3I0XA

Crystal structure of clostridium acetobutylicum 8-oxoguanine glycosylase/lyase in complex with dsdna containing adenine opposite to 8-oxog
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
291
structure length
291
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPQVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYARENNIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase,lyase/dna
molecule keywords 8-oxoguanine-DNA-glycosylase
publication title Structural basis for the lack of opposite base specificity of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase.
pubmed doi rcsb
source organism Clostridium acetobutylicum
total genus 107
structure length 291
sequence length 291
ec nomenclature ec 3.2.2.-:
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3i0xA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3i0xA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3i0xA01
2JHJA 3FHFA 4AIAA 2NOLA 2NOHA 1N39A 4YPRA 4HSBA 1PU8A 1WEGA 1LWYA 1YQMA 1RRQA 2OFIA 4AI4A 1ORNA 3I0XA 1KQJA 4E9EA 4EW0A 5AN4A 4E9HA 1LMZA 4E9FA 1RRSA 3KNTA 1ORPA 4EJZA 2H56A 4B22A 1PU7A 4YPHA 4OFAA 2NOBA 2OFKA 1KG7A 1PU6A 3CW7A 1KG4A 2NOIA 4EJYA 3N0UA 1YQKA 5KN9A 1XQPA 4B23A 4B24A 1MUYA 1DIZA 1YQLA 3CVTA 2ABKA 1PVSA 1MPGA 4B21A 3IHOA 3D4VA 1LWWA 1KEAA 3CWSA 1LWVA 5DPKA 4AI5A 1XQOA 3OH9A 1HU0A 1MUNA 1KG6A 4DK9A 1M3QA 4EA5A 4EA4A 4UOBA 3OH6A 3G0QA 3KTUA 1N3CA 4EVVA 1YQRA 3FSPA 3F0ZA 1NKUA 3I0WA 1EBMA 1KO9A 2NOEA 3S6IA 3FHGA 5CHZA 1P59A 4YOQA 3CWTA 1KG2A 5KN8A 3N5NX 1KG5A 2YG8A 1XG7A 2YG9A 3CVSA 2NOZA 4PIIA 2JG6A 1WEIA 1VRLA 1N3AA 3CWAA 4OFEA 3CWUA 2I5WA 1NGNA 1MUDA 2JHNA 4E9GA 1WEFA 4EW4A 1P7MA 1M3HA 2NOFA 3IH7A 3OGDA 4UNFA 2XHIA 1KG3A 4OFHA 3F10A 1FN7A
chains in the Genus database with same CATH superfamily
