3I0XA

Crystal structure of clostridium acetobutylicum 8-oxoguanine glycosylase/lyase in complex with dsdna containing adenine opposite to 8-oxog
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
291
structure length
291
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPQVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYARENNIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8-oxoguanine-DNA-glycosylase
publication title Structural basis for the lack of opposite base specificity of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase,lyase/dna
total genus 107
structure length 291
sequence length 291
ec nomenclature ec 3.2.2.-:
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3i0xA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3i0xA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3i0xA01
4E9HA 1LWYA 4EA4A 4DK9A 1P7MA 5KN8A 1KG4A 1YQMA 2NOZA 5DPKA 4OFAA 1RRSA 1KG6A 3CVSA 2H56A 4HSBA 1WEGA 1MPGA 2YG8A 2NOEA 4B21A 4OFEA 4E9GA 1P59A 1ORPA 4YPHA 1N3CA 2OFKA 4YOQA 4AIAA 3F0ZA 1WEIA 3OH9A 1M3QA 3CWUA 3S6IA 1N3AA 1XQPA 4EJYA 2NOHA 1LWVA 4YPRA 3OH6A 5AN4A 1PU7A 3IH7A 3CWSA 1KO9A 5CHZA 4EW4A 1FN7A 1NKUA 2JG6A 4EA5A 3CWTA 3FSPA 1KG2A 3CWAA 1LWWA 1YQLA 1XQOA 3CVTA 1PVSA 1MUYA 1KQJA 2JHNA 3IHOA 3N0UA 2OFIA 1PU6A 4EVVA 1MUNA 1YQRA 1KG5A 1MUDA 4UOBA 4EJZA 1EBMA 1HU0A 1PU8A 4E9EA 2NOBA 4B24A 4B23A 1N39A 3OGDA 2I5WA 1NGNA 4EW0A 4AI5A 1KG3A 2JHJA 3N5NX 4PIIA 3F10A 1KEAA 1LMZA 3CW7A 1WEFA 3I0XA 3I0WA 4UNFA 1XG7A 3FHGA 1DIZA 1ORNA 3FHFA 1M3HA 4B22A 4AI4A 5KN9A 3KNTA 4OFHA 2NOLA 2YG9A 3D4VA 1VRLA 3G0QA 4E9FA 1RRQA 3KTUA 2NOIA 1KG7A 1YQKA 2XHIA 2ABKA 2NOFA
chains in the Genus database with same CATH superfamily
1P5GX 4D7QA 4DK9A 1P7MA 1K35A 1YQMA 1QN5A 2Z8UA 1KY7A 4EAJA 3CVSA 3OY9A 1MP9A 3OYGA 1KYUA 3RPJA 4B21A 4OFEA 3L2WA 4E9GA 3H1ZA 1N3CA 2OFKA 1VOKA 3OH9A 1WEIA 1M3QA 3OYNA 1QNAA 3L2VA 1XQPA 1WQAA 2OOYA 3LCNA 2R5XA 3CWSA 5KL0A 3OS1A 3KRMA 3CWTA 4ROCB 3OSEA 1YQLA 2HL9A 1LXTA 3CVTA 1PVSA 2OFIA 5IYBP 2O3OA 2FKMX 4EVVA 1YQRA 3T4NA 5HSHA 5IYCP 