3OYEA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound2
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyeA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyeA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyeA03
5J2NA 3KIOA 5KCHA 3SPYA 3ZT3A 4FJKA 3LP0A 1D9FA 3AVNA 1KHCA 1UA1A 3AO5A 4F2SA 4B9SA 3C6UA 3T3FA 1NJYA 4DSIA 1RTIA 3KKSA 3SV3A 4AHCA 2P5OA 4IG3A 3ITHA 2ZD1A 1EP4A 3S3MA 1H3ZA 4FK0A 4RG2A 1XHZA 1JKHA 4DTMA 3AA3A 4IBNA 1JXBA 3OS1A 3QLHA 1Q9XA 3ISNC 5CY4A 1DTQA 3MP8A 1LWEA 1WGSA 4AHVA 4FM2A 4J2AA 3PUFA 1J9AA 1KVCA 4B3OA 3MEUA 4DTUA 1TKTA 4OGEA 4B8AB 4B9NA 1HPZA 3QINA 4Z4FA 4OGCA 4FJGA 1VSMA 3LPTA 3IAYA 3EYZA 5C42A 3A2FA 4I2QA 3C4SA 2KZMA 3SUOA 1B9FA 1RT6A 3MP1A 4H4MA 3K2PA 2BDPA 3RR8A 3HPOA 2QXFA 2OPQA 3V4IA 3DLMA 4O4GA 2ITGA 2HHTA 4CHPA 4AH9A 2XO7A 1LAWA 4CJPA 4FLWA 4E3SA 3RMCA 2LCCA 3QEWA 5J1EA 5KE2A 3NHGA 5D6XA 4N4IA 4DTNA 1OZ2A 3VQCA 1CXUA 1IH7A 2IG0A 3MEEA 1JL1A 1SKSA 1QHTA 1UA0A 3SYZA 3SUNA 3KK3A 3P8HA 1HYZA 1WSIA 1SKRA 4FLZA 4XIUA 3MP6A 4C8OA 3G0ZA 2OPRA 4BE2A 1VSHA 3TAMA 1RTJA 4RG8A 3CM5A 2HQEA 1X1PA 1KTQA 1O1WA 4CGHA 1C1CA 3LP3A 4C5GA 2XY6A 4CJ4A 1T8EA 1L3UA 1TKXA 1JL2A 1IKYA 4JS4A 2YV0X 3KD5E 2YHBA 3TAGA 1JLBA 3AO4A 3LANA 4IUTA 3T1AA 2HHWA 3ASKA 2XY5A 4M3UA 3ZT2A 3LZIA 3DLBA 3LDSA 2Q3SA 3H8ZA 2YNIA 2M16A 3KK1A 1BI4B 3AVIA 4CJEA 4HHTA 2G8KA 3AVBA 3JYTA 4IUVA 3RRHA 1SSFA 3WNHA 1SUQA 3HVTA 3VQ5A 2EHGA 3L2QA 4YFUA 2E6NA 3LYIA 1SV5A 2FHDA 4ELTA 3C94A 1ASUA 1I3AA 3AVJA 2QKBA 1A5VA 3QJ6A 5J26A 4CJ3A 4E1NA 3V9WA 1TAQA 3OYKA 4NCBA 4F2RA 2EKOA 4B9WA 4E7LA 4G1QA 3GOXA 4E7IA 4FM1A 1KLMA 1TK0A 3B6OA 5CYQA 4FK4A 4B8CA 3O3FA 3AVKA 4CE9A 4DQRA 4W5OA 3RTVA 4JRPA 4DQQA 3MEDA 2GF7A 1L3TA 5K14A 1BQMA 3SCXA 4B9XA 3VQAA 2RJFA 5FRMA 4QQGA 2RO0A 3SQ1A 3QESA 4ELUA 2E6MA 4CGDA 1REVA 4J2EA 4KV8A 4ID5A 2IDOA 2FBYA 3ULDA 1ASWA 5HROA 4Q5VA 4DQSA 3M8RA 2F8SA 1RT5A 4IDKA 4NYNA 4A4EA 4FK2A 4KHYA 1A5XA 1NJZA 4QQ6A 3BDPA 3OYIA 3I8DA 5FDLA 1CXQA 1QSYA 1BL3A 3H08A 3S3OA 4DF8A 2CKKA 1RT2A 3E01A 1F21A 2G8VA 2RJEA 3UT1A 4F3OA 2HHUA 2E6LA 1J53A 4DTJA 3NGZA 2X6NA 4GVMA 4CF9A 2R5MA 3MXJA 1VSDA 2D0CA 4CFDA 3CFPA 1JLGA 5KGXA 2LVMA 3ZSOA 1VRTA 1NOYA 3KLIA 