3S3MA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/inhibitor/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3mA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3mA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3mA03
3ISNC 1BCOA 3MECA 4ZHRA 4QVZA 4YFUA 3KJVA 2L3RA 1NK0A 4A4FA 1YVUA 1L3SA 3VQCA 2LTOA 1RTIA 3NF6A 4J2DA 1RT3A 1TKZA 4OKEA 3ZSRA 3WNFA 2JGUA 1S1WA 4FJ5A 3HPHA 3QNNA 3SQ0A 4AHUA 4HCCA 4FJLA 4DFKA 1ZYQA 1QSYA 4NZGA 3MEVA 3HP9A 4DTNA 5FROA 4PY5A 1NK8A 2QXFA 3SUNA 3QESA 4IUVA 1FKOA 3TI0A 1BQMA 1G15A 3NF9A 3LP3A 3KLHA 1OZ2A 3K5MA 4DU1A 3TAQA 3RR8A 2PYJA 4Q5VA 3P83D 3ZT1A 2RJCA 1ZBHA 4J2EA 2KZMA 2HNDA 2B5JA 1RDBA 3OQ5A 4L8RB 4KHSA 4FJNA 5C6SA 4CJ3A 1Z26A 3NNQA 2YHAA 1C1AA 4ID5A 4DQQA 3SPYA 5CIUA 3L2VA 1N27A 1FKPA 2IG0A 2E6LA 1ZBLA 4W5NA 2HHUA 1TK5A 3OY9A 4IUQA 3QKJA 2P51A 2BANA 3E01A 2RJFA 3ASMA 2HHXA 4CHPA 1WSHA 4CJSA 3QO9A 3HT3A 1WLJA 3SUOA 3MEDA 4CEEA 3AVJA 3ZT3A 4B9MA 3ZSOA 4CJ4A 4N76A 4CEDA 3OYNA 1Q9YA 3L2WA 3PO5A 3DLRA 1RBVA 4HTUA 1VSHA 4CEBA 3DLHA 2BDPA 1C0MA 3AA5X 1A5XA 2F96A 3NTIA 4IFYA 4CF0A 4KREA 4Z02A 4M3UA 1D8YA 2P5GA 4QQGA 1WSIA 3CYMA 2G8VA 1FXXA 4O4GA 4M41A 3PMTA 1S1UA 3O8VA 3SI6A 5KGXA 2R7YA 1SKSA 2GFAA 1ZBFA 3LZJA 1CXQA 4F8RA 4Y1DA 3KUFA 4AHCA 3DLMA 3RMAA 3CFPA 2RF2A 4CJWA 3LPUA 4PWDA 3AO1A 2RN2A 3DRPA 1RTJA 3NGYA 4Y1CA 1WJQA 3MEWA 4B8CA 5T7BA 2X6NA 4E0DA 4CJPA 4HCBA 1L3UA 2QK9A 4NYNA 1IKWA 3OYGA 2DIGA 2HQXA 3ITHA 4MFBA 1K6YA 2BUDA 5CZ2A 2RHUA 3H6ZA 1D5AA 4CEOA 4NYFA 4ELTA 4CHYA 4KPYA 4ZTJA 3LDSA 4AHSA 4WE1A 3K59A 1S1VA 1VSEA 2EFIA 3LANA 2X6SA 1WNSA 4A4HA 3RMCA 3OS0A 3H08A 4GMJB 1UA1A 3RR7A 5E41A 2EHGA 2O4XA 2WOMA 4FW2A 3HPOA 3V9WA 4E7KA 2LVMA 1BIZA 3HSTB 4DTXA 4FLXA 3VQEA 3HVRA 2F8SA 3Q1JA 2LDMA 5DK5A 3SQ2A 3EYZA 2HMIA 2PZSA 2A1SA 4B08A 1KHCA 3OS1A 5D6WA 3S6WA 3TWHA 3OMGA 1GOCA 4AILC 1VRUA 1XWLA 1TK8A 2HNYA 2WONA 1T05A 5FRMA 4W5OA 4CCHA 2R5AA 1XI1A 4AH9A 4GY5A 3L3VA 1RDCA 1IKXA 5KE3A 1HMVA 4IBNA 2Y1JA 3CEYA 1NK5A 2MWOA 4KHYA 1HYVA 5I42A 2G8FA 1RILA 4FK4A 4CGFA 4RW6A 3F70A 1EKEA 2YKMA 3A2FA 4G1QA 1TV6A 4FLVA 3C94A 3VQAA 5KCHA 4OVLA 3VN5A 3QETA 1QSSA 4RW7A 4DSKA 3AVNA 2PY5A 5JS1A 2DIQA 3CFRA 1CZ9A 3TAEA 1J9AA 5J2PA 3SNNA 4OPKA 3KLIA 3MEAA 4FK0A 2BE2A 4JLHA 3EAEA 1RT2A 1NKEA 2HHQA 3OYJA 3LH0A 3ZT2A 3DLKA 1SV5A 3NTKA 3OYDA 3NBPA 4AHVA 3FEOA 4W5RA 4BE0A 4CGGA 3B6PA 4JRPA 2XY6A 1BHLA 1J5OA 2Z1HA 5IN1A 5J2MA 4B9UA 4N41A 3ZSQA 2HVHA 2VYTA 4CJRA 1ASUA 1ZBUA 2VG5A 1VSMA 3DOLA 4RW4A 5CYQA 3VQ8A 3SZ2A 3PY8A 1WAFA 3C6TA 3OJUA 1NK4A 1RTHA 4E7HA 4N4GA 1NKCA 4J2BA 3KLGA 4DS5A 3LGFA 4DLGA 2JLEA 2OPPA 4H4MA 2GF7A 1B92A 2D0AA 2R5MA 2ITGA 1JL2A 3VQ7A 3DB4A 3BGRA 1RBSA 2FC0A 3HL8A 3V9ZA 1D9FA 3PO4A 4CK3A 1I3AA 1W9HA 3LLRA 4OGCA 3NHGA 3FC3A 1NJYA 4KB1A 5D3GA 2RI2A 2HQEA 3AA4A 1KVCA 2RJDA 5KE2A 2YKNA 4E89A 2YRVA 2JTFA 3WNEA 4XIUA 2DFHA 3NF7A 2XHBA 2M1HA 3LALA 1TKTA 2E6NA 1W0HA 5K14A 1CZBA 3V1RA 4DFPA 1KRPA 4EZ6A 2ZD1A 4C5EA 3TR8A 1HQUA 2OYQA 2FBTA 3QIOA 1Q8IA 4ICLA 1LAVA 1SL1A 1LW0A 1NKBA 3SCXA 2ZQBA 1U48A 4E3SA 1TVRA 1BIUA 5KRSA 4K8XA 1JXBA 3E9FA 3AVAA 5CY4A 5FRNA 3NE6A 3NH1A 1HJRA 3SV3A 3S9HA 2YNGA 3OYMA 1ITGA 1VSJA 4CK1A 4HVJA 3NGIA 4Q5WA 1LWFA 4KHUA 3RRGA 1S1TA 3H8ZA 4M45A 3C4SA 4LD6A 2EX3A 4E7IA 3U3GA 5CZ1A 4IURA 2BGGA 1U49A 4M3RA 5I3UA 3RWUA 3QLHA 4I9LA 4FJKA 4O44A 4C5IA 4DSEA 3BDLA 4IG0A 1WAJA 1Q9XA 4CHOA 2RHZA 1ZBIA 1JLFA 3AA3A 4PL6A 2XY5A 4DF8A 4C8OA 4OGEA 3OYCA 3OYLA 2KFNA 3IG1A 1BQNA 1I39A 4BDYA 1U4BA 4OKJA 3OVNA 2GBZA 2GFUA 4BE2A 4C5HA 4OVAA 1LWCA 1BI4B 1RBUA 3P1GA 4CFAA 4CGDA 4OKKA 5C0MA 4KO0A 1C6VA 1QS4A 4CERA 3O3GA 5J39A 1EP4A 1BL3A 4UQGA 1T8EA 2OZSA 4F3TA 4FYDA 4RG8A 2OPRA 5CYMA 1WSEA 4CFBA 3DLEA 3FLGA 2Q3SA 3NH0A 1UWBA 2R57A 3SYZA 4NCBA 4KTQA 1UOCA 5HRRA 4FCYA 3EY1A 1NJWA 4AHTA 4PA1A 2BIVA 4FZYA 4B9SA 2RKIA 1JXEA 1BCMA 4ID1A 2X4YA 1KFDA 5EU7A 1ASWA 1C1BA 1VK0A 3KIOA 3AO4A 2ETJA 4CHZA 4FK2A 1MU2A 3AVLA 4M3XA 2O4XB 3AVHA 3IRXA 1HPZA 1VSLA 5J26A 2X4XA 4B9WA 1VSIA 2IC3A 2OPSA 3CQ8A 4FM2A 3VQ6A 4B9VA 3AVBA 1BGXT 3QIPA 3QEVA 1VSDA 4KI4A 3VQPA 3O4QA 4IUPA 4BDZA 3SD4A 1C1CA 3WNHA 2A1RA 4DU4A 2OA8A 1HNIA 4DQRA 3OMCA 4I7FA 4KTWA 3M8PA 4B3OA 3ZT4A 1S9GA 4KI6A 3KK3A 4E1MA 2EQKA 1C0UA 4CGJA 1SL0A 2K3YA 4O0IA 1ASVA 1RT4A 3L8BA 3L2QA 4CE9A 1R0AA 1H3ZA 3LYIA 3L3UA 1N5YA 3MP6A 1G5VA 2XY7A 4IG3A 3L2RA 4LSLA 4FLYA 4Z4EA 2HNZA 3NFAA 4CJ5A 2G3RA 5HRNA 1S6QA 3MO8A 2YNHA 3ULDA 3HK2A 3VQDA 5JS2A 1NK7A 2RI3A 4KRFA 3TABA 4CGIA 1QHTA 4TSXA 3MXIA 3SV4A 2VWKA 3QEPA 2IOCA 1RT1A 5KTQA 2PQWA 2AJQA 3OYIA 1IKYA 4DG1A 4DQPA 1S5JA 2B4JA 3OA6A 5SZTA 3V81A 2E5QA 4FM0A 4DSLA 4FJIA 4QOZB 3LAMA 4FLWA 2IGIA 1HQEA 1LAWA 3KK1A 2XRIA 1SL2A 4B9TA 1SKRA 2RO0A 3DLGA 3JSMA 3BDPA 1NJXA 1SSFA 2RHXA 5KGWA 2WACA 4CRIA 4CGHA 4DWIA 4EZ9A 4EP4A 2M16A 1QE1A 3QINA 4IDKA 4O0JA 4W5TA 3PX0A 3DRSA 4FJ7A 1JLEA 4C8MA 2Z1IA 4DTSA 4NS5A 2P0KA 3M9QA 2G8HA 4A4EA 2L89A 3B6OA 3K2PA 3OJSA 1OZ3A 1JLCA 3OYEA 3IS9A 2RPIA 2LRQA 4QQ6A 5DMRA 3UWNA 2ATQA 1RNHA 5J2QA 3V6DA 1HYSA 4CJVA 1DTQA 3CG7A 3OYFA 1S1XA 4NCAA 