3OS0A 1QN6A 3OSTA 1YTFA 1C4GA 1EBMA 4ZTFA 2NOBA 4BE2A 1KFQA 4C7PA 2I5WA 4E7IA 4BDZA 1V5SA 4PIIA 1QNEA 3NA5A 2HZMA 3ENOC 3I0XA 1XG7A 4EAKA 1PZDA 3DPTA 3FHGA 4I8OA 3VN5A 2NWVA 1QN7A 4MRQA 3S3NA 3OYCA 2NOLA 2FGTA 4E9FA 3S3MA 3NNQA 1YQKA 2ABKA 2NOFA 4EA4A 1E42A 1KG4A 4BJUA 1RM1A 1KG6A 3EIKA 5F9CA 4HSBA 3OSMA 4B0AA 2OOXA 4ZTJA 2JPSA 1PCMX 4AIAA 3OYMA 3CWUA 1QN8A 2DKDA 2NOHA 1TBAB 4YPRA 5AN4A 3IH7A 4EAGA 3VW4A 1C47A 3ULXA 1CDWA 3OLPA 1XSZA 1FN7A 4EA5A 3FSPA 1TUOA 1KG2A 3CWAA 1K2YX 4ROEB 4Q11A 2MZ8A 3IHOA 1MUYA 1R4XA 4BDYA 2Y8LA 1VTOA 1AISA 1KG5A 4WZSD 4EJZA 1P5DX 3BKQX 1HU0A 3OYHA 1VKLA 1QTPA 1N39A 3OGDA 4TPSA 3PMGA 1NGNA 4EW0A 4NZGA 1KG3A 5EPCA 2JHJA 1JDYA 2HKPA 2DKCA 1QN9A 1KEAA 3CW7A 2V9JA 1PCZA 3L2RA 1DIZA 1NH2A 1ORNA 3OC3C 1JFIC 3D7QA 5FROA 4OFHA 1T6AA 5FRNA 4E7JA 2YG9A 3G0QA 4BACA 1QNBA 1Q9UA 3KTUA 4E9HA 3UW2A 1LWYA 5KN8A 2LAEA 3OS2A 4WXAA 1KY6A 1C9BB 3OYLA 2D0BA 2H56A 1TGHA 1QN3A 1WEGA 2V75A 2JPIA 4DULA 1VTLE 1P59A 2G30A 4YOQA 3R2XC 2Z0FA 1NVPA 4QG5A 2Y8QA 5CHZA 3OYEA 4E7LA 4EW4A 4IKFA 3EAYA 1KQJA 2JHNA 1PU6A 2H4LX 4HJHA 2HZSA 3L2UA 4D7RA 3OYDA 2NLVA 1B9KA 5FRMA 1PU8A 1NGMA 4B24A 4B23A 4E7HA 4BE1A 4PY5A 1UT7A 1QTSA 2FKFA 1LMZA 1UT4A 3FHFA 1QN4A 1U84A 3HS9A 1D3UA 2QRDA 1RRQA 2NOIA 4WX8A 3RSMA 1KFIA 5BMPA 3OYKA 1M5Q1 1UL7A 2NOZA 5DPKA 2DKAA 4OFAA 1RRSA 1VOLB 3S3OA 2ZFDB 4IL8A 4RODB 3HS8A 1MPGA 2HL8A 2YG8A 2NOEA 3L2QA 4BE0A 1ORPA 4YPHA 1QNCA 2QLVA 3F0ZA 5JN5A 1KYFA 3S6IA 3OYFA 1N3AA 4EJYA 3N89A 2W04A 1LWVA 3OH6A 3OYJA 1WJWA 1PU7A 3I3WA 1KO9A 2H5AX 2W03A 1TBPA 2PWWA 5BMNA 3TDHA 4E7KA 1NKUA 2JG6A 1LWWA 2IV9A 2QREA 1XQOA 4EAIA 3N0UA 2QRCA 2F7LA 3OYIA 1MUNA 2MJ7A 1MUDA 1W80A 4UOBA 1EUVA 3C04A 2FUVA 4EALA 2QR1A 4E9EA 2YA3A 2YH5A 5JMVD 1J3MA 3DPUA 2IV8A 2D0CA 1PCJX 3ASMA 4CFFA 2V92A 4AI5A 1KYDA 2NVMA 3N5NX 3F10A 2EHBD 2VJ0A 1WEFA 3I0WA 4UNFA 3PDKA 3TE5A 1M3HA 3ENCA 1YTBA 4B22A 5IYDP 4AI4A 5KN9A 3KNTA 3OYAA 3OCIA 3D4VA 1VRLA 3SNSA 2D0AA 2V8QA 1KG7A 3OYBA 2XHIA 2JOIA
chains in the Genus database with same CATH topology
