3L2QA

Crystal structure of the prototype foamy virus (pfv) intasome in apo form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 97
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2qA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2qA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2qA03
1TKZA 1HMVA 3V9UA 3SUQA 4TSXA 3H8ZA 5KE2A 4Z4HA 5DK5A 1KLNA 4FW1A 4CJKA 2FBTA 2P51A 4DSJA 1XI1A 4CE9A 4M42A 2RO0A 3CFOA 1VSIA 4CEBA 5KCOA 4UQGA 4DTOA 4FLZA 2XY7A 1EX4A 2HHXA 1TAUA 4J2DA 4FLVA 3ZSVA 3TR8A 1SV5A 5J1EA 3V9XA 3HPHA 3U3GA 1GOBA 3O4QA 4KHYA 4CIGA 4KHSA 2PQWA 4OGEA 5C6SA 5D3GA 3TAQA 2A1SA 4QQDA 2HMIA 2RI5A 4CRIA 3CG7A 3OYNA 3AO1A 5FRMA 5K14A 4DFJA 2XY8A 4NCGA 4CEOA 3HM9A 5SZTA 1XHXA 4C8OA 4FM1A 3THVA 2F5KA 4I7FA 3NFAA 5HRNA 4KTWA 3ZSRA 1EETA 4QOZB 3LP3A 4CHYA 1HYSA 4W5TA 4DU4A 1X9WA 1YT3A 3TAEA 3LWMA 1HNVA 4KRFA 3DRSA 1C1CA 3SUPA 4GW6A 4DTJA 3NH1A 3TABA 3FLGA 3KTQA 3I8DA 2LCCA 1CZBA 5J39A 2HB5A 4FJ7A 4CESA 4ID1A 3PY8A 5IAYA 1OZ2A 3OYLA 2P0KA 1BISA 4FK2A 4CEAA 2RPIA 3LLRA 5J2NA 1BIZA 2GFUA 5CZ2A 3KK1A 3O3HA 3AVNA 1ZBFA 1Q8IA 3DOLA 2YNIA 3KLGA 3K5LA 3V1QA 1IKXA 3VQCA 5JS2A 3MAQA 5KGWA 3SQ4A 3O3FA 3I0RA 4B8AB 3AVGA 4DLEA 3S3OA 3SV4A 4N5SA 1SKWA 3VQAA 4MFBA 2QXFA 3RR8A 2IDOA 3V81A 3PUFA 2EKOA 3T19A 3PFSA 3KD1E 1TV6A 2P5OA 4HCCA 3AVCA 4M3YA 4FZYA 2QKKA 3OYGA 1J54A 1TL3A 3EY1A 4B9VA 4KREA 2RKIA 4Z4CA 2FBXA 1JL2A 1ZBHA 4CK3A 1SSFA 4CHZA 1X9MA 1LV5A 1ASWA 3LANA 4KB0A 2O4IA 4JRQA 4CJEA 4JRPA 3HXMA 2QKBA 2GUIA 1BI4A 3NH0A 4C8MA 3AO2A 2ZQBA 1RTJA 1OI1A 1JLEA 1WN7A 1SL0A 4CECA 2XHBA 1Z26A 3IAYA 4CF2A 3ZT4A 1UWBA 4OKJA 3DI6A 3ZT0A 3TWHA 1W0HA 2D5RA 2EQJA 3HP9A 3FDRA 4Q5WA 1WSFA 1WGSA 1N6QA 4E0DA 3LP0A 4LSNA 2OYQA 3AO5A 3C4SA 2XY5A 3NGYA 2VWKA 4NYFA 3ZSYA 2Y1JA 1GOCA 3MXJA 1SL2A 4FLWA 2D0BA 2RI2A 3NTHA 3M8RA 4CEDA 2G8KA 1RBUA 3TAGA 2MWPA 2M1HA 2X4YA 3ASKA 2KFZA 3E01A 2RHZA 5I42A 3LYIA 5D6YA 4IURA 2HVIA 1T05A 3AV9A 4C5EA 2DFFA 2HHQA 3SUOA 4FM2A 4HUFA 4CK2A 1UAXA 3DLBA 3TAMA 4C5GA 1RI0A 4PUOA 4I9LA 2ZE2A 1B9FA 3VQBA 1WSHA 3V1RA 2VWJA 4M3XA 3VQEA 1NKBA 3P8HA 2R5AA 4K8ZA 1QHTA 4PLLA 3L2RA 4CK1A 2LSNA 1QQCA 4F2SA 3CEYA 4J2EA 1C1BA 2YHAA 1JLFA 4YNQA 1KLMA 3OS0A 3AVHA 2MWOA 1ZBUA 4A4EA 2R7YA 4FXDA 4N4GA 3LDSA 5J2QA 3C94A 4KHWA 5FDLA 4PLIA 1LWEA 1U47A 5CZ1A 2L89A 4M3RA 4Q0BA 2EQUA 3NF7A 4Z02A 3OYMA 1X1PA 3OYIA 5J26A 3L2VA 2B8AA 4CJTA 2JLEA 4B8CA 2Z1GA 2BANA 4CJRA 3DLMA 2BGGA 4MQ3A 4RW8A 1VRUA 1RDCA 2IGIA 1H3ZA 3DLGA 4HVJA 2DIQA 4N56A 3EAEA 3BDLA 1RBVA 1Z25A 4B3OA 4CIEA 1X9SA 3ZCMA 4E19A 3MP8A 1U49A 4L8RB 2G8WA 3ISNC 4NYNA 3DLKA 1WNSA 4NCBA 3K59A 3MEEA 5C24A 2YNHA 3LAMA 3MEUA 3ZSOA 3MEDA 4FK0A 1DTTA 4FU6A 4AHSA 3ZT3A 1RT3A 4OGCA 2OPSA 3PX0A 4DF8A 1BCMA 3V9SA 3AVMA 1N5YA 2DFEA 2YHBA 2ZD1A 3OYKA 1NJXA 3IG1A 4FJHA 2W42A 4FLXA 4QQGA 1QSLA 3KKSA 4KKOA 1WLJA 4W5OA 1T03A 4FJMA 2XY6A 4E7HA 3ALYA 3OYEA 4OLBA 3OJSA 4OPKA 4DU1A 2YKNA 2RJFA 3U6FA 3RR7A 3K2PA 2HNYA 4O5BA 3MEAA 2B6AA 4PY5A 3V6DA 1KSPA 3O3GA 2ATQA 5HRSA 2OPPA 5KGXA 4OJRA 3H6ZA 1A5XA 4BD3A 4CGGA 2P1JA 2BKDN 3ZT2A 4H4MA 4GVMA 2O4XB 3DRPA 4CJPA 2G3RA 2WONA 1NK7A 5HP1A 5DMRA 1NK4A 3S9HA 3SV3A 1U45A 5FRNA 4DSFA 4M45A 1HNIA 4J2BA 3D45A 4IG3A 3V1OA 4OKEA 3L3UA 1YVUA 2IAJA 3G10A 4N47A 1TK5A 3K5NA 1J5OA 3VQ6A 4QW2A 2Z1IA 3BGRA 2KFNA 2HQEA 1HQUA 3AA3A 2OA8A 1Q9YA 2A1RA 4A4FA 1TVRA 2Q3SA 5KI6A 2DTUA 3DB3A 3M8QA 3ZSZA 1D5AA 2YRVA 3PO4A 4R5PA 4FJLA 3VQ4A 3OJUA 4LD6A 1EP4A 4O4GA 4DQPA 4W5RA 1TK8A 2F8SA 3LX7A 2LTOA 1XHZA 1FK9A 1L3SA 3LAKA 5HRRA 3KUFA 4HUEA 3KIOA 3HYFA 3MP6A 4E89A 3K57A 2G8HA 3S3NA 3MP1A 3M8PA 5SWMA 1JLBA 4NCAA 4B9UA 4Z4FA 4PA1A 4CGJA 3U3YA 1ZYQA 1RTDA 1D9DA 1Q9XA 2RHYA 1S1XA 2O4GA 3OB9A 3DMJA 4CGFA 1C0UA 1VSDA 1RT6A 4M41A 4CEZA 3L42A 5KRTA 2R58A 4E7LA 2HVHA 4KTQA 1NKCA 4I2PA 4E1NA 3P5JA 3QKJA 3HSTB 4B9MA 1BQNA 4DTNA 4A4HA 1QTMA 1JLQA 2GBZA 4AILC 2R5MA 3OYCA 4AHUA 2RJDA 3QBYA 1HRHA 5FROA 4QCLA 3B6PA 4DSLA 3META 1WSGA 2E5QA 2X78A 1XC9A 4FZXC 1ITGA 2PYJA 1U4BA 1RT5A 4BDYA 1ASVA 3QETA 1RNHA 4DQIA 1TAQA 4ZTFA 1RT7A 4M3ZA 3AVFA 2IOCA 1JLAA 4DFMA 4CJVA 1WJRA 4C5HA 2F8TA 4CERA 4CEQA 4DS5A 4FJNA 4ELTA 4N4HA 3HO1A 4BE2A 3ZT1A 2RJEA 1B92A 1J53A 3DYAA 3DM2A 1BQMA 1G15A 3OA6A 3SQ2A 3NDKA 1TKXA 1ZBLA 4CHNA 4HTUA 4QQ6A 2VG5A 1LW2A 1F21A 3AVBA 2B4JA 2FBVA 2HHWA 2M0OA 2KTQA 1NK6A 1RDBA 1IKWA 1KHCA 1G5VA 5E41A 3KK2A 2G8IA 2XDPA 4ZTJA 3PX6A 3LP1A 3K5MA 4IUVA 1WJQA 3F70A 1VSMA 4IG0A 2FBYA 3LPTA 3QERA 1U48A 2Z1JA 3NTKA 4F8RA 1HPZA 3L3VA 3Q1JA 1ZBIA 3FFIA 2I5JA 4CJFA 1MU2A 1C0TA 3AO3A 4LD0A 5C42A 1I39A 3LWLA 4IFVA 3AVAA 4IBNA 2FC0A 2HNZA 2BIVA 1BCOA 1JLCA 2GV9A 3RRGA 2OZMA 2X4XA 2PYLA 5M9OA 1RT1A 2GF7A 4AHVA 4Z0UA 5CYMA 4LH5A 1VSFA 2AJQA 1A5WA 3AVIA 2LVMA 1UOCA 3T1AA 2RN2A 4C8LA 1ASUA 3TAFA 3QESA 3DLEA 2BE2A 4KPYA 2HHSA 4IUPA 4FW2A 1S1TA 4E7JA 2O4XA 5CY4A 1T7PA 5CIUA 4DS4A 3NGIA 3C6TA 2D0CA 4N41A 3PNWC 1LWCA 1S5JA 2R57A 5J2PA 4B08A 3O4NA 4GY5A 3JYTA 2XRIA 1GOAA 2M16A 4FJ5A 3SNNA 3LZJA 1C0MA 4AH9A 2HHVA 1C6VA 1RBTA 4CJUA 3I0SA 5IN1A 4X34A 1JLGA 4RW4A 3CQ8A 3F73A 