3L2QA

Crystal structure of the prototype foamy virus (pfv) intasome in apo form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
365
structure length
365
Chain Sequence
b'AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 97
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2qA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2qA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2qA03
3IG1A 4DSKA 4KKOA 1LW2A 1VSEA 3VQAA 3HPGA 4BDYA 1S1UA 4ELVA 4CCHA 2RKIA 1NJZA 1CZBA 4FZZA 4M3YA 3I0RA 1N6QA 4GMJB 1TK5A 4B9WA 3V9XA 1TKXA 4H4OA 5C6SA 1BQNA 1C1AA 5CYMA 3MP8A 4OLAA 3ZCMA 3LP1A 2X4XA 1S6PA 1HQUA 3U6FA 2JGUA 4EP5A 3UIQA 3AO5A 4DTMA 1HNVA 3DLMA 3AO3A 2VYTA 2OA8A 2HMIA 4B9LA 1ZBUA 2QQRA 3OYFA 1U04A 1TL1A 3DB4A 1L3VA 1S1XA 2XK0A 3MECA 2O4XB 4CGDA 1VSJA 2X78A 3WNHA 3SUPA 4FU6A 1H3ZA 1N27A 5KE2A 2R5AA 2DAQA 2BUDA 4E7JA 4DMNA 4Z0UA 4HUGA 3ITHA 5HRRA 1WAFA 4L8RB 2KZZA 4ZHRA 3MEGA 4CF8A 4IUVA 2E6MA 4BACA 1TKTA 2ETJA 3DMJA 3NGZA 3VQ7A 3VQPA 1BIUA 1NOYA 4M3UA 2O4GA 3ZSZA 1KFSA 1QQCA 3L2QA 1WAJA 4ELTA 1J5OA 4QW2A 4FVMA 3S9HA 4W5QA 1TK8A 4HUFA 2RJDA 1FKPA 1VK0A 2Z1IA 5KE3A 3HPOA 1WSHA 4FZYA 4RW8A 4KV8A 4CF1A 1ZBFA 1NJWA 3E01A 4H4MA 3L2WA 4AHTA 3MP1A 3V9SA 1S9EA 1JLBA 1X9WA 1VSDA 3WNFA 1T05A 5IAYA 5CIUA 3VQ9A 1NK6A 3G0ZA 4IURA 4B08A 2NUBA 3DLBA 3H8ZA 2IC3A 1QTMA 3DOKA 3ZT4A 4Z4FA 3DYAA 2XY6A 3ZSOA 4KB1A 1YT3A 4J2AA 2RI5A 2FBYA 2HNZA 4CGIA 2OYQA 4FLZA 3FC3A 4B9XA 4DSLA 4DFKA 5JS1A 4OKEA 3WNGA 4EP4A 1W9HA 1JL1A 3L2UA 4W5TA 4A4EA 3TR8A 2EQMA 4EDUA 5D3GA 5J2MA 1WSIA 3WNEA 1IKVA 1L5UA 5J2NA 2FBVA 4ELUA 1G15A 3L8BA 3PY8A 4CRIA 3AVJA 3P1GA 3T3FA 1RT2A 2LCCA 4FCYA 1DTTA 3MEAA 2HHXA 1D5AA 2HVHA 4CJPA 4CJUA 2G8FA 4IUPA 4IFVA 1SL0A 4FK0A 1QSYA 4HUEA 4OGCA 4YNQA 5KGWA 1KVBA 1N5YA 2YHBA 3ZSQA 1ASUA 3MEDA 3HVRA 2G3RA 1S1TA 1EP4A 3KKSA 4DFMA 4CFBA 4DQRA 3V1RA 5HP1A 1ASVA 2D5RA 2PQWA 4DU4A 4LSLA 3VQBA 2HHVA 2PZSA 1BIZA 1IO2A 4CHZA 1S1WA 1VRTA 3CM5A 3TANA 4KHUA 1XNIA 3TAMA 5KRTA 3OYNA 1BI4A 1SSFA 4HCZA 3DLHA 3DRRA 3LP0A 1X9MA 4HHTA 1OZ3A 2ZE2A 3ISNC 4B9TA 5CYQA 2XHBA 4CJVA 4FL6A 2LTOA 3OA6A 1HYSA 3PFSA 4NZGA 4F4KA 1JLCA 1OI1A 4QQGA 1EKEA 3TWHA 3NTHA 2LSNA 4OVAA 3EY1A 3QJ6A 3QEXA 4IUUA 3HJFA 3CG7A 4DU3A 3LLRA 3ASMA 5HRSA 3QEWA 4CEDA 4OJRA 2O4IA 4CJLA 1DTQA 4FW1A 4I9QA 4AILC 4B9MA 4K8ZA 3ULDA 4I2QA 4FLYA 3LP3A 3MO8A 1A5WA 3TAEA 3OYAA 3M8SA 4BWJA 4DF8A 1RTJA 1NK0A 2R57A 4CJ5A 3SYZA 4JRPA 1XWLA 1WN7A 3HL8A 2MWPA 4C8MA 3AA5X 1RDCA 2Z1JA 4CF9A 3O3HA 1VSIA 2KFZA 1Q9YA 1IKWA 5IN1A 1TK0A 4C5HA 4EZ6A 5KCHA 2HHWA 3M8RA 3VQDA 3KLGA 1U47A 5KH6A 5HBMA 2E4LA 2X6SA 1CXUA 3RRGA 3OJUA 1TKDA 3OYBA 3VQ5A 5CY4A 4E7KA 3HXMA 3O4NA 4DTJA 4RW4A 2VWJA 1O1WA 2RJFA 1QSLA 4KI4A 1SKSA 3F73A 3LGLA 3QLHA 2MWOA 5KGXA 2RI2A 1BI4B 4L59A 3SNNA 1S5JA 3VQEA 1TL3A 3SPZA 3VQ6A 4F8RA 4FJ8A 2F96A 3O3GA 3QKJA 3MEUA 3CM6A 3KJVA 3UWNA 4BD3A 2IS3A 3AA2A 2X74A 4CIFA 3EAEA 2P5OA 3IS9A 1NK5A 4I2PA 3GOXA 3QIOA 3F70A 1SKWA 2WACA 2JTFA 2JLEA 4CK3A 1QSSA 3QIPA 4O5BA 2RHUA 3BDPA 4C5EA 4BE1A 1RILA 3UT1A 3CEYA 4JRQA 4DSFA 3M8PA 5JS2A 1MU2A 3NNQA 4DTSA 5EU7A 4IKFA 3H08A 4FJMA 4FK2A 3QESA 2KZMA 4IBNA 2L8DA 3MXIA 5CZ1A 4BDPA 4CESA 3QIIA 2BKDN 2P51A 3HO1A 3OYHA 1RBSA 1SL2A 2ZQBA 1RTDA 1NK4A 4Z4IA 4CGFA 3L2VA 1JLAA 3TAPA 2W42A 4CEBA 4NCAA 1RDBA 4FM1A 2EQJA 3TAFA 1TVRA 1L3SA 3SD4A 2K3YA 3MXJA 2B8AA 3OS2A 3QO9A 4HTUA 4E19A 1RT5A 4KHYA 3LX7A 4FLTA 4A4HA 4JS4A 1ZBHA 3H6ZA 3KTQA 3LALA 1YTAA 5DMRA 1SL1A 4CFAA 3MEWA 1A5VA 3A2FA 4B9NA 4DS5A 4N76A 3SQ4A 1S6QA 2IOCA 3CFRA 1HJRA 2IAJA 4OLBA 2PYLA 1CLQA 4QVZA 1KTQA 3K5LA 4FLWA 4FJNA 1SKRA 1I3AA 2DIQA 5FRMA 4W5RA 2G8UA 4B3OA 3RMDA 1HNIA 1ZBLA 2IGIA 3K59A 3LDSA 1JXBA 1VSLA 3QERA 1XI1A 1BCMA 4OPKA 1LV5A 2G8KA 4C8KA 1L3UA 1NK8A 3O4QA 3SJJA 3K5OA 4I7FA 2E5QA 2LVMA 5SWMA 4DSIA 1C0MA 4QQ6A 4OKJA 3OYMA 3S3OA 3RMCA 3AVGA 4UQGA 1JLEA 3D45A 4KPYA 2FC0A 1HYZA 2Y1IA 4DU1A 4DG1A 3VN5A 3D0PA 4TSXA 3RMBA 3TI0A 1VSFA 5FDLA 1DLOA 1UWBA 4CFCA 1XHXA 2HHSA 3U3GA 5D6XA 2XO7A 1EXQA 3NHGA 3LWLA 3TAGA 4OVLA 1RTIA 4LD0A 4N4IA 1U4BA 3OYEA 3SUQA 4NCBA 3KD5E 1J9AA 5HROA 1VSHA 4ZTJA 1RNHA 1WNSA 1S1VA 2RJEA 4O55A 3IRXA 1UA1A 3V81A 2DFHA 1U48A 2BIVA 2VG6A 5J2QA 1RBTA 4CECA 4CJKA 2PYJA 1QHTA 3HK2A 3ZT1A 4CFDA 3SUNA 1NOZA 5C24A 4NYFA 4KHNA 3OQ5A 2GFUA 1ZBIA 4B9UA 4GVMA 1D9FA 4BE0A 2LDMA 4DQQA 3PO4A 2RO0A 3V1QA 4FW2A 1CXQA 3LANA 4AHRA 3NDKA 3C4SA 3TAQA 2HB5A 2YHAA 4DLGA 4ICLA 5FROA 1B92A 2CKKA 2D0CA 2WONA 2D0AA 4I9LA 2HVIA 4ID5A 4B8CA 2ITGA 1JL2A 3QNNA 2EX3A 3C95A 3NTKA 5SZTA 3KLHA 4DLEA 1B9DA 3VA0A 1D9DA 4KI6A 5M9OA 3C6UA 3Q1JA 4AHSA 3OYKA 3SQ0A 1YTUA 3NE6A 4CEEA 3DI6A 3MXMA 4DWIA 4CGJA 1I39A 4DTXA 3RWUA 1KHCA 2X4WA 3LPUA 3ZSYA 2RI3A 4FJHA 1L3TA 3ZSVA 1RT7A 1X1PA 3AA3A 1NJXA 4XIUA 4RW6A 2RHYA 2HQXA 1BISA 4RG8A 2RHIA 3LAMA 4KTQA 1HMVA 3CFPA 4CHQA 1JLFA 4CHOA 1U49A 1BHLA 2VG7A 2HHTA 2ATQA 4W5OA 1HPZA 3ZT0A 1LAWA 1WGSA 3K58A 5C42A 1RBUA 2QQSA 2B6AA 3P83D 3L3UA 3ME9A 4UC4A 4Z4HA 1UA0A 3PX0A 3CQ8A 1SV5A 1BL3A 1EX4A 4FYDA 4LSNA 3RTVA 4Q5WA 3OYJA 3CFOA 1KVAA 5I42A 4O4GA 1TAQA 