4E9HA 1LWYA 4EA4A 4DK9A 1P7MA 1E42A 5KN8A 1KG4A 1YQMA 2NOZA 5DPKA 2LAEA 2Z8UA 1QN5A 1RM1A 4OFAA 1KY6A 1KY7A 1RRSA 1VOLB 1KG6A 1C9BB 3CVSA 3EIKA 2D0BA 2H56A 1TGHA 4HSBA 1QN3A 1WEGA 4RODB 3HS8A 1MP9A 1MPGA 2YG8A 2NOEA 3OSMA 1KYUA 4B0AA 3RPJA 4DULA 4B21A 4OFEA 4E9GA 1P59A 1ORPA 2G30A 3H1ZA 4YPHA 1VTLE 1QNCA 1N3CA 2OFKA 4YOQA 4AIAA 3F0ZA 1WEIA 3OH9A 1M3QA 3CWUA 1KYFA 1VOKA 1QNAA 1QN8A 3S6IA 1N3AA 1XQPA 4EJYA 2NOHA 3N89A 1NVPA 1TBAB 1LWVA 4YPRA 3OH6A 5AN4A 1PU7A 3IH7A 3CWSA 1KO9A 3ULXA 5CHZA 1TBPA 3KRMA 1CDWA 4EW4A 1FN7A 1NKUA 2JG6A 4EA5A 3CWTA 3FSPA 1KG2A 3CWAA 4ROCB 4ROEB 1LWWA 2IV9A 4Q11A 1YQLA 2MZ8A 1XQOA 3CVTA 1PVSA 1MUYA 1KQJA 2JHNA 3IHOA 3N0UA 2OFIA 5IYBP 1PU6A 1R4XA 2O3OA 4EVVA 1MUNA 1YQRA 2MJ7A 1VTOA 2HZSA 1AISA 1KG5A 5IYCP 1MUDA 1W80A 4UOBA 4WZSD 4EJZA 1QN6A 1B9KA 3OSTA 1YTFA 1EBMA 1HU0A 1PU8A 4E9EA 2YH5A 1NGMA 2NOBA 3DPUA 4B24A 4B23A 2IV8A 1QTPA 1N39A 3OGDA 4TPSA 2D0CA 3ASMA 2I5WA 1NGNA 4EW0A 4PY5A 4AI5A 1UT7A 1KG3A 1KYDA 1QTSA 2JHJA 3N5NX 1QNEA 4PIIA 2HZMA 1QN9A 3F10A 1KEAA 1LMZA 3CW7A 1WEFA 3I0XA 2VJ0A 3I0WA 4UNFA 1XG7A 1PCZA 1PZDA 3DPTA 3FHGA 1DIZA 1UT4A 4I8OA 3VN5A 1NH2A 1ORNA 3OC3C 1JFIC 1QN7A 3FHFA 1M3HA 1QN4A 1YTBA 4B22A 5IYDP 4AI4A 5KN9A 3KNTA 3HS9A 4OFHA 1D3UA 2NOLA 2YG9A 2FGTA 3OCIA 3D4VA 1VRLA 3G0QA 4E9FA 1QNBA 3SNSA 2D0AA 1RRQA 3KTUA 2NOIA 1KG7A 1YQKA 2XHIA 2JOIA 2ABKA 2NOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E9H A;  1LWY A;  4EA4 A;  4DK9 A;  1P7M A;  5KN8 A;  1KG4 A;  1YQM A;  2NOZ A;  5DPK A;  4OFA A;  1RRS A;  1KG6 A;  3CVS A;  2H56 A;  4HSB A;  1WEG A;  1MPG A;  2YG8 A;  2NOE A;  4B21 A;  4OFE A;  4E9G A;  1P59 A;  1ORP A;  4YPH A;  1N3C A;  2OFK A;  4YOQ A;  4AIA A;  3F0Z A;  1WEI A;  3OH9 A;  1M3Q A;  3CWU A;  3S6I A;  1N3A A;  1XQP A;  4EJY A;  2NOH A;  1LWV A;  4YPR A;  3OH6 A;  5AN4 A;  1PU7 A;  3IH7 A;  3CWS A;  1KO9 A;  5CHZ A;  4EW4 A;  1FN7 A;  1NKU A;  2JG6 A;  4EA5 A;  3CWT A;  3FSP A;  1KG2 A;  3CWA A;  1LWW A;  1YQL A;  1XQO A;  3CVT A;  1PVS A;  1MUY A;  1KQJ A;  2JHN A;  3IHO A;  3N0U A;  2OFI A;  1PU6 A;  4EVV A;  1MUN A;  1YQR A;  1KG5 