3FDRA 3MAQA 3S3MA 1WSGA 3MEEA 3QEWA 5HROA 4CJEA 4E7JA 4E7LA 2OPQA 4CJLA 3WNGA 3LGLA 3ZT0A 4CF9A 4RG2A 3DYAA 4KTZA 1KSPA 1WSJA 4Z4HA 5C42A 1WGSA 3TAGA 1TK0A 3ZEHA 4KFBA 2B6AA 1EX4A 1Z25A 1HRHA 1KTQA 1TL1A 4LY7A 3FFIA 1JLGA 3KKRA 4NCGA 1XC9A 1JLAA 2R58A 4CIEA 4R5PA 3RTVA 3U6FA 4FXDA 3ME9A 4BE1A 3T19A 4OPJA 3LP0A 1BI4A 5J1EA 3DB3A 1RT6A 5HP1A 4B9NA 3AA2A 2Y1IA 2HHWA 4DTPA 2EKOA 2KTQA 5KCOA 1O1WA 3SUPA 1NJZA 4F4KA 1L3VA 4DTOA 2HW3A 4FZZA 1A5WA 4PLIA 4H4OA 3KKSA 2L8DA 3CFOA 4KHQA 1S9EA 3VQ4A 4CF1A 3C6UA 4CK2A 1T7PA 1X9MA 3SPZA 1IKVA 1TGOA 1XHXA 3AVFA 3P5JA 3QIIA 4O5BA 5KI6A 1LWEA 4UC4A 5IAYA 4KKOA 4J2AA 3RMBA 3DLBA 3OYAA 1X9WA 2RHIA 3MP1A 3MXMA 2F8TA 4QW2A 1RDAA 3V4IA 3TAPA 2P1JA 3KLFA 3K57A 3K58A 3PV8A 2RHYA 3TARA 1Y97A 3DMJA 4IFVA 1L3TA 3C95A 3TANA 4Z4GA 2XDPA 1J53A 4I2PA 4CF8A 4DQSA 3LPTA 3JYTA 3VQ5A 3PX4A 2IAJA 1KVAA 1B9FA 4JS5A 4CHNA 4RW8A 4FJHA 3VQQA 4A4GA 1GOBA 1NOZA 1C0TA 2HHSA 1NK6A 3LZIA 3DI6A 4Z4IA 2HHTA 1WJSA 1YTAA 2F5KA 4QCLA 4FJGA 4DFJA 3PX6A 2G8UA 4ELVA 3AVGA 3ZSVA 2XY8A 3HXMA 3VA0A 3QEIA 3QJ6A 4FW1A 5M9OA 1YTUA 3D45A 2RI5A 1S6PA 3M8RA 1VSKA 4ELUA 3KD5E 4PQUA 3HO1A 1TAUA 4F2SA 1RDDA 3OYBA 1XNIA 4FJJA 1NOYA 4L59A 4CIGA 4M3ZA 1N6QA 4CECA 3LP2A 1WJRA 3V1OA 3F9KA 3GOXA 2Z1JA 1EXQA 4Q0BA 4DSFA 2RJEA 2D0BA 3S3OA 2NUBA 3LP1A 4Z0UA 2IDOA 2YNIA 4DMNA 1JKHA 3S3NA 2FBXA 5D6YA 4CHQA 4CIFA 2D9TA 3ZSZA 3AV9A 1CLQA 3ASKA 2HVIA 2YNFA 2DAQA 1KVBA 1WN7A 4CEAA 1T03A 3AVKA 4KHWA 2QKBA 4B8AB 3OYKA 4QQDA 4HUGA 2X35A 4X34A 2W42A 4C5GA 2EQMA 4BDPA 4LH5A 4YNQA 2EQUA 1GOAA 4CEQA 2ZE2A 4ZTFA 2FHDA 2OZMA 2KZZA 4H8KA 4F2RA 3E9GA 4QAGA 2XO7A 2DFFA 4FLZA 4PLLA 2XK0A 3EZ5A 3LWMA 3PFSA 3G0ZA 4GVMA 4CESA 1KCFA 4M3WA 2X78A 4CJFA 4CFDA 3HJFA 5HRPA 4BD3A 1FK9A 3AO2A 3HPGA 2G8WA 4KV8A 1TAQA 1TL3A 3CM6A 3I0RA 3HM9A 5HLFA 1LV5A 3V9SA 4FJ8A 4FU6A 2G8IA 4CJTA 2KFZA 4DFMA 2KW4A 2DFEA 5C24A 1VRTA 4I2QA 3KK2A 1JLBA 2B8AA 3LAKA 4LD0A 3LWLA 4DF4A 2LSNA 4FLUA 3K5NA 4KB0A 3NDKA 5FDLA 3VQ9A 2DTUA 2PYLA 1UAXA 3VA3A 1JLQA 1X1PA 5J2NA 4FLTA 1D9DA 2DY4A 4F3OA 4DTUA 1CXUA 4M42A 3MXJA 4N47A 4CF2A 4C8KA 4K8ZA 1RT7A 2BKDN 2YV0X 4OLAA 4DQIA 3D0PA 4B9XA 3I0SA 3KLEA 3QNOA 4DU3A 4KAZA 3PNWC 3O4NA 2VWJA 3HVTA 4FVMA 2HB5A 4HCZA 2NLUA 2E6MA 4O55A 3OS2A 4CJUA 1DTTA 1L5UA 1KLMA 3SUQA 1BISA 3PMIA 1QSLA 3L2UA 2YHBA 3ZSWA 2X4WA 1U47A 2LCCA 5D6XA 3AO5A 3QEXA 4FJMA 4FJXA 2HHVA 2GV9A 1RCHA 2D0CA 3MEUA 2D5RA 2GUIA 3KD1E 1A5VA 4BWMA 4EDUA 2FBYA 1B9DA 3OYHA 4MQ3A 3G10A 5HBMA 3ZCMA 3O3FA 3I8DA 4DS4A 3RMDA 2JZ2A 4CJKA 2K3XA 2Z1GA 4BWJA 3NGZA 4DLEA 3V9XA 3T3FA 3P8DA 4AHRA 1J54A 4II1A 3TAMA 3L42A 3CM5A 4IUTA 4E1NA 4HUEA 4M3YA 2KQ2A 4OJRA 4Z4CA 3VQBA 4N4HA 3AVMA 3K5LA 3NTHA 1SKWA 4KHNA 3QBYA 4FZXC 4IUUA 3K5OA 3HP6A 4FL6A 5SWMA 2I5JA 4C8NA 3SQ4A 4CEFA 1QTMA 5KH6A 4N56A 3ZSXA 1SUQA 1TKDA 1UA0A 4PUOA 1F21A 4N5SA 3UT1A 5HRSA 3O3HA 1WSFA 4IKFA 3DM2A 4HUFA 2FBVA 1RBTA 2VG6A 3SQ1A 2IS3A 1HNVA 3V9UA 1U45A 3AVCA 4FM1A 1NK9A 1TKXA 3AVIA 3NCIA 3KTQA 3DOKA 3M8QA 3META 1RI0A 3RRHA 1JL1A 2G8KA 2QQSA 3PUFA 2O4GA 5KRTA 2CKKA 1X9SA 3MEGA 4OLBA 1U04A 4W5QA 1RBRA 4LH4A 4DTRA 3U3YA 3TAFA 3V1QA 4C8LA 4EP5A 2QQRA 1DLOA 3NH2A 2MWPA 3LX7A 4GW6A 4CJQA 4JRQA 2VG7A 3IAYA 3OB9A 3NAEA 4HHTA 2P5OA 1REVA 3QERA 1MHNA 3HYFA 2O4IA 3NF8A 4CFCA 3SJJA 4JS4A 1KLNA 4DSJA 4LSNA 4I9QA 1YT3A 1HYZA 3F73A 1QQCA 2X74A 1EETA 1IH7A 5C25A 1VSFA 4RW9A 1RT5A 4M3TA 3T1AA 3AO3A 4E19A 1LW2A 3ALYA 1IO2A 4N4IA 4DTJA 4Z4FA 4CEZA 3DRRA 4FJ9A 2EQJA 3P8HA 1RTDA 4B9LA 4DSIA 3UIQA 2E4LA 3MP8A 4DTMA 3ZSYA 3THVA 1IG9A 4BACA 1OYXA 1KFSA 2M0OA 3M8SA 2QKKA 1XHZA 1OI1A
chains in the Genus database with same CATH superfamily
4GV3A 3KJVA 1F43A 1GCPA 1NK0A 1VQ5Q 2IGMA 4JJNK 2YSQA 5ECAA 1OMIA 4FT4A 4PY5A 3FXMA 3I5SA 3QYBA 3VS2A 3J81K 2RDPA 3A5MC 2CRGA 5L23A 4D7MA 2B5JA 4L8RB 4ILGB 4B09A 3PIOF 1Z26A 3J80O 3DEUA 4A3FJ 1ZBLA 3LA2A 4M77F 2HHUA 4Y0WA 3U2RA 2ZGYA 4CHPA 1HU0A 2ZGZA 1YX5A 2E65A 5L3BA 2DN0A 3ZSOA 4MTEA 4CUGA 5AQGA 3WUHA 2YRDA 2JN6A 3L2ZA 4QQGA 5AZIB 1FXXA 3H3VK 2R5YA 5KGXA 1C0FA 3H3OB 4B3TK 4F3QA 2EGAA 4CJWA 2DD5A 3AO1A 2EILH 3T0YA 4J6YA 2J4RA 4MFBA 4KPYA 1A35A 5L3GA 2QBYB 2NRVA 4EJWA 3HPWA 4HCKA 2L9NA 3MZHA 5E41A 3SB2A 3NEUA 1QP3A 1M1KC 2LDMA 2A40A 2DOAA 3ZQHA 4HX8A 1H641 2ZXJA 3OMGA 4II3A 3SYTA 3EPZA 4H0VB 8ATCB 3SWNA 1RDCA 1QZ5A 4UV9A 3LNQA 1K9MR 3C94A 9ANTA 4OVLA 1M90U 4DSKA 2F9TA 3MFKA 3VJPA 2VGNA 4EW0A 3MEAA 1QVFS 3OIQA 1IV0A 4DS5A 3NTKA 2XY6A 2NAZA 5IN1A 2PVDB 2HVHA 1MW7A 3GTGJ 3PY8A 1NK4A 1ZSZA 2XC7A 4ZGJB 1GT0C 4N4GA 4AFZC 3KLGA 2FBIA 2NOIA 3WHBA 2X4HA 4YY3K 4C0FA 3E1YA 4JD2B 3TTFA 1D9FA 1RBSA 4JI4K 3M0PA 1GDTA 2RJDA 3LDLA 5DD4A 4AYBN 2KGTA 4ICLA 1SL1A 1NKBA 4C3HJ 5JVTA 3WEEB 1AWCA 4M78B 3VSLA 2AZVA 3JB9H 3Q9VA 2EPFA 2JXBA 4B9QA 3CC7N 2KLOA 2Q8KA 1YW9A 3H8ZA 4LD6A 3MEXA 1YIJT 3CI5A 2V1XA 4XOPA 2P9PA 3PFIA 1IN5A 1VQ4Q 2FNAA 2E1CA 1SZ2A 2NRWA 1C6VX 4C5HA 2CT3A 4XU2A 3BG6A 1Z9ZA 3O3GA 1VQ9T 2LBFB 4F3TA 3TQ7P 3BPVA 4KTQA 3T7ZA 4MMLA 4CCJA 2IA2A 3J7YP 4HF2A 1QVPA 3CP8A 5J26A 3O8MA 2TCTA 1A31A 1UGQB 2UXBK 