3S3MA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/inhibitor/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3mA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3mA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3mA03
3NH0A 4FJNA 3QNOA 3TAEA 3NHGA 5HROA 2HMIA 4HCCA 4B3OA 3DM2A 4EP5A 1L3VA 1UAXA 2XO7A 4KB0A 1L3UA 1RDBA 4HUFA 3L42A 4F3OA 1S5JA 4KFBA 2GV9A 2XRIA 4I2QA 3O3HA 4BACA 3LGFA 4DF8A 1KLNA 1SV5A 1QTMA 4KHQA 1BI4B 4IFYA 1G5VA 1C6VA 4JLHA 1ZYQA 4LD6A 1SKSA 1XHZA 4KTQA 3LYIA 3ZSOA 3VQ8A 4F4KA 1BISA 2W42A 2IGIA 1VRTA 3HK2A 4Y1DA 2HNZA 3NF9A 3PFSA 5KRTA 2HVHA 1OZ3A 4DTOA 1SL2A 3FFIA 2OZMA 4M3ZA 1N6QA 3QEVA 1KSPA 3V1RA 4DQSA 5CY4A 2FBYA 1BQNA 3DOLA 4CFCA 4FW1A 4FLZA 4RW6A 2PZSA 3S3OA 1W0HA 2YHBA 1SSFA 3DMJA 4DLGA 2P5OA 3LDSA 3ZSZA 2DTUA 3I0RA 5FROA 4EZ6A 4NCBA 2OZSA 1NK7A 5IN1A 4AHTA 4FLWA 5KH6A 1H3ZA 4AHSA 4CJQA 4B9VA 1S1TA 4IUVA 1BHLA 4CHYA 2R5MA 2YRVA 1BI4A 1J54A 3S6WA 1QQCA 3QINA 4KV8A 1NOYA 3TAMA 2L8DA 4OPJA 4I7FA 4WE1A 3IAYA 4RW9A 4C8MA 1TL1A 3MAQA 4BE2A 4KB1A 4CEDA 4F2RA 3MEEA 1NK6A 4M3TA 3WNGA 3NFAA 1XNIA 4E7JA 3OYBA 2P51A 2P0KA 1S9EA 3AVLA 3AVMA 2WONA 5C42A 3FLGA 3E9FA 3L3VA 4W5QA 2HQXA 3RMDA 2EFIA 1R0AA 1RDDA 3VQQA 4ELUA 1O1WA 2DFHA 3P5JA 3PV8A 1X9MA 1MU2A 4M3YA 4J2EA 2BANA 3VA0A 1JKHA 3ASKA 4E19A 3SQ0A 3MEUA 1G15A 4CE9A 4DSIA 3NTHA 1VSFA 1WSJA 3JSMA 3KIOA 1WSIA 3G0ZA 4LD0A 1NOZA 3M8PA 5J2NA 3CG7A 3OYAA 1DTTA 2DAQA 3EAEA 3D0PA 3C6TA 4XIUA 4FLUA 1HRHA 3DB4A 3NTKA 4JRQA 1NJYA 5C25A 2K3YA 3PX4A 3LP2A 3LZJA 1TK8A 4OVAA 2RF2A 1YTUA 3MEWA 5I42A 3SI6A 2EQKA 4AILC 1Q9XA 3C4SA 3K5NA 3B6OA 3HYFA 3ZSRA 1NK4A 2WOMA 4N4IA 1EETA 3L3UA 3M8QA 4BWJA 2D0CA 4CF0A 5KGXA 1NJZA 4K8XA 1IKYA 3NDKA 4Z4FA 4ZTFA 1MHNA 1IG9A 1WSHA 4DG1A 4NS5A 1A5XA 2JZ2A 3OQ5A 4CGJA 4JS4A 3TI0A 4AHCA 4B9WA 3NNQA 3AVNA 1C0MA 1VK0A 3LZIA 4DU3A 1I39A 4BDPA 3HJFA 3VQ6A 2VWJA 3ZT2A 2HW3A 1S9GA 4LSNA 3OYIA 3VQEA 4C8KA 1D5AA 1NJXA 3ZSQA 4BWMA 4CFDA 3ALYA 3AO1A 2DIQA 4OKEA 2DFEA 1LW2A 3DLHA 3CEYA 4DWIA 2HNYA 4IG0A 4KRFA 4C8NA 4FJKA 4DLEA 2F8SA 3AA3A 2YNIA 3OYEA 4OGCA 2GFUA 4QW2A 4DFPA 1KRPA 2B5JA 3V9UA 1T03A 1RT3A 5D3GA 1GOBA 3QBYA 3RMBA 4KHWA 2HQEA 4CHNA 4ICLA 3QEWA 1JL1A 4OKKA 2G8VA 3KTQA 4Z0UA 1TKXA 3OYNA 3O8VA 3DI6A 1N27A 4Y1CA 2LDMA 4DMNA 3AO2A 4K8ZA 3LP3A 2JGUA 1S1WA 5EU7A 1NK5A 1JLQA 2Y1IA 5KRSA 3CFOA 4MQ3A 1TGOA 3NH1A 4C8OA 4A4FA 1RCHA 1WSFA 3G10A 3CQ8A 2OYQA 2GFAA 4CF1A 3TANA 4CJSA 4FJLA 5KE3A 5E41A 4N56A 3VQBA 2O4XA 4BDYA 3QLHA 3KLEA 3AA4A 2KZMA 2Z1IA 1ASWA 3OJSA 4BE1A 3HP6A 4PLIA 4B9XA 3TR8A 2L89A 1OYXA 3RR8A 2BKDN 1RBTA 3ZSVA 2JLEA 4DTNA 1TL3A 4Z4IA 3NF7A 4Z4GA 4QAGA 4E3SA 3HP9A 2RHIA 2G3RA 4BD3A 1BCOA 1IKXA 1WAFA 2QK9A 4GY5A 3QEXA 4IUPA 1RBRA 3Q1JA 1VRUA 2OPSA 3ISNC 3QIPA 1ASVA 4FCYA 2XY8A 3QEPA 3DRPA 1ITGA 4CJRA 3AVFA 2F5KA 2IC3A 4B9MA 3O4NA 3SJJA 5D6XA 3ZT4A 3SUNA 1D9DA 2KFNA 4O55A 4E7LA 3LPTA 3PUFA 2LCCA 3KKRA 4FJXA 1VSEA 2YV0X 3TAFA 2MWPA 4KI4A 4CF8A 4QQGA 4FZXC 1Z26A 4CEOA 3LWLA 4HHTA 3H8ZA 3DLEA 4O5BA 3V9WA 4J2BA 1RT2A 5FRMA 1Y97A 1NKBA 1L3TA 4ZTJA 4CIFA 4H8KA 3HPHA 3ZT3A 4CHPA 3KJVA 3MP1A 3K59A 3KUFA 3MP8A 2ZD1A 4DFMA 3SPYA 1S6PA 2LTOA 1Z25A 3MXIA 1KHCA 4PA1A 1ZBFA 1HJRA 2FBXA 2FBTA 4HCZA 1JLFA 3MP6A 1A5WA 2B6AA 1B92A 4CEFA 4M41A 4CHOA 4HUEA 2HHQA 2PQWA 1TKZA 2A1SA 4CHQA 3AO3A 5CYMA 2X78A 3SV3A 4DSJA 4DQRA 4FZYA 2IAJA 4KAZA 3DRRA 4KHNA 4W5TA 3MEAA 3DB3A 3K57A 4PL6A 4B9SA 3L2WA 3ZSXA 1CXUA 1ZBLA 3HO1A 2HHSA 1CZBA 4ELTA 1VSJA 2ETJA 3DYAA 3NBPA 1IO2A 4LY7A 5HRNA 2JTFA 4O44A 1QS4A 3T3FA 4NZGA 1C0UA 3F73A 3H08A 4RW7A 1JLBA 1XI1A 2P1JA 3OMCA 3PX0A 1KCFA 3VQ5A 5J2QA 4FK2A 2LSNA 3ULDA 3ZCMA 5JS2A 5HRPA 4DQPA 4B8AB 4DU4A 3THVA 4LSLA 2R5AA 2IDOA 4C5EA 1NJWA 1HMVA 2YHAA 4B8CA 3NH2A 1RT7A 3P8HA 4IUQA 3FC3A 4OPKA 3HT3A 3M8RA 1ZBHA 3LALA 4KHUA 3AA5X 3MEGA 4CJFA 4OLAA 4FJ8A 2YKNA 4Z4EA 4M45A 1QSLA 2XY7A 3OYHA 3V9SA 4CECA 3S9HA 5SZTA 3QIIA 3QKJA 4E0DA 3OMGA 5IAYA 2F96A 3D45A 3VQDA 4GVMA 2KQ2A 3V1QA 4CJ3A 4DSFA 4DFKA 2XY6A 3VQAA 2AJQA 1JXEA 3AO5A 2OPPA 3L2VA 3K58A 4HUGA 1NK0A 1BL3A 3DLMA 3PX6A 1WJSA 4Z02A 2RI5A 2HNDA 2I5JA 2WACA 4A4HA 2NLUA 1WJRA 4C5IA 1I3AA 3OB9A 2K3XA 1UWBA 1JLEA 3V9XA 1RTDA 3PNWC 2QQRA 1ZBUA 2O4XB 1KLMA 1K6YA 2FBVA 3E01A 3LAMA 3PY8A 5KTQA 4OJRA 1HQUA 2BIVA 1RNHA 3GOXA 4Z4CA 1U47A 1QSSA 5D6WA 1S1XA 4KI6A 3NTIA 1KTQA 1QE1A 4FM2A 4FJHA 3C94A 1RT5A 3K5LA 5J39A 1HYSA 3KLHA 1X1PA 4CGIA 1U04A 3HM9A 2KTQA 4CK2A 2Q3SA 2HHUA 2CKKA 3AVKA 3K2PA 4ZHRA 3O3FA 5FRNA 4FXDA 1GOCA 4CHZA 3NCIA 1TKDA 1T05A 4KPYA 3FEOA 3MXJA 5I3UA 2B4JA 3DLGA 3ASMA 1LW0A 1RILA 1W9HA 3KLIA 4B9UA 4CJPA 4C5HA 2RPIA 1RT1A 3LPUA 3WNEA 4YFUA 3MEDA 2OPRA 2B8AA 4O0IA 4M3XA 1F21A 2X74A 4HCBA 1B9FA 1EP4A 4FJGA 1HQEA 3K5OA 3OYKA 3KLFA 3OVNA 2Z1GA 4CJLA 2YNFA 3IRXA 4CK3A 3LH0A 5C6SA 3ZEHA 3HPOA 4FLTA 2ZQBA 4DU1A 1RDAA 4DTRA 3QERA 2BGGA 4CESA 1RI0A 4IBNA 3OYMA 5C0MA 5D6YA 1SUQA 5SWMA 2DY4A 4NCGA 4PY5A 4G1QA 3TWHA 4RW8A 2KZZA 1UOCA 1FK9A 4RG8A 2Y1JA 1J5OA 4JRPA 4OGEA 3S3MA 3EYZA 4DS5A 1D8YA 2E6NA 3HVTA 4CEBA 3RMAA 1LV5A 3NE6A 