3L2QA

Crystal structure of the prototype foamy virus (pfv) intasome in apo form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 97
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2qA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2qA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2qA03
2YNHA 3AVCA 2L8DA 2M0OA 2RI5A 2A1RA 4DWIA 3KKRA 1C1CA 1UOCA 3M8SA 1KVCA 3DRSA 1KSPA 4RW8A 3VQDA 3SQ4A 4C8OA 1Z25A 3QLHA 4K8ZA 2P1JA 1IKXA 4PLLA 4JRPA 4DTMA 2PY5A 1LAWA 4KI6A 2LTOA 1NJWA 5C6SA 1L5UA 3ITHA 4Z4GA 4GY5A 3NFAA 1FKPA 3QESA 4EP4A 1KVAA 4Y1DA 2X4YA 3NTHA 3V9WA 4CEEA 2XY7A 1SUQA 3OB9A 3M8RA 5J2QA 4FXDA 4N56A 1A5VA 2QKKA 2FBVA 4DG1A 3AVIA 3MEUA 3NH2A 3K57A 4CF2A 1TKXA 1DTQA 4FJJA 3VQEA 1ASUA 1QHTA 5E41A 4OKEA 1S6PA 3NTIA 3NTKA 1U04A 1D9DA 4ZTJA 2R5MA 3VQPA 2E6LA 4GW6A 1OZ2A 2FHDA 3CFOA 4J2BA 3S3OA 5CZ1A 4HUGA 2M1HA 4N5SA 2BUDA 4N4GA 3QEWA 2HHVA 4CFBA 4E3SA 3SQ0A 3SI6A 3KJVA 2GFUA 3MP6A 5CYQA 4CK2A 4FLYA 2D0BA 1LWEA 2GBZA 2X6SA 3LX7A 1C0UA 3NGZA 3HT3A 1D9FA 3L2QA 4N47A 3D0PA 2DTUA 4DSLA 1L3VA 3ZT0A 3WNEA 5J2MA 1NOZA 4DQSA 2CKKA 4CJ4A 2BIVA 4DTXA 2LVMA 4B08A 5J2PA 4NYNA 4BD3A 1ZYQA 4TSXA 1ZBIA 3AVHA 2RHZA 4FM2A 2R7YA 4CJQA 2RJFA 2HHWA 4RW6A 3OYBA 3OS0A 1TK5A 2RHYA 2QXFA 4OPKA 2P51A 3OYCA 4BWJA 1R0AA 2K3YA 4CFDA 1LV5A 3QEVA 3L2RA 3DI6A 3KD1E 3VQ6A 2YRVA 2HHTA 1C6VA 3AA3A 3K59A 3Q1JA 3TAGA 3T19A 1XHZA 1A5XA 3AVGA 4KI4A 3L2VA 4M3ZA 1VRUA 1EKEA 1L3SA 1WSHA 3MECA 3RR7A 2ETJA 4CEFA 1RTIA 2G8IA 4CFCA 2DFFA 3I8DA 1LWFA 2PYLA 1BCMA 3IAYA 1OI1A 4FU6A 1J54A 4CHZA 2MWOA 2NLUA 3DLEA 4QQGA 3LAKA 1NKBA 5HRNA 3RWUA 1ZBLA 4FVMA 3KLFA 4AHVA 2VG6A 1F21A 4QQ6A 3SV4A 3HM9A 3LWLA 3I0RA 4FJIA 4I9LA 1FXXA 3AO1A 4HVJA 1UAXA 4HCZA 3SUPA 1HRHA 4CJPA 1YTUA 4EZ9A 3ZSVA 3P5JA 3L3VA 4B9VA 3V1RA 3DB3A 1WJRA 4LH5A 2W42A 4FK2A 3B6OA 1WN7A 4JS5A 4ID5A 1ZBHA 2HHSA 2HNDA 3E9GA 5D6WA 5M9OA 3QJ6A 4ELUA 4AILC 4CCHA 2HQXA 2RF2A 2G8FA 3QNNA 2JLEA 4CHNA 5I42A 2BKDN 3G10A 2HMIA 4DQIA 1TL3A 2PYJA 1QQCA 3LANA 3VA3A 2O4IA 4CFAA 3B6PA 4FK0A 3OYEA 4FLUA 1QSYA 3TAPA 4W5NA 4AH9A 2RI2A 1TKZA 4FL6A 4KV8A 4J2AA 3META 4AHCA 4QAGA 2XRIA 2EKOA 4PWDA 4FLXA 2RHUA 3QEXA 3MAQA 4M3RA 3P8HA 4Z0UA 2EQKA 4CGHA 3P83D 5J26A 5KRTA 4E1MA 2RHIA 4NCGA 1UA0A 1JXEA 2YKMA 3NBPA 4PUOA 4IURA 2L3RA 2B6AA 2EQUA 5D6YA 4W5QA 4KB1A 2YHBA 3QIOA 3FC3A 3VQCA 4CGDA 3H8ZA 4HCBA 3VQ7A 3TAFA 1S9GA 3ZSXA 3DMJA 4F3TA 4LSNA 4QVZA 3NAEA 2X6NA 4YFUA 3MEDA 3ZT3A 3H08A 1QE1A 2KFNA 3K5NA 1QS4A 3G0ZA 5J2NA 4FK4A 1VSKA 3HO1A 3TWHA 4Q5VA 2G8WA 2HQEA 3S9HA 4CEDA 1N27A 4M3XA 1JLBA 4B9NA 1RBTA 3NF7A 2YNIA 4FJ8A 1JLEA 4IFYA 1U48A 4FZXC 3DLRA 4Y1CA 3MO8A 4J2DA 1X9MA 4DU4A 4PA1A 4DTPA 4OLAA 4CHYA 2D9TA 2O4GA 2FBTA 1NK6A 3NGYA 2OPQA 4CK3A 4I2QA 3OYIA 3O4NA 1QTMA 3ASKA 3U6FA 3NH0A 3OA6A 1I39A 3AVLA 2IDOA 3OQ5A 5KGWA 2HHXA 2IGIA 1JLCA 3OYJA 3MP8A 4N4IA 4O5BA 4DF8A 3SJJA 1KTQA 1KFDA 4II1A 2Y1JA 5IAYA 2P0KA 4ELTA 1S1VA 2DIGA 4KHUA 1Q9XA 2KZMA 3O3HA 5FRMA 3DRRA 3AVKA 2P5OA 2RPIA 3MEWA 1RDDA 3LGFA 4F2SA 5HLFA 2MWPA 3PUFA 4M41A 4NYFA 4ICLA 4CHOA 3WNFA 1S1TA 3I0SA 1JL2A 3ZSQA 3OYNA 2GUIA 3MEAA 2O4XB 3DOLA 1MHNA 1C1BA 3JYTA 4O55A 1IKVA 3L3UA 4B9UA 2RKIA 3MEGA 2LDMA 1N6QA 1ZBUA 3BGRA 4B9WA 2I5JA 1JL1A 3PO5A 1KRPA 1SSFA 3V1QA 2RJDA 3DLHA 3EAEA 1W0HA 4RW9A 2Z1JA 1I3AA 3VQBA 2F96A 1SKSA 3MXJA 2EX3A 2X78A 4RW4A 3EZ5A 3KLGA 3MXMA 5K14A 1RBRA 4I9QA 2QQRA 4H4OA 3EYZA 3SV3A 4FJLA 3K2PA 4CRIA 4HUEA 3KK1A 4CGFA 3V9SA 5DMRA 1J53A 3O4QA 4KREA 3SPZA 4CGGA 4KO0A 4CESA 3CM6A 4CECA 2Y1IA 1TK8A 3HK2A 4CIFA 2LRQA 4DF4A 2G3RA 2D5RA 3C94A 4KTQA 1WGSA 3T3FA 1O1WA 1L3TA 1G15A 5CIUA 4W5OA 1X9WA 1KFSA 4KHWA 2BANA 1WAFA 1BIZA 3UWNA 2NUBA 5C24A 1X1PA 5CYMA 1WSEA 4DS5A 4IG0A 2RN2A 4XIUA 4FJXA 3LZIA 3DB4A 3AVBA 4OVLA 4DFKA 4FJKA 1JLFA 4FM1A 5CY4A 4E7JA 4CEOA 4LD6A 3OYFA 2RJCA 1UA1A 1QSSA 4BE0A 3QBYA 4NZGA 2RO0A 4DFJA 4DSKA 4OJRA 3LDSA 3CYMA 4FYDA 1LWCA 3E01A 1SL0A 3NF9A 4DQQA 3UT1A 4EDUA 3OS2A 3M8PA 4CJLA 3AA4A 4FJMA 4RW7A 5EU7A 5KE3A 4DLGA 2F8TA 3DYAA 3SZ2A 3FFIA 5D6XA 4CF8A 2R5AA 1YT3A 4W5RA 4O0IA 4CJKA 4L59A 4UQGA 1NJYA 3ASMA 4ID1A 4E19A 4DQRA 3ME9A 1HPZA 3MEVA 1XNIA 3LPTA 4CHPA 5KE2A 1SL2A 1N5YA 1DTTA 4CK1A 1IH7A 5KTQA 4RG8A 4DU1A 3U3YA 3RMAA 4OKJA 4JRQA 4NCBA 1HNVA 3HVTA 1RTDA 1CZ9A 5JS1A 5KCHA 1LW2A 4IUVA 4CJTA 1EP4A 1FKOA 3KLHA 1TKDA 4YNQA 2QKBA 3NDKA 3V9ZA 3M8QA 4Z4HA 3DLKA 1XI1A 2X74A 3ZCMA 5C42A 2XY8A 4FLWA 1GOCA 1VSMA 3KUFA 2G8HA 4N4HA 1TL1A 1LW0A 2OA8A 3NH1A 3SPYA 1NK7A 1RTHA 3AVMA 3QEPA 1Q9YA 4MFBA 3KD5E 3ULDA 3KLEA 3MEEA 4KKOA 2AJQA 4GMJB 3SQ2A 3RMBA 3MXIA 2Z1IA 2FBYA 4C8MA 3TR8A 1DLOA 1SL1A 1MU2A 3LAMA 4CJUA 4M3WA 5T7BA 1BHLA 4GVMA 3OYKA 4ZTFA 4M3TA 3VA0A 1NK5A 1KLNA 3PX4A 5KCOA 1RT3A 5HBMA 2OPSA 1HMVA 3AVJA 4OLBA 4CJVA 3AA2A 1L3UA 1NKCA 3ZT4A 3NCIA 4E7HA 2EHGA 2JGUA 4CGIA 3VQQA 3DLMA 5KRSA 4B3OA 4MQ3A 1SKRA 3H6ZA 1JKHA 3TARA 3NNQA 4A4HA 1IG9A 4LY7A 2HNYA 1RTJA 2LCCA 2D0AA 3JSMA 1RT1A 1J5OA 3LLRA 4IUTA 3AV9A 2GF7A 2IG0A 3O8VA 1IO2A 1TAQA 2XHBA 2IC3A 3WNHA 4EP5A 3CG7A 4E0DA 1Q8IA 2E6NA 4DTJA 1HQEA 1H3ZA 