39A 3MMYB 4H5VA 4ABZA 2E12A 4CC4B 2V51B 3LL7A 3HUGA 3Q0UA 5JS1A 1RBVA 2DF6A 3NQOA 2GBQA 1DPRA 3CP8A 3BP8A 3JCMh 1H88C 2CUEA 4JOMA 2HHQA 4EM1A 5GAMd 1OYYA 1S1VA 4DV5K 3OJUA 2DJNA 3E19A 3M4GA 3KX2A 4JK8A 2E1MB 2YKNA 4DG1A 4E6RA 2IA2A 1VQ5I 2P4WA 1FN7A 3IMXA 4BGAA 3CJQB 1XC3A 4BREA 4ISGA 2CGJA 5GMKi 2NOIA 1X9WA 1WJCA 1HNZK 5GANe 2W24A 3DV8A 2ZNZA 1JUSA 2IA1A 2KJBA 4LH4A 4YOUA 4MDXA 2UV1A 2D8HA 5AQOA 1QW1A 4OOIA 4DTJA 4WXCA 3NF8A 1E2XA 5C42A 5C3EJ 2DTUA 3OYMA 2DE0X 1L3TA 3OYEA 2AQFA 3M1FA 3CXCS 1HKCA 3RKXA 2DETA 3S1RJ 1JLGA 2IVOA 2Q8KA 1XDUA 4CEBA 2G9WA 2A3ZA 3K9KA 1S72A 1LOJA 4C8QC 1TQPA 1KQSP 5F0FA 5K14A 1N25A 1WDXA 2P84A 3RPUD 1I6HJ 5LBQA 1YNZA 1ETXA 1V76A 1J54A 3IWFA 1JJ2S 4BJ6C 1IO6A 3L2CA 3MEGA 2L7FP 3FB9A 4I7HA 2XPVA 5AJ3K 3F22A 3G1LA 3KLGA 2HYGD 3KZZA 3DFGA 5JLXA 5FLXZ 3CCLT 3SWNA 3LSHA 2IEKA 3PNTA 3VOEA 3L2ZA 3FIWA 1VQ9A 5IYCJ 4E19A 3IWZA 3THWB 4AQYK 5HK0A 3VMFB 2X6XA 4L5EA 4DQIA 1UE9A 4Q47A 2DBBA 2DDBA 1SG5A 5C2FA 2FE3A 3QJ6A 4LFAK 3D4VA 3E0JB 2WUSA 2GM4A 1VIFA 3X24B 2O4XB 4LD6A 1W7PA 2R7TA 3KZBA 2NVTJ 2JS2A 3JR9A 5FWCA 3V81A 4X0GA 3AO3A 3WGIA 4FLXA 3TW7A 5D6XA 3H5AA 2ICWG 3M0RA 1TOVA 3DOKA 1VQNI 2HKQB 3HRMA 1GDTA 4FWLA 3QEVA 4CEEA 2V1RA 5GAEJ 3HOXJ 3DU6A 1Y1VJ 3OMCA 4UOBA 3WU2C 5LL6S 1RFQA 4M78A 1CSKA 3WTXC 3VU3C 2B5JA 2WA0A 2I7PA 4KBOA 4S04A 1WZOA 4RCCA 1MUZA 2YR2A 4JS5A 3QERA 4LJZF 1SL1A 3O3FA 5LGNA 1J9AA 3U1DA 1EBMA 2JPCA 3ABKH 1WJ5A 5F1RA 1WNLA 3E6DA 4C5HA 2ZGWA 4BEHB 3TCJA 3PQKA 3QWLA 5F64A 1QWEA 1V4TA 1GLLO 2JPSA 1WI3A 4OAYA 1I0CA 4LLGF 1XOVA 3M0PA 2X3XD 4RB0A 2ME0A 2RQUA 3R0AA 3OYAA 2K3XA 1PUFA 2F9WA 2M45A 1WHHA 3LA2A 2IAIA 4HVJA 3V8JA 1YAGA 2XF6A 4MFBA 3EFSA 3RRHA 3C6AA 3GE1A 2ZCFB 4FE4A 1U8RA 1Z67A 1SFKA 1YJNT 3JYTA 3CCVQ 1LDJA 3EGXB 3G0ZA 1FBUA 3TAQA 4XN3A 1J5EK 2D2WA 3A8HB 4M74A 4XK4A 3HZ6A 2RB6A 3PO4A 4DS4A 1WFXA 2H27A 1IBKK 3CJ9A 3QEWA 2LQ8A 3CCQA 3SJJA 3EUAA 4KMFA 1Q82C 1GBRA 1H9GA 1SRLA 4CGDA 2YX7A 1BI3A 5GADJ 3EL2A 3WXJA 4A61A 4M7DB 4HRIA 1S8NA 1NKBA 4KHQA 2QQAA 4M3UA 3H1CA 1H92A 4DV3K 3BT9A 3CCVN 3PNWC 3GCMA 2QGGA 4KT5C 4ILHA 2FBIA 3WVEB 3K4KA 3JCMX 3WXMB 2MABA 4V2GA 4LY7A 4Z4FA 4FJKA 3PT9A 4BBRJ 3I5RA 2PYJA 3RMAA 3CPEA 3GF2A 2KXCA 1T2KA 3FE1A 2VQCA 3CPWS 2M9HA 3IUOA 2XC7A 5TISC 3U6FA 3ZQIA 4CCHA 4FTHA 2COMA 3O9QA 4U0YA 2QTDA 2VQHA 3ZRGA 1RPWA 1X75C 4E4HA 4EHUA 1LWWA 4XNFA 2V8IA 3ZMDA 1AD5A 1M8VA 5DD8A 4FX0A 4B3AA 4AT1B 1OR7C 2P0WA 2OAWA 1NLPC 3RIRA 4M3ZA 3CBMA 3OYBA 1F9NA 3CCRI 4XLFA 3KJVA 2D1VA 4NB4A 2HYFA 4DOZA 4X1VA 1K9MU 1NLOC 3F8MA 5BPIA 4EVIA 2ZXHA 5J4YA 2R5MA 3VSKA 2YKMA 5LJ3h 2AQEA 1NK5A 2PJRB 3FBNB 1DU6A 4NYNA 4JLGA 3S2HJ 1I1JA 5J2QA 3RTRA 4PHTX 3WGGA 3LSGA 1T05A 2UXBK 3JB9D 1UG0A 2JT1A 4FVMA 4H0XB 4MTDA 3SQ4A 3CCEA 1D5VA 1STZA 1ZGWA 4EV0A 1UTIA 3EZWA 2VLAA 2EIMH 1QZ5A 5AZJB 2I0NA 3G6ET 2CQXA 3I5SA 4G8XA 1X6OA 1O7FA 1GFDA 1TTHB 2JMAA 2KISA 3X28B 2X4JA 1QHHD 3WTUC 1FPQA 3E01A 1WGSA 2DJIA 4FJIA 3EPZA 1K8KA 2M02A 3QSUA 4FJGA 4AFSC 3O3HA 2RQTA 1B7TA 4LN2A 3THYA 1VQKT 1K4US 2K9LA 1YCYA 2DLLA 3HRSA 1OULA 3TTDA 4FZXC 2V79A 5BS6A 1UJ0A 1RRJA 3M8FA 4M77A 2GWJA 1YX5A 2Y75A 4TVRA 2H8HA 5B5EC 3M9QA 1JLCA 2HVQA 2EQJA 1E4FT 3C7NB 5GANg 3NTKA 3CXCP 4BY6C 2GZWA 3G71I 3THXB 1IN7A 1J9IA 2A6AA 1S7OA 3JSOA 4C3JJ 4J8OA 4KGZB 4JV5K 4OMYA 2A6HF 4XSXF 3O5BA 4N9HA 4DHYA 2DPNA 2PMHA 1BL3A 2HVIA 2KMTA 2UZKA 1UG1A 2AA4A 1JJ2P 2B0LA 3GUDA 1XQHA 4JKAA 3GTMJ 4U67L 4RG8A 3U9DA 2QEXI 4F7UA 3F72A 3KYCB 1I07A 3JRBA 1KG5A 4OMPA 2QA4A 2BANA 3CVSA 4HF0A 2EGAA 2FRWA 3LGLA 1SL2A 3GF5A 2LQNA 4UNFA 2OX7A 1ZGJA 4B22A 3JREA 3I56T 1E17A 4F52A 2ISYA 1G99A 5FLXK 3HSBA 2BH1A 1UA1A 1L3VA 3PUFA 5GINA 3Q1JA 1TK8A 1YG2A 1ZG1A 4EPCA 