4FLUA 3RWUA 2P5GA 4DF4A 4FJJA 3LALA 4EP5A 3ZSQA 1S6PA 1HYVA 4FJ8A 1NKEA 4JS5A 4FL6A 4CFAA 4RW9A 3QIIA 3RRHA 1SL1A 1RT4A 3QEVA 2KZZA 3KKRA 4F3OA 3SQ0A 1DTQA 2X4WA 4Z4GA 2KQ2A 3OYHA 2E6LA 4LY7A 4FYDA 4KV8A 4CGIA 1D8YA 2E6NA 2EX3A 4A4GA 3LGFA 1RT2A 3D0PA 2Y1IA 2HQXA 1J9AA 3OS2A 2NLUA 4FVMA 1D9FA 4L59A 1FXXA 5CYQA 1S1UA 4EDUA 3NTIA 3JSMA 1T8EA 1QE1A 3SD4A 3PMTA 3CFPA 2X6NA 4ID5A 3C95A 3HPOA 1JXEA 3LGLA 4AHTA 1A5VA 1L3TA 3QEIA 1UA0A 2VYTA 4CFDA 3VA0A 4KTZA 4CF8A 3V9ZA 3NAEA 4DSIA 3M9QA 3WNFA 3IRXA 4GMJB 4CF1A 1VSJA 2OPQA 1NOYA 3RMDA 5KH6A 1VSHA 1SKSA 1KFDA 4DMNA 2PZSA 2IC3A 3DRRA 4I9QA 3A2FA 4CFCA 3PX4A 1RBSA 4FJIA 4IDKA 3O8VA 2LDMA 1BL3A 3VQDA 2F96A 1NK5A 2QK9A 4ELVA 1S1WA 4Z4EA 1WAFA 1MHNA 3HK2A 4O44A 2VG6A 3HVRA 1KVBA 4E7KA 3CM6A 4ICLA 4CJ3A 3CM5A 4DWIA 2DY4A 3UWNA 2QQRA 3HP6A 4B9WA 3PV8A 2YKMA 3L2WA 4O55A 2DIGA 4CJQA 3NF6A 4WE1A 3LPUA 4K8XA 4CHPA 4DQRA 4C8KA 4BWJA 1VSLA 3QNOA 2JTFA 1JKHA 1N27A 4IFYA 3EYZA 3UIQA 1KFSA 2EHGA 5C0MA 3LP2A 4EZ6A 3DLRA 1QS4A 3QO9A 3GOXA 3WNHA 1NK0A 3BDPA 4KB1A 2BDPA 3SPZA 1XNIA 2RHIA 3DB4A 3V9WA 2L8DA 1WSJA 4FM0A 2D0AA 5HBMA 4PQUA 1CXQA 5HROA 3M8SA 3QEPA 2CKKA 2XO7A 4RW6A 3AVKA 4EP4A 1TKDA 4W5NA 4PL6A 3SUNA 4JS4A 4KI4A 3MXMA 3RTVA 3RMAA 4BDPA 3HL8A 4FLTA 3ZSWA 3K58A 1UA1A 1KRPA 2RHXA 4OLAA 2IG0A 1QSSA 3K5OA 5I3UA 3QNNA 3FC3A 5T7BA 3FEOA 4YFUA 3B6OA 3TARA 3EZ5A 1IO2A 2E4LA 4N76A 4Y1CA 3DOKA 2K3YA 2RJCA 4FJ9A 3OQ5A 3AA2A 3WNEA 3TAPA 2HHUA 4IUUA 2GFAA 4RG8A 4CGHA 3QLHA 4HHTA 1B9DA 2DAQA 3QIOA 3VN5A 4H8KA 4CGDA 1HJRA 1HYZA 1BHLA 3SYZA 2E6MA 3NF8A 3KJVA 2RI3A 4E3SA 4FK4A 5D6WA 4BWMA 1SUQA 1QSYA 1IKVA 3SQ1A 1K6YA 4QVZA 3VQ8A 3NF9A 4OKKA 2RF2A 2EQKA 5KCHA 1LWFA 4CJ5A 5D6XA 1LAWA 1LAVA 3P83D 1SKRA 2DFHA 3AA5X 3NE6A 3VQQA 4DTMA 4KFBA 4CFBA 1OZ3A 2EQMA 3E9FA 1RTIA 3CYMA 4CJLA 2RHUA 4FJKA 4DFKA 3C6UA 3L2QA 4OVAA 1RDAA 4O0JA 2HHTA 3ME9A 1XWLA 3TI0A 4AHRA 3P1GA 3VQ9A 2VG7A 3DLHA 4B9NA 3AO4A 2K3XA 4CJSA 3SCXA 3QEXA 4B9SA 1CLQA 1KVCA 3T3FA 1RILA 4DG1A 3OY9A 2IS3A 4OVLA 4IKFA 4CHQA 1O1WA 3KD5E 3KLHA 4B9TA 4KHUA 1YTUA 3PMIA 4DTSA 2YV0X 1WAJA 4HUGA 3S6WA 1S1VA 3HT3A 4KHNA 3QIPA 4ZHRA 1L5UA 4CF9A 4DLGA 4KHQA 3LZIA 3QEWA 2JZ2A 1KCFA 4JLHA 4CF0A 3SJJA 4AHCA 1JL1A 3OYAA 4Y1DA 4Z4IA 1NK8A 4M3TA 4CEFA 3MECA 4G1QA 3ULDA 4IUTA 4CHOA 1BGXT 2EFIA 4J2AA 4W5QA 4CIFA 4IUQA 3L8BA 2B5JA 4BDZA 1NK9A 4B9XA 4CJ4A 1REVA 3G0ZA 4F3TA 1C1AA 2X35A 5HLFA 4RG2A 2KW4A 3OVNA 3E9GA 3MEWA 2D9TA 1DLOA 2PY5A 2BUDA 1W9HA 5KRSA 1RBRA 4RW7A 1VSKA 1R0AA 3H08A 1NJZA 1CXUA 4H4OA 3NCIA 4E7IA 3OMGA 1L3VA 4BE0A 4XIUA 4CCHA 4NZGA 4FCYA 2LRQA 2OZSA 2OPRA 1TKTA 3VA3A 1S9GA 3MEVA 4FJGA 5JS1A 4FJXA 4B9LA 3OMCA 3CFRA 2XK0A 1NJWA 3F9KA 1LW0A 4KO0A 3OYFA 2KZMA 4DFPA 2ITGA 3S3MA 2HNDA 3SI6A 1KVAA 3ITHA 1TGOA 3ZSXA 1EKEA 1CZ9A 1S6QA 1IH7A 4F2RA 1KTQA 4C8NA 3QJ6A 2L3RA 1NOZA 4CJWA 4DQQA 4KAZA 3TANA 4M3WA 3KLFA 1NJYA 3P8DA 3HPGA 2G8FA 4UC4A 1JXBA 3IS9A 1TL1A 4DTXA 4F4KA 4LH4A 4DQSA 3LH0A 5C25A 4DTPA 3OYDA 2JGUA 1TK0A 4QAGA 1Y97A 2X74A 1WSIA 1FKPA 1L3UA 1IKYA 2YNGA 3KLIA 1RTHA 4KI6A 4O0IA 4FLYA 3WNGA 1VK0A 3VQ7A 1VRTA 4PWDA 4EZ9A 4DSEA 5KE3A 1YTAA 1VSEA 4HCZA 3HVTA 4M3UA 4DTRA 4LSLA 4CEEA 4N4IA 1I3AA 3ZEHA 3MEGA 2FHDA 2NUBA 3HJFA 5EU7A 4NS5A 3PO5A 4OPJA 3VQ5A 5J2MA 1WSEA 3RMCA 2G8VA 3MO8A 3MXIA 1BI4B 3L2UA 3AA4A 4DU3A 3SPYA 4BACA 5HRPA 3NNQA 5KTQA 4HCBA 1S9EA 2WOMA 4C5IA 2QQSA 3V4IA 3SZ2A 4DTUA 1FKOA 2Z1HA 4DSKA 2G8UA 3KLEA 3UT1A 1EXQA 3NGZA 1HQEA 3OS1A 3NH2A 1RDDA 4Q5VA 1OYXA 1RCHA 3KK3A 3VQPA 3AVJA 3QINA 4FZZA 1BIUA 3AVLA 4BE1A 2HW3A 2WACA 4ELUA 3NHGA 4I2QA 1U04A 2X6SA 3RMBA 1WJSA 3OYJA 3OYBA 4II1A 3NBPA 4E1MA 1IG9A 2ETJA 3ASMA 2YNFA
chains in the Genus database with same CATH superfamily
2A6HF 3RKWA 5KE2A 4Y7NJ 3P31A 1KLNA 5J4YA 4RCHA 2CGHA 5LHIA 1KC8C 3SWNC 2HBMA 1VQON 2P51A 1K78B 2PQ8A 3VEVA 3TTFA 1WWXA 1DPUA 4JRIA 5LJ5e 3ZRGA 2NRTA 1SKUB 5KCOA 4B3MK 4BHBA 4UUVA 3DBLB 4D0PA 3CCRN 1QQNA 1T08B 3R8EA 2V8JA 1HKTA 1VQ4A 1Z3YA 4DTOA 4X1VA 3D2FB 2HHXA 1TAUA 4J2DA 4A63B 2DPUA 2QEXQ 4MDAA 3ZSVA 3TR8A 4JX5A 1BK2A 3WU1B 4M73A 2QEXI 2V7ZA 3JCUC 1Z1DA 2P9LB 4E2FB 4I98B 4BR2A 3W2VA 3LSGA 1YF5L 3EUHA 4M4ZA 5C6SA 4KT6A 2LKSA 1KA8A 1ETQA 1VYTA 3R2XC 5FKNA 1YJWI 3WTWC 2D8JA 1VQ5Q 2JWKA 4CBWA 1LQ1A 2HSPA 1JCEA 4JK9A 3PQKA 3L2ZA 1TH7A 3CG7A 4NHJA 2FXUA 2CSIA 1VQ5I 5K14A 3CCVN 4DFJA 2A7YA 2GQQA 1UHWA 1YQLA 1T0FC 2QEXA 3IUOA 3TVTA 4C8OA 2LP0A 1XCVA 1MNEA 1IZ1A 1HCRA 2NRHA 3A01B 2LC4A 4BG8A 5F2RA 2PTKA 1R5HA 3QDFA 1TLHB 3O1BA 5HRNA 1OCCH 3VS6A 4QOZB 3FMSA 1ATNA 1YJWA 1T3LA 4CZLA 1HYSA 4A3MJ 1YT3A 1LEBA 3GFIA 1HNVA 1VQ5A 4A59A 4KRTA 2BUPA 4GW6A 2RF0A 3NH1A 1S22A 2JG6A 2DVEA 5D7UA 2PMUA 3TABA 2QXLA 1P9QC 2J4RA 1N36K 4M6YA 1Y1WJ 4MTEA 2KBTA 2QQBA 4KT0E 4RTXA 4XH5A 2V7YA 1RRJA 2QGFB 4ID1A 1OEBA 4XKBA 1BR2A 2P0KA 1ZC6A 3M4GA 3CQXA 1L3LA 3WXJA 3CPWP 3I56T 1LDDA 4PSXA 1NG7A 1AVZC 4CEAA 2KKOA 5IOZA 1P4AA 3ZEUB 2GFUA 3RTRA 1U2VB 2W00A 2QWQA 4I7HA 3TBIA 3URGA 3QYHB 5JVHL 5C4XJ 3K5LA 4RM3A 1OYIA 2P5VA 3VQCA 3VYSB 2DA2A 2VPLA 3SXYA 5KGWA 3ECOA 4IOXA 1N9RA 4E6KG 