4IDKA 2RN2A 1WSEA 2X4XA 5KI6A 4FM1A 1TK5A 4L8RB 4FYDA 3KD1E 2OA8A 4CCHA 1D9FA 3SQ4A 5C24A 1JL2A 3AV9A 4FJMA 1B9DA 5JS1A 1JXBA 4IG3A 4FLYA 4DS4A 1VSKA 1U4BA 4FM0A 4B9TA 3F70A 3AVHA 2EX3A 3FDRA 3KK3A 3RMCA 4B9NA 1BIUA 4DQQA 4FZZA 4PUOA 3ME9A 3MECA 4E1MA 4FVMA 3U6FA 2KFZA 4Z4HA 3AVJA 2D5RA 2EKOA 2HHVA 1SL0A 5CIUA 1DLOA 4YNQA 1C1BA 2P5GA 4N76A 3PMIA 3UWNA 1CZ9A 3CM6A 3IG1A 1TK0A 4RW4A 4CJWA 1JLCA 3P8DA 1YVUA 4KO0A 5CYQA 3OS0A 3AA2A 3S3NA 2RJEA 4C5GA 4R5PA 3CFRA 1X9SA 2YNHA 2HHTA 3SNNA 3L2RA 4N4GA 4EP4A 4QQ6A 4DSKA 4DSLA 3UIQA 2LRQA 5J26A 3OJUA 5J2MA 3SUOA 2QKBA 4FLVA 5HLFA 4DQIA 2E5QA 2IG0A 5HP1A 2GUIA 4BDZA 2E6MA 2RHYA 3SV4A 2RO0A 3NGYA 4FJJA 4N41A 3CM5A 2HVIA 2L3RA 5KCHA 1XHXA 4TSXA 3SZ2A 3ITHA 4FJ9A 1VSMA 3SCXA 2QKKA 2EQJA 1L3SA 3I8DA 1WJQA 3VQ7A 3WNHA 1HNVA 2O4GA 4W5RA 1WSGA 4PLLA 2PYLA 1HYVA 1EXQA 4CJKA 3EZ5A 1VSHA 3HPGA 4B9LA 3CYMA 2VG5A 3C95A 4DTUA 2RHUA 2EQUA 1SKWA 2R7YA 1SL1A 3A2FA 1WAJA 1LWEA 3VQPA 4CFBA 1S1VA 3VQ9A 3BDPA 1T7PA 4IKFA 4AH9A 2FC0A 3VN5A 2O4IA 3OYDA 1LAWA 1A5VA 1WNSA 2YKMA 3RRGA 2Z1HA 3AVAA 3DLKA 3NGIA 4KHSA 4I2PA 3L2UA 2E4LA 2G8UA 1TV6A 4FU6A 2VG7A 3LANA 3OY9A 2X4YA 3QESA 3AVIA 2RKIA 2FHDA 4CERA 4CEQA 1TAUA 1TVRA 4FJ5A 4C8LA 5M9OA 5DMRA 5J2PA 1KFSA 3LP0A 2D0AA 4NYFA 3V1OA 3SUQA 3RR7A 4OLBA 1DTQA 1VSIA 2QXFA 1OI1A 3HL8A 3LP1A 4OKJA 3SQ2A 2G8IA 3AVGA 4EZ9A 1SKRA 2LVMA 1HPZA 1Q8IA 4W5OA 4DF4A 3F9KA 5FDLA 4QOZB 2RI2A 4O0JA 4CJTA 3U3YA 1NKEA 4CJUA 3SPZA 3ZT0A 4F3TA 2MWOA 3OYGA 1KFDA 3TAGA 1YTAA 4AHVA 2EHGA 1S1UA 2XY5A 1IKWA 2A1RA 3K5MA 2R57A 3O4QA 3BGRA 5HBMA 3KD5E 4LH4A 5KGWA 3QEIA 1EKEA 4AHRA 3KK2A 3NAEA 4KKOA 1VSLA 1X9WA 3PO5A 2M0OA 1U45A 2G8WA 3LX7A 3P83D 4L59A 3OS2A 4CJ4A 3QIOA 3OYLA 3VA3A 2DFFA 1RBVA 4GMJB 3TABA 4NCAA 4CEZA 3OA6A 1QSYA 2ITGA 2Z1JA 3M9QA 1WLJA 4UC4A 2X6SA 3I0SA 4HVJA 3NF8A 1RBUA 1RDCA 1WGSA 2BUDA 1S6QA 3DRSA 4FLXA 4ID5A 3VQ4A 1J9AA 5KCOA 4DSEA 2E6LA 3SD4A 4CK1A 3U3GA 3OS1A 3MXMA 3AO4A 4UQGA 3DOKA 4Q0BA 3OYCA 1FXXA 4ID1A 3HSTB 4CJVA 1L5UA 2RJFA 1KVAA 4FJ7A 4AHUA 1C1CA 3JYTA 2M16A 1BQMA 3QO9A 4M3RA 1UA0A 4E7IA 4ELVA 2IOCA 4A4GA 5DK5A 4I9QA 1QHTA 3SUPA 1RTHA 3M8SA 1GOAA 4FK0A 4CGGA 4CJEA 4RG2A 2X4WA 2M1HA 2EQMA 4KREA 5HRRA 3L2QA 1VSDA 4E89A 2G8KA 3LWMA 4FJIA 4IUUA 3T1AA 3V4IA 4PQUA 1C1AA 2ZE2A 4W5NA 1JLAA 4CIGA 3C6UA 3P1GA 3HVRA 3ZT1A 3NF6A 1Q9YA 3LAKA 4CGFA 4DTMA 3HXMA 2KW4A 2X6NA 5K14A 3V9ZA 4KTWA 3TARA 4M42A 4II1A 2OPQA 4E7HA 4A4EA 1IKVA 4CF2A 4F8RA 3TAPA 1RTJA 1XWLA 3QETA 5T7BA 3PMTA 4FL6A 3SYZA 1NK8A 4QVZA 2XHBA 1ZBIA 3EY1A 4M3WA 1HNIA 1CLQA 4DTSA 4CFAA 1ASUA 3BDLA 3O3GA 4F2SA 2RJDA 3VQCA 4CGDA 3H6ZA 2HB5A 2RHXA 3KLGA 3NGZA 3TAQA 1U49A 2BDPA 3PO4A 2QQSA 3MO8A 2VWKA 2HHXA 4IFVA 2HHWA 2D9TA 4QQDA 3T19A 4EDUA 4DTXA 1RBSA 2IS3A 4DTPA 1N5YA 4PWDA 4NYNA 4DTJA 2ATQA 1LAVA 2GBZA 2RI3A 3ZSYA 1J53A 4E7KA 1LWCA 4GW6A 3DLRA 4X34A 4E1NA 3KKSA 4HTUA 1TAQA 1LWFA 5CZ2A 4CEEA 3QJ6A 4CJ5A 3B6PA 3DLBA 3V81A 5CZ1A 2NUBA 4KTZA 3RWUA 4J2AA 5HRSA 4J2DA 1WN7A 1BCMA 1KVBA 3ZSWA 4B08A 4DFJA 2G8HA 4CRIA 5J1EA 1NK9A 3LGLA 4FW2A 4JS5A 3OYJA 1TKTA 4N5SA 3QNNA 1BGXT 1RT6A 1YT3A 3V6DA 1U48A 1C0TA 2D0BA 3WNFA 3OYFA 3RRHA 4MFBA 2RJCA 2XDPA 2G8FA 2F8TA 4CF9A 3SQ1A 4I9LA 1FKPA 3CFPA 2X35A 4IUTA 4CGHA 3L8BA 3E9GA 1CXQA 2VG6A 1XC9A 3IS9A 3RTVA 3LLRA 4Q5WA 3AVBA 2VYTA 2PY5A 4M3UA 1FKOA 1T8EA 1RT4A 3UT1A 4OVLA 4IURA 2YNGA 4BE0A 1BIZA 1KVCA 2PYJA 1REVA 4QCLA 5KE2A 2R58A 4H4MA 1RTIA 3META 4N47A 1JLGA 4O4GA 2DIGA 3AVCA 1OZ2A 4Q5VA 4CEAA 3KK1A 4FK4A 3MEVA 2GF7A 4H4OA 1UA1A 1NKCA 4KHYA 4CIEA 4N4HA 2BE2A 1IH7A 2RHZA 4LH5A 2XK0A 1EX4A 1HYZA
chains in the Genus database with same CATH superfamily
1BG3A 1UGSB 2CUBA 1SFKA 5DLOA 2JQ7A 4FWMA 1W0UA 3I54A 1ZA2B 4GGGA 3S32A 1P4XA 2HBWA 2M7AA 3L7WA 2M0MA 4K0KK 2LF7A 1SL2A 2KPMA 4FPAA 3H5RA 4RBOA 1TTHB 3WGIA 2KSSA 4BY6C 1KU3A 5HDKA 4ZDLA 3LL3A 4CJQA 3CF5F 2G6FX 2KY9A 1XI1A 2R5MA 1QQCA 3TAMA 1X6GA 5C2DA 1VFCA 2IVMA 1Q82O 3CJTB 2EB7A 1MU2A 2VBWA 2X85A 1SD6A 1ACIA 3ZOBA 4RUGA 1VSFA 5B66C 2DA4A 3H9NA 2DX1A 3PSFA 5J2NA 1EO1A 2NZTA 3FZVA 2IIRA 1J3TA 1VQ5N 3I56T 4RGRA 3MEWA 4AILC 1Q9XA 2NNWA 3PNVA 2DPUA 2TRTA 4N4IA 2DJZA 5C12A 4Y28E 2Z9OA 1VOMA 4NS5A 3T0YA 3H0HA 4BDPA 3HJFA 1U3OA 3ZR8X 1KAZA 4C8KA 3JRBA 2Q1NA 2FXUA 4BWMA 3AO1A 1VQ8Q 2ZZDA 3QWYA 4DLEA 1UGQB 4IVNA 3QG1A 2GFUA 4DFPA 1N3AA 2IVWA 2JG6A 3C1DA 5FLXE 1YITN 3CCEN 1LOTB 1VQKT 2HCKA 2JGUA 1ZH5A 4IO9L 2OUMA 2Y1IA 4A4FA 2GFAA 4CJSA 4LFUA 3VQBA 1WIEA 1GHCA 1LVKA 2XKOC 4B9XA 1HF0A 1VQ9I 3DTEA 3MCZA 4F7UE 1B4AA 3MMYB 2LOOA 3VPZA 2XB0X 4BD3A 2EPFA 2Z33A 2NOEA 2X4HA 2OPSA 3QIPA 1G3YA 3A5ZB 2D8HA 4LF9K 2XF7A 3OW2M 4H0PA 4LDUA 2V51B 4O55A 1BW6A 3LSPA 3FIWA 3ZT3A 3I5RA 4FPBA 4DFMA 4D7MA 1ZBFA 3U8XA 1N78A 2HBLA 1YCYA 3QJYA 4DQRA 4FZYA 4KHNA 3CCJT 5AQVA 1IV0A 4MO7A 3JCUC 1I6HJ 3CQYA 4ORZA 2DN0A 2HR3A 1QS4A 1TWHJ 3MEXA 3BLYA 1ZRDA 3CXCS 4C8QB 2KZVA 1MBFA 2HNIA 3RERA 5JVTA 1ETYA 4NB5A 4ON0A 2QI2A 2ZPGB 1U6GA 4XK4A 5JVHL 1T95A 1X58A 3QKJA 1VI0A 1XG1A 4CJ3A 2XY6A 2D0QB 2AJQA 2A0FB 2OPPA 4BKXA 4BAYA 1Y57A 1RLQC 