3ASMA 4AIAA 2NOHA 1QN4A 1N39A 2JPIA 3OYKA 4PY5A 1K2YX 1ORNA 1KYUA 4ROCB 4E7KA 4QG5A 4B22A 4MRQA 1QN7A 1KG4A 4WX8A 1KYFA 2QREA 3SNSA 4E7HA 4BE2A 1YQLA 2V9JA 2ABKA 2Y8LA 3OYEA 3IHOA 3OYNA 1KY6A 1QTPA 3D4VA 4Q11A 2HKPA 1NH2A 1V5SA 3OSEA 1LWVA 5DPKA 1U84A 5FRNA 3OH9A 1KG6A 2OOYA 2G30A 3HS9A 1QN9A 3OYGA 1TBPA 1N3CA 2OOXA 1NKUA 1VOKA 5CHZA 3CWTA 5JMVD 2HL8A 3RSMA 1TGHA 2YG9A 2FGTA 1PCJX 2NOZA 2NWVA 2W03A 1WQAA 2R5XA 3ENCA 1N3AA 1NGNA 4EAKA 2V75A 1WEFA 1PCZA 1P7MA 5HSHA 1R4XA 2QRCA 1K35A 1VOLB 3KRMA 3PMGA 1KG3A 4OFHA 2HL9A 1B9KA 2Y8QA 4YPRA 3D7QA 1RRQA 2OFIA 1NVPA 5AN4A 5IYCP 1VTOA 2JPSA 1LMZA 1RRSA 1ORPA 4YPHA 2ZFDB 2MZ8A 2NOBA 3OSMA 2NVMA 4BJUA 2YH5A 4CFFA 1KFIA 2NOIA 2HZMA 3L2UA 5KN9A 1XQPA 4BE0A 1MUYA 4E7IA 2F7LA 2EHBD 3HS8A 1KEAA 5BMPA 4IKFA 1WJWA 3CWSA 3NA5A 2IV8A 3OS1A 3OYHA 3DPUA 1QN6A 1VKLA 1UT4A 4UOBA 3OS0A 3VN5A 3OH6A 3G0QA 3S3OA 3FSPA 3OS2A 3OLPA 3OYCA 1P59A 2D0AA 4D7QA 4E7JA 3N5NX 4TPSA 1NGMA 2YG8A 3L2QA 2DKAA 4PIIA 4ZTJA 4EAIA 2HZSA 3OSTA 3EIKA 2JHNA 4E9GA 3IH7A 3OGDA 1TUOA 3L2RA 2JHJA 3H1ZA 1YTFA 1T6AA 2D0BA 1PU8A 3OY9A 1XSZA 4ZTFA 1YQMA 5BMNA 4AI4A 2MJ7A 4EW0A 1J3MA 3RPJA 1KY7A 2FKFA 4E9FA 3KNTA 3PDKA 4EJZA 1PU7A 4OFAA 2LAEA 4WZSD 3CW7A 1YTBA 4EJYA 1P5GX 3N89A 2QR1A 1EUVA 4B23A 3OYIA 4B24A 1UL7A 4E7LA 1DIZA 1LXTA 2V8QA 1QNEA 2V92A 3UW2A 1W80A 1C47A 4I8OA 3OYBA 1Q9UA 3S3MA 3I3WA 1LWWA 1QN5A 2H5AX 4AI5A 1XQOA 1JFIC 1KYDA 1KFQA 5FRMA 3T4NA 1MUNA 1M5Q1 4DK9A 3R2XC 3BKQX 4EA5A 1RM1A 4EA4A 3OYFA 1PZDA 1CDWA 1C4GA 1YQRA 3C04A 2D0CA 2DKDA 5EPCA 1KO9A 1AISA 3OYLA 5IYBP 5KN8A 1XG7A 3CVSA 3OC3C 3S3NA 1D3UA 1QN8A 1VRLA 1E42A 2YA3A 3CWAA 1MP9A 1M3HA 2NOFA 4BE1A 1QNCA 2XHIA 2IV9A 3L2VA 1UT7A 2FKMX 2W04A 4DULA 3FHFA 4BDZA 2NOLA 1QNAA 4HSBA 5JN5A 1WEGA 1LWYA 4NZGA 3I0XA 1KQJA 4E9EA 2QLVA 4B0AA 4E9HA 1P5DX 3OYAA 5IYDP 2H56A 2DKCA 3TDHA 2Z8UA 3OYJA 5KL0A 3OYMA 3TE5A 2OFKA 1KG7A 3DPTA 1PU6A 2O3OA 4EAGA 3N0UA 1YQKA 3CVTA 4D7RA 1PVSA 1MPGA 4B21A 2PWWA 3VW4A 1C9BB 2H4LX 3F10A 4EAJA 3ULXA 3EAYA 1VTLE 3OCIA 1HU0A 1PCMX 4RODB 3NNQA 1M3QA 3OYDA 2VJ0A 4WXAA 3KTUA 2NLVA 1JDYA 4EVVA 3F0ZA 3I0WA 1EBMA 4IL8A 2NOEA 3S6IA 3FHGA 5F9CA 4YOQA 4BACA 1KG2A 3L2WA 1KG5A 4ROEB 2Z0FA 4BDYA 2FUVA 3ENOC 1WEIA 2JOIA 4HJHA 4OFEA 3CWUA 2I5WA 2QRDA 4C7PA 1MUDA 1QNBA 4EW4A 1QTSA 4UNFA 4EALA 5FROA 1TBAB 1QN3A 3LCNA 2JG6A 1FN7A
chains in the Genus database with same CATH topology