1TZLA 1PJRA 4OIRF 3O80A 2XKOA 4DLEA 3TGNA 3S3OA 2HOEA 2WAQN 1K8AO 4OPHA 1W2BA 3MHXA 2DRKA 1AHDP 2VONA 2EKOA 4H0OA 3CCMT 1IXCA 3KP3A 3CCLQ 4HCCA 3P9IA 4M3YA 2NUZA 1MMNA 5JVGF 1DP7P 3GF2A 2ZSIB 1H9TA 2K6DA 3A4CA 1VQLT 4H0XB 3CCLI 1J54A 4PJJA 1TL3A 3EY1A 2FBKA 3W6KB 2MOXA 1GDTA 2RPNA 4JBAA 1ZG3A 3Q9VA 3ABUA 5AIPA 2JTEA 3V42A 3BR1A 2PLYA 1SSFA 4CHZA 2XKPA 4F3QA 2FXAA 4ENNA 3QMLA 5EGOA 1WPKA 1B3QA 4B1ZA 2O4IA 3R0JA 4G12A 3SAGA 2QKBA 4XTUA 2GUIA 1BI4A 4G94A 1X1AA 2UUCK 1M9SA 1SL0A 1PCXA 5CHZA 4JKFA 4J9BA 2Q31A 2PEXA 1KU7A 1KG5A 5GAOn 4IZ9A 4U0YA 2OU2A 4JAXA 4LF8K 4CF2A 2JZYA 3CCLA 4PK4A 2HBPA 3JB9G 4OKJA 3B6CA 3TWHA 2C0TA 2DILA 4OMNA 2RK2A 4BRLA 3M7GA 5I22A 1Q18A 2K79A 1KD1R 4ZGEB 4UVBA 2OYQA 2P6SA 3C4SA 1TBXA 1NJIR 1OPKA 3HOTA 2XMFA 3GP8A 1J5EK 4DV7K 3ZQ7A 4KUMA 3H6EA 4FLWA 3A5MC 1LMZA 2D0BA 5LGUA 1UFMA 2IEKA 4MFEA 2Y75A 4CO8A 3ERMA 1X4PA 2BY0A 2KFZA 1J75A 3L09A 3LYIA 1KAZA 4IURA 5CK9A 2CUZA 1RZ4A 3LDPA 2BVMA 2J06A 1YHQQ 3D5RC 1XGOA 1BL0A 3WTVC 1FMKA 1WEGA 1VQMI 4C5GA 1YHQI 5LHHA 5D6EA 2ZE2A 2E2PA 1VQKQ 3TSZA 3SK3A 3T69A 1JT6A 2CUDA 1FOXA 4EJYA 1N75A 4K8ZA 1VQKI 1Q95G 4DK9A 3L2RA 2OC6A 3EG9B 2KKZA 2NOLA 4Z2YA 1SD6A 2NOGA 2UU9K 4J2EA 3E5UA 3UKGA 1C1BA 3V7SA 4YNQA 1KLMA 3OS0A 1R4NB 1K7AA 4YORA 1VQMA 1YHQA 2UXCK 1QZEA 4A4EA 4OX9K 1RKTA 2DMOA 1NGCA 3DBHB 1VYUA 1GCQA 3BG5A 2BH1A 2QDLA 2KMTA 1XQHA 3UNGC 4KJZA 3CXCS 1K8KB 2VLAA 2HS5A 3F8MA 2FZKB 5IT3A 3PNYA 3C7JA 4LF6K 3RSNA 4Z02A 2R7ZJ 1X1PA 2IGMA 1FYMA 2YHWA 2R7XA 2O03A 3HIFA 4B8CA 2MC4A 3PGGA 3OWTA 4CYCA 2VQEK 3C0CA 2ME0A 2RD1A 2EIMH 2BGGA 4RW8A 2KQRA 5AQWA 4UY8O 3GCMA 1XMAA 4M7AC 4I6MA 2DMTA 3DTIA 1TNTA 2LF8A 2ICWG 4HVJA 5KYWA 1R71A 3J80E 3PJRA 2NOJB 3EAEA 3CCEQ 3QYBA 4ZN1A 3ZCMA 1MSFC 1VRLA 1MMGA 5F0CA 2JA5J 3MP8A 4DR3K 1U49A 4L8RB 3A8OB 4XU0A 1WNSA 4NCBA 3MEEA 3THXA 2CQ7A 2K4YA 1WGXA 3MEUA 5KHDA 1FSHA 1TWCJ 2E71A 3MEDA 5GIPA 1RT3A 1KYWA 2FOWA 1T6SA 4RAGA 1BCMA 4X66K 2DFEA 2YHBA 4JI5K 1NJXA 2R93J 4XLEA 4QQGA 2QWPA 1WQWA 1WLJA 3ZP5A 3FXOA 1YJNQ 4FJMA 5GAN2 2W1OA 3OYEA 3G6EQ 2OFIA 4P55A 1Z9ZA 4OLBA 3EG0A 4OPKA 1YJNI 2YKNA 2YS9A 3RR7A 4Y3OA 3K2PA 5KN9A 3G6EI 3H41A 1KQ9A 4GDFA 3PIOF 4O5BA 3G4SN 4M77D 4ENKA 5LLQA 3MEAA 4PY5A 3EL2A 5JFRA 3V6DA 3EFSA 4LF4K 3WG7H 3CIPA 3CESA 3DBRB 2W48A 4AIKA 1RUNA 2L9RA 1M3QA 4AG2C 1QO0D 4CCKA 1I81A 3FMRA 3U1KA 2RNGA 2IS1A 5HNHA 3HHGA 2K3PA 2A05A 4D7NA 2KT0A 1A04A 2KXCA 2CT4A 3RUXA 4DSFA 4PSWA 3DLLF 3C18A 1I27A 5D5UB 4E7ZA 3BC8A 1HNWK 3EUAA 2AK5A 3KEYA 1QHHD 4OKEA 5AQJA 2HFHA 3M0RA 1YQAA 3OH6A 4DNCA 5GPAA 1EZZB 1ZYRF 4B1XB 3MKLA 4C92D 1P2FA 3Q9SA 3JSCA 1Q9YA 1X4OA 2QWWA 2J5OA 4CGZA 5KYYA 1QZYA 5KI6A 2YHTA 2DTUA 2JN6A 2ZMEA 2P0QA 2P5LC 1LFPA 4FT8A 1GLDG 1M90R 4BGAA 1D5AA 1ZA2B 3PO4A 2H3GX 2YUOA 4FJLA 3OJUA 4O4GA 4L5GA 5BQTA 4DQPA 2WTEA 2QASA 2ZCFB 4B3AA 2H27A 3JW4A 2F8SA 3LX7A 2QTDA 2ZB9A 1XHZA 2FSJA 3LAKA 3Q0WA 4JUVA 3KUFA 4HUEA 4DKWA 4XMYA 4F7UE 2BEOA 3BUZB 1M3AA 4DR5K 1YQRA 2G8HA 2SRCA 2K4JA 3M8PA 1HJOA 1JLBA 4NCAA 4AM7A 4CGJA 2KR3A 2HF4A 4EM2A 4QTRA 2HKXA 1WJ5A 1D9DA 1Q9XA 4CZFA 2I8DA 1K0XA 1GXIE 2NAZA 2WB1A 3EUKL 3KP5A 1IHWA 3CCJQ 4LLNA 2O4GA 4NB5A 3HXLA 2V79A 3K70C 1C0UA 1VSDA 4UB8C 4M41A 2O6GE 3L42A 5KRTA 1VQ9Q 3CCJI 2DBKA 3E9LA 2EQRA 2F4OB 4E1NA 4IX7A 4AI5A 3P5JA 4XOPA 3GTGJ 2V8KA 1A5JA 3VF2A 4AYBA 3L9FA 1JLQA 5DCFA 2R5MA 5FWBA 4CDGA 3OYCA 1JKRC 5LJ5d 2E1CA 1BR1A 3TO7A 5LRSA 3QBYA 4LFBK 1N3AA 1K9MO 1VQPI 2QG9B 3G1MA 5FROA 3WXMB 3B6PA 4DSLA 2O8DA 2R5ZA 2FYKA 2AZVA 1U4BA 2FA5A 2XU8A 1HBXG 3CCJA 3ISPA 2CYYA 3H9NA 5AQIA 2K2VA 2XAGA 4CXFA 3RKXA 4ZH4F 2H6BA 4MMLA 2ZPFB 2BW3A 2IBDA 1ATSA 1P90A 2ESWA 2LJ1A 4CCJA 2AS5F 4BR7A 3PT9A 2OI3A 3ID6A 5AQVA 5J3LA 2HVRA 3VS0A 3UPUA 1BU6O 4O6JA 2KIUA 3M54A 2HVSA 1YBYA 3I54A 1UJYA 2M9HA 1QVFP 3EE9A 2ZJQL 1VQPA 4OMOA 2DL8A 1D5YA 2QK0A 4DFMA 4CYDA 4CJVA 4FWQA 4C5HA 2VVKA 3G3ZA 4CERA 4R56A 3LSPA 3J81E 3GDQA 3HO1A 3S17J 5EZGA 5DTDA 5H6QA 2CGPA 3WE3A 2ZJPF 3VB2A 5HLTA 4B44A 3GEZA 4UHTA 2XDDA 1HR0K 3SQ2A 3NDKA 5J40A 1TKXA 1ZBLA 4HBLA 2VOOA 1HOMA 3M3ZA 4HTUA 2HNHA 2VG5A 4HYEA 1R1UA 1B8IA 4L9VA 1LW2A 3M4YA 2B4JA 2CH4W 4BQQA 2M0OA 4M9ZA 5D6FA 3H46O 4BBSJ 1OKJA 1IKWA 4XKVA 2R7OA 2MLGA 5E41A 3QFPA 1UGPB 1OISA 3UA6A 2KEAA 1VQ7I 1WJQA 3F70A 2BV6A 1ZUKA 4NBQA 2FG0A 4XLNF 3K6GA 2MA3A 3CMYA 2QWRA 3CMAN 3JXUA 1JU5C 5CQXA 4XSZF 5EX5A 3L3VA 1K8AU 3Q1JA 1UB4A 4WK8F 4EMGA 2WWYA 2A37A 1YITN 2EGAA 1MU2A 3OW2M 1QBJA 1C0TA 3KYDB 2DL3A 1N34K 4LD0A 3W6JB 2C06A 2E5ZA 3LWLA 1BI1A 4IBNA 4LDWA 5GJWB 3I5SA 3JCMb 1W36C 3V8LA 4L5IA 1VQ7A 2OV7A 3RRGA 4JYAK 2QWOA 3MK6A 1F4KA 1RT1A 3LNQA 1WJEA 5CYMA 2GXAA 4LH5A 4FL9A 4I09A 3T8RA 1A5WA 2COYA 4XM3A 3BZCA 2CH4A 2P5KA 2LBFB 3JSPA 1WI7A 3P4IA 3QESA 4RB2C 3CVTA 2O8FA 1BWFO 1ETKA 1VQ9N 4M9XA 3HOXJ 2O88A 4FW2A 4H0PA 2ZCWA 1H88C 1O7LA 2Y0SN 4FO0A 1NGDA 1XC5A 5DYMA 3LSHA 4IOCL 2CV0A 4PJNA 3KCCA 5M3FJ 3HZ6A 4CBXA 4A0ZA 4FASD 3U9GA 1S1NA 4DV3K 3N4PA 2R57A 4KDPA 3EGDB 4B08A 2DK3A 2V6CA 2Y31A 1W1FA 1SZ2A 2JJ9A 5ILUA 1H92A 2IGKA 5HVQC 2WSCE 4G8XA 1B7TA 1LVAA 2ZBKA 1FOYA 1GV5A 4EA5A 