4XMYA 1ZREA 4XU1A 3S1MJ 2VT2A 1GXPA 1VQMN 4I6ZA 2JS2A 3K5LA 1R22A 1Z7LA 2JRMA 3TL4X 3VW4A 2CFOA 2ZM6K 5I3UA 1W9HA 3BP8A 4V2GA 3QDFA 1YP5A 1MUNA 1ZK8A 3KLFA 1GV2A 1VQNQ 2YNFA 3LH0A 4XH1A 4M3FA 2KR3A 5JLXA 3WUHA 2DY4A 5EY4A 3OTOK 1FW6A 1NGEA 2GM4A 1WHMA 1X6OA 2VODA 1VQLA 2P9NA 2X4XA 2FVUA 2GTJA 1D9FA 4B3SK 4FJMA 2ZJPL 2DMNA 1OH8A 5KYYB 1NYGA 1EBMA 3ZGKA 4C8QC 2XUBA 4DR5K 2W00A 1A36A 3OS0A 2Z1DA 1YHQQ 2P9PB 3S41A 3F8NA 5J26A 1B34A 1M3BA 3H9QA 2W24A 1KEAA 3P9CA 5FLVA 1FBQA 3FM3A 1H8KA 4TSXA 1I1SA 3ITHA 3VPRA 3CC7I 2O8BA 1WJQA 3CCMT 1HYVA 1AZGB 3EDPA 1SL1A 2LSOA 1NEBA 1MNEA 4PJOE 1O3RA 3CUQA 5LLQA 2V52B 1V55H 1E3OC 2P9KB 2CG4A 3HL8A 3B6CA 5E84A 1Y0NA 2LVMA 2JJ7A 4IJAA 2ME6A 4F3TA 2MWOA 2NRWA 3OYGA 1Y64A 2HD0A 5IYDJ 3RZDJ 3FMSA 1E6GA 3VESA 3ZRGA 1RAAB 3KK2A 3LSIA 5L8RE 3KHYA 4M7YA 2V26A 1QQMA 4NC6A 4JKGA 1N8RC 4KICA 3GIBA 3SD4A 1LFPA 2K4BA 2K86A 3RYPA 3SUPA 2NVQJ 2FYKA 2ZPHB 2QWPA 3ATVA 4FJIA 2GTDA 3G71T 3LQRA 3SMPA 4NO7A 3LL7A 3CMEI 5J3LA 7AT1B 4M42A 3VB2A 4YOTA 3OWTA 1H641 2JOYA 1K1ZA 2UU9K 2RH2A 5CAIA 1WHKA 2O8EA 3DPLC 3D6RA 2UWMA 1T3SA 3CMET 1TQPA 2KFDA 4PWDA 1VQ5Q 3JS6A 2MC4A 2W40A 2WAFA 3VENA 2R7SA 5M1NA 2XAGA 5GAMd 3BE3A 5CZ2A 2EWSA 1NLPC 1E6HA 3HM8A 4IHWA 3OYJA 2OZUA 1IG7A 4JI4K 2ZNZA 2RJCA 2XDPA 1SVLA 2F8TA 1L0OC 1ACMB 1XC9A 3E9GA 1RT4A 4L5EA 2PNIA 2L7ZA 3META 2E1CA 1VQ5T 1JLGA 1OCCH 4CBXA 1Q18A 5GTHC 2AQFA 3QBWA 2JA2A 4M9SA 1MMSA 1ON1A 3O9TA 4AFSC 2BY0A 1K8AC 1DIZA 2DK3A 1AHJB 1G5VA 1SKSA 4G94A 3OL4A 4IZZA 3H3VK 2DODA 2E7XA 2CGHA 5LEJA 1OZ3A 2EIJH 2OZMA 6AT1B 3ZYYX 3G1MA 1JJ6C 1B9NA 3GFJA 2P5OA 3SMSA 2P7CB 1VQ5A 5LHGA 2W03A 5KYNA 2X0LA 3EFOA 4IUVA 3E6BA 2BUPA 3R3LA 5JMVA 1IGQA 3K4MA 4C8MA 2G7UA 3HHHA 5E3NA 1HDPA 2KDOA 3HRMA 3M0SA 3E9FA 1R0AA 2CUEA 1D1CA 2GX9A 4YHHK 4PSXA 3ULQB 3L09A 1VF9A 3ASKA 1K8AR 5DV5A 1FPQA 3QPSA 2Z99A 1WQ7A 2PU9B 3DTKA 4H5VA 3H92A 4JI0K 5IT9K 3C4SA 1O3SA 4BC5A 1XGSA 2KEAA 2F5DA 1BKBA 3FGUA 4K8XA 3NFCA 2I5WA 2ZXWH 2P0QA 2RVCA 2P9IA 1ATSA 3BFMA 1SAZA 2DFEA 1LW2A 2C0TA 4HAMA 5M1QA 4DR6K 5ED4A 2EFOA 4XLNF 1KRPA 3CVSA 1FN7A 3UKUB 4JI6K 3OYNA 2DK5A 3TEEA 5GIPA 2D1VA 2IA1A 1NK5A 1D09B 3CQ8A 1D0ZA 4N56A 4LFAK 4EMGA 3HP6A 2WAEA 3RR8A 1TL3A 4S05A 3CXCA 2OI3A 4IUPA 4LFBK 3P8BB 5AZIA 1YRNB 1T3VA 3I71A 2IC3A 4XK8E 2VQLA 3WTXC 3HSCA 1QU3A 4EA5A 1JT6A 1FIAA 3SXYA 2FEIA 4CF8A 4QQGA 4CEOA 5AR0A 3BPXA 5HS7A 4ZTJA 3K59A 3KUFA 3QQAA 4XQ3A 4A5MA 5L3CA 1YI2T 4JK1X 1NGNA 1U2VA 3ZX3A 3EG2A 1UECA 1Y07A 2M0CA 4E6RA 4O44A 2EIFA 5J2QA 3A5MC 2LSNA 4WQ5C 5GAMe 4BI3A 3QP5A 2PJPA 1QZ6A 3GF2A 3VGKA 5J8CA 4ENMA 5LRSA 2VQCA 2QK0A 2YKNA 2KRCA 2V79A 4IHYA 4BRPA 4CECA 1VA7A 3D45A 5E26A 2KQ2A 2ZMEC 1BL3A 5GANh 1M1EB 4NHJA 3OOPA 1I3AA 2GBYA 3OB9A 1XB4A 1B6AA 4FT4A 4MLOA 5KTQA 2AIRB 3SBGA 3GOXA 1ABOA 4F04B 3KLHA 4CGIA 3HM9A 2ZJRF 1KD1R 4C3IJ 4DJAA 1HLUA 4LLNA 3ASMA 4PKCC 1TWGJ 4C5HA 5CLSA 4X6AJ 4YFUA 3G71N 1F21A 2OTJI 1B9FA 3U3YA 2H6BA 2SRCA 5F04A 3EG9A 2UYTA 2W7NA 3MHXA 2H1LA 2P5VA 4MFEA 2DTIA 3AT1B 1J5OA 1D4XA 4BGDA 2MA3A 2E6NA 1QW1A 1G99A 3RMAA 4OF1A 3F3XA 3HSFA 1WSEA 1TK5A 3EUHA 3CC7A 1BO5O 1F43A 2VI6A 5FPMA 2L01A 3IUOA 2ZSHB 3MFKA 2EKOA 1MBJA 3PIOA 1S72Q 5ILUA 1HU0A 2DL7A 1ABQA 3P8DA 2COMA 1JLCA 1E3MA 2IW5A 3LFKA 3L2RA 1SD4A 3DBRB 3ROUA 2FSKA 2FO0A 2VVKA 4FLVA 2DPDA 1KD1O 3ZMTA 3EGXB 4FJJA 2QSHX 3CM5A 4A3KJ 3NARA 3NVKA 2HBMA 1ZLKA 1L3SA 2P5LC 3VYUB 5FD6A 4IX7A 1SKWA 3A2FA 1QO0D 4HSBA 5F64A 5AQOA 1UB4A 4AI4A 1TV6A 5IYCJ 2RKIA 3GW2A 1XD7A 3IL2A 3SDBA 1B07A 3F9KA 2OCCH 1QHAA 3CMMA 4C92C 3DPUA 3C7NA 4LNPA 1FJLA 2L7MP 3KD5E 2FE3A 3QDKA 2WC9A 1QWEA 3ISPA 1KFZA 5CKEA 1XQSC 3ECHA 3JRIA 2YX4A 4UUTA 4EGZA 5E18F 2E6LA 3AO4A 4ID1A 3HSTB 2DFUA 4CUGA 4DV1K 4C2MJ 2DA6A 1TP4A 1D8KA 4DBQA 2O8FA 1KYZA 3CCQA 4CGGA 1XGMA 4RG2A 3E9OA 1GLDG 3L2QA 4IUUA 5HDGA 1I6XA 2M8EA 4OIOF 3F2KA 3ZT1A 3CCJN 2KW4A 1O13A 1ORPA 1MDMA 2OPQA 3P39A 1ZGWA 1N39A 5H20A 1K4TA 4BREA 2WSEE 4U0VA 1X1CA 1NE8A 4HG2A 3EE8A 3SWNA 5GAN5 1O9SA 2VWKA 3TTCA 1RBSA 1YJ9T 5I22A 4Y91A 4AC0A 3DXKA 5FU6B 1MW7A 2BW3B 3AAPA 3DLRA 4D6WA 3FBNB 1O4XA 1FJGK 2KVQG 1RC9A 1B72B 3RWUA 3H5NA 2KYBA 4EMKA 5BS6A 3LGLA 4FW2A 4CO8A 1IHVA 4N5SA 4M78A 3V6DA 5FPDA 4MFBA 2DLPA 1DP7P 3EGXA 4J2BA 4JYAK 1CXQA 1WI7A 2GWRA 3FX3A 1Y96A 1Q95G 1T8EA 2ZAEA 2ZGZA 2YNGA 1VQKN 1OPKA 4F7UF 1S72I 4PJJA 2ZJ2A 2WTEA 4HEA2 2DD5A 1RDBA 4F3OA 2F4IA 4KMFA 2QQAA 2OANA 3I4NJ 3CCVT 3CMAQ 1NNEA 3VQ8A 5TISC 4A6DA 3C2GA 1ZXOA 2UUBK 3EHQA 2AKLA 1MJBA 1BQNA 1ZRCA 2YJFA 2R92J 2D6FA 2YHBA 3DMJA 3TREA 1ZG5A 1XMKA 1AWCA 5H6RA 2HYGD 4IQ4A 1XSXA 1YI2A 3DQVC 1QQJA 3MAQA 1WXUA 1NK6A 1YJWQ 3HTRA 2P51A 2HF4A 1S9EA 3EYZA 4L8RB 3LSTA 2HQXA 4Y3OA 4EJZA 1ZSGA 1OV3A 4BC4A 1X75C 4M3YA 2UXBK 1W4MA 1VQ8A 1ULYA 4JHDA 3JSMA 2QWMA 3RBBB 1JTYA 1VZ0A 3CZ6A 3LZJA 3D7EO 1WJAA 4W1UA 4CYCB 1EV7A 3IH7A 3L4IA 4RM3A 2JZ2A 4AHCA 2KMTA 2DXUA 3S8PA 4PZJA 2VWJA 4P9FA 2P8TA 2EBIA 2LP0A 2QCOA 4KRFA 3TW6A 3GTPJ 3VS2A 5E1ZB 2D5VA 2P4TA 3W6VA 3HRSA 3HYIA 3RMBA 1SANA 4OKKA 2RB6A 3VGLA 1BOTO 2DO3A 3F22A 4Y1CA 3LMMA 4DMNA 4K8ZA 1ZYRF 4XICA 