4LLGF 3SZPA 5LJ3e 1HNIA 4CD3A 3DPTA 5ADXA 4H5VA 3C0CA 3PFYA 4IG3A 2A0FB 3DU6A 2HNZA 2O9LA 1I1JA 2ZAEA 3J80K 2W10A 3M57A 5J8FA 2IPQX 4H5RA 2DTZA 3KP2A 2EWSA 1Y7XA 3P4IA 1SHGA 3R0AA 4C8QA 1FYMA 3H0FA 1TWBA 5AONA 2Q2EB 5I9EB 4ON0A 2Y4XA 3VEXA 1SKRA 3BDPA 3PSFA 2RHXA 1U1TA 4F7UG 3FIFA 4X65K 4WYBA 2QUFA 3CO7C 4C0DB 3K2PA 1BUPA 4A5AA 3OHRA 3CC2T 4M77D 3EN9A 5HNFA 2RQQA 1QVGS 3FDRA 1IO6A 2VQGA 4XU1A 3S8PA 1WSGA 3MEEA 5FKMA 1TNSA 3LGLA 3I56A 2B6AA 3DP7A 4A57A 4ORZA 2V7YA 1YHQA 1BI4A 1Q7YO 4L9TA 1DGWY 1BA1A 2WFBA 3SUPA 3ZQFA 1YIJQ 3CCVN 3ZMTA 2LG4A 2X1CA 4JQFA 4CCLA 3AHUA 3ULEB 2E1MB 4UVBA 2L8DA 1NEGA 3CMEN 4ZNXA 5HDNA 3AG3H 2OJ2A 1PU6A 2M2EA 4ZN3A 5EEHA 3GX4X 3TARA 4ISEA 3D7SB 2KRFA 4KGZB 3K0SA 4L18B 4B1UB 4IQ4A 3CC4T 4K41A 2VBZA 4FYVB 4NHJA 3JREA 3JRIA 2OCEA 5M9OA 1GLBG 2BZ8A 1WA7A 2J06A 3F9MA 5BS6A 3E97A 3PQJA 3QDFA 1FZPB 5FW9A 2JA5J 2RJEA 4DSFA 3V8KA 3CC2N 2NVQJ 2YNIA 3S3NA 1O3SA 4DBQA 2K9SA 3ASKA 2M51A 3GYHX 4C1NI 1WN7A 3OYKA 1CGPA 5GAHP 2EQMA 5BREA 1S7EA 2DDAA 1E17A 2DFFA 3EHQA 4YOXA 4M3WA 2CUDA 3O8HA 1HPMA 4PCQA 2RHKA 3CC2I 3FZKA 2KFZA 1VHXA 1XCBA 2VBYA 1MMDA 3FIWA 2PEXA 5H6RA 4GY2B 2XF7A 1TBXA 3OSGA 3BZCA 4OFEA 2BXYA 2D1HA 1WHKA 1XC5A 4H0YB 4CF2A 4C8KA 3F8MA 1U2VA 1GLCG 1ON1A 3HXLA 3HRMA 1AHJB 1U3OA 3KWGA 3LFUA 1FOKA 1QQMA 3AO5A 3RSEB 4JI5K 2CH0A 4A59A 5HBMA 3RERA 2K3XA 3SEQA 3H6EA 4II1A 1XMXA 4Z4CA 5F6FA 4UY8I 1T6CA 3CWTA 3K5OA 3U1KA 1JUSA 3UATA 1W0UA 2YSRA 3TP0A 3UT1A 5IOYA 4IKFA 2RF0A 1MSFC 2VG6A 3RPUD 2VC1A 3JW4A 2JPSA 1XQSC 3QQAA 1WI9A 3CWAA 5KRTA 2RA2A 4L9JA 3NH2A 1N25A 2RD1A 2H3EB 5AQKA 3RMQA 4PJOG 4MLHA 4YOUA 4B8XA 5CKTA 5H2FC 4RTZA 4JK7A 2MSYA 1EIFA 2F9WA 4N4IA 4QT7A 3VUZA 1OYXA 2XKPA 3NF6A 4EMGA 2PTKA 3G73A 2QWMA 5CQGA 4QVZA 4PNOA 4E2FB 3HZJA 1ZH5A 2A28A 3QNNA 3DTEA 3BZKA 3J7ZI 2H6BA 1FKOA 4GLMA 1RC9A 4XTUA 2B7EA 3RSNA 1MMAA 3WTXC 1P6RA 2XV4S 3KYCB 1V55H 3ASMA 4I2OA 3K70D 2KROA 3OYYA 1BN5A 4GNIA 5AIPA 3ZX0A 4Y33A 1Q9YA 4G9YA 5F0HA 3TSQA 1OCPA 2F96A 5GAN7 4Z02A 3GUDA 1D8YA 2K5CA 3S16J 5LBQA 4M7DC 4MDXA 2RF2A 1W5SA 2BE7D 5KK1A 2GQQA 5AQSA 2QK9A 1IKWA 2EKHA 4AHSA 1UGPB 3QBXA 4JLIA 2RM4A 4L9NA 1N8RU 2JNGA 2JS2A 2DYIA 5CKBA 1HXDA 3CQYA 2M0YA 2W48A 3CERA 1F5TA 1JKOC 3CCMQ 2D2WA 1DJ7B 1TK8A 4E6RA 5FU7C 1K73R 4Z8AA 1S6LA 5HS7A 1WBDA 4QS7A 2KBTA 4FK4A 3KZZA 4FLVA 2BZXA 4RW7A 3K2ZA 1CZ9A 5CJ9A 2ESHA 3EETA 1NPRA 1OJLA 1BHLA 1Y1WJ 4N41A 5C0YA 1JBMA 2V9PA 4FX4A 2X4JA 2K7LA 2DMQA 1TWFJ 3SZ2A 1R8OB 1NG7A 4M7DD 1G4DA 3HIFA 3NWTA 2GEMA 5J8CA 1FBSA 2VXFA 2QM1A 5C4JJ 1W9HA 3QSUA 2YRVA 1WPYA 5FU6B 1G3SA 2Q0OA 4F04B 3BTLA 1TVRA 3BFMA 1U78A 4M45A 1YYVA 1FOYA 5E79C 4HG2A 2BGGA 1OYIA 5I3UA 3CJRB 3CLQA 3JCMW 3I35A 2HF4A 1RUWA 2K4BA 4MMKA 4IVNA 2E7WA 5EG0A 2JTVA 4BDYA 4CBXA 1KHIA 1LOJA 5JICA 4KO0A 1WSEA 1I5ZA 3SYZA 1YE9A 3H9NA 1P92A 2Z2SB 5AQIA 1C1BA 2QKBA 3AO4A 3FXLA 4FSXA 3IRXA 2JVGA 1IXDA 3JCMb 1BGXT 2KFDA 1QCFA 3J7AY 3ZGKA 1MDUB 3FXQA 3A5LC 4DU4A 5IT9Z 3L8BA 5CR4A 3MP6A 1S6QA 3GCMA 5CKFA 2QKMB 2X1EA 3GBTA 5KTQA 2CSQA 2Z99A 2NOGA 1U0JA 3OYIA 2CQQA 1S5JA 2JVVA 4Q4ZF 4FLWA 1HKCA 4C2UA 1PVSA 4KIGA 1XX5A 5IT9E 2DDBA 1YHQN 5FD5A 2RPIA 3QG1A 3A8HB 3WTUC 4X64K 3HJEA 4JLGA 3AAQA 3SLCA 1FOWA 1T6SA 3CCRQ 5DM6L 2DK5A 4CF9A 3TAGA 5KNLA 3ZEHA 3OH9A 5FLVA 2AXLA 2ICWG 1JLAA 5M3FJ 1QP2A 2IPOB 4OPJA 3JSPA 5J40A 1RT6A 3AA2A 2QYZA 3Q0WA 2JT4A 3CCJQ 3CFOA 2CJJA 3L4IA 2QF7A 1W5CC 3BY5A 5EOYA 2UXXA 2RNJA 1WQWA 3V7CA 3ZN0A 4UVCA 1WVRA 5LJ5g 4BL0B 1NLVA 3G4ST 3O5ZA 4OINF 4KIBA 5FLMJ 3HRUA 3Q9SA 3O1BA 2HHSA 2VYPA 1IW7F 1YTAA 4M73A 4DFJA 4MIMA 5H20A 3AVGA 4B1YB 2X85A 2HEQA 3TW6A 4KIFA 4QPQA 3C6HA 4M78C 3KZBA 1PJRA 4OMOA 5KYWA 4FJJA 2I5WA 1T0HA 5GAMf 2FG0A 2HMAA 2XIGA 2CFXA 3FXOA 1W7AA 3ZMDA 1YBYA 4CYCB 5GPAA 4WWCA 2EJFA 2ZCFB 3PVQA 4RTFD 3T5XA 4Z6YA 4J8OA 2ECZA 2RNAA 5DEQA 4CFDA 5D6EA 1MMGA 2HDAA 3V7RA 1S3JA 5C24A 2NOBA 3THWB 3H36A 5EEGA 3CDIA 4IPAA 4M9ZA 5J2NA 2DY4A 4D5FA 1Y96B 3MXJA 5HCKA 1U3EM 2ZCWA 2EPDA 2NS0A 2XHKA 1R77A 1M90C 3H5AA 5HVQC 2H09A 1NGAA 4OMLA 2GV9A 3SFMA 2HFHA 5B1BH 5J4YA 4AG1C 1BK2A 3WTZA 1LJOA 3HUGB 4CCNA 2M02A 4D8DA 4BC2A 4YIIA 3HHHA 1M1KU 4KHNA 4YDUC 1VQNT 2F48A 2X3XD 1SAZA 1F1ZA 3ISPA 5IP9J 2HQ5A 1HSQA 1RBTA 3AVIA 3M8QA 1JL1A 4OLBA 1R0BG 2CKKA 4DUYK 3QO3A 1YW8A 1FPQA 1WH5A 4CFCA 3ULQB 3BWGA 3HRTA 1P7IA 3P8HA 1YITA 3H3NO 3SJHA 1R36A 3MECA 3CCSQ 4A4FA 2QA4A 3I56Q 2IS4A 1I81A 2PQ8A 3I0XA 1SS6A 3VGMA 5FKKA 1KA8A 4N0AC 2LC2A 4DQ8A 4DU1A 3QFUA 4MQ9F 1X43A 1OCRH 1FSHA 5CYVA 5C6SA 4HX7A 3PIPL 5J3LA 2KIFA 3X26B 5AQHA 3CJ7A 4JI0K 2L9VA 3E2UA 4N9HA 1YUWA 4N76A 4ZYGA 2R7QA 2VKDA 3VYTB 5HK0A 3L2WA 1WEGA 2EZLA 3DLRA 3LOCA 4CYCA 2E1MC 3WG9A 5ICEA 2HDWA 2GFAA 5LMNK 1X3UA 4Y1DA 4FTHA 1JKRC 3FLCO 5T7BA 4F7UA 1QQNA 1L3UA 2HQXA 3CC7Q 2BH1A 3ITHA 4F92B 1TOVA 2HCKA 4ESBA 2ZM6K 2DEQA 1H8KA 1KU2A 2OCCH 4HBLA 4JZ3A 3OS0A 4M6YA 1E6GA 4DV4K 2NNYA 1TWCJ 3HKZA 3HVRA 2FBHA 4M9XA 2KJBA 5D6WA 4I6MB 3I3LA 5J1UA 1NGCA 4A0XA 1X69A 1WUAA 1XI1A 4AH9A 2KMUA 4LDXA 4PJLA 4BQOA 3SWNC 4RB0A 4HOBA 4RW6A 3CCVI 5BNGA 1YIOA 4BJ6C 2OTLA 1ZARA 