4AHTA 4KH1B 4BQOA 3DWLE 2W7NA 3R6OA 3VS5A 1TWGJ 4NBQA 3KK1A 2R7SA 1F4KA 2E2OA 4FSXA 4NNJA 4XM3A 4B24A 3JCMb 3KZIC 2ZSHB 2W10A 4LF6K 5AQFA 5DV5A 3ENHA 4AC0A 3NARA 3O2PE 3ASNH 3R3LA 3TARA 3QNOA 1KVBA 2C0IA 3JCMW 5CVRA 1TWFJ 1R5HA 2FB7A 1T08B 2MYSA 1YI2I 5KPRA 1GOBA 2DD4A 2EBIA 4BXXJ 3RMSA 4AHRA 4CCLA 4M78G 1IUFA 3CYMA 4FT8A 1F1ZA 5FWBA 3ZSRA 1JGGA 1JB0E 3F9MA 4WQ4C 2F4OB 3I3LA 1WEGA 4OFAA 3LSRA 2E64A 3QIIA 2L3QA 3SEMA 2M1BA 2VC1A 5ERIA 1ORKA 1KG1A 2COYA 1YIJQ 3LDOA 4X66K 3CO7C 3QYBA 4J01A 1RKWA 3BDPA 4N0AC 4M75B 5IHIA 2NAZA 1AWCA 4HTUA 1YW9A 4M7DD 1RRQA 5AQJA 5M1PA 2YUNA 1DU0A 1VQNN 3MO8A 1UMQA 3WTTC 1FP2A 2A28A 4AIHA 3DTIA 2DMTA 2RF0A 2HFHA 1LNWA 2CWEA 2V6EA 3CCRT 2OFIA 2ENMA 4ESJA 4YOWA 1NYGA 2E1HA 2F5KA 1QVFA 3S8PA 1YIJN 1U1SA 3AVLA 5AN4A 2ZPHB 1BM9A 3EQLF 1QQJA 2HW3A 2XF5A 2H1KA 2M1HA 1H3HA 4RM3A 3F8FA 2ABKA 3TAGA 1KCFA 4AFUC 5KYYA 2P9NB 2FA5A 3MN5A 3FZLA 3K2ZA 4WTOB 2LLKA 4FJLA 4KTQA 3I59A 3PIPA 2EH3A 4OMZA 3MKZA 4DF8A 4M3BA 4F3TA 3A1PA 3F8CA 1FMWA 3NF7A 2VJ4A 2GWRA 4ZYGA 3KP3A 1PSFA 4PDKA 4XICA 1C6VA 4KH4A 2FRYA 2KGTA 1VQ4I 5CKDA 4MFEA 4XH4A 1R36A 3NEUA 4GO1A 1YQLA 3CPWP 3VYUB 2KRNA 4OU0A 4CJSA 4B8CA 2X3WD 4BROA 3MN9A 2CW7A 4DSKA 3PVLA 3AVKA 2YLBA 1HYOA 2CW0F 1JKHA 1GFCA 2CT4A 3ZSXA 3DEWA 1PJRA 2HPMA 4NZGA 4OP0A 2VUMJ 1ZKGA 3EGDB 1B9FA 3JCMP 1B07A 1N6QA 4JKHA 4L3QA 4B48A 3CMYA 1M4ZA 1G3YA 1JXBA 2QW9A 2EPFA 3CCLA 4G94A 2Y90A 3RR6A 1N33K 5GAMe 5FU6C 1W2BA 1IG8A 5GMKm 4YPRA 2HOAA 2VQEK 1QHGA 4FPBA 2XB0X 3RBBB 2JPBA 2HZYA 3OYJA 5E3MA 4E7LA 2D0PA 3L2UA 4LK0F 4ID1A 1VQPQ 1K1ZA 3O6BB 3GPLA 1ZSZA 3MZ8A 4YOYA 3NNQA 2D9TA 3RDIA 1TQIA 2EYWA 4D5CA 2LBFB 2V9VA 4FOEA 5J40A 2XHCA 4E7JA 2E1MC 3ZT4A 4KPYA 1ETVA 3EH1A 5GMKl 5DYMA 2LF8A 4J2BA 2RK1A 1RC9A 3GNFB 3E9GA 1XMOK 1S9GA 1R8OB 3VSLA 3OMYA 2D1XA 2VGMA 2WV1A 2H3JA 4N0BA 1HPZA 4E9HA 3VYHB 2W84A 1USSA 3QYEA 5GAN7 2ZD1A 2LQKA 4HAMA 1TWBA 1VQPN 1QPIA 4KIFA 1BUPA 5GTIC 1GLFO 4GLKA 3CCSI 2DJQA 1XMAA 5CO7A 5KQ8A 4OMMA 4J9EA 3F6VA 4Y1DA 4M77G 5EOYA 1NOYA 3CESA 3THKA 2DFIA 4RGRA 2WB1N 2RQWA 5JVGF 1DLOA 2K6DA 4QPOA 5F08A 4Z94A 2CH5A 1HKBA 1QBJA 1N78A 1QGPA 4MDBA 5GANf 4A2BA 2M9UA 4JLIA 1GOAA 3FZMA 1WFWA 3O5ZA 1EKEA 3R6MA 3TAMA 3M07A 5FKOA 4FM1A 4LK1F 1YJNA 4CEDA 3TU5A 4L9TA 4A3FJ 4Z0UA 1J09A 2LP5A 3LH0A 2ZO4A 5AQHA 4AIJA 1B72B 1X9SA 4LDUA 1QCOA 3A1YA 3LALA 2DZ9A 2NRZA 1RT3A 2LR8A 3QICA 4IXCA 2ZFUA 2P9LB 4MLHA 2LJ1A 1ZBJA 2E5KA 1SFEA 2QEXQ 2DL5A 5HOOA 1SF9A 3M7GA 5HODA 1SPKA 1SKSA 4WK8F 4IZZA 3FXOA 1VQLI 4H0OA 4M75D 4M3EA 2GBYA 2NUPB 2J5PA 3P8BB 5LFAA 1E3MA 1JBMA 2W42A 1ITGA 2J4RA 2HS5A 1BWFO 2E1YA 1Z6RA 1BI0A 1VQ7Q 3HSFA 2DBKA 2ZSIB 1ZBSA 3O3KA 1VQ5A 3BG7A 2ZC2A 1KG3A 4QPQA 3TO7A 2QEXN 1EA3A 3ZMZA 5J39A 2CW8A 4IHTA 3DRPA 4BR4A 2VWJA 1ZUUA 1VFCA 5CVVA 2D45A 3DM2A 2YPRA 4ZGDB 3VF4A 1S1UA 2Y69H 3H0HA 5HS9A 1VQ8T 1XC9A 2QBYB 3IL2A 1YI2Q 3CCUT 2MLKA 1Y39A 2KQWA 1GL5A 2QQRA 3I0XA 1VQ4T 4ID5A 4LDWA 5EEGA 2ZZDA 1OCPA 4GMJB 2VV5A 3QXEB 2FRHA 5IXFA 1VQ7N 4KAZA 9ATCB 1YS6A 4EA4A 4M3TA 1HD3A 1ATNA 4FISA 1BCMA 5B1AH 5I2MA 5TKWA 3F2KA 3OIQA 1KONA 1ZLJA 3CC7I 4LG0B 2F5CA 5KCOA 3VQQA 3EUKL 3KP4A 2MBFA 4LFCK 1ABQA 2NRWA 4CIFA 5GMKh 2R7UA 4RTYA 1YI2N 2XHIA 1O3TA 3HHHA 3VODA 2HU9A 1ERDA 4Z4HA 4GBQA 5KYWA 3A5MC 2J5OA 2XDDA 2YSQA 4N4IA 4N41A 3JB9I 4EJWA 2Z0WA 2CQKA 1XG1A 4NC8A 2MCNA 3G6EA 3E1SA 2D0NA 1IRXA 4C8OA 2FU4A 3AO5A 2V75A 4M7DC 2E36A 5GAN5 5IH2A 2Y30A 2XMFA 1FYMA 3FEOA 3PFSA 2EIJH 3KWIA 2R7WA 4DSFA 5GAOm 3AVNA 4HT8A 4DTOA 2VWFA 3J7AO 3RZDJ 2DBMA 4XU3A 1Z91A 1YHQI 2FMYA 2ECZA 1VQNA 4CYCB 2JHNA 2O8DB 4PJOF 2ASPA 4CSWA 1VQKA 2X0LA 5ELZA 4CCOA 2F69A 2JK3A 3WHCA 1AT1B 2K3FA 1K8AR 2FBKA 4CZHA 4I99C 