4BRGA 1WZ2A 4H5TA 4B3RK 3LOCA 1R8OB 3OL3A 3SB2A 4LF6K 1NBWA 3QLHA 4C1NK 4FT8A 1WA7A 3VEYA 5L23A 1ATRA 2V7ZA 2ABLA 3BR6A 2KL4A 5CE3A 1R7JA 4XNFA 4GRIA 2DZCA 1ITGA 4CJRA 2HWVA 4HOBA 2KROA 3SJJA 3ZT4A 4V2SA 4ZYHA 1MJ9A 4F7ZA 2LKPA 1U2VB 3V9WA 5BPDA 3RQIA 3F21A 2XGXA 5HK3A 3KE2A 5F1JA 3J7AP 3D2EA 3SV3A 1J2XA 3DB3A 2QA4A 5BPLA 3DYAA 1WJDA 1JU5C 3H08A 3K7AJ 2R5AA 4AIHA 1W0TA 1HMVA 2OQGA 2YHAA 2E1OA 1VQOT 1BBZA 4N0BA 1ESVA 1TXQA 3UE5A 4LB6B 2VWFA 3FSPA 5CVIA 1PJRA 4LG0A 1YJ9Q 3RR6A 2MI6A 3X25B 1Z05A 1K9MC 3MN9A 5HOOA 1WJSA 4Y17A 2CP7A 3M3YJ 2O4XB 1QVFP 2F1LA 1RNHA 3H36A 2P84A 1R49A 1F1BB 2DL8A 5GAOq 3JAMO 4M3EA 1U04A 1X3WB 2QSGX 5BPIA 4FISA 5FRNA 1GOCA 1AT1B 2P9SB 2NOGA 1V5GA 5BNGA 1W1WE 1XSDA 4AM6A 1MH4A 1TT5B 2OTJN 1KONA 2K9LA 2VUBA 1JO8A 1VQ5I 4OMNA 1HQEA 3BTIA 4H03B 4BR4A 3ZEHA 3RSEA 1K61A 4OFAA 4IBNA 5SWMA 1OLTA 4PY5A 4A3GJ 5D4SA 5GAHP 3AG1H 2PBDA 1OR7A 1Z6TA 4M9XA 2HMPA 2KKZA 1WH7A 1RAGB 4RGSA 5IXBA 1ZR2A 1YW9A 1VSKA 3Q9SA 2BW3A 2E2IJ 4FZZA 5KYWA 3IAS2 3AVJA 4XOTA 5CIUA 2P9UB 4N76A 3PMIA 1PRMC 3HSEA 3KBGA 4EP4A 1TU0B 2LRQA 1T44A 1BR1A 2CW0F 3SUOA 4EM0B 2E6MA 2NAZA 3BY7A 2ZF5O 2DL3A 1W36D 4KH1B 1J59A 3GLLA 1Z77A 3CCLN 3FXRA 2FSNA 3FMQA 1K4SA 1M90R 3EZ5A 3P9KA 1JCGA 3KXTA 5LJVA 1ZBJA 1I5ZA 4BRQA 2HSTA 4XBFA 2YWWA 2X4YA 3CCUN 3LSJA 5BMZA 1JJ2A 3SUQA 1HKBA 1ETOA 5LJ5e 4M75B 1DU6A 1H8AC 3I9QA 1IV6A 4O0JA 3SEZA 2NRAC 1NKEA 1KU2A 3SPZA 2VGMA 2D8JA 3QRFF 4O5VA 3GLXA 5K7FA 1W36C 1U45A 2BXZA 3T9NA 2DFFA 1QCOA 4NCAA 2V7YA 4H5NA 4RTWA 4ID5A 3CUOA 5IT9E 3SWNC 2JSPA 2CSQA 4XU3A 4OMZA 1WI9A 1KVAA 4YIRX 1B8IA 1WJBA 1GVDA 4XN0A 3K0LA 3ZMZA 1QHTA 1QCNA 4DGWB 3E6CC 3RDIA 5AQLA 5GINA 4LG0B 4CIGA 3C6UA 5HK0A 2HKXA 3HOYJ 5DM7R 3EYYA 4II1A 3PM1A 1YS6A 4LGWA 3JB9H 3TGNA 4F8RA 2A6EF 3HBLA 3QB0A 1TZLA 4X66K 4EPCA 3UKGA 4QQDA 1FMVA 1SHFA 3VYTB 2NRTA 4BXUA 1UGPB 4CCLA 3VTHA 3KKSA 5GAOm 1OCTC 4HTUA 1K8AU 3SEQA 1S5LC 4QSHA 3I55A 3JTHA 4CD3A 5AYFA 1KVBA 1UELB 1VQ4I 4M7XA 2E6ZA 3G6EN 4MDAA 4G6DA 5GAGJ 2LY9A 5J8FA 5GMKm 5EC7A 1WNLA 2O9LA 1VQMT 1SSHA 4M71A 4BE0A 2IA2A 1I4K1 3ENOA 2ENMA 2LYCA 2WV0A 2GWJA 3BR0A 3I9V2 3NH0A 2HMIA 4EP5A 4KB0A 1WSUA 1U3EM 5HVQC 2EBPA 3WTWC 1TUGB 3VGMA 5I2MA 3OIOA 1KJWA 3ZSOA 1BOAA 4BRIA 3F10A 1FWZA 3WEEB 5KRTA 5AQRA 3O9RA 1IV8A 3BR3A 3V1RA 2W6KA 4M6XA 5AN4A 5KYUB 4RAZA 2EWNA 3OYYA 2JN6A 3J80Z 5FROA 2RAEA 3ENHA 3ZX2A 3V4GA 4OMPA 2H6CA 3QYGB 4F2RA 3OYBA 3CMAI 1M1KR 3ABLH 2BANA 3IH4A 1M3AA 1FTZA 4CCJA 2K3FA 3BJOA 2DAQA 4HW0A 1BWFO 5FKLA 1HSJA 2VGNA 4MZPA 1YTUA 1ZSZA 5AQHA 4YORA 1EETA 4BWJA 3PO3J 3Q0WA 5F0FA 4JS4A 3O2PE 3NWSA 3OQ5A 3G1LA 4DU3A 5FGMA 3S1RJ 3BG3A 2QLZA 4ZGEB 3H9GA 2EQIA 4XKWA 3I0WA 3KP4A 2Q2RA 1K73O 1XMQK 1FSHA 4ELZC 5D3GA 1JJ2P 4RGXA 4ICLA 2NRVA 3O8VA 2PMHA 1BIAA 4XLAA 4GLKA 4ZJZA 4BG8A 4AVPA 4BC2A 2COBA 1Z3YA 3JRGA 2NVUB 2JUCA 1J7KA 5A2QE 4X65K 4BRMA 1OVQA 2DO7A 3G1JA 2YS9A 2JPSA 2KLAA 3DXMA 3TP0A 3GTMJ 2QA4N 4GO1A 1VQPQ 1HA8A 5LGTA 4KT0E 2HZDA 2ZSIB 3LPTA 2K02A 4FJXA 2E7WA 3R60A 4OO1J 1VTNC 2HKQB 4QKUA 3ZETA 4M7AF 5ICFA 1XC3A 3FZLA 4CIFA 1MBKA 5AIPA 1IGNA 2PUOB 3MP6A 4J7FA 4KDPA 2L9VA 3AO3A 1M1KO 3HO1A 1KQSP 4PNOA 1CXUA 2HHSA 5KQDA 3PNTA 1TYQA 5L3DA 1OU8A 2WTUA 4ENJA 3CCRA 1X2NA 4OPKA 1A0NB 3MCPA 3CC2N 3GNGA 1C6VX 3Q0UA 2I5JA 2COZA 1ETKA 3MKYB 4V2FA 3F5TA 3TBIA 2VJJA 5GAOn 1ZBUA 1JQQA 3C0BA 3E01A 3BQZA 4YOXA 1U5SA 4EMKC 3NTIA 3C94A 4M75E 3BR1A 1RT5A 1XMAA 3A0BC 1F4KA 1KQ8A 3RZOJ 3KZBA 4FXDA 2CRGA 2OV7A 1HYOA 3RYRA 3DLGA 1BOBA 1YITI 1KG7A 2PVOB 3CDHA 4DV5K 2ZMEA 2MF2A 1OEBA 3G71I 2ACJA 3OVNA 1KG3A 2O2OA 4ZYAA 4ZNXA 2OZ6A 4H0EA 5GAN4 3C65A 4OPHA 3CLQA 2KZZA 2VQHA 5CR2A 4EM1A 1V4SA 3FZMA 3T69A 2L0AA 4NLCA 2Q0OA 4A63B 4F7UA 3SLCA 5M1PA 3A0HC 2MD5A 1DQUA 1FOWA 2ZGWA 3CCEQ 2A6HF 3SQ4A 3F23A 5C3EJ 4A53A 3U1DA 3OSFA 3VWBA 1U4BA 5L3GA 3ASNH 1V5EA 3QDRB 3VEZA 1WPYA 3UWNA 3JRZA 1OCZH 1R4MB 1I5OB 2F2EA 4OINF 2M7BA 4CJ7A 3REOA 1G4DA 2E5QA 4BDZA 2IJLA 2ICWG 1KQSM 3F8FA 2HU9A 4PLLA 5CYVA 4CCNA 4A0ZA 3VQPA 4B1YB 2QEXN 4IKFA 3BY6A 3OHRA 2NOZA 3FBIB 2FHDA 3GBQA 3L00A 4JI2K 5FLXK 3EPZA 2G8IA 1XTAA 4W5OA 5AJ3K 3G6ET 4AFQC 4CCOA 1VQ7N 2VXZA 5CVJA 1X9WA 3VETA 1UJ0A 1UCRA 2QBYB 3I0SA 2K5FA 3MZYA 2Y90A 2R5YB 4XRSA 2NS7A 4WK8F 1FXXA 2CYZB 4IPAA 4QPOA 3JYTA 4FVUA 4MEXF 1ZHIA 4PSWA 1APLC 4G9YA 3Q7CA 5BRFA 1FOKA 1C1AA 5GMKh 1RPWA 1MGTA 2F2XA 3P1GA 3IQLA 2LMDA 2JXBA 4XM3A 4JKEA 1BJAA 1S6LA 4GDFA 3HXMA 3I55N 1SFEA 4KTWA 4E7HA 4CF2A 3BTCA 1BI3A 1XX5A 1RTJA 3K1PA 1PD1A 1BB9A 3K10A 1OH7A 1HW1A 2AK5A 5CQYA 2OTLT 3K4JA 4CGDA 3REAB 4AIAA 1R5HA 1NGCA 4JJCA 1BN5A 2DERA 1CKAA 4DTXA 2LK2A 2IS3A 4EIKA 3PIPL 1ZG3A 3L2ZA 3ZSYA 2QA4I 4JLGA 1GXQA 1NM1A 3FK7A 3D7SB 5HRSA 2RNGA 1BCMA 4L6V5 2IS4A 3H3ZA 2HDWA 5J6XA 1XDUA 4IXAA 1FYLA 1LNXA 1X4OA 4PFPA 1Q1VA 1U48A 2G8FA 3CJAA 5LJ5h 2DA1A 1MWKA 2PY5A 5DCMA 4L3QA 4JBAA 4QCLA 5HLTA 3M0UA 1FNNA 3KYCB 4LH5A 2RHZA 4IO9F 1SEUA 3WU1B 1M3QA 2DMTA 3M7GA 1Z3XA 4E7SA 3X26B 3L42A 1U2WA 2XRIA 4I2QA 3EN9A 4JLHA 1HXDA 4ENNA 1C6VA 2ZPIB 4J8OA 2FLOA 1XGOA 2CYYA 3ZMVA 4FWSA 4DTOA 3I35A 