3ASMA 2JHJA 3H1ZA 3FHFA 1YTFA 4AIAA 2NOLA 1QNAA 2NOHA 1QN4A 1N39A 4YPRA 4HSBA 1PU8A 2D0BA 1WEGA 1LWYA 1YQMA 1RRQA 4PY5A 2OFIA 4AI4A 1ORNA 3I0XA 1KQJA 4E9EA 1KYUA 2MJ7A 1NVPA 4EW0A 5AN4A 4ROCB 5IYCP 1VTOA 4B0AA 3RPJA 4E9HA 1LMZA 1KY7A 4E9FA 1RRSA 3KNTA 5IYDP 1ORPA 4EJZA 2H56A 4B22A 2Z8UA 1PU7A 4YPHA 2MZ8A 4OFAA 2NOBA 3OSMA 1QN7A 2LAEA 2OFKA 4WZSD 1KG7A 2YH5A 3DPTA 1PU6A 3CW7A 1KG4A 2NOIA 4EJYA 1YTBA 2O3OA 1KYFA 2HZMA 3N0UA 3N89A 1YQKA 3SNSA 5KN9A 1XQPA 4B23A 4B24A 1MUYA 1DIZA 1YQLA 3CVTA 1QNEA 2ABKA 1PVSA 1MPGA 4B21A 3IHOA 1W80A 1KY6A 4I8OA 1QTPA 3D4VA 4Q11A 1LWWA 3HS8A 1KEAA 1NH2A 1QN5A 1C9BB 3CWSA 1LWVA 3ULXA 1VTLE 5DPKA 4AI5A 2IV8A 1XQOA 3OH9A 3OCIA 1JFIC 1KYDA 1HU0A 3DPUA 1MUNA 1KG6A 1QN6A 2G30A 4RODB 4DK9A 1M3QA 1UT4A 3HS9A 4EA5A 1RM1A 4EA4A 4UOBA 1PZDA 3VN5A 2VJ0A 1CDWA 1QN9A 3OH6A 3G0QA 3KTUA 1TBPA 1N3CA 4EVVA 1YQRA 2D0CA 3FSPA 3F0ZA 1NKUA 3I0WA 1EBMA 1KO9A 1VOKA 2NOEA 3S6IA 3FHGA 5CHZA 1AISA 1P59A 2D0AA 4YOQA 3CWTA 5IYBP 1KG2A 5KN8A 3N5NX 1KG5A 4TPSA 4ROEB 1NGMA 1TGHA 2YG8A 1XG7A 2YG9A 3CVSA 2FGTA 3OC3C 2NOZA 4PIIA 1D3UA 2JG6A 2HZSA 3OSTA 1WEIA 1QN8A 1VRLA 1E42A 2JOIA 3EIKA 1N3AA 3CWAA 4OFEA 3CWUA 2I5WA 1MP9A 1NGNA 1MUDA 2JHNA 4E9GA 1QNBA 1B9KA 1WEFA 1PCZA 4EW4A 1P7MA 1M3HA 2NOFA 1QTSA 3IH7A 3OGDA 1QNCA 4UNFA 2XHIA 1R4XA 1VOLB 1TBAB 2IV9A 3KRMA 1KG3A 1QN3A 1UT7A 4DULA 4OFHA 3F10A 1FN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHJ A;  3FHF A;  4AIA A;  2NOL A;  2NOH A;  1N39 A;  4YPR A;  4HSB A;  1PU8 A;  1WEG A;  1LWY A;  1YQM A;  1RRQ A;  2OFI A;  4AI4 A;  1ORN A;  3I0X A;  1KQJ A;  4E9E A;  4EW0 A;  5AN4 A;  4E9H A;  1LMZ A;  4E9F A;  1RRS A;  3KNT A;  1ORP A;  4EJZ A;  2H56 A;  4B22 A;  1PU7 A;  4YPH A;  4OFA A;  2NOB A;  2OFK A;  1KG7 A;  1PU6 A;  3CW7 A;  1KG4 A;  2NOI A;  4EJY A;  3N0U A;  1YQK A;  5KN9 A;  1XQP A;  4B23 A;  4B24 A;  1MUY A;  1DIZ A;  1YQL A;  3CVT A;  2ABK A;  1PVS A;  1MPG A;  4B21 A;  3IHO A;  3D4V A;  1LWW A;  1KEA A;  3CWS A;  1LWV A;  5DPK A;  4AI5 A;  1XQO A;  3OH9 A;  1HU0 A;  1MUN A;  1KG6 A;  4DK9 A;  