3L2QA

Crystal structure of the prototype foamy virus (pfv) intasome in apo form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 97
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2qA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2qA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2qA03
4CK1A 4KV8A 4X34A 4KRFA 4FU6A 1ZBUA 1C1AA 3QEPA 4XIUA 2IGIA 3OYFA 4JS4A 3SJJA 1K6YA 1WN7A 3OYAA 1A5WA 2Z1GA 4FCYA 1TVRA 4FVMA 2EKOA 5J39A 4AH9A 1F21A 4Z4HA 2RI3A 4RW9A 2R7YA 4DSLA 1HPZA 1S9EA 3LYIA 4OKEA 3DMJA 3MXIA 1UAXA 1KFSA 4CIFA 2F96A 1RNHA 3Q1JA 3FDRA 1B9FA 1T05A 2KFNA 4OPJA 3HJFA 4E7LA 1RT5A 3C4SA 3DRPA 1KLMA 4I7FA 4DFPA 3MXJA 1DTQA 3PFSA 4DMNA 1J5OA 1IKWA 3AVKA 3B6PA 2YKMA 4AILC 1S1UA 1G5VA 3DLGA 5HRNA 4DSFA 3G0ZA 2R5AA 2OYQA 1UOCA 1WJRA 1S5JA 2DFHA 2GV9A 3HT3A 2O4XB 3FC3A 3NGYA 3L2QA 4FZZA 4RG2A 4GMJB 2JGUA 1IKYA 3DLRA 4DTSA 4YFUA 3SI6A 2YRVA 2WONA 2ETJA 4KHSA 3SZ2A 1RT6A 1TKZA 4KKOA 1UA0A 1U48A 4N56A 3IAYA 1FKOA 4HTUA 3VQ6A 4ZTFA 2BKDN 3MP6A 3ZSXA 4CJ4A 2EQKA 4GY5A 1G15A 2FBXA 4KHYA 3OY9A 4CGDA 1Q8IA 2G8WA 3QEIA 3RWUA 3QJ6A 3AV9A 1YTAA 5HRSA 4CJLA 1XC9A 1ZBLA 1X9WA 1QS4A 1TKXA 1TKDA 1FKPA 4H4OA 1NK8A 4CJEA 4I2QA 4N41A 4DQSA 3FEOA 3LGFA 2RJEA 4FLUA 1JLQA 1L5UA 4FJ9A 3H6ZA 1BQNA 4N5SA 1KHCA 1DLOA 4QQDA 4Z4FA 1SKRA 4DSEA 2HHTA 3M8SA 3OMGA 4IG3A 4CEFA 3DRRA 1JLFA 1HQUA 4A4GA 4CEAA 3OS1A 3ALYA 3OJUA 1Z26A 1RILA 1WSHA 4CJSA 1NK5A 2X6SA 3I0RA 3EY1A 3K5LA 1WSGA 3DM2A 4M41A 2HW3A 3HM9A 1RT7A 3E9FA 1JLCA 3SUPA 3HPOA 4B08A 4NYNA 4CF9A 5KI6A 4UQGA 1SKSA 4RG8A 3PX6A 1JLAA 5C0MA 2GFAA 2RHYA 3HYFA 4PA1A 4IUQA 2RKIA 1C0TA 1W0HA 3BGRA 4OGCA 3MEUA 1XNIA 5C24A 1WAFA 4OGEA 2VWJA 2P5GA 1XHZA 3MP1A 2BGGA 1QHTA 3QLHA 2HB5A 3L2VA 3LLRA 4B9TA 4BDPA 4BE1A 1RDCA 1S6QA 3L2UA 4QQGA 5HRRA 3CFRA 4J2EA 1JXEA 1ASVA 1IO2A 1RT4A 1VSFA 4NYFA 4E7JA 3L8BA 4FLYA 1SKWA 2RHIA 4FJ8A 3TAMA 2LRQA 3O4NA 4CEDA 2WOMA 1S9GA 3QKJA 3KLGA 4OLBA 1EKEA 2RHZA 2L89A 1S1VA 4PWDA 4M45A 3NE6A 3LALA 3UIQA 4QAGA 3L3VA 2Y1JA 3B6OA 4KREA 2GF7A 1NOYA 5KGXA 1KSPA 2VYTA 4Z4IA 4KB1A 1ASWA 3KKSA 5FRMA 4N4GA 4OKKA 2IDOA 4Y1CA 3TR8A 4FLVA 5I3UA 1WSJA 1X9MA 4KFBA 1VSEA 3V6DA 3S9HA 3BDPA 2HVIA 3TAFA 3LP2A 2JLEA 4FJJA 4AHCA 4DLEA 3NGIA 5M9OA 1HNVA 3V1RA 3ZT4A 4EZ9A 1JXBA 3D0PA 3SUQA 5KE2A 4FL6A 4IFYA 4OJRA 3LP0A 4CEQA 4ID1A 3VQ8A 4CEZA 5E41A 4N4IA 1D9DA 1N27A 3LX7A 1B9DA 1RDDA 5KRSA 2DY4A 2RI2A 2P5OA 1VSHA 4JLHA 3TAEA 1XI1A 1TKTA 1IKVA 4KI6A 3KLHA 4FXDA 1BIUA 4QCLA 2G3RA 1VSDA 1C0UA 3CM6A 1CXQA 3KD1E 4C8MA 2YHAA 2XO7A 2X6NA 2ZE2A 2HNYA 2B5JA 3NBPA 4E19A 4E89A 3VA0A 3OYLA 3AO3A 4CRIA 2Q3SA 4O5BA 3WNHA 2HQXA 5HRPA 2EQJA 4DFKA 3T1AA 3OYHA 4CEEA 4KO0A 4F2SA 2HHUA 4J2BA 3AVJA 2ITGA 3QIOA 4FK2A 4I9QA 2O4GA 1KFDA 1UWBA 4AHUA 2RI5A 2Z1HA 3QIIA 4Z4EA 1RT3A 1TK8A 1BI4A 1VSJA 1D9FA 5SWMA 3AVBA 2X4WA 4EDUA 4O55A 3VQ4A 4FM0A 1NJWA 3CEYA 1UA1A 1TK0A 1CXUA 3AO5A 3G10A 4C5EA 4E7HA 3UWNA 1WSFA 2KQ2A 2XY8A 2BDPA 4B9NA 4E1MA 4M42A 3C6TA 5FRNA 1JLGA 3ZT0A 2MWPA 1GOBA 2E6LA 5EU7A 3HPGA 4HVJA 2DAQA 4CFAA 1U04A 4CJQA 3M8QA 1RDBA 3DLKA 4Z02A 4B9WA 3LAKA 4RW6A 3VN5A 2XK0A 4BWJA 3NHGA 1IG9A 1RTIA 4DS5A 1RTHA 4CJKA 3C94A 1NK6A 1BHLA 3F73A 2HQEA 4DSIA 2DIGA 4FJ5A 2EQUA 3MEVA 1J53A 2K3YA 2M1HA 2MWOA 5KCHA 1REVA 1U47A 3PNWC 4FJLA 1BISA 2X35A 4WE1A 3ZSQA 4DQIA 2FC0A 3OVNA 3ZSRA 3PV8A 1T03A 2G8KA 1SUQA 1HYVA 4CHQA 4B9LA 2LDMA 3QINA 4CHNA 1ZBIA 2IOCA 3AO1A 4CESA 3V81A 3RTVA 3C6UA 3CFPA 2O4XA 3K58A 1KVAA 1CZ9A 1ASUA 4F3OA 3OYJA 1CZBA 3F9KA 2G8IA 1BCOA 4O0IA 2M0OA 2OPRA 4JRPA 1ZYQA 2G8FA 2X4XA 4L59A 4IURA 2K3XA 1FXXA 3SD4A 1RTJA 2Z1JA 4KTWA 4OKJA 3MEGA 4CF1A 2YHBA 1NKBA 4B9MA 1OZ3A 4B3OA 2HHSA 4CGJA 2B6AA 2IG0A 1OI1A 3O8VA 2XDPA 4B9XA 2VWKA 2OZSA 2OPSA 2G8UA 4O0JA 1JLEA 4KTZA 1SV5A 3HSTB 4AHVA 1EP4A 3LAMA 4DTJA 1QQCA 5HLFA 3PY8A 2X4YA 4PY5A 2E5QA 4C8NA 4OVLA 2ATQA 3OYBA 3LPTA 4CJ3A 2OPQA 3P5JA 4B9VA 2KZMA 1EX4A 3T19A 4FM1A 3SNNA 1RBVA 3L2WA 4OVAA 2LSNA 3IG1A 5J26A 1BGXT 5CZ1A 4DTMA 2F5KA 3TAQA 1QE1A 4LSNA 4Z4CA 2PQWA 1HNIA 2RJFA 3VQCA 2XY6A 4FZXC 4QOZB 3KLEA 3HVRA 4Q0BA 1S6PA 4CJUA 4O44A 3K59A 5I42A 2KTQA 3OB9A 4FJXA 2RJDA 2E4LA 2VG5A 4N76A 3AVHA 4NCAA 1H3ZA 2L8DA 1U49A 1C0MA 2KW4A 4CEBA 3ISNC 4E1NA 3P8DA 3NGZA 4B9UA 3PMTA 3AVMA 3MAQA 2G8VA 3RR8A 1BCMA 4KTQA 2IAJA 3K2PA 4KHQA 1TAUA 1KTQA 3HP9A 3TAGA 1S1XA 4QW2A 3NTKA 3MEDA 3PO5A 2B8AA 1JKHA 3NNQA 4IFVA 1N6QA 1JL2A 3RR7A 1RI0A 4Z0UA 1C6VA 1O1WA 3MEEA 4FJ7A 1RDAA 2E6NA 4FLZA 3QETA 2F8TA 5DK5A 3UT1A 4DWIA 2YNGA 4CHOA 2M16A 2EQMA 4CJWA 4EP5A 2HMIA 4LD6A 2PYLA 3T3FA 4C8KA 2F8SA 2JZ2A 3ZSVA 5KTQA 1A5XA 5CIUA 5J1EA 1GOCA 4H8KA 5D6WA 3TI0A 4FJMA 2AJQA 3CYMA 1NJZA 4DU3A 2RHUA 4HUFA 1HJRA 4CFBA 1LV5A 3ZSYA 3L3UA 2IC3A 3RMCA 2GFUA 3MEAA 4A4HA 2EX3A 3P83D 3MP8A 5KCOA 4CFDA 3K57A 4OPKA 3DOLA 3F70A 3AA3A 4CCHA 2HNDA 4IBNA 4LSLA 1QSLA 1U45A 4UC4A 2DFFA 3DLEA 3OYEA 4BDZA 2WACA 3AVCA 5CYQA 3KUFA 1VSMA 4CGHA 5KRTA 3ULDA 2KFZA 3VQ7A 4CJTA 3AA5X 4HCZA 3AO4A 3V1QA 3ASKA 3PX0A 4FJIA 2HHVA 2PY5A 2HVHA 4QQ6A 3EAEA 4E3SA 3VQQA 3QESA 4FK0A 3OYCA 1VSIA 