2VOOA 1M8VA 1KSPA 2W4SA 4NXMK 2N8GA 3OS5A 4FLZA 2YDLA 4M78B 1VQ6A 3LDPA 3LDSA 2DTUA 2H1KA 1NGGA 4RMNA 1J9IA 2WBMA 5F0CA 3TOBA 4A59A 3X24B 3Q9VA 3GL1A 2K85A 4I98B 4Z8AA 1JHHA 1OR7C 3QYEA 1X9MA 4J2EA 2TCTA 3F8MA 4ETSA 1P7MA 1YO5C 3J80O 3FZHA 3NTHA 5GAMh 1AVZC 4IF4A 4HBLA 5EYRA 4DNCA 2IS1A 3FXLA 2XU8A 2JNGA 3I56I 2PMZA 1HUXA 3VF2A 3WODF 1IXSB 2PAVA 1M4ZA 3P31A 3FFKB 5IY5H 4GVEA 4B9WA 4XLPF 3LZIA 3TQNA 2M0YA 1KAXA 4OKEA 2XGEA 2F8SA 2YHWA 2OJ2A 2BVMA 4M7DA 1SFOJ 1JUPA 3DI6A 2YT6A 4FSVA 2JZYA 2LDMA 1E2XA 2HEOA 1WJCA 1K0XA 4MIMA 2GIZA 4Q48A 3M58A 3G10A 4M7DD 1WWXA 1OYXA 4BQOA 3NF7A 4Z4GA 3LA2A 1R9TJ 3UATA 4CZIA 2ZBKA 2Y48A 2ISYA 1VRUA 4HRIA 5K5QA 1P4AA 2WSCE 2OQRA 3CCQQ 2V8IA 4HX8A 2E65A 4Y52J 3CMAT 4C92G 3K0SA 2FMLA 5GAN2 4AD9A 2Q97A 4FZXC 3CJCA 1EH8A 3MP1A 1S8NA 2A61A 1NKUA 2E1HA 2LTOA 2A40A 1HNXK 2HFHA 1B3QA 2DVJA 1B92A 3TEDA 2K9MA 4DSJA 4M63C 3SZTA 3TQ7P 1W5CC 1ETQA 3ER0A 3K2AA 2CW8A 3T3FA 1C0UA 3T1HK 2QKMB 3K4CA 1KG4A 1KCFA 2H8WA 1TUUA 3QFUA 4CCKA 4Y0WA 2A36A 4B8AB 3DXJF 2QGFB 1A35A 2DE0X 3EE9A 1RADB 1ZGJA 4FWKA 1Y8RB 2LJ1A 1GLFO 5GPCA 4FX0A 2OFIA 2M30A 4E0DA 1N8RU 2DT7B 3ZLJA 3K4NA 4JAXA 2KK4A 3OW2A 2NOJB 2Y4YA 3TO9A 2E19A 3NEUA 4G7HF 1M90U 3PNWC 2QQRA 3LAMA 2QM1A 2L7FP 1KQSA 4A3CJ 1JGSA 4CK2A 4ZHRA 3BW1A 3DXMB 1YQLA 2A6TA 1LW0A 2WFBA 3EETA 3CCEI 2CH5A 3CC4N 3BEXA 3K5OA 3IRQA 4FLTA 5CK9A 3VYHB 2X1CA 4RG8A 1FK9A 1LB2A 4RGUA 2Z16A 3E5QA 5GAOr 2MFZA 4KBOA 2EIMH 1WVRA 1V1CA 3M6GA 5LJ5j 3IP4B 5DCFA 3WXIA 2O8BB 2A07F 4M6YA 5H2FC 1IN6A 5D6FA 3GO5A 2E1ZA 1T0FA 3G4SA 2M9HA 4J6WA 3N4PA 2EV0A 4N4GA 4DSKA 3UKRA 3HGYA 3VSKA 1T0JA 1KAYA 2Y31A 3SCXA 2HKNA 4M7DB 1WHLA 4M78G 3AHUA 2O4GA 4FJNA 1YYVA 2L54A 2HZYA 4RTYA 2EQUA 5EOYA 3BDPA 2VQEK 5LGUA 4PKIA 3PFYA 5LD2C 5GMKe 3QODA 5GADP 2FPFA 2XASA 2EZKA 3ZL7C 2DM1A 2XMFA 3TKYA 2DTHA 3AVIA 4CZZA 1Q81R 4PHTX 4RCHA 3JRCA 1U8BA 1V76A 2MBFA 1FBUA 5ILSA 8ATCB 1I8FA 1S1UA 1R1VA 1EKEA 1WQWA 3AL0C 3P83D 4C2UA 2QWRA 4M75F 3OA6A 1NM7A 3BROA 2WWYA 2Y2ZA 1ZG1A 4JI8K 4WXCA 2VQFK 1RUNA 2UUZA 1GOAA 4UUSA 2X4WA 2CQ7A 3I0XA 2OAZA 1Y1WJ 2EJGA 1AA7A 4DR4K 3GBGA 5F27A 3QU3A 2QA4Q 1K4US 2X6NA 2GWKA 3SYZA 2DBKA 4QVZA 5I21A 3HUGA 4UV9A 2HB5A 3CCSA 3OSGA 3O1BA 4KFCA 3PO4A 2A3ZA 4OB2B 2XG8D 4NUBA 4BRKA 2ED0A 4GW6A 2XRLA 3HSRA 1K8KA 1TAQA 2BV6A 1S7EA 2LR8A 1K73C 4H0TB 5J1EA 1OOTA 1K79A 3H6EA 3WNFA 4M75G 3CBMA 1YFHA 3FE1A 2XHCA 4JRKA 4I9LA 2EYWA 4DA4A 4OU0A 3CO6C 1VQ6I 1W7PB 4N47A 3GMEA 2JVVA 2DIGA 1OZ2A 1OPCA 1S3JA 1VQPT 3M5AA 3CC7Q 1B59A 4B3OA 4D5FA 3RMQA 4MEYF 2WB1A 2QM3A 3EH2A 2GV9A 4EA4A 1W5SA 1DGRM 1XHZA 2COWA 2E5ZA 4C92D 3HK2A 4DOWA 1J5EK 1E7OA 1RL2A 3X20B 1JBMA 3EYIA 3E5XA 4PGHA 3FIFA 3HKSA 5CY4A 1W2BS 4MO5A 4YOUA 4D1QA 5DUKA 5FU7C 2IA0A 1W4SA 2YUOA 3FRNA 4RCCA 4CZCA 2ID3A 1WRJA 1A6QA 1M1KC 1Y56A 1QVFA 3MEEA 4CZGA 5C42A 3R6MA 1DKGD 3BR5A 4M75C 4CZFA 2ZJRL 1VQLI 1MUDA 1MUYA 3BG6A 1QBJA 1U0JA 3G0ZA 2AQEA 3OYAA 5GAN6 3J81K 2K3YA 2FOWA 3LP2A 5GAEP 9ANTA 1R0CB 2HTJA 1GLBG 5FWCA 4P96A 1YS7A 4DV7K 5DEQA 2LQ8A 1VQLT 4YPHA 3CCMQ 2E1YA 3VS4A 1M5Q1 4ZTFA 5F2RA 2PQ8A 4DG1A 2PUKB 2AXLA 4BRFA 3DBHB 2F5EA 3GF5A 1VK0A 1FOYA 2YU9J 1ZQ3P 3U4LA 1PP7U 3CPWS 4GKKK 4K41A 3ALYA 4AT1B 2E3HA 4FJKA 2V6CA 5IP7J 2KISA 2XAUA 1V4TA 4I02A 4O8UA 5TKYA 5IHIA 4XRFA 4B24A 4BU2A 2AHQA 3CCLT 1TGOA 3W2AA 3TSQA 4XEIA 1LNWA 2P5KA 2EIKH 3DV8A 1BK2A 1JT0A 4II3A 2O4XA 1BJZA 1U5TA 3MAJA 1G2HA 3ZMSA 1LWYA 2EINH 4HPQA 2JW4A 3TP3A 2K5LA 3CJQB 3EUAA 2A37A 4CC3A 1IKXA 1WAFA 2IIMA 1RBRA 2P9SA 3ISNC 4FCYA 3QEPA 5CQEA 4DV3K 3FR0A 4B9MA 3F6VA 5D6XA 1D9DA 2QWOA 4BROA 2LCCA 3N0UA 3F0CA 1EZZB 1Y97A 3KWGA 3SPYA 1Z25A 2CP0A 2FBXA 3DU5A 4J6YA 2PQWA 1C0FA 3S6IA 2O9SA 1VQPN 4JKCA 2R5ZA 4B44A 4JKFA 1WKMA 1N75A 1VSJA 2LD5A 2XHIA 1PU7A 4LY7A 2NVXJ 3LDOA 4M78D 5HRNA 3IH2A 5CHZA 1U9NA 4MDBA 3PX0A 2DMQA 1NG9A 3ZCMA 5JS2A 3O6BB 4ENKA 1N9RA 2BYVE 3OR1C 4BR7A 3FC3A 1SRLA 3C12A 3PIOL 1VQ9T 1WDXA 2E1NA 2LKXA 3E6DA 2YU3A 4A6EA 3M54A 1VAZA 4DSFA 3D1NI 1AWXA 1TNTA 2EFPA 1YJWN 3K58A 5TGTA 4ANJA 2CQKA 3CC4A 3BY5A 3VFZA 1BU6O 3B02A 3VDXA 1ZTRA 3V9XA 3MWTA 4C3JJ 3H1VX 4OJRA 1H9GA 1WQ2A 1QZYA 1HYSA 1EA3A 2LREA 3E9LA 4CBWA 3CCRQ 2KHOA 2FJ1A 1SKUB 2YXYA 1PKTA 4OAZA 3R0JA 3O9QA 4Q4ZF 2YX6A 4K2EA 1AHDP 2Z1GA 3ELKA 4IEJA 3S2WA 3K6GA 4E9FA 3H3UA 2LNVA 4RTTA 4NCGA 3NWTA 1UOCA 1NK2P 2A3LA 1Q81O 1B9MA 3HVTA 2X6OA 2EJRA 5C24A 4IXCA 5JS1A 5IPAA 4IG3A 4KH0B 4DS4A 2WSFE 4B21A 2EV6A 3T8RA 2QWNA 5FU6C 3J8AA 1YIJI 1CZ9A 3IG1A 2PBIA 1YVUA 3AA2A 4HF2A 3SNNA 3OW2P 4B1ZA 1KU7A 1VNDA 3ZXSA 1N8RR 3NGYA 4R1HA 1Y96B 3MX5A 2IPQX 5GIOA 4H0VB 1EXQA 1SMYF 2E8AA 4N9HA 4RB2C 4OFEA 4JJNK 4JI5K 2FC0A 2Y0SN 1MH3A 1OMIA 4I2PA 4A3MJ 1U5TB 1IZ6A 4O3MA 3H9JA 5GANj 1KFSA 2KT8A 4Z4IA 2GXAA 2CREA 3WG7H 2CGLA 1UJ8A 2V1QA 4YIFA 1FSEA 1NMDA 3URGA 1QVTA 5B1AH 1KFDA 4B3XA 3JRAA 3ML6A 5KGWA 1W5TA 3DRSA 4FETA 1J9AA 3CCSI 1MDMB 4DSEA 1OFCX 3DOKA 4JLIA 4QT7A 3TU4K 1WOQA 4IIOA 5GAHJ 2KXCA 4E7IA 2LX7A 4HX7A 2HOTA 2EQMA 1WJFA 3T1AA 5DM7L 4OIRF 5EX5A 4DV0K 4AF1A 2G9WA 4CCMA 4BJ6C 4LF8K 4H4KC 1K78B 2K57A 