2EQJA 2E6MA 4E7LA 3ZT1A 4KAZA 3V9UA 3RRHA 4F4KA 2DAQA 3LPUA 3SUNA 3ZT2A 4KPYA 4E7KA 1WJSA 3ZSWA 4CJ3A 2KQ2A 3M9QA 1KLMA 1CLQA 2EFIA 4C5EA 3SUQA 5J1EA 1C1AA 3PV8A 3V4IA 2Z1HA 4AHSA 1G5VA 3VQ4A 1IKWA 2R58A 1WJQA 4CF1A 2WACA 4FJHA 1BGXT 3DOKA 3L2UA 4NCAA 1A5WA 3RMCA 3IRXA 1JLQA 1B92A 1JXBA 4BDYA 4IBNA 3SCXA 2DY4A 4I2PA 4Z4FA 4DTOA 4QW2A 4CJRA 3DLBA 5KGXA 3AO5A 3K5OA 3BDPA 1TAUA 4RG2A 3S3MA 1BQNA 1U4BA 4CE9A 3KK2A 2XDPA 4IUUA 4A4EA 3U3GA 1RI0A 4LD0A 3C6UA 2WONA 4UC4A 3OJUA 3OVNA 2HB5A 3RRGA 3OYLA 2Q3SA 4CF9A 1WNSA 1T03A 4Z4EA 2R57A 2VWKA 4OKKA 1BCOA 5KI6A 3VQ5A 1RNHA 1S1XA 1BISA 3LP1A 2BGGA 4O4GA 3LH0A 2IOCA 4BE2A 4FLZA 4HCCA 3V9XA 3MP1A 3L8BA 5C25A 4KHYA 4KTZA 2D0CA 4DTNA 2VG5A 5KH6A 4QOZB 4L8RB 3TABA 4AHTA 1RDCA 1CXUA 1KVBA 3RTVA 1NOYA 3HPGA 4CEBA 4DSIA 4F2RA 1NK9A 1SV5A 4O44A 5J39A 1IKYA 3HSTB 1NJXA 3C4SA 1CXQA 3A2FA 1C0MA 4FW1A 4M45A 2HVHA 4QQDA 3QIIA 1C0TA 5JS2A 3AO2A 4FW2A 1GOAA 5HROA 2G8UA 1GOBA 1S6QA 1B9FA 4IUQA 2FBXA 5IN1A 4C5GA 3K58A 2QQSA 1J9AA 2QK9A 3NF8A 4JS4A 4DTUA 3SUOA 4KHNA 4BDPA 3HP6A 1ASVA 3O3GA 1VSIA 3D45A 1BI4A 4NS5A 3VQ8A 1VSDA 1WSIA 4O0JA 4M3UA 1WSGA 4B9LA 5FRNA 5SZTA 3WNGA 3LP2A 2YNGA 1LAVA 4DQPA 4OGEA 4J2EA 2PZSA 3VQ9A 3V6DA 3FLGA 4CJ5A 5FROA 4CJFA 3EY1A 3PMIA 4FZZA 3OS1A 2OPPA 4BDZA 4CHQA 3HVRA 3PX6A 5HRRA 1BI4B 2BDPA 3OJSA 3DRPA 1U49A 3VN5A 1XHXA 3QETA 3KKSA 1HNIA 2YV0X 3ZEHA 4DSFA 2XO7A 3L42A 4EZ6A 1X9SA 3FDRA 5HRSA 2YKNA 1RT4A 2OYQA 3PO4A 3IS9A 3KIOA 2ZE2A 1CZBA 4C8KA 1Y97A 3L2WA 1BIUA 3OY9A 4B9TA 1NKEA 3CEYA 2ZD1A 1XC9A 3OYAA 2XY6A 1RT6A 4DU3A 2RI3A 4C8LA 4M42A 1K6YA 2GFAA 2DIQA 3F73A 2DFEA 3LWMA 3HYFA 3LYIA 4OVAA 2X4WA 4Q0BA 5FDLA 4H4MA 2RJEA 4A4FA 2EQMA 4DSEA 2K3XA 4PL6A 1W9HA 2F5KA 2OPRA 3HPOA 4FJ5A 1VK0A 4QCLA 1RILA 2ATQA 2E5QA 3QIPA 1EXQA 3F9KA 2WOMA 2KFZA 3QKJA 3S6WA 1XWLA 1YTAA 4DTRA 2PQWA 1JLGA 4DLEA 3DM2A 1T7PA 2X35A 4Z4IA 3TANA 2RHXA 3E9FA 3V1OA 2LSNA 4C5HA 4BACA 4WE1A 3HL8A 4LSLA 1NJZA 4KHQA 1TGOA 1TKTA 4C8NA 3C95A 1RT2A 1VSFA 4R5PA 3PFSA 3CFPA 1RDAA 1REVA 3RR8A 1Z26A 3ZSRA 2HHQA 2OZSA 2JTFA 3K5MA 2HW3A 3OYHA 1SKWA 3NF6A 3O3FA 1ZBFA 4K8XA 1RCHA 2G8VA 2E4LA 1RT7A 3PX0A 2HHUA 4CJEA 4JLHA 1VSHA 4KFBA 5DK5A 4FJNA 2YHAA 4IDKA 4KRFA 1NK4A 3UIQA 3LZJA 1NK0A 3ZSZA 3THVA 2HVIA 4G1QA 4HHTA 3CFRA 4AHRA 1RDBA 3ZSYA 1WLJA 3SQ1A 3PMTA 3QNOA 1VSEA 4B8CA 3PNWC 1WSJA 2KZZA 4ZHRA 3OYDA 2M16A 5C0MA 4W5TA 2BE2A 1YVUA 3AVFA 4DFMA 3AO4A 4FM0A 1RBSA 1D8YA 1KHCA 3LALA 1BQMA 4I7FA 3LP3A 4AHUA 3QEIA 1KCFA 1TVRA 1FK9A 3OMGA 3BDLA 5CZ2A 4HTUA 2IS3A 4CF0A 4X34A 4F8RA 4FZYA 1UWBA 3K5LA 4DSJA 3DLGA 4Z02A 1D5AA 1RBUA 3NHGA 1T8EA 4N76A 4B9SA 3AVAA 4BWMA 2B8AA 1S9EA 4DFPA 1T05A 5HP1A 1RBVA 3KK3A 2HNZA 2ZQBA 2IAJA 1S1UA 3OYMA 2A1SA 3AVNA 3S3NA 2X4XA 4PLIA 1VRTA 5HRPA 2FC0A 1S5JA 1OYXA 2GV9A 3TAEA 3VQAA 3HJFA 4B8AB 1JLAA 3PY8A 4LH4A 3F70A 2VWJA 4FCYA 2DFHA 2G8KA 4IKFA 4PQUA 3NGIA 4CERA 3T1AA 1HYSA 2KTQA 4KTWA 4FLVA 3SNNA 4OGCA 1TK0A 2F8SA 3GOXA 1TV6A 1RT5A 1OZ3A 2XY5A 4B9MA 4FJ7A 3QERA 3QINA 3P1GA 1HYVA 3ZSOA 4E89A 2YNFA 3IG1A 1S1WA 4Q5WA 4FJGA 4Z4CA 1VSLA 4A4GA 4CEZA 2L89A 3HXMA 5D3GA 4CIGA 2JZ2A 3C6TA 4M3YA 1U47A 2VG7A 2OZMA 3V81A 4F3OA 3KLIA 3AA5X 4IG3A 1WSFA 4DMNA 3TI0A 4B9XA 4E1NA 5I3UA 3FEOA 4ELVA 3NE6A 3LGLA 1B9DA 4CJSA 3OMCA 3AO3A 2KW4A 5SWMA 1HQUA 4CEAA 4DS4A 4BE1A 3ALYA 4FJ9A 3HPHA 1EETA 4KB0A 2ITGA 3CM5A 2O4XA 1EX4A 3KTQA 3ISNC 2B4JA 1ITGA 4PY5A 4C5IA 1NK8A 4CGJA 3OYGA 2B5JA 4DTSA 1HJRA 3RMDA 1BL3A 3SYZA 4H8KA 1ASWA 1WAJA 4FLTA 3SD4A 4E7IA 1HYZA 3TAMA 3P8DA 4N41A 2Z1GA 3LP0A 3TAQA 4KHSA 1U45A 1VSJA 2P5GA 4OPJA 4CIEA 4IFVA 1QSLA 3CQ8A 4CJWA 2XK0A 4HUFA 4CEQA 4IUPA 2VYTA 3HP9A 3QO9A
chains in the Genus database with same CATH superfamily
5L3EA 3HDDA 2YNHA 3AVCA 5GMKj 3BWGA 3BG6A 4D6WA 2MD5A 1FJGK 1Q81O 1D1CA 3PM1A 4WTOB 2XSDC 1VQ6T 1VQ4A 1W70A 2CYZB 4BRDA 1KSPA 5AQYA 3SQ4A 1RRQA 1WJFA 4FWNA 1I27A 1LAWA 3SLCA 4XU0A 5K5OA 1HK9A 5C6SA 3O2PE 1NZ9A 5F2RA 2OA4A 2QWPA 2CV0A 4DOWA 3CCLA 1VQ5N 2V1DA 3ITHA 3ZQGA 4EP4A 1KVAA 4AVPA 3CWAA 2VOOA 1KAZA 1Y96A 1X3ZB 3OB9A 1SHFA 4BUGA 3M8RA 1MNEA 1HDDC 4N0BA 2DCEA 4FE4A 4MZMA 5J2QA 4JNEA 5LJ5g 4IVNA 3UDCA 3VGMA 1RAHB 3NH2A 3AG1H 4CF2A 4MTDA 4WCGA 5E3LA 3WTYC 4EQQA 3JCMe 5E41A 4MZPA 5CQEA 2XICA 1YIJA 5GADP 1YS7A 3H92A 2E3HA 2YPRA 3PLAA 1SFUA 3VQPA 3HM5A 1DPUA 2EJFA 3W6VA 1WJAA 4C0DC 3CFOA 5HOOA 1ZARA 5CJ9A 5AQHA 1WHLA 5KQ8A 3S3OA 5CZ1A 3HSCA 4JYAK 2M1HA 2LC2A 4RAFA 3DLLA 4N4GA 2HHVA 3H3OB 3SQ0A 4M77C 4KIGA 1GXIE 1S7EA 3QO3A 3KJVA 4M75A 1KSWA 3MP6A 4A5AA 4PJOC 2D0BA 1PP7U 2IA1A 1I4K1 3MD2A 3A8YA 3VJPA 2XPWA 1FX7A 4N47A 4AI5A 4BRCA 3D0PA 2DTUA 3ULEB 3WTVC 2L3QA 5IOYA 1L3VA 2VXEA 2YDLA 1UELB 2KRHA 2V7FA 2HSEB 1NGNA 3BDUA 4RTYA 4CJ4A 1TQMA 4CW7B 4UUSB 1KQSM 5EVZA 3D2EB 3HSFA 1VYUA 2P5LC 4XEIA 2HL3A 4B08A 1GRIA 4KH4A 4CZFA 4G7ZF 5BMZA 3VOEA 1QVGS 3NRVA 1RAAB 1BR2A 4KH0B 5JI6A 2DO7A 3AVHA 4RDUA 2L4MA 2M8GX 2WB1N 1X75C 3KBGA 4H0VB 2HHWA 4CYDA 1HOMA 3ZCOA 3UATA 2M0CA 1TK5A 4DK9A 5FD5A 2BV6A 1G8XA 2HQRA 5FKNA 3A4CA 1YNZA 4LOCA 1IV6A 3DFGA 2JM9A 1R0AA 2B63J 