2DIQA 2R4GA 3CMAA 3GW2A 3CCLI 1NKEA 5BR9A 2HHQA 2NVUB 1SV5A 1J75A 1QKWA 2Z1HA 4BRQA 2MF2A 2DFIA 3C6TA 4BRDA 1I1GA 4J2BA 3IHOA 2F2EA 3DB4A 4RB3C 4W97A 3OA9A 4Y92A 4ZYDA 4KB1A 3E6DA 2E5KA 1Z21A 3SEZA 2LP0A 3HHGA 4C8QC 2YJFA 3EG3A 3QIOA 1Q8IA 3QFPA 3GBQA 4HX4A 3MKLA 1OISA 3QWXX 2BZYA 2VONA 1RZ4A 2F5EA 1JXBA 3FWEA 4VUBA 2BEOA 2M9HA 1NLPC 3ABUA 4KHUA 1GXQA 3VYGA 2Q1NA 3AAFA 4LDUA 3H3ZA 5CZ1A 4HWIA 2MAMA 4JUVA 1KC8R 5GAMe 2VPRA 4BXFA 4MDBA 3FM3A 5K7HA 3W0LA 2QEXQ 1NPPA 2QWRA 1E4GT 3OYCA 1U4BA 2CQNA 4BE2A 1D1CA 5JLXA 2QA4Q 2DTHA 1XDUA 4FYDA 3G6EN 4GV6A 1EQYA 5BRHA 2DMOA 1HSTA 2LLKA 3EY1A 4YELA 4EVIA 1HKBA 4M3XA 4XK4A 3J7AP 3VQ6A 1G99A 3AVBA 2PMZA 5EGOB 4I99C 2XIDA 1Q1VA 3HOYJ 1KQ9A 3JCMQ 3TOAA 4AIHA 3OV8A 4CGJA 1H9TA 5GAN3 2EFQA 1TC3C 1VYUA 5GAOl 2NRZA 4FLYA 3T69A 1MWKA 3ECOA 1P8ZA 1M3AA 2R93J 3KZYA 2TRTA 3I59A 1O9SA 5LJ5j 2ME0A 1QVGA 1WYXA 1H89C 4DG1A 5BN8A 2Y0SA 4CC3A 2IGIA 2QWQA 2FNPA 1SSFA 2P0KA 4XM3A 2DRKA 4DR3K 5CAIA 2IA0A 2QYOA 2DXTA 2LRQA 2VQCA 2NOEA 4M75A 2ZSIB 3TPQA 2YHWA 3VW4A 2OTLT 1IGNA 2GIVA 1VQON 2LJ3A 4BI4A 4WTOB 2HBPA 2AKLA 1M2OA 4NCGA 1VQ7I 4CIEA 4NQWA 4FWRA 3P7NA 2CGKA 3KEQA 5I21A 3UKRA 4K42A 4IX7A 1VQMI 1PUFA 4DBFA 4JI6K 4MLEA 4J01A 1D0XA 1T7PA 3CMAQ 4UC4A 1K9MC 3THYB 4QW2A 3S32A 3AAPA 2ENMA 1XPXA 2GX9A 4EA5A 4A4GA 5EVZA 1PKSA 4M63C 5DUKA 1H3HA 2F5KA 4QVCA 3PX6A 5M1QA 2DW4A 3B6CA 3R6MA 4DV3K 5GAN4 3M4OJ 2VXEA 3D45A 1JI8A 4FT2A 3KD5E 3HO1A 4L59A 2COMA 3ROUA 3GOXA 4CZIA 4CIFA 3ZSZA 4XU3A 2CUZA 4ZJZA 3ASNH 3WE2A 2ZE2A 3A0IX 1VRLA 3EZ5A 4JI3K 1QZEA 3OBWA 9ATCB 4G6QA 1TAQA 3M5RA 2JUCA 1LDDA 2MPXC 3RDVA 3S14J 3K5NA 1K4SA 1KC8O 3CP2A 1F1BB 4K8ZA 3G7ZA 1VQNI 3P38A 3OTOK 4OLAA 4QWQA 4DV7K 4CJ7A 2DL8A 3QNOA 4C92G 4AI5A 4J9HA 4FVMA 3I33A 1FP2A 1IDYA 5KYNA 3L2UA 2OBPA 5BOXA 5AQUA 4LFBK 1UELB 2HGCA 1TSFA 4M7AD 3VF6A 4M3BA 4CJKA 2UWMA 4ME7A 3V9XA 3CMEA 1KG3A 3OS5A 4AHRA 1IAWA 3EG9A 4ILHA 2EZIA 4LK1F 4FZXC 5KPTA 3HP6A 2CZ7B 2EIJH 3OR2C 3ECHA 2YHXA 1N77A 1NYGA 4ISFA 1P4WA 3TO6A 5FPDA 4W5QA 1W5TA 1XSVA 2GA1A 4PL7A 4O5FA 2K4YA 2DNUA 2O4IA 3SJJA 3MZ8A 2DT5A 3HFOA 3OWTA 3LMMA 4M3TA 3T1AA 1VQOI 4GYGA 5HK3A 2EQJA 3RESA 2PUKB 3LSIA 4BACA 1N33K 1VQ6I 5AFUA 1FMWA 2GZWA 2L3RA 2GNCA 3WEEA 1W2BA 3H1VX 4OKEA 1S1WA 2YLBA 1AZEA 1ZYQA 3E66A 1ZK8A 4PJOF 3BG3A 1W7PB 1UGVA 3DLLA 4XSZF 2C06A 1YJ9A 4U67L 1NJIO 1RRSA 2P9UB 3RQIA 2QK0A 3CCLA 4MDWA 3PO2J 2JS0A 1IUFA 1YQRA 1F4KA 4HKEA 4KREA 4GBQA 2ZPGB 1W1WE 4O4GA 2ESNA 1TT0A 2R7YA 4NC8A 2K57A 3KUFA 3TTCA 1QVGM 4BU2A 5LGNA 4A62A 4FVUA 4CO8A 1NGBA 4NYNA 4JX6A 3B6AA 4CHOA 3ZPLA 3TVTA 1VSEA 3DWLE 3RR7A 5FLXK 4QLCU 3SMPA 1J7KA 1BIZA 1K8AR 3EYZA 2A1SA 1K6OA 1HOMA 3CWUA 3OS1A 4BR0A 1A04A 3CO6C 3TWHA 1MUYA 4BRNA 2HNYA 1HDPA 2F4IA 1ZBJA 2OJED 1I6XA 4JBAA 4GO1A 3A2FA 3I55T 1YJWN 3W2WA 1ORKA 4FHTA 2HKQB 4DSEA 3SEMA 3R1XA 1W0TA 3M0UA 2HBMA 2P4RA 2VYTA 2OTJI 1ASUA 1ZBUA 1Y71A 3KP7A 3WT0A 3F6OA 4B3XA 2PNIA 1K8KB 5JLFA 3O6WA 1RKTA 1KO9A 5LMUK 2VT3A 1GLLO 2XAUA 4ELVA 2QQAA 2W82A 4C30A 4BH9A 4E3SA 2PU9B 2PJRA 1MH4A 2DFUA 2YNGA 1VSJA 3NGIA 3DF8A 1ZGAA 4C8QE 1M9SA 4IURA 5ADXH 5BPIA 1JJ2A 3ZL7C 1P9QC 3E9LA 4B1RA 1X1AA 4CZJA 4OGEA 4LG3A 3JCMg 3DKYA 4M9SA 3OVNA 4CFAA 5C0MA 2KXDA 4IL6C 2OZSA 2H56A 1M1KO 1NJIU 3THKA 3HOUJ 1UOCA 4FCYA 3LAPA 1QVTA 2VI6A 3GWZA 4CHZA 2ZXWH 3H5RA 4M3GA 4FK0A 2W84A 3CCMI 4IOCF 4DR4K 4A12A 4KI4A 5JVGL 2NUTB 2ME6A 4M77E 4BJ5C 3HG9A 4WK8F 2PZ1A 3JB9F 4FOEA 3JB9D 3TEDA 3R0JA 2K3YA 4O0IA 1RKWA 3WTWC 1SSHA 1V1CA 2DZCA 4LSLA 3D5RC 3TSUA 4MHGA 3R8EA 3ULDA 3AL0B 3BEXA 3VQDA 3MXIA 1TW3A 2FSJA 1V3FA 2WBMA 1NYFA 2JA2A 2HR3A 3M3YJ 4BRCA 4OOIA 4XORA 3QDKA 4J7IA 1OH7A 1ZKGA 2HQAA 2ZPEB 2VN2A 1AOYA 2Z1IA 2F6CA 2PJRB 1FOXA 4J9CA 4A4EA 4Y15A 2O8FB 2E2JJ 4PUSA 1Z0XA 1KQ1A 1IHWA 3CD6A 5DMRA 3CCEA 2ATQA 1GBQA 1RAAB 3WTVC 1KGSA 4C92B 4G6DA 3S3MA 2PG4A 2IGNA 4D9JA 1HNZK 4E7LA 1W2BM 1NK3P 1J59A 4HAMA 4CD1A 4BC5A 2DOFA 3KYDB 1EX4A 2XF6A 5IT3A 2OAZA 4BE1A 2OD5A 4BHPA 2VUBA 4IHVA 4NC6A 4FZZA 1GLAG 3ATVA 1NHAA 3BY7A 3R6NA 4KT6A 5AIQA 3P5JA 4O5BA 4A3MJ 1LWEA 3QXEB 4XNFA 2KXCA 2F8TA 3TAPA 1KG7A 3FBIB 1XNQK 2ECBA 1Y97A 4RWTA 3JS6A 2RREA 3KCCA 1O7FA 2WB1A 3PX4A 2UXDK 3GTPJ 4RTVA 3ELKA 4S04A 2NRHA 4PFPA 3JRGA 1ACIA 1RDDA 1NE8A 3E6MA 3VUBA 3Q7BA 2NUBA 1XMAA 3A5NC 3DTKA 4ASNA 4JHDA 5M1FA 3AVKA 4B8AB 1T95A 1GBRA 4AMCA 1UMQA 4LF8K 3FDYA 1N5ZA 2CYZB 2DMPA 1BJZA 3CUQA 1RLQC 4H8KA 2KZZA 2IXSA 1B4AA 4KUIA 4QKUA 1FJGK 1ZA2B 2Q31A 5HRPA 4BD3A 5HLFA 3HOWJ 1B3QA 2B8AA 3KLOA 1JCEA 4WF9L 1O75A 2A5YB 2Y9YA 3E6BA 3FMQA 3RYRA 2AQFA 1WHLA 3X20B 1VQ6A 4YIRX 5IOZA 2BGCA 1RI9A 3A8MB 2HB5A 2E6MA 4DOWA 3VENA 1ZA1B 1AA7A 2QTVA 4BQZA 2HU9A 4ZYAA 2K2VA 2X4WA 1M4ZA 3MEUA 1AKHB 4FWOA 4UB8C 3RMDA 2KEAA 1PC0A 1EH7A 1XGMA 3CCJI 3L42A 1KJWA 1KC8C 4UUSA 3GVAA 3AVMA 1WQ2A 1ABOA 1BKBA 2CP7A 2XUBA 1DPUA 1TKDA 4PUOA 2MFZA 3O3HA 3KPHA 2IS3A 3C0BA 3SAHA 2QZ8A 2VKNA 1UGSB 3A01B 5L3FA 4EP5A 1ZGJA 2QQRA 3LX7A 2DLPA 2DLLA 1OQYA 4LSNA 4GKKK 2ETHA 1YT3A 5JMVA 4E19A 1YN8A 2W6KA 1SD6A 4EMKA 3G6ET 1KAYA 4J9DA 3O08A 4J2DA 4YG2F 