3PO4A 4DMNA 2D0AA 1TV6A 2BANA 1S1WA 1U45A 1B9DA 4PLIA 1Z26A 3P1GA 1B92A 1ITGA 4CJUA 3TARA 3G10A 4KREA 4MQ3A 3OS2A 4CF0A 1NJXA 1U48A 5J2PA 3RMBA 1NK6A 1Y97A 4CRIA 4DFJA 4N76A 1KCFA 3VQPA 2PZSA 3THVA 4FLYA 2QQRA 3DI6A 5C25A 1OZ3A 1WAJA 4UC4A 3O4QA 2I5JA 1U49A 3O4NA 3PO5A 4IFYA 2HB5A 3OYAA 1N27A 2HHXA 2RHZA 2BUDA 1WSEA 4E0DA 2G8UA 1RT1A 1Z25A 4BD3A 3KLEA 1U4BA 4KFBA 1WSGA 3BDLA 3I0RA 2HHQA 4W5RA 1EX4A 1C0TA 4I7FA 1S5JA 4FJMA 4HUGA 2FBXA 2KW4A 2HVIA 4N4HA 5KH6A 2EQKA 4OKJA 4CERA 2G8HA 1BI4A 4KTQA 2FBTA 2LRQA 4DSKA 3L2WA 4LD0A 2M1HA 1WSHA 1W0HA 2P51A 3RWUA 3AO2A 1S1XA 3QETA 3QKJA 5M9OA 4M3WA 4LD6A 5HRRA 3TWHA 1VSEA 2P0KA 4OPJA 1KFSA 4CK1A 5FROA 1BIUA 3LGLA 5KI6A 1VRUA 3DLGA 3P83D 4JS5A 4UQGA 3AA5X 2MWOA 2XDPA 4CEBA 4ZTFA 1RBTA 1S1UA 3ZT1A 4FZYA 3B6PA 3O3GA 4CK3A 2RN2A 2O4GA 1NK5A 4B08A 5IN1A 4F3TA 3HYFA 5KCOA 4DQIA 4M45A 4CHYA 3TANA 1VSIA 4AHTA 3HL8A 2PYLA 3F73A 3VQQA 2ETJA 2IOCA 4QAGA 2GFAA 3HP9A 1ZBLA 4KB1A 3ZCMA 4DTOA 3HO1A 1S9GA 4Z4IA 2YNGA 2XY7A 4N56A 3L2UA 4HCZA 4FLXA 2LDMA 2P5GA 3MEWA 4IUPA 2DIGA 3T19A 4E89A 3OYEA 1C0UA 1TK8A 4I9QA 2RI5A 3QNNA 3AVMA 2L8DA 4JLHA 1LV5A 4FZXC 2X4WA 4A4FA 2E4LA 2A1SA 4H4OA 1RNHA 2L3RA 4FLVA 3K5NA 4FJIA 4CJRA 2G8WA 4B9VA 4CFAA 1XI1A 1RBUA 1L3VA 3ZSQA 1RT7A 3F70A 4KRFA 4LY7A 4KAZA 3LLRA 1R0AA 1HNIA 3VQDA 1NK7A 5KE3A 3V1QA 3ASMA 1NK4A 2G3RA 3HT3A 4CCHA 2RI3A 4K8ZA 1ZBIA 4M41A 3DRSA 1KRPA 1KSPA 3H6ZA 2JTFA 1K6YA 2Z1IA 3DOLA 2WACA 4FJJA 3NTIA 4OKEA 2B4JA 4B9TA 3UWNA 3HPHA 3AVHA 4N41A 2YNFA 4DU3A 4FYDA 2OPSA 3HJFA 3NF8A 4GW6A 4DTRA 3MXIA 3OYJA 1KVAA 5C6SA 3TAQA 2RKIA 1CLQA 4C8LA 5E41A 2YHAA 3I0SA 2DFEA 1DTTA 4CIFA 1SL2A 1EETA 4CHNA 1IKWA 2YKMA 3RMAA 4BACA 5KTQA 1CZBA 4Y1DA 4IUQA 5CZ2A 2OA8A 4PY5A 3M8PA 4Z4GA 1TAUA 4QVZA 4Z0UA 4KHQA 3NNQA 1MHNA 1UOCA 4DFPA 4QOZB 2DFHA 5KGWA 3L3VA 3OYBA 4DF4A 4FW1A 4RW8A 4BDZA 1JLFA 3SUPA 5T7BA 1J5OA 3VQ7A 2IC3A 4KO0A 2GBZA 2RPIA 1QS4A 2B5JA 3NCIA 4FJLA 4QCLA 2EFIA 5HRSA 4E1MA 4NCAA 1YVUA 3ZSXA 3LX7A 4O55A 4EDUA 1TL1A 1KLNA 1U47A 3SQ2A 3FFIA 4DSEA 3DB4A 1JLAA 1WJRA 4DLEA 3K59A 2OYQA 2JZ2A 1Q9YA 2MWPA 3P8DA 1SL1A 4DLGA 4CJFA 4Q0BA 1S9EA 2BE2A 2XHBA 4PWDA 3LZJA 2EQUA 3MEVA 4OVAA 4CHOA 3L3UA 