1M3Q A;  4EA5 A;  4EA4 A;  4UOB A;  3OH6 A;  3G0Q A;  3KTU A;  1N3C A;  4EVV A;  1YQR A;  3FSP A;  3F0Z A;  1NKU A;  3I0W A;  1EBM A;  1KO9 A;  2NOE A;  3S6I A;  3FHG A;  5CHZ A;  1P59 A;  4YOQ A;  3CWT A;  1KG2 A;  5KN8 A;  3N5N X;  1KG5 A;  2YG8 A;  1XG7 A;  2YG9 A;  3CVS A;  2NOZ A;  4PII A;  2JG6 A;  1WEI A;  1VRL A;  1N3A A;  3CWA A;  4OFE A;  3CWU A;  2I5W A;  1NGN A;  1MUD A;  2JHN A;  4E9G A;  1WEF A;  4EW4 A;  1P7M A;  1M3H A;  2NOF A;  3IH7 A;  3OGD A;  4UNF A;  2XHI A;  1KG3 A;  4OFH A;  3F10 A;  1FN7 A; 
#chains in the Genus database with same CATH topology
 3ASM A;  4AIA A;  2NOH A;  1QN4 A;  1N39 A;  2JPI A;  3OYK A;  4PY5 A;  1K2Y X;  1ORN A;  1KYU A;  4ROC B;  4E7K A;  4QG5 A;  4B22 A;  4MRQ A;  1QN7 A;  1KG4 A;  4WX8 A;  1KYF A;  2QRE A;  3SNS A;  4E7H A;  4BE2 A;  1YQL A;  2V9J A;  2ABK A;  2Y8L A;  3OYE A;  3IHO A;  3OYN A;  1KY6 A;  1QTP A;  3D4V A;  4Q11 A;  2HKP A;  1NH2 A;  1V5S A;  3OSE A;  1LWV A;  5DPK A;  1U84 A;  5FRN A;  3OH9 A;  1KG6 A;  2OOY A;  2G30 A;  3HS9 A;  1QN9 A;  3OYG A;  1TBP A;  1N3C A;  2OOX A;  1NKU A;  1VOK A;  5CHZ A;  3CWT A;  5JMV D;  2HL8 A;  3RSM A;  1TGH A;  2YG9 A;  2FGT A;  1PCJ X;  2NOZ A;  2NWV A;  2W03 A;  1WQA A;  2R5X A;  3ENC A;  1N3A A;  1NGN A;  4EAK A;  2V75 A;  1WEF A;  1PCZ A;  1P7M A;  5HSH A;  1R4X A;  2QRC A;  1K35 A;  1VOL B;  3KRM A;  3PMG A;  1KG3 A;  4OFH A;  2HL9 A;  1B9K A;  2Y8Q A;  4YPR A;  3D7Q A;  1RRQ A;  2OFI A;  1NVP A;  5AN4 A;  5IYC P;  1VTO A;  2JPS A;  1LMZ A;  1RRS A;  1ORP A;  4YPH A;  2ZFD B;  2MZ8 A;  2NOB A;  3OSM A;  2NVM A;  4BJU A;  2YH5 A;  4CFF A;  1KFI A;  2NOI A;  2HZM A;  3L2U A;  5KN9 A;  1XQP A;  4BE0 A;  1MUY A;  4E7I A;  2F7L A;  2EHB D;  3HS8 A;  1KEA A;  5BMP A;  4IKF A;  1WJW A;  3CWS A;  3NA5 A;  2IV8 A;  3OS1 A;  3OYH A;  3DPU A;  1QN6 A;  1VKL A;  1UT4 A;  4UOB A;  3OS0 A;  3VN5 A;  3OH6 A;  3G0Q A;  3S3O A;  3FSP A;  3OS2 A;  3OLP A;  3OYC A;  1P59 A;  2D0A A;  4D7Q A;  4E7J A;  3N5N X;  4TPS A;  1NGM A;  2YG8 A;  3L2Q A;  2DKA A;  4PII A;  4ZTJ A;  4EAI