2YWWA 4DV6K 3G6EA 3KD1E 4G9ZA 1Q7YR 2DODA 5E3MA 1JQQA 3BTCA 4O3MA 1KG2A 2YRVA 1VFCA 2HHTA 2W00A 2AKLA 1XHZA 1YQLA 1A5XA 2EYXA 5IH2A 4LF8K 3RKXA 1U6ZA 4M6VA 2W82A 2FOKA 4LG0A 1WNLA 1JEGA 4DUYK 4CC7A 2DQLA 1MGQA 3CO6C 4EPCA 1E3OC 1VRUA 4NQWA 2VL8A 2ZSIB 3ABTA 4RGUA 4C8QE 2JVGA 4L3QA 2EW3A 4I02A 4OFAA 1YITT 3G1OA 4IXAA 4N0AC 2PYLA 3OIOA 4FU6A 4HPQA 1NPPA 4CHZA 2MWOA 4QQGA 1VQ6A 3KHYA 4EMHA 1ZBLA 3LDNA 4LB5A 3ZN1A 2K3PA 1HR0K 1NG6A 4M74A 1F21A 2ZNZA 5KNLA 4E7SA 3JSCA 3REAB 3SHFA 4I9LA 2RC4A 1FXXA 3AO1A 1R22A 4HCZA 3EDPA 4Y91A 2DN0A 4JI7K 5KYYA 3JS6A 4DHYA 4FE7A 4M9XA 4IEJA 1U2VB 2K7LA 3V1RA 4B1RA 1KQJA 3DB3A 3CCJT 4LE9A 2EV0A 1WJRA 2W42A 1Y1VJ 4FK2A 4JKCA 1PD0A 4JS5A 2NYXA 3TU4K 5J3BA 3VRZA 3K0SA 1X2MA 3KP7A 2ISYA 2RA2A 5EY4A 2ID3A 2JLEA 2ZJRL 4RTTA 1IG8A 3ZP5A 1N36K 3DKYA 2ELHA 1O9SA 3V42A 1NG9A 3C0BA 2PYJA 1QQCA 5CR2A 1O13A 3VA3A 3AKZA 2O4IA 3FXOA 4JYKA 3JTGA 1YJWQ 3HTSB 3ZQHA 4C2UA 4ZYDA 4NLBA 4FL6A 4B48A 4IO8A 3VEWA 4RLFA 2D0NA 3RIRA 1TXQA 2EKOA 4FLXA 5BPNA 1ZUYA 4JKHA 3P8HA 3CJAA 2EQKA 3QOEA 4CGHA 5J26A 4PL7A 4E1MA 4IRIA 4RAGA 3R60A 5F1RA 4XQ3A 4Q48A 2DA9A 4NCGA 5CR4A 3M1EA 1A5JA 3CJRB 1MV3A 2UV1A 2L3PA 2V8IA 2N8GA 2KI7A 2DMOA 3CCMN 2Y30A 3EG2A 1KQSA 4KB1A 2PZ1A 2LRDA 1D0XA 3FC3A 1HPMA 1OH5A 2JK3A 2E88A 2KISA 1S9GA 3VSKA 3GE1A 1UJYA 4DYRA 1XJWB 4OMLA 1B72A 2HQAA 3DMJA 1LNXA 2LJ0A 2O2OA 3L4IA 2FBHA 3OW2P 3ZYYX 1VQ7N 5TKWA 3MN6A 5AZIA 1O7LA 5F08A 1ZG5A 3ZT3A 3H08A 1OU8A 1FP2A 2VPLA 1AA7A 3CMEQ 4C92C 1ULYA 4LUDA 5C3EJ 1SF9A 1QO0D 1M3BA 4AIDA 4OF1A 2G8WA 1QVFA 1K8AO 2XUBA 2AHQA 1Q82U 1FC3A 4ETSA 2FZKB 1Z77A 3FZLA 3NF7A 1AD5A 4I99C 4IZZA 5AFUA 1QHAA 1ACMB 4DR7K 2J5OA 1AZGB 5FFXA 3K2AA 3RJPA 3X28B 1XTAA 1BU6O 1X9MA 3QDFA 4XKCA 4CJ7A 4DU4A 4OLAA 2DOEA 4CHYA 2NVTJ 2DMPA 2O8EA 2A61A 1UB4A 5C12A 2L7KA 4ORZA 1NK6A 3EEQA 2OPQA 3NGYA 4LG3A 2K27A 2KXDA 4CK3A 2RB6A 3MEXA 2A3SA 3O4NA 2M7AA 1T0FC 2YJEA 1QTMA 1S72N 3JAME 1EV7A 1YITA 4TV7A 4D5CA 3CD6I 4A3DJ 3FKIJ 3CXCA 3NWSA 3VYRB 1XQHA 1GLFO 2IGKA 3MP8A 2GXBA 1AOJA 2VE9A 3SJJA 3JAMZ 1KD1U 2XF7A 1KFDA 2Y1JA 4KRTA 2YT6A 3O3HA 3QYBA 3AVKA 4YG2F 2P5OA 3EO3A 3MEWA 4UB6C 2KPMA 3VODA 1ZBJA 4RTZA 2K9GA 1RDDA 4E9GA 3KETA 3LGFA 3R1XA 4J9EA 1TH7A 2MWPA 1IHVA 3KX2A 3K10A 1NG7A 3PUFA 3CCJA 5GAN7 2EJRA 3GTLJ 4CHOA 2ISZA 4B3XA 1VUBA 3WUHA 1RKWA 1Y7XA 1QPIA 2KEAA 3E97A 1Q81C 3DOLA 1C1BA 5TKYA 3FMSA 1M30A 3ZGKA 1IKVA 4J6WA 2KROA 2RKIA 4HEA2 5H2FC 4UVAA 3H3VK 2CZ1B 1JL1A 2WY8Q 5JR3A 1OX8A 2MG4A 3V1QA 3CJNA 5EOYA 1GCQA 2QDLA 3M5AA 1NMNA 2NRRA 5DY9A 1T6CA 4M63C 3B73A 3I3LA 3WT0A 1WXTA 2F96A 5KAFC 1UMQA 1MJ9A 2Y9ZA 1KG6A 1PNJA 2WBMA 2FRHA 4A63B 2QQRA 1P90A 2RNAA 4Y15A 5HDGA 4BY7J 4UOBA 3LDOA 1MBEA 3G1JA 4K11A 1RPWA 3CCVT 1IW7F 3VENA 1RAFB 2H8WA 1K79A 3H0HA 3OR1C 5GAMe 3CM6A 4CECA 1TNTA 3HK2A 1WSUA 5L3GA 2LRQA 1HC8A 1B4AA 4I2OA 1RETA 2HYFA 2HKNA 4XTVA 5GAOl 3ZL7C 2DTOA 4KTQA 5KYUA 2GOXB 4JK1X 4BC4A 1O1WA 5ELZA 1L3TA 1TQPA 1ON1A 3IMXA 2W7NA 1JRIA 2IVOA 1NM1A 4U0WA 1KFSA 3LSTA 4KHWA 3EG1A 2SEMA 4X65K 3M0PA 2MBFA 1BIZA 3EUKL 3J81E 3UWNA 3CMMA 1K6OA 2NUBA 3WG9A 1FTZA 1S1NA 3E1SA 3O5ZA 2OAZA 1WSEA 2A3ZA 2LKXA 3M4OJ 2BZYA 3DB4A 4OVLA 3AVBA 3RVCA 4FM1A 4E7JA 1GFCA 3FIFA 3CW7A 4LD6A 5IHIA 1KQ8A 3QRFF 2YG9A 2E12A 2O88A 1JT0A 4K43A 2V52B 4NZGA 2RO0A 3QICA 5GAN5 1IGUA 2HHHK 2LK2A 1IXDA 1X9JA 3BZCA 3BTLA 1HDPA 4DZJA 4A93J 4FYDA 3JCMV 1X4PA 2FRYA 2XKOC 2F1LA 4ESFA 4JZ4A 1SFXA 4OIRF 4DQQA 1DGRM 4EDUA 4M7DF 1RABB 2LMJA 2QI2A 2DVEA 3C7NA 2IGMA 4CJLA 1FMWA 3IKTA 3A8GB 4DBRA 2YUPA 1IV0A 4RW7A 5EU7A 3GLXA 3SEZA 4KISA 2VUBA 3E1YA 1WB9A 4BR0A 2ZPGB 1GLLO 1QVPA 4OIQF 1SAZA 3MX2A 3ENBA 1FMVA 3KYLA 5I2MA 4IHSA 6PAXA 4W5RA 2P0PA 1DGKN 4UQGA 4EVVA 2JRTA 2Y31A 3KP3A 2JJ7A 2YS9A 2AK5A 4HF1A 1SD4A 2ZJRF 3BROA 1X27A 1XMAA 4RLQA 1PKSA 2ED1A 1SL2A 4B23A 2X85A 4OKJA 4M78F 4NCBA 1RTDA 1CZ9A 5JS1A 2CS3A 1LW2A 4IUVA 1YP5A 2HBKA 2WSFE 2JN0A 4YNQA 1ZLJA 2NYSA 3C0CA 2ME0A 3SAHA 4BROA 5AQOA 1RTHA 1X4OA 4EA4A 5L3FA 3LOCA 3I35A 4MFBA 4M6XA 1Z9CA 2WTEA 3OW2M 5IOZA 3N5BB 2AJQA 1K61A 3CPWP 3SQ2A 4H5RA 2XPUA 2L3DA 2HQHA 2ZMEB 3VERA 3CF5F 1DLOA 1MU2A 3LAMA 3VGKA 4RCHA 4GVMA 4C8QD 2K57A 5LMNK 3ATUA 5DCMB 4ZTFA 2COMA 2DXTA 4CZCA 1NK5A 2M0YA 4GLKA 3I56Q 2HTJA 3PX4A 3G1MA 1AWXA 4OLBA 3F2KA 5AIPA 4L9JA 4L0YB 4GO1A 1NKCA 3NCIA 4E7HA 1AVZC 2JGUA 1KQ2A 4JV5K 2IGNA 4UXNA 3DLMA 2BY0A 5FW9A 4AIAA 4E4HA 1JKHA 3ID8A 1CQTA 1IG9A 3CCVA 2XRLA 3ZEUA 1FOYA 3SJHA 1FN7A 2B9SA 4JQFA 1X3WB 4A61A 2HKQB 2JPCA 2LCCA 1ETVA 3KZIC 2EGEA 1NHAA 3AG4H 3AV9A 2DMUA 2GF7A 3NHNA 2F4MB 3G73A 2KBTA 3LWIA 1F36A 1BI1A 4J00A 3HI0A 3A5NC 4PFPA 3K4BA 3QU3A 3LWHA 2V1NA 1YJWI 4DTJA 2W84A 3A0BC 2VC0A 1X1DA 3DJCA 4KAZA 3U23A 4F4KA 3LPUA 1LB2A 3ZT2A 4E7KA 3HOVJ 5IPAA 4Y7NJ 3TBIA 4A59A 1Q18A 4H0OA 3NEUA 1CLQA 4C5EA 3A8MB 2AA4A 4KFCA 1ZREA 5J1EA 4BJ5C 4AUXA 4F91B 2R3SA 2Z1HA 1ILYA 2X6WA 2MCNA 4M7AA 4B6MA 2A6HF 4CF1A 2WACA 1ITYA 5DM6L 2K86A 4HX4A 4FJHA 1BGXT 3DOKA 4LF5K 3ZMDA 2EGCA 4CZGA 4DV7K 1Y71A 3L2UA 4V2GA 1JUSA 1MSFC 1NBEB 4XIDA 2JOYA 2LKPA 2H56A 1VQ5A 3OSSC 3QUIA 