5J39A 5CZ2A 1J53A 1NJYA 4CEQA 3NFAA 1SUQA 4HVJA 1TKZA 1RCHA 2XY5A 4C8LA 3LZJA 3AVLA 4Y1DA 3AO1A 3AVAA 3OYCA 1D8YA 1ITGA 1FKOA 4NYNA 2RHZA 1XC9A 3SUOA 4Q5VA 3QNOA 4CK1A 2M1HA 4E7HA 2YRVA 1WLJA 1HQEA 1HYVA 1KVCA 3OS0A 1FXXA 3V1OA 4CJWA 4B9SA 4C8OA 3P5JA 5HRNA 3U3YA 4M3TA 2X4YA 1IKXA 4KFBA 4RW7A 3ZSRA 1Z25A 1X9SA 3NH2A 4PWDA 3TARA 4LH5A 4M3ZA 4CHPA 3OYGA 2BDPA 3NGYA 2WOMA 2VWKA 1XHZA 4KRFA 4E7IA 1C0UA 3PX4A 4CJ4A 4F3OA 1GOBA 1RDAA 1LWFA 4FJKA 4DFPA 1YVUA 1C6VA 2YKMA 4OKKA 4OGEA 3LWMA 2K3XA 2X35A 3NF8A 3DLEA 4JLHA 4BE2A 3OB9A 4J2BA 3LAKA 4CGGA 1A5XA 4A4GA 4DQIA 3QETA 4CJEA 3LZIA 1ASWA 3PV8A 3KKRA 3SPYA 3SZ2A 1WJRA 4IG3A 4CGHA 4FLUA 4CE9A 3ZT2A 2EQUA 1VSKA 4KTZA 1CZ9A 2YNIA 2QKKA 4LD6A 4RG2A 2DTUA 4DTUA 2X6NA 3JYTA 4EZ9A 4CJQA 5HLFA 2DIGA 3AVKA 4MFBA 4PY5A 1RBVA 3NF7A 3VA3A 1KSPA 2Z1GA 1BGXT 3AVFA 4CJFA 2P5GA 3HVTA 4KB0A 4W5NA 2B5JA 3M8QA 5J1EA 4X34A 4II1A 4C5GA 5K14A 3I0SA 4QQDA 2OPRA 2XDPA 3RR8A 1VRUA 2D9TA 2I5JA 3SCXA 4C5IA 2DY4A 3BGRA 4Z4EA 1UAXA 3G10A 3NCIA 4GY5A 4M3RA 2E6LA 4IDKA 3AA4A 2GUIA 5HRPA 2KFNA 1RT4A 2G8IA 3DLRA 1OZ2A 1C1CA 2HHUA 4YFUA 1FK9A 3KD1E 4N56A 3IAYA 4FZXC 4DTNA 3AVCA 3AVBA 3ZEHA 2FHDA 3NH0A 4PA1A 4PL6A 3BDLA 3SQ2A 4DQPA 3ZSXA 1W0HA 3KLIA 3VQ4A 2EHGA 2OPQA 1LAVA 4AH9A 3HT3A 2IDOA 3FFIA 4E1MA 1JLQA 5KCOA 4CJRA 2KQ2A 3MP6A 4QAGA 3LP2A 5KI6A 2M16A 1KLMA 1GOAA 4O0JA 2XY7A 4N47A 5T7BA 3K5MA 1BCOA 3F9KA 4DTOA 2BGGA 2G8WA 1TAUA 1Z26A 2P1JA 1Q9XA 2L89A 2YNFA 1BQMA 2R58A 2YV0X 4KHWA 3SV4A 2BE2A 4M42A 4E7LA 3OYDA 3SQ1A 2GV9A 1Y97A 2YNGA 1ZYQA 3AVNA 4CJ3A 3VQCA 1NK9A 3NBPA 4HCCA 3DOLA 1JKHA 4CJTA 3LH0A 5KRSA 4FJLA 1RBRA 4KHSA 3TABA 2EQKA 2EFIA 4FLXA 1NK7A 3B6OA 4Y1CA 3P8DA 4IFYA 3HSTB 4FJJA 4ID1A 4FJ7A 4M3WA 2PY5A 2OZMA 3JSMA 2QKBA 4G1QA 5KTQA 3AVIA 4CEZA 4BWMA 4KREA 4O44A 1NKEA 3MEEA 4QOZB 4IUQA 3EZ5A 2F5KA 2M0OA 4E3SA 3KIOA 2ZD1A 4DFJA 3O3FA 2QXFA 3QBYA 4MQ3A 5J26A 2D0BA 1WJQA 4NCGA 3AO2A 1TV6A 3OMCA 2HQEA 3DM2A 1RTHA 3E9FA 2YKNA 3META 4CIEA 1JLGA 1WSGA 4KHQA 1KLNA 2JZ2A 4RW9A 4CK2A 1S9GA 1VSMA 1HRHA 5I3UA 3PMIA 4HCBA 2XRIA 2IG0A 1REVA 5FRNA 2R7YA 3S3NA 2F8SA 3HP6A 3FEOA 3OYLA 1B9FA 1GOCA 3V9WA 3HPHA 3KK2A 4FJGA 3OS1A 3T19A 2Y1JA 1IH7A 3NF9A 1C1BA 3V9UA 4Z4CA 4M3XA 4CEAA 1KCFA 4O0IA 2G8VA 2KTQA 2RHXA 3RMAA 2XY8A 2QK9A 3K57A 2GBZA 3KK3A 3V6DA 2E6NA 3PO5A 4KO0A 3QEPA 4FK4A 4FXDA 3SV3A 3PUFA 1R0AA 4R5PA 4PLIA 5C25A 3AO4A 4M41A 4Q0BA 3C94A 3VQ8A 1QE1A 4Z4GA 3ZT3A 2AJQA 3E9GA 1T7PA 3T1AA 2OPPA 4CHNA 3HM9A 1UOCA 4IUTA 3NGIA 3KUFA 4JS5A 3KLFA 3ALYA 2P0KA 4A4FA 2RJCA 3AVMA 2RN2A 2HW3A 4C8NA 4CF0A 4LH4A 3LPTA 5D6WA 3CYMA 4PUOA 3AV9A 4J2DA 3LGFA 4NS5A 4Z02A 1RDDA 4J2EA 5J2PA 4CF2A 4CIGA 4KAZA 4DTRA 1QS4A 4B8AB 3OMGA 4AHCA 4N4GA 1U45A 4FJ9A 1MHNA 3PX6A 4AHUA 2FBTA 2Q3SA 1OYXA 4N5SA 4F2SA 3PMTA 3ASKA 3NH1A 2VG5A 3L2RA 3MEVA 2DFFA 4DSEA 2DFEA 1G5VA 4K8XA 3PNWC 5D6YA 3K2PA 2R5MA 4FJ5A 1LWCA 3V9ZA 3KK1A 3NAEA 3SI6A 1KRPA 3DRPA 3AVHA 3NF6A 2EKOA 4FLVA 2Z1HA 4WE1A 4E0DA 1EETA 3OY9A 3DB3A 3DRSA 1JXEA 3FDRA 2L3RA 2RPIA 4DF4A 2HHQA 2FBXA 2NLUA 1WJSA 3QEVA 1RT3A 2OZSA 3OVNA 3V4IA 4FJXA 3RRHA 3L3VA 2HNDA 4DSJA 4ZTFA 3NTIA 4QCLA 3EYZA 3M9QA 1T8EA 4CHYA 2A1RA 4CERA 1LW0A 1F21A 4PQUA 3S3MA 2BANA 4DS4A 3KLEA 5DK5A 1KFDA 4IG0A 2LRQA 3VQQA 1LWEA 2RF2A 4KTWA 2O4XA 3DLKA 2G8HA 3QINA 4LY7A 5E41A 1WSEA 2OPSA 3HP9A 3FLGA 1C0TA 4GW6A 3P8HA 1NKBA 1IKYA 4FM2A 4N4HA 3C6TA 3B6PA 4DQSA 4PLLA 3K5NA 4F3TA 4N41A 3HYFA 3ZSWA 3OYIA 2A1SA 1K6YA 2HNYA 4BDZA 3LYIA 3OJSA 4F2RA 3S6WA 1RT6A 2YNHA 4FJIA 1T03A 4B9VA 1NKCA 1WSJA 4CEOA 1WSFA 2B4JA 4H8KA 3QEIA 2GFAA 4AHVA 3L42A 2GF7A 1RT1A 1J54A 3DLGA 1Q8IA 4E1NA 3I8DA 4CJSA 4FM0A 4CEFA 5C0MA 4OPJA 1RI0A 1TGOA 3MAQA 1IG9A 3RR7A 4M45A 2KW4A 4DTPA 3O8VA 3THVA 2F8TA 4E89A
chains in the Genus database with same CATH superfamily
2LH9A 2QA4Q 3KFWX 1VSEA 3BR6A 3VQAA 2YUPA 2LSOA 4LITA 3TKYA 1BKBA 2Y30A 3VEWA 1S1UA 2ETHA 4E9EA 2RKIA 4ZN3A 1NJZA 2JHNA 2EWNA 2NUTA 1Y6IA 1U78A 2BOLA 5HNFA 2ZO4A 2K5FA 1O9SA 2MH2A 4A3GJ 2Y4YA 1BQNA 1KK7A 2EV6A 3EHQA 1O3TA 3I56N 3ZEUB 2QEXI 3F6OA 3DXJF 3BF1A 2X4XA 3REAB 3UIQA 4DTMA 4XKBA 1HNVA 1MBHA 1XDSA 1ON1A 2XB5A 4IZ9A 4B9LA 1EA3A 1IRXA 1ZUYA 1KG7A 1WH5A 2CP7A 2HYJA 3E6DA 4WCEL 3LSJA 2YDLA 2M0YA 4EV0A 4DB3A 1YS7A 5B1AH 5FKNA 1H3ZA 5LJ3j 1MUYA 3PVQA 4ZN1A 1ZRCA 1TNTA 2R5AA 1O7LA 2DAQA 4RTXA 2ZXWH 4F7UB 2K9SA 5J1UA 4HUGA 3ITHA 4L8RB 4R8HA 1NG9A 2CSQA 4ZHRA 4CF8A 2EW3A 4PHTX 2PMZN 2E6MA 3CBPA 1SVMA 2M9UA 2C0IA 1CGPA 2XICA 2XKPA 1PUEE 3NGZA 4BS9A 1YF5L 3VQ7A 5E3NA 1BIUA 5EDNA 5LJ3d 1XD7A 1O3RA 1KFSA 3N0UA 5M1QA 4ELTA 1J5OA 4DEYA 5K5OA 1IB8A 1AD5A 3C7JA 5KPRA 1TK8A 3TO9A 4HUFA 2RJDA 1VQ9I 5GAN3 3GIBA 4LDVA 5KYYB 3M4YA 4OAZA 2Z1IA 2HQ5A 2PQ8A 2HR3A 1WSHA 3T1HK 2IJLA 3OIOA 1K9MR 3H6EA 4BR7A 1P7MA 1NJWA 1VQ4N 2D1XA 1OV3A 4BGDA 3VDXA 3M5AA 2W24A 2C6YA 2LBFB 2JZYA 3G0QA 1X9WA 5C44J 5BREA 2DN0A 1T05A 4EA4A 4MFEA 3LAJA 1BL0A 1SAZA 4A3BJ 1D8KA 5ILSA 5A0LA 1M3HA 2VIXA 1PU7A 4HZFA 4UV9A 3J7AY 2RK1A 3CJ9A 1J5YA 1Y1VJ 5BNGA 3FHFA 2B9SA 4DNCA 5AQRA 2NUBA 5ICFA 3Q5FA 4JD2B 3VUZA 3E9PA 1B6AA 