2R3SA 5J3BA 3VPRA 4CJUA 4E9HA 5F6FA 5IN1A 4F14A 2FPEA 1UFFA 1LCKA 4RW4A 2MLKA 1T98A 2IP2A 2VQGA 1QNTA 3RWUA 2ASOA 2K9SA 4DBHA 2YSQA 1UG0A 1Z9QA 5F1XA 3OL4A 3ZSQA 4PFZA 5AT1B 1SRMA 4EAHD 4FJ8A 4JS5A 3J7YP 4FL6A 4JLGA 2EFNA 2LREA 4RW9A 4WYBA 3HBTA 3QEVA 2XC7A 2KZZA 3KKRA 3GTKJ 4B24A 1Y71A 3EG2A 2NVXJ 3H0FA 1WA7A 4B1RA 4ESJA 1YAGA 4LY7A 3D2EB 4KV8A 1D8YA 5HNFA 3C6HA 2EX3A 5KPRA 3LAPA 4PKCC 3ASOH 3FZFA 3GTPJ 2NUPA 3G1JA 4CCNA 5EXWA 1SVMA 2BHYA 2HQXA 3CJTB 3M9AA 3F72A 3THKA 1Q81O 2NLUA 4FVMA 3CJNA 5IHIA 4L0ZB 4YIRX 4LN2A 3JSMA 1JTXA 1ETYA 3SD4A 3PMTA 1B07A 1QP3A 3SBGA 2CSQA 5AQKA 3LGLA 2IRFG 2LQKA 3OHRA 5IY5H 2MFZA 3K0LA 3VEYA 4DSIA 3NAEA 4YELA 4C3JJ 1F5TA 3H0HA 3IKMA 1K73C 1KG3A 3WNFA 3G71T 1NMNA 5J1UA 3MMYB 3CPWS 3FBIB 5KH6A 2DDBA 2LQ8A 3E3VA 3CMEQ 1M1KR 3CC7N 2IC3A 5CYVA 3CMEI 3VRYA 2D5VA 2Z2SB 4CFCA 4OFAA 3HTUA 1RAEB 3JCMf 1MDMB 2O8KA 2X9HA 3BJOA 1NK5A 2QK9A 4KICA 3FXRA 2PFUA 4Z4EA 1MHNA 4UUSB 5ILSA 1XMOK 2VG6A 3HVRA 1JJ2S 3IKVA 3P8BB 2QSHX 3S93A 2LF7A 2P7CB 1VQ6T 2JSPA 4CJ3A 3CM5A 4YOXA 2E7XA 4EW4A 4A4KA 3PV8A 2YKMA 2WADA 4ME7A 3L2WA 1WXBA 1JXSA 1TOVA 1DGKN 2ID3A 1NGAA 4Q5SF 1ZN2A 3HUGA 5IH2A 2Y9YA 4XLPF 4CHPA 2A42A 3HKZA 2O0YA 2LVSA 1YYVA 3A5LC 2ELJA 1K0SA 1R00A 3OS5A 1WJBA 4FPBA 4IFYA 5ICEA 4LIVA 1WHJA 2HZTA 3GYHX 5C0MA 2HAXA 4FYXB 3DLRA 3UR3C 1QS4A 3GOXA 4HVVA 2RQWA 3PFYA 4EJTA 1R49A 4YY3K 4KB1A 1MZBA 2F48A 2M3AA 2QA4N 4A2UA 1XNIA 1H641 4NNJA 4U67L 5TKYA 1T39A 3V9WA 1MBGA 2F5CA 4JPBW 3DP7A 5LJWA 2DQRA 1K1ZA 2D0AA 4PQUA 3VRZA 2FNAA 5HROA 4QSHA 1K4SA 3CC2N 2KRSA 4EP4A 2NYSA 4PL6A 3A8YA 4I99C 3WE2A 4KI4A 3OGDA 3I59A 2HMAA 3TCJA 4BVOA 4KBMB 1PP8F 1M3BA 3CCQN 2UXBK 3VGMA 2EYYA 3ZSWA 5CQYA 3X25B 2AHJB 3M1FA 1SFXA 2AKKA 3BQZA 3HM5A 5FGMA 4OO1J 4HNTA 3B02A 2EYQA 2HF3A 2J6OA 3LSKA 3QNNA 4G9ZA 1YX5A 4BQAA 5T7BA 2LOOA 3TARA 2F9TA 3I56I 1IO2A 3RPUD 4BY9C 4FWOA 5FWCA 3DOKA 2K3YA 5EG0A 1PD0A 2WFBA 3WNEA 2RQUA 4GNIA 3NARA 2HHUA 4J5YA 4RG8A 5DCMA 2HSTA 3F9MA 2DAQA 3QIOA 4LD5A 1U9NA 4CZGA 1FIPA 1HYZA 1PYVA 5DLOA 1Y6IA 2E6MA 3KJVA 4AD9A 4BXXJ 3KXTA 5BREA 5DM6L 3I35A 1IKVA 2EVRA 3GTOJ 1K6YA 2F5VA 4DV1K 3I56A 2RF2A 1X2QA 4JI7K 1IN5A 1OVYA 3MWMA 2XI9A 3BZ6A 1LAVA 3DWLA 3P83D 2DTZA 2NOEA 4DJAA 5FU7B 1VQ4N 2JRMA 1PC0A 1WLPB 2PMZA 5KVRA 3S16J 3IRQA 4DTMA 4KFBA 1HKBA 3S6IA 2JOYA 3DXKA 3CF2A 4CFBA 1VQLQ 3CCMI 1LNXA 2M0YA 1WXTA 1KIKA 3L2QA 3WTZA 3OSVA 1VQLI 4H5RA 3LWIA 1O75A 4RTUA 2RH2A 2LP5A 2QQ8A 4LFAK 1GLCG 3QPLA 3F6OA 4E9EA 4IOAL 2KPMA 2OAZA 2K3FA 2PJPA 4JKGB 1JKOC 2K3XA 3SCXA 3QEXA 2COBA 2KL4A 3LSIA 4EM1A 5GAOl 3T3FA 1IV8A 2GQVA 1XSXA 3AGKA 2QENA 1RILA 1W2BS 1R1TA 4DG1A 1RUWA 1KU3A 3OY9A 2PVDB 3CCMA 1K9MU 5D5XB 1ON1A 2XIGA 3FB9A 1BYMA 1VQLA 1D0YA 3HFOA 2HVQA 2COZA 2ETHA 3PMIA 4DTSA 5E17F 2X51A 4DQ8A 3JCMX 1FMWA 2K85A 3I4PA 1WAJA 4LF7K 2DE0X 3S6WA 4FOEA 4KHNA 1ZSZA 4PIIA 4ZHRA 5HY6A 3M0SA 4QVCA 3UKUB 2Y0MA 4JQFA 1HSTA 2YRDA 2XVCA 4K43A 1YIJN 1YJWN 1HW2A 3VDXA 3JRHA 1BR4A 3T8TA 2NYXA 3EN9A 3I3LA 4JKDA 4JLHA 2NOZA 1TUCA 3G2BA 2BZTA 2PN6A 1JL1A 1ILYA 3OYAA 2H6CA 4Y1DA 4KGVB 2G9WA 2H1LA 3RERA 1FBUA 3MZYA 4CEFA 2KDSA 4LDVA 2L3DA 1U9OA 2F69A 3JRBA 3VUBA 2Y69H 3VWBA 5HLGA 1SD7A 2Z1DA 1T56A 2IVMA 4XU3A 1NK9A 1MMAA 4HEA2 4YRVA 3CQZJ 1REVA 1RPWA 1OR7A 3BLYA 5E3LA 1D0ZA 1ZR2A 2P4TA 1W4MA 2F2XA 3K4CA 1PG5B 3MEWA 2VE9A 4IEIA 4LK1F 4HVWA 1S7EA 2L54A 3SZPA 3TDZC 3J7AY 4J9IA 3AY9A 4P9FA 3I0WA 3ER0A 4X64K 3J7YJ 4G6DA 3WGHA 3TU4K 3ATUA 2PJRA 1R5GA 3NCIA 2QW9A 1L3VA 1G99A 2BYVE 5M1FA 5LHGA 2VODA 2ZPBB 3KEOA 1M30A 1Z77A 2HXIA 2O61A 3H35A 1J3TA 4FJXA 1NLPC 3CFRA 2YRCA 1KAYA 1MH3A 4K42A 3S41A 4B1VA 5L3CA 4P9UA 4DUZK 4B4CA 1LW0A 2K3BA 1TUDA 3OYFA 4B48A 4DV4K 3Q5FA 4H03B 4ZYHA 4KUIA 2KZMA 2PBDA 2KRFA 3MMVA 3S3MA 2HNDA 3SI6A 2AXTC 1NK3P 4OMYA 1TGOA 3ZSXA 5DEQA 3VODA 4DV5K 3G1OA 2HQ5A 2NVQJ 4DEXA 4II2A 1KTQA 3BTLA 1ORPA 4C8NA 2FJ1A 3AG4H 3BEXA 2CT3A 3V4GA 4A3EJ 1B9NA 4XRMA 2MC3A 4MDXA 2HMPA 4TVRA 2DBMA 3O9QA 2O5RA 3TTDA 1JXBA 4MDBA 1ZGAA 4DQSA 4Y4RA 5C25A 2DOEA 3RIRA 4PHTX 2A6EF 1YXQA 1VQOT 5C44J 2E20A 4C2MJ 3RZOJ 3VS3A 1ZSGA 1G3TA 3GX4X 3QBXA 4KI6A 2VWBA 2ZNYA 4EGZA 4BR5A 3CCRT 4HF0A 3TQ7P 3TSWA 3S14J 4HQEA 1ZUUA 3VTIA 4IHTA 4FHTA 3VEOA 2RQPA 3LSRA 1F9NA 1SFKA 2DDAA 4X62K 3PO5A 4NC6A 1I3QJ 4ZDLA 2W4SA 5EGOB 1RGIA 4KH0B 2G8VA 5AQPA 3LL7A 1AZGB 2EZLA 1BI4B 1W0TA 3AA4A 5JLWA 2Q0UA 4IF4A 5H1SQ 4BACA 2LR8A 3NNQA 4BU2A 4HDUA 1S9EA 4BREA 1W7PA 1OJLA 1BA5A 2DERA 2XGXA 2FF3B 3V4IA 2AO9A 4J01A 4DSKA 1KD1O 1ZGJA 5EOYA 1DDNA 3SB2A 2Q0RA 4A6DA 5H20A 3CCVT 3R6SA 2R7SA 3NGZA 3KZBA 3OS1A 1Q81U 1RDDA 1OYXA 5EF6A 3LDNA 2HZYA 3HM8A 1NHAA 1N8RR 1RI7A 3WVEB 5AFUH 1VQMN 3FSPA 2YWWA 1CZAN 1T0HA 4BE1A 2HW3A 4XKWA 1QPMA 2VXEA 4I2QA 2IA0A 5DY9A 3OYJA 2ENMA 4II1A 4A3BJ 1RR8C 2LKPA 1APLC 4RTVA 2GA1A 1IG9A 1C0FA 5BPMA 2BVLA 1K83J 3FDYA 1AWOA 1RAAB 2LY2A 3WGIA 4J7IA 5GANf 3GZ6A 1S29A 4DZJA 5DK5A 1NMDA 4FW1A 4F04B 3KP4A 5HLHA 2HKQB 2HL5C 3BG7A 4QT7A 3IMXA 2FBTA 4DSJA 1H89C 4JJBA 4M63C 1T3VA 4XIDA 2JUFA 2RO0A 4IEEA 3M07A 3ZMDA 3QOEA 4I02A 1NGBA 4AU7A 2QYOA 2W57A 