1WN7A 2DIQA 1TK5A 4CEEA 2YKNA 1KVBA 3VA3A 4ID1A 3DRPA 1A5WA 4GMJB 1L5UA 3KD1E 2VWKA 5KRTA 2AJQA 4CJQA 1RBRA 1YTUA 3V9UA 3OYFA 1RTHA 1NK8A 2PQWA 4M3RA 1YTAA 3AVFA 4Q5WA 3NTKA 4FJNA 4CGFA 3EY1A 4NYFA 3CFRA 4CJTA 3V6DA 1C0MA 4II1A 3O3HA 2X6SA 4DU4A 2DY4A 4DFKA 2G8IA 3IS9A 4FJHA 3NDKA 3D45A 4KHNA 4OPKA 4HCBA 3NGIA 3NH2A 3SV4A 1U04A 3AVCA 3HVRA 4H8KA 2GUIA 3AVGA 4RW7A 3V81A 2WONA 2YNHA 1WLJA 4FVMA 3DLEA 3C95A 3K5MA 4DTPA 3CEYA 1ZBHA 2JLEA 4O0JA 3RR7A 5HLFA 4CEQA 3QEVA 1SKWA 3S3NA 4DSFA 3SPZA 4CEFA 2F8TA 2BIVA 3LAKA 2R5AA 4KHUA 3PMIA 4M3XA 4YNQA 4TSXA 2GFUA 4FLTA 3LGFA 3AVAA 1QSLA 3WNEA 1FKPA 2DFFA 4IUUA 1LW0A 4FJ5A 4O44A 1HMVA 1NJWA 3ZSZA 2HHSA 2O4XB 2D9TA 2X4YA 1BHLA 4M3YA 4M3TA 1RT4A 1WAFA 4CJWA 3NF9A 1RT3A 3ZSRA 1ZBUA 3PV8A 4CK2A 3OB9A 2K3XA 3FEOA 3DB3A 4GY5A 3V1RA 1YT3A 3DOKA 3WNGA 4ZTJA 4CEZA 4E7HA 2VG5A 2F5KA 3E9FA 5D6YA 4RW4A 2RJDA 3DRRA 2QQSA 1HYSA 3K57A 3BGRA 3QO9A 5FRNA 4CF1A 1IG9A 4CFCA 2ZE2A 1LWFA 4ELVA 1GOCA 3HP6A 1T7PA 2FBVA 4ICLA 3K5LA 3SJJA 2Y1IA 3ZT0A 4C8KA 3OQ5A 3OYMA 3QERA 3U3YA 3SI6A 1TVRA 4LSNA 3V9SA 4Y1CA 1WJQA 1UAXA 4LH4A 2X74A 4W5QA 3LPUA 1D8YA 3VA0A 2KFZA 1LW2A 3U3GA 3ZSWA 1XC9A 1RDCA 3IRXA 1RDAA 4CJ5A 2B8AA 1VSKA 4KPYA 4FXDA 4L8RB 3JSMA 3VQ9A 1FKOA 4CEAA 5SWMA 2OZMA 4F8RA 4DSJA 3HXMA 3L42A 2X35A 1C1AA 4IFVA 3KKRA 1N6QA 3PX0A 3M8QA 4RW6A 1G5VA 2D0BA 2YRVA 3OYNA 1DLOA 3VQ8A 4DFMA 1XWLA 4AHUA 1RILA 1X9MA 1NOZA 3DLRA 2O4IA 3ZT4A 5D6WA 4CF2A 2KZZA 3OYCA 3HPGA 4DS4A 1TGOA 1T03A 3FC3A 3QIIA 5HP1A 3QEIA 4KKOA 4AHSA 1LWCA 4CEDA 3PFSA 1RBVA 2L89A 1JLEA 2K3YA 1HQUA 5KRSA 4KTWA 3LWMA 4MFBA 2X78A 4CJLA 2FC0A 4CESA 3MEGA 4NS5A 2NUBA 2D5RA 4IG0A 2DTUA 3D0PA 2WOMA 1S6QA 3SZ2A 1Q8IA 2KTQA 1BGXT 3Q1JA 4EZ9A 1NK0A 4BE1A 4EP4A 1QQCA 4K8XA 4C8MA 3MO8A 4QQDA 3K5OA 5J2MA 3L2RA 3U6FA 1WNSA 3M8SA 1TKZA 3PY8A 2HNDA 4BDYA 4NZGA 4C5EA 5HRPA 3TAFA 2PYJA 1RDDA 3PX6A 1JLQA 2HQXA 2RJCA 2GV9A 1RTDA 3PNWC 3OYHA 4Z4HA 4QW2A 2HNYA 2RHIA 2KFNA 4CFBA 5I42A 1HYVA 1KFDA 5CIUA 4FM0A 4W5NA 1NKBA 2O4XA 4CF8A 4CGIA 1BQNA 1FXXA 2IAJA 2VYTA 2RHXA 3AA2A 3LALA 1IKXA 4FZZA 1UWBA 1TKDA 3ZSYA 5JS2A 1NK9A 3VQEA 3LH0A 2M0OA 5J39A 1GOBA 2R7YA 3MAQA 4M42A 2ATQA 2NLUA 3NGYA 