4M72A 2WY8Q 3VQCA 4DV6K 4F7ZA 1W6XA 5JLHA 3CW7A 1R1TA 3CUQC 4BG8A 1JTXA 2G6FX 4YPHA 3GFJA 3IAS2 1QNTA 4CC4B 1MNMC 4KHSA 1ETKA 3CDHA 2CZ6B 2Z5UA 2PX9A 1ZUKA 5GMKi 2VKEA 1TK5A 1XQHA 1S5LC 2FOKA 2E5ZA 4CJ4A 1ZSGA 2KSSA 3OYNA 2HOAA 2JSPA 4CVNE 2XPVA 2A07F 2R7SA 1KAXA 3HZ6A 1BO5O 3R61A 4GRIA 2K02A 2ZKZA 2GUPA 2NZTA 4C8QF 3RKXA 2CDTA 5TISC 4KULA 3OYGA 1QTMA 3B02A 4II2A 2ABLA 4ENMA 2FPDA 1BW5A 4WE1A 3L09A 3ABTA 2DT7B 4GMJB 2EHGA 2O4XA 3VERA 2D0NA 5D8LB 1UEBA 3VMFB 1KHCA 2RE2A 1BJAA 3C1DA 4DV1K 1RAHB 1YCSB 2NUPA 3UA6A 4MNUA 2LT1A 2G8FA 1WJEA 3RIRA 2VWFA 2YKMA 1EKEA 1WIEA 2KRNA 4JI1K 2PY5A 4ISGA 1SANA 4N4OB 1LEAA 4JAXA 3ZT2A 2JRMA 3NBPA 4JPBW 3J7YJ 2VQEK 1PCXA 3MCPA 5D4SA 2VG5A 3M54A 4AYBA 4QS9A 1Y56A 4IQJA 3LGFA 4FYWB 5LJVA 2O8KA 2GF7A 2ITGA 1WXBA 1JL2A 4AM7A 2E2PA 2H6CA 5IPAA 1G2HA 3LLRA 4BR7A 1GL5A 4KJZA 1D5YA 5GAN5 2Q2EA 3F8CA 3O2PE 2FB7A 4LC9B 1VQ9A 2LQ8A 3H3UA 2XSDC 4BG9A 3SXYA 3I56N 3SV3A 2CGLA 2F5TX 5AQZA 3GBGA 5IYBJ 2Y48A 1Y0MA 4EIAA 3C18A 4A6EA 4LOCA 4IIOA 1JHHA 5IT9O 3QAHA 4A53A 1LOTB 1M5Q1 1R4NB 3NVKA 5GAGP 2KFNA 1BQNA 5LJ5d 3CD6I 3CCEI 2DXUA 1KQJA 3EO3A 4KITB 5ILSA 5E26A 3WODF 1R71A 1KFDA 1NH3A 1MH3A 3C2BA 3MX2A 1VSLA 2R7WA 4A3EJ 5CHZA 3VQPA 4IUPA 1D3YA 1LQ1A 4KTWA 1X27A 3AG2H 1NLOC 2UXNA 3JXUA 3KEOA 3P9IA 2XY7A 1Z6TA 1ZYRF 2LD5A 3CUOA 4LUEA 2M9UA 2YWWA 2AK5A 3MN6A 1HQEA 1JTYA 1YP5A 2FL7A 4RGRA 1JCGA 4EP4A 4FJ7A 1Y8RB 3BF3A 3E5UA 4C8MA 3E0JB 3OYEA 2O61A 5I2SA 2H8HA 5J2QA 3OYFA 1QBJA 3MAQA 3OL3A 4H5WA 2QEXN 2RQRA 2LX7A 2KLAA 2IVPA 2R58A 1Q81R 3T19A 2O8DA 2VB6A 2LY9A 1TWAJ 2KTQA 5KCOA 1O1WA 2CZ1B 5I22A 4C3JJ 4PLIA 3PVLA 3A0BC 4V2GA 4IZ9A 2KISA 2QEXI 3CBMA 3VQ4A 1MDMB 4M77G 2QWOA 2FEZA 3ID6A 4LDVA 3AVFA 5DCMB 1WQ7A 1BOBA 5IAYA 3PLAA 5LL6Z 2RHIA 1UJYA 5CVUA 2XGEA 1KVAA 3CCUT 5EYRA 1GOBA 2M4GA 1TWGJ 3JCMV 2AS5F 5LFAA 3WGIA 2QG9B 3U8XA 3PQKA 3ZN1A 1YCYA 4CECA 3F9KA 5E18F 3DXJF 1V4SA 4DMNA 3SDZA 3K4CA 1FW6A 4J9EA 3RJPA 5GMKh 3GL1A 2JMWA 1YQMA 2E8AA 4HUGA 4O8UA 2WSEE 1LCKA 1E4FT 1BC7C 4EMKB 4GVMA 4B3AA 2WA0A 2L7MP 4PDKA 2YU3A 2D45A 1VQ4A 4FJ8A 2HYGD 5FKNA 5CR2A 2L02A 4DUZK 4W1UA 1ETWA 5FDLA 4R55A 2BTTA 4GV9A 3EYYA 1X1PA 5GIOA 5DY9A 2CP3A 4AIDA 3D0PA 4DYQA 4PJOB 4LDYA 4EW4A 3DXKA 3O4NA 4D8KA 2AHJB 2MW8A 4NB5A 1L5UA 1KLMA 2GXBA 1FMVA 4NO7A 3QEXA 2A42A 4IEIA 2DX1A 2OV7A 2JZ2A 2RK1A 3KWIA 5FLXO 2ZWHA 1ZAOA 3OR1C 2NS8A 1PU7A 1NGDA 3CCUI 3LFKA 4C8NA 5BQTA 3P8BB 1QZYA 2O7OA 5HRSA 4UOBA 1BR4A 3AVCA 4BQAA 3MEGA 1VQLN 4AG2C 3CCYA 1AWJA 4GW6A 3BZ6A 4XTXA 3S1NJ 4HZFA 2HKNA 2M87A 3KTUA 4I9QA 2PMUA 3UKUA 2IP2A 5EXWA 2NVYJ 4XKBA 3RDIA 4OMYA 2JZYA 4BRIA 3ZSYA 1QQIA 4RAYA 2HSTA 2DA6A 3OSFA 2QW9A 3VTIA 4BRGA 2NRRA 1J09A 1UG0A 3N05A 1W2BP 1YX3A 3VEZA 4KYWA 1W2BS 2G9WA 4MFEA 2E1OA 2JA7J 3MMVA 4ENNA 3F22A 4A5BA 4RAFA 2CS7A 2V7FA 2LQNA 3AKZA 4I98B 2DVJA 3JR9A 2XDVA 1WSHA 3CZ6A 1LNWA 1QMCA 1O57A 3FGUA 3VV0A 1VSHA 3QRFF 1WPKA 1R7JA 4I7HA 5DPKA 2XDBA 2P7CB 1VUBA 1UHFA 2G8VA 2C6YA 2L0KA 3LSJA 1ETYA 2M8GX 4AHCA 4F17A 2IVOA 1W7PD 4AUXA 4WX9A 1S72T 1IN6A 4RTUA 4CJPA 3N5NX 4AC0A 1A36A 1S1VA 1WOQA 1SFOJ 4NB4A 1WNSA 1YJWT 1VQ9I 1I50J 4Y13A 1LDJA 1S9HA 5DK5A 4FWNA 3S6WA 1YNZA 2QAZA 1OCTC 2KR3A 2R5AA 4C8QG 2EJGA 1LE8A 1EZZB 4UNFA 3J81Z 1PYVA 1VQOQ 1XDSA 3ZEUA 2B0LA 3MCZA 1NMNA 3P39A 5GAMg 3DLKA 4FWSA 1VQ5I 1KG2A 3JB9J 2UUZA 2NVXJ 1KFZA 2XICA 4MLOA 2K40A 1VSMA 1NGEA 4LD9K 2G7UA 2DL3A 3D2FB 1B92A 4C92C 1N3AA 3CF5F 3FC3A 5D3GA 3JCUC 5KE2A 1DGKN 2XHBA 2ZFUA 1ZR2A 1VQ8Q 3B73A 2W04A 3M5AA 5M1NA 4H0PA 4KFCA 1OOTA 5CVVA 1HX1A 5EJCA 2BZTA 3M55A 4LFAK 1QVGP 3VEWA 1W97L 2K86A 3C7NB 3RWUA 1FBQA 4X1EA 3VESA 3ZQIA 3BDLA 2A6TA 4M77B 3CCVA 3HM5A 3WTTC 4ZZLA 2DK3A 3QYGB 1YITN 2OTLI 3THWA 4PL6A 2FF3B 2FF4A 3O9TA 3U21A 3EGXA 2Z33A 1KG1A 1BI4B 3P1GA 2DA1A 3MN7A 2NRTA 4NOYA 4KICA 2OZUA 3JCMc 5HRRA 1DEJA 5AQNA 5CCAA 1UFFA 1K4TA 2DA5A 5B1AH 2X6OA 1BCMA 1YI2N 2LJ0A 1W36D 2YHYA 2FU4A 1OPCA 2GA2A 4BI8B 1FIPA 4IXCA 4KI6A 1XS9A 5GAOq 4RM3A 3MCAB 1GV5A 2G3RA 3QZ5B 3F8FA 3MPUB 3A5OC 3HGGA 3V8LA 1PRLC 1IKYA 3V81A 3OA6A 4FM0A 1KYZA 2DA2A 3GTJJ 4PKIA 2KI7A 5LJ5e 4BC3A 3OBYA 4DWIA 1VQKA 2J7IA 3MWTA 3VB2A 3FHFA 2G8HA 4AFSC 4B3RK 2R7XA 2CS3A 3PNVA 1CKAA 3CPWP 2CP2A 3TU4K 3BCBA 1YITQ 3IH3A 5LJ3g 2R7RA 4KH1B 5L3EA 3FXJA 5K1YA 4LUDA 4RG2A 3I4MJ 5GANh 2VJ4A 5C42A 1I5LA 3VKIA 4KFBA 4JN4A 2XASA 1JLGA 1SQKA 4JYKA 4I6MA 5J1EA 3GTKJ 4RLFA 2Y1IA 3O80A 2DEUA 4DTOA 2HW3A 1FP1D 3G2BA 3HEFA 5GTIC 4GDFA 1EWQA 1M3QA 1P7MA 2QASA 2FPFA 3CC2A 1VQ4I 4M7AB 4KH6A 1SKUB 4BR5A 5FD6A 1YWOA 2DD4A 3K58A 4V19S 1KD1C 5GAEP 1N3CA 2F7TA 2J6FA 2OU2A 1H0MA 3G71I 2KYMA 1IJJA 1MA9B 2FQ4A 1N78A 4XEIA 1E3HA 4IZZA 3M8RA 3MHXA 1GUUA 1DDNA 2PUOB 4M3ZA 2J5PA 5GJVB 2EAYA 1VQ8A 4AIAA 2QA4T 2Z1JA 5GTHC 5LJ5f 4DOVA 2O9SA 1VQ4N 2FBXA 3AV9A 2EYWA 2XSJC 1T03A 4C2MJ 2HL5C 4C5GA 2FHDA 4HQMA 3Q5FA 4CJFA 1VQ8T 4GGGA 1MUNA 3DPUA 3K10A 5LJ3j 3O9SA 2EINH 1I07A 1HKQA 1UAXA 1HCRA 4JI8K 2EYXA 1X3WB 4IRIA 1DUXC 3LQRA 2ZXHA 2NNWA 2W1OA 3GFLA 3GLXA 4EJYA 4DU3A 3HVTA 2NLUA 3J7AF 4OO1J 3CCUN 2CUJA 3CCQI 3ZSWA 4FJMA 