1OPLA 2BUDA 5BRHA 3BY7A 4CZLA 4FM0A 4R55A 5CQYA 5GAOl 5LJVA 4KN4X 5DM7L 4KHSA 2OV7A 5K5QA 5J2NA 2RMOA 5EDNA 1Q82O 3A03A 4BG8A 2LREA 3G1OA 3VYSB 5JS2A 4GKKK 1KD1O 3LP2A 3P5JA 2EWSA 1WSUA 2ZWHA 3CMET 2NUTA 3OYIA 1MGTA 3X26B 5HP1A 1SMTA 3CM5A 4C92B 1E3PA 4GRIA 2KMUA 4CHNA 1TXQA 1YWPA 1ZK8A 3MP6A 4B1ZA 3HPOA 3AKZA 3MHXA 2KDOA 4CC2A 3TSWA 5LHHA 5C0YA 3M8RA 3JCMd 3D1NI 3NF9A 2CUDA 2GA1A 5ILUA 4GDFA 1LKXA 4D1QA 3H3ZA 4B9LA 2KKOA 1KC8U 3UE5A 3MN2A 5AZIA 4FWNA 2P0KA 4ZYAA 3N4QA 2QXFA 4Y0WA 2XASA 5GAMg 3LMMA 2F5VA 2O8CA 4M7DE 1P8ZA 1PG5B 3A2FA 3LWIA 5FLVA 3CFOA 3A01A 2KVQG 1MSEC 3QDFA 3TDZC 4LD5A 4C8QA 2EFPA 1RI0A 4HNVA 3QJYA 1N5ZA 1SFXA 3S93A 3VYRB 4LDYA 3RZOJ 1RACB 1ZLMA 3H9NA 2A07F 3H0GJ 1K0XA 9ANTA 3G0QA 3A0HC 2M8EA 4PJOC 2OCEA 1HSJA 1S3XA 3BFMA 2NNNA 3WGHA 2LRQA 2ZAEA 4FZYA 1IF1A 5BPNA 1W97L 2QSGX 4M7AF 3LDNA 4WF2A 3FSPA 4IUPA 1ZA2B 5KYUB 4A53A 2ZM6K 1NGDA 2DFHA 2FVUA 2O0YA 2KQ2A 3DLLA 4IDHA 2V52B 2E1NA 1KQ0A 2DXIA 5GTHC 3RRGA 5HVQC 4PSWA 3RQIA 1GBQA 1BOBA 2EK5A 5D5VB 2CP3A 2DILA 3LSKA 3S15J 1UHCA 3CCRA 3FISA 3ZP5A 3TKYA 3CFRA 4D8DA 1KA8A 2OA8A 2P5VA 2WBNA 1UGPB 4Y4RA 5BMZA 1W7AA 2ZXWH 2P9KB 1GLCG 4KH0B 1RDWX 4B9MA 1HNXK 3TAEA 1U5TB 4PSXA 2W4SA 4EGYA 2XKOC 4EM2A 5HLFA 5D6WA 4R8HA 2OTLI 2FL7A 1JL1A 2Y0SA 1SD6A 1FMVA 1KU2A 2VGNA 4H5TA 3O4QA 1BL0A 2K4YA 4C0ZA 4EW0A 5LRRA 3C0BA 1WN7A 2Z1DA 4E1MA 1XN7A 2Y9ZA 1EX4A 3O9SA 2P4RA 2HQHA 1RUWA 1N32K 1YS7A 3VERA 5C15A 4MLOA 2H3EB 1DJ7B 2P9IB 3FZFA 4R5PA 4IUTA 2NVQJ 3EG2A 1WSFA 1NBEB 3IRXA 3DXJF 3CQXA 2QTXA 4B9XA 3LX7A 3BWGA 4IHXA 2ZPBB 2F5DA 2F48A 1YIOA 4B3OA 5FRMA 2XPUA 5FPNA 4A4GA 3ISNC 4KRTA 4ANJA 1VQLN 3R61A 1EZZB 4YY3K 1T0HA 3LP0A 3WNHA 4NC7A 4YORA 5GAOr 3BTJA 4M3GA 3G71A 2Y1JA 5AFUA 1LQ1A 2ITMA 1C1AA 2H56A 3I55T 1ZARA 5GAN4 4EJUA 3IFRA 5J2MA 1NK2P 3E97A 2QWRA 1LE8B 4IL6C 4UVAA 4P5OA 1I27A 2FHDA 4HVUA 1WJQA 3D5RC 3SBTA 4MNUA 3CC7Q 2NOJB 1I6XA 3VTHA 4QVZA 1F43A 2VOPA 2E65A 3CMAI 2PVDB 4M71A 2P7VB 3NGYA 1MJBA 3IAM2 4LSNA 1FTTA 4X1EA 1BHLA 1D8YA 1XQOA 2N8GA 2XGDA 2PAVA 3O4NA 1ASVA 3CQTA 1PD0A 1T33A 4QTRA 4IUUA 4DR2K 3EFRA 4JI1K 3VYGA 4FLYA 1T6DA 4F17A 1XQSC 2FZKB 1KQ9A 4HV5A 2O61A 3CC7N 2M0MA 4EDUA 1B8IA 1OR7A 1KZHA 2JJ7A 3KK3A 2E2NA 1ZELA 2A68F 5EG2A 4C92D 1FOWA 1MMAA 3M58A 2Y4XA 1LAWA 1YHQQ 1RR7A 3TSZA 3REAB 2A08A 2KPMA 1MBHA 5HRRA 1NBWA 3AG1H 2RC4A 4R1HA 4HQEA 3A8LB 1JCGA 5IN1A 3J7YP 4DSIA 4H4KC 2QCOA 2PX9A 4YDUC 4WYBA 3OGDA 1WVRA 4MGRA 2W6LA 3DF8A 1W6XA 2L2PA 3ZQQA 2L0KA 2OJED 2LJ0A 2K9MA 4CI6A 3QODA 5I2SA 3DXKA 2EIKH 4M75E 1RABB 5IPAA 2MGQA 1I94K 4FWQA 3K5MA 4GV6A 2DRKA 3DWLA 4DUYK 1VA7A 4L0ZB 1YHQN 3CCYA 4BQQA 1YP5A 2BKDN 3UKRA 5J47A 3DYAA 2CMPA 1VSLA 1QVFS 3K4MA 1SQKA 4NC6A 4CBUA 2DK8A 2P5GA 1ZBXA 2G8FA 5C4JJ 4DSJA 3LYIA 2QM1A 3BPXA 1C6VX 3JRGA 2JZYA 2JGUA 4JHDB 3NTIA 4B1XB 4J9HA 4C5IA 1U3OA 4EHTA 4HZFA 4GV9A 2XU8A 5AQTA 1SD5A 2DFEA 1O4XA 1Z9CA 2PMUA 2W57A 2VB6A 1EP4A 4K25A 4FETA 4OB3B 2F8TA 2UU9K 4B1UB 2B86A 3JCMJ 2R7QA 4Q5WA 2JUCA 3MKDA 5GAN6 2MFZA 2JLEA 2L02A 4A62A 3FMRA 5LD2C 3V9ZA 3TQ7P 5GAMf 5E3LA 1HA8A 5HRPA 2IGOA 2XGEA 1SKRA 3BZ6A 1FNNA 3KEOA 2E20A 2GF7A 3UR3C 4GY5A 4PK4A 1PDNC 2M0YA 1JT0A 3B6PA 5H20A 4M6XA 1MNEA 3L0QA 5LLQA 3MMVA 1SSFA 3NAEA 3CCUA 4Z4IA 2HQNA 2EW3A 2OZSA 4M73A 5JICA 1VQ4A 4LITA 4EMGA 4DV2K 1OZ2A 4AG1C 2P9UB 4CJVA 1YQKA 2DTHA 3VPRA 2E5NA 1EF4A 4DTNA 4HT9A 1G83A 2HDWA 2EQUA 4RW4A 4CYDA 3LAJA 3EHQA 1GLNA 2Q1ZB 4O4GA 3V42A 4DV1K 1YQAA 3RPUA 1YXQA 1GOCA 1W2BS 3S6IA 1YJ9I 2CSQA 5CPRB 3M9AA 2FOWA 2HNIA 2Y48A 3FXKA 1TUYA 1N8RU 5IYBJ 2YT6A 5GAN2 1MUNA 4KBMB 2HZDA 4AM6A 1G8XA 2OPTA 3M5RA 3CJTB 1VQOI 5HKCA 2OZUA 1TKTA 4HG2A 4YFKF 2L7ZA 4M6YA 2F5TX 4OIQF 3A98A 