2CV2A 2CP2A 4AVZA 4F3QA 1Z9QA 2NOLA 1B92A 1R58A 1K9MR 3K4NA 2Z0WA 1JXBA 3CZ6A 3QP5A 3UR3C 1NLPC 4AQYK 3MK6A 4BY9C 4CCOA 1E2XA 4R55A 1DQUA 2HBPA 2CW7A 2ABLA 5AZJB 3MWPA 2PI0A 4OO1J 2X6YA 5C10A 5JFRA 1BO5O 1AU7A 4CJRA 1D8JA 2P8TA 3DLBA 5I2SA 3K5OA 1TAUA 3PIPA 1WIEA 2MLGA 1CSKA 1BQNA 1HKGA 3I4MJ 4CE9A 2W10A 3JRAA 4NC7A 2XDPA 1TBXA 3I33A 4JN4A 1K8AC 3V8KA 2VKDA 1WHHA 3BC8A 4FWRA 1X3NA 4A4EA 2DDAA 4A3KJ 3QJYA 4I01A 4UC4A 1NGIA 2M02A 3OJUA 1V76A 3RRGA 2X3XD 2Q3SA 3KVGA 2IA2A 4RTUA 2EWNA 4RB0A 2J05A 4EM0B 4Z4EA 1IN5A 2VWKA 3H0FA 4OKKA 5KI6A 2FX0A 3WU0A 2JVVA 2AQEA 1OX9A 3WE2A 3UKUB 2GOMA 1CF7A 1S1XA 3GNGA 2LKSA 4O4GA 3CMEN 4AMCA 2IOCA 4BE2A 3KZBA 5FO5A 3K9KA 2FOWA 1BUPA 5C25A 1KU3A 5GPCA 3FB9A 2LBFB 4BYYA 1Y1WJ 2VG5A 5M1FA 5GANg 2FQ3A 3TABA 4AHTA 1MH4A 4XOTA 1XQSC 2QWNA 2H94A 5LRRA 2AS5F 3TW7A 4HVVA 2QVOA 2P9IA 1DU0A 2FSJA 3L9FA 1SV5A 5GAHP 4HNVA 4O44A 2ELJA 2E1OA 1K9MO 2GX9A 1CXQA 1U5TA 2B0LA 3IQLA 4JI8K 3DWLE 5M5YJ 2HVHA 1ZH5A 1C0GA 1XMOK 5HROA 4IUQA 5IN1A 3VYHB 1MUYA 2D1VA 3CCEQ 4R1HA 1J9AA 2QK9A 3SUOA 4KHNA 1ASVA 2UXCK 2KYBA 1RAEB 1KGSA 1YAGA 5ADXA 2L7ZA 2ZJPF 1C6VX 1WFWA 3H0DA 2LQWA 2O7OA 3KFWX 5CQYA 4BJ6C 4WWCA 4KA4A 4O0JA 4NNJA 3I9QA 4PJOE 5L3CA 3SZGA 2BGCA 2KK4A 5J6XA 5LHHA 3JCMQ 2V75A 5EZHA 2ZF5O 2ICWG 3HOZJ 2QA4I 2YCHA 4U0YA 1LAVA 4E9FA 1TUGB 2JNGA 4OGEA 3J7AO 4J2EA 2FE3A 3SAFA 2XDBA 1HLUA 4V2SA 4CJ5A 5FROA 1RI7A 1WI9A 3H35A 1TUCA 2V1RA 1OH6A 3VRYA 3WODF 2GZWA 2QW9A 1YG2A 3OS1A 3LM9A 3LSJA 4HZFA 3MKDA 1I50J 3GCMA 4H5NA 3I5UA 4HV6A 3HVRA 2LX9A 4BS9A 3ZMSA 4JI6K 2XROA 1MMGA 3EGXB 4B8XA 1BI4B 1QKWA 5A2QO 2BY3A 2OJED 2PVDB 1MNMC 2R5ZB 3FE1A 1K8KA 3N97A 1BA5A 1NGFA 1XHXA 1DGWY 1SVMA 3S2WA 4FTHA 1TC3C 2QEXI 1BU1A 1VIFA 3THKA 2M4KA 2FF3B 3CPWM 5GP9A 2M87A 1PJRA 2L2PA 1Q86U 2K5LA 3D2FA 5FPNA 3CD6T 2VXFA 1YQAA 1X9SA 3BG7A 2ZCFB 2PVOB 4A3IJ 2EYWA 4AFQC 4LJZF 2VJIA 4XNFA 1TOVA 3L1AA 4J9IA 2QKLB 4XTXA 5FLXO 2NS0A 3J7YP 2OTJN 1IDZA 4KBMB 1X43A 4JPBW 2H09A 1NKEA 3CEYA 4V2FA 2A5XA 3E2UA 2XY6A 1RT6A 4YOVA 4DU3A 1RRJA 4YIFA 5CCAA 3ZMVA 2P4TA 4PNOA 1M2VB 1BI2A 2GFAA 3LWMA 1YQKA 1HUXA 3LYIA 1UEBA 2P9NA 1ABQA 3IH3A 4A4FA 1PHTA 2EQMA 1JCEA 4Y52J 1TWAJ 3KP6A 4XLEA 1SFKA 4KNYA 1B07A 3CUOA 1OCTC 5JICA 1XC3A 1WJCA 2EFWA 3EYYA 2E71A 2KFZA 3QKJA 3S6WA 1V29B 2VVKA 2NOZA 2EV5A 1FZPB 1ZBXA 1YTAA 1VQ4Q 3L7WA 3DM2A 3FHFA 4OU0A 1T7PA 4Z88A 1OPLA 2KAFA 1IN8A 3BZ6A 3CCMA 2OFKA 3ABLH 1I94K 1Q86O 4C5HA 4WE1A 2LMDA 1MMSA 1N5ZA 1TUDA 2D8JA 1NJZA 4XTYA 2L2OA 2FA5A 1TGOA 1TKTA 4MTEA 1Y0MA 1HCRA 4M7YA 4X0GA 5M1PA 3VESA 4A5MA 3RR8A 4GYGA 1FSEA 2RQUA 2E7XA 2HW3A 4MEXF 2E3IA 1SKWA 2E10A 3E9PA 3NF6A 4ESJA 1ZBFA 1OMIA 3BFMA 1RCHA 3IFRA 3LDQA 1AHJB 1VOMA 1BBYA 4KN7X 5GAGP 3FX3A 2P9UA 1LOJA 3F21A 1TW3A 1B1BA 1HBXG 1OCRH 2L3SA 2EA4A 4M75F 4KRFA 1NK4A 5B1AH 3BDDA 3NARA 5DM6F 4XRSG 2HMAA 2HVIA 3K4LA 1VQMQ 1LE8A 1ZKGA 1LWVA 2QYOA 3J7ZI 3KNTA 2OZUA 3CFRA 3GTJJ 4AHRA 2WY7Q 3FBIB 2ZNYA 2D0PA 2HF3A 3DBLB 2QBYA 1RDBA 1WLJA 2HEQA 3QNOA 3F5TA 3OSGA 4UHTA 5FJ8J 3MN5A 1Q1HA 4B8CA 2G7UA 4C3JJ 4MZTA 2XAHA 1HXDA 1TTYA 1VQ9N 2ZXWH 4EW0A 2R0QC 2R4GA 4ZHRA 4BBRJ 2QUFA 3RKYA 1ZGWA 2DBMA 2EZKA 1U84A 4F7UG 2NRVA 3GFJA 1OULA 2BE2A 4EM2A 4BUPA 3RMQA 4C8QB 5J1YA 2CUJA 3WU2C 4XRSA 2JG6A 2CUZA 2K6DA 1RBSA 1KHCA 3AL0C 4BC3A 3M53A 3CPWA 3HOSA 3A5MC 1ZAOA 2B7EA 2HZDA 1KCFA 5A0GA 4AC0A 3I56N 3HKZN 1W2BP 1SFEA 3J80E 2IS3A 4CF0A 1X2QA 4X34A 4A62A 1MJBA 2ZMEC 3LM2A 3Q7CA 1N77A 3M0TA 3MZHA 1TYQA 3CD6A 4MLOA 4LDYA 3K5LA 5KYNA 1IDYA 1ZHIA 1LFUP 5CQXA 4BWMA 1UGSB 1WUAA 1KQ0A 4F7UA 4DFPA 1T05A 2ZQBA 1S1UA 2A1SA 3S3NA 3EFSA 4H5TA 1EZZB 1UFMA 4PLIA 2FC0A 1ZRDA 3Q9VA 1QGPA 3TAEA 1TP4A 1ZLMA 4FM4B 2YI1A 3K2ZA 3R8EA 5GTIC 3ZX3A 2R7UA 2VWJA 3DEWA 2QSFX 5FWBA 3DXJF 1P4AA 5LJ5e 4PQUA 1TTHB 3OSVA 4CERA 2WSCE 1HYSA 4FLVA 5C4JJ 3LFKA 3EUAA 3H9QA 4IIOA 1DEJA 1TK0A 1B6AA 1QWEA 1YRNA 4I7HA 4P1WA 5DM7R 1QQIA 2WAFA 2P9LB 4FJ7A 3A0IX 3ESWB 2DERA 1V4TA 3P1GA 3QINA 2ZFUA 2ME6A 5IXBA 2L54A 3TPQA 4Q5WA 3S15J 2KIQA 4FJGA 4YDUC 4XH5A 3QDKA 5GMKm 3L0QA 2M30A 3ULRB 2IP2A 2WA0A 4PZJA 2HL5C 2Y75A 2DDBA 4UUTA 3GZ5A 2PJRA 4M3YA 3S41A 2O8DB 4XLFA 1JJ8C 2A05A 2VG7A 3HXLA 2OAWA 4RB2C 4A3CJ 1YQRA 3S1QJ 3LW5E 4ME7A 4XN0A 4DMNA 5I3UA 4E1NA 3EG9B 3VS3A 1NGJA 3FEOA 3MZ8A 3E6BA 4AD9A 2H3EB 4ILHA 5JVGL 4MDWA 3M8FA 1NJIU 1YJWT 2GGRA 1GXQA 5K7ZA 3M5RA 3PNYA 3KLNA 2EFPA 2YUQA 8AT1B 4JOMA 2O4XA 3GTMJ 4YEJA 2B4JA 3LQRA 4CZZA 4NBQA 1K9MC 5DCFA 1ATRA 2CP0A 3BY6A 5E1ZB 1PUEE 4DTSA 5D5UB 3BR5A 5C2DA 2E41A 1GVDA 3SD4A 2MA3A 2AZSA 1OQKA 3TAMA 3U8XA 3P8DA 5D7UA 5AR0A 3SQNA 3TAQA 4KHSA 2VJ4A 2EZIA 3KYCB 1VSJA 1BKBA 4YTLA 3CCEI 4GVEA 2P84A 5IP6A 4IFVA 4Y3OA 1DP7P 2RE2A 3CQ8A 1XS9A 1BOBA 4IUPA 5AQXA 4WX9A 1Y07A 2E64A 3K1PA 2CZ6B 2FSKA 3BZKA 4II2A 2GA2A 5FPMA 5EEGA 3PFIA 2E20A 1U9NA 2M0OA 3PUBA 2RI5A 2A1RA 2P9PB 3AGRA 4J8OA 3S1MJ 2F5TX 3KKRA 4XQFA 1C1CA 2F9TA 1UOCA 2FUG2 3M8SA 1U5SA 3KEOA 1QQOA 1UHFA 4C8OA 3KTUA 1HNZK 3QLHA 3CMET 4K8ZA 3M59A 1Y0NA 4PLLA 2AIRB 4JRPA 4DTMA 2BZXA 4KI6A 3S1RJ 2OI3A 1NJIO 5H1SQ 1L5UA 2F2EA 5DLOA 