3ZSOA 1C6VX 1PUFB 4J2AA 2UU9K 5GAOr 3MVPA 3O8GA 4KT0E 4CGIA 1RFQA 2HAXA 1FSHA 4B9XA 3G71T 1WQ7A 5JS1A 1L3LA 1TUCA 2JMAA 1KQSS 4ISFA 4IWVA 3RI4A 3BR3A 4W5TA 1KYWA 2GTOA 1W97L 2JTVA 2QEXA 1GXQA 4OB0B 2EQMA 4EDUA 3CCMT 4YFXF 3GUDA 1EJ9A 5CVIA 1WSIA 2YUOA 4XU0A 2RQPA 5GANe 3I5SA 3VYTB 4MO7A 4EJUA 3K7AJ 1TQPA 2JRMA 4ELUA 1HCRA 1LFPA 2DA7A 1X3ZB 3AVJA 1ZG5A 3TU4K 2HHXA 2NOHA 2CW0F 4FL9A 2HVHA 2WAFA 2A41A 3WG7H 4IUPA 1VQ7N 4YNQA 4YRVA 3JRIA 4NL2A 1Q82R 1ASUA 1AZGB 3BTLA 3P4IA 3LNQA 4B3SK 5DCMA 4U7BA 2XPWA 3QUIA 3OMYA 3KKSA 3OS5A 2R7UA 5F1XA 3CMAA 4DFMA 1VQPN 3V1RA 2JUGA 5KYUA 2RPNA 2P9UB 3I5RA 3ECOA 2HZYA 4OOIA 2JVHA 5AQUA 3VQBA 2YUSA 3NWSA 3IV5A 2PZSA 2HTJA 2DNUA 4CHZA 3TANA 1DQUA 2DYSH 4PGGA 3TAMA 5KRTA 1N77A 1JT0A 2VXFA 3GP8A 1N8RC 2BW3B 4HCZA 3DRRA 3LP0A 5IYBJ 2KZVA 3ISNC 1IN7A 1UGRB 1S22A 4OFAA 2RD1A 4FSXA 4RWTA 4JLGA 3OA6A 4F7ZA 5LJ3h 1T98A 2M8EA 1OI1A 4QQGA 4JKEA 2G6FX 2MG4A 3VS3A 3NTHA 5TJJA 2VGMA 3CF5F 4IUUA 5HLHA 4JLIA 1RUOA 3RMQA 2P9LA 2W00A 1V4SA 4LOCA 2DVJA 3RPUA 2RQRA 1FIPA 3ZQIA 4E9FA 4NB4A 2PUOB 3B02A 4DU3A 2AQEA 3LLRA 1ZLKA 3ASMA 1F36A 4CEDA 1KU9A 2VPRA 2OTJT 2CV2A 2P0PA 1DTQA 3A1YA 1YJNN 4AILC 3F6VA 2HF3A 4K8ZA 1BYMA 2D4WA 3ULDA 4FLYA 4GV6A 3TAEA 2BHZA 1EBMA 3FJPA 1HKCA 1U5SA 3M8SA 2X4JA 2VJ5A 1M8VA 1W2BS 2JWKA 4YIIA 3SYZA 3CLQA 1SVOA 1VQ8N 4M78B 4CF9A 1OCZH 4M6XA 4EGYA 2Y0SA 1TTYA 1VQLN 1IDZA 2KFZA 4BJTA 2P9NB 1IKWA 2V9KA 4LDYA 1YW8A 5E20A 4EZ6A 3M8RA 2J6OA 1NYFA 5KH6A 3TOBA 2OX7A 2EV0A 1CXUA 2K6DA 1T6CA 3OJUA 2L9RA 3ZOBA 3OYBA 1RC9A 3ULQB 1S7EA 3JRFA 3CETA 4XICA 4JYAK 3ZN1A 2EJ9A 3OL3A 2VWJA 3SBGA 2KMTA 1ZN2A 5AIQA 4RAZA 2M8GX 2ME6A 2ASMA 3F73A 2IS4A 2DAOA 2R7TA 4JNEA 1RACB 5C15A 3QLHA 2LF8A 4OP0A 3A8HB 3CCRI 2RI2A 3FM3A 4BNCA 1VQ5I 5D4SA 1BI4B 4L59A 2O2OA 1DGWY 2E7WA 3ZMZA 3KWIA 4L5IA 3FB9A 1S5JA 1U5TB 3DPTA 2L3DA 2YU3A 1PVSA 4F8RA 1YITQ 4FWNA 1YHQT 5J3BA 3D2FA 3O3GA 1HLVA 4JI3K 3MEUA 3JXUA 3WTZA 3CCSQ 4JKHA 1ILYA 3CLOA 3TW6A 2IS3A 2P9KA 2PMUA 1J5EK 5GMKj 1NK5A 4X65K 5CKFA 3KNTA 3IH7A 1SKWA 3TSWA 3F8BA 1PRMC 1XCVA 2BE5F 3NHNA 1NH3A 3DQVC 2NOZA 4O5BA 2J06A 3BDUA 3BDPA 2LLKA 3CCJT 2VBYA 4AWXB 3H41A 2P5KA 5J4YA 2D0QB 3EDPA 2L4MA 2VONA 5BQTA 2RNGA 4DSFA 5JS2A 4HXJA 3TSQA 5EU7A 4IKFA 3CPWP 5FD6A 3ATUA 2CGKA 3QESA 4KUIA 2ZB9A 2L8DA 3HSBA 4MFDA 1LVAA 2HKOA 2VE8A 3QIIA 2P51A 2QA4T 3OYHA 5F1JA 1JJ2S 1RI7A 2MC4A 3O1WA 1TLHB 2QBYA 1WZ2A 1SHGA 1VYUA 2QSHX 3L2VA 4WCIA 3W2VA 3BFMA 4M7AG 4NCAA 4HSRA 1SS6A 3U1KA 3TAFA 3GF2A 4Y3OA 3M54A 3QO9A 4E19A 4R56A 2IA0A 3ULRB 5JMVA 3FXOA 5E1WA 5GAOp 1AWJA 5A0GA 1R00A 4ZDPA 4DEXA 2Y2ZA 1QZYA 4G6DA 3CCQT 1ZBHA 2MF2A 2FBKA 3M53A 3F72A 2OAWA 3KTQA 1NKUA 1MGTA 3FKJA 2GZWA 4I02A 3A2FA 1IJWC 3IAS2 4DS5A 3BEXA 4XLFA 2PVGB 2DJQA 4BVOA 3QWXX 4LLLA 1ERDA 1P7JA 4DV7K 1YX3A 2XF7A 2J05A 5KYWA 1OCOH 2IAJA 4NQWA 2KT8A 3TREA 4H0YB 3KP4A 2QK0A 4FLWA 1FY7A 3A4CA 4JZ3A 1XDUA 2VKEA 1K73U 3G6EN 3PTAA 4B3OA 3ML6A 4D9JA 1HNIA 1ZBLA 1D3BA 1FMKA 4BR2A 3Q9SA 3K59A 3LDSA 3M0UA 3CCLT 4BR9A 4DKWA 4BB7A 1BCMA 5DS9A 4D1QA 2G8KA 2OTLQ 2OUMA 1A0NB 1FBUA 5F6FA 1ZRFA 4JPBW 4XLPF 1NK8A 3HOYJ 4GKKK 1WH7A 3HYIA 1QQIA 1GHCA 2CQ7A 2IGKA 1VQ5A 2D1KA 2LVMA 5JFRA 3HRMA 4RBOA 1FOXA 2PI0A 2P6SA 2EZKA 5CVRA 3AG3H 3M4OJ 1W2BA 2R7RA 1HYZA 3I58A 5HS9A 2F2EA 2G9WA 4GO1A 1T95A 5BMZA 1UHCA 3D0PA 4CW7B 1JE8A 4H0XB 3M07A 2HQAA 2N8GA 2RKHA 3VS5A 1OX8A 4KYWA 4ZYDA 3ZGKA 4IOCF 3TAGA 1RTIA 4N4IA 2KT1A 2O3FA 5LJ5f 1Q1HA 2R0QC 3MKWB 3LAPA 3UR3C 1U4BA 4BRDA 3U9GA 2DZCA 3N97A 1GLDG 2AP1A 2X9HA 3SUQA 3J81O 5FU6B 1RNHA 3EETA 2L9VA 3GO5A 3R0JA 2GAUA 2BV6A 4O55A 1ZK8A 4H5NA 3TDUC 2OU2A 3F0CA 3PIOF 3VOVA 3NQOA 2NVYJ 2QKLB 1E6HA 3HM8A 1PD1A 2VG6A 4LE9A 4P9FA 2COBA 2YU9J 5C4XJ 2KLOA 2QEXQ 2WAQN 4BI3A 4CECA 4QPQA 1BG3A 3R3LA 1AHJB 3EN9A 2PYJA 1ORKA 4GDFA 1KG3A 2RE2A 1R9TJ 2VT2A 2O8CB 4PKCC 3F8MA 3ZT1A 4CFDA 4OO1J 3RKQA 3GW2A 2DXUA 4B9QA 3FHNA 2XPVA 3DFGA 4AM7A 5GMKh 2JA6J 1C0GA 2DQLA 3CUOA 3OQ5A 2HZDA 1VOMA 2R7VA 4DV2K 1OH6A 1R71A 3G4SA 2PFUA 3GZ6A 7AT1B 3F0ZA 1YIOA 3CJQB 2RO0A 2Z3YA 2COZA 3PJRA 2ZPHB 5C12A 4AHRA 2GNCA 1LE8A 3OR2C 3R61A 4I01A 2W0ZA 1Z67A 2HBJA 1SRLA 2YHAA 2KIUA 4BI4A 2NAZA 1GLLO 1OCCH 4ICLA 1QCNA 4XNFA 2CYZB 3ABMH 3VFZA 4A3KJ 3NWTA 2WONA 2E41A 3VEOA 2DBBA 1RAFB 4BXFA 4WFAL 4CCJA 1TWAJ 3EFSA 3PNTA 1RAGB 1X3UA 3KZZA 3KETA 3NTKA 4K43A 1JB0E 4NUBA 4DLEA 1GLNA 2Y69H 2BE9B 1VQ9Q 1JJ2A 1REPC 3M0RA 3BR5A 3CQXA 4JK9A 4EW0A 4OIPF 2QW9A 4JK1X 4LF7K 3C6UA 4GFBA 1RGIA 4JI1K 3SQ0A 2K9QA 2KY9A 5K5QA 2A61A 4LDXA 2V9VA 4Y13A 2J5OA 4ON0A 4CEEA 3MXMA 1YQRA 6PAXA 2VWFA 2QGUA 4HCKA 4PIIA 1IREB 4CGJA 1I39A 1AKHA 2KK4A 1EV7A 2OQGA 1PSEA 4LUDA 4DTXA 3E1YA 1LQ1A 2STWA 3BG3A 3ZSYA 1XSDA 3G1MA 1P90A 3FZVA 5HOOA 1L3TA 4HX4A 1AWXA 4H0VB 1K9MC 4H5TA 3TCJA 2WSCE 5F04A 5BRHA 4J7FA 2RHYA 1BISA 2XDDA 4L18B 3ZRGA 2RAEA 4J9DA 1XN7A 1Z3XA 3AY9A 2RHIA 3OIPA 3LAMA 4HT8A 3VEXA 1TC3C 5ADXH 3IP4B 1HXDA 2EB7A 2KSSA 1CQTA 4MIMA 1GVDA 3KCCA 3IDHA 3BTJA 2TDXA 2KGTA 2MD0A 5MLCQ 4E2FB 2F48A 1YW7A 1BHLA 2JHJA 4M78F 2VG7A 5KK1A 3CC4I 2L3SA 4BY1J 3RMSA 3DEEA 4EW4A 