3ZT3A 3VEYA 4WFNL 2D0OA 3N05A 4WQ4A 2QKMB 1MNDA 4FL6A 2D4WA 2EFNA 1YJWI 3G25A 1JGSA 1R0AA 1G3SA 1Z21A 2O5RA 4FWKA 5KNLA 4EQQA 1WBBA 2OTLQ 2FG0A 1ITYA 4N0AA 2MW8A 4DR3K 3H41A 2ESNA 4LIUA 4LF7K 1BIZA 4NLCA 2Z3YA 4ELUA 2BXYA 3BG6A 3BG5A 3F6OA 2YRVA 1T44A 1XS9A 3UA6A 1WSIA 3CJAA 2DTZA 2JA8J 4Y7NJ 1QP3A 4BRKA 4BQLA 1NK8A 1NJIR 4ELTA 3R8EA 4A69C 4DR4K 2HOTA 4C0DB 3MXMA 3GO5A 1DGWY 4BDZA 3QIOA 3PFIA 3CC2I 1U2WA 3OA6A 2I5UA 1N8RC 2VBXA 3KP7A 2YNHA 1ZAOA 1PYVA 4NCGA 4HLXA 4IFVA 3VGMA 5M9OA 2OTLN 3M8QA 2FZGB 1KFDA 2Z1GA 4P96A 3CCSA 3CWUA 4AYBN 3HJFA 3BF3A 3VEZA 3BF1A 1GV5A 1PNJA 5BR8K 1PVEA 4UQGA 3CMEA 4HYEA 4DBQA 2YNIA 3DB4A 1M90U 4FK0A 2BDPA 4CCJA 2LVSA 3F8BA 4I2PA 2EYXA 3EYYA 2ATQA 1BC8C 2QM3A 4O8KA 4IIMA 1QPMA 4F3OA 1C0MA 2BE2A 3L3UA 2JRTA 3R4KA 4R79A 2DA2A 1VOMA 1NEGA 3N4PA 3I56Q 1EV7A 3CW7A 3RESA 4GNIA 2YHTA 3PJRA 3S3NA 4JJNK 4BUPA 2JTMA 3CLOA 5FKLA 1KD1R 4IHYA 5M3MJ 4HNTA 3CHWA 2M8GX 3ZQFA 5J3BA 3I5UA 2MWOA 3CMAQ 4DFPA 3K2PA 3ZYYX 1VQLA 1WGXA 3SBGA 4XTVA 4O6JA 1R77A 4M78F 1GXPA 2JVVA 2IC3A 3P8HA 1ZUKA 5E79C 1U5SA 2HF4A 3MEDA 4KHYA 2BZ8A 5FFXA 1NGEA 2ZJPL 4FXDA 1TVRA 4RAGA 1UWBA 2IS3A 2LKSA 1SAUA 1MDMA 4BR7A 5FLXO 1LWEA 1BR4A 4AU7A 1ILYA 4XLNF 4AFZC 3CMAN 1WJDA 1TYQA 1PU6A 2PU9B 2QVOA 1R71A 4J00A 1RNLA 3M8SA 1D9FA 1CKBA 2IGMA 2K79A 2DQLA 3MEVA 2MC3A 3JCMe 4CZJA 2ZJRL 2ZJQL 1D0XA 1FLIA 2VT2A 1WI9A 1R00A 2HTJA 4MHGA 1XSVA 3UPUA 3FR0A 1E7OA 1QP2A 1HW2A 2E2HJ 2BGGA 5J3LA 4BQAA 2LCSA 4C92C 1LWYA 4W1UA 1G59A 1BJAA 1AZGB 3CJ7A 5GIOA 1QVFP 1D4XA 2QKLB 1B34B 1I8FA 2LOOA 3VETA 2FPEA 4HTLA 1OPCA 2BY3A 3BZKA 1Q81O 1QVGS 1GRIA 3CC4T 2DTOA 2NUBA 4CZKA 4J2DA 2JVGA 1HOMA 3WODF 1DUXC 4G6TB 1ZQ3P 1MU2A 1T03A 3B02A 3TDUC 2NRVA 1T98A 1SVOA 2M34A 2HBWA 1U04A 4F92B 5AIPA 2XK0A 2LDUA 1M2OA 5LY3A 1IDZA 1X1AA 2KP6A 2FEZA 4CD3A 4AWXB 4XK8E 4EMKB 1BR1A 5A0LA 1KLNA 1AHJB 2D0CA 5EY4A 2LDMA 3GTKJ 3MK6A 1VYTA 1P4WA 4P9UA 5I9EB 2BZXA 4G7HF 3K4JA 1T56A 2EJRA 4XSZF 2KLOA 3CUOA 2DFUA 4F2SA 1MA9B 3VRYA 3VQ5A 2VE9A 1GLEG 4BQZA 2I2LA 1WSJA 2VJIA 4A12A 1VSHA 1I39A 3WXLA 1RTDA 4J6YA 4B9UA 1YW7A 2D1HA 2H8RA 2GFAA 3G2BA 3CC2T 3I4PA 2BEOA 2M0OA 1IN6A 3PL8A 2O4XA 3VEVA 3AVGA 2OAZA 2CSIA 4FL9A 4FWPA 3LQRA 1AWXA 2WSCE 2A3SA 2KHMA 1SKUB 3M3ZA 3ZETB 4HDUA 2K57A 5J6XA 4J9GA 2HVSA 4CHPA 2L2OA 4M3FA 1R6RA 2XY5A 1SANA 3EAEA 4BI4A 4BR0A 3NVKA 3HXLA 1X3WB 4C92E 2Q1NA 3V4IA 4Y15A 3G4ST 1W2BP 3TOAA 4XH5A 3MXJA 4AIDA 2V1XA 1YJ9Q 1UOCA 4Y52J 2RN2A 3ID6A 5EF6A 2H6CA 2LCLA 2RQQA 5J1RA 4DK9A 2V7ZA 1U5TC 4NDLA 4IEEA 1NGBA 4AI5A 3R2XC 3K4LA 2O03A 3SDBA 3TSUA 3HI0A 1W1WE 3C1DA 4EJYA 5IOYA 1WKMA 3L8BA 1VQOQ 2X6WA 3GTLJ 4HCZA 4CJQA 3FKIJ 2Y9YA 1LEAA 2O01E 2GQVA 4JX6A 4I76A 2XIGA 1FYNA 2W00A 2PN6A 1M8MA 3FK7A 2O4IA 4BGDA 1PP8F 5D8LB 3DEUA 1YJWQ 4DLEA 1A5XA 1YJ9N 3OSFA 2EPDA 4CK2A 3VEWA 3CJBA 4XOPA 4IHVA 1N6AA 4C8LA 3KFWX 2DTIA 2QWOA 1TUDA 5KK1A 4MMKA 1TV6A 1WXUA 4M77F 2HEOA 2DT6A 2E88A 4DTXA 1CZ9A 3C95A 3DOLA 4IWVA 1VQON 2LSNA 5FFZA 1XSDA 2JJ9A 5ILVA 4I2QA 1N3CA 1ACIA 4DS5A 1AOYA 3FZKA 2RVCA 1VQ6I 5KQDA 4DQ8A 3FXJA 3UDCA 1CGPA 3A0IX 3OYGA 1G15A 1BISA 1RT2A 1RESA 3K4BA 1YJWN 3JCMc 2CGPA 3REBB 4BRHA 3P8DA 2JXBA 5KTQA 1VRLA 2VT3A 2DA4A 2HQAA 1UZCA 1R5ID 4ZH4F 2CFXA 4M7DA 3MCZA 2L54A 4OVLA 1Z25A 3FWEA 4FX4A 5M5WJ 1LMZA 1JUPA 2VKVA 4DYCA 1NLVA 5HLHA 1TTYA 2A36A 4KH5A 4JPBW 3FDRA 5DK5A 4CEOA 3CZ6A 2NS7A 1BYMA 2IPQX 2ZNYA 2GXBA 5AQNA 4LF9K 1SUQA 5FGMA 3LPUA 1IXCA 2DEQA 2J05A 2NUZA 4BC2A 2M4GA 3K0LA 1N5YA 3ZQCA 4QT7A 4ENJA 4PGGA 3VQCA 4B6MA 4YOXA 5T7BA 2R57A 3SQNA 2DYBA 1XD7A 1TZLA 4FJ8A 1T0FC 3OWTA 4BYYA 4JX4A 2FLOA 4RGXA 2LSOA 3E5UA 2HGCA 4UC4A 2HOEA 4A4HA 2HYJA 2R4GA 3LWMA 4Z02A 3CD6I 4PJMA 