1KC8O 2XGXA 3VGLA 4ASNA 1FKPA 3QESA 1Z1DA 4Y1DA 2X4YA 4ZDLA 3V9WA 8ATCB 4LF9K 5L8RE 2FZGB 2XY7A 2ZJQL 1SUQA 2E1CA 2M5WA 1A5VA 4G7OF 2V7ZA 2QKKA 1S7OA 1MNDA 4DG1A 4LFCK 4L5EA 1NH3A 3K57A 1GXPA 2E35A 2IVPA 2QAZA 5KHDA 1DTQA 2RV8A 3JAMO 4OKEA 1V1CA 3NTKA 1U04A 2A6AA 4WYBA 1RKTA 1SMYF 5F64A 2HVRA 2Y48A 2R5MA 3M3YJ 2ECBA 4NHJA 1ORNA 4UUSA 5A0LA 2YUSA 4J2BA 4XK4A 5CVRA 1YITQ 2VGNA 4JI2K 4PJJA 2NVYJ 4N5SA 1MD0A 3QEWA 4E3SA 2JPBA 3L00A 5HODA 4F16A 3DF8A 2IS4A 2OU2A 4LXCA 5M5XJ 4MMKA 4B21A 4FLYA 3DTEA 3F3XA 2GBZA 3LX7A 4IOCF 3NGZA 2Q8KA 2M9HA 1D9FA 3VW4A 5E8IA 1OU9A 1N78A 1W36D 4PDKA 1XMQK 4CDGA 1V5GA 4GYIA 2DXIA 3HGYA 2RQRA 3WNEA 4V19K 2KQWA 1JJ2P 5J2MA 1GUUA 1W2BM 2IPQX 1GLCG 4DQSA 2IGOA 5D6EA 5DYMA 2D1XA 4J5YA 4A2AA 2WUSA 4A3FJ 4R79A 2DMNA 3HRTA 1H0MA 4M7XA 4NYNA 4HRIA 1VQ4I 3GFMA 2QF7A 5E20A 1ZYQA 3WEEB 4CZLA 3T69A 4O5VA 3PO2J 1YJWA 1K83J 1ZBIA 1YI2Q 4DCHA 4YIIA 2MH2A 4JI3K 3UKRB 2RJFA 4HDVA 4JP0A 3OS0A 1VZ0A 2QZ8A 1UB9A 3RSEB 2E1ZA 2BH1A 1YTYA 3TSWA 1K4US 4CFDA 3CCLI 3F23A 4PL8A 2DYRH 1ZQ3P 1TZLA 3KK7A 1K0XA 5F0FA 4HQMA 1N34K 3AA3A 3THWB 1K76A 4ITVA 1UGRB 5GAOr 4WFAL 3TAGA 2EYZA 5HNFA 4HX8A 1M90U 4KI4A 3LFUA 4OPHA 1EKEA 4B3TK 3WTSC 3H6EA 3J81O 3CJCA 4CEFA 2PNIA 1RTIA 1LJ9A 1X1CA 4CFCA 1BCMA 2IS2A 1VQMI 4OAYA 2NLUA 3WTTC 5HRNA 3RWUA 5TISC 1WHMA 2Z5UA 3SMSA 4AHVA 2YHTA 4BXUA 1DKGD 3CMEA 3SV4A 3R4KA 3MQ0A 1QVFS 4IL6C 2NOGA 3I0RA 5B8HA 1KO9A 4HF2A 1HRHA 4CJPA 1YTUA 4EZ9A 3P5JA 4EATA 3HKSA 3TSUA 3PVLA 1YCYA 3O8MA 3OL3A 2CMPA 3CDIA 2LJ1A 5CAIA 2R7FA 5KK1A 2KZVA 2LY1A 3QBWA 3F8NA 5M9OA 4CCHA 1DPRA 2X9HA 4CHNA 3BEXA 2JA2A 5LJ3g 4DQIA 3RPUD 3FZMA 2K4BA 3CXCS 1JUMA 5FD6A 2VQFK 3LANA 4GCVA 3JCMP 2X6OA 1RR8C 1XCVA 3O9RA 4C2MJ 4MO4A 3DLLL 4D5FA 1QSYA 3T1YK 2DF6A 4W5NA 4BQAA 4AH9A 3ASOH 1TKZA 4KV8A 4J2AA 5JVGF 1APLC 1PYVA 1ZX6A 1YXQA 2XSJC 4AHCA 4QAGA 1HU0A 4BVPA 3GBTA 3CQYA 3AG2H 4JUVA 1NK3P 2RHUA 5HDKA 3MAQA 2TCTA 4XLHA 3HTVA 4MQVA 2HXOA 3H0IA 3P83D 4UY8O 3UA7A 1O7FA 3RR6A 4CVNE 4HT9A 3G6EI 4C8QC 3G7ZA 3Q9SA 3QZ9B 2MF2A 1R00A 3K4CA 1QKXA 1W2BA 2YKMA 1ONVA 1U78A 1JE8A 4PUOA 2CT3A 3SK3A 4FWLA 2AT1B 4J9CA 4IURA 2L3RA 1UHWA 5D6YA 2H8HA 4W5QA 4F14A 3VQCA 3HFNA 5LJVA 4HNUA 2ECCA 3TAFA 1NGBA 2L9VA 3PE0A 5GIOA 3AAPA 1D3BB 4BL0B 4LSNA 2DXCA 1TUUA 1U8RA 5ECAA 3I56T 3DXMB 2EKHA 4YFUA 1EH7A 2V51B 3MKLA 3REOA 2V1UA 2L9RA 4CH7A 4AT1B 5J2NA 3A8OB 4YOQA 1VSKA 2W6KA 1WVRA 1NEBA 1NNEA 5B1BH 4FSVA 1TW2A 3HIFA 2L0AA 1ZGAA 3A5OC 1N27A 4M3XA 3B6CA 4X1EA 2ZGZA 3D7EO 3VTIA 2K5IA 1X58A 1RBTA 4CA0A 3IH7A 2W24A 2OTJA 3DPTA 1T39A 1JLEA 2QM3A 1K73O 1U48A 4FZXC 2BVLA 5GAN4 3DLRA 4PJLA 3T0YA 3MO8A 1PUFB 2XRNA 2CV1A 2PU9B 4PA1A 2NZTA 4DTPA 1OV3A 4X9DA 2O4GA 4BRFA 2DJQA 3FF5A 1P7IA 4CSWA 3CCVQ 2VV5A 4LF6K 3FSPA 3OYIA 5H20A 1PU7A 1WXUA 3U9DA 4JD2B 3TOAA 4IEEA 4M7AF 3ASKA 1ZC6A 1VQON 3U6FA 3GG4A 3EG3A 3OA6A 3DCFA 2IDOA 5GTHC 3OQ5A 5KGWA 4DF8A 2CH0A 2VQCA 3MKYB 1Y64A 3GVAA 3V7RA 3ZQ7A 4II1A 3ZQLA 2P0KA 1T38A 1MJAA 2DIGA 5HK3A 4KHUA 3S2HJ 4JKEA 2WWYA 2FXAA 2IA0A 1YF5L 4MO7A 2X6XA 5FKOA 2JTVA 1TWFJ 3CUQB 2NRZA 1OR7C 1MBKA 2X48A 4F2SA 4S05A 3REBB 2FBKA 3HUGA 1UFFA 4M7DG 1G3WA 5I9EB 3BJOA 2W48A 1J59A 3I59B 3PIPF 3WNFA 1S1TA 1YYVA 2CS7A 3LAPA 3I0SA 1UECA 4IZ9A 3GXOA 2RKHA 5C2FA 3MEAA 2GEMA 4H4KC 1B59A 3BTJA 3JYTA 2V9KA 1T3LA 2HR3A 1VQ5Q 3SJMA 3GZ6A 2NOEA 2CZ7B 4LDWA 3A01A 1FIPA 1T33A 3MEGA 2LDMA 4C9YA 2KKOA 1N6QA 4MLHA 4B9WA 1BW5A 4MLEA 3O4WA 5DEQA 3PO5A 4D7NA 2HBMA 2LT4A 1SSFA 1XQPA 2O3FA 2BEOA 2RJDA 1YQMA 4LC9B 2VWFA 2CUDA 2NRHA 4GBQA 3VQBA 2KNBB 1KU7A 1T6SA 3LSPA 4HVWA 3E0JB 1U3EM 1YOVB 2EX3A 2X78A 1E3HA 1KC8C 1T0HA 4M78G 2ZWHA 4M7DA 2NRAC 2FZCB 5IHKA 3KLGA 5K14A 5HVQC 3NFCA 3EYZA 3SV3A 2UUCK 3SB2A 4FJLA 2O8CA 3ERMA 2NOFA 1U06A 4KMFA 1JO8A 2KJBA 3VYTB 4NB4A 5EG0B 1MUZA 2DK8A 3CCSQ 2D6FA 2DRKA 3O4QA 4KREA 1HKCA 3EKUA 3THXB 3SPZA 4CGGA 1QWFA 4AG1C 3E5XA 2ZPHB 1RIOH 4CIFA 1HA8A 1VQ9A 4XLPF 2NVXJ 5GADJ 2D5RA 5LMUK 4IHVA 3K69A 2XG8D 4LFBK 2CSIA 2IS6A 4BQOA 5HY6A 1WGSA 2P9SA 2V26A 1BI0A 2CFOA 4RMNA 2JMWA 1G15A 4M77F 2F2XA 4FETA 1JHHA 3AFHA 4Y13A 2IRFG 4M78A 2D4WA 1KQ1A 3LSHA 3WQUA 1SANA 1UJ0A 3JCMf 1NMDA 1OISA 1OPKA 2CP6A 1YITI 4PJOF 3K9JA 2NUTA 1VTNC 3OIQA 4PGGA 1X1PA 1KQ9A 2CYYA 3IHUA 5CYMA 1S22A 3BG3A 3I56A 3HKZA 2XHKA 4XIUA 4FJXA 3CLOA 1OCPA 1J75A 2NAZA 3HBLA 1R1VA 3DXKA 3PNVA 3QYEA 2UYTA 2DA6A 1DT9A 3H0GJ 4G8XA 2Z9OA 3BLYA 4DA4A 2CQNA 2KRMA 4OP0A 2DETA 3ONQA 1Z9ZA 3LDSA 3CYMA 1PD1A 2VQHA 2GTJA 5L3DA 4B1VA 2F5EA 4O8KA 4CBUA 4M3EA 2H3GX 4BNCA 3E01A 5F0XA 1AWJA 2M3AA 3BJAA 4FJMA 4UB8C 3WU1B 5DPKA 2P5KA 3MKZA 5KE3A 2F8TA 2NNNA 2E1YA 5D6XA 1AHDP 3V7SA 1M8MA 3THYA 2K2MA 4CJKA 4L59A 4FASD 1H9GA 1S9HA 4E19A 2EB7A 3TDZC 1YI2I 3ME9A 4DQRA 1HPZA 4RTWA 3MEVA 2X0LA 1PC0A 2R7ZJ 1KXPA 3HC7A 2OAUA 1M1GA 1JI8A 4OMZA 5M3MJ 5EC7A 1LEAA 5KE2A 2MH9A 4NXMK 5HNHA 1QZ6A 4QPQA 4RG8A 2WV0A 4DU1A 2GNCA 2YHYA 4S04A 3HVTA 4BRMA 5D8KB 5KCHA 3O9TA 2VBYA 4QVCA 3R6MA 3I71A 1FKOA 3KLHA 1TKDA 3DPUA 2KVQG 1YW8A 2G7HA 1ABOA 1JJ2A 1N6AA 1HX1A 3V9ZA 5KCMA 3M8QA 1KAYA 1YJNQ 