A;  1MUD A;  4UOB A;  4EJZ A;  1EBM A;  1HU0 A;  1PU8 A;  4E9E A;  2NOB A;  4B24 A;  4B23 A;  1N39 A;  3OGD A;  2I5W A;  1NGN A;  4EW0 A;  4AI5 A;  1KG3 A;  2JHJ A;  3N5N X;  4PII A;  3F10 A;  1KEA A;  1LMZ A;  3CW7 A;  1WEF A;  3I0X A;  3I0W A;  4UNF A;  1XG7 A;  3FHG A;  1DIZ A;  1ORN A;  3FHF A;  1M3H A;  4B22 A;  4AI4 A;  5KN9 A;  3KNT A;  4OFH A;  2NOL A;  2YG9 A;  3D4V A;  1VRL A;  3G0Q A;  4E9F A;  1RRQ A;  3KTU A;  2NOI A;  1KG7 A;  1YQK A;  2XHI A;  2ABK A;  2NOF A; 
#chains in the Genus database with same CATH topology
 1P5G X;  4D7Q A;  4DK9 A;  1P7M A;  1K35 A;  1YQM A;  1QN5 A;  2Z8U A;  1KY7 A;  4EAJ A;  3CVS A;  3OY9 A;  1MP9 A;  3OYG A;  1KYU A;  3RPJ A;  4B21 A;  4OFE A;  3L2W A;  4E9G A;  3H1Z A;  1N3C A;  2OFK A;  1VOK A;  3OH9 A;  1WEI A;  1M3Q A;  3OYN A;  1QNA A;  3L2V A;  1XQP A;  1WQA A;  2OOY A;  3LCN A;  2R5X A;  3CWS A;  5KL0 A;  3OS1 A;  3KRM A;  3CWT A;  4ROC B;  3OSE A;  1YQL A;  2HL9 A;  1LXT A;  3CVT A;  1PVS A;  2OFI A;  5IYB P;  2O3O A;  2FKM X;  4EVV A;  1YQR A;  3T4N A;  5HSH A;  5IYC P;  3OS0 A;  1QN6 A;  3OST A;  1YTF A;  1C4G A;  1EBM A;  4ZTF A;  2NOB A;  4BE2 A;  1KFQ A;  4C7P A;  2I5W A;  4E7I A;  4BDZ A;  1V5S A;  4PII A;  1QNE A;  3NA5 A;  2HZM A;  3ENO C;  3I0X A;  1XG7 A;  4EAK A;  1PZD A;  3DPT A;  3FHG A;  4I8O A;  3VN5 A;  2NWV A;  1QN7 A;  4MRQ A;  3S3N A;  3OYC A;  2NOL A;  2FGT A;  4E9F A;  3S3M A;  3NNQ A;  1YQK A;  2ABK A;  2NOF A;  4EA4 A;  1E42 A;  1KG4 A;  4BJU A;  1RM1 A;  1KG6 A;  3EIK A;  5F9C A;  4HSB A;  3OSM A;  4B0A A;  2OOX A;  4ZTJ A;  2JPS A;  1PCM X;  4AIA A;  3OYM A;  3CWU A;  1QN8 A;  2DKD A;  2NOH A;  1TBA B;  4YPR A;  5AN4 A;  3IH7 A;  4EAG A;  3VW4 A;  1C47 A;  3ULX A;  1CDW A;  3OLP A;  1XSZ A;  1FN7 A;  4EA5 A;  3FSP A;  1TUO A;  1KG2 A;  3CWA A;  1K2Y X;  4ROE B;  4Q11 A;  2MZ8 A;  3IHO A;  1MUY A;  1R4X A;  4BDY A;  2Y8L A;  1VTO A;  1AIS A;  1KG5 A;  4WZS D;  4EJZ A;  1P5D X;  3BKQ X;  1HU0 A;  3OYH A;  1VKL A;  1QTP A;  1N39 A;  3OGD A;  4TPS A;  3PMG A;  1NGN A;  4EW0 