1HNVA 3CQ8A 5HRNA 1XNIA 3OS0A 4FLUA 4FJXA 4BWJA 5DK5A 4DQPA 1JXEA 4DSLA 1FK9A 3DLHA 1RBSA 1X9WA 2EQMA 3KLGA 1SL0A 2VWJA 4IKFA 1HRHA 4J2BA 1BCOA 4CHQA 4R5PA 3HSTB 3AO1A 4FJ8A 3VQ4A 4JRQA 3NAEA 2P1JA 3AO3A 3META 4LH5A 1G15A 1WSFA 3RMDA 3NTHA 1VSLA 2HVHA 3NH1A 3QNOA 2HW3A 4CJKA 1QE1A 4A4HA 4FJ7A 2DAQA 3HM9A 3O8VA 2XRIA 1BIZA 1C6VA 3LP1A 2RHYA 4OLAA 3AVLA 3OVNA 4F4KA 3L2VA 4DG1A 4O0IA 1I39A 3OJUA 3SD4A 4KHWA 3PX4A 4WE1A 3S9HA 2F96A 4E7JA 1JLCA 1D5AA 3OMGA 4EZ6A 4C8NA 3LP2A 3ZEHA 4CJVA 4KB0A 1D9DA 4DTSA 2EX3A 3L8BA 2HNZA 4B9UA 2IS3A 3HK2A 4PQUA 3QEXA 2OPPA 4N4GA 3EZ5A 4FJ9A 2VG6A 3UIQA 4L59A 4KHSA 4FU6A 5JS1A 4KTZA 4BWMA 2E5QA 1NKEA 3SQ0A 4BE0A 3VN5A 3CM6A 2LTOA 4CGGA 1OI1A 4CJSA 1WJSA 4DWIA 5C0MA 2Y1JA 3FDRA 4J2DA 3KTQA 1GOAA 4CIGA 3P5JA 4CIEA 4M3ZA 3TI0A 4CHZA 4B9MA 5SZTA 4CECA 4OJRA 4PUOA 4AHRA 1X9SA 3TAPA 1RI0A 4CEOA 4B9LA 3AA4A 4HVJA 2LSNA 2BKDN 1S1VA 1L3SA 4PA1A 4FW2A 5I3UA 2XK0A 3E9GA 1MU2A 1S1TA 3V9ZA 3QIPA 3DLKA 3TAEA 5CZ1A 3OYLA 1CZ9A 4Z4CA 4DS5A 3OMCA 5D3GA 3EAEA 3KLHA 3NE6A 1BISA 4I9LA 1C1BA 4E7KA 4O5BA 3LWLA 4Z02A 3ALYA 3ME9A 2QK9A 2PY5A 1IKVA 1EXQA 1S6PA 2BGGA 2XY8A 2Z1HA 4HTUA 2RF2A 1ZBFA 1EKEA 4Z4EA 1OYXA 3NBPA 3OA6A 3NH0A 3M9QA 2JGUA 1NKCA 2B6AA 3CYMA 4OVLA 3NF6A 3CFOA 3SUQA 1N5YA 2ZQBA 1QSSA 4DTXA 3MEAA 3KJVA 3KK2A 4HUFA 4DU1A 1W9HA 2KQ2A 4FL6A 1HQEA 4EP5A 4I2PA 1TL3A 2VG7A 3F9KA 3WNFA 3DMJA 2A1RA 4PL6A 3MECA 5C24A 3OYDA 4HCCA 4IURA 3CG7A 2RI2A 5DMRA 3KLFA 4KI6A 4E19A 3QBYA 1LAVA 2W42A 3IG1A 2RHUA 2G8FA 1QTMA 3TABA 1J54A 3V1OA 3DM2A 3LAMA 4OKKA 5CYMA 4PLLA 2HHVA 4X34A 4CGJA 5IAYA 3OY9A 4C5HA 1WSJA 2Z1JA 1HJRA 5J2QA 3AV9A 1BCMA 3NF7A 4A4GA 3QEPA 2X4XA 4N47A 4BDPA 1IO2A 1RCHA 3VQBA 2EQJA 3K58A 2R58A 3S6WA 3VQ6A 4AILC 3PMTA 3QIOA 5EU7A 4LSLA 2R57A 1VK0A 3RRGA 3OJSA 3NFAA 1XHXA 1VSFA 1VSJA 5HBMA 2QKKA 4FCYA 2OZSA 4W5TA 3ZSVA 3V9XA 4HUEA 4OLBA 4N5SA 4C5IA 3FLGA 4NCGA 1ASVA 1RDBA 3TR8A 3OYGA 3DYAA 4ZHRA 3C6TA 3MXMA 3KUFA 2HMIA 2Z1GA 3SQ4A 4KI4A 2IGIA 3SNNA 4RW9A 1T05A 1ZYQA
chains in the Genus database with same CATH superfamily