A;  2HZS A;  3OST A;  3EIK A;  2JHN A;  4E9G A;  3IH7 A;  3OGD A;  1TUO A;  3L2R A;  2JHJ A;  3H1Z A;  1YTF A;  1T6A A;  2D0B A;  1PU8 A;  3OY9 A;  1XSZ A;  4ZTF A;  1YQM A;  5BMN A;  4AI4 A;  2MJ7 A;  4EW0 A;  1J3M A;  3RPJ A;  1KY7 A;  2FKF A;  4E9F A;  3KNT A;  3PDK A;  4EJZ A;  1PU7 A;  4OFA A;  2LAE A;  4WZS D;  3CW7 A;  1YTB A;  4EJY A;  1P5G X;  3N89 A;  2QR1 A;  1EUV A;  4B23 A;  3OYI A;  4B24 A;  1UL7 A;  4E7L A;  1DIZ A;  1LXT A;  2V8Q A;  1QNE A;  2V92 A;  3UW2 A;  1W80 A;  1C47 A;  4I8O A;  3OYB A;  1Q9U A;  3S3M A;  3I3W A;  1LWW A;  1QN5 A;  2H5A X;  4AI5 A;  1XQO A;  1JFI C;  1KYD A;  1KFQ A;  5FRM A;  3T4N A;  1MUN A;  1M5Q 1;  4DK9 A;  3R2X C;  3BKQ X;  4EA5 A;  1RM1 A;  4EA4 A;  3OYF A;  1PZD A;  1CDW A;  1C4G A;  1YQR A;  3C04 A;  2D0C A;  2DKD A;  5EPC A;  1KO9 A;  1AIS A;  3OYL A;  5IYB P;  5KN8 A;  1XG7 A;  3CVS A;  3OC3 C;  3S3N A;  1D3U A;  1QN8 A;  1VRL A;  1E42 A;  2YA3 A;  3CWA A;  1MP9 A;  1M3H A;  2NOF A;  4BE1 A;  1QNC A;  2XHI A;  2IV9 A;  3L2V A;  1UT7 A;  2FKM X;  2W04 A;  4DUL A;  3FHF A;  4BDZ A;  2NOL A;  1QNA A;  4HSB A;  5JN5 A;  1WEG A;  1LWY A;  4NZG A;  3I0X A;  1KQJ A;  4E9E A;  2QLV A;  4B0A A;  4E9H A;  1P5D X;  3OYA A;  5IYD P;  2H56 A;  2DKC A;  3TDH A;  2Z8U A;  3OYJ A;  5KL0 A;  3OYM A;  3TE5 A;  2OFK A;  1KG7 A;  3DPT A;  1PU6 A;  2O3O A;  4EAG A;  3N0U A;  1YQK A;  3CVT A;  4D7R A;  1PVS A;  1MPG A;  4B21 A;  2PWW A;  3VW4 A;  1C9B B;  2H4L X;  3F10 A;  4EAJ A;  3ULX A;  3EAY A;  1VTL E;  3OCI A;  1HU0 A;  1PCM X;  4ROD B;  3NNQ A;  1M3Q A;  3OYD A;  2VJ0 A;  4WXA A;  3KTU A;  2NLV A;  1JDY A;  4EVV A;  3F0Z A;  3I0W A;  1EBM A;  4IL8 A;  2NOE A;  3S6I A;  3FHG A;  5F9C A;  4YOQ A;  4BAC A;  1KG2 A;  3L2W A;  1KG5 A;  4ROE B;  2Z0F A;  4BDY A;  2FUV A;  3ENO C;  1WEI A;  2JOI A;  4HJH A;  4OFE A;  3CWU A;  2I5W A;  2QRD A;  4C7P A;  1MUD A;  1QNB A;  4EW4 A;  1QTS A;  4UNF A;  4EAL A;  5FRO A;  1TBA B;  1QN3 A;  3LCN A;  2JG6 A;  1FN7 A; 
#chains in the Genus database with same CATH homology