A;  4NZG A;  1KG3 A;  5EPC A;  2JHJ A;  1JDY A;  2HKP A;  2DKC A;  1QN9 A;  1KEA A;  3CW7 A;  2V9J A;  1PCZ A;  3L2R A;  1DIZ A;  1NH2 A;  1ORN A;  3OC3 C;  1JFI C;  3D7Q A;  5FRO A;  4OFH A;  1T6A A;  5FRN A;  4E7J A;  2YG9 A;  3G0Q A;  4BAC A;  1QNB A;  1Q9U A;  3KTU A;  4E9H A;  3UW2 A;  1LWY A;  5KN8 A;  2LAE A;  3OS2 A;  4WXA A;  1KY6 A;  1C9B B;  3OYL A;  2D0B A;  2H56 A;  1TGH A;  1QN3 A;  1WEG A;  2V75 A;  2JPI A;  4DUL A;  1VTL E;  1P59 A;  2G30 A;  4YOQ A;  3R2X C;  2Z0F A;  1NVP A;  4QG5 A;  2Y8Q A;  5CHZ A;  3OYE A;  4E7L A;  4EW4 A;  4IKF A;  3EAY A;  1KQJ A;  2JHN A;  1PU6 A;  2H4L X;  4HJH A;  2HZS A;  3L2U A;  4D7R A;  3OYD A;  2NLV A;  1B9K A;  5FRM A;  1PU8 A;  1NGM A;  4B24 A;  4B23 A;  4E7H A;  4BE1 A;  4PY5 A;  1UT7 A;  1QTS A;  2FKF A;  1LMZ A;  1UT4 A;  3FHF A;  1QN4 A;  1U84 A;  3HS9 A;  1D3U A;  2QRD A;  1RRQ A;  2NOI A;  4WX8 A;  3RSM A;  1KFI A;  5BMP A;  3OYK A;  1M5Q 1;  1UL7 A;  2NOZ A;  5DPK A;  2DKA A;  4OFA A;  1RRS A;  1VOL B;  3S3O A;  2ZFD B;  4IL8 A;  4ROD B;  3HS8 A;  1MPG A;  2HL8 A;  2YG8 A;  2NOE A;  3L2Q A;  4BE0 A;  1ORP A;  4YPH A;  1QNC A;  2QLV A;  3F0Z A;  5JN5 A;  1KYF A;  3S6I A;  3OYF A;  1N3A A;  4EJY A;  3N89 A;  2W04 A;  1LWV A;  3OH6 A;  3OYJ A;  1WJW A;  1PU7 A;  3I3W A;  1KO9 A;  2H5A X;  2W03 A;  1TBP A;  2PWW A;  5BMN A;  3TDH A;  4E7K A;  1NKU A;  2JG6 A;  1LWW A;  2IV9 A;  2QRE A;  1XQO A;  4EAI A;  3N0U A;  2QRC A;  2F7L A;  3OYI A;  1MUN A;  2MJ7 A;  1MUD A;  1W80 A;  4UOB A;  1EUV A;  3C04 A;  2FUV A;  4EAL A;  2QR1 A;  4E9E A;  2YA3 A;  2YH5 A;  5JMV D;  1J3M A;  3DPU A;  2IV8 A;  2D0C A;  1PCJ X;  3ASM A;  4CFF A;  2V92 A;  4AI5 A;  1KYD A;  2NVM A;  3N5N X;  3F10 A;  2EHB D;  2VJ0 A;  1WEF A;  3I0W A;  4UNF A;  3PDK A;  3TE5 A;  1M3H A;  3ENC A;  1YTB A;  4B22 A;  5IYD P;  4AI4 A;  5KN9 A;  3KNT A;  3OYA A;  3OCI A;  3D4V A;  1VRL A;  3SNS A;  2D0A A;  2V8Q A;  1KG7 A;  3OYB A;  2XHI A;  2JOI A; 
#chains in the Genus database with same CATH homology