2CZ0B 1WSUA 8ATCB 3WTUC 4AUXA 2VBYA 3CLQA 2RDPA 2XY7A 2UXNA 4IRIA 1XUPO 2JWTA 4XEIA 1O57A 3KLNA 1JKPC 3CCSN 1T38A 1Y7XA 2OTJQ 5AN4A 3U3GA 3THYA 3PTAA 5FLXZ 3O4QA 3AFHA 3U8XA 4KHYA 5LMUK 2PQWA 4RBOA 5EY4A 5DLQE 4CI6A 2ECZA 5D3GA 3ZX0A 5FU7C 4U0WA 2A1SA 4QQDA 5B3SH 2DYIA 1LDKB 2TCTA 2PG4A 1FSEA 3SLCA 3LWFA 5I2MA 4JZ4A 4JI0K 4LDUA 5FRMA 3AG1H 4L3QA 3M8FA 1Q82R 2XB0X 4CEOA 2EV6A 5SZTA 3VS2A 4CYCB 2L7KA 4FM1A 5F27A 3HTSB 3THVA 2Q97A 2EJFA 2ZJRF 2ZXIA 4PZJA 1JGGA 3ZQQA 3RNJA 4IEJA 4I6MB 5KYWB 2HOTA 1EETA 3ULEA 5FLMJ 3HOWJ 2CH0A 1X9WA 3HRSA 2LQWA 3UF4A 2V1NA 1LOTB 3LWMA 3IV5A 3K4NA 1FYNA 2C6YA 3EETA 1C1CA 1IXSB 3GTQJ 4YIFA 1G2HA 3CP2A 4DTJA 4MQVA 2VBXA 3ERED 5FLXK 3THXB 2KFDA 3KTQA 3I8DA 2LCCA 2FO0A 3M5AA 3I58A 2FU4A 1WFWA 2RQRA 1FX7A 4H0TB 2O8EB 1UJ8A 1GBQA 4KGZB 3KP2A 4DBQA 5CCAA 2HTJA 1BISA 2MSYA 3MQ0A 2YHXA 5J2NA 3KK1A 3R6OA 3T1BA 1Q8IA 3DOLA 3UE5A 4BI3A 3EUHC 3V1QA 2RN8A 1KQSA 3I9V2 5JS2A 2CGKA 3CUQA 5A2QZ 1R22A 3MAQA 1YJ9A 3SDBA 1Y8RB 2ZFWA 2K4BA 1OH6A 2VCPA 4MO5A 1U06A 2IA1A 2LSOA 4OAZA 3PIPF 2YU9J 1YG2A 1IN7A 3EQLF 1IF1A 4GV6A 4AFQC 4HTLA 4E6RA 3SV4A 3A8LB 1SKWA 4JJNK 2QXFA 5CKHA 3EKUA 5EEHA 2M34A 1UZCA 3HOYJ 1YFNA 2FQ4A 3V81A 1MV0B 2CO5A 3ZQFA 4DR7K 2ZGYA 3F8FA 3KD1E 4B9QA 1UTIA 3CO7C 2P5OA 1EIFA 2HKOA 3JAME 1DPRA 3AVCA 1KQ2A 1YWOA 5C2FA 4XORA 4FZYA 3P9CA 5D5VB 3MCPA 3ASNH 2M8EA 2RKIA 1Z6RA 4Z4CA 2FBXA 1KXPA 2WBNA 4HF2A 1ZBHA 2KDOA 2EYWA 1X9MA 1LV5A 2H1KA 1O13A 3X26B 3NFCA 4FWLA 4JRPA 4II3A 4XSXF 2E36A 4U7BA 2FOKA 1UHMA 1JCFA 3BY7A 2HBKA 1OI1A 2HU9A 4OMLA 2L7ZA 3FHGA 5IT9Z 2E3IA 2YG8A 1WHHA 4WFAL 5KYYB 2HQAA 5A2QK 1FJLA 3ZMSA 3ZMTA 2XHBA 2ZMEB 4UVAA 1QLYA 2JMWA 3UATA 3BG9A 2A5XA 1SVOA 2OQRA 2QYZA 2D1KA 3CBMA 1W0HA 2CFXA 3TW7A 4Q5WA 2L2OA 1WGSA 4AF1A 3HDDA 2Q8KA 3ESWB 3K9JA 2FRYA 4Z94A 3AO5A 4BI4A 5E3MA 1Y0UA 3KBGA 4OFEA 1R0CB 3NGYA 3M8EA 2QWNA 3ZSYA 2YDLA 1K4US 1SL2A 1PVEA 3WXKA 4XK4A 2GEMA 2HBWA 4IJNA 5IYCJ 2G8KA 2B0LA 1QVGA 2OD5A 2XKOC 2RHZA 5I42A 3DXJF 4GYGA 3CF5L 5AFUA 4XOTA 4XTXA 1T05A 3AV9A 4C5EA 2GX9A 2HHQA 1G8XA 1VQPN 1ABQA 4CK2A 3JRAA 2WA0A 4HV6A 1U5TA 3TAMA 5IT9K 5K5QA 2H3JA 4I9LA 3VERA 1B9FA 3QBWA 3VQBA 3CVSA 2XAFA 4B3RK 4YOWA 2VWJA 2DMNA 1UB9A 3A5OC 3KVGA 1NKBA 4DQ2A 3P8HA 2R5AA 2XHIA 1QHTA 4MEYF 1RAHB 2NNNA 2CUFA 3SFZA 2LSNA 2JA8J 2B86A 4M78E 4BRHA 1QQCA 3CDIA 3D4VA 3ZR8X 2QSFX 2GAUA 5FKMA 3R60A 4CUGA 2DNUA 2DPPB 3EEQA 4X9DA 2JT1A 5ERIA 2E2JJ 2R5ZB 1EBMA 4V2SA 2MWOA 2ID6A 1ZBUA 2YSRA 2L7FP 3M4OJ 2ELKA 4FXDA 5K7HA 4J9GA 3LQRA 2RK1A 3LDSA 2DA5A 2OA4A 1XX5A 2BW3B 1T0JA 1OCPA 1FJGK 2YX7A 5CZ1A 1T3SA 2L89A 1SANA 8AT1B 3QAHA 2D1VA 3IL2A 2A36A 1BC8C 3H3OB 5LY3A 3ID8A 3ABLH 5C12A 4C3HJ 3L2VA 3ZPLA 2B8AA 2JLEA 4KIFA 3MDQA 1U0JA 2DRMA 4OB2B 3EE8A 3CJCA 3G71Q 2LNBA 2BANA 3GFMA 3DLMA 1VQ7N 4JDSA 1J5YA 4MQ3A 3JV3A 2M30A 2CQQA 3G71I 1RDCA 1TYQA 3LA7A 5FLXO 1H3ZA 4N56A 5DDGA 5TGTA 1U3EM 5HDKA 1B8IB 2RREA 2W84A 1IN6A 2ADUA 2V26A 2K9LA 2AQEA 1WI9A 2CG4A 2LJ3A 1SEMA 3E6CC 4E19A 1VA7A 3O8HA 5KQ8A 1JB0E 4C9YA 2FUG2 4OU0A 3JRCA 2A08A 3MPUB 1ZUYA 5CVIA 2FSWA 2R7FA 4XU2A 3VV0A 3G71A 4FK0A 3CW7A 1GBRA 1JGSA 4OGCA 4B6MA 1VQ6Q 5LJVA 1N5YA 1OH5A 5C4JJ 2CREA 1B6AA 4BYYA 4ZJZA 3OYKA 2FMYA 3IG1A 4OMZA 4FJHA 1BO5O 1VQ6I 2W42A 1ZK8A 4KKOA 5ICFA 5AZIA 5E8GA 2DD5A 1RESA 2K9GA 1LWYA 1R59O 3CCET 2X4HA 1GCQC 3C2BA 4HX4A 1NEGA 1KGSA 3FHZA 3N4QA 1OPCA 5AQYA 3CCUQ 1I6HJ 4CZMA 2ATCB 5JLFA 2K9QA 1KONA 2IS4A 3O3GA 3H6ZA 1ATRA 1S72A 1A5XA 5FJ8J 1VQ6A 4CGGA 3U1DA 2O8FB 2P1JA 4OIOF 2BKDN 2Y4XA 4UOBA 5F08A 1QVGP 5C15A 4H4MA 1NGGA 2EFWA 3DRPA 4CJPA 2PUOB 4KNYA 2A5YB 2WONA 1KD1U 5EEGA 4HWIA 1NK7A 5HP1A 1Z3XA 3H0DA 2C0OA 1V4TA 4IRGA 2QKLB 3KLOA 3JAMZ 2FZGB 1U45A 1HSQA 3EH1A 2NUTA 3GVAA 5M1KA 1ZBSA 5A2QO 4J7FA 1JT0A 1PRLC 3L3UA 2IAJA 4NXMK 2Q0OA 1TK5A 2ZZDA 1J5OA 1IGNA 3H1VX 4B43A 3VQ6A 4QW2A 3NAUA 3OIPA 3LMMA 2DL7A 4BS9A 1HQUA 2GIVA 3AA3A 3W2AA 2A1RA 1WFXA 1XN7A 1TVRA 2Q3SA 1W4SA 1HA8A 2NRXA 3DB3A 3M8QA 1P4WA 3GNFB 2DODA 2KROA 2ZPGB 2F1LA 3N4MA 1QA6A 5H2FC 2EJRA 4CZKA 2LY9A 2HEQA 4LD6A 1EP4A 4J8FA 2P9NA 5LGNA 3M6GA 2K5CA 4KHPK 4BRNA 2F5EA 2NRAC 4HPQA 3G1LA 2P9PA 3HPWA 1MPGA 3ENHA 1IJWC 2DMQA 1LOJA 2KNBB 5BPNA 3S3NA 2ROLA 1TUUA 5SWMA 5IT9O 3GL1A 2Z9OA 2NUPB 2A5WA 1STZA 4F17A 2FPFA 3RSEA 5TISC 1HKSA 1VQNQ 3ZX3A 4ISEA 2WBMA 2RHKA 1KQ8A 4JX4A 3FIWA 2RHYA 4AFZC 4ESRA 1S1XA 4PDKA 1TWBA 1W7AA 4JI4K 2YT6A 1BUPA 2MW8A 1RT6A 1LPQA 4CEZA 2R58A 3CMAT 4N4NB 5GTIC 1NKCA 2CZ1B 4X65K 3M8JA 3U2RA 1AKHA 1Z67A 4MMKA 1YITT 4CZEA 2ZPIB 4A4HA 2LJ0A 4DTNA 2WY7Q 1QTMA 2LT1A 4M77A 1MW7A 4XBFA 2GBZA 2M7AA 2DM1A 3HKZN 1HLUA 4AILC 3DU6A 3RYRA 1D09B 1K6OA 2RJDA 1X2KA 1NGIA 2GXBA 3RDIA 3META 2E5QA 2D0PA 2YCHA 1KD1C 1ITGA 5HS9A 3L00A 3L7WA 4JI1K 1JHFA 2F4IA 2ZMEC 2P6TA 2KT8A 2MK5A 1NJIC 4BDYA 1ASVA 1X1DA 4C0FA 3QETA 3BZKA 2LX7A 1UHFA 3D7EO 1PU7A 1NE8A 5IP7J 2UXXA 1VQ9T 4YPHA 5LJ3f 4M3ZA 5GMKi 1JJ8C 2FPDA 1RFQA 2IIMA 2YUPA 4NC8A 2X0LA 3DEUA 1WX6A 3H1CA 2K02A 2IOCA 2RV8A 1WJRA 4CH7A 3WVDB 4C0ZA 1Z0XA 3TOBA 4G7ZF 2DL4A 4FJNA 4ELTA 5K5OA 4C92A 3QPSA 