1JLEA 5GANd 1R22A 4BR9A 3NDKA 2P6SA 2QYOA 3K58A 1M3CA 5M1NA 4EA5A 3A8MB 3M0SA 1VQ8Q 4HX7A 3TTFA 4KB0A 2E7WA 4B44A 1BU6O 4TSXA 3TSPA 3RVCA 1KU3A 3E6BA 1R1UA 2PJRA 1ZG5A 5GAEP 3TAPA 2VKEA 1OI1A 4FJ9A 1VSFA 7AT1B 2Y31A 3RUXA 4LLLA 4QWQA 4BNCA 3E3VA 1YYVA 4Y1CA 5BN9A 2CGKA 3FXUA 4RTWA 2GXAA 3KPHA 1Z6TA 2VXDA 3KLIA 2R5AA 3REOA 4QVDA 1G4DA 3FFIA 2G7HA 3CDIA 4ITVA 2YLCA 3QPHA 4A5AA 2RN7A 4F16A 3WU0A 2JMCA 2HQEA 4IUVA 4WFBL 5AZJA 4Q48A 3PO5A 4JYKA 3I4MJ 4CGGA 1TH7A 1UAAA 1U2VB 2CUZA 1NGNA 3DKXA 1E0EA 1VQ8N 1RAIB 4LB6B 1B9NA 2A69F 2IT0A 2KYMA 2VKHA 2P9SA 3HYFA 4QQGA 2VC8A 4LFBK 1X4PA 3U4LA 3SWNB 3HFOA 4E0DA 3NWSA 3JCMg 3C94A 4ILGB 4W5QA 3AV9A 2ZGYA 3BR5A 1X01A 2WAQA 2O8EA 4M63C 2EFIA 4L9VA 4CECA 2A61A 2XVCA 2NYSA 2VBWA 1Q1VA 4PJOA 4YIRX 4H4MA 3DU5A 8AT1B 3OIOA 3C65A 4C5EA 2WV0A 4KHUA 2EZHA 1M1EB 4E89A 2KIMA 5CE3A 2ZPEB 2PJPA 2QWQA 3SZPA 3JB9G 1BN5A 3NH1A 3CCJI 2OTJI 1ZXOA 3C7NA 3THVA 3CCMI 5GPAA 3HKZN 2A41A 4WCGA 3FXRA 2NS0A 3THXA 1XUPO 4IG0A 3FMQA 2QYZA 1IH7A 1YX3A 2CZ1B 1RT6A 4PLIA 3L1AA 5AYFA 5D6EA 3F23A 1ZQ1A 4ZYEA 4U0WA 3MECA 1NG9A 5D5WB 1QQCA 1O75A 2VWBA 4K8XA 2NNWA 1KQ1A 4K43A 1BCOA 5HS7A 3J7ZI 5E26A 1N77A 5HROA 2E8AA 3L2RA 1Z77A 1D3BA 1OCZH 4G6DA 2CQNA 2MC4A 4XU1A 4KB1A 4NXMK 2LMJA 1K8AU 1MUDA 4BRCA 2UWMA 3KHYA 5SZTA 3GW2A 1KSWA 3C2GA 3PTAA 3U8XA 2K3YA 5C44J 1V5GA 2LY9A 2XKOA 1XGNA 3MKWB 1LJ9A 4CFCA 5AQGA 3HP6A 5CKHA 2HNYA 3AFHA 4DEYA 2EVRA 1YLFA 5KYNA 1K78B 2XPWA 2IG0A 3I0RA 5ICGA 3UWNA 4F55A 3O80A 3LSTA 2PUOB 3TVTA 3NAUA 4IO8A 4EGZA 2L89A 2VQFK 4FIBA 1AKHA 3ZFJA 5KH6A 3RDVA 4CJPA 4WCIA 2X6YA 3ZMTA 5H6QA 2K02A 1M27C 2M51A 4RG2A 1X1CA 3VQEA 1IZ1A 1XTDA 4FPAA 4IXAA 3MN6A 5FW9A 4Q4ZF 1GLJO 2VASA 1RAEB 1OOTA 3CFPA 2DQRA 3U1KA 3S3MA 3SXYA 5EEHA 4FASD 4PQUA 1XDSA 3KWGA 3SZ2A 3WE2A 2FSWA 4C9YA 4A3CJ 4FWSA 2IPOB 4WX9A 1K8AC 3AVMA 2JN6A 1NGHA 1FIPA 2KE9A 2ZF5O 4OLBA 3EFOA 1JKQC 2WBMA 2NVXJ 2VC0A 5GAGJ 1UHMA 1UGQB 3E6MA 1U9NA 3RR8A 2QDYB 4J2EA 1S1TA 2O8BA 3KLHA 2E1CA 4OLAA 2VG6A 1M2VA 2DL8A 2LZ6B 4FLZA 4DQQA 3QHSA 5C4XJ 2YHXA 4F7ZA 3M53A 2ETHA 2ISZA 2JT4A 2W04A 1ZBFA 1FBQA 5KCHA 1OU8A 3UKUB 4XLAA 3S6WA 4HOBA 5DDGA 1ZYRF 3L9FA 3HSCA 2GOXB 3W2AA 2XICA 2JHJA 1UFFA 3N5BB 5K7ZA 1FIAA 1ZHFA 2E5LK 1VQ6Q 4PL8A 1S6PA 2CP6A 2NLXA 1WXTA 4C8KA 3ZGKA 5FPEA 4O8UA 4PGHA 4U87A 1JE8A 1C1BA 3K5OA 5AQZA 4H0VB 4M7DG 2XRLA 5GPCA 3DBRB 4FCYA 3T69A 4A3LJ 2GTJA 1CLQA 2IGKA 1MBFA 2L3RA 1JO8A 1LCKA 4XLPF 1XTAA 3CC4A 3P39A 5AQPA 1KQSM 2CREA 4QQ6A 1P2FA 4X6AJ 1E3OC 1PU7A 2GFUA 1HDPA 1GXIE 1O13A 3ULEB 4KIGA 3AO1A 1UHSA 1WQ2A 2E6LA 4KTZA 1VQ6N 1WNSA 1PSEA 1DTTA 2OPPA 2VYPA 4LMYA 1M1GA 1HKQA 2BXZA 3PLAA 1V55H 5TRDA 1MJ9A 4B9QA 4CEFA 4N47A 4UUSB 5BPMA 4YDUA 2LKXA 1WIEA 1UFMA 4Z8AA 1OVYA 3SQ2A 4B3MK 3WTZA 4NHJA 3J7AP 1U45A 5F27A 1K8KB 1KU9A 1W4MA 2XV4S 3ZMUA 5AQUA 1Q81R 4KRFA 1ETWA 3A0BC 3OA9A 4HPQA 1UGVA 4XAXB 1FEXA 5DTDA 3THYB 3V8KA 5LJ5d 3H5NA 2DA6A 2WAEA 3CD6Q 1JU5C 1BGXT 3ME9A 4DBRA 1HJRA 5I22A 3IDHA 5BREA 1F5TA 3VENA 5FU7B 3CC2A 4FW1A 1HSTA 1JLFA 2E3HA 2R58A 4B9SA 5B3SH 4Z4GA 2RQRA 2EILH 3QMLA 1U47A 3T9NA 1VQMT 2C0OA 3I55Q 1J0RA 5DMRA 1Z9ZA 1BJZA 1KYZA 1HPMA 2VPLA 3Q9SA 2A05A 1RDBA 2EA2A 2OPSA 3CD6N 3OV8A 2LBFA 1UELB 3HGYA 1SAXA 3DLKA 4CEQA 3G4SA 4HUGA 3LH5A 1RR8C 4B21A 4L18B 2VQGA 2NRTA 2CP7A 2YV0X 4F7UB 4JS4A 3IHUA 2X9HA 4E7ZA 2XAJA 4CGJA 1D5YA 5ICFA 4B1WB 4HNUA 2O2OA 1WAJA 4YOTA 4EMHA 4YPHA 2GELA 3NF6A 3SDZA 3WHBA 2IVNA 4RB3C 3NHNA 2P5KA 5HDNA 3I55N 5KRSA 3JCMf 1S7EA 3DTEA 3RPQA 4I6MA 1NK6A 2YS9A 1X3UA 1PC0A 5BN8A 5DCFA 3KP2A 3OW2M 2KIFA 2CGLA 1VZ0A 1OV3A 4FYXB 2IS4A 2MLGA 3JSPA 1ZN2A 1DGRM 2HBKA 2XY6A 4OPAA 4EMKC 2MIOA 1IXDA 2PBDA 4DCHA 1T38A 