2VUMJ 4AM3A 2XVCA 1CLQA 2DZ9A 2ZXIA 3E6MA 2DAOA 3K4LA 2QQSA 4DOZA 5LHIA 4HNUA 5CO7A 4Z6YA 4XSZF 1IREB 4U0YA 3KZIC 2MMPA 2M9UA 1DGWY 4BGAA 1FP1D 5CVVA 4ZDPA 2P9NB 3WXMB 1WN7A 1VQNA 2G8HA 2P9PA 2KRSA 2I7NA 3C6HA 2KNBB 1CZAN 4J9HA 4ITVA 4ESRA 5KPZA 3AGRA 2D0BA 2VKVA 4JP0A 2A3SA 2HOSA 4C8QD 4EW0A 3L8BA 2K9GA 2UXCK 1UB9A 5CCAA 1MUZA 1KVCA 2H3EB 2ECBA 2XKOA 3GOIA 3KETA 3WQTA 4BH9A 2GF7A 1ZQ1A 4KYWA 1Y1VJ 3EFRA 3I58A 3CCUI 1WBDA 3TAEA 2IEKA 3JAME 2DFIA 1NLOC 3DM2A 3HHGA 1BI2A 2CS3A 1VQ9N 3CCJA 1KYWA 3LGFA 4J9FA 1BI4B 4JI1K 4DQ2A 2ZKZA 5ELZA 2Y0MA 2M4KA 1WYXA 2O8CB 4E9GA 1VQ8I 5KHDA 5CKHA 1N6QA 3IH3A 4Z88A 1X1BA 4RW6A 2IS2A 2ZNYA 1HOMA 1AD5A 5IT9Z 4X9DA 2RQRA 1GV5A 1LCUA 5KH6A 1S1TA 3NE6A 2NUPB 2YRVA 2YUPA 1J54A 3S6WA 3AG3H 2XGDA 3VEXA 4OPJA 2HBPA 1RACB 4CEDA 1CKBA 5F6FA 1XNIA 4ME7A 2WONA 3T7ZA 4X64K 2VC0A 1JCEA 1Z91A 1WHJA 4B1VA 5AQFA 3EUHC 4CE9A 2OCEA 2GGRA 4LG3A 3BOQA 1B34B 3C6TA 2BEOA 3H41A 1FZPB 1GLJO 3W3CA 2JTVA 4IOXA 1NK4A 3QWXX 4CF0A 2COYA 3CD6Q 2O8DB 3CD6T 4M7AE 1IG9A 1YJNQ 1BR4A 4CGJA 4XKVA 1SG5A 3OSVA 4LN2A 2QYZA 2E5KA 2DLLA 1S7OA 1NEGA 2HNYA 4RAFA 2ELKA 1MNMC 2HVRA 3V9UA 5IHKA 2PFBA 2G7HA 1JL1A 3CP2A 4CICA 4BUPA 4WCGA 1AU7A 1A04A 4N4OB 4UY8O 4BR0A 2L0KA 3NH1A 1WSFA 4BRNA 4H0YB 3E19A 4DOVA 2D4WA 2L5QA 1H88C 4FM4B 2MLKA 4QPQA 3O9UA 2DU9A 4B48A 2RHIA 3E97A 1G3WA 3RPUA 3H3OB 2JUGA 4GV6A 3KZYA 4NQWB 3IC7A 3PUFA 3VUBA 2XF5A 2QBYA 2W48A 4KI4A 2LP5A 2ELJA 3H8ZA 3DLEA 2P9LB 3K4BA 1QGPA 2E20A 4CHPA 2ZD1A 3MP8A 3WXJA 1SS6A 1RAIB 2KMUA 1T0HA 2E35A 4HUEA 3K9KA 3CC4I 5GAEJ 3O80A 3L2WA 3ZSXA 3OBWA 1ZBLA 4B43A 1FLIA 1YHQT 1LMZA 3NBPA 4JX4A 4IIMA 3IDHA 1IB8A 3SZGA 4YOYA 5M1OA 3ULDA 3ERMA 1Z21A 1QVGP 3VTIA 3QZ9B 3GP8A 4B8CA 2QQBA 2LVSA 3PE0A 2QG9B 1PVEA 2O5RA 4IHSA 1J5YA 4Z4EA 3CC2I 1A6IA 1IBKK 1QP2A 5KPTA 3OMGA 2F96A 5L3FA 3C2HA 1W7PA 3PQKA 4M7AD 4GVMA 1UJYA 2R93J 3KPHA 3G2BA 3MMVA 5H1SQ 2JVHA 4BY6B 3D5LA 1KLMA 1K9MR 1U47A 3S93A 2OX7A 3KEQA 4FM2A 2GA2A 3ZQCA 5AQYA 2FNAA 2EV5A 2P7VB 1X1PA 3X28B 2WA0A 1MSEC 3K2PA 4PK4A 4OB3B 1R36A 5EXWA 2KQWA 1ORNA 4J9IA 4WF2A 4EFHA 5CKBA 2E71A 3GG4A 2B8AA 4O0IA 2W10A 3I56N 4A5BA 4ZYEA 3CMEQ 4CJLA 1UEBA 2OAUA 2LC2A 1SUQA 4KHPK 1MV3A 2BZXA 4OMFB 2HSPA 1VQOA 4JKGB 3K9JA 2M87A 1QP3A 2FRWA 4FM1A 4UNOA 2W84A 4JPBW 1TWCJ 4A3EJ 2LJ3A 1JXBA 1SFUA 3V8KA 4FLYA 2JTEA 2VV5A 2LY1A 2UXXA 5AQJA 3NHNA 3ME9A 4HSTA 2QA4T 2R7DA 2LT1A 1PHTA 1C1BA 1HW2A 1K9MO 5CYQA 3S3NA 2RJEA 2F4OB 2GELA 2PI0A 2RQUA 4H0OA 3K2ZA 2M02A 5HP1A 2RO0A 4XSXF 3JCMh 2L3RA 3VYGA 1W7AA 5AQUA 2QKKA 1GFCA 3VOEA 1ZLMA 2E5LK 2LZ6B 2DMPA 1UFFA 4EATA 4QVCA 2VG5A 4C8QG 2R7YA 3ZN0A 2F9WA 3DKWA 1NU0A 2VL8A 2DA7A 3AVAA 4BJ5C 3L2UA 2E4LA 3LANA 1T0FC 3JCMX 1ZUYA 4PJ0C 5IXFA 3VEVA 2L4AA 1I27A 4J6XA 2WAQN 1PWTA 2LBFB 4CJUA 4PKGA 3ZT0A 2GOMA 1VYUA 5D5WB 4HT8A 1IKWA 2J6KA 3BG5A 3ZX0A 1KXPA 3CCVQ 3QIOA 1X3MA 2F9TA 2DXIA 2XPWA 1RNLA 4MLEA 1S6QA 4FLXA 1KC8O 2CW7A 2UUCK 4B1RA 2XSJC 3AG4H 2IOCA 2DYRH 5EF6A 3H0FA 2NXNB 4M75D 3E1YA 2R7XA 4JK9A 3ID6A 4KREA 3CCLA 3V4IA 2ZE2A 1Z0XA 3DWLE 4FT2A 3KWIA 3LAKA 1VQNI 1N25A 3V9ZA 3ZQLA 2E36A 3QETA 4B47A 2V4JC 1TQMA 3EY1A 4FWLA 2ISZA 3BC8A 3VSLA 1Q1HA 5JR3A 4ZN1A 5FLXZ 2CQQA 4DW6A 2A05A 3JCMg 3A1PA 3M0QA 5AFUH 3E7LA 2NYSA 1VQNT 4YDUA 2ZCFB 4FWRA 3IWFA 2D1KA 4J2DA 2MD0A 5D5XB 4EGYA 2VQGA 1YBYA 2QTXA 1Q82C 2KIFA 4TV7A 2GAUA 3ZMUA 4CGHA 2VG6A 1ZAOA 5LL6Z 2QXLA 4OVLA 2QEXI 1RTIA 1G8XA 4BBRJ 1U06A 3SYTA 5K5OA 4AIKA 3FHGA 1IH7A 2DOEA 1PU8A 3WHBA 3LWIA 3EHRA 4BC3A 4K25A 1SV5A 1YWPA 2EYQA 3PIPA 5ECAA 1ZYQA 4UXNA 3TCJA 4H0XB 4BJTA 2HNZA 3PFSA 4BS9A 1JHFA 2JUFA 1LDKB 4M73A 4A5AA 4XOPA 4LMYA 4EQQA 5M5WJ 2WADA 1QWFA 3HFNA 1QQIA 4DLGA 5A2QZ 3I0RA 4GLMA 4AHTA 2CSIA 3ASOH 4YFXF 5JVGL 3FXUA 1TL8A 2FRHA 1I5LA 1OX9A 2WY8Q 3M8JA 3EGUA 2MH2A 3IMXA 5DUIA 4WYBA 1EH6A 2K9QA 2CH4W 4DSIA 4NC8A 4LITA 3PVLA 5BRHA 4M74A 1T2KA 3CG7A 1R77A 3P4IA 5E20A 3V7SA 4JRQA 1NJYA 3N5BB 3TSZA 3M4GA 4A3DJ 3SI6A 1H1VA 1YIJT 3DCFA 3HYFA 4MO4A 3M8QA 3OA9A 3IKVA 4M7AG 4LK0F 1IKYA 3BQYA 1YI2I 4TVRA 4PL7A 1X1AA 3I33A 2NVYJ 4B1UB 3F6OA 3IAM2 4ESJA 1I39A 1NG6A 4YOVA 4M75A 4CFDA 4M77C 1X19A 4JV5K 2M3AA 1OH5A 4ZYGA 4BNCA 3QXEB 3CCMN 4HQMA 4NL2A 3M5RA 5AQWA 3TOAA 1KQ1A 2OYQA 4FJLA 2DNUA 4YFNF 2OFKA 3FXQA 2PVDB 1ASWA 4WCEL 1BW5A 1RBTA 4JKDA 1P7JA 3WGHA 3I55T 4M7DG 4AQYK 3IV5A 2QTVA 1X2QA 2O3FA 3DLAA 1QA6A 1OCOH 3R6SA 4GNIA 3AVFA 3DAWA 2KFNA 3JSCA 2FSJA 3ZQFA 1FY7A 4IJNA 4JK7A 4EMSA 3TAFA 3S17J 3F9MA 2KQRA 2A68F 1FYNA 1JJ2S 3FZKA 5L3EA 3W2VA 2KJBA 3JAMZ 2FBTA 3QUIA 2PJRA 3BDUA 1TKZA 5HLIA 2CQXA 2VJIA 1T8IA 1IAWA 3K57A 1KHIA 2CH4A 4E9EA 1GCQC 4ELTA 4M6VA 1WEGA 2DYSH 2JTFA 2R7TA 4QWQA 1UGVA 2EA2A 3G6EI 4BI8B 1Z9CA 2XD0A 5GTIC 2NUTB 1O57A 4P1WA 3M8RA 2NWMA 4CZLA 2CV0A 3LALA 2O8FB 4OLAA 1TT0A 4BRLA 3DLBA 1AWWA 4LOCA 1BIBA 3EGDB 1PUFB 3AO5A 4M3BA 3PX6A 4Z02A 2RI5A 4OP0A 1GXIE 1UWBA 5EGOB 2GZWA 1JJ2M 1OKJA 4FJHA 4RA2A 1TWAJ 4F3QA 2VPLA 2CKKA 2HVSA 3J80E 2V1UA 3V8JA 1T05A 2FZKB 3PIPF 2B4JA 3LPUA 2MABA 4IHXA 5C44J 4M3XA 2DMUA 3SFIA 3CJBA 3E0JB 5DTDA 