3KLFA 4JS5A 5J2MA 4DSKA 4M3ZA 3SQ0A 1J54A 4FYDA 3K5NA 3H08A 3TARA 3L42A 1Z25A 2D0BA 3ITHA 3VQAA 2XHBA 4KHWA 5SZTA 3AVNA 3V9ZA 1VK0A 3AVIA 1ITGA 2GUIA 3WNGA 4W5QA 4NZGA 2RO0A 5FDLA 4JRQA 2Y1IA 1T7PA 4C8LA 4M3UA 4HUEA 2XY7A 4BE0A 3QBYA 3VQEA 3LP3A 2FHDA 2YNFA 3C95A 4NS5A 5HBMA 3RMAA 3TANA 3P8HA 4W5TA 4O4GA 3QNNA 4BWMA 4DQQA 3OYIA 1FK9A 4C8OA 1YTUA 1HYZA 2E6MA 3NF7A 4KI4A 1HQEA 2YV0X 4ID5A 3LH0A 4FZYA 4CIEA 4NCBA 4PL6A 1I3AA 1KVCA 3ZEHA 3NFAA 3KK1A 3KK3A 4DTPA 4E7IA 2LTOA 3MXMA 1L3VA 1RBUA 1NK9A 1Q9XA 3LGLA 3ZSWA 3LP1A 3KD5E 3CG7A 4FW2A 4Q5VA 3NH2A 3SUNA 5D6YA 1JL1A 2FBYA 4I2PA 4DSJA 2VG7A 2NUBA 4DFJA 3NTIA 2XY5A 1R0AA 2OZMA 4FLWA 4FLTA 2BIVA 3OYKA 4BE2A 1KRPA 3SPYA 4K8XA 5J2PA 4M3YA 2HHQA 4E7KA 5C6SA 3VQ5A 4ELTA 4MQ3A 2EFIA 2RF2A 2XRIA 4LD0A 3A2FA 1J9AA 3CQ8A 3LWLA 5DMRA 1LWCA 3V4IA 1DTTA 1I39A 2A1RA 2QQSA 4FJHA 2DFEA 4N4HA 4GVMA 4CJ5A 3RRHA 5C25A 2QQRA 2R57A 3IS9A 4OLAA 4AHTA 4A4EA 1WJSA 1YVUA 1LAVA 3VA3A 3HPHA 5IN1A 1CLQA 2ZQBA 1YT3A 5CZ2A 1S1WA 3V1OA 3TABA 4CF8A 4IUUA 2BUDA 2VG6A 3LZIA 4W5OA 3OS2A 4CJRA 3QEXA 4HCCA 4CJVA 3AVGA 4IKFA 3QEWA 3PX4A 5CY4A 4DG1A 1L3TA 4FK4A 4PQUA 3VQDA 3FLGA 2YKNA 4J2DA 4M3TA 4CGGA 3OYNA 3OYMA 3D45A 2EHGA 3KTQA 2R58A 1VSLA 3AVLA 3KIOA 5KH6A 4LH4A 4ELUA 5KGWA 3SV3A 5IAYA 3DI6A 3U6FA 3WNFA 3I8DA 2QXFA 3ZT2A 3TAPA 4C5GA 1C1CA 4EZ6A 4TSXA 1C1BA 3DOKA 5JS2A 2RJCA 1ZBFA 1KCFA 4DS4A 3OYGA 3CM5A 4FJGA 3V9WA 4CGFA 1BI4B 4KHUA 1EETA 4F8RA 3M8RA 3E9GA 3DYAA 3ZT1A 3LDSA 4DTXA 3MO8A 3SQ4A 2B4JA 3FFIA 1LW0A 4GW6A 4K8ZA 4LY7A 4DTUA 5JS1A 2KZZA 3JSMA 1EXQA 3P1GA 1GOAA 1QSSA 5KE3A 2D0CA 5K14A 3V9SA 3PO4A 4F2RA 3LZJA 4FJNA 4DU4A 3U3YA 3KLIA 3WNEA 4KAZA 2OA8A 1KVBA 1NK0A 4C5HA 1RBTA 3K5MA 3ZCMA 4KB0A 4RW4A 3DRSA 1QSYA 1VRUA 5FROA 4RW8A 3O3FA 1SL0A 1NJYA 1LAWA 5C42A 3L2RA 3DLHA 4ICLA 3SQ2A 1VRTA 4CJPA 4DTOA 4CK3A 5J2NA 2O4IA 2I5JA 3QERA 4ZTJA 3VQPA 3HL8A 4FM2A 2P1JA 3U3GA 3NH0A 4IUTA 3LWMA 3V9UA 1L3UA 1BIZA 2HHWA 4W5NA 2PYJA 1B92A 4B9SA 1ZBHA 1TK5A 3VQ9A 3ME9A 1A5VA 4RW7A 4Y1DA 4DQPA 4M3WA 5HROA 3OMCA 2D5RA 2DIQA 3KJVA 3M9QA 4CERA 1RCHA 4FLXA 1NKEA 1RTDA 4R5PA 3HXMA 3NF8A 5HP1A 1W9HA 2GBZA 4ELVA 2IS3A 3E01A 1IKXA 3CFOA 2BE2A 1SL1A 1RT2A 1LWFA 2RN2A 4IDKA 4A4FA 1SL2A 1XWLA 3THVA 2P0KA 4CEOA 4M3RA 1NK4A 2G8HA 3NF9A 3V9XA 3QIPA 3S3OA 4YNQA 4N47A 4PLIA 3DB4A 3HP6A 4CHZA 1L3SA 2HHXA 4W5RA 3SUOA 1TV6A 2FBVA 4CF2A 1WNSA 3NF6A 1TL3A 2YNIA 4F3TA 4DU1A 4E0DA 3HK2A 4L8RB 3NTHA 4J2AA 4FJKA 3MEWA 3ZSZA 3KK2A 3META 1WSEA 3DLBA 2D0AA 2ZD1A 3TWHA 1WGSA 1RT1A 2RHXA 3RRGA 4M3XA 3AVAA 3IRXA 4B8CA 1OZ2A 2YNHA 3AA4A 1RBSA 3SPZA 3K5OA 5J2QA 3OA6A 3QO9A 4CHPA 1LW2A 3OYDA 2X78A 4I9LA 4HUGA 3SV4A 4CE9A 3SQ1A 1WJQA 1NOZA 1TGOA 3BDLA 4MFBA 4CIGA 4CGIA 3DLMA 4C5IA 3AA2A 4NCGA 1OYXA 2P51A 5T7BA 3O3GA 2RPIA 1RBRA 1BL3A 3VQBA 4DF8A 4HCBA 2QKKA 4DQRA 3ASMA 4LH5A 3PUFA 2R5MA 1NKCA 2L3RA 3KKRA 3RMDA 4FW1A 3ZT3A 1HMVA 1WLJA 1JLBA 3EYZA 1MHNA 1NK7A 3QEVA 4H4MA 3HVTA 5D6XA 1WAJA 4DFMA 1N5YA 3S3NA 2FBTA 3M8PA 4AHSA 3DB3A 2QKBA 1HRHA 3AVFA 4DLGA 4F4KA 1SSFA 1XHXA 2W42A 4HHTA 2BANA 3O4QA 4G1QA 4IUVA 3MECA 1U4BA 1X9SA 4IG0A 4BD3A 3GOXA 1IH7A 3PMIA 2PZSA 4QVZA 4KPYA 2D9TA 1D5AA 4CF0A 5D3GA 2CKKA 3SCXA 5CYMA 1Y97A 2A1SA 2Z1IA 2OPPA 3NH1A 3LPUA 4BDYA 2LCCA 1BQMA 3OJSA 3SYZA 4DF4A 1QTMA 3S6WA 2DTUA 1X1PA 4B8AB 3ZSOA 2NLUA 4KHNA 3S3MA 1TL1A 3O3HA 3I0SA 4CK2A 4ZHRA 3NAEA 4PUOA 3NCIA 4IUPA 1NJXA 4DTRA 3EZ5A 1KLNA 4EP4A 3HO1A 4CHYA 2LVMA 1HYSA 2JTFA 3JYTA 1Q9YA 3H8ZA 4CJFA 2X74A 4Z4GA 4CFCA 1MU2A 4DTNA 4PLLA 3OQ5A 4AHRA 1D8YA 4BACA 3LANA 4Q5WA 1VSKA 1T8EA 1S1TA 4CECA 3QNOA 1TAQA 4II1A 3RMBA 2QK9A 1WSIA 3NDKA 1LWEA 2HNZA 3AO2A 3OS0A
chains in the Genus database with same CATH superfamily
2B9SA 2KYMA 4JS4A 2IVWA 5LGUA 2CUZA 4YOYA 1I1SA 1XX5A 2Q2EA 1RRSA 3P31A 5GINA 1K9MR 3FKJA 1X3MA 5AZIB 3DPTA 1JHHA 4RTXA 1LWVA 1JTYA 2Y30A 2BZXA 2DI3A 3KTUA 1VI0A 4DR6K 4BEHB 1R4MB 3BR6A 2XUBA 3H0IA 4LD9K 3ZSXA 4WFAL 1KQSM 3EKSA 3QEIA 3E5XA 2HBKA 1AKHB 5HRSA 1IXDA 1SAXA 3CMAQ 1IG8A 2NYSA 2ESHA 1M1FA 3FXUA 2KP6A 3DTIA 4CCKA 3F8MA 2YG8A 1UDLA 2HVIA 1N75A 1RILA 3QYFA 1ZA1B 3SUPA 3J7ZI 5KI6A 4E70A 1FOKA 2K57A 3AL0B 3PX6A 3A5NC 4PA1A 3ZMTA 5CAIA 3V8KA 3CCRT 2Q0RA 3I71A 3IMXA 4MO7A 1WH7A 1RT4A 3D4VA 1Y0MA 4BRLA 1ZG5A 3DPLC 1MUYA 1KC8C 1NLOC 4PWDA 3CJRB 4IJAA 1C0GA 4M45A 2K2VA 2Y1JA 3ZQHA 2KZVA 3K4CA 3VB2A 3ECOA 4DLEA 2JVVA 4XTUA 4XN0A 2DZCA 4DHYA 2GWRA 3A0HC 4C2TA 1WI3A 3TTDA 4M7YA 1VSHA 4OMLA 4OB2B 4KGXB 1OR7A 3NBPA 2TRTA 1Y07A 2WAEA 2HQXA 5HRPA 4PKHA 3JCMV 3KZYA 4C30A 2YJEA 2VJ5A 4AU7A 3HHGA 2HFHA 3CXCS 1IHWA 1RT3A 3LA7A 2YUNA 2DERA 1R00A 3CEYA 3DFGA 4A5BA 3QU6A 5FRNA 1PKTA 5EU7A 3S41A 2HBWA 2H94A 3M3YJ 1Q18A 3VN5A 2YJFA 3REOA 3WE3A 3PNWC 3EQLF 2ZNYA 3X28B 2X35A 2JA8J 2HZDA 4NL3A 1SUQA 4CHNA 3JSPA 3FKIJ 2ME6A 4Y3OA 1G3WA 3W2AA 2O4XA 4BR2A 2FPFA 4F3OA 5C3EJ 4IOCL 4YEJA 1N8RR 1FBUA 1AD5A 5AQYA 2LDUA 1ABQA 2K9MA 3BG3A 3J7AY 2IG0A 2KY9A 3C2HA 4FX0A 3ENBA 3SB2A 2X51A 5IT9Z 2LQWA 1POGA 2OPQA 2FVUA 1EX4A 1K83J 3NWSA 2ABLA 4CJUA 2VG5A 4HSRA 1FLIA 4A6DA 5CVVA 