3FC3A 5KGXA 2OTJQ 3VS1A 2ZJPF 1TWAJ 5JVHL 3OYCA 5FB2A 3INZA 3GZNB 1Y96B 5LRSA 5I42A 2RAEA 1QRYA 3LFUA 2DJZA 1R4MB 1O9SA 1SFOJ 4OX9K 1WHUA 3LDLA 4PKGA 3KD5E 1B72A 1YRNA 2K7LA 1WWXA 2KIQA 5AQIA 3HRTA 1R1TA 4MZTA 4C23A 2PZSA 1FWZA 3CF2A 2R3SA 2X4WA 2BV6A 4BC4A 2IJLA 2QA4T 4AVZA 1JJ6C 2CFOA 2ZJRF 4ESBA 4IOAF 2OTJN 4A3IJ 3ENBA 3VS7A 4KHNA 4B43A 2CP5A 1X27A 2AO9A 2OC6A 4CCNA 1YCSB 1T0JA 1YUWA 2VXEA 5J1YA 4CGFA 1NK9A 2DU9A 2V8KA 5IAYA 2CUFA 2J6FA 4BE2A 5E1ZB 4CJ7A 5H1SQ 3M57A 3MKYB 1Y7XA 4PJ0C 2RK2A 1U48A 2O6GE 4BHCA 2PI0A 3ZL7C 2K3PA 3O1BA 4JK1X 4FYYB 5CQXA 3SPZA 4IIOA 1ZRDA 3QRFF 2I10A 3PY8A 4IZ9A 2E34A 4OGEA 2R7VA 3NH2A 2IW5A 3W3CA 2HNDA 4MDWA 4UVCA 5IT9Z 2HF3A 4M41A 2YUOA 3IHOA 1IKYA 3OIPA 2JN0A 1IO2A 2KYBA 2DPDA 2DTRA 3H46O 4IJNA 3JRIA 5IP6A 1G3WA 2ZMEC 1YFHA 3K59A 3W6JB 3Q9VA 4XKCA 2V1QA 1R9TJ 4WXHA 5LMUK 2WACA 3HOTA 3J81E 1REPC 3OL4A 4CESA 4M75G 1HW1A 2JQ7A 2VOOA 3U3GA 2Q0UA 2JWTA 3ZCOA 2IS1A 4LG0A 5M5YJ 1RNHA 4ZDOA 1QQNA 5GMKe 2WOMA 2GEMA 4OKJA 5AR0A 5E1XA 3X25B 2IIRA 4DZPA 2L8DA 4RLFA 1Q1HA 2BE5F 5E8IA 2EFQA 1P7MA 1U6GA 3VTIA 3LM2A 4XR6A 3S1NJ 3META 3EE8A 4C3IJ 2HVHA 1WJSA 1E3HA 1UJ8A 1NGCA 3SD4A 1YE9A 4DSLA 3SB2A 1MJAA 4V2SA 4FM4B 1NK4A 4CYCA 3AG4H 4YEJA 1QZEA 2O8DA 3WQUA 3VQ7A 2RV8A 3CXCM 4ASNA 2Z2SB 1IHWA 4I98B 1NMDA 4NCAA 1AZEA 3NMUA 3VB2A 4F2RA 4XTXA 3NVMA 3J80Z 2ZB9A 2DMNA 3QEPA 4IDKA 1KFSA 3VS0A 1TNTA 3QU6A 1O1WA 1XG7A 1BI4A 5GAOp 2R7ZJ 3EG9B 2CP0A 4CGIA 3TU4K 5ILSA 2A6TA 3RMDA 3E5QA 5L23A 1K73R 4XBFA 1JJ2M 1TS9A 3J7AF 2VI6A 1Y57A 1YITQ 2CV0A 2CV1A 1H3ZA 3DPTA 3V9SA 3F21A 2Z1JA 2X1DA 4JI2K 4CE9A 2FBYA 3JTHA 1V3FA 1HQEA 4M7XA 2GTOA 1MMGA 2LNBA 2NXNB 2RI5A 2LC2A 1W0UA 3VDXA 2FBXA 2DPUA 3JCMQ 2XHKA 4C92A 1FK9A 2NOEA 4Q0BA 4PZJA 3OW2A 1F36A 4E1JA 4NCBA 1ON2A 1VIEA 3CCVT 4A6EA 2YNFA 3TPQA 2BBYA 3HOZJ 3BQYA 1HXDA 1HKTA 3J7ZO 5GANj 1YITN 1NJIU 4BQNA 1NK3P 1NEBA 2R7OA 2VWKA 3AY9A 2E5QA 3GTQJ 5L3GA 2CYZB 4WFAL 3WU1B 4EEFG 3FMSA 1DQUA 2LD5A 1WSEA 3GMEA 2CH4A 5CKFA 4BJ5C 2KKZA 3OS2A 2VODA 4EMSA 4M3XA 2UXDK 1UECA 3TAFA 1XPXA 1T95A 2F9TA 3GL1A 1A6QA 2D0QB 3E9OA 2LG4A 3ABUA 4EP4A 1ONVA 3TQNA 1SL0A 3C12A 4FE7A 1SVLA 2XRNA 5A2QZ 3D2FA 4C0GA 4A4KA 2C06A 1POGA 4O5BA 2VCPA 1SEUA 4C30A 2EGCA 2WTUA 4RMNA 4HCCA 1YVUA 2UUCK 2J06A 1Q82U 4B09A 3ATVA 1YIJI 3B6AA 1I5ZA 1LWFA 1MBJA 2OQGA 1BO5O 2XO7A 1NYFA 4BI3A 1VSJA 2PMZN 5M1OA 1WOQA 1TNSA 1NJIC 1KD1U 5CYVA 3RSEB 5M1FA 5KYUA 2X9DA 3F10A 2K2MA 2G0EA 4H0TB 4FZZA 4B8AB 1K9MR 1NM7A 1OX8A 2RE2A 3OOUA 2AZSA 3TO9A 3QPSA 1DPUA 5E3NA 5ECAA 4JJDA 3QFUA 4E7SA 3RWUA 2YG8A 1WHKA 2ED1A 1HYSA 2P5LC 3MXIA 2M0CA 1KSPA 4E47A 1QKWA 3CIPA 4XL9A 3M6GA 1I3QJ 2KJCA 2BY0A 2M7AA 1WLJA 4CHOA 1XCVA 4XRMA 2P9KA 2EZKA 1T6CA 4DTPA 1IAWA 3L7WA 1U5TA 1R7JA 4RAYA 4GYIA 3CDHA 1X3ZB 5KN8A 1WLPB 1G3TA 3FFKB 2CUJA 3H8ZA 5IHNA 2QK9A 1J6ZA 1KD1C 3BEXA 4BRIA 2F4IA 3CPWM 3CDLA 1OQKA 3BR2A 2AIRB 2A42A 5KI6A 1YQRA 1ZC6A 1UGSB 4I2OA 3TMOA 3DPLC 3CF5L 5KYWB 4J6XA 4B08A 2RM4A 1LCUA 3SYTA 2EJGA 4FU6A 2ESWA 4AH9A 1XI1A 5KHDA 4NS5A 1UJYA 4FT4A 2K9NA 4IKFA 1NGFA 1P92A 2B63J 2XIDA 4ICLA 1VQ5T 2PLYA 3GTPJ 4V19S 2FZCB 3GFIA 1C1CA 2XAUA 4EJVA 4O3MA 1LW2A 1MV0B 2NYXA 1MMNA 1MZBA 3VYTB 3VQ9A 5LHIA 1S72I 4ETSA 3JAMK 4RKUE 3OYDA 4E2FB 1MBKA 4UB8C 4KREA 3DEEA 3K70D 5F1JA 3CCJA 5FO5A 5IT9K 1IV0A 3RJPA 3JV3A 3CCMA 4KHPK 4CVNE 4B23A 3U9GA 3U23A 2ID6A 3SFIA 5FJ8J 3SLCA 4F14A 2IVWA 3GTJJ 1JRIA 4QLCU 3HTRA 2QWMA 1VQ9I 4JP0A 1I81A 1P9QC 4VUBA 4YNQA 2A5YB 2DI3A 2E5ZA 1XNRK 1RBSA 3BZCA 2JTFA 1RT7A 3HM8A 3SAHA 4Y33A 3A8GB 4IRHA 1VQMA 1W36D 4C0FA 3DLBA 2KK4A 3AA5X 1VQPI 1R0BG 2VXFA 2W0ZA 4A59A 4WCEL 4A5MA 4QCLA 1VK0A 4UXNA 3KIOA 4KIBA 1T0FA 2DYIA 4KUMA 