1WGSA 2DX1A 4HQEA 1MA9B 4A3FJ 5E8IA 2QQSA 5J4VA 3ME9A 2X48A 2R7SA 4A53A 4GV9A 1K9MU 1VUBA 1SV5A 2O8FA 3ABLH 1EX4A 1XMAA 2GLOA 2XU8A 2JTEA 1K6OA 4ENMA 3CFOA 3A01A 5I42A 4D5CA 2EAYA 1AVZC 3CD6T 4CZEA 4XLHA 1FYKA 2L4AA 3V7CA 5CZ2A 1VQ7I 2HI3A 3FMRA 3JR9A 2XY5A 3THYA 4ZNXA 3TL4X 3LZJA 3O08A 4ITVA 4JOMA 3AVLA 3GTQJ 1BUPA 4XOTA 5B3SH 4CHUA 1QPMA 3JS6A 1VQPI 4NYNA 2DXCA 3SUOA 3ZETB 3INZA 2M1HA 3SZPA 1WLJA 1ATRA 3FBIB 3FRNA 1KVCA 4CJWA 4B9SA 5KN8A 4C8OA 3THWB 5DEQA 3P5JA 4M3TA 5LBQA 1IKXA 4KFBA 2D1VA 3ZSRA 5GAHJ 4GNIA 1X9SA 5D8KB 4PWDA 5AFUH 1OPKA 1XMXA 2YR2A 4RTTA 4XRFA 5LL6S 1VQ4T 2WOMA 3CC2N 1ULYA 3BY6A 4AFZC 3QFUA 1XHZA 1X1CA 4IOCL 2KIFA 2UUCK 1NM1A 4KRFA 2EJGA 2VASA 5M5XJ 1RDAA 4GYIA 4DFPA 2R7FA 3DTKA 3RKYA 2VWBA 4QLCU 1D4XA 3VS6A 3CESA 5EZHA 2EFQA 4OKKA 1PSFA 3FXRA 3CCST 4DYRA 4C8QD 3JAMZ 2L3QA 3DLEA 3G25A 2YI1A 2VKDA 3IH2A 3GFMA 4HVWA 4YOWA 3PIOL 3FZMA 1ZELA 4ETSA 4M7AB 4J2BA 4CGGA 2D2WA 2R92J 2X1EA 3HOZJ 1NYGA 1VQOI 2A40A 1G99A 3D7SB 2DQRA 4C92C 1P2FA 1WJRA 4CGHA 1FIAA 3EG3A 2HBKA 4CE9A 1M1GA 4A6EA 1Q82U 2ED1A 3WU1B 1VSKA 4KTZA 5LL6Z 4DQ8A 1W5SA 2LNVA 3GPLA 3L6QA 3CCEN 1TH7A 2NUZA 2HGCA 3IC7A 1VQNI 3NMUA 1D1AA 4H5VA 1FLIA 2I7PA 1ZR4A 1VQ8I 1RBVA 2X6OA 2Z1DA 2GQIA 4X1EA 1VQLI 1BGXT 3JRZA 2KIMA 2V51B 4CJFA 4DV3K 3SWNB 4Q48A 3TSPA 1Z1DA 4X34A 3I0SA 4QQDA 4C8QF 2OPRA 3CF2A 3CC4A 4JDSA 1IN5A 3BR2A 1EO1A 2GWJA 2BYVE 2XMFA 3PQJA 3FK6A 3R0AA 4M3RA 4RMNA 1I3QJ 4DUYK 2ZSIB 3DLRA 1C1CA 2QTDA 2P4TA 1CKBA 3KD1E 3IAYA 4FZXC 4AFSC 2RA2A 4NHJA 4AU7A 4J6WA 5DM7F 1X27A 2DILA 2E20A 3U4LA 2ZF5O 2BUPA 3SQ2A 2V7YA 1Y71A 1Y96A 3CCRQ 1VQ7A 1X3NA 2HMPA 1NJIR 3WGIA 4FX4A 2A08A 2OPQA 4BY9C 2V1NA 5H2FC 1LAVA 1QVUA 4DV0K 1BI2A 5DPKA 4BI8B 3M56A 2JN6A 3AG2H 3S1RJ 2RQWA 4F14A 2P84A 3A02A 2KQ2A 1ZX6A 3QPHA 1SANA 1X6GA 4QAGA 4XK8E 1QNTA 5LJ3e 3H9QA 2DT6A 5IT9Z 2XY7A 2F9WA 4XL9A 5K5RA 4R0KA 4N47A 3PQKA 3RR6A 2AXTC 3K5MA 1Z7LA 1E4FT 2H6BA 3F9KA 1WB9A 1QQNA 2G8WA 2JN0A 4C8QG 3SQNA 5AQLA 5LD2C 3EG1A 1K4SA 3LFUA 1TTHB 1K76A 3PE0A 4FX0A 2KNBB 1R1UA 4MMLA 3VQCA 5F0HA 1YE9A 4HCCA 1UGPB 3QYEA 4CJTA 3LH0A 4H4KC 2KBTA 3HL2A 1ZUKA 3H3NO 3TW7A 1M1KR 1MKMA 4CCLA 1RBRA 3TABA 3I55A 3K2AA 4XEIA 4QS7A 3R6MA 1VQOA 1MZBA 2MSYA 4FLXA 5C0YA 1NK7A 3B6OA 4UV8A 3HSTB 1ITYA 4RUGA 3SFMA 1K0XA 1B4AA 4FJJA 4AIKA 4ID1A 3HRUA 2X4HA 1ZQ3P 2PY5A 1X3MA 2OCCH 2QSGX 4BROA 2M7BA 3F8FA 1VQNA 1OPCA 1HSTA 1MH3A 1KQ2A 1VHXA 5AONA 4IXCA 2E35A 2E7XA 2LC4A 1AWWA 1D0ZA 1VQLA 1APLC 2FXAA 4QOZB 2KIQA 1Z6TA 2IVNA 2CFOA 1X2NA 3U21A 4EIKA 4WWCA 1HW5A 3HFOA 3OSSC 5KN9A 5J26A 1YJWQ 2D0BA 3AAQA 4JKAA 1KSWA 1R23A 1VQKN 2GA2A 3DM2A 2I8DA 2W84A 2GBYA 3R6NA 2Q0OA 1JLGA 1WSGA 1JHHA 2EZLA 1ZGWA 1SAUA 3M8FA 5BPLA 4M7DB 2BXZA 4RW9A 2DOFA 4KISA 1RDWX 2EIFA 5AZJA 3CMAT 4M77G 4X1VA 2L7KA 4HCBA 1VI0A 2LNHB 2XRIA 2EYWA 1M90R 2J7IA 1REVA 1MDMB 2R7YA 5I21A 2X6YA 2DE0X 4BRGA 3JAME 1LWYA 5F0FA 3F2KA 5FW9A 1KC8C 1BW5A 3MX2A 1B9FA 3AG4H 2LT1A 3I4MJ 4A4KA 1V4TA 2Y9YA 3BT9A 3NF9A 1E3HA 1GBRA 1NM7A 3KP3A 2WSEE 4Z4CA 4M3XA 2EJRA 1KCFA 1TYQB 2OV7A 3JRAA 5DLQE 1O75A 3JRBA 2L01A 3TMOA 2XY8A 3CBOA 3K57A 4HV6A 4X9DA 5AQZA 3CUQA 3LSTA 3VEZA 2E6NA 5F08A 3BF3A 3I54A 2FG0A 2CYYA 4KO0A 1QPIA 2GTDA 2O8DB 4JRIA 1SFKA 2DL3A 2ZJQF 2R5ZB 1YG2A 5GP9A 4RMOA 3S2HJ 3SV3A 4ANJA 3JCMQ 3NEUA 3AO4A 4M41A 4M4ZA 5BN8A 3K0SA 3VQ8A 1YIJN 3QJYA 2RH2A 3HKZN 5EJCA 2GOXB 2DTZA 3CCUN 3T8TA 4A5MA 2MW8A 3A98A 3ZT3A 1YJ9A 5I2SA 4M3GA 2HS5A 5DCFA 4CI6A 2ZCWA 5FO5A 1KG1A 4CHNA 4IUTA 3VYGA 3KLFA 1TU0B 2OC6A 4X62K 3L9FA 2RN2A 2M5WA 2PUKB 4JKDA 4M9SA 4EMKC 2DD5A 3AV9A 3LGFA 5GAN4 5DM7L 2QF7A 3GL1A 3WEEB 2XHCA 1KAYA 4ESBA 4BR0A 4AI5A 2SEMA 3AT1B 3JCMc 5HLGA 3OMGA 4N4GA 1G2HA 2K5IA 2HBLA 4PKHA 5J8CA 1UAAA 1B8IA 2P9IA 1QRYA 4YIRX 2H8WA 4PJOC 3A0HC 1GCQA 2CDTA 2DFEA 1TW2A 1OQYA 2FYKA 2CV1A 1Q81R 3VGMA 1X43A 3V9ZA 3CMEN 1W7PD 1MJ9A 4PKGA 1KQSM 3DU5A 2XAHA 2DXIA 2E1MB 2ZNYA 3A03A 1K8KB 4UVAA 2JG6A 4CD3A 1IXRC 4B1YB 1NPPA 3FDRA 5FU7C 2L3RA 4XSXF 1TOVA 3MCAB 2DODA 2LCSA 2FBXA 1WJSA 4CJ7A 2WB1A 3THKA 3K6GA 3Q0WA 5FPNA 1QKXA 3RRHA 4RDUA 4ZTFA 2R5YA 5GIOA 3M9QA 2HVRA 4ZC3A 4FOIA 2IGMA 4F91B 2ZM6K 3HBLA 5TRDA 1LW0A 4BQQA 2BANA 4NXMK 2M51A 3KLEA 4KMUX 4JKCA 5DK5A 1KFDA 3BE3A 2LRQA 4B47A 3CUQC 4DHYA 4PSXA 4LY7A 1O57A 2QTVA 2H8RA 3LDPA 1WSEA 3HP9A 2FPEA 4GW6A 1NKBA 1IKYA 2LG4A 5LY3A 4V19K 1HLUA 2CP2A 3C6TA 2HPMA 4A2AA 1F43A 2RN8A 2QYOA 1ZSZB 5DM7R 4N41A 3HYFA 4IZZA 3ZSWA 2E2PA 2QUFA 3I4NJ 2K9LA 2HNYA 3CPWM 1IRFA 2BH1A 5J1RA 4EHTA 2M4KA 3OJSA 4WFNL 4F2RA 2YNHA 5GMKe 2FEIA 1WEIA 3A1PA 1T03A 2K02A 2K3PA 4WXDA 3CP2A 4HX7A 4OIRF 1GLJO 2GFAA 4AHVA 3L42A 3MMYB 3DPUA 1JQQA 2DD4A 3TTFA 3K4LA 3CC4Q 3SDZA 3DLGA 5LJ5d 3F22A 1XCBA 3V8KA 5FGMA 4U88A 3UA7A 4J9FA 4CEFA 1UCRA 3C18A 4OPJA 1OISA 1TGOA 1IG9A 5BPIA 5KYYA 3FXQA 3HOXJ 4DTPA 3BR1A 2DPNA 2LFBA 1FYMA 1QZ5A 2NOJB 1BA5A 2H1KA 5CE3A 1NMNA 4AVPA 2HYGD 3DCFA 3I53A 4CCHA 2EFOA 3M55A 3VOEA 4FZZA 3JSCA 2LCLA 4M3YA 2QENA 4UUSB 4ESJA 3EH2A 1VQ7Q 3VGLA 2XROA 1N6QA 4Y7NJ 3R9PA 4B9WA 1GCQC 3V9XA 1OULA 1Z9ZA 1C1AA 1ZR2A 6AT1B 