1SFOJ 2RJEA 4ZDOA 1J53A 4L9NA 4V19K 3DM2A 4NDLA 1G15A 4XTWA 2ABLA 2KT1A 4ZYEA 4CHNA 3SDZA 4KH5A 1A6QA 4LB5A 5L23A 1QHAA 1WEFA 3E66A 2O7OA 2HHWA 4CCOA 3FWEA 3CD6N 2FX0A 3JRFA 4C8QA 1GLFO 3W0LA 1RRSA 2XDPA 3OH9A 4ZTJA 3LP1A 4IUVA 3CJ1A 2EZHA 3GNGA 2Z5UA 4ETSA 2F9WA 1KJWA 3LH5A 2BE7D 3HOUJ 2KRCA 2B7EA 3QERA 3FX3A 1TTYA 1U48A 3NTKA 4GXOA 3MKYB 4KYWA 5E1XA 1ZBIA 3CWTA 1TTHB 2I5JA 1H8AC 2RB6A 3BW1A 3BE3A 4O5VA 4PJ0C 2YXYA 5GAHP 3U9ZA 2FC0A 4BQLA 2P0WA 1R6RA 1M2OA 3I59B 2DCEA 3ABMH 2OZMA 2PMZN 1D5VA 4JLIA 4AHVA 5GAN8 2FE3A 1VQNN 5HS8A 2LLKA 2LVMA 5EEAA 1UOCA 3V7RA 3T1AA 3OIQA 4GCVA 1ZBXA 3TAFA 1Z7LA 1BOTO 5KNLA 1W7PD 3DLEA 3T5XA 2ZFUA 2DA9A 2HHSA 1DEJA 2DOAA 1EJ9A 1J2XA 5F64A 5E1WA 3F8BA 5JHUA 3FE1A 5HK0A 3CXCM 4L5EA 5E3NA 4DS4A 5EG0B 1MNMC 3L2CA 4RAFA 3C6TA 3NGIA 1F36A 2IJLA 2E2HJ 1GLLO 3DTEA 2C0IA 3CC7T 3CCMN 2VASA 5DCMB 1LWCA 1S5JA 4HKEA 5J2PA 4KBOA 1X43A 2DW4A 3QWLA 3BDDA 2A40A 3JYTA 1VQOQ 4ASNA 1C0MA 1VOMA 1C6VA 1RBTA 1A0NB 1GLAG 4A0XA 2EFOA 1XGNA 1VQOI 2PVOB 1JEGA 2FF6A 2O8BA 3FZHA 1JLGA 2ELHA 1QCFA 2YI1A 1S5LC 2JVVA 3F73A 4XL9A 3CCRQ 1QQMA 5GANh 3LALA 3NWSA 1RKWA 3WEEA 2L4MA 3HKSA 4DBRA 3CCRI 2YLBA 4RAZA 1CF7A 1RACB 4BY7J 1HYVA 2DA1A 2Y4YA 2DA4A 1QVPA 3RRHA 1SL1A 1IW7F 1RT4A 2JVHA 3A8HB 4M7XA 2VQFK 1EH6A 1DTQA 2X4WA 2L2PA 1VQOA 2KQ2A 2F2VA 1XB4A 2E6LA 2O2OA 3VS5A 4FYDA 2M7BA 1X6GA 2OJ2A 1J9AA 3FJPA 1E0EA 1ON2A 1X1CA 3CCRA 1YQKA 4KGXB 3D1NI 4LUEA 1D9FA 1OCTC 4L59A 1RADB 1VHXA 1FXXA 5CYQA 2KDZA 4EDUA 3V8KA 1KFZA 2PX9A 4CZZA 3CCVI 1ZSZB 1JQQA 5BR8K 2EINH 2QA4T 2RAEA 3LA3A 1W5SA 1NPPA 1UAAA 4AHTA 1A5VA 1L3TA 2LYCA 4CJ7A 3QEIA 1UA0A 2VYTA 2EILH 1Q86R 1R77A 1TUYA 4KTZA 1VQ8N 3H1QA 3V9ZA 3R3LA 4YFKF 3CC2T 1V4SA 3IRXA 4C92E 4GMJB 1NOYA 3W3CA 5L3GA 4M78D 2X6YA 3RMDA 4ANJA 2ECBA 1KFDA 1SKSA 1NEBA 1UMQA 4DMNA 4EA4A 1UHSA 3M3YJ 4EIKA 3CCVA 2DLPA 3CCQT 1SFEA 1U2VA 3PX4A 4N0AA 1X2MA 1WBDA 1B1BA 2LDMA 2JT4A 2TRTA 1Z9CA 4C8QE 5E3OA 4EATA 4WXDA 4YOUA 2F96A 2DKGA 3K1NA 5JLXA 4ELVA 3JREA 2XIDA 4V2FA 2OTLQ 4YOTA 3HK2A 3S32A 3K2ZA 4A2AA 2BZ8A 3M59A 1KVBA 3CETA 4E7KA 4CA0A 1MSEC 4JKCA 5GAN6 2CU7A 2NRZA 4J6XA 4DWIA 2DY4A 2WUSA 5CVUA 1KEAA 1OQKA 4N9HA 3MCAB 4QWQA 1IAWA 1K8AR 4CJQA 2PJRB 5CVRA 3VU3C 1WEIA 2L7MP 5A0GA 3NWTA 4C8KA 1SD4A 4BC2A 2V1DA 1WNLA 4EJUA 2Q1ZB 1VSLA 2DFIA 2EA2A 2JMAA 5FW9A 3VF6A 3SDGA 1VQ4T 1IUFA 1QCNA 4M7AE 1HK9A 3LP2A 2WSEE 1XGSA 1SMTA 3K4BA 2Y9ZA 3VGLA 1R58A 2E10A 4BRMA 3VGKA 3BR6A 5LBQA 2BY2A 3OYYA 2NOFA 2XGCA 5JICA 2KK4A 3S1RJ 2RHIA 4A0YA 2Q1NA 4UUTA 1HX1A 1E3HA 2E34A 2L8DA 2AA4A 2E5NA 2IIRA 3PLAA 1WSJA 2Q2EA 5HBMA 4D7MA 1CXQA 2HDDA 4Z6YA 4RW6A 1TKDA 4W5NA 4JYKA 1ORNA 1IREB 4R79A 4DA4A 3JS6A 4BDPA 3QQAA 3INZA 4V19S 3CWAA 4L6V5 4F52A 1GLNA 4FLTA 4TV7A 2VWFA 4RB0A 2ECCA 1UA1A 1KRPA 2DA6A 2RHXA 2VUBA 4N4OB 1DIZA 1D1AA 1LPLA 1YQMA 5DPKA 3QYEA 2IG0A 2CP5A 2D0QB 1LWWA 3TEEA 1YIJT 4RMOA 4LMYA 3FC3A 3RQ4A 4CC2A 5GMKl 2H94A 4ABZA 3HSBA 1CSKA 1X3ZB 2NOHA 3HGGA 3PL8A 5DS9A 2AQFA 4Z89A 4B22A 3CZ6A 3QUIA 2P9IA 4CGHA 3QLHA 3CBPA 4GKKK 3WQTA 3VN5A 4H8KA 1HJRA 3D0SA 4I0BA 2CP7A 2ASMA 4E3SA 4FK4A 2V4JC 4BQNA 2ZXWH 5KYXA 3REBB 1SUQA 4AIDA 1W7PB 5IYBJ 3SQ1A 4HNVA 4HW0A 1T33A 3QJYA 3VQ8A 1FOWA 2M02A 3EFRA 4RTFD 1QQIA 2EZIA 4F55A 3TKYA 1LWFA 2B63J 5IXBA 3PSFA 3O6BB 5M5WJ 1SKRA 2FSNA 3SEMA 3O8GA 3NE6A 4EHTA 2L9NA 4M71A 2OTLN 2FMLA 3FBNB 3EFOA 4M72A 2EQMA 3E9FA 1ZLMA 2JS0A 2FLOA 3CJBA 3IKTA 1KQSS 4OVAA 1RDAA 3HSEA 2HHTA 3ME9A 1A6IA 3TI0A 4UV8A 4AHRA 3P1GA 4LGWA 1ACMB 3IQLA 4LNPA 3DLHA 4B9NA 1Y1VJ 2NVUB 2XRNA 5JI6A 4WQ5C 2KMUA 3IAS2 4B9SA 2VT3A 4M74A 1T44A 3WGGA 1IRFA 2HDCA 5GAHJ 2LCLA 3JRZA 5FKLA 3N5NX 3K4MA 3MVPA 2QM1A 3ZX2A 1LJOA 4CCLA 5EJCA 2WC9A 5IHNA 1W0UA 5AYFA 2FNPA 5KPZA 4EV0A 4G6TB 2DT7B 5TJJA 3H5NA 1L5UA 3BT9A 4CF9A 4U88A 3VSKA 4CZJA 2VPRA 4BR9A 3QEWA 4ZGDB 4A61A 1KCFA 3F23A 1LNWA 4CF0A 2JRTA 3SJJA 4AHCA 2HPIA 5I2SA 2A0FB 1K73O 2K9NA 4JZ3A 1O7FA 1GXQA 3I5RA 3MECA 3ULDA 1U1TA 1XQSC 3THYB 4DGWB 2K7AA 3ABKH 2E6ZA 2EFIA 3CJQB 4CIFA 3BG6A 1YI2Q 4BDZA 1WZ2A 3RPUA 2X48A 2JJ7A 1F1ZA 4L18B 2ZJQF 1TSFA 3CQTA 4KA4A 4CJ4A 3KZIC 1UDLA 4FYVB 2FL7A 3K10A 3G0ZA 1RAGB 1S3XA 3QOPA 1YE9A 4A3DJ 1JE8A 1M2VA 5HLFA 3E2UA 5TRDA 1U84A 2JMCA 4RB1A 2D9TA 3BY6A 2EFQA 2BUDA 1ZKGA 4PJLA 3CC4N 4J9DA 1QVGS 2GOXB 4EJWA 1RBRA 1YJ9N 1R0AA 2M87A 1OH8A 2GBYA 3FXQA 3O9TA 3ULEB 2JQ7A 2KIMA 2UXDK 3G4SQ 3H08A 1NJZA 4H4OA 1WI3A 4HX7A 4E7IA 4FSSA 1MMDA 4XIUA 4NZGA 3ZMUA 3T1HK 2OPRA 5CO7A 4UNFA 3HHTB 1E3MA 4FJGA 5JS1A 3L6QA 4OINF 3JCMe 1WRJA 4KUDK 3DTKA 1ZSZC 3FHNA 2W40A 2E2OA 3LAJA 2WC2A 3GOIA 2CP3A 3HOSA 1IO6A 1ZTRA 4DFPA 5CKFA 2ITGA 4LLGF 4F7UA 2QBYA 1IH7A 4OP0A 3JCMc 3RPQA 1OU8A 4F2RA 1SC7A 1BI3A 2DK5A 1I0CA 4YDUA 1IGQA 3QJ6A 2L3RA 4JP0A 4KAZA 1NNEA 3TANA 3KLFA 3MN5A 4OMMA 1ZLJA 3G0QA 3J7AO 3HPGA 3P8DA 2G8FA 1VQKA 2MPXC 3CUQB 1TL1A 4DTXA 3VENA 4BR0A 4LH4A 2MIOA 3P38A 3ZMVA 4MHGA 1X6BA 1TK0A 5DUKA 1Y97A 3KEQA 1GL5A 3OOUA 1OR7C 1YUWA 1WSIA 1FKPA 2FRWA 1IKYA 3KLIA 3I9QA 2F5FA 4I76A 3CPWM 2XASA 3K9KA 4FLYA 1PSEA 2PVGB 2RC4A 2WY8Q 3I55N 3QFUA 