3CCJT 1R0BG 4AWXB 1NG7A 2O01E 1ZGAA 3Q5FA 1SPKA 1TQIA 1OCTC 2YNGA 4B23A 2LTPA 4RMOA 4HSTA 3PIOF 2F8SA 2ELJA 5FLXK 3WTTC 2A3LA 2ZJQL 2EWSA 1YN8A 3CMMA 1ENHA 2OJED 2HNDA 1WHLA 2Q8KA 3F72A 3CXCA 4KMFA 4E47A 3F6VA 3R6NA 4V19K 3AO4A 3GZ6A 4RDUA 3JB9F 3MKLA 4M7DD 5ICEA 2E5ZA 2E1OA 3LWIA 1NPRA 5AQZA 5E1WA 1ZELA 3EN9A 2V52B 4C8OA 1FK9A 3NF7A 3UKRB 5B8HA 2ZF5O 1B72A 3DWLA 1JL1A 2LQKA 2VG7A 4QS7A 2BTTA 2NRVA 3VQ5A 3HZJA 5D5UB 2ATCB 3F8NA 2HHUA 1EWQA 2OBPA 4RWTA 2GM4A 1PUFB 2ZO4A 4J01A 3IUOA 1M8MA 4BR0A 1YT3A 4PIIA 2O2OA 2HHHK 3OS2A 2FZKB 1YP5A 4YOVA 3N4PA 3AVLA 4OU0A 4B8XA 3ZT2A 2L9SA 3Q9SA 3AGRA 2RJCA 2GXGA 1PP8F 2HQHA 5AQVA 2LLKA 1Z1DA 2D6FA 1YQAA 2CV1A 1OULA 3QMLA 4QPOA 2V8IA 2NVQJ 3DRSA 3MKDA 1WI9A 2HSPA 3FXLA 1FBQA 4DTOA 3QYGB 5GADJ 4BC5A 3HUGB 3E19A 4M7DC 4C92C 4IRHA 1EJ9A 3HB9A 4FT2A 4RW7A 3ZEUB 1RTDA 2V1UA 4P55A 4DOZA 4D8DA 1Q81C 3BC8A 1T33A 2J05A 3EUKL 1FBSA 3SFMA 1B07A 1Q1VA 1UECA 4HF2A 3R6OA 2OZUA 2P9UA 1QVGP 1LW2A 2WBMA 2DL8A 3BDLA 2OTJT 1RAEB 1QZYA 2R5MA 2V9PA 4OIQF 3ZX2A 1T0FA 1TXQA 4QKUA 3CCVT 2CQQA 4JEPA 2H3GX 3LSPA 3TTCA 3ULQB 1HCRA 1YBYA 3C0CA 3ABTA 2ZXWH 3WQTA 2NYXA 3MWMA 4J8FA 3O2PE 4M4ZA 3TU4K 3OQ5A 4J9DA 2VQCA 5CCAA 4O5FA 3CD6N 1SZ2A 5B5EC 1H89C 1JHFA 1ZLJA 4IEIA 1QCFA 4A5MA 4FVMA 2P9KA 2QCOA 1Q82U 3CP8A 2FF3B 2VONA 1EFNA 5IT3A 3C4SA 1M8VA 1ACIA 4KGZB 4DFPA 2ZC2A 5FU6C 2JWLA 2K40A 5IP7J 4E9EA 2AZSA 1BW6A 3HOVJ 2R7WA 3EH2A 4F16A 4KKOA 5ILSA 3W3DA 3CW7A 2RD1A 4IEEA 5BREA 2YX7A 2H6CA 1DPRA 1YTAA 2QBYA 2QM3A 1TKDA 4H4OA 4FVUA 1OCOH 1R36A 2O61A 3CC7Q 4FJ9A 5GANh 2KKOA 2HHTA 3UNGC 2QTXA 4BHBA 2Z99A 3CCSN 1WSGA 3WTYC 2V26A 2EZLA 1A35A 4RG8A 3CPFA 5DS9A 2LX7A 3CC7T 4OGCA 3CC4T 4HF1A 1QHHD 3ZLJA 2P5GA 3SFIA 1PU8A 3L2VA 4MIMA 3L2UA 3CXCM 3BTCA 2QWRA 2K5IA 3GCMA 2RHIA 4XORA 1T95A 2RPNA 4LFAK 2JWKA 3KLGA 1ZYRF 2VUBA 1IGQA 2VWFA 3F10A 4RTZA 1VQ5A 1LOTB 4KB1A 4D6WA 1WSJA 4OMMA 5EVZA 5ECAA 4FJJA 1M5Q1 4CEZA 1ZGWA 1FWZA 3D7SB 1ZTRA 1HW1A 1XI1A 2DEQA 1XUPO 1JXMA 4XM3A 2HNYA 5IP6A 3CMAN 3WNHA 2GQQA 3AVJA 1NJIR 2ITGA 5JLFA 5A2QZ 3AG3H 3G1OA 4UUVA 4FT4A 1NJWA 1R0CB 1V4SA 3FZFA 4JI5K 2DXTA 2XPUA 1YHQA 1XSDA 2DAOA 2ZJ2A 3GF2A 4CW7B 2YHYA 2ID3A 3C94A 2ISYA 4KITB 4DSIA 1SD5A 2ZJRF 4FJ5A 1PNJA 1XNQK 4XTVA 4YIFA 5E79C 3PV8A 2B7EA 1HUXA 3RBBB 2RGVA 5FLXE 4M75A 1H1VA 1ILYA 2CGHA 5CR2A 1BCOA 4FISA 4F55A 3E9OA 4J00A 2E10A 3RKXA 4CF1A 2E1MB 2FQ3A 1NKBA 2HHSA 3NVMA 2V1NA 1WSUA 1JLEA 1QVUA 4ISGA 5KYUA 2KRFA 5GTIC 3G1MA 3BY6A 5A2QE 1QLYA 3R61A 1YI2I 3L2WA 2PJPA 3TTFA 1UJ0A 5FFZA 2PAVA 1MMGA 3HVRA 4G7ZF 3ISNC 2XC7A 5F1JA 3WTXC 4NB4A 3L9FA 3K2PA 2NVYJ 3NTKA 2DA7A 3RKWA 2XI9A 4PJOB 3KEYA 3P38A 4G7OF 3ZSVA 3TI0A 1R49A 2O9SA 3CYMA 1S8NA 1HJRA 5LRSA 3G4SI 5KCOA 4M3GA 4JI6K 5DYMA 1PSFA 3Q3SA 4UC4A 2OTLN 4A6EA 3H0GJ 3VYUB 1MJBA 3ASKA 2LY1A 4XLAA 1PHTA 2FMYA 1W2BA 2E36A 4F92B 2P5KA 4NC7A 1N3CA 2E1CA 1WYXA 2UV1A 2O8EA 3HYIA 1HKBA 4BRAA 2PLYA 1WJFA 1D5YA 4BGDA 3I5RA 4NS5A 3U4LA 3LSKA 1KAZA 4QT7A 1MPGA 5FU7B 1S72Q 4PL6A 2JG6A 3DKYA 2X6OA 1HLUA 3WU2C 1Q9XA 5E1ZB 4IZZA 4Q5VA 3NH2A 2IXSA 1HU0A 3NTIA 3WE2A 3ABKH 3ABUA 3OYKA 4L0YB 2XF7A 2QQBA 1J9AA 4A4KA 4CZKA 3BR0A 4BXFA 3V1OA 1ZAOA 4NXNK 4W5OA 1FC3A 4PQUA 4IKFA 2IT0A 3HEFA 3O80A 3D45A 1SHFA 3KIOA 4BRKA 2MYSA 2D1VA 5GAMj 4NBQA 4CGFA 2YG9A 3CMET 5H6QA 3MKZA 5JS1A 2YX6A 3P1GA 3NPFA 3PO4A 2C0IA 4FWLA 4JKDA 3KLIA 1NK0A 3ZCMA 4XLPF 3H46O 4OFHA 3IHUA 3CDHA 3HKZN 3D2FB 2CZ7B 1NGGA 4CJPA 5FD6A 4QWQA 2PYJA 3BZ6A 2EINH 4F93B 4NXMK 4PGHA 1OYIA 2F1LA 5AQOA 1JCGA 4CYCB 2GBZA 5AQLA 2FSKA 3ERMA 2PNIA 1NM1A 5A2QO 4IQ4A 1RT2A 3H92A 3THVA 3L4IA 4IOXA 2HOAA 2YUQA 3QBXA 1Y1VJ 1MUDA 5K7ZA 5LJ3h 1APLC 4EJZA 2VC8A 1MSFC 3C2GA 3PNTA 4IZ9A 2RHXA 5EXWA 1SF9A 4ZGJB 4IXCA 4EEFG 1IBLK 2NS0A 4C92G 4BQOA 3O3GA 4LG3A 3CWUA 1YWPA 4LH5A 3D0SA 4YIIA 1HW2A 2GA1A 3CCSA 5DCFA 3JAMZ 2DVJA 2M34A 2JA5J 3S3NA 1W0TA 1BU1A 3ZP5A 3BT9A 3DPUA 3J80K 3PMIA 4G7HF 2WSFE 4WQ5C 4KHNA 3DKWA 4YOTA 3GFMA 4YFKF 2D1HA 2K3BA 3O1WA 1HYSA 1QQIA 1PVSA 3G4ST 4AHRA 2IGMA 4Q5WA 3CMAT 5GMKl 5AQJA 1ZQ3P 2NOLA 3EZWA 2EZKA 4KRFA 3IRRA 4XIUA 3PTAA 4LLNA 1IC8A 2QWNA 2FU4A 5LGTA 2DILA 4CIFA 1BOBA 1OX9A 2HI3A 2DF6A 2ZPBB 1IV6A 3DBHB 3GBGA 3CCMI 1G5VA 2OANA 5HRNA 3IP4B 3R60A 4J83A 2H1LA 2CH4W 1JJ8C 2FB7A 2ETJA 3I4MJ 3QPTA 4N56A 1JKRC 3ZEUA 5C4XJ 3MP6A 2B63J 4A5AA 1I3QJ 2KROA 3AV9A 4LUEA 3PO2J 3S1QJ 2L2PA 1VQPT 4H0OA 1ZBJA 3Q9VA 4D7NA 2ITMA 1UGPB 3HI0A 1QVFA 1KHCA 1YITA 3JV3A 3CPWA 4A63B 5KYXB 2IP2A 5FKMA 5BPNA 2Y0SN 2CP5A 4M78B 1SQKA 4A69C 5H20A 4M7DE 4HBLA 3GE1A 5M1OA 5AQGA 4H0VB 1V55H 1KQJA 3DTEA 1ZRCA 5FGMA 4J6WA 3QYHB 4BE1A 3ZFJA 4KIBA 4LF6K 3M0RA 2DW4A 4E7JA 4NHJA 1U8BA 3CJ1A 1X43A 1STZA 5LMUK 2BHZA 1W2BM 4EVIA 1S1VA 4M78C 3ZRGA 3LALA 1TTHB 2GF7A 1WPKA 1FOWA 3THKA 4N4GA 2HDCA 1NM7A 3BDPA 5IXBA 4LN2A 2JLEA 4EJUA 3EH1A 2VQLA 4DA4A 4A0ZA 2VIXA 5E26A 1D5VA 3VRZA 4CEQA 3D1NI 2MIOA 2HKQB 3L09A 2DY4A 2ZGYA 5LJ3g 2P5OA 1P7JA 1VQ8I 5AZJB 2M7AA 4BYYA 2DO7A 2OAUA 4O5BA 5BPIA 2YRDA 4BY7J 5AQWA 4G6DA 3QIOA 3FGUA 2D8HA 1KFDA 2H27A 2Y4XA 3FIFA 3CD6I 3DXMB 