4M73A 1V54H 5CKTA 2DT5A 3ZCMA 3OV8A 2XY8A 4BVOA 3I0WA 3RYPA 2G8HA 4WFBL 4N4HA 2CQQA 1YI2N 2A08A 3NH1A 3A03A 2ZXHA 3SFZA 4DEYA 3CCQN 3RCOA 1MKMA 4KKOA 1T56A 1BG3A 1GT0C 3RMBA 1IGQA 3SWNA 3MXIA 1WH5A 2CW8A 2EILH 1JB0E 2FBYA 4C8MA 3M3ZA 2XAUA 1SL1A 2FMYA 2ZC2A 5GANe 3EETA 3OYKA 4KHPK 1KLNA 3GFIA 3HTRA 1SG5A 2RHKA 1IRXA 5CHZA 1HMVA 1EFNA 3VYGA 4LG0B 2E5ZA 5M1KA 1L3UA 3A0HC 5E18F 4CGIA 4QS7A 2PFUA 3VV0A 1X3UA 3VQQA 4WQ4A 1WZOA 1MZBA 1MPGA 1DP3A 3RQIA 1WRJA 2M1BA 4B09A 1OKJA 4B3OA 4NLCA 1SKRA 4BHPA 3NNQA 3ENHA 4PJMA 3IAS2 2FBIA 3HFOA 3KP5A 1J5OA 2DA4A 4C0FA 1Y56A 4BGAA 5I22A 1D8KA 1QNTA 2IG0A 3O8VA 3AY9A 4LLGF 1RAGB 4P55A 3IH4A 3CPEA 1TAQA 5BOXA 1X19A 3CPFA 3R2XC 2COZA 3WNHA 3HRGA 3BY5A 4KICA 4E0DA 2E6NA 1HQEA 1OCCH 1H3ZA 4IFEA 2E6MA 3K70D 4WCIA 4IRHA 2GQVA 3ZT1A 3QAHA 1UJ8A 1QRYA 2DAQA 4PGHA 3SUNA 4GV9A 2YRCA 1WJSA 3ZSWA 4CJ3A 2HGCA 2KQ2A 1SS6A 3CCMQ 3GZNB 3HEFA 4NUBA 4JJNK 3SUQA 2BXYA 1EH8A 3W2WA 4DR6K 3V4IA 2KMTA 4AHSA 5IHNA 3VQ4A 3G4SN 4YHHK 3M8EA 4XOPA 1VQ7Q 3M0RA 1Y6IA 3ER0A 1G59A 2LLKA 1OJLA 3RMCA 5AYFA 4FWMA 3IRXA 1JLQA 3CBMA 5GAOn 2BY1A 3ZFJA 1VQMT 2KRCA 2FB7A 2O61A 4WQ5C 4C92F 2LC4A 4IBNA 3QHSA 2YHWA 1M1KO 4I2PA 1OCOH 2F4VK 5BRDA 1EF4A 4Z4FA 1NGEA 3AARA 4AU7A 4A0YA 3I53A 5KGXA 3AO5A 2WAEA 3CF2A 2HDAA 2ESHA 4RG2A 2VXZA 2WFBA 3OH6A 2Y0SN 1PSFA 4IO9F 5KAIC 2QXLA 3HYIA 4QIWN 3U3GA 2XF6A 3RKWA 2KFDA 1S72Q 4LD0A 3C6UA 2X3WD 3OVNA 2HB5A 1K78A 2XI9A 3OYLA 5GAN6 2X1CA 1T03A 3A5ZB 1ESVA 3SMPA 4PK4A 1Q81U 3J80O 3RNJA 4JLGA 1GLJO 5IT9E 3S1NJ 4A57A 4OOIA 1B72B 1M27C 1LCUA 4RGRA 3LNQA 1BISA 1SMTA 3CCVI 1C0FA 3HSEA 2KT8A 3VKIA 5AZIB 4HCCA 4ZYEA 3V9XA 4KGZB 3MP1A 4KHYA 4RWTA 1JJ6C 5IT9Z 4OX9K 2D0CA 2LH9A 2E1MB 3M8JA 2J6OA 3O6WA 2JJ9A 5J8CA 4U7BA 3H1QA 2LCSA 4QOZB 1F9NA 4LD5A 4L8RB 2GBYA 1FP1D 4BKXA 1KVBA 4BRPA 1VQ8Q 2FEZA 2Q2EB 4NDLA 1I1GA 4F2RA 2ZAEA 1JTYA 2DW4A 1LWWA 1IKYA 1KHIA 1XD7A 3M58A 4ZZLA 2COWA 1QQJA 2AZVA 4XU1A 5ADXH 3EHQA 3MVPA 3P9KA 3QIIA 2ELKA 3H5AA 3AO2A 2BY2A 5FLXE 1B9FA 2O8EB 2V1XA 1VHXA 1UHCA 3NF8A 4I0AA 3RI4A 3HP6A 3T9NA 1VSIA 1BI4A 3K4JA 1ZRCA 5GMKi 4NS5A 3V7CA 1QMCA 1VSDA 4B9LA 5FRNA 1VQ5I 1JKPC 1HW5A 3R61A 2HKXA 2VWBA 3KFVA 1YW9A 3CMAQ 3WNGA 1H8AC 4J83A 3LP2A 3L2ZA 2YNGA 4BQZA 1MDUB 2EAYA 2LF7A 2PBDA 4MFEA 1XNRK 2PZSA 3VQ9A 2DXBA 4CHUA 1H9TA 5AQWA 1WZ2A 2VODA 3QYFA 1KYWA 2VONA 2DFUA 4EMGA 4U7DA 2ASMA 4Q4ZF 3O9SA 3EUHA 4FZZA 4CBXA 2OPPA 1BYMA 2ATCB 1N39A 4BDZA 4CHQA 3E3VA 1E6GA 2EWSA 1N33K 4DW6A 1JCFA 4BR5A 1V4SA 4ISEA 2H27A 3CUQC 2LP0A 3HSRA 3VS2A 3A1YA 3CCSI 3DRPA 3K7AJ 1U49A 3VN5A 4JK7A 3VEVA 2R7RA 1BOAA 3EYIA 4EMKA 5CVJA 3HOTA 3KKSA 4BR4A 3HGGA 4M75G 1QQNA 2KHMA 3QOPA 3FGUA 4FISA 3SZPA 3ZEHA 4EJVA 1JXOA 3L42A 4EZ6A 4UV9A 2LSOA 1VQMA 1QLYA 3K9TA 1AWCA 4I09A 1RT4A 4ZC3A 2I5UA 3PO4A 1W4SA 4EM1A 1N9SA 3DBHB 2A40A 3CCSN 1Y97A 4B9TA 4L6V5 3CQZJ 3E9LA 4AF1A 2A6TA 4DV0K 3JCMd 5FLVA 4AFSC 1USSA 2RI3A 3VF6A 1F1ZA 5E3NA 5AQZA 3HHHA 3FHGA 4C8LA 2G0EA 2DT6A 2QGGA 2KSSA 2H6BA 2AO9A 1LPLA 2DIQA 5AQTA 2FPFA 1MBJA 1ENHA 5KYUB 2PMUA 2E2IJ 4FYVB 5FDLA 4H4MA 2QSHX 3CPWS 2RQPA 1P92A 4UNOA 2K3XA 1SAUA 3NQOA 1O3QA 2EK5A 5AQKA 1L0OC 5HS8A 2OPRA 1WYXA 2R5YB 3H1VX 4DOVA 1LQ1A 1JTXA 1EXQA 2PJPA 2MFZA 2WOMA 4NO7A 1IV8A 4ABZA 1KZHA 1R5GA 1FMKA 4XR6A 2D1HA 3WVDB 2I2LA 3TMOA 2R7SA 5GAEJ 4DLEA 2OZ6A 3VYSB 3O8HA 4YELA 2IW5A 3HRSA 2X51A 4IEIA 1H1VA 3V1OA 3G71N 2LSNA 4BACA 3LL7A 2M4GA 4LSLA 5A2QK 3GEZA 2R93J 1ZRFA 1VQPN 4C8NA 3T7ZA 1RRSA 1RT2A 2BUPA 4M71A 1VSFA 4R5PA 5HK0A 3PFSA 3KEYA 3F8CA 1A0NB 2ZJ2A 4HSTA 3GF5A 1Z26A 3PL8A 4ELYC 3ZSRA 3P31A 3C7NB 3W3CA 4DR5K 2OZSA 2MLKA 4KDPA 1IF1A 1PKTA 1QVFM 3CCRQ 2K9MA 4K8XA 2OTLN 5HLHA 2VYPA 2ESNA 1ORPA 1BOTO 2HHUA 2BW3A 3I4PA 4NXNK 4JX6A 3LA7A 2YHAA 4EIKA 4IDKA 1X6GA 4KIFA 1P9QC 2W85A 1V3FA 5FLXK 3E5UA 3ZSZA 3WXKA 1XMKA 2O01E 1IBLK 4V19S 2FG0A 1RNLA 1W36C 1LUJB 3U9ZA 5GAOp 4Y92A 4KT6A 3P9CA 4M75C 3I55Q 2DM1A 1A36A 2RN8A 3VS6A 5GMKe 1M1EB 3CQXA 3GNFB 4BC2A 4E6RA 3OWTA 1WBBA 2EV6A 1YJNN 3CXCM 3D6RA 2K02A 1HW2A 4KH1B 1VQOA 3R3LA 1YIJN 2O03A 4G6TB 2KZZA 1XN7A 1W0TA 2M16A 4JJDA 1GBQA 4J6XA 3CC7N 3EHRA 3AVFA 4G7HF 4P96A 4F93B 2KKZA 1ETYA 2CGKA 5DS9A 1RLPC 1D8YA 3TO6A 2IVMA 3EGDA 1ZSZA 4AHUA 3S32A 2BVMA 5F1XA 4EJYA 1WHUA 3CWSA 4KYWA 4YFNF 1Q7YO 4IXCA 2F5DA 2V9PA 2YX4A 3OMGA 2QKMB 2FF4A 1NU0A 5CZ2A 1KG1A 2R7VA 4OWRB 5K7HA 3S93A 1H641 2FQ4A 4JDSA 1YI2T 4K0KK 1OQYA 1UWBA 1IZ6A 4A2BA 3DP7A 4JJCA 2DKGA 1J5YA 1UZCA 3W2VA 4J19A 5D4RA 2YLBA 4B9SA 3CCQT 3AVAA 1FYLA 4IIMA 1K8AU 1S9EA 4FQGA 4LDXA 1RBVA 2Y2ZA 3CCMI 2IAJA 3IUOA 2X4XA 1WJDA 5CLSA 3RESA 2KRSA 5HRPA 3ZLJA 1S5JA 4OINF 2DLLA 2GV9A 2KZGA 3HJFA 2K2VA 4JI1K 3MAJA 2VC8A 3T1HK 3CJQB 4ZDPA 3F70A 2W6LA 1N8RR 1BIBA 1VQ7I 2NRTA 4GGGA 1ZA2B 5BREA 1K4TA 4IKFA 2O8DA 2ASPA 1YVNA 2XIGA 2G6FX 1NGAA 1ZELA 2E5NA 4J9FA 2KTQA 4BR2A 1EA3A 5GIPA 1R5HA 2YU3A 4OB2B 2V7YA 1WKMA 1M1KC 4PFZA 2XY5A 4B9MA 1FW6A 3QERA 4U87A 5KQDA 2VQLA 3GIBA 1U6GA 1W7PD 2GXGA 5GINA 3ZSOA 4E89A 2HOAA 3IG1A 3QPHA 3VS0A 4BJTA 1IJJA 3PIOL 4GV6A 3VEYA 2O9LA 1ERDA 2M0MA 4Z4CA 