 3ASM A;  2JHJ A;  3H1Z A;  3FHF A;  1YTF A;  4AIA A;  2NOL A;  1QNA A;  2NOH A;  1QN4 A;  1N39 A;  4YPR A;  4HSB A;  1PU8 A;  2D0B A;  1WEG A;  1LWY A;  1YQM A;  1RRQ A;  4PY5 A;  2OFI A;  4AI4 A;  1ORN A;  3I0X A;  1KQJ A;  4E9E A;  1KYU A;  2MJ7 A;  1NVP A;  4EW0 A;  5AN4 A;  4ROC B;  5IYC P;  1VTO A;  4B0A A;  3RPJ A;  4E9H A;  1LMZ A;  1KY7 A;  4E9F A;  1RRS A;  3KNT A;  5IYD P;  1ORP A;  4EJZ A;  2H56 A;  4B22 A;  2Z8U A;  1PU7 A;  4YPH A;  2MZ8 A;  4OFA A;  2NOB A;  3OSM A;  1QN7 A;  2LAE A;  2OFK A;  4WZS D;  1KG7 A;  2YH5 A;  3DPT A;  1PU6 A;  3CW7 A;  1KG4 A;  2NOI A;  4EJY A;  1YTB A;  2O3O A;  1KYF A;  2HZM A;  3N0U A;  3N89 A;  1YQK A;  3SNS A;  5KN9 A;  1XQP A;  4B23 A;  4B24 A;  1MUY A;  1DIZ A;  1YQL A;  3CVT A;  1QNE A;  2ABK A;  1PVS A;  1MPG A;  4B21 A;  3IHO A;  1W80 A;  1KY6 A;  4I8O A;  1QTP A;  3D4V A;  4Q11 A;  1LWW A;  3HS8 A;  1KEA A;  1NH2 A;  1QN5 A;  1C9B B;  3CWS A;  1LWV A;  3ULX A;  1VTL E;  5DPK A;  4AI5 A;  2IV8 A;  1XQO A;  3OH9 A;  3OCI A;  1JFI C;  1KYD A;  1HU0 A;  3DPU A;  1MUN A;  1KG6 A;  1QN6 A;  2G30 A;  4ROD B;  4DK9 A;  1M3Q A;  1UT4 A;  3HS9 A;  4EA5 A;  1RM1 A;  4EA4 A;  4UOB A;  1PZD A;  3VN5 A;  2VJ0 A;  1CDW A;  1QN9 A;  3OH6 A;  3G0Q A;  3KTU A;  1TBP A;  1N3C A;  4EVV A;  1YQR A;  2D0C A;  3FSP A;  3F0Z A;  1NKU A;  3I0W A;  1EBM A;  1KO9 A;  1VOK A;  2NOE A;  3S6I A;  3FHG A;  5CHZ A;  1AIS A;  1P59 A;  2D0A A;  4YOQ A;  3CWT A;  5IYB P;  1KG2 A;  5KN8 A;  3N5N X;  1KG5 A;  4TPS A;  4ROE B;  1NGM A;  1TGH A;  2YG8 A;  1XG7 A;  2YG9 A;  3CVS A;  2FGT A;  3OC3 C;  2NOZ A;  4PII A;  1D3U A;  2JG6 A;  2HZS A;  3OST A;  1WEI A;  1QN8 A;  1VRL A;  1E42 A;  2JOI A;  3EIK A;  1N3A A;  3CWA A;  4OFE A;  3CWU A;  2I5W A;  1MP9 A;  1NGN A;  1MUD A;  2JHN A;  4E9G A;  1QNB A;  1B9K A;  1WEF A;  1PCZ A;  4EW4 A;  1P7M A;  1M3H A;  2NOF A;  1QTS A;  3IH7 A;  3OGD A;  1QNC A;  4UNF A;  2XHI A;  1R4X A;  1VOL B;  1TBA B;  2IV9 A;  3KRM A;  1KG3 A;  1QN3 A;  1UT7 A;  4DUL A;  4OFH A;  3F10 A;  1FN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...