1S3XA 2DMPA 1HNZK 2BDPA 3THWA 3SDZA 1PUFA 4B9SA 2XK0A 2MABA 4DS5A 1VQLI 1ZG3A 5FLMJ 4KULA 2EQUA 4WYBA 4EPCA 3HGGA 1LFUP 4VUBA 4IFEA 4M77C 3WGHA 4RS8A 3AKZA 1I94K 2WY7Q 1ASUA 2KEAA 3F9KA 4JKGB 1WJDA 1JUPA 3RDIA 3O9SA 5BR9A 2BE7D 3PNYA 4HVWA 1VQPN 1NGJA 1KQ2A 3MN2A 2ETHA 2K3FA 4UVAA 5LL6Z 1V54H 2ATQA 4OVLA 4CJ3A 4AQYK 2C6YA 3VYRB 5DM6F 3SEQA 2J5PA 1E4FT 2DYSH 3TQ7P 2QM1A 2IAIA 1SKUB 3QXEB 5I9EB 5LHHA 3BZKA 1KQ8A 4IL6C 3WGIA 1L3LA 3HTUA 2NRWA 3G71A 3EGDB 4IFVA 4MZTA 1JL2A 3RPUA 2QK0A 3J7YP 1LWWA 2ZGZA 1TYQA 3R0JA 1A5XA 3M8EA 4KT6A 5J1EA 4DK9A 2K9LA 3JRAA 2SRCA 4B22A 3U21A 2PBDA 3EGXB 4K2EA 3AA3A 5D5WB 1QSLA 1TC3C 1M1KO 3DTKA 4BROA 5TJJA 3PX0A 2HHVA 3E66A 4KHPK 2EIJH 4EV0A 5J2MA 2LKSA 2FBKA 4KHWA 2EPDA 1FYMA 1RDWX 1ITGA 3LW5E 4B4CA 1MGQA 4BE0A 1A0NB 2F7TA 1IRZA 1BUPA 3TANA 4W5TA 3OYIA 3L2ZA 3ZEHA 1W7AA 1WBDA 1U0JA 2V79A 1XQOA 4AUXA 4DSJA 1O9SA 3WXKA 3BZCA 2GGRA 4KH0B 1VQ8T 5DMRA 5AQKA 2MC4A 2J06A 4XAXB 2GX9A 3H0HA 4PUSA 1KG4A 4IUUA 4XL9A 3QEXA 3BY7A 4I2OA 1K73R 1G3TA 3OYNA 5AN4A 2F4OB 2P6TA 5ICGA 3M58A 3EG2A 3K1MA 3VRYA 2NUPA 3OW2S 2FYKA 2DT6A 4HCKA 5KYUB 3COAC 3CM5A 1W6XA 3VTHA 3JSCA 4GY2B 3URGA 2FSNA 3GPLA 1JKOC 2FE3A 2W7NA 1WIEA 5L23A 5GAOl 1UG2A 4JYKA 1JJ2S 1O3RA 3H9NA 1QMCA 2LFBA 3F6OA 4F2RA 2BVLA 4AIDA 4BC4A 1UCRA 2LKPA 4ZDLA 4KB0A 2W48A 2OAZA 2YLCA 4BB7A 3T5XA 1SL0A 4JX5A 5DCMB 2CT4A 3GFJA 3CC7N 1N34K 4O5VA 1O4XA 4CDGA 2V7FA 1IG7A 3N5NX 3JRFA 2JPCA 3ZMVA 4FSSA 3NH0A 4RB2C 1TNSA 1BI0A 1SRMA 1O3TA 4JK7A 3GBQA 5BMZA 1VQ8N 4CD3A 1LPQA 1R5ID 3A2KA 1LWFA 4CEOA 5A0DA 3M8JA 4CF2A 3JCMX 2GOMA 3NTHA 1UHSA 5C2FA 1FIPA 2I5WA 4LDVA 4Y7NJ 3FZMA 2CP3A 1NG2A 2QGFB 4C1NI 3BF3A 4I9LA 3HO1A 2CU7A 2KQRA 3C0BA 3T8TA 2JTMA 4DQRA 4J19A 3ASMA 2HYGD 4ORZA 1AKHA 1NKCA 2QWMA 2Y0MA 4OB1B 4LB6B 2FBTA 2KZGA 1AWCA 4A3MJ 2R5YA 3Q0WA 1FY7A 5GAMg 2EQIA 3BQYA 2RQTA 3CERA 1RPWA 4BD3A 1IH7A 1HBXG 3MWPA 4CF0A 4BY6C 2K86A 5DD4A 1NLVA 3VOEA 4XIDA 4XLHA 3G6EQ 1CKBA 2FXUA 4DTRA 4XQ3A 2JN0A 1X6BA 2W4SA 4Z4GA 2XRLA 3HRMA 3M4OJ 3H1VX 2R7ZJ 3LANA 2QDYB 4CECA 3OS0A 1X27A 5D5VB 1UAAA 4KV8A 4L3QA 5HKCA 3CMEQ 1C1AA 3OYFA 3OYAA 1GL5A 1TVRA 3MN7A 2GQVA 3FISA 1HPZA 3LYIA 1RR7A 3E3VA 1TS9A 4B3SK 1DTQA 3PFSA 5LJ5d 2NAZA 2GQIA 4I0AA 4DKWA 2I7PA 2M3AA 4U0YA 4Z2YA 3DLGA 4DSFA 2HCKA 3EEQA 1KAXA 4RG2A 5A0LA 3O6BB 4TV7A 2A0FB 3I55Q 4E1JA 4HV5A 4V19S 2DO3A 3VQ6A 2HZTA 2HVQA 4L5IA 3D5LA 2ZAEA 3OY9A 7AT1B 3H5AA 3D7EO 2PVDB 2E2PA 1FKPA 5LJ5h 4M7AB 1ZLMA 2FF4A 1GLLO 4FLUA 4BQZA 2KXDA 3HPWA 1BQNA 5M3FJ 3SWNA 1NYFA 4JI0K 1BR4A 1Z26A 5BPLA 1AVZC 4ZYHA 4LF8K 1Z3YA 1QVGM 4A3IJ 5GIOA 5C0MA 1C0TA 1FSEA 2QQAA 1WUAA 2VCPA 4BDPA 2OTJN 1YIOA 2LT1A 2KGTA 2BGCA 1C6VX 1HK9A 3T1YK 2H09A 1IO2A 4OOIA 4XNFA 1ASVA 1XQHA 4DOVA 2QYOA 3CCVN 2VBXA 5D5XB 4QAGA 1X58A 1YNZA 2CW8A 1KSPA 1XQSC 1MW7A 5I3UA 5GAGJ 4L18B 3DAWA 4FPAA 1XGOA 3LNQA 3KP2A 5F0XA 3LOCA 4BVOA 2M2EA 3HDDA 4IFYA 2HAXA 2R7SA 2DA6A 2FEIA 3SJHA 2HNIA 5JI6A 4KYWA 4WCGA 1Q82C 1MNDA 1FT9A 2Q3SA 2IJLA 5C4JJ 1Y39A 4GNIA 4KO0A 3F3XA 4WXCA 3ZN1A 2P4TA 1D3BA 2I5UA 5F04A 2E2HJ 4MGRA 3AVBA 2Q0UA 4FHTA 5EG2A 3UWNA 4B9NA 1RKTA 4CZGA 2VXZA 3CMYA 1RTIA 1YITI 1M2VB 2K9NA 5GAMe 3RVCA 4FJLA 4A3KJ 4WE1A 1KG6A 1T03A 1QPIA 3IWZA 2OV7A 4CHQA 1MMAA 1KGSA 1KD1U 3KWIA 2GWJA 3O5BA 3C6UA 4M7AE 2F6CA 2OPRA 4H0PA 4M74A 1I1JA 1RUOA 1NH3A 2FX0A 2MF2A 3PY8A 1MMDA 1WXUA 4BRFA 3LPTA 4M78A 3FMQA 3FZVA 2EZIA 3T19A 1S72T 4OVAA 3HRTA 3LL3A 3VS3A 4OMOA 5HDKA 5AQRA 1MGTA 8ATCB 3OB9A 2E4LA 2A69F 4FZXC 1X9JA 3IWFA 1WBBA 4HV6A 2LMDA 1OPCA 1RI0A 4CYCA 2E6NA 2F2WA 1X2NA 5D6WA 3FXMA 4ZH4F 3VWBA 4DYCA 3ER0A 4HUFA 1JGSA 2EX3A 1DPUA 1YJWQ 4C3IJ 2V1XA 3VS0A 3CCVA 1OMIA 5FW9A 1VSMA 3TL4X 5KHDA 5M5XJ 3I4NJ 5B66C 1TWAJ 2AKLA 1PU6A 3TO6A 4OF1A 1SSHA 3EAEA 1T0FC 1G99A 1U3OA 4LDWA 4N9HA 5DLQE 1MA9B 1Z25A 3DEWA 1ZSGA 4RCCA 4M78D 1WZOA 2VVKA 1WEFA 2JHJA 4HUEA 3OW2M 3QPHA 4XKCA 1R8OB 3M9AA 3VEOA 2ECZA 2CZ6B 4AVPA 4F17A 2KHOA 5D6YA 5L3FA 4A2BA 1QVTA 4Y92A 1H9TA 5AFUH 1KRPA 3SPYA 1V76A 4MQ3A 1OH7A 4F7UB 2H6BA 2A1RA 3MZHA 2R7OA 1DIZA 4Z88A 2PMZA 4FOEA 4BRDA 5IPAA 1GFDA 5IYDJ 3CCYA 2HF4A 1ETQA 2DA4A 2UXXA 2MAMA 4C5GA 1R7JA 5M1QA 2VN2A 1ZBFA 1E0EA 4Y0WA 5BN9A 2OTJI 4OMFB 3E9GA 2HGCA 3ENHA 3CCLT 1BIAA 1AWOA 1WJ5A 3BROA 4QLCU 1BWFO 3OH6A 3M0PA 3VOVA 4H5VA 4ITVA 1ZH5A 4YG2F 5GAHP 2A07F 5J2NA 2JJ7A 3HOUJ 4FM2A 5C10A 2HHWA 5HLHA 1VQOT 2DD4A 2FPEA 5IY5H 1T6CA 1UELB 4KIGA 2BE2A 4BKXA 5FB2A 1RETA 4KNYA 3F23A 2G8HA 3EE9A 2GTOA 4F91B 2EVRA 3SUOA 3HFOA 4F3TA 4DU1A 3NWTA 3C1DA 2YDLA 2D0PA 3H9JA 3MEWA 4CZLA 2ZPIB 1K8KA 3TWHA 4BHCA 3ZETB 4HUGA 5AQXA 4YY3K 3VETA 1KK7A 2P51A 4ZYAA 1Z7LA 3H36A 5IYBJ 3RMDA 1LJOA 1JLBA 2OA4A 4I76A 2IIRA 4DFMA 4F7UE 3KCCA 2ZSHB 3VPZA 4HHTA 2WSEE 1X9SA 2MBFA 4A3JJ 2WSCE 4IG0A 1YQLA 2DOEA 1KQSP 2JMWA 1PRLC 2R7QA 2Z1IA 2OPPA 1NGEA 3FXRA 2EB7A 2GIVA 4M7DF 2KT1A 4IO9F 1BIBA 3FM3A 4EHTA 2LJ1A 1UB9A 3D5RC 1R6RA 1YTUA 4M75C 4DQSA 4PL7A 4CSWA 3VS6A 4AI5A 3L4QA 4RTVA 3OIPA 4BBSJ 4WF2A 4K43A 1JJ2M 4LOCA 4P5NA 1GUUA 4QTRA 1K79A 3J7AF 3VESA 1IUFA 1XG1A 3K1PA 3AY9A 2IS6A 