1AOYA 2D4WA 3VQ7A 4WCIA 1EQYA 4IOCF 4EZ9A 2NVYJ 2DTOA 1VSEA 2KGTA 3HVTA 4M3UA 4DTRA 4N4IA 2VXFA 1N78A 1V4RA 2HL3A 3CCST 1UUEA 1WB9A 4ITVA 2BHZA 3G25A 3VQ5A 1U5SA 3CCEI 2IPQX 4HRIA 4FWMA 1FZPB 4BRKA 2P9KA 2YUSA 1SAZA 1HUXA 1JJ2M 3MXIA 3L2UA 1BOAA 4M9SA 2QDYB 2DJNA 4M75A 1YI2N 3K1MA 5KTQA 2BY3A 2OZUA 5BRFA 1XMQK 1GCPA 1SEUA 1SVLA 1KG2A 1S9HA 2G8UA 4UY8I 4BJ6C 2XGDA 3H9QA 3UT1A 1EA3A 1K9MR 2W6KA 2EV0A 3NH2A 2E70A 3ELKA 3CCEA 1HYOA 1UEBA 1BIUA 2XPVA 4WF2A 3WT0A 1GVDA 2WACA 4BRGA 4S05A 4OMQA 3O2PE 4M3BA 2X6SA 4HT8A 1QVFA 1I1GA 3E9PA 4WX9A 1KG6A 2CS3A 2QUFA 2N8GA 5DM7L 1M1EB 4DYCA 4JV5K 2ETJA 3ASMA 2YNFA 1TKZA 1VF9A 1YCSB 1HMVA 3V9UA 2DYSH 1DU0A 1AHJB 4CJKA 4AM6A 2NZTA 1U5TB 5GINA 2P7VB 3E1YA 2FRHA 3GG4A 1EFNA 4DHYA 1YJNA 3IC7A 2J6FA 4LB6B 4CE9A 2CQXA 3G6EA 2CW0F 1RLQC 5GJVB 5MLCQ 4UQGA 2OQGA 5I21A 3ZYYX 5CAIA 1NGEA 2L4AA 3AG2H 2DQLA 5GAOq 2K9MA 5F1JA 4JRKA 3NVKA 2VYPA 3R6MA 4B47A 5J1EA 3H5RA 6AT1B 2BE5F 2E88A 3PQJA 3V9XA 5TKWA 1ZBJA 1GOBA 2Z0WA 2E7WA 4RTTA 3TAQA 5GANj 3BTIA 2X6OA 3ZBDA 2ZPEB 1OVQA 2D6FA 3VOEA 1XDSA 3P9KA 1OULA 4BRDA 3ZN0A 5BNGA 2HTSA 1YO5C 2HMIA 5ICCA 5AQLA 2VGNA 3CMAQ 2J5PA 4C8QD 3OYNA 1JUSA 2G7UA 3CMAI 1YITQ 2JSCA 2R0QC 1XHXA 1S7OA 4M7YA 2CWEA 1YITI 2FBHA 4M77G 4I7FA 3OMYA 4U0VA 3RQIA 1TWAJ 2M51A 5M5YJ 4B1YB 2RNJA 3WHBA 1TYQB 1QHGA 2W85A 4A5NA 4A3FJ 1V3FA 2KLOA 1ZAOA 2OTJT 3LP3A 3J7ZO 4W5TA 4NLBA 1E6GA 1S72N 3BPXA 4S04A 2L9VA 1TNSA 3C2HA 4FSXA 4NL2A 2DOFA 4BHPA 2M45A 3CMAA 3Q0VA 1ZG1A 3R0AA 5EDNA 3VMFB 3CDHA 3TU5A 4KH1B 3VESA 1P92A 2K86A 4RA2A 1XOVA 4O3MA 2QI2A 4IHWA 1YITA 3FLGA 4R1HA 1VQ9I 4EVIA 2QGUA 5J39A 2HB5A 4BGDA 3VS4A 1H9GA 2UZKA 5IAYA 1V54H 1X01A 4M7AD 1W2BM 3OYLA 1D8JA 3TOAA 3WXIA 1HKCA 4FK2A 4W1UA 2JNGA 2L3QA 2JW4A 2RPIA 2K57A 3O08A 3LLRA 2Z33A 5AZIB 2KP6A 3M1EA 2DXBA 1JUMA 1YFHA 4C92G 1BIZA 2AKLA 4XTZA 1QGPA 3I5UA 3FKJA 3AVNA 1EO1A 1YRNA 4J6YA 4WQ4A 5J8FA 1JTYA 3SJHA 3KLGA 3RESA 3LW5E 4K11A 4OB0B 1VQ9A 1IKXA 3WQUA 1X69A 4AQYK 4H0EA 1VQPT 3GTMJ 2V52B 3SQ4A 3O3FA 2RA2A 3I0RA 1RC9A 4M75E 4C8QG 2DXCA 1WH5A 4HNUA 1IGUA 1V29B 4JJCA 3HGYA 5H6RA 3WTYC 2IDOA 4ZYAA 5BRHA 3PUFA 3T19A 1L0OC 1PP7U 4EMSA 1K76A 1R5ID 5IHKA 1Q81R 4KREA 3D5LA 4B9VA 1Y8QB 2NUTB 4Z88A 4JKBA 1JL2A 3CBOA 1M1FA 2GOMA 4CK3A 3J80Z 1BG3A 5DM6F 3VYRB 3LANA 4KB0A 3DQVC 5L8RE 3HXMA 5BN9A 1NGFA 1LWVA 3NH0A 4C8MA 3AO2A 2ZF5O 1FWZA 1MD0A 2XPWA 1RTJA 2MG4A 1O3TA 2A41A 4LK0F 2YX6A 3ECHA 4CECA 1Z26A 1FT9A 2O9SA 3H3NO 3TSQA 2J05A 2PI0A 1UWBA 1KU2A 1M27C 5KAFC 3MD2A 4CSWA 1YP5A 4C0GA 4PGHA 3HP9A 4OB3B 3FDRA 2P9NB 4IO9L 1WSFA 5F0HA 1N6QA 4DR2K 2I7NA 1KQ0A 1OV3A 2CSOA 4LSNA 1K4TA 5LL6Z 2P9PB 4IOAF 2DJIA 3CC7Q 3O3KA 2JA6J 4KIGA 3ZCOA 1WYXA 2DXTA 4BKXA 3CUQC 2D0OA 3CC7I 2WAEA 4ZGJB 1YS7A 3QPHA 3NTHA 5K1YA 3OL3A 4CEDA 4M7DA 1OCZH 3TAGA 4IJAA 2X4YA 2GTOA 3ASKA 3J80K 2W0ZA 3H36A 3RSEB 5D6YA 2HVIA 1K73U 4XTYA 4FM2A 2HI3A 5FO5A 4HUFA 1N32K 4AG1C 1U2WA 1UAXA 4Y92A 3GE1A 4IIOA 3NMZC 2RKHA 3EHRA 3C6AA 1ETOA 2XRLA 4EJOA 1PUEE 1WSHA 5GAEP 4J9EA 4M3XA 3DCFA 4AC0A 4A12A 1AKHB 4LUDA 4Q48A 1KO9A 3VYGA 4M77B 1U78A 4L9JA 1NYGA 2XDVA 3M0TA 5BS6A 3LFUA 4F2SA 1R8OB 4RCBA 2DBBA 1IC8A 2YHAA 1JLFA 1IBKK 4XK8E 2Q2RA 2OBPA 4QVDA 1PKSA 3BOQA 2MCNA 3PFIA 1FBQA 1N8RC 1W5CC 3M53A 5GANe 4A2BA 2KZGA 2R7YA 1B59A 2M4GA 3K70D 4N4GA 2COMA 2HYFA 1I1SA 3CI5A 4Q4ZF 4WCEL 4D8DA 4AT1B 2VXZA 3C94A 2OAWA 4KHWA 3GFLA 1DGRM 2DL5A 3TP0A 4PLIA 4GGGA 1MMSA 1LWEA 1U47A 2A68F 4M3RA 2YUQA 1MBKA 3EH2A 4Q0BA 2FEZA 2QA4Q 3C65A 2K2MA 2K5LA 3NF7A 2JS2A 3OYMA 4RDUA 3EG1A 4A5BA 1R36A 2ZKZA 5CR4A 4XAXB 4CJTA 2GCXA 2GA2A 1LKXA 1WHGA 4XN0A 4B21A 2DJQA 1T8IA 2O9VA 5JHFA 4C92B 3CC2Q 1WHKA 3HTRA 3SZTA 4XICA 5GAN4 3CC2I 4GKJK 3ZL7C 3GZNB 2IGIA 2CZ7B 1YTYA 3CCQQ 2DEUA 1FBSA 2V9KA 3EPZA 4PJOA 4RAYA 5FFXA 3WODF 3RMSA 4B3OA 3Q0UA 3QRFF 2STWA 4CIEA 3CCQI 3DJCA 1U5TC 1IRZA 3BJ6A 2LMDA 1E3PA 1P7MA 3AL0B 4C8QB 1JCGA 2G8WA 2O3FA 3DLKA 2VKDA 5GAMf 3JB9J 3HFNA 5C24A 3K59A 1VYVA 2YNHA 1N9SA 3LAMA 4MQ9F 1J0RA 3CC2A 1DTTA 5GAGP 4UNOA 3JCMd 4AHSA 3ZT3A 4HXJA 4RLQA 4L5JA 2XF6A 3WXLA 3AVMA 5EG2A 1LE8A 2ZD1A 2JK3A 2OCEA 3CCQA 3L1AA 1RR7A 3JRDA 1QSLA 4JKAA 2H8WA 3QP6A 3H5AA 3E5XA 2E60A 3M5RA 4W5OA 4MO7A 1EF4A 1TWGJ 1D3YA 3BTJA 2XY6A 4JI6K 2GM4A 3MKWB 4LE9A 1Q82C 3GUDA 1BU1A 1MDUB 1CGPA 3OJSA 1TWFJ 3WU2C 1NG6A 2RJFA 2E1YA 4YFNF 1B72A 1V55H 2R5YA 5CLSA 1R4MB 4RCCA 4Y33A 1JI8A 1WVRA 1VQ4Q 4F16A 2ATQA 3M58A 1NKUA 1UG2A 3KETA 2DX1A 2OPPA 4IFEA 5KGXA 1VQ4I 4OJRA 2E2QA 3UDCA 3ZT2A 2F4VK 5B1AH 3HI0A 3ABTA 1GXPA 4KMFA 3CMEA 4ENJA 1D3BA 1P4XA 2CV1A 4FSVA 2KYBA 1W36D 2YJFA 1X19A 1NK4A 1OH7A 4QLCU 3J81Z 4LDYA 1IG8A 4CZIA 5M1OA 2GIZA 4EW0A 3S9HA 3VYTB 5FRNA 2IVNA 1HNIA 4M45A 3UKUA 1IUYA 2TDXA 3D45A 4IG3A 5D5WB 4JI2K 3CCUT 4N47A 5JR3A 3FR0A 3KE2A 3MEXA 4M7DE 1OCRH 3BGRA 3A5ZB 3OTOK 3I64A 4ENMA 3VOVA 3C7NA 2K5FA 2HQEA 5FPNA 2DT6A 2JA7J 4A4FA 4RWTA 2O8BB 4Y17A 1YCYA 3FK6A 3FXMA 1IN8A 2R7VA 1YIJQ 1YJWQ 3ZSZA 5C0YA 3O8MA 3ENBA 3WEEB 1YIJI 3VQ4A 3T7ZA 3FXUA 2KJBA 1CF7B 2MF2A 4KT5C 4ISGA 5J47A 5GMKe 4W5RA 4QS8A 1TK8A 