2WADA 2BH1A 3RQIA 3KEQA 1ETXA 1N9RA 1UG0A 4FJKA 4KRTA 4J9HA 1KHCA 1SFXA 5GJWB 1AEYA 3AO5A 1JKOC 4B9SA 7AT1B 5J8CA 1O7LA 1YJWQ 3SV3A 4IG3A 3ITHA 4QSHA 3ZYYX 4IRHA 1PC0A 3D7EO 2D1VA 1B3QA 5L3BA 3AA3A 1XOVA 3EL2A 1ORNA 3OBWA 1W6XA 5FKOA 1VQKT 1QHAA 1JXBA 3HM5A 4CZFA 3ISNC 3HJEA 5A0GA 4A59A 2VL8A 3D7SB 1LOJA 4DBFA 4AHVA 5F04A 1N8RC 3PUFA 1J9AA 3CI5A 1KVCA 2GOXB 3H35A 5GAMg 3MEUA 3S1QJ 3K7AJ 4OGEA 4B8AB 3EDPA 5IT3A 2K02A 1VQ8Q 2DA2A 2M9UA 4HT8A 5GAOq 2IVWA 2MLGA 4OGCA 3QYHB 1YW8A 2MLKA 4FJGA 1YITA 3Q9VA 1VSMA 4A2UA 4S0HB 4EVIA 4LLNA 2KVQG 1P7JA 4PGGA 1B9FA 2V6CA 3Q3SA 3O9RA 4M9ZA 5KHDA 4H4MA 3K2PA 5B5EC 2ZJPL 3HPOA 3SEMA 1LAWA 1T95A 4I6MA 1WQ7A 4E3SA 3ZQ7A 1T0FC 4ISEA 3RIRA 2UXXA 2YG9A 2V6EA 1XDSA 3ISPA 1QPIA 4HEA2 4YIRX 3ZCOA 3NHGA 3BTCA 4LE9A 1MSFC 4L6V5 2V9VA 5JICA 1UHFA 4D8DA 4RAFA 3ID6A 5EC7A 2G0EA 3BPXA 3MEEA 1JL1A 4CCLA 2D1XA 4YFKF 3LOCA 4B23A 2FRHA 1I27A 5ICGA 1P90A 2AHQA 1WSIA 5HLGA 1VYTA 2L9SA 3G0ZA 3M1FA 2OPRA 1VSHA 4RG8A 2ZGZA 1X1PA 5B3SH 2O2OA 3LM2A 1CF7A 4NQWA 1O1WA 2W00A 1QQJA 2H3EB 1RGIA 3LQQA 1C1CA 1YN8A 3O1BA 3LP3A 4YOQA 4C5GA 4FSSA 1L3UA 1TKXA 5GANd 1QKXA 3ATUA 4EM2A 1IKYA 4I98B 2P5VA 4DR3K 5LLQA 3JB9D 4B1RA 3R2XC 3KD5E 5DCMA 5KPRA 2VODA 4DV4K 1PD0A 1Z1DA 2LP5A 3JAME 4IUTA 1HKTA 3C18A 3ASKA 3KNTA 1NK2P 1OX9A 3GTQJ 5DM7R 1HSJA 3ABLH 3T1BA 3LZIA 3LDSA 2WAQA 3HOZJ 2Q3SA 2YNIA 4XONA 5AZIA 1MMGA 3AVIA 4BRCA 4BQZA 2B86A 2Y0SN 5LHIA 3CF5F 4U7DA 1BJZA 3RRHA 2EV6A 1BG3A 1P4WA 3WNHA 3HVTA 3VQ5A 3VEYA 1E3MA 2R5ZB 2EFQA 4YFUA 3NRVA 2LLKA 3VEVA 3SJMA 1PUFA 3S1RJ 1SVOA 3LYIA 2V26A 4DNCA 3HEFA 1MA9B 3FHGA 1XGOA 2A3ZA 4H0XB 1G83A 3HTSB 4IHSA 2JN6A 4E1NA 1B4AA 1TWFJ 3WG9A 4OMZA 2FA5A 2I5UA 1IN6A 4F2RA 4YOYA 4EIKA 4B9WA 3ENHA 4AC0A 1MDUB 2HNHA 4LUEA 4FM1A 3CBPA 4A62A 1X4OA 1IDZA 2V51B 2MABA 1KZHA 4CE9A 3QODA 1QU3A 4O5FA 4W5OA 3DXMB 5LJ5f 1PVSA 4N4OB 3TTCA 3F72A 2I0NA 2DAOA 1YIJA 1KG1A 3FSPA 5E8IA 2YHYA 3MEDA 5A2QE 1WDXA 4LF5K 2GGRA 5FRMA 3M3YJ 4KNYA 2H6CA 1OQYA 1OCTC 3SQ1A 4JKCA 5FFXA 2JHJA 2E6MA 1N32K 2F4VK 2K27A 2OZ6A 1VQKN 2LF8A 2QG9B 3ECHA 4OMMA 1NHAA 1H8AC 1SEMA 1W0TA 1TUCA 3TGNA 4ID5A 1YF5L 4A3BJ 3PSFA 1ASWA 3S1MJ 3K1PA 2QKLB 4D9JA 5E17F 1NZ9A 1E3HA 3M8RA 3FZKA 4IDKA 5HLIA 1R00A 1A5XA 1NJZA 5C15A 4QQ6A 1TXQA 1KONA 2YSQA 3VKIA 4OOIA 2FYKA 4DF8A 3BCBA 2P0QA 