4M75B 1S5JA 2GV9A 1E17A 4A3BJ 3HT3A 4WWCA 4BREA 2MG4A 1YJNA 2JGUA 1JO8A 2WONA 5J4YA 1VQKA 3KLNA 1W5TA 2OTLI 5JICA 5D6EA 3RWUA 4N4OB 2E2NA 4BRCA 2XGEA 1XOVA 4CVNE 1D09B 1TKXA 4N41A 4C3JJ 4H0TB 3CCUA 4BR7A 1XTDA 2H3EB 4GRIA 3OYYA 2K6DA 1KG3A 4XLCA 1H3HA 4HXJA 3M8FA 3OJUA 2CQKA 3I0RA 3K5LA 2E1HA 3GDQA 4WFBL 3DLLF 1QQJA 2CSIA 4BRMA 4WCIA 5AQSA 4V2FA 3EUHA 1W7PA 4LLLA 2JSPA 1OISA 4J2EA 2N8GA 1JXEA 4FJ8A 4U87A 2DXIA 2PJRB 2LRQA 2LSOA 3PIPL 3CCUI 3EGUA 2VQFK 1R1TA 1GLEG 1Q81O 3U8XA 2X9DA 3B6OA 2OQRA 2PBIA 1RUNA 2IDOA 1X9MA 5C0YA 3S9HA 3G6EN 2HU9A 2ZJRL 1NLPC 5FKLA 4CJ7A 4BL0B 4B44A 3MJXA 2QLZA 4U7BA 3THWB 2A5YB 2A08A 3A02A 3KD1E 1BDGA 2HQ5A 3A0IX 4F04B 3OSSC 1VYTA 4X62K 2B86A 4DYQA 1W4MA 2NUTB 2W6LA 3RI4A 4DJAA 2EYWA 4FASD 3G10A 5FKKA 2YLBA 3NVKA 2JTVA 4B6MA 2DA2A 1NK6A 3I54A 5IT9E 5ELZA 1REVA 4NUBA 3C7JA 4CC3A 4AIJA 2HQNA 1A6IA 1ZBIA 2O8CB 3DEEA 5BPDA 2K5LA 1OX8A 3CCQN 5JR3A 3M0TA 2RDPA 2X4XA 1LJ9A 4XONA 2HW3A 1K8AR 4A12A 5KN8A 3E6DA 3SBTA 2F4VK 3RKYA 1NG6A 1EP4A 3LAMA 1XDSA 2VJ4A 1FZPB 2DTOA 1IGUA 2DRMA 2UXCK 4FM1A 3QOPA 5CZ1A 4DTMA 1N77A 2F5KA 5GMKi 4Z4CA 4BQQA 5KPTA 3KLEA 1NBWA 4E7SA 3H9QA 1Z9ZA 1CF7B 5I22A 2FRHA 2FNPA 2IPQX 2HSTA 3E7LA 2MI6A 3PO5A 3GTKJ 5FKOA 1CSKA 3HSBA 3QETA 1L0OC 5AQFA 4LD6A 4M73A 5HS7A 2DL7A 1NJZA 2RQPA 2XIDA 4E7ZA 2RHUA 3AAQA 3UKUB 1VQ4Q 4A4HA 3MP8A 2HYFA 3DOLA 3IH2A 4IBNA 2VKNA 3F2KA 4K41A 2Z0WA 5CYQA 3HRSA 1C0WA 4Z8AA 1SEUA 4HCZA 5LLQA 2O8XA 2DBKA 3UA6A 1T8IA 2VL8A 3GTPJ 2E65A 4FYDA 2L2OA 5BR8K 4EM2A 2AP1A 1T7PA 2RO0A 5AQHA 3SAFA 1YQKA 3R8EA 3HOYJ 3CUQC 1NKUA 4XK4A 1I3AA 3PLAA 3JCMc 5IXFA 3LFUA 3FXOA 3K0SA 2M0MA 4FW2A 4D5CA 2RNJA 3MD2A 4I2PA 3CCRN 1FYLA 1YAGA 2VJJA 1XTAA 1R23A 2VBYA 3VENA 5AIQA 4OPAA 3DU5A 4IEJA 2CSQA 4EVVA 4D7MA 3CC2I 2C0OA 1X3UA 3IS9A 4AHTA 4I99C 4BI8B 3ULEB 3TO9A 3ABMH 4LFCK 4HPQA 5HLTA 1Y96B 4J2DA 2NS8A 3QFPA 2LRDA 3CJ9A 2AO9A 1WDXA 3KXTA 1R1UA 1EO1A 3MKWB 1C1BA 4M77E 4DS4A 3ASOH 3OYGA 4HVVA 4HNUA 1D3BB 3V9WA 4UB8C 3SDBA 4XSXF 1KQSA 3M57A 1SD4A 3V9SA 1N6AA 2FF6A 4Q47A 2Y48A 1B34A 3EDPA 4ZZDA 2KMTA 1ETKA 1EQYA 3MN6A 5KAFC 2OZ6A 4UVBA 1VRTA 4JHDB 3IH7A 3QERA 4DBFA 3U3GA 1L3UA 2M30A 4QIWN 2NVXJ 3BR1A 1TK5A 1VA7A 3O08A 5GAN6 4FLXA 3ZMUA 4AM7A 4DCHA 1HR0K 4B1VA 2VC1A 3R9PA 2XV4S 2ZFUA 2HHXA 4PK4A 2JA6J 4HWIA 4J2AA 2ZJPF 2JVGA 3ZSZA 3MAJA 2A42A 3QP5A 3DLBA 4GVEA 2IS4A 2Z3YA 3REAB 4MLHA 1RBSA 3U9DA 1OH8A 1Z05A 4QS8A 5J2QA 2JT4A 2R5ZA 5KK1A 2QYZA 4ILJA 3DLMA 3CCLN 3M59A 4DV1K 3A5ZB 4FWNA 1G83A 1NEBA 3BJAA 2QA4A 2QF7A 1R22A 4B1YB 2RK1A 4OAYA 4M7AA 3TKYA 4O8UA 3CC2Q 1VQ6Q 2DU9A 5E8GA 4XR6A 4BDYA 4DF4A 4FQGA 2CS3A 2F5FA 4JKFA 3JYTA 1QP2A 2COZA 1S72I 5FLXZ 3VMFB 4WX9A 2D2WA 1XN7A 4UVCA 4ILGB 4JI4K 4II1A 2G7UA 1AU7A 1XC3A 1OOTA 4OAZA 2CJJA 4DBRA 4BNCA 3WHCA 4BJ5C 4A3FJ 1W36C 3ATUA 4OKEA 1VQLN 1DJ7B 4DUYK 5FPMA 3GOIA 3EO3A 1K8KB 1SFUA 2D0OA 1M4ZA 1IKWA 5EYRA 1U2WA 2CGJA 4YOQA 1ETWA 4GMJB 5EGOB 1IXSB 1TKZA 1U48A 4BQLA 2DE0X 3MN9A 2KRCA 5M5WJ 3R6SA 1VQMQ 1G15A 1QQMA 5GANg 3N4QA 1N8RU 2X3WD 1Z21A 2NOHA 4M6XA 4A61A 5J3BA 3HRGA 4CJEA 1YJ9I 2RJEA 2DDAA 2JJ9A 1ZLKA 4LB5A 2HR3A 4CEFA 2DPDA 1SS6A 4XOTA 5AIPA 1K61A 2R7DA 4A4GA 1HQUA 4JAXA 1U6GA 3LL7A 4EGZA 4FE7A 4KT5C 1P4AA 1JGGA 2DBMA 4CGZA 1KQ1A 2HB5A 1XMOK 3LLRA 2AIRB 3O4NA 4DBHA 3CBPA 3QKJA 2YT6A 1YJ9A 1MBGA 1Y1WJ 3IDHA 1YQRA 4PKIA 4C2MJ 2HDDA 2YCHA 1O13A 2QAZA 5IH2A 1Q86O 3V7SA 2A6EF 1U2VB 2OX7A 2X4HA 5AFUA 4Y13A 1D9DA 3LX7A 2RI2A 1WKMA 4JLHA 4KI6A 3K9TA 3OH9A 2X6NA 4HX8A 3VA0A 1WCMJ 4EGYA 3X25B 5M1FA 1OVQA 2K4JA 4HT9A 5CVUA 4AHUA 1UZCA 5JLWA 2Z1HA 3QIIA 1M3CA 3HOZJ 3J7AP 2XU8A 3ENOA 2X0LA 4ELZC 2DOAA 3H5RA 2G6FX 3S6IA 2OCEA 3KP3A 4HVJA 3FMRA 1W1WE 3JCMJ 1RTHA 2PMHA 3OSFA 1U9NA 3C3WA 2YXYA 2IS2A 3CI5A 1VQMI 4FOIA 4XU3A 5EGOA 2ROLA 3HSEA 4GO1A 1YXQA 3CFPA 1TNTA 2EYYA 3E6CC 5EG0B 2G8IA 1UG1A 3LDNA 2G8FA 2JMAA 3RSEA 4X66K 2DT5A 4OB0B 1DT9A 1G3YA 2O5RA 5CLSA 1WHUA 4N9IA 3I9QA 2NRRA 5ED4A 4ZNXA 4PJOG 5M1NA 2JRMA 3F8FA 4EFHA 3CQTA 2JUCA 2L9VA 2XY6A 3CMAA 4JHDA 2R4GA 1C0MA 4M77G 3H5NA 4F3QA 2VGMA 3RR8A 1OYYA 1S1XA 1N78A 3MEDA 3CPWM 1O1WA 4NQWB 4OFAA 2ZPEB 4CJWA 2EQMA 2QSGX 4W1UA 4JKBA 4C8KA 2Z33A 2CZ1B 1BW5A 4BU2A 4PNOA 2GFUA 4X1VA 4OPKA 1OYWA 1U45A 2D1KA 4CGHA 1N32K 4XKVA 4DQ2A 3EHQA 4OIOF 1PCXA 1AHJB 2D0BA 4BC3A 1Q86U 1O75A 2GUIA 3WNGA 2Y1IA 4JI1K 4C8QB 1JCFA 1DGKN 2FHDA 5HBMA 4H5NA 1IGNA 2WAQA 3BG5A 3MCZA 2P9PA 4FZYA 1ATRA 4C9YA 4GYGA 3KK1A 3EGXA 5TGTA 2LJ3A 3BTIA 1HKSA 3I56I 1VQ9I 2L7FP 4EJOA 3P7NA 5J1UA 5HODA 4A57A 1VQ8Q 4DFJA 3K4KA 1NE8A 2KSSA 4A3CJ 4QSHA 4FWRA 5AONA 5DY9A 1X2KA 1IN5A 4DR7K 2E1ZA 2NXNB 3T1HK 3RPUD 5FPEA 5GAOq 3HZ6A 3NARA 1M1KR 4DB3A 3PIOL 4B47A 2EJFA 4WTOB 3F0ZA 3WNFA 2DMQA 1B72B 2HDAA 1WVRA 4HAMA 3CC2N 3MO8A 2YS9A 3FIWA 3JB9H 4FJNA 3JAMK 1IHVA 4KAZA 4JYAK 4F14A 2DK5A 5JHUA 1SFEA 1SVOA 2DMTA 4ICLA 3QP6A 2M9UA 1FP2A 2P1JA 3CJBA 1VQOI 1BIZA 2P9PB 3RNJA 2K5FA 3RR6A 4J6XA 3AHUA 2F2VA 3WXJA 1QHAA 1SL2A 3CUQB 2MD5A 4AIAA 3CF2A 3J80O 2BE5F 4CHZA 4HLXA 1EH8A 3MK6A 4E0DA 4FWQA 4M75D 3G71T 1Z7UA 3DQVC 