 4E9H A;  1LWY A;  4EA4 A;  4DK9 A;  1P7M A;  1E42 A;  5KN8 A;  1KG4 A;  1YQM A;  2NOZ A;  5DPK A;  2LAE A;  2Z8U A;  1QN5 A;  1RM1 A;  4OFA A;  1KY6 A;  1KY7 A;  1RRS A;  1VOL B;  1KG6 A;  1C9B B;  3CVS A;  3EIK A;  2D0B A;  2H56 A;  1TGH A;  4HSB A;  1QN3 A;  1WEG A;  4ROD B;  3HS8 A;  1MP9 A;  1MPG A;  2YG8 A;  2NOE A;  3OSM A;  1KYU A;  4B0A A;  3RPJ A;  4DUL A;  4B21 A;  4OFE A;  4E9G A;  1P59 A;  1ORP A;  2G30 A;  3H1Z A;  4YPH A;  1VTL E;  1QNC A;  1N3C A;  2OFK A;  4YOQ A;  4AIA A;  3F0Z A;  1WEI A;  3OH9 A;  1M3Q A;  3CWU A;  1KYF A;  1VOK A;  1QNA A;  1QN8 A;  3S6I A;  1N3A A;  1XQP A;  4EJY A;  2NOH A;  3N89 A;  1NVP A;  1TBA B;  1LWV A;  4YPR A;  3OH6 A;  5AN4 A;  1PU7 A;  3IH7 A;  3CWS A;  1KO9 A;  3ULX A;  5CHZ A;  1TBP A;  3KRM A;  1CDW A;  4EW4 A;  1FN7 A;  1NKU A;  2JG6 A;  4EA5 A;  3CWT A;  3FSP A;  1KG2 A;  3CWA A;  4ROC B;  4ROE B;  1LWW A;  2IV9 A;  4Q11 A;  1YQL A;  2MZ8 A;  1XQO A;  3CVT A;  1PVS A;  1MUY A;  1KQJ A;  2JHN A;  3IHO A;  3N0U A;  2OFI A;  5IYB P;  1PU6 A;  1R4X A;  2O3O A;  4EVV A;  1MUN A;  1YQR A;  2MJ7 A;  1VTO A;  2HZS A;  1AIS A;  1KG5 A;  5IYC P;  1MUD A;  1W80 A;  4UOB A;  4WZS D;  4EJZ A;  1QN6 A;  1B9K A;  3OST A;  1YTF A;  1EBM A;  1HU0 A;  1PU8 A;  4E9E A;  2YH5 A;  1NGM A;  2NOB A;  3DPU A;  4B24 A;  4B23 A;  2IV8 A;  1QTP A;  1N39 A;  3OGD A;  4TPS A;  2D0C A;  3ASM A;  2I5W A;  1NGN A;  4EW0 A;  4PY5 A;  4AI5 A;  1UT7 A;  1KG3 A;  1KYD A;  1QTS A;  2JHJ A;  3N5N X;  1QNE A;  4PII A;  2HZM A;  1QN9 A;  3F10 A;  1KEA A;  1LMZ A;  3CW7 A;  1WEF A;  3I0X A;  2VJ0 A;  3I0W A;  4UNF A;  1XG7 A;  1PCZ A;  1PZD A;  3DPT A;  3FHG A;  1DIZ A;  1UT4 A;  4I8O A;  3VN5 A;  1NH2 A;  1ORN A;  3OC3 C;  1JFI C;  1QN7 A;  3FHF A;  1M3H A;  1QN4 A;  1YTB A;  4B22 A;  5IYD P;  4AI4 A;  5KN9 A;  3KNT A;  3HS9 A;  4OFH A;  1D3U A;  2NOL A;  2YG9 A;  2FGT A;  3OCI A;  3D4V A;  1VRL A;  3G0Q A;  4E9F A;  1QNB A;  3SNS A;  2D0A A;  1RRQ A;  3KTU A;  2NOI A;  1KG7 A;  1YQK A;  2XHI A;  2JOI A;  2ABK A;  2NOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...