1VSLA 4F17A 2E1NA 2PUKB 2HEOA 4LIVA 5FWCA 3NVMA 2Z33A 4E7ZA 3GYHX 3C6TA 2LX7A 5CE3A 5JHFA 1S72I 4J9GA 3E66A 4E9EA 1VI0A 3FJ5A 3HL2A 1IG7A 2YSQA 1FNNA 3CLQA 1ETOA 4BRAA 2OZMA 2GQIA 3V81A 4FWKA 1OYWA 5H6QA 3M0UA 5AT1B 2NVQJ 2BZTA 2AKKA 2PVGB 4A6EA 1LDKB 4B9XA 3G4ST 3KLOA 4P5OA 2O8BA 4XSZF 3CO7C 1ZTRA 3AO3A 5SWMA 2XU8A 1N8RO 4CEAA 4D9JA 1X6OA 2WAQN 4IRGA 1WXBA 3HPHA 4LF4K 2MGQA 5GAHJ 1EETA 4AIHA 1XMXA 1H88C 4JHDB 4XM3A 4FPBA 4KB0A 3JCMh 2MABA 1DU6A 3CM5A 2DRMA 2QWRA 1VQ8I 5JLFA 2P9PA 3KTQA 2F7TA 3MWMA 3H9JA 4BGBA 1STZA 3MN2A 3M55A 2HSTA 2E2OA 3I64A 5AQUA 2B5JA 3RMDA 4JK8A 1NWKA 3B8AX 3CDHA 4M6YA 4D8DA 4JKBA 4YPHA 3TO9A 3LP0A 3B6AA 3JB9F 1WDXA 4XL9A 2DILA 4BG9A 2P5GA 1LDJA 3HSBA 1CF7B 2K9SA 4AFUC 5AQPA 4JKDA 1QZYA 4K2EA 2FYKA 3CC4Q 2Q36A 4HUFA 1MBHA 4XK8E 2VYTA 2I0NA 3HP9A 1VQ8N 3NPFA 2A7YA 3SEMA 4IDHA 3FJPA 3VU3C 4AI4A 1QCFA 2L8DA 2NLXA 2OBPA 1VQKQ 2DA3A 2IPOB 4G6QA 3CMAI 3IP4B 2EFOA 4I6ZA 4DWIA 2DA1A 4GKJK 2EPFA 2E1MC 4A6DA 1HD3A 2E70A 3DRSA 4KT5C 1R0BG 1Z21A 3OS5A 3VQDA 2ZFWA 1G83A 4D8KA 5EEHA 2YG8A 2FSWA 3FZFA 2P1JA 3SEQA 3FMRA 1YI2A 4KGXB 1HKSA 1NE8A 2PY5A 3NVKA 1ARKA 2A37A 3IRRA 4YRVA 5LY3A 2L9SA 3CCQA 5AQFA 4M7DE 3FKJA 1I07A 1R23A 2R92J 3ISPA 1B34A 3X25B 4Z4GA 4PSXA 4GY5A 3NFAA 5C4XJ 1FJLA 5EZGA 4DBQA 4KIBA 1JGGA 2CGLA 4L5JA 2LG4A 2QTXA 3CMAN 3VB2A 2YXYA 1JT6A 4BXFA 2KGTA 3H5RA 2OTJQ 3FIWA 2RQWA 2IVNA 1AKHB 1EH6A 2UU9K 3AVIA 3TP3A 4P9FA 3CJ1A 1VYVA 1RAIB 2OCEA 2LFBA 4J7FA 3ZOBA 1D9DA 3N05A 1W5SA 1BL0A 3J7YJ 4U88A 4CZHA 2E6LA 4GW6A 2LCLA 5LJ3e 4B1UB 2FSNA 3WE3A 1QHHD 4EHUA 5GAMd 4HUGA 4XN3A 4EW4A 1NPRA 2JTMA 1NKUA 2BUDA 4N9HA 1K8KB 2K9LA 2OFIA 1Z6TA 5LJ3d 4CK2A 5ILUA 1XOVA 3KPHA 1LWEA 2X6SA 1XNQK 5BR8K 3R6SA 2ETHA 1D0ZA 2E36A 4D1QA 1C0UA 2P6TA 4Z8AA 2QENA 2C0TA 5H6RA 3C2HA 3BUZB 1FT9A 3FM5A 3ZT0A 1VQ5T 3THWA 1P7JA 1ZLKA 3QZ5B 3O8GA 2EPDA 3QPLA 1GCQC 3JRZA 3SAGA 4DTXA 3G4SA 4HOBA 1WOQA 3CCUN 1W5CC 1RACB 3SXYA 2OD5A 4IX7A 1WFXA 4H5WA 5J2PA 5BRFA 2DU9A 4H03B 1NYGA 2HMPA 2GXAA 2L7MP 4RKUE 4TSXA 1A31A 2XGDA 4PJ0C 3CCJN 3BR6A 3Q3SA 4FM2A 2R7YA 4CJQA 7AT1B 1OCZH 2IS1A 5CKBA 2P9NB 3LSGA 5GAEP 2RHYA 2QXFA 1N25A 4R56A 4ILGB 2P51A 1H92A 1NGHA 3CCST 3QEVA 3L2RA 3JRGA 1OFCX 3DI6A 4LIUA 5GAGJ 4IOXA 3JAMK 2V8JA 1C6VA 3CHWA 4AG2C 2P7VB 3Q1JA 1W2BS 1Z67A 2J06A 2WC2A 3NWTA 2STTA 4NB5A 3CJTB 2Y0SA 3AVGA 3A98A 3L2VA 4M3ZA 5LLQA 4CZIA 2NOIA 3HZJA 4I0BA 4BAYA 2F69A 3BF1A 1L3SA 3OR2C 3AL0B 2C0IA 2WBNA 1VQ9Q 3RR7A 2G8IA 3WTXC 5DDGA 3I8DA 4ZGJB 1LWFA 1IUYA 4HWIA 3IAYA 1WLPB 3E9OA 1FBSA 3BR0A 1J54A 2EIJH 2HFHA 3RUXA 3I55I 1QZEA 4FVMA 1M4ZA 3KLFA 1NGDA 2CQXA 1BDGA 2VG6A 1B9NA 1SVOA 4ZZDA 3RMSA 3I9V2 4PKCC 3CCRN 1MH3A 3MFKA 1WGXA 1QPMA 4ISFA 3HM9A 2HD0A 4FJIA 3HG9A 4HVJA 2F4IA 1UAXA 1MDMA 2LJ3A 3SUPA 3UB5A 5C0YA 2K5CA 3ZN0A 3MCZA 3ZSVA 5GMKl 4Z89A 4YOXA 4FO0A 4B9VA 2P9UB 5EEAA 3K4MA 4X62K 3OL4A 2LOOA 4LH5A 2A07F 1QCOA 1VQPT 3ZETA 3GBGA 3B6OA 3LL3A 2KRFA 1WN7A 5GAOq 1L3LA 3RPQA 3I55N 3D1NI 1XX5A 2BHYA 1B8IB 5D6WA 1VF9A 4CCJA 1Z3XA 2RF2A 2G8FA 3QNNA 4BG8A 4B1YB 2OTLT 3BCBA 3AG3H 1UGVA 1D4XA 3VEXA 1Q7YC 2BKDN 3G10A 4M7AG 3N4QA 2QBYB 1Q95G 2EJ9A 1TL3A 1G3TA 3JB9J 4WF2A 2KJCA 2LF8A 2NOJB 4MDAA 1DIZA 4CFAA 2R7WA 2B86A 1REPC 1LNWA 3OYEA 3VF4A 3D5RC 4QS9A 5LGTA 2KLAA 2MC3A 1IJWC 1FWZA 4C23A 2NS8A 4PWDA 4FOIA 5F6FA 1R4MB 3PGGA 1V55H 4Z0UA 1YJNT 1FOXA 5KRTA 3N4PA 4D0PA 2Q2RA 1LMZA 4Z94A 5LRSA 2KE9A 3M6GA 3J81K 2RHIA 2O8FA 3VWBA 1UA0A 2RDPA 1WCMJ 2VBZA 1JXEA 3W6KB 5BQTA 5DUIA 2DL5A 2H1KA 3GO5A 4EGYA 1BW6A 2K4JA 3CC7T 2EQUA 1TT5B 2L5QA 4IOAL 1PUFA 4RBOA 2DX1A 2EZLA 4HCBA 2PBIA 1EJ9A 4CGDA 1YHQQ 3VQ7A 1H8KA 2M7BA 3EE9A 5LJ5f 4F7UB 3ZSXA 3JSOA 4F3TA 1K9MU 1O3SA 4QVZA 5M3FJ 4CC4B 3FRNA 2V9VA 4KT0E 2HSPA 2DL4A 3QYHB 1QE1A 3JRCA 1IBKK 3LQQA 4QT7A 3IC7A 2KFNA 2OQGA 3K5NA 2OQRA 1U1SA 4XH1A 2VKVA 3JTHA 1PRMC 2XHCA 1SQKA 4FK4A 3CMEI 3ATVA 2PX9A 3TWHA 5KYXA 4KN4X 3S9HA 2NUPA 3BE3A 4EFHA 4CEDA 2HVSA 2HZTA 3G1LA 4B9NA 3N5NX 3H5NA 3DBRB 3D7SB 3CCSA 3K70C 1W7PB 4IFYA 3TTFA 2VJ5A 2KRNA 1BWFO 4ILJA 4CUGA 1YRNB 2ZSHB 3X26B 1E3MA 5BS6A 1E3PA 1I1SA 5EX5A 3EQLF 3H45C 2MYSA 2D9TA 3LDLA 1D5YA 4EJTA 4ZGEB 3FHZA 1W4MA 1PDNC 3WTUC 1N75A 1YFHA 1N8RC 4M77G 4GLMA 3MJXA 3KE2A 5GAMh 1ETWA 2DPUA 2QWQA 4PJOG 1ORKA 1RUOA 3NH0A 1WQ2A 3OIPA 2P0WA 4B47A 3WXIA 1W7AA 5EXWA 4LFAK 4HW0A 3ML6A 2HHXA 4X6AJ 3CCMT 3G3ZA 2IGIA 1D3YA 5LJ3h 1JLCA 3W6JB 2PJRB 4N4IA 5CHIA 5AQQA 2LY2A 3H36A 2ECZA 2DFIA 4M7AC 1GBRA 1KTQA 1ZG1A 2E6ZA 3EN9A 5IAYA 2X9DA 4FX4A 4ELTA 1RUWA 1S1VA 2KZMA 5HDNA 4FSSA 1VQ7T 3QFUA 2I5WA 2EBPA 1V5FA 2VBXA 4M77A 5HLFA 3G71A 2IBDA 3U21A 4M41A 4NYFA 1YW7A 2WB1A 1VQPA 3J7AF 1WQWA 4J9BA 5EG0A 1NM7A 4PJOA 1ZQ1A 2O31A 1JL2A 1VAZA 4B24A 1R5ID 2DI3A 3OYNA 2GUIA 2CUFA 3PNTA 1VQKI 1FY7A 2O4XB 3THXA 4YFXF 2X1EA 4O55A 3S16J 4H0EA 4B9UA 5I11A 4F04B 1KEAA 4E6KG 2OTLA 2A28A 4XTUA 3GBQA 5TRDA 3CERA 3JB9I 1EQYA 5JLWA 2XAQA 3FISA 3GMEA 4L18B 3P4IA 1W0HA 4RW9A 2Z1JA 1QZ5A 2W03A 3JRHA 1G3YA 3CC4N 1PP8F 2Y69H 3OBWA 3CESA 2HPIA 2J6FA 1S72T 4I9QA 1XGOA 1WPYA 1JJ2S 1YJ9Q 3SFMA 