3EUHC 3M1EA 3PVQA 4ENJA 1V29B 1A31A 3N05A 1UUEA 4YELA 2ISZA 4YHHK 4MFBA 4CIGA 3CCMN 4C5IA 5T7BA 2CQ7A 2MLGA 5EF6A 3PUFA 5JHFA 2EYZA 3FRNA 2PMUA 4JRKA 3QDKA 1WAJA 5K7HA 1F36A 4MEXF 1RAGB 3DB3A 1HRHA 2W42A 2XKPA 3UKGA 5HNFA 1REPC 1BQMA 1QHGA 3HSRA 3O3HA 3NAEA 2LY9A 4KMUX 2LVMA 1SANA 3QDRB 1YI2A 1LDJA 1J0RA 1VYVA 3W0LA 1Y57A 1GV2A 4HZFA 1WSIA 3AO2A 1EIFA 2FSWA 3I58A 3EYYA 1RC9A 3A01A 1ZBUA 5J1RA 3QEPA 2DA9A 3VV0A 1YIJT 3UDCA 5AQQA 1S9EA 2JVHA 3CF5F 2LVSA 3FK7A 3SLCA 2VQHA 3KZZA 2ED0A 5E1XA 4IXAA 1BI2A 5CVRA 3QUIA 2JZYA 3GTJJ 2YHXA 5K5QA 1B3QA 2CG4A 4M77B 3CCJQ 3QZ5B 2BHYA 3IAYA 1DU6A 1PD0A 3CC4I 1N8RO 4DNCA 2VLAA 4M75E 3CLQA 3JXUA 3GLLA 3GW2A 1K8AC 1MNEA 2ZXIA 4PJ0C 1ZBLA 1QS4A 1XC9A 1KC8O 1IJJA 5M5YJ 3J81O 1Z3XA 3VYTB 2VOOA 1EWRA 1FW6A 1OJLA 5GANf 1XSVA 1JLFA 5HLIA 1R59O 1VQNA 2X6SA 3DM2A 3O8MA 3HPOA 2PX9A 4C1NK 4RM3A 2HSEB 4LDUA 2QENA 1WAFA 2L5QA 1RDCA 3FZLA 2ASPA 1K7AA 3UPUA 3CBOA 1Q95G 3GTMJ 4XU2A 4FLYA 5GAN5 1I6HJ 3FJPA 2IEKA 3VS5A 2WOMA 2RQQA 3W6VA 1EKEA 1YRNB 5FFXA 1X75C 3KKSA 3V7RA 4BHPA 2HBPA 3LP2A 4RGUA 2B0LA 4JNEA 2E5NA 2DMNA 3V1RA 3H9GA 1X1CA 3A5MC 5J4VA 2W57A 4QCLA 2X85A 4M3FA 4S0HB 5F1RA 4AFSC 4AG1C 2PZ1A 2XO7A 3GFIA 4CHUA 3AO3A 5CKEA 4DIQA 1HX1A 3E6MA 4IHSA 4AF1A 4CEEA 2AXTC 4I9QA 2QWOA 1VSJA 1X19A 1R5HA 2CUBA 3BDUA 3FE1A 3C6TA 2QXLA 2E3HA 1ZX6A 3K1NA 3VERA 3A8OB 2NRHA 4PL8A 1J6ZA 3PO3J 2A7YA 2K4BA 5TRDA 5FLVA 1KQ9A 3I9V2 2CYZB 2Z5UA 4WK8F 4M78F 3AG4H 2IW5A 5CKDA 3V81A 3K58A 2RB6A 2E20A 1E6GA 2FOWA 4UV9A 3VEYA 3A8LB 1WJBA 2C06A 3MEGA 3VJPA 1USSA 3H6EA 2D0NA 2OZSA 2PUKB 3TPQA 1E3MA 1G2BA 5DD8A 3ZN0A 3E9LA 1DEJA 4B3TK 1H8KA 4XN3A 2CS7A 4NDLA 4LIUA 2RJDA 4FJXA 2XGXA 3MMYB 4E1NA 3NGZA 3J80Z 4LD5A 3CC7A 1TAUA 3QZ9B 4GKKK 3J81E 1IN8A 1ORNA 5EEGA 1RDAA 2QQ9A 4XMYA 3VF4A 1VAZA 1X1BA 4RCHA 3VUBA 3DLAA 2JZ2A 1S3JA 2QUFA 2KHMA 1HF0A 1Q81R 2I7NA 5HY6A 4W97A 1BO5O 4DZJA 4CFBA 2IC3A 4ESBA 4A53A 1LCUA 2E2OA 4BDZA 4U7DA 3ZMSA 4CJTA 2E88A 2IA0A 1WRJA 1WOQA 1D1AA 3TDZC 5KYYB 2L02A 4E3SA 3OYCA 3KP6A 5KQ8A 3A8MB 5KYWA 2QA4T 5SZTA 3CWAA 5LJ5f 3UATA 5IT9K 2P4WA 4H03B 1M90O 2DPUA 3KNTA 4ZYDA 3OR2C 2EZHA 3F8BA 4DTPA 4E7IA 1RBUA 5HK3A 1J75A 1LOJA 3PE0A 1TUUA 2RA2A 3I4PA 4E7KA 1KG1A 4XRSG 3O8GA 2XRIA 4DEXA 2ENMA 3PL8A 2CGPA 2FBHA 1I27A 3OL3A 4N4HA 4B1RA 2QQRA 3MKYB 1P4XA 5AT1B 4PSWA 4YPHA 3CMAI 2R93J 4YORA 2LMJA 4FK4A 1YHQQ 3BJ6A 4ZZLA 3LDLA 3A01B 5F2RA 3EYIA 2R58A 3KFWX 1UG0A 4WQ4C 3BG6A 4FE4A 5KGWA 3SV3A 2XB0X 3LDPA 1RKWA 3TAPA 1VNDA 4BXXJ 2AKKA 1IBMK 2E12A 4FX4A 1BI4B 2QG9B 1LW0A 4IOCF 1JXSA 3RPQA 3GIBA 2CMPA 1EXQA 4G9YA 1QSSA 5GAN7 3VS2A 2XAGA 3UE5A 4RW4A 2D8JA 1R1VA 2WTEA 5H1SQ 4YDUA 3L7WA 1Q7YO 3LWMA 2E7XA 2FJ1A 1FYNA 1O3SA 2CH0A 3OMCA 4LE9A 3CCRA 4M7AC 2F4IA 1Z77A 4I6ZA 4CC7A 1W4SA 3CCUT 2OTLQ 1IAWA 3H3OB 4JUVA 3U1DA 1JJ2P 1K1ZA 1UE9A 1DDNA 2CFXA 4M3BA 3HK2A 3TW6A 4L8RB 5KQDA 3GF5A 4ON0A 2KAFA 3RZDJ 3FF5A 3CCLQ 3QU3A 4B8CA 4IHVA 2Y4YA 1NOZA 1TGOA 2QA4N 4MHGA 2UZKA 2BY0A 4PJOD 1E3HA 4X0GA 2KRNA 4M7DA 2X6XA 3ZT3A 1HMVA 1BA0A 1KZHA 1WJCA 2EGCA 1MJAA 2CP6A 2L7KA 1N8RC 1YX3A 2E2JJ 1YIJA 1Y0UA 3H3UA 2IS1A 3SYZA 4F7UA 2GOXB 1M30A 5AQUA 1QU3A 5HNHA 5KCMA 1HJDA 4CFCA 1YI2T 1MD0A 3GTQJ 1HA8A 4FWPA 1OQKA 2LYCA 3TVTA 1LWEA 2TCTA 4KUIA 4MZPA 3G1LA 1X3WB 3R4KA 4AC0A 4M78E 3QYEA 4XH5A 1B9FA 1MDUB 1GLDG 2I10A 2KRMA 1IRGA 2K9GA 1KLMA 1SFXA 4JLGA 3IKVA 1WJRA 1U5TB 2UUBK 4CZMA 2Y2ZA 4ZYGA 2MOXA 1RT6A 1KU2A 1HW5A 1TH7A 4OMNA 4UY8I 3CCJI 4GY5A 4C3HJ 4CGDA 1Y64A 2CDTA 1A36A 2FO0A 3FMSA 3TCJA 4KIFA 4EQQA 3FHFA 2UXNA 3CMEI 3DXMA 4QQDA 2XASA 2KJBA 2K79A 3WEEA 4JI2K 1WSHA 2Q0OA 2VXDA 1K6OA 3M54A 1MJ9A 1QPMA 3GWZA 3RCOA 2UYTA 3BGRA 4OGEA 3A03A 3GTGJ 2XDBA 1S6QA 2MH2A 3VTIA 1H88C 3TAMA 3QAHA 3S17J 1NZ9A 4BJ6C 3K2AA 1S72N 1H0MA 2A37A 5KGXA 4OKKA 3VSLA 1TWBA 1IUYA 2VJIA 1VQON 2W25A 2Y31A 3TO7A 2ROTA 1K8AU 2IVOA 3CJ7A 1P59A 5KE2A 2VT2A 3SBGA 1VQ4I 1WXTA 1B9DA 4LIVA 5LFAA 2EKHA 4HX4A 1FOXA 1GT0C 1QVGS 3G7ZA 2E5KA 1BIUA 2DJNA 4PKGA 4XBFA 1CF7A 3OYLA 4WQ5A 2RC4A 3ZL7C 3CQXA 1IREB 4ESRA 1LEBA 5L3EA 1BJAA 1XGSA 2D0QB 5E3OA 2O8DA 3R3LA 1TK0A 1UFMA 3EE8A 4JLIA 4C5EA 1N3AA 1MBKA 2DAQA 1IG9A 3WU1B 1K9MO 3I35A 3F73A 1TWCJ 4CUGA 3HOWJ 3SDGA 1BISA 1WFXA 3JCMW 5AJ3K 4DR5K 1HYVA 1ITYA 4IIOA 2IOCA 1HQCA 3I56A 5M1PA 1VQ9N 2Q2RA 3QG1A 1LE8A 3VEXA 1JE8A 3SD4A 1UEBA 3L1PA 3JCMh 4JI7K 3WVEB 2CWEA 4O0JA 3HSTB 2D45A 4DTJA 1LFPA 4DZPA 1QQCA 4FPBA 2PN6A 1GDTA 4B9VA 3P5JA 1U9OA 1LEAA 3SFZA 3U9GA 4XLEA 5J26A 4EMHA 3S2DJ 4CBWA 2KW4A 2QEXT 4CICA 1BCMA 4X9DA 3SMPA 2AHJB 5C2DA 2JRTA 4FYVB 2K27A 4ELYC 5LRRA 5AQNA 1AZEA 2M16A 2Q97A 2UUZA 5FLXO 2MPXC 2DXBA 1YJWT 3JCMe 4V2GA 3CJNA 3RMCA 1BJZA 3CCEI 3PQKA 3NGPA 5IOYA 3AVCA 4WXDA 2FG0A 1LFBA 2DA1A 3AA5X 3CCSQ 5TKWA 1OEBA 2PY5A 3CTAA 3OS5A 4FK0A 3RUXA 3L42A 3VQAA 2XHBA 3P39A 5GMKe 3AVNA 4OLAA 5HVQC 3WQUA 3CUOA 3JRIA 5IWAK 2V9VA 3AG2H 1MIJA 3THXA 3HG9A 3MPUB 2DN0A 1GBRA 1BL0A 2X1CA 5DM6L 4YPRA 3H0DA 4M3YA 3VU3C 5GADP 4HW0A 1EZZB 2EFIA 3FM5A 1RLQC 1TWGJ 4II2A 4UNFA 3PSFA 1YVUA 4K42A 5IN1A 3RQ4A 1IV0A 2BUDA 4B9QA 