2O61A 4ENNA 4CDGA 1DKGD 2HOTA 3MP8A 3ZCMA 4L3QA 1VQPQ 2F9TA 2F5VA 3DXMB 2LDUA 4AF1A 4B3XA 1TWBA 1UHWA 2F4OB 1F1ZA 2VYTA 1ZBUA 2QQ8A 3CC2I 3QYHB 4ZZDA 1U04A 2GGRA 1W2BP 3DXKB 1PUFA 3WU2C 1S9HA 3ZMTA 3H0DA 2XK0A 2ZSHB 1QLYA 3MN5A 5A2QE 1VQ5T 2Z9OA 1XQPA 1Y64A 3SUPA 2NOLA 2ZJQL 4H0OA 3UKRB 1FJLA 3CP8A 4ZJZA 4PJJA 3PIOA 4XKCA 1N27A 2GQVA 5KE2A 1B3QA 1Y07A 2YS9A 4XTXA 3HRSA 3JCMX 2BUDA 2L9NA 4E7JA 2QGFB 4CC7A 5KVRA 4Q4ZF 2YSQA 4HWIA 4KICA 3FJ5A 1WAFA 5HRRA 4MQ9F 3KX2A 4IUVA 1E0EA 2OA4A 4BR4A 3H5AA 2H27A 2BZYA 1WPKA 3OYYA 2OFIA 4A59A 2IVPA 3FFKB 3VQPA 5C4JJ 2CQQA 2D8JA 3ZSZA 1ABOA 1DDNA 1KQ9A 3CCEI 4FVMA 4W5QA 2F4VK 3JSOA 4AFQC 5FLXZ 4OF1A 1FKPA 2JT1A 3B8AX 2BVLA 3FXLA 4HBLA 4JEPA 3N5NX 4DJAA 1VQNQ 4DYQA 1N9RA 1WA7A 1QVFS 4J9IA 4G12A 2DKGA 1VQ8Q 2P9UA 3QMLA 5GAEJ 4HNTA 4H4MA 1VQLQ 8ATCB 3KYDB 3ZMUA 2V79A 3MP1A 4K42A 1JLBA 1NHAA 3KBGA 3JW4A 3ZR8X 1VSDA 4Q5SF 1BR1A 4A3LJ 5IAYA 2ROTA 2FF4A 3TP0A 5HDKA 4CYCB 3VQ9A 1MGQA 2VKVA 4LF9K 2HU9A 3G4ST 2RF0A 4IURA 2BW3A 2HBWA 4B08A 2KPMA 3AAFA 2K4YA 4YOUA 3DLBA 1WOQA 4BQAA 5GAN8 4M73A 4CZJA 3DOKA 3GBTA 4YDUA 5EOYA 5LJ5h 2DJIA 2LQNA 2MK5A 3SYTA 1NPRA 5LJVA 3A2KA 3OGDA 4UB6C 3ID8A 2OYQA 4FLZA 3FC3A 2DA2A 1JJ2P 1ATSA 4DFKA 3G73A 4UVCA 5M3FJ 1K8AR 2ZWHA 5EVZA 3RTRA 3RJPA 5ICEA 1VQ6N 1R7JA 2M0MA 3CJ1A 1K61A 2FVUA 3TR8A 2IPOB 3CJNA 3GFIA 2PJRB 5HK0A 3Q3SA 4MEXF 3TO6A 3WNEA 5J2NA 2E34A 1NJIC 3CC2A 5B1BH 1G15A 1YUWA 3PY8A 3WTUC 4CRIA 1ODDA 3ENBA 4RCHA 1DTTA 4EPCA 3WT0A 4M78A 2FEZA 1R4NB 2FO0A 1Y1WJ 4LLNA 2P9NA 2YCHA 3JCUC 1X69A 1SL0A 4LNPA 1QSYA 4EVVA 1LMZA 2DBKA 4L5GA 1G3WA 5CVUA 2GWKA 1KG5A 1N5YA 2V26A 4EMGA 3E19A 1U6ZA 3MEDA 2G3RA 1EP4A 1DU0A 1SFEA 1UGSB 1GFCA 3FZFA 4A3MJ 1LOTB 3R60A 4J83A 1UGQB 2DL8A 3JCMP 1Q7YR 4KNYA 5HP1A 2EGAA 4FT2A 3IUOA 3CQZJ 2PQWA 4IO8A 5K7FA 3TTDA 4LSLA 4BAYA 4YOVA 4HV5A 1LJOA 2ZJRF 4JKGA 1NJIU 3FHGA 1S1WA 1VRTA 3CM5A 4KHUA 3MCPA 2BZXA 1XNRK 2JS0A 1R5GA 3VMFB 1BI4A 2ECCA 3CCEA 1XMQK 5CPRB 3E9OA 1U5TA 3CWAA 5CYQA 2H3EB 3DF8A 2LTOA 1Z0XA 1NWKA 4AD9A 4RGUA 5LMUK 3SLCA 4CBWA 2KJBA 3JCMb 1JKOC 1VRLA 3P31A 3UNGC 2LSNA 1HDDC 3HTRA 4OVAA 2VCPA 2QWNA 3VYHB 2IVOA 3HJFA 5FKMA 2FQ4A 2HSEB 5JICA 2VQGA 3LSRA 1YRNB 4C2TA 3K70C 1VQKI 4OMZA 4M78E 4OJRA 4QS9A 4A63B 2QWQA 3PO3J 1KQ8A 2I0NA 1JUMA 2JA8J 3D1NI 3OIQA 5GJVB 2W85A 4IVNA 1ARKA 2ICWG 3CERA 4EVIA 3MO8A 4JJBA 1A5WA 4I76A 2LJ0A 1J7KA 3OYAA 3M0TA 2LQWA 1RTJA 1M1KU 3BJAA 2E2HJ 3GVAA 2HKQB 4CJ5A 1J6ZA 4JRPA 3MFKA 3HL8A 2CGPA 2Z1JA 3D7EO 3I8BA 4ELYC 1Q1VA 4K2EA 4KBOA 1QHGA 1UB4A 4HG2A 2NRVA 4H5WA 3PLAA 3VQDA 1Q86C 1JU5C 3WU0A 2FZCB 2E4LA 2X6SA 5L23A 1YCSB 3HUGB 1UFFA 2K86A 4M7YA 3RRGA 1QMCA 2M87A 2QCOA 3CWSA 1NMDA 3N5BB 4MDAA 5GADJ 1M90C 2A3ZA 1U8BA 2JMCA 3OOPA 2L0AA 4M78C 3HXMA 4UOBA 4DTJA 3FHZA 3H0IA 4DR1K 2RJFA 3VRZA 1QSLA 2M3AA 1SKSA 3GXOA 2V1XA 4L0ZB 3MPUB 2E10A 2MWOA 5KGXA 5CR4A 1RPWA 5K1YA 1ABQA 2CQKA 3M58A 2I10A 1SC7A 1RRQA 5EC7A 3G71N 2MA3A 1J9IA 1YIJI 5HDNA 3BDDA 3P9CA 3SPZA 3MK6A 3CCUI 3WVEB 5GAOn 1Q86U 2JVVA 3VTHA 5BRDA 1QWFA 5L3CA 3QKJA 5I22A 4R55A 3S93A 3KJVA 1MWKA 3U9DA 3CCMN 2CO5A 2X74A 2PTKA 1M90U 2KXCA 3D5LA 5DLOA 5M1FA 3F3XA 5GAMf 3QIOA 3UKUB 2WACA 1U5TC 4UUVA 4R1HA 2QTXA 1I07A 4CK3A 1OKJA 3QIPA 5KPTA 2CSIA 1QSSA 2LKPA 4C3HJ 1HPMA 1XGMA 2Z33A 4BE1A 3KZYA 1STZA 1RKTA 2GX9A 3CC4T 1K73O 5LGUA 5IHKA 4IX7A 4C0DB 2XG8D 3UKGA 3SEZA 2QQAA 4FJMA 1UUEA 3K69A 2AZSA 4QS8A 2ZXJA 4IBNA 2QWOA 1V29B 4YG2F 3FZKA 4FETA 4Y4RA 3CMEI 4UB8C 2BKDN 4A5NA 4KRTA 1RBSA 1NLVA 3DBLB 3E9LA 1RTDA 1AA7A 5BN9A 1S72A 3CCVI 3HC7A 4XH4A 2L02A 1QKWA 2FL7A 2XHKA 2JTMA 4D6WA 1VQKA 1P4WA 4XTWA 1YS6A 4C8QE 3QP5A 3NRVA 1TVRA 2LMDA 3SD4A 3A5MC 4JX6A 3CXCM 4GLKA 1SD7A 4HTUA 4WCGA 1OU9A 2VXDA 4FASD 4XKVA 4FLTA 2LD5A 1IC8A 2K9MA 4BUGA 2P9PB 4XN3A 2DT7B 3HDDA 3H45C 4BY7J 1WPYA 3E2UA 4BRKA 5E3OA 1ZBXA 1RLPC 2BZTA 1YTAA 1SL1A 4BC4A 2O8CA 2QWWA 3QB0A 4N76A 2K7LA 1W70A 1EIFA 2IOCA 4KA4A 2OTJN 1HJRA 2ZJRL 1CLQA 1VNDA 4EATA 3N4PA 3OSFA 2ZZDA 4FJNA 1EF4A 4JRKA 4OMYA 1SMTA 3QP6A 4RA2A 1K83J 4A93J 3DEWA 3OA9A 4OINF 3V8JA 4RB2C 4EFHA 1I5LA 2FSWA 1R5ID 1A36A 1U9OA 1Q81U 3JRHA 4EJYA 3DV8A 4BXUA 3HTSB 1P92A 4PKIA 3P38A 3M57A 3K5OA 1AOJA 2E5QA 3I55T 4E70A 2C0TA 1C0MA 3S14J 1YIJA 4OKJA 1VQOT 2V8JA 3HKZA 1X19A 3S3OA 3M8JA 4XTYA 1H3HA 4I6MB 1OYIA 1N5ZA 4DU1A 5KAIC 1PDNC 1RRSA 1IUFA 5GMKm 1VAZA 3RMBA 2ELJA 3DKYA 1VSFA 5FDLA 1VIEA 4CFCA 3ZP5A 2DCEA 3GX4X 3O5ZA 5EY4A 1N8RR 1XX5A 3QXEB 3U3GA 1VQNT 5D5XB 5D6XA 4XLNF 4X64K 1EXQA 2LVSA 2NOFA 4CH7A 1HJDA 4IQJA 4GXOA 3VPRA 1K1ZA 1KD1R 2LY2A 4AIAA 1OX9A 2FRYA 2XSDC 3HHTB 3NMZC 3QPLA 1J9AA 3JAMK 1ZGAA 1YHQN 2MYSA 1WNSA 2NWMA 2RJEA 1MPGA 2LOOA 4HAMA 2VXZA 3IRXA 1UA1A 3V81A 3MN7A 4DV5K 4V2FA 5E3LA 4FO0A 3GZ5A 2K85A 2X6WA 2HQRA 4BBRJ 1K0SA 1UHMA 2VVKA 1RBTA 1SSHA 3Q0VA 1QHTA 4HSTA 3CMEA 2LY9A 3QBWA 1TUGB 5AQJA 3QZ5B 4C2MJ 3R6SA 5FU6C 1XPXA 1NOZA 3CC2Q 1X58A 2OBPA 4NYFA 4KHNA 3CCVA 1TWGJ 1OJLA 1PJRA 2MOXA 3CCJN 3SK3A 1IRZA 1V54H 4GVMA 4DGWB 3OSVA 2LDMA 2DDBA 4JUVA 4DQQA 3EYYA 2IS6A 2VQLA 3PGGA 1PKTA 2JJ7A 3M9AA 1V76A 4XTUA 