5DM6F 1MMGA 3PL8A 5C6SA 5LHHA 3JSOA 1RDAA 4DTRA 3ZETB 2UUAK 4I7HA 1JKQC 5C0MA 4XQFA 4AG2C 4JRPA 1IHWA 1B8IB 3QZ5B 2NLXA 4M7AA 3CBPA 4NLBA 1BA0A 4C3HJ 4RCBA 1QVGA 2M8GX 2FBKA 1BIUA 3VEWA 1LE8B 1UHSA 4BEHA 1S7AA 2P5GA 2CP5A 4RW4A 4CJWA 3M07A 3CFRA 5HLHA 2HHTA 2HHHK 2JM9A 4EW4A 5M3MJ 2MSYA 2E70A 4DR2K 3F0ZA 3CCQN 3EQLF 3DLLF 1X9JA 3D0SA 2QENA 3GE1A 2W41A 1HNVA 2E60A 2NYXA 1NPRA 3CI5A 1TW3A 5A2QK 3R0AA 1WXTA 1K9MU 2KP6A 5L3BA 2D0NA 1KK7A 3O9SA 2IVOA 1YIJA 4X1EA 4BQLA 3NGIA 3G4SN 2QWQA 4ZZDA 2DXTA 3OY9A 1XQHA 1HPMA 2M34A 2HOAA 5JHUA 1UG2A 2XPVA 4XTUA 3CHWA 3QYBA 3AY9A 1WB9A 1VSIA 4EZ9A 3DEEA 2YPRA 3WVDB 4DF4A 2Q2EB 3HIFA 4RMOA 2JS0A 5FDLA 4QOZB 3WU2C 1YJNT 1Y0MA 2YG9A 3CCLI 1NGAA 4R56A 3LNQA 2XY5A 1OH6A 3K5MA 2R57A 4LC9B 2VT3A 4CYCA 1GL5A 3O8GA 1LEAA 5CKDA 4CEZA 2CGJA 1T33A 2PTKA 4UC4A 1WZOA 3TW7A 5KCOA 3DBLB 2DOAA 4Q0BA 4CC4B 3OYCA 1IN5A 2RJFA 4FJ7A 3CQZJ 1VIEA 1CF7B 1S29A 1O7LA 1VSDA 1T56A 2EGAA 2FX0A 3EG3A 4KRTA 3HVRA 1P4WA 3NF6A 1M1FA 4E2FB 4A4EA 4EHTA 3L1AA 3DKYA 5TJJA 2BDPA 4PKHA 3P9IA 1Q7YU 1BR2A 4NYNA 4KBMB 2GBZA 4FWPA 3HUGB 1J53A 3BG9A 4CI6A 1LWFA 3QJ6A 4CZHA 3V81A 2NUBA 1KG2A 3I5SA 1R58A 3ZSWA 5FLXO 3QNNA 5E1XA 5AZIB 2DXBA 2XIGA 3SQ1A 1FKPA 3HFOA 2LDUA 2DT6A 3ABKH 1Q7YO 3RTVA 1OCRH 4Q5WA 3TMOA 3DPTA 2BBYA 2F6CA 2PYJA 2CDTA 5KE2A 2VXDA 4CDGA 4KA4A 4O4GA 4Q5VA 3FKIJ 2FF6A 4CIEA 3GDQA 4AHVA 2VJ4A 5FFZA 4HCCA 2QDLA 1BM9A 1FC3A 2HGCA 4PUSA 4KHQA 3GFIA 1FMKA 5LBQA 1BISA 3RQ4A 3GZ6A 3AGKA 2OTLQ 2WV1A 2H8RA 2ZB9A 2F2VA 2J06A 1V5FA 1YITA 3M1CA 4A93J 4DHYA 2FQ4A 3R4KA 1KZHA 5F0XA 2LNBA 5LJ5f 3OOUA 4BI4A 3LSRA 4KGXB 2Y9YA 2LT4A 3BZ6A 5JI6A 3C3WA 3JCMe 2GNCA 1E4GT 4NDLA 3RDVA 3VQQA 2DFHA 2VKEA 2W57A 2E4HA 3B8AX 4BVPA 1K8AO 2D1HA 4OMMA 2E10A 1LWVA 4LD0A 1NOZA 1DTTA 2PZ1A 1UMQA 3DLLA 4C92F 4UV8A 3M9AA 2P81A 3WTTC 4HCKA 1WUAA 5KGXA 3A0IX 5AQXA 1YJ9A 1W2BA 1ETXA 1ITYA 3WTUC 1WSHA 2LQWA 1C0MA 3CCVI 4L9NA 3JCMJ 1WFWA 3S15J 3ZSQA 3CF2A 3CMAA 2BXYA 1PUFA 3WE3A 3J81Z 4QS8A 1XQPA 3C7JA 4BY7J 2NNNA 4QW2A 2ADUA 4XLFA 4B09A 5HDNA 3KTQA 4ELYC 4OMQA 4YELA 1YW7A 4VUBA 5GANe 3V8LA 1I81A 1UAAA 2R7RA 4F9OA 3RSNA 4XIDA 3RKXA 5KE3A 5E41A 4BHBA 2M51A 3F8BA 3FKJA 3AA4A 5J47A 2CT3A 4A57A 4P55A 2BKDN 4ZGJB 3N4MA 3GUDA 1YN8A 4LIUA 3HP9A 1BCOA 2DTZA 3PJRA 1IW7F 1ASVA 2HSEB 1E0EA 2CUZA 3O4NA 4RM2A 1NZ9A 3PFIA 2HXOA 1VSEA 4RB3C 2PMZN 2IAIA 4JQFA 1QLYA 4XN3A 4CVNE 2ID6A 1T38A 4BVOA 3TTFA 2B6AA 3L9FA 4CEFA 2P4RA 2A1SA 3ZQQA 1GRIA 2EYXA 5IT9O 4IRGA 2FZCB 4XAXB 3M8FA 2ETJA 3ZPLA 5LRRA 1JLBA 4M7DF 5AQGA 2GXBA 3THVA 1RKTA 2VJ5A 3TDUC 1R71A 4LSLA 4XH4A 3A8YA 2BGCA 2FMYA 2JK3A 3NMZC 3HT3A 4IUQA 4KHUA 4ZN3A 4EJUA 1RIOH 1KQ9A 3OYHA 2CO5A 5B3SH 4DFKA 3V1QA 3P38A 4B8XA 2K79A 4HUGA 4I99C 2HNDA 2QW9A 3GTQJ 2NUZA 1JLEA 3KEOA 5IOYA 2PG4A 4BR2A 4FASD 5LY3A 1HQUA 1S1XA 3PO2J 1NG7A 4DZJA 1X6BA 1PYVA 2CFXA 2HHUA 1OJLA 3NCIA 1TKDA 3UPUA 3EL2A 2DEQA 4UUSB 5J3BA 2BHYA 3JB9I 3WVEB 1ATNA 3A02A 1Z67A 2HPIA 3CTAA 2QUFA 2ZQBA 2LH9A 3QERA 1SFXA 2HBKA 3SAGA 5KVRA 4G1QA 2ZC2A 4RW8A 2Y1JA 3QBXA 3LAPA 1WPKA 1N34K 2JN0A 2FPDA 1EQYA 4LF7K 4N4NB 4DBHA 3FWEA 2K3PA 3HTUA 2CT4A 1LCKA 3KK3A 3PT9A 2V1NA 3A5LC 2CU7A 4NC7A 4BHPA 4A5NA 2UZKA 2M2EA 2QKBA 5J4YA 3HBTA 5HLFA 4F92B 5E1WA 3SV4A 1RESA 3U9ZA 2E2JJ 4WFNL 4E4HA 3I8DA 1X27A 2XAHA 4IHVA 2NS8A 4CFBA 1WAJA 1LWEA 4OX9K 1LDDA 1WNSA 1WHUA 4A3FJ 5DM7F 2DD4A 3DLKA 2G8UA 2VBXA 2RV8A 1EJ9A 1C0GA 1LWWA 1TVRA 4FJ5A 1WBBA 3FK6A 4NYFA 2D0AA 3V1OA 2EZHA 1OYWA 3OMYA 1VQ8T 4HTLA 5I11A 3D5RC 3M4OJ 1QNTA 2EFNA 2LTPA 1YXQA 1SQKA 3W3DA 2MW8A 1B7TA 2F69A 1YTAA 3QPLA 2EHGA 3RSEB 2A1RA 4WF9L 1HBXG 4FYYB 4AHRA 3M56A 5FU7B 4FWNA 4CJ4A 3OS2A 3OYLA 3TABA 2BH1A 2Z1JA 5AQSA 4G7ZF 5IHNA 5AQMA 2GQQA 4UQGA 2E5NA 4HVVA 3TO7A 3G6EQ 2P0PA 5AQQA 1U8RA 3KCCA 4AHUA 1HDDC 1YQKA 5DK5A 4I9QA 3CLOA 4E47A 2Y75A 2H56A 4XKBA 2E3IA 1MBHA 3L0QA 2KI7A 1ZSZC 5A0DA 3VYRB 2CZ0B 4M3WA 4N0AA 4M77F 3BDLA 3KVGA 3TAQA 5AFUA 3BZKA 3CVTA 3LSGA 3MO8A 4AFUC 4EDUA 2EYYA 2X1EA 5LJ3j 5MLCQ 2RI3A 1JKRC 1NJIC 3ERED 1RLPC 4IHTA 2AKKA 2BZYA 2I7PA 2EK5A 3CC2T 3TPQA 3I53A 3HTVA 1YE9A 3HRUA 1R59O 1T39A 3RRHA 4CF9A 5EG2A 3TU5A 3LLRA 2X3XD 3VS1A 1BIZA 4BG9A 3KK1A 2W6LA 4CEAA 3MEVA 2RQQA 5CHIA 1YIOA 4RTZA 2JVGA 4E9HA 1YI2N 1PD0A 1VQNN 1L3UA 1LOJA 4DF8A 4BACA 1KLNA 3FM5A 2X9HA 3HOZJ 3PUBA 5FD5A 3KFWX 2M1BA 2W42A 3O08A 2KDZA 3A98A 1QKXA 5KN8A 2LX9A 4FW1A 1BI1A 3S3OA 1W0HA 2YRDA 4AYBN 1KC8U 2VPRA 3ZSZA 1K0SA 2ZXJA 3M8EA 2CS7A 1H9TA 1AZEA 4AHSA 3PQJA 3I8BA 4CHYA 2W82A 3MKZA 2CJJA 1KQJA 4MHGA 2DL4A 3LDQA 2VKNA 2X6XA 2DT5A 1I0CA 5KYWB 2JA6J 3GZ5A 3L3VA 3JB9J 2EFIA 1RDDA 1RUOA 4Y7NJ 4C8QE 1O1WA 2STWA 1SF9A 1O75A 1G15A 4DEYA 1NTCA 1XC5A 4HKEA 3C18A 4E7ZA 1QRYA 1PG5B 2DDBA 3DB4A 4NXNK 5CKTA 3G4SI 1QVFM 1SPKA 2KRMA 2CUDA 1W2BP 3WHCA 4FE4A 1HCRA 4KGZB 2ZFUA 4RWTA 2AS5F 1PDNC 4C9YA 1FP2A 2VWBA 1LDJA 3OYEA 1T03A 4R0KA 1OYYA 2XICA 4JKHA 3HC7A 4YEJA 2BY1A 4HV6A 3JB9G 1EIFA 2FOKA 4NL3A 2CV2A 2QYOA 3TANA 4PLIA 5AQZA 2JLEA 2JHJA 3ULRB 5E8IA 2YSQA 1W1FA 4JX6A 4JNEA 1QQNA 4DR7K 5BOXA 3M0PA 