4IX7A 1SC7A 3O1WA 2NUTB 3QKJA 3E1YA 1OH6A 1K8AO 3IRRA 1LDKB 1H9TA 1I5LA 4FLUA 1X1BA 1IKWA 5GAN3 2XB5A 2DMOA 4JI4K 1ASUA 2QLZA 1TWHJ 3H36A 1QHAA 3IKMA 5J1EA 1N9RA 2OI3A 4JRKA 2BY2A 1XCBA 2ELJA 1VQNT 5D3GA 1KU7A 3A2KA 2VBYA 4IRIA 3O8VA 4ZNXA 1K7AA 1EJ9A 5AZIB 1MIJA 4CI0C 1X2MA 2CS7A 5LJ5e 4CHUA 5M1QA 4BR2A 4ZZLA 1IG9A 1B3QA 3QWYA 1LWCA 4O0JA 2O8CB 1M1FA 1Z05A 3PO2J 3J80K 1KG4A 3A01B 3H92A 5DD4A 2WADA 5E3OA 4C8QB 4CHYA 5LGTA 4LF5K 2VKDA 1DT9A 2VQLA 2HHSA 4I9QA 4HX4A 4ELYC 3H0DA 4S0HB 3HHTB 2Y0MA 4FQGA 1MW7A 1Q86R 1DDNA 4BAYA 1ZBLA 2CQ7A 4CEAA 3VQBA 3SUNA 4C92G 5FU7C 2YCHA 1RL2A 4JHDA 4MDAA 4C2MJ 4FWOA 1D0ZA 5LJ5j 4A3BJ 4PL7A 3T1YK 4ZTJA 2KQRA 4A4EA 1KRPA 1LOTB 3HTVA 4KJZA 2GCXA 2JMWA 3ECHA 2XGCA 5GAOq 1VSKA 3D2EA 1VQ7I 2VONA 3VEXA 4JKGB 2DNUA 3EG0A 2FPFA 3M0QA 3FM5A 2FXUA 3K2AA 1X58A 2E19A 2P6TA 5JLWA 3PO3J 3VQAA 3WNFA 2NOFA 2B6AA 5I3UA 2LNVA 2XROA 4FOIA 3U21A 4ENMA 2YHBA 1RGIA 1U4BA 2DM1A 2GOMA 3RI4A 2ZGZA 4A3MJ 5GAHJ 3NGIA 4W5NA 1RDCA 2E6MA 3ZXSA 2KT0A 4A3GJ 4L0YB 3O9TA 4DFMA 1K61A 3MWMA 3D5LA 1VRTA 4EM0B 2FF4A 3B8AX 2PFBA 3NCIA 5A2QK 2L4MA 5DUIA 1IJWC 3L4QA 3F73A 3H1VX 4FSVA 4OMLA 3JCUC 5D5UB 1D0YA 1J75A 3OYHA 2CDTA 2VKNA 2M2EA 1SKWA 4RA2A 1I4K1 3ZLJA 4XTWA 3H3OB 2KFNA 4BC5A 3KKSA 3GYHX 2E6NA 3MX2A 1ATRA 1PUEE 4XKBA 4FJJA 4KO0A 3ULRB 4P5NA 1HRHA 1HNVA 5EU7A 2P8TA 1D5AA 1QU3A 4UUTA 3FXQA 4R0KA 5FD6A 5EXWA 3F0CA 2R0QC 1RAGB 2O4GA 3RMCA 4IJAA 1WJBA 3CCEI 5CJ9A 3WXKA 1G2HA 2PNIA 4FJMA 2F96A 4II1A 1HX1A 3WVDB 3S14J 1MGQA 1NU0A 3ASKA 3JRCA 2DVJA 4KFCA 3HVTA 1PHTA 3PGGA 4OMOA 5CLSA 1QVUA 2WONA 4AHSA 2ECCA 1RLQC 3BCBA 5LMNK 2JG6A 2JA7J 4KI4A 4A4FA 3KEYA 1VYUA 1S22A 1LFBA 4BH9A 2KROA 5HLIA 1WCMJ 4B9TA 3PIOL 4F7UE 1KEAA 5JFRA 1UHFA 2V6CA 1L0OC 5C25A 3JB9F 4QW2A 4KV8A 2DD5A 2RKHA 1BDGA 2PTKA 1CF7A 2X1EA 4BXFA 4NXNK 1HW5A 3SJMA 5KCMA 4KGXB 3AVCA 3DAWA 2L0AA 4BKXA 2EYQA 3HT3A 4RB1A 2LRDA 4G7OF 2DKGA 3N5NX 3HJEA 1V29B 4A5NA 1WH7A 1HU0A 1S72Q 1QNTA 4CJLA 4K2EA 4FK2A 1Y71A 1M3BA 5IYDJ 1YOVB 3TEDA 1TC3C 1X4OA 4JQFA 1Y64A 3M54A 2OZMA 1APLC 3TTCA 5CYMA 3UNGC 1IBLK 3G71T 1M3QA 1MNMC 3CCVA 3AO4A 3F8NA 3A4CA 2EKHA 2E2PA 3MAQA 2R7FA 1IRFA 3QYFA 2NRAC 5AQWA 1I50J 1VQ9Q 4ZYDA 3MP8A 4LXCA 1S5JA 3PX0A 3C2HA 2NOGA 4DNCA 3LSIA 3CJRB 3GWZA 1QQIA 2KY9A 1WB9A 1S72N 2UUAK 2QEXT 1WAFA 3K9TA 1Z1DA 5TJJA 1RTIA 3I54A 2R5YA 3DQVC 3JCMV 4OF1A 4C8QD 1W1FA 1YWOA 3GVAA 2EZLA 3I35A 1VAZA 3I53A 3SAFA 3DP7A 1D1BA 4KN7X 4IG3A 3PM1A 3BDUA 2R5ZB 2ZXIA 1RRSA 3DXMB 1RBRA 5F2RA 4ZN3A 3KFVA 1VQ9N 2ZPIB 4C5GA 4ESFA 4W97A 3V1OA 3FDYA 3QINA 3IV5A 3OS5A 1WUAA 2JWKA 4KNYA 1NZ9A 4OAZA 1TU0B 2QGFB 4IOXA 4E3SA 4D7NA 5LEJA 3VOVA 2DA3A 1TWCJ 1PU8A 3ULQB 5LHGA 5GAMj 1NG6A 1TKDA 2WY7Q 3WQTA 4JD2B 2F7TA 4DTUA 2IRFG 1VTNC 2BE7D 1H641 1YI2T 1FW6A 3JXUA 1ZH5A 1TGOA 4BY6B 4CC7A 3R9PA 2STTA 1IJJA 3KK7A 2QG9B 1HDDC 2OU2A 3HB9A 5LJ5g 4L9NA 3NBPA 3OBWA 3FKJA 4DEXA 4WQ5A 3MQ0A 4X62K 3K1MA 4XLEA 2KZVA 2Q3SA 1VHXA 2D0BA 1S9HA 3RQ4A 4G1QA 1A5VA 5JLFA 4OIOF 4KITB 4BDPA 2KSSA 2GX9A 4NO7A 1V5FA 2LY1A 2DRMA 2DAQA 2IOCA 1KIKA 1IUYA 3VS3A 5AQXA 3FRNA 4XORA 4YFNF 4A3DJ 1IG7A 2EINH 3M59A 4M7DF 3FK6A 1WQWA 1AVZC 4J6WA 1OVQA 5CQGA 3CCQQ 3VQ6A 3K9JA 4B9WA 5D6FA 3ELKA 2M7BA 2RHXA 3WEEA 1AWJA 2BVLA 1MH3A 3G3ZA 1VI0A 3V6DA 2DW4A 4M3WA 1LVKA 3X20B 2CRGA 1KHCA 5C10A 5IWAK 2A40A 1GHCA 4U88A 2OQRA 3VQDA 4EMKA 1RBUA 1XWLA 3QPLA 2CT3A 2OJ2A 4AIAA 4LFUA 4RS8A 2NZTA 3BQZA 3JAME 3P1GA 5CVUA 3QNNA 3CCQN 4TV7A 4DF4A 5IT9E 2JA5J 2H8WA 3A5ZB 2GBZA 2WSFE 3CG7A 2L9VA 3OL3A 2QWLA 2HAXA 4L5JA 3M1CA 4MIMA 3DPUA 5EVZA 2QGUA 2EGEA 2QUFA 3QO9A 3JSMA 3CCLI 4L6V5 2DDAA 3OW2S 2VL8A 3IC7A 1NWKA 4MTEA 1Q81U 1HNIA 4IOCL 3MDQA 