2LYCA 2D0CA 3VS4A 1ZBSA 3KD1E 3KFWX 4HVUA 2JG6A 4J00A 3W2AA 1OX9A 3L0QA 1ENHA 3K5LA 2MIOA 1KG6A 2HBWA 3BTJA 4FL6A 4CEFA 1OH5A 3WGGA 1SUQA 5I11A 3DBRB 1S22A 3HUGA 3SQ1A 3VF4A 5J47A 3DOKA 5FGMA 1YLFA 5LEJA 2KP6A 1RBRA 5TRDA 2IAIA 2YX7A 4M7XA 2O8DB 3I55Q 2QEXT 4BGDA 1Y0NA 2RAEA 4XRSA 4QVDA 1M90R 3NF8A 1KLNA 4JS4A 1TXQA 1WI3A 2JJ9A 2L0AA 1HYZA 4YFNF 2X6XA 1IO2A 1VQ7T 1VQNA 4DSIA 3FZFA 1EFNA 3C2GA 3QMLA 1G3WA 1HW5A 1BI1A 5A2QE 3V4GA 1JJ8C 2F5CA 4PJOC 1TKZA 2P9SA 1RDUA 1QSYA 2FPEA 1I8FA 2QWLA 4KNYA 1UDLA 2F2WA 3QESA 4IUVA 3TAQA 3LP3A 4Q5VA 2O8BB 1ZBHA 4J2EA 2DODA 3OQ5A 1BR1A 4JNEA 3HKSA 1D4XA 2JHJA 1BDGA 3TP3A 3WU2C 4CZLA 4W5NA 3E01A 1WHUA 2WC9A 1OX8A 4M78A 2HZYA 3E19A 3GNFB 2DILA 3CJCA 4B9MA 2JRTA 1T39A 4HDUA 4A3GJ 2COBA 2PBIA 3KK7A 2PFUA 5GANg 3CQZJ 2V9VA 3CCSN 1FJLA 5FWBA 4LLLA 2WB1N 3O8VA 1QA6A 1ZBFA 4LB6B 1OVYA 3HTVA 2CT4A 4E9HA 2LREA 3HRGA 5C15A 4E0DA 3CCRI 4LF4K 1K6YA 3TO9A 4AT1B 2DI3A 3GZ6A 1HR0K 3HSTB 1XGSA 4DTXA 3O3KA 1WHMA 3CMAN 1XCVA 3KP3A 1GOCA 5GANe 1YO5C 1XWLA 1T05A 1IKXA 1HYVA 2JM9A 3RUXA 3ZR8X 2N8GA 2QSFX 4DK9A 1QSSA 4BXUA 2BVLA 1WXTA 1XSDA 3H9GA 3OYJA 4AHVA 4IHSA 4CGGA 3UKRB 2EGCA 1U9NA 1U1SA 1Q81C 3DOLA 3VQ8A 3OJUA 4BY6C 1ZC6A 4JJBA 2UYTA 4H4MA 2PFBA 2D0AA 1YJNT 2F5FA 4BHBA 1KVCA 1MGQA 1ATSA 2CMPA 1JT0A 3K4KA 5F08A 3ZQ7A 2YJEA 3BQYA 3IP4B 1TQPA 4KGVB 2V9KA 2P0WA 4H0OA 2IS6A 4K8XA 3PJRA 1ZUYA 5C12A 4PK4A 3U3GA 3G6EI 1S72A 1AWWA 2M1BA 2ZXIA 5DCMA 3W6VA 4FQGA 3H46O 1RL2A 4KHPK 2PVGB 3S2DJ 3K7AJ 5CE3A 2VGMA 2EZHA 3T8RA 1MBHA 3VF2A 4FZYA 4C8OA 1JXEA 4M74A 4FK2A 5HY6A 1MU2A 4AHUA 1VSIA 2OPSA 1S7AA 1FC3A 3F23A 3WQUA 1Q7YU 2VLAA 4JX5A 3ENHA 4KN7X 5JFRA 4FO0A 2RB6A 4BKXA 1S9GA 2MYSA 3B8AX 1MJ9A 2GXAA 1N5YA 1G5VA 2E5NA 2M3AA 3VYUB 4Y52J 3K1PA 1X4PA 4BRPA 3IWFA 3OIOA 2YNHA 1YHQT 3L9FA 3BY6A 5LHIA 2IJLA 3UPUA 4GKJK 1VI0A 1JJ6C 5SZTA 2KKZA 2R7OA 1O4XA 2Q36A 1TH7A 3QINA 4W5TA 3J8AA 4IJNA 3I59B 2ZZDA 1JKQC 5JLWA 2LZ6B 4XIDA 2R0QC 2VIXA 2CGHA 3IS9A 3O4WA 4QQ6A 2Y75A 3BC8A 1K8AC 3G25A 2Y9ZA 2JK3A 2KMTA 1H8AC 5FWCA 3PNYA 4AWXB 2XB0X 1LVKA 3HOVJ 2VE8A 1DU0A 5ERIA 1RAFB 4ZDPA 3ZT0A 2DT6A 1KSPA 3PE0A 3CCMA 3MKWB 3U6FA 1JJ2S 3IRQA 2X6YA 5HOOA 1HJDA 2DL4A 4M4ZA 2M34A 2JPCA 1Z67A 1Y64A 1Q81O 5M5XJ 3H35A 2VASA 3QIIA 1UCRA 5KYXB 5BR8K 2KY9A 3IWZA 1Q86O 4Z4GA 2HDDA 1UGRB 4ZDOA 4WXCA 2A41A 1RACB 1IN8A 4PJJA 2D1KA 2KK4A 1NK6A 4HT9A 2K6DA 1UB4A 5CQXA 4YOTA 5DD8A 1TQIA 4G94A 1JCFA 1K79A 2ZNZA 1VNDA 2ZJ2A 3HYIA 3DU5A 3JSOA 2K9NA 4CIGA 1K73U 1IDZA 3S41A 1LKXA 1XUPO 2D0BA 3NMUA 2DAQA 2Y4YA 2ZPIB 4YORA 3CETA 2CQ7A 2HDCA 3QYEA 4FLZA 4CESA 4C8QB 2SRCA 1FK9A 1KC8U 3I0RA 4R56A 3U23A 2GBQA 1AWOA 1SF9A 3LAKA 1QKXA 3ESWB 3URGA 3MK6A 4KB0A 4BY1J 2ELKA 4FL9A 4WFAL 4FLTA 1S29A 1ZQ3P 4DTUA 1Z3XA 5IT9K 3EUKL 3AGKA 2ZMEB 2BY2A 3V8JA 4L5JA 3TQNA 3MAJA 3I0SA 2WBNA 2CUFA 1IC8A 4JYAK 4BGAA 1IREB 4O55A 3SUQA 3HOZJ 4OFHA 5JHUA 2VJIA 4EJVA 2LH9A 3D1NI 4XTWA 2WV0A 2QM3A 1K78B 1P2FA 2XHCA 2W40A 1YJNQ 3H92A 4RB1A 5IXFA 4H5TA 4HTLA 4A3CJ 4BWJA 1XTAA 4TV7A 3HSFA 5AQLA 1SAUA 3L1PA 1X2MA 4BHCA 2O01E 2GCXA 2HVRA 1F21A 1MMSA 2FBVA 2DYRH 3R9PA 1RI0A 2JTEA 1U04A 4I01A 4X62K 1SVMA 1REVA 1T3VA 5GJWB 3E3VA 1J9IA 1ZBXA 1YS7A 3QERA 1K1ZA 2BVMA 4MO5A 4Y4RA 3M59A 1TYQA 3CCEN 1T6DA 1IV6A 4E7ZA 2E6ZA 3RR6A 2EZKA 3MX5A 2E4LA 4LITA 4CH7A 3IFRA 3M8SA 1YVUA 3FSPA 3ZSRA 5KYXA 4FJLA 1YJ9N 4PSXA 2O31A 3ZQCA 2L7KA 2CWEA 4PIIA 2NOHA 1NK8A 3RKQA 1DP7P 1QHAA 3CCJA 3QP6A 1NGJA 3DJCA 1G3YA 4AVZA 4HYEA 5D5UB 4IDHA 1UFMA 4HV6A 3CC4A 1ZELA 3NHNA 2UUCK 3M0TA 1Y8QB 2E6LA 1RDWX 3CVTA 3EFOA 2BANA 4JKAA 1ATNA 3W6JB 2HOTA 3SUOA 3KP4A 1PRMC 4OIPF 4ZH4F 1SAXA 1M3CA 4F55A 3A8LB 4IFYA 1Q86R 2YX4A 2YRCA 2V26A 3OGDA 3PMTA 4ESFA 2SEMA 1Q82O 4Y1CA 4XKWA 3WU1B 1PNJA 4EAHD 3EDPA 4FWKA 4KN4X 3E5XA 2K9MA 4EIKA 8AT1B 1EA3A 1FBUA 5KYYB 4FLXA 2PZSA 1P4AA 4HEA2 3DLAA 2E10A 2KDOA 2UUBK 2WONA 2PMZN 3A4CA 4MTDA 3A0HC 1WHGA 1HMVA 3IKTA 4IBNA 2Y1JA 4KHYA 2DA4A 4DOZA 2W7NA 4CZMA 1GRIA 4CGFA 4A3JJ 1PVEA 1NJIR 3JAMO 2RQPA 4EGZA 1RT2A 3CCRN 1UHWA 2QVOA 5LHHA 4OP0A 1REPC 3LM9A 1NJIC 4G9ZA 2X9DA 4U0WA 1MBEA 1WAFA 3JB9I 4IOAF 1T56A 1YI2Q 3JB9G 2LCSA 1H88C 3KP6A 2HXOA 3BGRA 1R9TJ 2R7UA 2LQWA 4RDUA 3AA4A 3JCMh 2ZD1A 1T3LA 2O8XA 2XGDA 1KD1U 4F52A 3K6GA 5CKEA 4M75D 3OYMA 5LD2C 4MFDA 2FX0A 3LM2A 3ZQQA 2UV1A 2QGGA 3DXMB 4CBWA 3QLHA 3TDUC 2M7AA 2Q97A 2RHZA 1NMDA 1VQNQ 3JAMK 5IYDJ 1VQLI 5GADJ 2YUPA 2L9SA 1RBUA 1YS6A 3CC7I 1O3RA 1SFKA 4MO7A 2OF7A 2V1QA 5ELZA 2DXCA 2R57A 2Y0SN 3N0UA 1WX6A 1QGPA 3PO3J 5DUIA 2AZSA 5EU7A 5FFXA 1O3TA 3AVLA 3ERMA 2O4XB 2F2XA 2IIRA 1WJDA 1TLHB 1P90A 3UKUB 2OFIA 3M1CA 2V8KA 1ZLJA 4I7FA 1VQMA 3CCJT 2P4TA 4LGWA 3CPFA 2F5VA 1Y07A 1QVFP 1ASVA 5A0GA 1R0AA 4LD5A 3QP5A 2EGEA 1AVZC 2AQEA 3KHYA 3L2RA 4X6AJ 4GLKA 3CCLQ 3O9RA 4BREA 4PKGA 1NK7A 2RI3A 1JRIA 2IOCA 2JOYA 2AJQA 3IUOA 2DVEA 2WAQA 4Y28E 3LAMA 3UNGC 1LAWA 4M78F 3FZVA 4B9TA 2JPBA 3M56A 3U1DA 5AFUH 4EM1A 2ESWA 3ZQGA 1JLCA 4X9DA 4JX4A 4WXHA 3CHWA 2LY1A 1S1XA 3TCJA 2X6WA 3DYAA 2E41A 1ZSZC 4KTZA 2CGJA 5FLXZ 1Z25A 1HRHA 3HTUA 