2CKKA 1RT2A 1RACB 3VERA 2RJEA 3PIPF 1NGEA 2R4GA 2CP6A 2E6LA 3H1QA 4BHBA 4C92A 3BOQA 1LPLA 1J53A 3NGZA 2X6NA 1OU9A 1WI7A 4CF9A 3QQAA 4KMFA 2R5MA 3LSMA 1VSDA 2DXCA 3CWSA 1JLGA 5GAHP 4C2TA 3WGIA 4CBWA 5E3LA 1ZK8A 4Y91A 4XRSA 1NOYA 2GA1A 1L3LA 1ETVA 2XC7A 1NGCA 1K9MR 4DMNA 3G6EA 2ELJA 4M72A 2M2EA 3RR6A 3CC2T 5JVGL 3W6VA 1AOYA 1B9DA 5DV5A 1B8IB 3L00A 3J7YJ 3TVTA 3FK7A 4BRQA 4C8QA 1B92A 4J01A 4X62K 4CJUA 1KYWA 3O2PE 3TARA 3BLYA 2NOFA 4BREA 1NMNA 1I4K1 2QASA 4P96A 1F36A 2JPBA 1M4ZA 3WODF 3INZA 1NJXA 3RMBA 3I64A 2XROA 2A05A 4CRIA 4N76A 3JXUA 2LKPA 3GX4X 5FGMA 2NUPA 3THVA 2DXBA 2XI9A 5C25A 4XU2A 2DQRA 5FLXO 1ON1A 4UC4A 3O4QA 4NLCA 3LFUA 5E84A 3JCMh 1VQKI 4JP0A 1B6AA 4IFYA 5K7FA 2LQKA 1EBMA 3UKRB 4RM3A 1O9SA 3GTJJ 1T0HA 3OL3A 4A5AA 5DLQE 4E0DA 2O8KA 2G8UA 1G8XA 3VU3C 1RT1A 3B02A 2PX9A 2QWWA 2BVMA 1Z25A 4K0KK 4BD3A 4LLGF 2UXBK 2EGAA 3T5XA 5GAN5 3KLEA 1U4BA 4JKGA 5FB2A 3I0RA 2HHQA 3VF6A 2KGTA 4BRMA 5JLHA 4QPOA 1C0TA 1S5JA 4HUGA 5GAGP 2FBXA 2PBIA 1LB2A 2KW4A 1ESVA 4RM2A 5KH6A 5C10A 1YIOA 4AT1B 3HTUA 4BQOA 5HDNA 5H20A 2W7NA 2HVSA 1IBMK 4AFZC 1EIFA 2DQLA 1BI4A 3QWYA 2CUJA 3LSHA 2DA5A 2AZSA 2FBTA 3L2WA 1Z0XA 2YLBA 4EMHA 2AQFA 2CYZB 1DKGD 2QWOA 1X3UA 2IW5A 2A6TA 2O8BB 5FU7B 1KAYA 2P0KA 2K7LA 4OPJA 4A3KJ 3FB9A 1KFSA 1BN5A 4BRGA 3IRQA 5FROA 5GTHC 1BIUA 4GVEA 4UNOA 3DLGA 5H1SQ 3P83D 3ZN0A 3SDZA 3OW2P 1K7AA 2OU2A 5GAOp 3M0TA 1SKUB 5GAMj 3LA2A 5IXFA 4JLIA 3IHOA 4F92B 1S1UA 4YOTA 1LUJB 4ZYGA 3ZT1A 4F3QA 4FZYA 3B6PA 5IY5H 5IN1A 1YVNA 2LY2A 4F3TA 4ENNA 3H0DA 3I55T 1AWWA 5BRHA 1Z3XA 4CHYA 3HL8A 1OULA 2CQKA 3VQQA 4XKBA 5IHIA 2GQVA 2F5CA 3HP9A 2R7UA 1X1BA 2QQ8A 1ZBLA 1YRNA 4XU0A 3SB2A 3B8AX 1NEBA 2V1UA 3A8MB 2YRCA 4XLEA 2XPWA 3J80E 2PQ8A 2YNGA 2XY7A 4MFDA 4LF8K 2LJ3A 4B9QA 1LDKB 1OVYA 3L2UA 5C4JJ 1WH5A 1H8KA 4AFSC 2JQ7A 4HCZA 3ABMH 2DIGA 1YJWT 1G4DA 3H92A 1T33A 1BR1A 3T19A 4EPCA 2X4JA 1XTDA 4CBUA 1JI8A 1GRIA 3QNNA 2L8DA 2VONA 2QDYB 4BJTA 2XSJC 4GCVA 3F8NA 2IVNA 1AVZC 2X4WA 1RFQA 4A4FA 1DJ7B 3CUQA 1U3EM 2GQQA 4M78B 4HWIA 4C8QC 3G1JA 1NGIA 5H2FC 2WA0A 1IRGA 4HLXA 1XI1A 1JJ2M 3ZSQA 1XC3A 3F70A 4M71A 4BY7J 4FE7A 5EEHA 1DGKN 2HBMA 2EZIA 3LLRA 1R0AA 1HNIA 1QCNA 2RN7A 3G71A 2CZ0B 