5LHGA 3AVGA 2M7BA 4NQWA 1YWOA 5CY4A 3S16J 1T3SA 2HD0A 3O5ZA 2OUMA 3DI6A 4ATOA 1IW7F 2GWKA 4EZ6A 3PVLA 4JJDA 1KCFA 2ZWHA 1Q1HA 1D0ZA 5LJ5j 2QSFX 3DYAA 3QWYA 3B8AX 4DTUA 1X2QA 3JW4A 2NUPB 1Y8RB 5F0HA 2D0CA 2V7YA 5KAIC 3CCVI 1AZGB 5TKYA 3K5MA 1R58A 2PVOB 3CJAA 1ATSA 1WA7A 1HLVA 4RW8A 1FX7A 1UTIA 2VKDA 1Q86C 1AWWA 4N4NB 4RTUA 4JX6A 3V9UA 2RNAA 3IH4A 4BY6B 4HNVA 4PGGA 3ME9A 2O3FA 4CCLA 5HROA 1QZZA 3KJVA 3LSHA 4LUDA 1NKEA 2P7CB 3CPWP 2JQ7A 1WLPB 1HSTA 3OWTA 4M3RA 1N5ZA 4JKAA 3V9XA 3ZQQA 5DCMA 1MZBA 2XAJA 3NF6A 2KKZA 4P9UA 4ESFA 2LR8A 4JKHA 3T7ZA 3PFIA 3RRGA 4IIMA 3CWSA 2A3ZA 3GEZA 2RN7A 3K4MA 3OYDA 3QJYA 2X78A 2CUFA 1WJQA 2COBA 2GBYA 1OYXA 2X6WA 3VQBA 1SVMA 2L3RA 2Q1ZB 1ZHIA 2F5CA 4LF5K 1NK7A 4H4MA 4F9OA 5D6XA 3JCMb 3I53A 4CZHA 1VQ5T 1JJ2A 3REBB 4DR3K 1D8JA 3EKUA 2VT3A 2FRWA 2O0YA 1XSXA 3BCBA 4FTHA 4QVZA 1VQNN 2CO5A 3OJSA 4XTZA 3CIPA 4CHYA 2BXYA 2FD5A 2JTFA 1Q9YA 3I55T 2HOTA 2RN8A 2HOEA 3IAM2 2HNZA 2XICA 4FU6A 1JI8A 2O9LA 4JJBA 4ZDPA 2EYQA 3AT1B 2DDBA 3I59A 4AH9A 1F21A 4Z4HA 3KZIC 5F08A 3TOAA 2DFIA 3CUQA 2L7MP 2DA3A 1WHJA 3C65A 1LDKB 1YJWI 3O4WA 2D1XA 3G0ZA 1Z6RA 5EY4A 3Q7CA 2W84A 1IKYA 3HL2A 3EG9A 2AT1B 3KFVA 1FYKA 1X6OA 3H35A 4BG8A 2YR2A 1LE8B 5DUKA 1JKPC 2JHNA 4JD2A 4CJ4A 2QVOA 1TYQB 4UXNA 1YJ9T 3KLOA 2CQNA 2DQRA 1KA8A 2E70A 2ZCFB 3KP4A 4IG3A 3VKIA 3JTHA 3BDDA 5GAN3 4FWMA 1IRFA 4H0XB 3HM9A 4N0AA 1JLCA 4NYNA 1SKSA 3W3CA 1N9SA 2ASOA 3BE3A 2MK5A 1YCSB 3JB9J 4NCBA 1JB0E 1TSFA 3MEUA 3HJFA 5DTDA 3N4MA 3BP8A 3I3LA 1V4RA 3OBYA 4M3XA 4ZYEA 1VSFA 4M7DB 2EV5A 3E1SA 2HTJA 3P9CA 4JKGA 3K70D 2L89A 1GLBG 5D4RA 3GFLA 4KREA 4Z4IA 1YJNT 4KN7X 3ZXSA 3CCET 2EIMH 1G8XA 2KDSA 4C0ZA 1IJWC 3PJRA 5E41A 2OTJA 3FXKA 1BA5A 3C6AA 4E4HA 2BYVE 4FXDA 1TW3A 4L9JA 4MQVA 2RQVA 1CXQA 1T39A 2EBIA 4E89A 3MZ8A 3GZNB 2RNGA 2M9HA 4J2BA 2HVSA 3RKQA 3TSZA 3FB9A 5GJWB 2E60A 1W7PD 4FM0A 1TUDA 2X6YA 4Y28E 4E7HA 3CCJA 4A3LJ 2FA5A 3HTVA 4JK8A 3DCFA 1IN7A 3HPGA 1X2MA 1U04A 3DLKA 4S05A 3NHGA 2J5OA 1NEGA 4CJKA 1S9HA 3CMEA 2K3YA 2M1HA 4RTTA 2P9LB 1TQMA 1ORKA 3OVNA 1BI1A 3UB5A 4BQAA 1H641 3I0XA 3RTVA 1E6HA 2KIUA 2L54A 2E71A 1ON1A 1NMNA 1FXXA 2LQNA 4OKJA 2L3DA 2WAFA 4B9XA 3CCJN 1ZARA 4IOAL 2PQ8A 5K1YA 3OYBA 4J9IA 3MZYA 1BGXT 1QE1A 2ASMA 1TWHJ 3BW1A 3J80E 4Q0BA 3BTJA 2LG4A 4M75G 4E6KG 4BR4A 2QEXN 1KYWA 3KP7A 2EA4A 4KHQA 3BJOA 4NO7A 2ZPHB 4IHTA 1I6XA 2MH9A 1N6QA 4HNTA 3MEEA 3WG9A 2NOZA 3OSGA 4ENNA 1ZR4A 4RAFA 3G4SA 1GOCA 4CZEA 4AFZC 4BRIA 1X01A 2RHKA 1CQTA 3P83D 1M1KU 1QVFS 2NNWA 3O3KA 2ZXJA 1B8IB 3ULDA 4YDUC 3SMSA 1LDDA 4E9FA 4CBUA 1BOAA 3NRVA 3ESWB 1ETVA 3LWFA 4LFUA 1I4K1 1MUZA 4XH4A 4PFPA 5FDLA 4PDKA 4C8LA 1BKBA 3QBYA 4AT1B 1PWTA 1IZ6A 4XKWA 1ZXOA 1YF5L 2HF3A 4CO8A 2STTA 2E1NA 2XROA 2O8KA 1VQKI 2NOJB 4BUPA 4XRFA 1KC8R 2A68F 1N36K 1MUNA 3SUNA 4GKJK 5HCKA 3CWTA 4WFNL 2K9QA 2OZMA 1KQ0A 1AOYA 1R0AA 4FLWA 4BE2A 4EW4A 5F0FA 2JPSA 3THYB 4LD0A 3A2FA 1PG5B 5CYVA 1DTTA 1R4NB 2QQSA 2EFNA 2KRSA 1LAVA 2DTZA 1S1WA 3GNGA 3I55N 1UHMA 3H3ZA 1X69A 2JUFA 4L0ZB 2MA3A 2NWMA 3FBNB 3TSPA 5CPRB 1VSLA 5GMKm 4PFZA 2A61A 1K4US 4FJGA 4XU0A 2VOPA 3LDSA 4NL2A 4CI6A 1GCQC 2BE9B 3JSMA 4G9ZA 1GOAA 1SAZA 3CCEA 3CDLA 2MCNA 3AL0C 3OGDA 1S1NA 4I02A 1SAUA 2M0YA 5FPDA 1T08B 3SQ2A 1RDUA 2O4IA 3R1XA 2I5JA 2I0NA 2MC3A 3HOSA 3G6EI 3PFYA 4D1QA 3EUAA 1TTYA 4NC6A 3W2VA 1U06A 2YX4A 2DIQA 4DQ8A 2RVCA 4BH9A 3R0AA 5J47A 2EYXA 3NF8A 5HP1A 1YW8A 1VQ6I 4A4FA 3QYBA 2QTVA 1QVFP 4A2UA 2UWMA 1HKGA 4CYDA 1QCOA 3KK2A 4ENMA 1VQ9T 3C7NA 2P7VB 1WGSA 3IRXA 5JMVA 1YHQI 4XEIA 2O8EB 4P9FA 2COWA 2K2MA 3SV4A 4CGIA 2LF8A 1FJLA 4HCBA 1KFZA 1OU9A 2FPDA 2QKKA 4PJOC 2CP7A 5BS6A 5BRDA 3GLXA 3CO7C 1N5YA 1H8AC 4WXHA 2A36A 3RDVA 4A54A 4JBAA 1U4BA 5J40A 3J81Z 2M5WA 3WXMB 3ERED 2G9WA 4M7DG 2ED1A 3ZSOA 1B9NA 1QVGA 4PUOA 1XB4A 4JRIA 1VQPI 4IUPA 3EZ5A 4CJFA 1C0FA 3F21A 3BOQA 5AQTA 2PJRA 1VIEA 2W00A 3OOPA 1BR2A 5E18F 1VQ9A 1OKJA 1K6YA 2XPWA 2XHCA 3JREA 2HDWA 4RW9A 4DSLA 3QWLA 1UAXA 4OPJA 4PKCC 3TP3A 1R71A 1NJIU 1K9AA 4I7FA 1GXIE 5JVTA 3B73A 2LF7A 3UA7A 3B6PA 3CCRQ 2ELKA 1JEGA 4FZZA 4G94A 4MZMA 3DLRA 1QNTA 2W1OA 4X64K 1IV8A 4DV5K 3G73A 4HTUA 2L01A 5HDNA 4C8QG 3V8LA 2G8WA 2JT1A 4X65K 5GPCA 4FT8A 1HC8A 4IO8A 4JI3K 1X1AA 2GTDA 5GAMh 4I2QA 3RZOJ 5CJ9A 1VTNC 5CKTA 2DODA 2R3SA 1OPKA 2YSQA 4A3GJ 3CJCA 4CJSA 1MH4A 4FYWB 1JUMA 1XCBA 1F5TA 2L7ZA 1MKMA 1QP3A 2KI7A 1NNEA 5LEJA 1VQOA 1UGSB 4JZ4A 3HYFA 4K8XA 1JCEA 1XNIA 3SHFA 4B9TA 3CCVQ 1RFQA 5HRRA 5I21A 2CP0A 2Y75A 1YUWA 4XK8E 2XD0A 1ZUKA 4AYBN 3WU0A 1VIFA 3CCLA 3HM8A 2ZMEA 1NJIC 4ZJZA 1YX5A 4C0GA 4KA4A 3TSWA 5CKFA 4C0FA 2FLOA 3V6DA 3HXLA 1RLPC 1Y7XA 2MMPA 4PJLA 3LM2A 4ID1A 1Y96A 3DKXA 4N4IA 3G4SQ 4MDXA 3TAEA 1TKTA 1JU5C 1YJWA 1YI2N 2YHAA 2ZE2A 4E19A 2B5JA 2DL3A 4CRIA 3G3ZA 2Y0SA 4ZDOA 1WPYA 3IFRA 1IBKK 3N5BB 1SVLA 2DTIA 4FYXB 3H3VK 1M1KC 1J5EK 2WWYA 2YRCA 1JLGA 2IBDA 1RRJA 4Z02A 1KYZA 4J9FA 5LD2C 5GTHC 2GXBA 4GYIA 2KE9A 1NYGA 4DQIA 2RMOA 3JCUC 2XG8D 4OINF 3L1AA 2LOOA 4J9GA 1CZBA 1QZ5A 1ZYQA 4B9MA 1EH7A 1LKXA 1YRNA 3JRZA 2NVTJ 3C6HA 4CCJA 2P9IA 2QA4I 4PY5A 4B09A 2FOKA 3VYSB 1M2VA 1DGRM 