3GEZA 3V1QA 2NUPA 2A3LA 2STTA 1WI7A 1WUAA 2H8HA 3GTGJ 2ASPA 4RTVA 3NDKA 3TAQA 2HB5A 1NBEB 2ATCB 2QA4N 1GFDA 4DLGA 3T8RA 3PUBA 5FROA 4KGZB 1B92A 2CKKA 1N6AA 3K9JA 2NOIA 1BJZA 2D0CA 2OJED 1X6BA 2D0AA 3RCOA 1DP3A 2E1HA 2BXYA 3HRGA 1U8RA 3QYGB 4ID5A 4M75B 4L9NA 2AK5A 2VN2A 3QNNA 4EMHA 3JB9J 2IEKA 2EX3A 4QWQA 1HX1A 2CU7A 2EGCA 3ASOH 3CCEQ 5SZTA 1K9MO 1IRGA 1K78B 3BQZA 1WLPB 2VUMJ 3CCQN 1HA8A 4EQQA 1D9DA 2XVCA 1YJ9T 3ZETA 4N4NB 5M9OA 3TTCA 2QDYB 2XAGA 4FM4B 3OYKA 2JSCA 2AHJB 3NE6A 2NLXA 2HEQA 1VQMI 3FM5A 4DWIA 1KHCA 3L4QA 2DI3A 4B1XB 2HYFA 3GOIA 1BC7C 1E4GT 4FJHA 2V4JC 3ZSVA 3QYBA 5IT9K 2ADUA 2PLYA 3K9KA 4MZTA 2LTPA 4RW6A 3FR0A 3CCLN 1NGGA 3KK7A 3CBMA 3N4QA 4RG8A 2HEOA 2L7MP 2K4JA 1I1SA 4PK4A 4KTQA 2JWTA 5AIPA 2K79A 3ID6A 2GELA 4HPQA 4F16A 2M34A 2HBPA 2F5EA 1XMKA 3GFJA 2VYPA 2GEMA 2LT4A 1BU6O 1QCOA 3AHUA 4A61A 3OW2M 1WZOA 2HHTA 2F5CA 4C92D 5H20A 3J81Z 3LDNA 4IPAA 1M3CA 1HPZA 5DD4A 2KYBA 1LAWA 3QICA 3RKWA 5C42A 1RBUA 2QSFX 2B6AA 1VZ0A 3VJPA 4UC4A 4QPOA 3EGUA 3PX0A 1W4SA 3K1PA 2EFWA 3CQ8A 5M3MJ 4OFEA 1W7PA 4FYDA 2B63J 3CC7I 5EF6A 4BRFA 3OYJA 4B3RK 1YAGA 4EMSA 2CRGA 4YEJA 5J39A 3KHYA 1O3SA 3T5XA 1NJYA 1RRJA 3W3CA 3SWNA 2DMQA 2I2LA 1Q82O 4C8LA 1K79A 4GVEA 4JK7A 1BI3A 2KT0A 2M0CA 1IXCA 2CUEA 1ZH5A 3DJCA 2K5LA 5GJWB 4UHTA 1HYVA 3OS0A 3OBWA 3MWPA 3QAHA 1JJ6C 4C92F 5ADXA 2X4YA 4RW7A 3BP8A 2P0QA 3I64A 2DEUA 3MZYA 1YNZA 2QYZA 1ZBJA 3OYGA 1U1SA 2F5TX 2DA5A 2H94A 2FBIA 3U9ZA 4B1ZA 1M30A 1K8AU 1IZ1A 4CJ4A 1ZGJA 3JB9H 5BPDA 4H03B 2RN7A 3W6JB 3F10A 2EWSA 3WXJA 2E71A 3QWLA 1W1WE 4MZPA 2X35A 5LGNA 3NF8A 1DGKN 1UJ0A 2VBZA 4G9ZA 2QM3A 1ZUUA 2OTLI 3LAKA 1MMGA 3QETA 1R59O 4XOPA 3DBHB 2M4GA 5LJ5e 4BQOA 3PV8A 3KKRA 4CZHA 1M2OA 1VQMA 3I4PA 3M4GA 5LMNK 3SZ2A 1YI2T 2LC2A 4P1WA 2LX7A 1QBJA 1VQKQ 1UE9A 2E5LK 2YNIA 4LD6A 3LSGA 1E2XA 4M7AC 1X2QA 5ED4A 4RG2A 3KZBA 5F64A 3T1YK 4EZ9A 4CJQA 1Q7YU 2L0KA 4JI6K 4S0HB 5HLFA 3HEFA 1X1DA 2DIGA 1P59A 1V4RA 5DD8A 3ZL7C 1QCFA 1WJAA 4IEJA 2KR3A 9ATCB 3VA3A 4XU3A 2Z1GA 5AFUA 1KGSA 1KQ0A 4ORZA 2DMNA 1TUDA 2YLBA 1LPQA 2JRTA 3M8QA 1NGJA 2ZFWA 3JRDA 4II1A 4C5GA 5K14A 1B07A 3W6VA 4M3BA 5IYDJ 4DYCA 2D9TA 4UY8O 2A5YB 1QVGM 1XUPO 3SMSA 4LDUA 2I5JA 2Q1ZB 4BJ5C 4CCMA 5HS7A 1UAXA 3NCIA 3FXKA 3OH6A 1TZLA 4IDKA 3RDVA 2W7NA 5HRPA 3SWNC 4QT7A 2YHYA 4I6ZA 3V42A 1T38A 3ZBDA 4UXNA 1FK9A 1O4XA 4I0AA 3CC7A 4NC7A 4AYBN 2DRKA 3CQTA 4N56A 1LPLA 4II3A 3G71I 3ZEHA 4OAYA 1QW1A 4FQGA 3JCMJ 4Y15A 2JWLA 3JV3A 4HOBA 2JSPA 2D8HA 4BKXA 3EL2A 3WTSC 4MNUA 1MMNA 3VQ4A 1SD5A 2R7QA 3DBRB 4AH9A 1ETVA 3VYSB 1YIJQ 3VENA 2IXSA 1KAZA 3CCMI 1YWOA 1IV8A 3CCUQ 3REOA 2D1HA 2MLGA 3VKIA 4BC3A 1ORPA 2JT4A 3TEDA 3GLLA 4HDVA 3LDOA 2ABKA 5KCOA 3LP2A 4CGZA 4LD9K 4OMMA 1GOAA 3OTOK 2K4BA 2RM4A 4M7DA 1SZ2A 3IWZA 1ESVA 3EGXB 1J59A 2GXBA 4IQ4A 3NARA 4DOVA 1SVLA 3CD6N 2GIZA 3GTMJ 1BCOA 4P5NA 1MDMA 1KJWA 4DTOA 1TAUA 1Z26A 4B43A 4B1VA 1Q9XA 3O3KA 2A42A 1BQMA 2R58A 2YV0X 3SV4A 3MCZA 2ISYA 1V55H 3BLYA 1JT6A 4A6DA 1NGDA 4BH9A 1KHIA 2P4RA 3AVNA 3FX3A 3TQ7P 4FWLA 1USTA 3KLNA 3DOLA 3H46O 1TYQA 5KRSA 2QBYB 2W4SA 2OTLA 4X66K 3FF5A 2L7FP 4FJLA 2JPCA 2KAFA 4KHSA 3CIPA 2DT5A 4C2UA 4PUSA 2PMHA 3CMEQ 1G3SA 3WHBA 2EFIA 2PVOB 1U84A 2NXNB 3P8DA 3GYHX 1GXIE 3I0XA 2O8DA 3CCVQ 3KEOA 5C2FA 3MAJA 2R5ZA 3T9NA 2FLOA 1D09B 3S2DJ 4BR5A 2F5DA 5TKYA 4BQLA 2E65A 3CCSN 4EHUA 5KTQA 4BQZA 3AVIA 1N39A 1I1GA 2FUG2 3CO6C 4QSHA 2F5FA 2DA3A 4KREA 5GAOq 4O44A 4V19S 1E6GA 3EO3A 1RLQC 3RYPA 4C30A 1IXSB 1LFBA 2PJPA 4NQWB 4M7DE 1TW3A 4HQMA 2DPPB 4PFOA 2OTJI 5GINA 2VT3A 4DFJA 3QOEA 3O3FA 1WEFA 4EM0B 2QXFA 1JJ8C 1D3BB 1ETOA 4KH5A 4ZYAA 2O9SA 3OMCA 2Q2EA 2EGEA 1U2WA 5DDGA 1NLPC 4M75F 2HCKA 1OVQA 4CIEA 3LSHA 4DR5K 2LKXA 1KLNA 1YBYA 2JZ2A 2IS2A 3PMIA 1WVRA 2OAZA 1SEUA 4PJOD 3ZYYX 1BIBA 3S3NA 1R0BG 3S2WA 3HP6A 4Y33A 3TO7A 2VPLA 1KQJA 1OYWA 2WY8Q 1GOCA 1EQYA 4AIDA 3HPHA 3KK2A 3H0HA 1HNWK 3OS1A 4M7DC 3CCMA 2ACJA 2K9GA 4CZCA 2A3SA 1SKUB 4WQ5A 1MMDA 1XC3A 2G8VA 1TG0A 1K8KA 4FVUA 3CPEA 3IL2A 2JPSA 1DJ7B 5GAOm 3AGKA 3EFOB 5CKHA 3FLCO 4FWSA 2BTFA 3RPQA 4N9IA 3W3DA 1SD6A 1IN8A 1YHQI 2J4RA 4J9CA 3OOUA 3BY5A 2KLAA 1A5JA 3CPWS 4R5PA 4D7NA 5C25A 4Q0BA 2DETA 4J7IA 2YG8A 3C94A 1QE1A 5LJWA 1BR2A 5JVTA 4Z4GA 3LSIA 4PJOF 5BPNA 2OZ6A 2PVDB 2C0OA 1HKTA 2AJQA 3TQNA 3H1CA 1VQ9A 1ETWA 1S6LA 1TWCJ 4FIBA 1UOCA 3HM9A 3DTEA 1QVFM 4MTEA 4EIAA 1KD1C 2RJCA 3AVMA 2HW3A 4KH1B 1Z7UA 1RI9A 1W4MA 1ZSZA 3H9GA 3CCJI 5IP6A 5AQTA 4LH4A 3A8OB 1UGVA 3CYMA 3H3OB 1O3QA 5LEKA 3QU3A 3RZOJ 1I50J 3BPVA 5FLXK 4GYGA 4NS5A 1R1VA 1ZG1A 1RDDA 1ZARA 4J2EA 4EGZA 5J2PA 2ZBKA 1S29A 4CF2A 4LFAK 2QAZA 3TPQA 4KAZA 1QS4A 4MGRA 5HKCA 4AHCA 1U45A 5L3FA 4AHUA 2E88A 3DU6A 5EG0B 3RSEB 1N8RU 1GLAG 1ETKA 5AR0A 2F1LA 1I0CA 4ZH4F 2XC7A 3MEVA 4GV3A 1KONA 3MKLA 4O6JA 1G5VA 1KD1U 3Q7CA 4K8XA 3PNWC 1M4ZA 1NU0A 5CVVA 1TT0A 3X24B 2OTJA 2PAVA 1R4MB 4FJ5A 4OU0A 1RKWA 3RBBB 4PZJA 4O8UA 3KK1A 2ZPFB 3SI6A 3AVHA 5D5VB 5D8LB 3LFKA 1ETQA 4WE1A 4BG9A 4ZYHA 2HMAA 2X51A 4UUSA 3CCQI 2VOOA 2H56A 1TL8A 4IJNA 4KT6A 1CF7B 5ECAA 2R93J 4UVBA 4JHDA 1H89C 2EBPA 4DF4A 2HHQA 1JTXA 1UG1A 2KDOA 2CREA 