1VQKN 2QQ8A 1M3QA 3C65A 1XUPO 4ZN1A 3K2PA 2ZO4A 5K5RA 4HUEA 2P5VA 5IT9O 5JMVA 4CGFA 3VFZA 3V9SA 3HRMA 5FFZA 5DMRA 1BK2A 1X3MA 1J53A 1YJNA 1JCGA 2OTJI 5DM7L 4M7DD 5J47A 2JVHA 4KO0A 2M2EA 2Y1IA 3WHCA 1JXMA 3O08A 1ZYRF 1TK8A 2EFQA 4LK0F 1J9IA 3EL2A 4GRIA 2GAUA 2BOLA 4JX4A 2EQIA 2M9UA 3VEZA 3WGGA 3KWIA 3CC7A 5CIUA 1VQ8T 1U5TC 2IVWA 1X9WA 3BW1A 5F0CA 2BANA 3PJRA 5CKEA 5E8GA 4PKGA 2BHZA 3JCMb 2GA1A 4N0AA 3SBGA 4IG0A 2IIMA 1JGSA 3KP2A 4DFKA 1R36A 4M78D 4OMNA 3TQNA 3OYFA 3KZZA 1KG4A 1UTIA 3U9GA 2LTPA 4DBHA 1WPKA 2KIFA 1QSSA 3QBYA 4M75E 4DFJA 1SD5A 4OJRA 3C3WA 2HDCA 3JRDA 1M1FA 3ABMH 4PUSA 5C15A 1ZR2A 1GLAG 3CWTA 3NF9A 3B02A 2FPDA 2P81A 1HJDA 3M8PA 2CH4W 1S6LA 3CBPA 1FIAA 3CMAT 5FLMJ 1U8BA 2HKOA 1KJWA 2WSEE 4GV3A 4DLGA 3H9NA 3DYAA 3JCMX 1B7TA 1T44A 2EJGA 4CF8A 2R5AA 4I6MA 1PVSA 1Z3YA 3I5RA 5ERIA 4ID1A 2ZBKA 3C7JA 2DYSH 3MPUB 2Z16A 4RAZA 4XONA 3L2CA 1UE9A 2RVCA 2HVQA 3LPTA 1T3VA 3CI5A 5CKFA 2K4YA 4WXDA 2DA5A 1I1JA 1IH7A 5KTQA 3RMAA 2QWLA 2E2PA 5BR9A 2A69F 1NK2P 2VJJA 4JRQA 3EFRA 2PAVA 3JRIA 1EP4A 5ILVA 2HYGD 2RH2A 4HQEA 2QKBA 2LNHB 1XG7A 1VQ7A 1PSEA 4Z4HA 1XI1A 3GW2A 3VPRA 3LDPA 3QQAA 4FLWA 1ZUUA 3ZRGA 3RYRA 3UKGA 1TL1A 2OA8A 4A3MJ 1VQ9I 1NK7A 5DV5A 4C92G 1K9AA 3AVMA 3QEPA 2O6GE 1Q9YA 2P4WA 3KD5E 1KU2A 4GMJB 4KMUX 2K5FA 4L9NA 1T8IA 3MX5A 4M3WA 3TSQA 4ATOA 3CCUT 3F8BA 4IOAF 2MSYA 3VA0A 3IV5A 1I3QJ 2WAQA 5KCOA 3I56I 1RT3A 2OPSA 2Y90A 3BQZA 4W97A 2XC7A 3C1DA 1M3CA 1S72A 2EHGA 1D09B 4A5BA 3X24B 4C92A 3RPUA 1SKUB 2XD0A 3IRQA 3EFOB 2BTFA 1BIAA 3ZQQA 1WH7A 4MQ3A 1GLEG 4DR2K 2KIMA 2PUOB 1R1UA 2HXIA 4S0HB 4LY7A 4AM3A 2HNYA 5HLGA 4JRKA 4B22A 3OSFA 1UGQB 3JSMA 4LB6B 4N9IA 3LLRA 2JT4A 1ZUKA 1IXCA 3M56A 3JCMJ 2DE0X 3VSLA 1IO2A 1K8AR 1ZBSA 1IZ1A 1AOYA 1XC5A 2DBKA 4EP5A 2ZGWA 4ISGA 5E26A 2HBJA 1VQ8A 4VUBA 4BEHB 2LZ6B 2M51A 3DKMA 1FLIA 1T0FA 4C8QF 3TTCA 1R6RA 2IIRA 1KLMA 3M9AA 4EV0A 2EFIA 1VQNQ 4O6JA 2ROTA 5GAMj 4A2UA 3CCRT 4J7IA 3PV8A 3NMZC 2DJIA 4XLCA 1G5VA 2E2NA 2QGUA 3QP6A 5EGOB 5FPDA 5HS7A 1H89C 4EAHD 5KYWA 3BPXA 3CF5L 3RQ4A 5LJ3j 4H0XB 5J8FA 2NNWA 2FJ1A 3BTIA 2VQGA 1A5WA 1A35A 3MN9A 1P6RA 1YHQI 3CMAA 2CP7A 4BDYA 1NGGA 3I55T 5BN8A 2ZGYA 3MN7A 3IWZA 2WC9A 3Q7BA 1P4XA 4H0TB 1CZAN 5E1WA 3PTAA 1YIOA 4CO8A 3QWLA 4G94A 2DPDA 5LJ5d 1I0CA 2JS2A 5DD4A 3BDPA 4CC2A 3S3MA 2RK1A 4DNCA 1Q82R 3U4LA 3KK2A 4GKKK 2Q2EA 4OFHA 2MC4A 4HAMA 4RTXA 4JKAA 4G6DA 4NL3A 1YHQN 2LD5A 1VQOQ 1LCKA 3H1CA 2ID6A 2MMPA 1R8OB 2E5KA 3IUCA 3AT1B 4CF9A 4B3RK 1FYMA 5ICCA 4XBFA 4PJNA 3BOQA 2VT2A 3VQ5A 3BCAA 3UNGC 3LP1A 1M3AA 1KAXA 3LH0A 1X01A 5AQGA 2WV1A 3TP0A 3BQYA 5KN9A 2VQEK 3L8BA 2PG4A 3I58A 3QDRB 4KTZA 4I98B 2A41A 5DM7F 1JU5C 2EBIA 3WGHA 1POGA 5KH6A 3WXJA 5CQGA 3OHRA 1RDCA 1CXUA 1NOYA 1KD1R 4EVIA 1LKXA 3HPGA 2A3LA 1KC8U 4CEBA 4DSIA 1X1AA 3AAFA 4NC6A 1NK9A 3FR0A 4FIBA 2DO3A 3A2FA 1XGNA 1T3SA 2GWKA 4FT8A 3CCUA 2CFXA 4B1WB 2CH4A 3MMVA 1Z0XA 4DUZK 1T95A 2VBWA 1C0TA 4FW2A 1GOAA 1GOBA 2CRGA 3MWTA 2FBXA 3K58A 4C5GA 9ANTA 3H3UA 2RAEA 3FBNB 2IJLA 2DLPA 4DTUA 4BDPA 1Q82O 3CD6N 3NGPA 3O3GA 1RL2A 2DOFA 1G4DA 4FOEA 2XMFA 3GUDA 4EHTA 1T08B 1AT1B 4BRKA 3S8PA 3VQ8A 1TWCJ 4CD3A 1BR4A 2XKOA 3VPZA 3ZMUA 2QA4Q 5SZTA 3V4GA 2DA2A 4E70A 1I6HJ 3TDUC 4DQPA 2ITMA 2PFBA 1P8ZA 1EO1A 3GWZA 2LYCA 3ZQCA 4JBAA 1Y0UA 1ODDA 4GDFA 1AZEA 4BR7A 2WTUA 5KN8A 4HLYA 1T6DA 4CJFA 2JA8J 1YFNA 4WXHA 1IO6A 1KA8A 3O5BA 3CVSA 2A6EF 3SYTA 1YE9A 3HUGB 2E65A 3COAC 1YJ9I 2Q1NA 3PO3J 2Y9YA 3HB9A 3J80K 5FKKA 1KD1O 3T5XA 3PX6A 1X2NA 3A8HB 3BG9A 2RPNA 4X9CA 4QLCU 3KCCA 2O9SA 4B3MK 4BB7A 4LITA 2BE9B 3CCRA 2KIUA 3FWEA 4CYCB 2FXUA 4FSXA 1PCXA 3A01B 1XTDA 4DJAA 2QEXQ 5D8LB 3VOVA 1YX5A 3F22A 3DLAA 1J3TA 1FTTA 3GDQA 3ULEA 1N3CA 2DD4A 4CCMA 3VS5A 2R5YA 4OMQA 1YJ9N 2HNHA 2YKNA 5E17F 2AQFA 4RGSA 2UUBK 3V8JA 2QYZA 4M7DB 3I55A 2G9WA 2DK5A 2OYQA 4A54A 3IS9A 3KIOA 2L01A 2ZE2A 1CZBA 2O8CB 2BBYA 3D2EA 2DQRA 1RR7A 4JI4K 4C8KA 3TSPA 3L2WA 3UA6A 1BIUA 3OY9A 2XF5A 3J81Z 3FXLA 2ZJPL 2ZD1A 5J1UA 2Q0RA 3DU5A 3F0CA 1WX6A 3Q0WA 1MBGA 3ZQFA 2CSOA 4M42A 1GV5A 3CC4T 3R9PA 4LK1F 3DQVC 3SFIA 1PU6A 3HYFA 4OVAA 3OBYA 3PT9A 2X4WA 5EG2A 4FYYB 2P9SB 4RAYA 3GTQJ 5KPTA 4HCKA 4UVCA 4Y4RA 4O5FA 4DSEA 1VQKT 4M78B 2OC6A 4LD9K 4M75D 1P2FA 1FOWA 2DPNA 3HPOA 2V6CA 2LQ8A 2GIVA 4BXXJ 4QCLA 2F5CA 2ATQA 2NUTB 5D5WB 2VPRA 1SRMA 2KHOA 2BE7D 3M1FA 1XWLA 2K7AA 4IF4A 4DTRA 1WHKA 4HVUA 3DXKB 3K1NA 5AQSA 1QCNA 4U0VA 4WK8F 5ICGA 2KT1A 3GTGJ 3U1DA 4Z4IA 1RLQC 2RHXA 2BE5F 3E9FA 3EKSA 2DT7B 5CKHA 2HCKA 2DVJA 2CT4A 1F1BB 6AT1B 3C95A 1E4FT 1RGIA 2FF6A 3GFLA 1REVA 1LDDA 3CCQQ 4J9HA 3OOPA 3VS1A 2OTJT 2JTFA 2JUCA 2FD5A 3O3FA 3JREA 2RMOA 4BU2A 2G8VA 1X1BA 2ACJA 2IEKA 2GBQA 1RT7A 4CJEA 5EDNA 2DMTA 4ESBA 3KZYA 3DTIA 1U2VA 2P6SA 1VSHA 4KFBA 4A3GJ 3THYB 4KULA 1WJBA 4FT4A 2ABKA 2Z3YA 3J7ZO 3F0ZA 4CCLA 2CQKA 2MPXC 2CUBA 5J4VA 1Z6RA 3LZJA 1NK0A 2XPVA 5TJJA 5LJ5h 5D6FA 3RTRA 4JZ3A 3MDQA 2I10A 2RQVA 1YN8A 4RM3A 3TREA 1QP2A 1Z7UA 5IWAK 3WTZA 5J40A 5B5EC 2NRXA 3W0LA 2E4HA 1EWRA 1ZA1B 1MUNA 3ZSYA 1OEBA 1I5ZA 3FFKB 3LCNA 4XKWA 3PNWC 2EYQA 1P4WA 5GANf 2FPEA 3BR2A 1HSQA 1QVGP