3SZPA 5HY6A 3M0TA 4ZYDA 5AZJB 2GA1A 5KPRA 3CJ9A 3KFVA 1XMOK 2DA5A 1IXRC 3J81E 1K7AA 4AUXA 2Y30A 2P9KA 2P4WA 4O5BA 1I1JA 5FRMA 4EMKB 2ZCWA 3MXIA 4HCZA 1JLFA 2ABKA 5K7HA 2IAJA 4W5TA 2GTOA 4PL6A 1MSFC 2DTOA 4NZGA 1OQKA 1PM3A 4RW7A 5M1FA 2JTMA 2LF8A 5ICCA 4L0ZB 3DF8A 4IDHA 4FYVB 4DU4A 2QTDA 2ESHA 1RT7A 3MD2A 1PSFA 1R00A 2RD1A 1Q86C 3V9SA 3S9HA 1EWQA 2VKHA 2VIXA 2NUTA 2DYBA 2OJED 5EEAA 1SC7A 4QVDA 2O61A 1NK0A 3DLMA 2WACA 1ZHFA 2WUSA 2K3XA 1GCQA 3EUKL 2NRHA 1K6YA 4NNJA 1W2BM 4C30A 2KT0A 2QVOA 4I0BA 4B6MA 2LCSA 1YG2A 4ISEA 3N05A 3AVKA 4RTXA 5BN8A 1NYFA 2R7QA 3HI0A 4CZKA 2CZ7B 3FEOA 2KXDA 4JZ4A 1RILA 2XI9A 4CJPA 2RPIA 2HQHA 5JVGF 1YIJN 3H1CA 2VYPA 4WQ4A 3KYDB 3S1NJ 3ZQIA 1RZ4A 1S72A 2BGGA 1R6RA 1UGRB 2DRMA 4BQNA 5HL7L 3UDCA 4GV3A 3MCAB 1FTTA 4J9DA 4A2UA 4WQ5A 4OB1B 2YUNA 3WE2A 1VQ9Q 3FXJA 1Y0UA 2EH3A 5LJ3f 1VQ7A 2JWLA 3CJRB 3MECA 4G12A 4Y13A 4MTDA 1BU1A 2YHXA 2JA5J 1FT9A 1ZGAA 2MG4A 2DMOA 4QQ6A 4KISA 5J2MA 2Z0WA 3JR9A 5E79C 3CCUT 2B63J 1VQPI 4KUDK 2L3QA 2KT1A 3IFRA 2EQJA 2RQWA 2EYZA 3CXCM 2E64A 4W5RA 2NRXA 4ATOA 3LSMA 3C95A 4DTUA 3FZFA 3K1MA 1MIJA 2B7EA 4GYIA 2QQ8A 2Q36A 5FPNA 1M2OA 8AT1B 1JUSA 4U88A 1UDLA 4CERA 4LDXA 4F52A 1WHGA 4RTVA 3LP0A 4OLBA 2QXFA 3ESWB 1VUBA 1HPZA 2NOHA 2DQLA 3JCMd 4MNUA 3I59B 4PJOC 2BY3A 1NBEB 1GFDA 3O5ZA 4IZ9A 3OW2S 4KKOA 3PO5A 4GMJB 4F7UB 2IXSA 2L2PA 2X3WD 3NF8A 1HLVA 3JCMP 5D7UA 5EJCA 3LM2A 3H0IA 1KQSS 3OS1A 1L5UA 1XNQK 3E5UA 3CPWA 2WY7Q 1FIPA 2QWWA 2HBJA 3HOVJ 2R5YA 1IRFA 4P9UA 1T3LA 3VF6A 1M90O 1GDTA 1N33K 2O8XA 2IGNA 2I2LA 2FZGB 3E66A 4FSXA 4M78E 1LJOA 3ULEA 3WTYC 2A7YA 4OIQF 3LA7A 3CIPA 2D2WA 4FL6A 2C0IA 4M77B 4Z89A 3J7AF 1Z9ZA 5IOZA 2A28A 1U49A 4MQVA 2HEQA 2HHWA 2E41A 4A2BA 5FKOA 1WEIA 2UXDK 3MDQA 4C92A 5DD4A 4X34A 4K11A 4LIVA 4E1NA 2IPOB 4CEEA 2OBPA 2CWEA 3FJ5A 3DEWA 3BZCA 3RVCA 2R7UA 5I2SA 2ZJQL 5CR4A 2DOFA 3CFPA 1R5ID 4RLQA 1NOYA 4M3UA 4LK1F 3UT1A 3CXCP 2O8CA 1F9NA 1HD3A 2R58A 3SHWA 4F14A 1GT0C 3A5OC 3LA3A 4BGBA 1KIKA 2XK0A 2HQRA 2BZ8A 2XPUA 3NHGA 4LDYA 1JB0E 1RAFB 4M7DE 2HQAA 5BR8K 5AQNA 3MN2A 4HYEA 4HX4A 1TYQB 2IGIA 4Y1DA 3NF9A 2HQ5A 2D0OA 3OIPA 1VQ4T 4KMUX 1NGHA 2KIMA 1SSFA 1UUEA 3VF4A 5B8HA 1K78A 4NCBA 2OZSA 3ABTA 5GMKi 2OU2A 2JWKA 2FL7A 3QINA 3FDYA 1PNJA 1XMXA 3G25A 4FIBA 2EGCA 4M3TA 1OPLA 3WNGA 1M2VA 2O03A 3AVLA 1Q81C 4ELUA 1IRXA 2IGOA 2HTSA 3RJPA 2E2OA 1JKHA 3W2WA 2RDPA 4V19S 2F5VA 1DPUA 3W6KB 2DJNA 3QPHA 5LMNK 3L1PA 5GADJ 3DKXA 3VS0A 4K42A 4I6MA 2GOXB 1G59A 2OTJT 5C25A 3MVPA 1VQKA 4BQQA 4ZDOA 5HS9A 1EH7A 3K5NA 2D0CA 1R23A 1AWOA 4Z4FA 2ZGYA 1RI7A 4X9CA 1IG8A 2KDSA 3ECOA 3NNQA 5HNHA 5DPKA 3NVMA 1GVJA 3VQ6A 4ISFA 1S9GA 4U0WA 3A2KA 2FUG2 4UB8C 2Q0UA 4IG0A 4C8NA 3KZZA 1GBRA 4F16A 2YNIA 2BE7D 5GANd 4I01A 4YOWA 2HQEA 4KHWA 4BQZA 3QEWA 1TKXA 1FYMA 4R79A 1N27A 5ADXH 3SWNB 1JGGA 2JJ9A 3GWZA 4JX5A 1S1WA 1LJ9A 2P9IB 2RREA 1P2FA 3TTDA 2RQVA 2K7AA 2EVRA 2NVTJ 2CP2A 2Z1IA 1KC8R 4AI5A 5FWBA 1UG0A 1M30A 4BRDA 2XY8A 2MLGA 1RAHB 4XKCA 3JB9F 1IZ1A 2LKSA 2XKPA 3PLAA 3LWLA 1NKBA 4H8KA 3HPHA 3OV8A 2LCLA 4KNYA 3CC2A 3GNFB 3PIOF 1X3ZB 4M41A 2JPCA 1T98A 1Y71A 3MEAA 2VKDA 2RPNA 5JHFA 4HLXA 1TWBA 2G0EA 1DP3A 2L9SA 4H5RA 1YQRA 3I64A 3F73A 4L5JA 5FKMA 1HKTA 4WFBL 3DEUA 2ZXHA 1JUMA 3GPLA 4D5CA 4C5EA 1NJWA 3D2EB 3V7CA 2A08A 1TTYA 3VRZA 2XY7A 1TLHB 4B9UA 3R1XA 3LAJA 3H0GJ 2A5YB 4A4HA 1J09A 4RTFD 4ESBA 1VQ4A 5KQ8A 2BIVA 4EJTA 4KI6A 1KTQA 2VE9A 1F1ZA 2KTQA 1AWJA 4KH6A 2XC7A 3JCMc 4XLEA 4KPYA 3RMSA 1RRSA 1ONVA 2R7WA 2X74A 3BTJA 3QOPA 4U87A 2A42A 1RRQA 3CCUA 2EA4A 1KQ0A 1ARKA 2ZJQF 3CCJI 4C0ZA 1IC8A 1YI2Q 3LH5A 1G83A 4OGEA 4DS5A 5DLQE 4CEBA 2B86A 1XNRK 4XONA 1ENHA 5A0GA 1R4NB 1IDZA 3JCMV 3HOXJ 2QZ8A 2QQ9A 4C92B 1W97L 3U6FA 1S3XA 2LY2A 5LGNA 1TK0A 2I10A 4A3IJ 2JA8J 3QP6A 3FF5A 2P9LA 3I0TA 3A01A 2L7KA 2LJ0A 1W7PD 1XHXA 5KCHA 4M72A 4GCVA 4O6JA 4OAYA 4QIWN 5HLGA 3CC7N 4O5FA 2J6OA 1QVUA 3PVQA 2XDDA 4C0GA 4CSWA 1JJ8C 4HDVA 3CCJQ 3CWAA 4C0DB 1Z6RA 3AKZA 3THXA 2E12A 5D4RA 3PNYA 1OX8A 2DL5A 4UVBA 2VG7A 4A3BJ 3UR3C 1DDNA 1DTQA 3SQ2A 4I0AA 1HX1A 2J5PA 3BR2A 2KZGA 2R0QC 3HTSB 2BZTA 1VQLN 3O6WA 3ENBA 1YHQN 2O0YA 3K1NA 5AONA 3QEIA 2O8KA 5EZGA 4UVCA 3VA3A 4HNVA 1RDCA 5HKCA 3CWSA 1VQ6T 1E3HA 2K2MA 3THKA 1VQLQ 1UHWA 2FBIA 4ELVA 2EZIA 5A0LA 4CJEA 1JTXA 4DV4K 2XAJA 2G8KA 4AU7A 1KGSA 1LFBA 5DYMA 3GYHX 2WB1N 1HC8A 2FSWA 2AZVA 3TARA 1F5TA 4HLYA 2PN6A 2E88A 1I1GA 1XG7A 4DEXA 1XWLA 4S0HB 4AG1C 2XHBA 3FXMA 1HNIA 2STTA 2F5FA 1ASUA 5GANf 3VQCA 3KLGA 3J81O 3NGZA 2WBNA 4AYBA 3H45C 1H89C 3VOVA 3M3ZA 3T19A 4DYRA 3JAMK 4C8QA 4DTJA 1LAVA 4KULA 2YLCA 4AIJA 5E17F 1YJWI 1IUFA 2ASPA 2FU4A 2DYIA 4KTZA 4J9BA 2KRHA 1NK9A 5FO5A 1ERDA 2MYSA 1X3NA 4HQEA 3GCMA 1RAEB 3G1OA 4RB0A 3E2UA 4N0AC 3IS9A 3JW4A 2VYTA 1PVSA 4BYYA 1HKGA 3NMUA 3AG2H 2XIDA 3HOTA 5FW9A 4CH7A 2QEXT 3ZQGA 2H27A 3M57A 2DQRA 2V1RA 4BRAA 1K83J 3AL0B 4AMCA 3TVTA 1S5JA 1YX5A 3GXOA 1QTMA 3ABMH 1IDYA 4CBUA 3CW7A 2DPNA 1TUYA 2RN7A 2NOBA 1YWOA 4UVAA 3QEVA 2VONA 2KIUA 3ABUA 1WLPB 2ME0A 2ZWHA 1TS9A 5B1BH 5GJVB 4IFEA 4JYKA 9ATCB 2VN2A 1UG1A 1RDUA 4OFHA 2R7OA 3AVMA 2OD5A