3VESA 4BL0B 3QEVA 2VUBA 1RT3A 1IBLK 1W5TA 2DFIA 3DXMA 3NGPA 2PEXA 4MMKA 2A6AA 3J8AA 4JK8A 4WQ5C 1LKXA 4OMFB 1T8EA 2E1MC 3WTVC 4BRPA 4CHYA 5HS8A 4B6MA 3DXKA 3BCBA 4DS4A 2NVXJ 4YPRA 1VQMQ 1LWEA 2RF2A 3RVCA 5LHHA 3O8HA 5KYNA 4A5BA 1HKBA 3CCLI 3O2PE 1I1JA 4H0EA 4XRMA 2OPSA 3UKRA 3P8HA 3H0FA 3CMAN 4PLLA 4PL7A 4EJZA 1G3TA 1DPUA 1POGA 3OYIA 1JGSA 3JCMg 2W41A 1K6YA 4BDZA 2IBDA 2P4WA 5D6FA 3LA7A 3S6WA 1WQWA 4FJIA 2YT6A 4H8KA 2EPDA 1KQSA 1S72T 1TS9A 1WX6A 2VJ4A 4EAHD 2RDPA 1VQ6Q 4RCCA 4ILGB 2Q31A 1ZSZC 3I8DA 4RTWA 3J7AF 5TGTA 4K41A 1T56A 4FM0A 4B4CA 1R58A 2NOBA 2L2PA 1PCXA 3DKMA 4GRIA 2XI9A 1J3TA 1J2XA 3RR7A 4M45A 5GAMh 3O8VA 5M5YJ 1RAIB 2F8TA 3IG1A 4DSKA 2ECBA 2DL5A 3CC7Q 4RB3C 4M7XA 3M8EA 3IRRA 2FD5A 1SEMA 2DYRH 3HSFA 4ELVA 2AS5F 2NOGA 2Q97A 1PU8A 3I0RA 4N9HA 5FB2A 4GMJB 1TK5A 3LDQA 4I7HA 1TKXA 5KPZA 4IHTA 3ZQQA 2A6EF 2GQQA 2DLPA 2JA5J 4BHCA 4OX9K 4CYCA 1T33A 5CYMA 1RUNA 2ZFUA 3LP1A 2FJ1A 5BRFA 3U6FA 2JGUA 3BJ6A 2NNWA 2B0LA 4M9XA 4HKEA 3DLMA 2AXLA 5L3EA 3AO3A 3RYRA 5IP7J 4XH5A 2DO3A 3CPWA 4LG0B 4IHVA 4F7UF 1WI3A 2BBYA 1JBMA 1T08B 3DB4A 5CLSA 5I2MA 2X3XD 3CWUA 2Y0SN 4CI0C 1S1XA 4CBXA 5IXBA 1T8IA 4MO5A 2VC0A 1VSJA 2X78A 2HKXA 1YJWI 3UE5A 1V5EA 2CGLA 3AKZA 2EFPA 2JUFA 1DGRM 4C23A 1BA0A 2DMOA 1KC8R 3CDHA 1RZ4A 4CCKA 1QZZA 4DMNA 3N4MA 3KXTA 5A2QO 2KZZA 5KAFC 2O31A 2RNJA 4B48A 1R77A 4BACA 1TKTA 3JRCA 2JPBA 3HBTA 1WCMJ 4XQFA 1P9QC 2LX9A 1Y0UA 4GKJK 2KKZA 2OANA 5E3MA 3CCRA 4M3UA 2O4GA 3TU5A 2HZTA 1QQCA 3L2QA 3M1EA 3PL8A 4XR6A 2IIMA 4QW2A 3S9HA 1U6GA 3CCLA 1VK0A 2KFDA 1M2VB 2FQ3A 3C7NB 3HPOA 4FZYA 4WXCA 1Z05A 3C0BA 3ZX0A 3CQYA 4KV8A 4BRCA 3IHUA 2QASA 1ZBFA 5GAN7 4ZZLA 2DL4A 3K1NA 1JCFA 4KN4X 2E36A 1WJDA 3H1QA 2YRDA 4IOXA 4FWRA 3TP3A 4AHTA 1S9EA 2VV5A 3IAM2 3EUKL 3WNFA 2KRMA 1P4AA 1IUYA 3CCVT 1B7TA 3SHWA 3CJRB 3VV0A 1MBKA 2IW5A 4M3EA 3I56I 1KFZA 4G7HF 1WBDA 3G0ZA 2M1BA 3ABUA 3FXUA 1ZXOA 3A8LB 1NEGA 5HK3A 2NVUB 5IOYA 1BBZA 1TQIA 1JGGA 1MDUB 3ESWB 3ZT4A 3PFYA 4JX5A 3H5NA 2I5UA 1Y96B 4Z4FA 2IPQX 3HHGA 4ME7A 1IV0A 5FKLA 3GMEA 4DZPA 2E2JJ 1NJIO 3EKSA 3HOUJ 3G71Q 1WJ5A 2K2VA 5BS6A 3BQYA 4A12A 4DSLA 3K70D 3M3YJ 2ZMEB 4OKEA 3S17J 1WEGA 2RHKA 4EP4A 4DIQA 1KU7A 3GDQA 3S41A 4XLAA 1W9HA 1JL1A 1PU6A 4O5VA 2LZ6B 4M72A 3SDGA 3L2UA 1ZKGA 3CCMQ 1HKGA 4A4EA 3BCAA 3CMMA 4EJVA 5AQWA 4JV5K 4CBUA 5D3GA 3WE3A 5J2MA 3L1PA 3O4WA 3CHWA 4LUEA 1DP7P 1L5UA 4KGXB 3AL0B 9ANTA 3P1GA 1RT2A 4ILJA 1BBYA 2LCCA 4BREA 3MEAA 2KZGA 1D5AA 4AFUC 3GLXA 2NYSA 5GTIC 4CJPA 1YJWA 4CJUA 4MLEA 2G8FA 4IFVA 3LW5E 3O6BB 1LNWA 4HUEA 3D5SC 1I8FA 4OGCA 5KGWA 3MHXA 2E5ZA 1WJFA 1IJJA 3VF4A 1IAWA 3B6CA 3HSEA 3E5QA 3ECHA 5I9EB 4LB5A 3HUGA 1M1KO 3QO3A 2HSTA 2XGDA 5KNLA 1RESA 2XD0A 3LA2A 2KMUA 4L9VA 4M78D 4DQRA 1VQ4I 4A0ZA 2EYZA 4A3JJ 1YYVA 2NRAC 2ID3A 3M1CA 4KDPA 4BC2A 1MSEC 1QWEA 4XLCA 2CT3A 4BRAA 1BIZA 1IO2A 1U9NA 4IOAF 3ROUA 4CZLA 4BRHA 1VQ5N 2O9LA 4RGXA 3ABKH 3EZWA 1WWXA 2MIOA 1SSFA 4RTUA 5CKDA 3DLHA 1X9MA 1KYZA 4HHTA 1OZ3A 3O9UA 4B9TA 1KG6A 3BW1A 4RM3A 2P8TA 3R6OA 3VTIA 1G83A 2WTUA 2X0LA 4CC4B 4ZGJB 1MJAA 4DV1K 3I9V2 4OPHA 4F4KA 1JLCA 1D1CA 1EKEA 4C92A 3TWHA 3JTGA 4B09A 3EY1A 4NC8A 4GGGA 3QJ6A 1HKQA 2PBDA 2DK8A 1LCUA 4O5FA 2OTJQ 3D6RA 2CG4A 2ESHA 3QEWA 1I27A 4AC0A 4J19A 1F9NA 4CD1A 2CFXA 2OCEA 2A36A 1NNEA 4I9QA 4B9MA 4NOYA 3I56A 1X75C 4CZGA 5EX5A 2XAJA 1VYVA 3DKWA 1YX5A 4WF9L 4S05A 1M90O 5JLFA 2W40A 3CXCS 1LWWA 3EEQA 3ABTA 5IY5H 1MUNA 1XWLA 1WN7A 2UXBK 2A6TA 2MH9A 5J47A 2MWPA 3NFCA 4C8MA 4C3JJ 4BYYA 3AA5X 1N75A 2R3SA 1H1VA 3EKUA 1VSIA 2FSKA 4I98B 5IN1A 4HVVA 4C5HA 2HHWA 5KCHA 3RKXA 2HOAA 3AFHA 3VF6A 5FKOA 2MCNA 3G4SN 5HL7L 5M5WJ 4KHPK 2A5XA 3S1NJ 1TKDA 2EYXA 2RB6A 2E70A 1IGQA 4MLOA 2NVQJ 2EJFA 4C1NK 4E7KA 2A07F 4AQYK 3O6WA 2PMZA 2QWPA 1BI0A 3U23A 2FU4A 4RW4A 1O1WA 4KI4A 3WQUA 1IV6A 1QU3A 4A2BA 3UDCA 4C92E 5AQMA 1WXTA 3LWHA 1OH7A 3ZN0A 1EH8A 2BY2A 1BM9A 1YHQQ 4EEFG 3VQEA 4M78G 1VQMT 3VQ6A 2A68F 2LKSA 4BU2A 2KISA 1MBGA 1ZG3A 5AYFA 4XQ3A 2FNAA 4DA4A 4XN0A 2ESNA 1XQHA 1YITT 1OOTA 5FLVA 2QQBA 2E3HA 4GY2B 4PJMA 2C06A 3L09A 2LJ1A 1W36C 3HB9A 4BD3A 2F2XA 3AA2A 1JXOA 2ZJ2A 5DM6L 3FIWA 1Y0NA 1VQ4A 2P5OA 3C2HA 2KQRA 4KFCA 3EG9A 4YIFA 4I2PA 1UMQA 2LY1A 2WUSA 1E3MA 2JTFA 3GZNB 4NLBA 2NRZA 3CCJQ 2FMLA 1U3OA 1JO8A 2X1CA 1RILA 1YJNI 4IO9L 3UT1A 2XF6A 1HU0A 1FTTA 1A35A 2AKLA 3I35A 1GLBG 4I6MA 3JCMV 1MU2A 2OQRA 3NNQA 1QQJA 4CCOA 1RAHB 2FF6A 3TVTA 5DTDA 3H08A 4ZYEA 4JQFA 4MEYF 1Q81O 2WADA 2NRRA 5HDGA 3DAWA 2VKHA 4CESA 4IF4A 1SAXA 3EG2A 4CZKA 1OR7A 4A3CJ 1SL2A 3CC7T 2ZQBA 2XAQA 4KIBA 4IFEA 5GANg 2WA0A 4FPBA 4WF2A 4XBFA 4CGFA 1JLAA 3TAPA 2W42A 4C0DC 4CEBA 2J6KA 3UATA 3MJXA 1IXDA 4FM1A 2EQJA 4Y92A 2K3YA 1FMVA 3IKTA 4D7MA 1WHJA 1RT5A 4KHYA 1Z91A 4A3DJ 1BOBA 3MQ0A 3CCQQ 2R5YB 1O7FA 2XPUA 4YHHK 2HDWA 3SEMA 4A4HA 1OQKA 1MSFC 4DBRA 4FSSA 3H6ZA 3ER0A 3LALA 3J81K 4OIOF 4B9NA 3HKSA 2O03A 3OSGA 1RDUA 3DWLA 1ACIA 3SQ4A 2CS3A 2VQEK 1YLFA 1R5HA 3FDYA 3CFRA 5KQDA 2KRHA 5GAMg 1S7OA 4IOAL 5GPAA 4YOQA 2ISZA 1YCYA 2JA7J 2DJNA 5EEHA 4Z8AA 1G3YA 5FRMA 3H1VX 3CMAI 4RAFA 4BRQA 2DBMA 3CCLQ 2IGIA 2KQWA 1VQPA 2ELKA 