2YX7A 1MGTA 4Q5SF 4XL9A 1AKHA 3V1QA 1Q7YO 3I5UA 1P7MA 2V79A 4MGRA 1T2KA 1N33K 4FT8A 3H3ZA 5J1YA 3VSLA 4MMKA 4XBFA 3CP8A 2OFKA 4M41A 1Q82R 1KRPA 2HMAA 4M7DC 1IXSB 4FWSA 2JTFA 1M90O 3C6AA 1K6YA 2X1EA 3P39A 5M5WJ 1SAUA 3J81Z 5BS6A 3CC2N 2WACA 1Y64A 3AVHA 3I56Q 4IHVA 1PD1A 4FYDA 2F2VA 2E64A 3BG7A 3OSFA 3TDUC 3MXIA 1NG7A 1X2KA 1QMCA 1KVAA 2LJ1A 1M2VB 3C7NB 3K2ZA 1XN7A 3CCSI 2YHAA 3I0SA 1GXIE 3J8AA 4KH0B 4F7UA 4ABZA 1OR7A 2F5FA 3JB9H 2KIQA 3QYEA 5KTQA 2DJQA 5H6QA 2BUPA 1TWGJ 2CUFA 4E70A 2K9QA 5F6FA 3X20B 3KVGA 1TAUA 3CCQA 1GUUA 3KZYA 3QWLA 3FKJA 4KHQA 1DU0A 1HW2A 5E1XA 1MNMC 1UOCA 3WTSC 3WVEB 1VQ7I 4AWXB 4DF4A 1UGPB 4K41A 5J4YA 2DFIA 3E5QA 4RTXA 1QQOA 2OJ2A 3SBTA 3CCUQ 2DOAA 2NRWA 2IC3A 4PL7A 2DFUA 2RPIA 1D1AA 1W5CC 3NCIA 4FJLA 2NVUB 2IA0A 1ZN2A 3DLAA 5D5WB 5KCMA 3LWHA 1S72I 2LCLA 1X3NA 2W48A 5AFUH 4PIIA 3CC7A 1TL1A 1ZG3A 3WT0A 4B1XB 1YCSB 4G7HF 4DOVA 5AQUA 2DN0A 5M3FJ 2P84A 4XLNF 3CC2I 2W6LA 1WJRA 3Q0UA 5C0YA 4DLEA 2YRDA 3K59A 1U9OA 5C3EJ 2JZ2A 2UUCK 1Q9YA 2MWPA 3FM5A 4KGVB 2FOWA 3MHXA 4CJFA 2I10A 3CD6A 1S7OA 5EDNA 1XC5A 3OOPA 4PJOD 2JPCA 4J6WA 3I55N 1HLUA 2IT0A 4LIUA 2XHBA 2W84A 4NL3A 5IYCJ 2EQUA 3MEVA 4M7AA 3F21A 4CHOA 4VUBA 1XMXA 5LHGA 3EO3A 2FSWA 2DIQA 2ZSIB 4CEEA 4JJCA 1KVBA 2C06A 1O3RA 1O7FA 4Z2YA 3GTPJ 4GMJB 3A8GB 3KD1E 5EG0A 3J7AY 1FT9A 1KFZA 2HQNA 1AU7A 1TU0B 2V1DA 4CJQA 1YTUA 3MWPA 4B1WB 4I02A 1RTHA 1K83J 1VQ6A 1KQSA 3OH6A 4L9NA 4PNOA 3A0IX 3JB9F 3MD2A 1RADB 3AVFA 2HFHA 4Q5WA 1YJWN 3NTKA 4FJNA 3EY1A 1XUPO 1Q86O 1F9NA 2X51A 3CPWM 3V6DA 2CO5A 1C0MA 1BDGA 3D6RA 4WCIA 3O3HA 5I2SA 3IH7A 3B6CA 1KD1U 2X1DA 3S14J 4M3BA 2JUFA 3G4SA 3NDKA 2MW8A 2NVXJ 1HJOA 2XIGA 2LY9A 1U04A 3AVCA 3HVRA 3HOSA 4RGSA 1ARKA 5AQIA 1YHQA 4N0AA 2LG4A 2NWMA 3DU5A 3A01A 4FVMA 3DLEA 3CEYA 1ZBHA 4B3TK 3BFMA 1XS9A 4UB8C 1V76A 4O0JA 4EMKA 1D0XA 1MBKA 1OR7C 1Z7UA 1SKWA 3PVQA 4DSFA 3SPZA 1E0EA 1KAZA 2BIVA 4IQJA 5FWCA 3LAKA 1NG2A 4BRIA 1FC3A 3CJBA 4KHUA 3I55I 4M3XA 4C0DB 3QFUA 4B1ZA 4L18B 1WGXA 3KFWX 5LJ3d 2YUQA 5I2MA 2ZMEA 1JXOA 1NJIU 3V7SA 2H1LA 3GTLJ 1SHFA 2DF6A 2B0LA 1NJWA 2D0NA 3ZSZA 3OGDA 4O3MA 1YUWA 4DEXA 4NC8A 1UGSB 3WU0A 2DOFA 3M59A 3CPEA 2VIXA 2KSSA 1Y0MA 1XMQK 3FXKA 2F48A 