3FJPA 4FWLA 3HSCA 4R5PA 1UG2A 1D5VA 3RTVA 1S7OA 4RUGA 1ETQA 1RADB 4LDWA 1D1AA 2EKOA 1L3VA 1AWXA 1HLVA 1B59A 1ORPA 5C4XJ 2OTLQ 3JV3A 3MN9A 4PJOE 1I27A 3MP1A 1XSXA 1RDAA 1RGIA 2FRHA 3FBNB 1DP3A 3VEYA 2FMLA 2LRDA 3S2HJ 3FHZA 4RW8A 2EQRA 1C0TA 4LFCK 5GAN8 4IHTA 3O5BA 3C7JA 4AI4A 1AEYA 5AQTA 1SC7A 2P81A 3ULRB 1SVOA 4N0AA 1NBWA 1ZXOA 2MC3A 4B24A 4GYIA 5AQRA 1VQMT 2J05A 3S3OA 2LR8A 3H0GJ 1YAGA 3JRHA 2E2HJ 3I58A 3THYA 1GOAA 2Y0MA 3FHNA 3JRAA 2CO5A 2ELJA 2JMCA 1YJWI 4GCVA 1KQSA 3X2QH 3V9SA 1VRTA 3KK2A 2DMUA 2O8CB 4BUGA 1JLQA 2MLGA 2OTJN 4F3OA 1AKHA 1VQOA 3GIBA 1OCOH 5GAGJ 5IHIA 4KAZA 2R7ZJ 4OMNA 3K4BA 3C2HA 3R60A 3BR3A 3J7AO 1QSLA 1OFCX 4F14A 1MNEA 5FKOA 3K9JA 3P31A 4BWMA 2CG4A 5A2QK 3I8DA 3O3FA 3F0CA 1J54A 2K3PA 1IGUA 1XJWB 3CM5A 4M3YA 3VQBA 3BPXA 3CC4I 3QBYA 1IB8A 4WCEL 2Y2ZA 3SQ4A 1Q82R 1UA0A 1YJ9I 4KGXB 3VWBA 1OCCH 3VYHB 4HUFA 1Z3YA 4UHTA 1NK9A 3G1OA 2DJZA 3RRHA 4JJCA 1M90O 2OTLN 3V1QA 4CJQA 2VG7A 2I10A 1FSEA 2YG9A 1AD5A 3MJXA 2KKOA 1LW2A 2LCLA 4Z4FA 2JM8A 4FJ9A 1AHDP 2NVTJ 2QKKA 4L6V5 1HKGA 1PD1A 3SFZA 1EH8A 2E1ZA 2P6SA 3UF4A 2ZO4A 3K2AA 3SQ0A 2AKKA 1XNRK 1B72A 5C2DA 2QXFA 3CCST 3IQLA 2CH4W 3K5MA 4A69C 5FU7B 3P83D 4BB7A 2DBKA 2D5VA 1BU6O 1X3MA 1RUOA 2EA2A 4FISA 3PNTA 2E34A 4B22A 2G0EA 4WQ5C 3A1YA 2GOMA 1TUUA 2A69F 4CJSA 3ZT3A 4XONA 2WUSA 1VQPI 1NEBA 1RBVA 4I09A 1OV3A 1NGIA 2F2VA 1ZX6A 3VRYA 1KIKA 3SAGA 4XR6A 3PL8A 5E8IA 3LPUA 1UECA 2RN2A 3MEWA 1UUEA 2Q2RA 5AQOA 2J6OA 5CZ2A 4ELTA 3H6ZA 1VQ7N 4IOCL 5C3EJ 2O9VA 3M58A 3JRZA 4NL3A 4BRLA 2WOMA 4XLCA 4EFHA 2OZ6A 2HMIA 4IXAA 5FLXE 2NWMA 1U5TA 5FPEA 3R6OA 3GEZA 1WJAA 4XKVA 3QYHB 4F7UF 4RCCA 2GGRA 4G7ZF 1YIJA 3F70A 4G1QA 1GVJA 5KCHA 4DIQA 2KT8A 2DZ9A 4OPKA 4JLHA 4PSWA 4BE0A 2LK2A 5J2MA 2JUFA 3M1EA 1NTCA 5GANd 4E7HA 2V52B 3LAJA 4L5EA 3MKDA 3J81E 1U8RA 2OPPA 2R5MA 2DPDA 2QLZA 1KQSS 1XD7A 3WNEA 2EFNA 4HLXA 3LALA 1W0HA 4EJTA 2R7VA 3BP8A 4M75C 5D7UA 4DHYA 2OYQA 3MKYB 5M1KA 2ZJQL 2WAFA 2KL4A 1WZ2A 2R7FA 4LF5K 3J81O 4A2BA 4YOVA 2GWRA 4M7YA 1S1TA 2KT0A 1JO8A 5F1XA 1KU7A 1U49A 1OU8A 1QVFM 1BW6A 4BEHA 4IF4A 4ILJA 4HVWA 1HNWK 1SD4A 1WAJA 3FZLA 1Q9XA 3CVSA 1PD0A 1ZBIA 2DM1A 2XY5A 3OW2M 4DF8A 5ILVA 3IG1A 4M7DB 2KIQA 2ZSHB 3HC7A 2RMOA 2QA4N 1VQ5A 5GAEJ 4LN2A 3A8YA 3CBPA 2E2NA 4B9SA 1X01A 2IIMA 4IWVA 1QPMA 1USSA 1HPZA 3BTCA 3QIPA 4IO9F 2LTPA 1C1CA 4WQ4A 3ZT4A 3W2VA 4E1MA 2L54A 3CPWA 4QIWN 3L2QA 2H3GX 2EFPA 5CVIA 3LL3A 4CGIA 1RT1A 3NGPA 2PQWA 2KRCA 4QOZB 4A6DA 4DSLA 1MIJA 2E70A 2XD0A 4YDUA 1T44A 4KH0B 4FX0A 2QENA 1U5TB 2WACA 4CGHA 5LRSA 3PX0A 5BMZA 1FWZA 2HQRA 5FJ8J 1BG3A 2VUMJ 2PN6A 3HHTB 2ABKA 3UWNA 2ZFWA 1SFXA 1SEMA 2P0PA 1E0EA 5ED4A 3ZMSA 4E6KG 2DJQA 2ELHA 1IBLK 2YDLA 4M77A 4KMUX 2JWLA 3K4JA 3UE5A 2MH2A 1J0RA 3FFIA 4PJMA 3FJ5A 2XDDA 2MMPA 3KZIC 2NYSA 2IS2A 4AFQC 4LMYA 4G7OF 5KPZA 2V75A 2FXAA 3JCMf 3CF5L 1NBEB 5IY5H 3EFSA 3VRZA 4H0TB 3MWPA 3JRFA 1FY7A 1X9MA 2W57A 1BOTO 2WSFE 5KI6A 2RN7A 1GCQC 3RMBA 1Q82C 2ID6A 3OYAA 3Q7CA 1G6NA 4JS5A 4FJHA 2HTJA 3A02A 2Z1DA 3ABLH 1VYVA 2HHTA 2P9LB 4DB3A 1X2NA 5HLHA 2YU9J 4LF6K 2W24A 4FW1A 1S6PA 1VSKA 3OW2A 5DLOA 3CCLT 2E35A 2I7NA 3JTHA 5L3DA 1EXQA 3JRBA 2A61A 2EQUA 3QOPA 1M8VA 2HBKA 1Y39A 2HPMA 4GFBA 2OZMA 1ZR4A 3BR0A 2XK0A 2V1RA 1RIOH 1HD3A 2G8WA 4B3MK 1SD5A 3UR3C 1IRZA 1LV5A 5AQWA 4CJTA 1MBGA 2FMYA 2KW4A 7AT1B 1GXIE 4B43A 1JLBA 2GLOA 1NWKA 3VQ9A 5CLSA 1F36A 1HC8A 2F4OB 4XLHA 1YTYA 2YV0X 4M3EA 4M75B 4HSRA 4M7AG 3G71A 1Z7LA 3H5NA 1V5GA 1MDMA 3IHUA 4RGSA 4XRSG 1OR7C 2YHBA 2HHVA 4AD9A 1WEIA 1BU1A 1PKTA 2XPWA 4DS4A 3OYHA 1N9SA 1WI7A 4BRHA 5DLQE 1AZGB 3P8DA 2KQ2A 5IWAK 5GMKm 5L8RE 2I5JA 4AIKA 4HF1A 1TUDA 1VOMA 1WSFA 2CYYA 4IOAL 1ETOA 2E7XA 5K5OA 2O4GA 1VQPA 2P7VB 4C8LA 3VSKA 1ZHFA 4J7FA 3CLOA 2MWPA 2EA4A 3H1CA 1RAEB 3WXKA 4HHTA 2HHHK 3NMZC 2F4VK 1JE8A 2P9PB 2F69A 2BW3A 1EETA 1RT5A 3AO3A 1ITYA 1SRMA 3MP8A 3VS0A 3AGRA 5M1OA 3THVA 1IG9A 4YFUA 4BRFA 5DM7R 4FPBA 1UZCA 3QHSA 3CCQA 2JGUA 1FMKA 4BYYA 4BNCA 4DFKA 3RKWA 4IO9L 1G15A 4FE7A 3A1PA 3EGXB 3ZT1A 2RJCA 4F9OA 2HNDA 1YI2T 2V1DA 4FJNA 2LY2A 5JVGF 2P9IA 2NOZA 2CFOA 4EJOA 2ZPHB 3U4LA 2P51A 3HB9A 3W3CA 5F0CA 2CW0F 2W6LA 2HHXA 1WSUA 1QLYA 3MEDA 4OMMA 2R7DA 4M77C 2Z16A 3MWMA 4A3KJ 3NTIA 1STZA 1S3XA 1WSIA 2CH6A 2VJ5A 1EWRA 4BVPA 2P9KB 1ZN2A 4I0BA 3HKZN 2RQVA 1KXPA 4OIOF 2IA1A 3RZOJ 3PUBA 1VQPN 2ZPBB 3A03A 3LDSA 3K59A 1NKUA 2KZGA 1IXSB 1UA1A 4MO4A 3BG9A 1Q7YC 1EV7A 4E7KA 3EKSA 2LVMA 2R92J 2CUBA 3Q1JA 5F0XA 2HF3A 3CTAA 3JAMZ 2P9UA 1IBKK 1WWXA 4AILC 3BJAA 3L3VA 3SFIA 2MWOA 5GAMh 2FVUA 5FFZA 2IVMA 1R59O 3VQAA 2LNVA 3TAEA 2NS7A 4CICA 3Q3SA 4W5RA 1KU9A 5LJ3h 3JTGA 1EO1A 5CYQA 2QQBA 2QTDA 4M7DG 1D3BA 3VQ7A 3LSPA 2FC0A 3I5RA 2RI2A 2HQEA 1KQSM 3NF7A 1CZBA 1XQOA 4A3LJ 2X9HA 3KBGA 3H9JA 1U9OA 2H27A 5JHFA 2GAUA 2RKHA 1N39A 4CGZA 2HVQA 3NH1A 4XN3A 4A2AA 2JN0A 4CI0C 4OMPA 1D1BA 3AARA 1SG5A 4BVOA 4JJDA 4ATOA 4RGUA 1FEXA 1HW2A 2V51B 4U7BA 3DEEA 3ZRGA 2D1XA 2XG8D 2E19A 3A2KA 4UQGA 1YQKA 5CYMA 4CFBA 2PLYA 3LWHA 4ID1A 4M71A 3OL4A 1U8BA 2DCEA 4FM2A 3QEVA 1M2VB 4XL9A 3GTMJ 1YHQI 3L6QA 3SD4A 1B8IB 2A1RA 