3QQAA 1ZQ1A 5DM7F 3IG1A 2CV0A 2YHWA 2K9SA 1IRXA 3RMQA 2YU9J 3E6BA 2JW4A 4CEBA 3CCUQ 4A93J 3NFCA 3PMTA 4M3DA 4L9TA 3GZ5A 1G6NA 2C0TA 4LF7K 4Z89A 1ZN2A 4DWIA 4CHOA 2PYLA 3T3FA 1SMYF 2KK4A 1N9RA 2P84A 2LNHB 2XRNA 1QZEA 1JRIA 2P81A 1VUBA 1CZAN 4KRTA 1V5FA 3F9MA 3M55A 4K25A 2H56A 3V1QA 4FJIA 1ZA2B 2BV6A 2OU2A 1RGIA 1DP3A 2A6AA 3QESA 4M3ZA 4OWRB 3CC4Q 2J6KA 3H08A 2EPFA 1AWJA 3VF6A 1B6AA 4KGVB 3D2EB 2XY7A 5HOOA 4N0BA 2BW3B 2NOEA 4KBMB 4O4GA 3RQIA 5F1XA 1KD1C 1HYZA 2KFDA 3LH0A 4CIEA 5GP9A 4EM0B 1FTTA 1K4SA 2XAHA 3VW4A 1T98A 2FL7A 1WH5A 1XDUA 2R5YB 2XY5A 1RZ4A 4RGXA 5ILUA 2E7WA 2DEUA 4ELTA 4GV6A 5EC7A 4HX7A 1IDYA 1RR8C 4A59A 2UUAK 4FJHA 1WJSA 5GANd 4JJNK 3HSCA 2E34A 4CJVA 4XRMA 3RSEB 3OYMA 4IRGA 2JTEA 3FWEA 4LH4A 3CCQA 4ZN3A 3EFOA 3I8DA 4BGBA 5F64A 1ZSZC 3HGYA 1ZHFA 3PSIA 1MSEC 2HZYA 2P9NB 4F8RA 3M8RA 3ZT1A 3SQ4A 2W41A 2B4JA 4GW6A 1JJ6C 5LEKA 3I56Q 4BS9A 1OPLA 1VQ9Q 4AVZA 1YS7A 4HEA2 3WNEA 2OA8A 2KRHA 1RBTA 3W6JB 4Y15A 1Y71A 1VRUA 3A1YA 5J8CA 1HYOA 5CQEA 3HL8A 3NEUA 2QASA 4MEYF 2QEXI 3M56A 2EILH 1VHXA 1A5VA 5IHIA 1WZ2A 2D5RA 4M3WA 4HLYA 1RCHA 2R7UA 4ELVA 4R5PA 4EJWA 4LK0F 1SL1A 2VQGA 1XWLA 5LGNA 2EJ9A 3BY5A 4M75F 1OCZH 4MO5A 5D8KB 1QKWA 1QW1A 3IH3A 3META 2JA2A 1U78A 2DQLA 1PYVA 3K5OA 3OA6A 4CHPA 5KYYA 1LUJB 3FR0A 4KBOA 1WNLA 1LPLA 1J3TA 4FW1A 1LVAA 2M8EA 2VXFA 4MO4A 1SSFA 3VDXA 2BANA 3J7YJ 3X2QH 2EFPA 4PFOA 4GFBA 4CC4B 4G1QA 2CKKA 3NH1A 2DTUA 2JOYA 1X1PA 4RLFA 3TOBA 5DV5A 1KLNA 3ZMZA 1XMQK 3LSGA 2Q36A 4PLLA 2YUSA 4CC2A 3RMBA 2QK9A 4CZJA 4O3MA 4HKEA 2FXAA 1VQKN 2EKOA 5LY3A 2GLOA 3JRBA 4R55A 2F96A 1RNHA 2ZJPL 1T05A 4AFUC 1Q7YU 2RQUA 4C92F 1WI7A 4Y91A 2HVRA 4M78G 3DBLB 3OV8A 1P92A 4J6YA 1S1UA 4KI4A 5JVHL 5GAGP 2ZCWA 1I5ZA 2O4XB 3BFMA 1JT6A 1QCNA 4FSXA 3M3ZA 4QPQA 5GPAA 2YRVA 2MLKA 2QWLA 3QDFA 3CLOA 5DEQA 1UA0A 2LKXA 3VODA 5I2MA 4XOPA 1FOYA 1WQWA 5C15A 5J6XA 1VZ0A 1YQMA 1X9WA 3LWHA 4N5SA 5GAEJ 3HJEA 3M8SA 4J7IA 1J5OA 4XKBA 1F4KA 2WB1A 2AK5A 2X9HA 4B1XB 1Z6TA 4CF9A 4UQGA 4H5WA 1YG2A 2XDDA 3CBMA 4B08A 1W0HA 3A98A 1VQ4A 5C44J 2ECCA 1XHZA 3G25A 4L6V5 2AQFA 5CKHA 3CFRA 1NK3P 1SKWA 2MSYA 2QWWA 5D8LB 1K73O 3GG4A 1S9GA 2RHZA 1VQ6N 5H2FC 2LQ8A 1BC8C 3K70C 3QOEA 3PUBA 5E3LA 2EJRA 3TR8A 2LK2A 3TEDA 1MBJA 2NRZA 3OW2P 1N27A 1F1ZA 3TBIA 3ISPA 5C12A 4OX9K 2L0AA 2AQEA 1U1SA 1ZGJA 2VYPA 4DR1K 2CV2A 2LCSA 2XKOC 2O4GA 4IX7A 1XQPA 2DL5A 4MDWA 2IA2A 1USTA 5GAMd 1KEAA 4HTLA 4M42A 1BM9A 1VQ7Q 3M8QA 3TSQA 3LAKA 4B9WA 5GMKh 1S72A 5KCHA 1U47A 3N97A 3J8AA 1XS9A 2A5WA 2XPVA 3FZKA 1HDDC 2GZWA 2YHTA 4AI4A 1H9GA 2HMPA 2QDLA 4M63C 1D1CA 3J81K 1KU3A 1NMDA 4KTWA 1S7AA 3H1CA 3X26B 1Z9CA 1LMZA 3E5UA 1P4WA 3I5SA 4C8QD 1M3QA 5HLFA 1TG0A 2BY3A 1K73U 1KIKA 3WEEB 1YJNI 1B8IA 5I42A 2DVEA 2K3PA 2JNGA 1H3ZA 5J8FA 2L8DA 2EIFA 3NHNA 2HPMA 6PAXA 1AWXA 3VS7A 4KH1B 1C6VA 1O57A 3LAPA 5TISC 1PU7A 3K57A 4KTQA 1U6ZA 3F70A 2H8WA 4LSLA 5KRTA 3OYEA 2M45A 4L9VA 5IP9J 3WHBA 4GV3A 2HKXA 2P8TA 2HVHA 1BA1A 1J54A 4OIRF 3TARA 2QI2A 5ADXH 4W5QA 3ELKA 3DWLE 1NGDA 3RMAA 6AT1B 4KH4A 1Z67A 4KFCA 4LF9K 2E6MA 1SD7A 1KVCA 3KK3A 1LVKA 1YIJN 1BI3A 3MXMA 3EPZA 4LXCA 3SEMA 1VQLQ 2Z9OA 2NUBA 1NHAA 1IF1A 5BNGA 2BIVA 2HHQA 4OFEA 1LB2A 1NJIO 3LSJA 3V4IA 1I39A 4GVMA 1ETYA 2LCLA 5GAOp 2K85A 3CESA 3CC2A 5JLHA 4K11A 4CF8A 3D5SC 4HCCA 1ZC6A 3QEWA 2LBFA 1L3TA 1T0JA 3MHXA 3O9QA 5CQGA 2CZ0B 4CGGA 2M87A 3EGDA 1VQMN 2Y9YA 3HUGA 3VGLA 4FWSA 2GA2A 4B1WB 2CYYA 2X1EA 4KHUA 5LMNK 4BUGA 4LY7A 3N0UA 1VQMA 4FYYB 4FO0A 2EAYA 4EJVA 2RKHA 1JUSA 2RQRA 5K5OA 3JAMO 3BF1A 4B3RK 4OMPA 4ZTJA 4DW6A 3CD6A 2KIQA 3IKMA 4DQPA 1WQ2A 3M9QA 4CERA 3LDQA 4M71A 1YITN 3SQNA 2F9WA 3E01A 4IDKA 2O31A 1A6QA 2P0KA 1K73C 3VUZA 2EH3A 3A5LC 3AGKA 4W5RA 1GLCG 5GAHJ 4CH7A 4BGAA 1YCYA 3O1BA 3B6AA 4MLOA 1NG9A 1HSJA 3WODF 1HNWK 2M51A 1QVPA 2YNHA 3AA4A 2F2XA 3SPZA 2ABKA 2E5LK 3CF5L 1D4XA 2J6FA 2P0QA 2JMCA 2EBPA 4FM4B 1ERDA 2O88A 3AA2A 1OV3A 2PFBA 4M7AF 4RAZA 4KN4X 4ISEA 3A8YA 4RUGA 3CQZJ 3KKRA 3ZX3A 2RH2A 3QBWA 4BVPA 1ZK8A 3M8PA 2QKBA 2A3SA 3AVFA 3CCSI 4F4KA 2A41A 3CHWA 3ABLH 1XHXA 1PKSA 1U5SA 1S5LC 5JVGF 1W2BS 1WB9A 1PP7U 4H4KC 2LP0A 4OMZA 2JS2A 4LFBK 3CCQI 2BY1A 3LH5A 4A3DJ 1YJ9Q 4G6TB 4DOWA 2DOFA 3OW2A 2NLUA 4LLGF 3I0SA 1QZ6A 4XU1A 4Q5SF 1D8KA 1WWXA 5CK9A 2D5VA 4M72A 3LMMA 4DUZK 4DTNA 3CPWS 1GLNA 5KNLA 1VSKA 4J9BA 3QPLA 1RADB 2V1QA 4CK1A 3HRUA 2IGIA 5L3CA 3JRHA 1WN7A 2KIFA 4EMSA 3CCEQ 2Z1GA 4FCYA 5D7UA 5AYFA 2WA0A 3Q1JA 1S7EA 2V75A 1RT5A 3JS6A 3QPSA 1Q82O 2KISA 4XSZF 4KH6A 4EATA 3KETA 3K7AJ 4AILC 3M4YA 3FHNA 4PJOA 3RJPA 2DTRA 1NPPA 2KDOA 2VE9A 3VS4A 2ZZDA 4ZTFA 3O9RA 4DV2K 2GXAA 3LSIA 1GVJA 4AIKA 3UKUA 1NK8A 3CCUN 2QKMB 1L5UA 2RAEA 4Z4FA 1SKRA 4DSEA 2GCXA 2RV8A 1VQ7N 3JAME 4CEAA 3E5QA 3RYPA 4RTFD 1NK5A 3EY1A 2WV1A 1YIJI 2PU9B 3H0FA 4RB0A 4CCMA 4RBOA 2GFAA 2RKIA 4OLBA 1MV3A 4BRGA 4QVDA 1Z91A 2PTKA 3BG9A 5B1AH 4NYFA 1VYUA 3OSVA 1NGBA 4J9EA 3ONQA 1D3YA 1HOMA 1B9MA 2CH4A 1YYVA 3ZBDA 1Q81U 1ASWA 2GAUA 3IUCA 3ZT4A 1JXBA 5FWBA 3DXKA 2VBWA 1TUGB 4OJRA 1X4PA 2QGUA 4MNUA 5JVGL 1IKVA 2JS0A 5KYWB 2DJQA 1VQ8A 2ECBA 1JKQC 2QTDA 2NOFA 1YE9A