4BRCA 3F0ZA 2NOIA 3CO6C 3J80O 4XONA 4IHYA 2LTOA 2M1BA 3HL2A 1HPMA 1FY7A 3O6WA 1FMVA 5HRRA 3J81K 3HYFA 4E89A 4YEJA 3Q7BA 4BRAA 3LWHA 3MP1A 3WTXC 2IAIA 5HK3A 4JOMA 1WJDA 5IYDJ 4B9UA 3CD6T 2QCOA 4A3CJ 3U3YA 1YIJA 1RTDA 3M0QA 3VYUB 5GAOm 3LFKA 2M0CA 3VUZA 3DMJA 1Q86O 2VT2A 1ZGWA 4HSBA 4GLKA 1RNLA 1S8NA 3KTUA 4E7LA 2KLAA 4VUBA 4KTQA 4I2PA 2IGNA 2CMPA 4XLHA 3QKJA 1RAIB 3CMMA 4EM0B 3HG9A 2PMHA 4WWCA 1FTZA 3AAQA 2BXZA 3JB9D 2H3EB 4AHUA 2XSJC 3A03A 1HRHA 2OANA 4MIMA 4QCLA 3VTHA 4CI0C 1T6CA 4QS7A 4PFPA 1V5GA 2P8TA 1XC9A 4FZXC 1N5ZA 3HSRA 1XMKA 4OMPA 1VQNT 4PJOE 4LD9K 3QWXX 2LK2A 2RGVA 1UGVA 1P8ZA 2V7FA 3CJAA 4IO8A 2XF5A 1O3SA 1GVJA 1R7JA 4MGRA 2YHYA 4U87A 3VFZA 1RT7A 2GTDA 2ROTA 2M9UA 3L4IA 3AVFA 2KY9A 1JJ2P 4PL8A 5AQQA 1JLAA 1V5FA 5K7ZA 3D5SC 4P5NA 2LDUA 3IDHA 2F8TA 1NG2A 4DS5A 1Q7YR 5ADXH 1YWPA 4ZN3A 3TDUC 2YU3A 1B92A 1D1BA 2HKNA 4XLFA 4FOIA 1BQMA 1MBFA 2DA7A 2NS0A 1J6ZA 2XAQA 2UUBK 4DBFA 4F7ZA 4MDWA 2QEXN 4UXNA 2V1RA 3AVBA 4E7SA 2FBVA 4J19A 5LL6S 2AZSA 2KTQA 1KG4A 5LEKA 1NK6A 4JI8K 4BBRJ 2DN0A 4ORZA 1KHCA 4IWVA 1NZ9A 4BJTA 1ZXOA 2G8IA 2BOLA 2QGGA 1MKMA 3PX6A 4NO7A 1XNQK 1VSMA 2FBYA 4ESBA 2KAFA 3CQYA 3LPTA 4M77C 5LJ3j 1HC8A 4J8OA 1VQ5N 4F8RA 4UV9A 3A02A 4PKHA 4CW7B 4AFSC 5L3DA 3X24B 3M0UA 4KITB 5HS7A 1WOQA 3FFIA 2E2IJ 4BVPA 2Q2EB 5GAEJ 3DKXA 1IJJA 3MFKA 4HF1A 4ATOA 4Y91A 2GBQA 4RGSA 4AIJA 4DV6K 4JI3K 1I94K 2BIVA 2L3PA 1BCOA 3E6DA 1H3HA 1A35A 2PYLA 2Z3YA 5M9OA 2QTXA 1D8KA 3O9RA 3AVIA 3SHFA 2NNYA 3AG3H 1BA0A 4E47A 4DYRA 1FLIA 1XNRK 2CW7A 3HSCA 3PM1A 4HDVA 1ZX6A 4M75D 1XPXA 2Y48A 1VQMQ 1IB8A 1U8RA 4C3IJ 4KPYA 1AT1B 4IUPA 4C92C 5L3EA 1S1TA 5B66C 3TL4X 2O4XA 3ZETA 3FK7A 5CY4A 4AMCA 2VUMJ 1NLOC 2KVQG 3UA7A 4F7UG 1T7PA 1VQ8T 4AIAA 3OW2A 4JK7A 2ZAEA 1X3WB 2DJZA 1ZARA 2I10A 2QWLA 2D0CA 3PVQA 1BBZA 4HA8A 2LKXA 2P9IB 3PNWC 2HR3A 3AL0C 4C8QC 4ZZLA 4GY5A 2JVGA 5IP6A 3ML6A 2YLCA 1ZHFA 2XRIA 1WJFA 5KYXB 4BRQA 2UUAK 1BM9A 1K61A 3LZJA 1FTTA 3MZHA 5A0LA 1TL8A 1MWKA 4F92B 3VS7A 3I0SA 3EKSA 1FYKA 5KAIC 2EQIA 1PDNC 2E35A 4HOBA 3OOPA 3CQ8A 1BIAA 2PU9B 2P5GA 3EFOB 4FJJA 3J81O 1Y96A 4EP5A 3KHYA 1S6PA 5CQEA 4CCMA 3IHUA 3QO3A 1NKEA 3ULQB 2ASPA 4CFAA 1LVKA 1WJCA 3QIIA 3F8CA 3TO9A 3COAC 4YOYA 3CCSQ 4IL6C 5GAGJ 4F3OA 3CCLN 1FIAA 3SQ0A 4Z4GA 3M55A 4H4KC 3CCSI 3CF5F 1I07A 3OYHA 1QZ6A 2QAZA 1XSVA 4ILHA 1JKQC 4KH4A 1W2BP 1ZG5A 4RTZA 3LGFA 2V1UA 1X75C 3D0PA 3ZOBA 4M75G 4FWNA 5AQGA 1HNXK 5LEJA 1ODDA 1I5OB 3OS2A 3BROA 2L5QA 4HLXA 4PUSA 1S1UA 3F21A 3F6VA 2AP1A 4UVCA 4OOIA 1T8EA 2MBFA 1MGQA 4BC4A 1IXDA 2I5WA 4FIBA 1QE1A 5GAOr 1MBJA 5AJ3K 2Z16A 3U4LA 3CFPA 2ISYA 3CCSA 6PAXA 5HDNA 1RDWX 1VTNC 3C95A 4ID5A 5M1QA 1JXEA 1IG7A 2XB5A 2HHHK 3I8BA 2H56A 2DYBA 3TSUA 2LZ6B 3ROUA 1ESVA 4CFDA 2KJCA 3VS1A 4HQMA 3TP3A 3NVMA 2O8EA 2W6LA 3IWFA 4CF1A 1VSJA 2CW8A 1SPKA 2OX7A 4WF9L 4H5WA 3QHSA 2FF4A 3VKIA 5B5EC 4I9QA 3H9JA 4QIWN 3A2FA 1RBSA 4FJIA 4IDKA 1FYLA 2E2NA 3HB9A 1NJIO 2G7HA 1BL3A 3I71A 1QZ5A 1X3NA 2DZCA 1Q1HA 5GANd 3VQDA 1WDXA 2CQKA 1M2VB 4J83A 2XUBA 4FE7A 1YHQN 3FIFA 1WAFA 3ATVA 3PE0A 4PNOA 1XDUA 2E41A 3U9DA 2OFKA 3PVLA 3EZWA 4HG2A 1AWJA 4J00A 1QVFS 2DTRA 1F1BB 3CM6A 3IHOA 3J8AA 1VQKN 1E2XA 3V7CA 1POGA 4M78F 3HP6A 3ZQHA 5GAN3 1OFCX 3THWA 2ZJ2A 4AM3A 3TMOA 2CV2A 4O55A 2DIGA 5C2DA 3NF6A 5CPRB 3HSFA 1E17A 1HLVA 3RI4A 3OW2P 4FVUA 3S1QJ 3BF1A 4HX8A 1ABOA 1H8KA 2EGEA 3K4JA 5ADXA 3BR3A 2JTFA 4JN4A 4BRPA 1JKHA 1N27A 2XHKA 3EYZA 3UIQA 1KFSA 5LJ3e 2YPRA 1MGTA 3G7ZA 2GWJA 3NGPA 2OTLT 4IVNA 2FVUA 4BY1J 4J9FA 3SMSA 1U3OA 1X9JA 3S15J 1WIEA 3QO9A 1QPIA 1NK0A 5HCKA 4F7UB 4EGYA 2EIJH 3CJ9A 2LX9A 2QBYB 3TO6A 3BDPA 3IH4A 3I4MJ 1KSWA 2D1XA 1M3CA 3DB4A 4XQFA 2DEQA 4JK8A 3ZFJA 2EGCA 4FM0A 2IVWA 2R4GA 5HKCA 1FEXA 2XO7A 4N0AC 2OTJI 3AVKA 3ZQCA 1NM1A 3N97A 2MD5A 3PIOA 4KN7X 4OB1B 3RTVA 2VQCA 4DOZA 3JRIA 4W97A 2LNVA 2P9UA 2M0MA 5KYUA 1RIOH 4QPQA 3CCEN 5IP9J 4BL0B 3ZLJA 1Y39A 3NMUA 3S1MJ 4OLAA 1WHUA 3OIOA 5GADP 5CJ9A 4XLAA 4M78A 2E1OA 3JRGA 2A07F 2HYGD 4FE4A 2VKEA 3BCBA 2ZC2A 3L0QA 2OTJA 4R55A 4YFUA 5L3FA 2G0EA 3B6OA 4MO4A 5M1NA 3EZ5A 4A5MA 1ZRCA 4CC3A 1FNNA 4A93J 3DLLA 2RJCA 4IHVA 3TAPA 4B8XA 2O8CA 1KC8R 5JVGL 1QQOA 4IUUA 2GFAA 2H8HA 2P0PA 2CFOA 3KYLA 1N77A 2P9KB 4WXHA 4EMKA 1ETXA 2OUMA 1ZLKA 1B9DA 1VQPQ 4CGDA 3SYZA 1BHLA 3NF8A 3HRMA 1DGWY 4FETA 2RI3A 4MLHA 4M75B 4BWMA 2AHQA 1E4GT 1YJNN 1N25A 5ECAA 3G6EN 4M7DD 2VC8A 4QVZA 3NF9A 1NGNA 4OKKA 2I5UA 2EB7A 5KCHA 2ITMA 5E8IA 4OAYA 1SMYF 2MABA 1P7IA 5D6XA 1LAWA 3F8NA 1KHIA 3AA5X 1Q1VA 2L3SA 1MJAA 2CUJA 1AWWA 1GFCA 2DO7A 3R4KA 1XJWB 1TP4A 1W1WE 3FKIJ 5E26A 3UB5A 3BPVA 2RM4A 3CYMA 1OQYA 5AQMA 2RHUA 3CC4T 5LJ5f 3HJEA 3C6UA 1YJ9T 1Q86U 2ZPHB 2EZKA 1ONVA 4Y15A 1PRMC 2CH6A 2QKMB 3GZ5A 2MYSA 1XWLA 4J9CA 1OMIA 5FU6B 2VG7A 3IUCA 2KRNA 5AQUA 3SFIA 3AO4A 2E65A 4CJSA 4R8HA 2H09A 2EH3A 5AZJA 5LD2C 2JHJA 2IS3A 2MGQA 1GFDA 4IKFA 3MJXA 3FGUA 1A31A 5D8LB 2ED0A 5E84A 3RYPA 4ZDPA 4K25A 1V76A 2YV0X 3S1NJ 4YG2F 1MUYA 3GO5A 1C6VX 4RKUE 4MZPA 2VI6A 1S1VA 1VQ7Q 3QB0A 5F0FA 3OV8A 5GAN5 2ZWHA 1J7KA 2X3XD 3FZLA 3KZYA 1DP3A 3H3UA 3VF4A 2NRVA 3KK7A 1X3UA