2JTVA 2YUQA 2P1JA 1B6AA 3WTWC 1BIAA 1QE1A 4OB0B 4CICA 1KC8R 4RBOA 2XRIA 1ATSA 1BB9A 5CZ1A 3VA3A 1L3LA 2L7KA 4ZYHA 3FIFA 3UB5A 1FMKA 3ZSQA 3ISPA 1DP7P 1EIFA 4RMOA 1USTA 3IH2A 2BW3A 2K7AA 3CCEQ 2HBMA 3QG1A 1HQUA 3T1HK 3HPWA 5M5XJ 2OD5A 2JS0A 1MDUB 4BC3A 3DTKA 3FLGA 1UAXA 2RPNA 1NJIO 1TLHB 4MMLA 2ZMEA 1QLYA 2GIZA 1KGSA 3CO6C 1NGJA 1O3RA 3ROUA 2H3GX 4EATA 2P9PA 3U3YA 2YHAA 1F1BB 5EZGA 4BB7A 5GP9A 3OYKA 4CF2A 1MKMA 4PNOA 3EKUA 4PUSA 1ABOA 4LC9B 4CXFA 3J80E 4MO5A 2ME6A 4K42A 2WSEE 1CXQA 1Q81C 3FBIB 1J59A 2CO5A 3CCEN 1ZGAA 3VQPA 3VN5A 5TKYA 4FYDA 1XGOA 4H0PA 6PAXA 2FPDA 4DFJA 2EJFA 3S9HA 1YIJA 4YRVA 4UV9A 4H0EA 2HR3A 2K9QA 2JM8A 1HKSA 4DU3A 4HSBA 4RTZA 1QVTA 5KPTA 4EAHD 4W5OA 1YJNI 3A5LC 2HKXA 2Z9OA 1ESVA 2RO0A 2VJ5A 1SMYF 3CCST 2XY7A 1UEBA 3GEZA 2X78A 3AAFA 2C0TA 4NUBA 1MDMB 2XD0A 1FOKA 2FXAA 1HLUA 3G7ZA 4CC3A 3P4IA 2EV6A 1TYQB 2J6OA 2HXOA 3JB9J 4D8KA 2G3RA 2OCCH 5B1BH 3ZOBA 5CHZA 1OYWA 2DFFA 2UUBK 2QA4Q 2XSDC 3NTHA 1ASWA 3N4MA 3P83D 4JI7K 2A6EF 3SZGA 1G5VA 3H45C 2HBLA 5J8FA 3M4OJ 1KQ2A 3OYFA 3LNQA 3WNEA 4FYWB 1XMQK 3TABA 1SSHA 4RTVA 4JI6K 2NVYJ 1WHMA 2EBPA 4I0BA 3VQ4A 4C2TA 3K1PA 4JDSA 4XEIA 2CH6A 4HHTA 3CF5F 1HR0K 4J9IA 1L5UA 1VQLT 4KYWA 1RDDA 2QA4N 2M5WA 3BJ6A 2CZ6B 5HRSA 3BR6A 1IZ6A 1Z3XA 5A2QE 1PCXA 2A5XA 1FX7A 1YT3A 3TANA 4OPJA 2PY5A 2LKPA 5BPDA 4KFBA 3BLYA 1QSYA 2H1LA 4YTLA 4XU2A 4V2FA 1Q7YR 5K7HA 2YU9J 4M75F 1IDYA 3CVTA 3TEEA 2B4JA 2MMPA 4PJNA 1M30A 2KZGA 3AL0B 2Q2EA 1QSSA 1PM3A 2KT1A 3QDRB 5AQMA 4KKOA 2O8XA 2CH4W 5CY4A 3I8DA 1U2VA 1NKEA 1IRGA 5L3DA 5IOZA 1QS4A 1WEFA 3SHWA 1SS6A 5E20A 2NOLA 3F0ZA 3M4YA 5LJ5f 4N5SA 4MZPA 1RCHA 5JR3A 2V1UA 4BU2A 3OB9A 4GVEA 1TW3A 1FTZA 4XOTA 3CC7T 2R7DA 3OQ5A 1Z26A 3GLLA 2P0PA 1H8AC 4UB6C 3G6EI 3IP4B 4Z4CA 3RKQA 1X1DA 2OA4A 2Z1IA 1VQPA 4Z2YA 2MOXA 1TSFA 3I0SA 5CZ2A 3VJPA 1ZSGA 2F6CA 2QWNA 2D5RA 4A0XA 3P31A 4ZDLA 5DCMA 3H35A 4FHTA 2O8FB 3LP1A 4BY9C 2FNPA 4RAFA 1VQKI 2IBDA 1IHVA 2WB1A 2HL5C 2YNGA 1LV5A 4HF1A 2ELKA 3ZQ7A 1IV6A 4OO1J 2Y1IA 3O8MA 1FSHA 4B3XA 2CP2A 2ZQBA 2Q2RA 2ZPFB 1O7LA 4BHPA 2XKPA 4M3RA 1YHQT 1A04A 3QB0A 1MWKA 4B9VA 5LL6Z 1MBEA 2LFBA 2MD0A 5KYXA 1UB4A 1U78A 3VFZA 4M42A 3TP3A 2Z16A 5DEQA 1FJLA 3NFCA 3LWFA 1WPYA 3LWLA 4G7ZF 1M1KO 1K73U 4CJEA 4C8QE 3HBLA 4M75C 2LJ3A 1UG2A 1SD4A 3ECOA 3ML6A 3ZT0A 3SQ0A 3DRRA 5F6FA 5A0DA 4ENKA 4AILC 1K78A 4FK4A 4Y17A 3G1JA 4CZEA 3OW2P 1IKXA 1GCQC 1NNEA 3KE2A 3CCLQ 3I56I 3SEQA 2H09A 3KP5A 2ZE2A 1QO0D 2KBTA 1N36K 2IVMA 4CF9A 5HLTA 1MH4A 2QEXA 3TGNA 4BRNA 3ENOA 1OQYA 3QEXA 4OKKA 4K8ZA 4BG9A 1GLDG 2BTFA 1REVA 3ZEUB 2HWVA 5H2FC 4Y28E 2HSPA 2RDPA 4RM2A 1RUNA 2OPQA 3K4CA 1HKGA 2LTPA 3RERA 1WRJA 4OIRF 4KICA 3MZHA 3SCXA 4CRIA 5C6SA 1Q9YA 1EH6A 3HZJA 4P55A 4ZGJB 4DB3A 4RW9A 3CCLN 5KRTA 1K73C 3FJPA 1VQ7A 2QASA 5ADXA 2LT4A 3LAPA 4LIVA 1YTYA 4JJBA 5L8RE 5IXBA 1IGUA 1C0FA 4O5FA 2PUKB 3Q0WA 2EA4A 5M1KA 3BG3A 4XONA 5AQRA 4JJCA 5CVJA 3ZX3A 4BUGA 4CGHA 3HOYJ 4J83A 4D9JA 3C6UA 1HSQA 2LH9A 3S16J 2KR3A 1YI2A 1BA1A 2E71A 2QWWA 3CQ8A 2WC2A 3LDPA 2VBZA 4CCKA 5E18F 5EG0A 3MEEA 3UKUA 3QP6A 1XGSA 1QVFM 2RNJA 4W5TA 1N39A 4Y3OA 1YFNA 4M9XA 1U9OA 3G73A 4EIKA 3QEIA 1V5EA 3HM9A 1ZA1B 2HZTA 2XUBA 3PVQA 1N8RR 3W2WA 2XGXA 2XAGA 3KUFA 3BR0A 1BIUA 3H0IA 2P7CB 5LJ3d 2HD0A 4QAGA 4IVNA 3BPVA 2W41A 1YJNQ 3BJOA 4DTRA 3CWTA 4MQVA 4DU4A 3MWTA 2VVKA 4HUFA 3HP9A 1C0UA 4XTZA 1EXQA 2AKKA 1XHXA 2ASMA 4YOQA 4CA0A 1RI7A 4I01A 3LDSA 2V8JA 3ULEA 2NRHA 3AA4A 4OVAA 2HPIA 3HSRA 2CSOA 1LPLA 1D8JA 4HUEA 4BWJA 4IQ4A 3BGRA 3MEXA 5M3FJ 3RTVA 1DTQA 1E6GA 2GQQA 4YG2F 1PKTA 1NJZA 4A3JJ 4N4HA 2D1KA 2JSPA 1BBYA 3GFLA 2AP1A 4UUSA 3KTUA 5KN9A 2NOZA 1YJNN 2P9SB 3RKYA 2HQRA 2UXXA 3NE6A 2ATCB 1R4NB 1A5WA 1RDUA