5F04A 3FX3A 2JJ7A 4DQRA 3BJ6A 1R49A 3KK3A 3CMEQ 1WB9A 1LWYA 1RT4A 2L4AA 4IHWA 2A3LA 1R22A 3E9PA 1O3QA 1ZGWA 4YIFA 4K25A 3HK2A 4B1ZA 3WU0A 3TABA 2K9LA 5DCFA 1ONVA 1KEAA 2E3HA 4QTRA 4HNUA 2VPLA 3CXCM 1KQSP 1K78A 2VOPA 2P5KA 1I5OB 3TREA 1MMNA 4NS5A 3M9QA 2MD0A 1Y6IA 3CCSI 1L3LA 2LNBA 2X48A 1RNHA 5GAOr 1FLIA 4WCIA 2Z0WA 2L3SA 4E7JA 4CJLA 4LXCA 3HSRA 4XICA 1WSJA 2O0YA 2LF7A 1KTQA 1Z9CA 1CSKA 3F8NA 4RB2C 2A68F 3TL4X 4EHTA 3I5UA 4ITVA 4M7DE 4KH5A 1TYQB 3ENBA 4KHQA 3EHRA 4CK2A 4MEYF 4FPAA 3PV8A 1KG4A 3TGNA 4R0KA 2JWKA 4QS8A 4OFAA 2P5VA 1KU3A 3I9V2 3I64A 4Z4IA 4QCLA 2G8UA 2VOOA 5JVHL 2YX6A 2E1NA 4JKGB 3ZSVA 1Z91A 4A2UA 1E3MA 1GHCA 2H3JA 4M75G 3ERED 2FOWA 4FOIA 2Q0RA 2VKVA 4RCHA 2ISZA 4EPCA 1USTA 1QZZA 2W41A 1VQ9Q 5BPLA 4Z0UA 2IDOA 1CQTA 4DV5K 3FB9A 2FXUA 4CEAA 1B1BA 4X34A 2W42A 1NU0A 1NM1A 3RCOA 3X25B 1TWHJ 5AZJB 1N6AA 4V2SA 1N9RA 4J6XA 4KV8A 2WTEA 4JKFA 3T9NA 2G8IA 5HDGA 1ODDA 4JKEA 3INZA 2V6EA 2RQUA 4NQWB 1IRXA 1WEFA 4ETSA 1I94K 1K61A 3VA3A 2EW3A 4C0DC 3TOBA 2ECCA 3FR0A 1DKGD 4OX9K 3G1JA 1IZ1A 3HGYA 4H0EA 3QB0A 4NLBA 4EV0A 3G4SA 3RI4A 4MQVA 3ZCOA 4HCZA 2CQKA 2D6FA 1OH6A 3AT1B 1IXRC 2LCCA 2L4MA 2DA7A 2PMHA 2DMNA 1OCZH 2ZF5O 4NXMK 4XU0A 1K9AA 4AF1A 1V76A 4DR5K 3T3FA 2UU9K 3G1MA 5EC7A 3NTHA 1N32K 1Z05A 1YXQA 4ZDLA 2XGCA 3DM2A 2E2IJ 3V9UA 1V5FA 2BW3B 5CHIA 3META 2QQSA 2HL3A 1HK9A 2NUPB 1MJBA 4M75E 3U3YA 1A5JA 1ZUUA 4HF0A 3F21A 3IAYA 1RFQA 2JHNA 2EV5A 4XH5A 3QICA 4BGBA 1QQCA 3M4YA 3HFNA 2KPMA 3RSEA 3VETA 1P7JA 4A3IJ 5EY4A 2BOLA 3DKWA 4ZHRA 3EH2A 4J9FA 1JJ2M 1L3SA 1I6HJ 2LTOA 2DMTA 2WWYA 1K0SA 3HPHA 3J80Z 4KH4A 4DTNA 1Y0UA 4PKHA 5K7FA 2JW4A 3TI0A 1VF9A 3WXJA 4XLNF 4UNOA 5KYUB 1VYTA 1HBXG 4X66K 1Q86U 4FETA 4C9YA 4CJ3A 2YHAA 3SPYA 2TDXA 3GNGA 4KMFA 1BR2A 5M5WJ 3EL2A 5EZHA 2RV8A 4RGXA 2QGUA 2O8BA 2QWWA 2E60A 4YFXF 4B4CA 2OX7A 3H41A 3BG5A 1A5XA 3AA5X 3LSRA 2Y90A 2P5GA 1TW2A 3EFOB 3WVDB 3SI6A 3CQTA 3FKIJ 1CXQA 3MMYB 1HW1A 5E1WA 3C3WA 1RTJA 4NDLA 1BA5A 5LJWA 1NG2A 3ID8A 3QZ9B 3CMMA 3CXCS 1WHHA 1ABQA 4OB3B 2LJ1A 2QSGX 2GWKA 1HYOA 3R4KA 1G83A 4U7DA 1WCMJ 1VRUA 2GOXB 5FRMA 3A01A 4GY5A 1QZ6A 3QU6A 5LGTA 3BE3A 3ZX3A 3SBGA 1GLDG 1UHSA 5JS1A 1IGQA 5LL6S 1J9AA 3G71Q 3KLIA 3EAEA 5J1YA 3OYDA 5ICGA 4B9UA 2W00A 5LJ3f 1QWFA 4CJRA 1X19A 3MQ0A 3WXLA 4FSVA 3H0HA 1HJOA 2DYSH 1ZREA 2HKXA 3CWSA 1WLPB 5CO7A 4DLGA 5CQYA 3TTDA 1WH7A 2DTUA 2OQRA 1ZG1A 3O9UA 4PFZA 3CESA 2JTFA 2DFHA 4HNTA 4DFPA 2JUGA 2FE3A 3COAC 1PSFA 2LKXA 1LW0A 2STWA 3VODA 5KRSA 3CPWM 1LEBA 4HVJA 1E2XA 1TUGB 1X75C 1ZG3A 2ZMEC 2VE9A 3VPZA 4YFKF 1XGOA 5BRDA 4C92D 4C5IA 1FYNA 1KZHA 3AA3A 2PAVA 2RPNA 1VQKI 4LG0B 1X58A 3CCSA 4CERA 4BUPA 1BL3A 1XG7A 3CCQQ 4YPRA 3FLGA 3NH0A 1XGNA 2K3FA 3LSHA 4O5VA 1XQPA 2COWA 2RKIA 4J9IA 3CBOA 3AVHA 2IC3A 5TJJA 4JRIA 2KDSA 2OUMA 4ELYC 2NUZA 2ZC2A 1KSWA 1HNXK 1PDNC 2O8CA 2LQKA 5GPCA 4M7AC 1SL0A 2W0ZA 4Y17A 3LYIA 5E3NA 2MG4A 2EJRA 4IEEA 2YUQA 4A0ZA 5HRNA 5EDNA 4DR6K 1LDKB 5K5RA 2YUOA 3F0ZA 3I55I 4M7DA 2FD5A 1R1VA 4UUTA 5GMKj 2B4JA 1T3SA 2E5QA 3KK1A 3AL0C 2RO0A 2YI1A 3DLGA 5BRFA 2V79A 4C23A 4EZ9A 3F3XA 1HKSA 2EQIA 3ZP5A 3CD6T 2QWPA 1E3OC 4JD2A 3B6OA 3OJSA 3CC7A 2M0CA 4AU7A 2QSHX 2XI9A 1UTIA 4KT0E 2YG8A 1VQ8I 4CZCA 2VT2A 2I8DA 3D7EO 1NGGA 5HROA 5B8HA 3TSZA 4Z4HA 1E7OA 4LY7A 2P0QA 3IV5A 3KXTA 4KISA 1VQOT 4FXDA 4KDPA 3BTIA 3CXCA 4U0VA 3I53A 1DIZA 1NJZA 3KYLA 2AXTC 4H4OA 1CKBA 4CYDA 1V4RA 3LDNA 3VYRB 2E2OA 5B66C 5LEKA 1TGOA 1YG2A 4KKOA 3D2FA 1MD0A 1Z77A 3DLBA 1XMOK 3FRNA 4EMKC 3V4IA 5CKHA 1MBJA 2MGQA 5E20A 4CF8A 3LPTA 3VQ5A 2IAJA 4R79A 3S1MJ 1V4TA 1A6QA 3G4SI 1ZG5A 1RETA 2HAXA 2QDLA 5AJ3K 1K83J 4DQ2A 1JT6A 5IH2A 2OQGA 2EYYA 2F1LA 1OR7A 3AG1H 2MCNA 3L4QA 1K8AO 3SBTA 4Q0BA 1NK2P 1FYLA 3LDPA 1ATRA 5D6YA 2V1NA 3FK7A 3FZHA 1XOVA 1BI2A 4WFBL 1ZSZB 3X28B 4BDPA 5K7ZA 4LH5A 3IC7A 3GLLA 1T98A 5BN9A 4ZZDA 5GANf 1S1NA 3SJMA 1UAAA 3IAM2 3CM6A 1PP8F 1U5SA 4Y7NJ 4DZJA 2HEOA 4MZTA 2P9LA 2DFEA 4I2QA 3LWLA 4M6XA 3AY9A 1M2VA 2KNBB 1YITI 2V1UA 1SPKA 2HBJA 5HLGA 3GG4A 3IDHA 2QA4I 2FJ1A 5IXBA 1R23A 1GLEG 1QHHD 4LFUA 5GIPA 3TMOA 3EUAA 2GUIA 2D5RA 4RLQA 4I0AA 4MQ3A 3CJ9A 4DLEA 3TAMA 1RAGB 3HTRA 1TNTA 4C8QD 3CCMN 1M27C 3ZXSA 4IUUA 1ORNA 3O6BB 4N56A 4H5NA 1BL0A 2XGXA 3F5TA 2AO9A 2RNGA 3RBBB 2CREA 3REBB 4LH4A 2CU7A 3K4MA 3HOTA 4LIUA 3BQZA 3JCMe 1MHNA 3LW5E 2QGFB 3I9QA 4JK9A 3CPEA 4ENKA 3DRRA 4B9LA 1X6GA 1FIAA 3D6RA 1D8KA 1HSJA 3CCRA 2VBXA 4BQQA 2A37A 4AM3A 2ZJRF 2B86A 4FASD 1R4MB 2CP6A 3MEVA 1K9MO 1BQMA 3NF9A 4CXFA 1OZ2A 1BM9A 1NM7A 2WY7Q 3EZWA 4JEPA 1C1AA 4A54A 5CIUA 1VQMQ 3JRCA 2ZJQF 2KHMA 3RTRA 1VQMN 4IUQA 2HI3A 2VWBA 4MZMA 1WLJA 2E64A 3CMAI 1OH8A 1VAZA 4RAZA 1ERDA 4N0BA 1Y1VJ 2HZTA 4CEBA 1GXPA 3REAB 1C0MA 1FN7A 4C0GA 1JQQA 3THXB 2NUTA 1IUYA 1PUEE 3EH1A 2W03A 3DRPA 3FISA 2K5LA 5AQJA 3KVGA 1K76A 3RKYA 2ED0A 3BR1A 4C92A 4PZJA 1IRGA 1D3BB 2X6SA 4A4HA 2DJNA 2CW8A 3RYPA 3C65A 3FMRA 2EK5A 3RZDJ 4HT8A 3VQEA 1IJWC 3KETA 4M7AE 1RNLA 2ASMA 5J1RA 2DJIA 4Y91A 4W5OA 4CCHA 2D8HA 2DK8A 4KRTA 3CCRT 3G6EA 2VC0A 1S72I 3BCAA 3VEVA 2E5LK 5I42A 1C0GA 1NG6A 1IXCA 2OC6A 5CVRA 3W3DA