3EGDB 2OI3A 1JXBA 2KL4A 2YJFA 4XH1A 5C2DA 1WXUA 4OPKA 1LV5A 3LQRA 1Z3YA 2ZXIA 4C8KA 4EJOA 3EYIA 4CUGA 5E8GA 1KG4A 2OTLT 2VJIA 3SJJA 2ED0A 4XU1A 5BR9A 3L7WA 1AU7A 4I7FA 2KE9A 2KKOA 4QQ6A 3KLOA 1M9SA 3OYMA 4M6YA 1TWFJ 3RMCA 5LEJA 2O8EB 4I2OA 4M9ZA 4KPYA 4DR7K 2WBNA 3CXCA 3S32A 2Y1IA 3FZLA 4DG1A 2E1CA 5GAHP 3P9KA 4M75A 3K4BA 4HDUA 2COWA 4DR3K 1R1TA 3TI0A 2UYTA 1A04A 1UWBA 2HHSA 1K78A 2JOYA 1WHUA 2CUBA 3KE2A 1E17A 2FE3A 5KHDA 3L2CA 4B1RA 2XGEA 3VS7A 4OPAA 2CQXA 4LD0A 5F2RA 3BC8A 3SHFA 2L54A 2A6HF 3D4VA 3A5NC 3IWFA 2LK2A 4FWPA 4KUDK 3DWLE 3OYEA 4CSWA 5AQPA 4FSVA 1YJNA 2DVEA 1S1VA 2DO7A 2KP6A 3OL4A 1OR7C 3H9JA 3OHRA 2DFHA 3OW2S 3KZIC 2E12A 3MKYB 2RMOA 1LWVA 4A62A 4ISEA 1WJCA 3QZ9B 5J2QA 4FE4A 4EMKA 2GXAA 1YP5A 2CZ7B 4CJKA 2W04A 1SF9A 4JI0K 2XRNA 3PVLA 2QEXT 2OAUA 1MW7A 1VQ8A 1ZLJA 1SRMA 1WYXA 5C24A 2KRSA 3ZQCA 5FJ8J 2XGXA 3U1DA 4DBFA 1D5VA 2Y9ZA 1XSXA 4BXXJ 2GFUA 3TSZA 3IMXA 4DQ2A 4CZZA 3FMSA 3ENOA 3CC4N 2KYMA 2KI7A 4U7DA 1YVNA 2VC1A 3G6EI 4PJOA 2FF3B 4XU2A 3PO4A 5ELZA 2QG9B 2P5VA 1CXQA 2KJCA 2E1YA 4M75E 1Q86R 2ZPBB 2WBMA 4KUMA 1GUUA 3MN9A 1I4K1 3GCMA 3HGGA 3C4SA 2Y90A 1YWPA 2CS7A 2QVOA 1TBXA 2XGCA 5IPAA 2IGNA 3TSUA 3JSPA 4UNOA 1TWHJ 5EZGA 1ORNA 3GTKJ 3GFLA 5LGTA 1M3BA 5CKTA 4I9LA 1ZC6A 2VBXA 4L0YB 1KIKA 2HVIA 2WTEA 2ITGA 4B8CA 2IAIA 5JVGF 1YQKA 1XOVA 3E6BA 4JYKA 3C95A 3HG9A 3D2EB 5AQOA 3QBXA 3KLHA 1OCPA 4F93B 4FTHA 2EQRA 2DTOA 3J80O 1GCPA 1B9DA 4WX9A 2FOWA 3OH9A 1VQ9T 4RB1A 1Y57A 5GAMe 2KDSA 1YQMA 1ZTRA 5AQVA 1T6SA 2VKNA 1UB9A 2YSRA 4M75C 4XRSA 3T69A 2RQTA 2HDCA 2A7YA 3RWUA 2O9VA 2X4WA 2PU9B 4CZIA 3LPUA 1QZ6A 2CH4A 4C0FA 3TBIA 2RI3A 1KC8U 2O8BB 5DY9A 2AIRB 1BK2A 1FYNA 1RIOH 3LCNA 3AA3A 3FGUA 2ZPGB 2B7EA 4PJOE 3I56Q 5EG2A 1GDTA 2HQXA 3I0TA 1GL5A 2JVGA 1J75A 4Z6YA 1HMVA 1FYLA 1FOWA 3I55N 3TGNA 1JLFA 2XAFA 3BJOA 1RL2A 2DEQA 1U2VB 1VQON 1PWTA 4E9GA 4PNOA 1K8AO 4MDWA 2HVSA 2ATQA 5E79C 4W5OA 1W5CC 1WGXA 2EA4A 4JI4K 3L0QA 1UJ8A 3ZT0A 1D3YA 3JB9I 3GG4A 4G7ZF 3G1OA 3K58A 4HA8A 3J7ZI 4M7AD 1NGNA 2HVQA 3Q7BA 2XF5A 1MIJA 3SJHA 2ZGWA 3L3UA 3P9IA 1QVGS 3JCMf 2NRHA 1VQNN 1VA7A 1BL3A 3RTVA 4BEHB 5M1PA 3CD6Q 1TUUA 2HD0A 4O4GA 3U8XA 2LP5A 1OLTA 1TAQA 1V5FA 1CZAN 1J53A 4B3MK 3FXJA 2P0WA 1SUQA 2FSNA 3AARA 1KQ1A 2FOKA 1TKZA 1RCHA 1X01A 4ABZA 1EH6A 1IF1A 4H0PA 3AO1A 3LL7A 5IT9E 2W1OA 4O8KA 2F2VA 3G6EA 2XAUA 4CYDA 1ITGA 1FKOA 2RHZA 4HF0A 1Q7YO 1XC9A 3QNOA 3MEXA 4CK1A 2F4MB 2IP2A 4E7HA 1B72B 2LQ8A 2ZKZA 3E97A 5IP9J 1FXXA 4E9HA 3V1OA 4IHXA 4JKGB 3B6AA 1KU3A 1A31A 1WHGA 5HRNA 5HVQC 2AKKA 1M5Q1 1KQSP 4JN4A 3ZEUA 2E4HA 1Z25A 4A3EJ 1VQ4Q 2E5NA 1WXBA 4E1JA 3NH2A 3TARA 1NGHA 2D0OA 4LH5A 1IBMK 3NGYA 2VWKA 4M7AF 3OW2A 3QYFA 3CJTB 1ON2A 1TP4A 4OMNA 3IH4A 2XASA 2CZ0B 2DU9A 2D5VA 4E7IA 1C0UA 1MH4A 3ZFJA 2O88A 1Y7XA 3VEYA 5F1RA 1GOBA 4LB6B 4FJKA 1YVUA 4BVPA 1Z9QA 2FRHA 3HOWJ 2X6XA 2K3XA 1UJYA 2WFBA 4BRNA 1UECA 4EM2A 4AG1C 5B8HA 1KA8A 4QVCA 2L7ZA 4A4GA 4DQIA 1WJEA 5DV5A 5LJ5j 3VS0A 4F7UA 2FPDA 3M6GA 2FSJA 2EYYA 3FKIJ 3EGXA 3ULEB 2P7VB 1ASWA 1I5ZA 2IGOA 5EXWA 3HGYA 4DOWA 1ATNA 3SPYA 3O9QA 4IG3A 4FLUA 3DEUA 4RAYA 4LK1F 3ZT2A 1X9JA 3JTHA 2EQUA 4LF6K 2EIMH 4F52A 1KZHA 1JUPA 2YJEA 3L00A 4MDBA 2DTUA 2DK3A 4DTUA 4PGHA 1T0HA 4B8XA 1YJ9N 2WAQA 2NYXA 3AVKA 4BRIA 5HNHA 3K4MA 1KSPA 1WFWA 1H641 1LVKA 1JCEA 2P5GA 1NG7A 4XIDA 2VQCA 4KB0A 4J6YA 3SZGA 4BQNA 2B5JA 5H6QA 4K0KK 3O1BA 3G4SI 5J1EA 1K73C 5ICCA 3I0WA 2XDPA 3EUHA 3KP2A 4LF4K 2LBFA 1RABB 4E4HA 3KEQA 2BY0A 3SCXA 2E8AA 3E66A 4Z4EA 2UXXA 3PFIA 1LB2A 3G10A 3D0SA 5JVGL 2E6LA 2W25A 3AA4A 2GUIA 1N33K 1E3PA 1RT4A 2G8IA 5ILVA 4YFUA 1WNLA 2VE9A 1Y39A 2VOPA 2OJ2A 1NK3P 3GTPJ 4C8QB 2XIDA 1HSQA 5HCKA 5KYXB 3AVBA 2A05A 3HTVA 1UHFA 4ENKA 2DRMA 1XC5A 2F69A 2OZUA 2V1QA 4F7UE 2TCTA 4JD2A 4PA1A 2A0FB 4DQPA 3ZSXA 3WTTC 4NLCA 1W0HA 4DW6A 2VC8A 3KLIA 4P9UA 2Y4XA 3WG9A 4BBSJ 2R7XA 3HT3A 3VW4A 3CCRT 5CQEA 3FFIA 2VB6A 4BY6B 2A28A 5HY6A 3VS1A 5I11A 2DERA 3HTUA 3I33A 1JI8A 2CH0A 1HOMA 2CUJA 1ZRDA 3FZHA 1OH5A 4ISGA 1JLQA 3PIPF 2V52B 1PP8F 3MP6A 4II2A 1KLMA 5FLMJ 3ZX3A 2A5WA 2W57A 3WXLA 2NNNA 3COAC 1AZEA 4O0JA 3H3UA 4WTOB 2VODA 2WB1N 3ERED 4WYBA 3THXB 2Z0WA 1BWFO 1OKRA 5T7BA 3CF5L 3CJBA 2KHMA 2F6CA 2BGGA 5AQSA 4OB1B 3BPXA 4OWRB 2D6FA 1YTYA 2XV4S 3CMYA 4KHWA 1QVGA 2BE2A 2JK3A 1OH8A 1N9SA 4E7LA 4HVUA 4M7DD 3OYDA 2KVQG 3QPTA 1YJNQ 3O8MA 2YNGA 1ZYQA 3ONQA 2ZCFB 4CJ3A 4F92B 2QGGA 5ILUA 2JS2A 3DLLF 2V1UA 4A5AA 3NBPA 4KULA 5GTHC 1JKHA 3KYLA 5DUIA 2RQUA 2ZAEA 3R2XC 1MJBA 3QHSA 3JRGA 1MD0A 1H9GA 4GBQA 3EFOA 3SBTA 4CZFA 3J80K 2CGHA 4W97A 3EH1A 3QDKA 5CO7A 4IFYA 2K57A 2HWVA 2UV1A 4DK9A 4PSWA 4FJ7A 2ZJPF 1B9NA 4JBAA 5E1ZB 4M3WA 4RAGA 4M77B 1B9MA 1GLCG 3FMQA 1BO5O 3CJCA 1IN4A 5GAN2 3UF4A 1ZQ1A 4WQ4A 1NKEA 3EUHC 3F23A 3MEEA 3SXYA 1XG7A 3J7YP 4IUQA 3A5ZB 3EZ5A 4YPHA 4M7DF 3B73A 2V7ZA 3BWGA 4LD5A 2CUFA 5J1YA 5AQFA 5AZIB 3KIOA 1YI2N 2Q8KA 5JLXA 3IKVA 3SZTA 4MQ3A 4AMCA 4M71A 4NCGA 1G59A 5CQYA 1YJWT 3C2BA 2AA4A 4L5EA 1B34B 3E9FA 1QVTA 3META 2V9PA 4UY8I 1NEBA 4KHQA 4HNVA 3CMAQ 1PNJA 1BW6A 4DUZK 5EG0A 1S9GA 3C12A 5I3UA 3PSIA 3RSEA 3F9MA 2E1OA 2F8SA