4CK2A 3OB9A 3FEOA 3KZZA 5ILSA 5K5QA 4A12A 3VYTB 4J8FA 1MKMA 4UOBA 2P9PB 2VG5A 2K5FA 1A35A 1YJNA 1VQNT 3DRRA 2LJ0A 1SZ2A 3PO3J 3QO9A 3M5RA 4ISFA 1W5SA 4E47A 2QSGX 4CF1A 2A42A 3HOTA 2RQUA 4CZMA 3KP3A 4LK1F 2EYXA 4A6EA 4ETSA 4ELVA 1R22A 3EQLF 1T7PA 1GXPA 5LEKA 4AI5A 1N75A 1D3YA 1GVJA 4KT0E 4OMOA 1S22A 3K5LA 3SJJA 2JMWA 3A5MC 3DXKB 1J5YA 3V8JA 2Y1IA 4C8KA 1N8RO 4OP0A 2HHHK 4P5OA 5JVTA 1TVRA 3JR9A 4Y1CA 1WJQA 5D7UA 4QS8A 1QQMA 5IHNA 1YI2Q 3CHWA 5D4SA 1MBHA 1YQKA 3UF4A 3LSJA 3PJRA 1H1VA 1XQOA 5KYYA 4NXMK 4EA5A 2Z3YA 4EMGA 1N25A 1RDAA 5FW9A 1Q7YR 3LL7A 2B8AA 1SMYF 5CVVA 3O8MA 3AG3H 3CMEQ 3JSMA 4CEAA 3ZMTA 2RF0A 3HKSA 4C1NI 4F8RA 3HXMA 2IVMA 4CUGA 3KKRA 3ZMVA 2FE3A 4D5FA 3JB9J 1N6QA 3BR3A 3IH4A 4D7MA 3U9ZA 4L3QA 3DCFA 3VYSB 5IP9J 3H3UA 4PFPA 2L0KA 3VQ8A 4MDXA 3O3KA 3VFZA 3QFPA 3V8LA 1X9MA 5HCKA 2DA1A 3DLRA 3FIWA 1K8AR 1LDDA 3ZT4A 3R60A 5D6WA 4PGHA 3AG2H 2DLLA 4ZYHA 1XQSC 2WB1A 1TGOA 3HC7A 2CJJA 2KQRA 1YJ9Q 3QEIA 4M6XA 1H0MA 1X2QA 4FWMA 1RBVA 3S6IA 3I4PA 1JLEA 5KRSA 4C3IJ 1LWYA 1YAGA 3JREA 5ADXA 1K6OA 3K2AA 3E9LA 2Y30A 2IPOB 3HFNA 2KBTA 3K1MA 3BE3A 3T8TA 1OCRH 3C2HA 2YHWA 2O8XA 1VQ5A 3LA7A 4IG0A 2EBPA 2VC0A 2ZMEC 1SC7A 3ULEA 2RMOA 3SZ2A 4EATA 4BR4A 5AQOA 3GZ6A 2D8HA 3Q1JA 1VQ9Q 1K73O 2E35A 3K0LA 4RCCA 4EZ9A 4BHPA 1ZH5A 3KP5A 4XSZF 1H3HA 4DYRA 4UY8O 2FLOA 2RNGA 1ZYRF 3H5RA 1QQCA 1JE8A 2NOIA 3MO8A 4QQDA 4Y15A 1E3OC 3I3LA 1WNSA 1TQMA 2XGDA 5GANh 1TKZA 4BY9C 5M1FA 4M9XA 4OMPA 4C5EA 1FN7A 2JUGA 4LF6K 2PYJA 1GCPA 3MZYA 5E18F 4L5JA 3E7LA 2HQXA 3ZQFA 3SFZA 1RTDA 3QPSA 2HDAA 1JJ8C 2WWYA 4XLCA 4E6KG 2RHIA 4HTLA 3GFMA 3H0GJ 1DP7P 5I42A 1HYVA 3F6VA 4JJDA 1R5GA 4MTDA 5CIUA 3TSZA 4W5NA 3H36A 1HDDC 4MDAA 4J9FA 4DCHA 2H8RA 3M0PA 2V7ZA 3KCCA 1BQNA 3OA9A 2KLAA 5CQXA 2WBMA 1TP4A 1QP2A 4M4ZA 3CCVQ 2RHXA 3LALA 1IKXA 4EFHA 2ZPBB 1UWBA 2O31A 5BMZA 4LG3A 3ZSYA 2UUZA 1NK9A 5FKLA 1TWCJ 4O6JA 3LH0A 2M0OA 3BR1A 2R7YA 3GZ5A 2NLUA 2OX7A 3QYFA 1J6ZA 3FZVA 3V42A 1VQNN 1XNIA 2MH9A 3B6AA 3WTVC 2IVOA 4FLUA 4FJXA 4BAYA 4J8OA 1JXEA 4DQPA 1UMQA 3GZNB 1RBSA 5C4XJ 1FBSA 2XF5A 4FQGA 3OOUA 2XHCA 4EJUA 1GLNA 1RI9A 1HRHA 4UV8A 2VKNA 4RLQA 4KT6A 3HSTB 4DEYA 3RZDJ 5D5XB 2DCEA 2L7KA 1VIFA 2EIKH 2VQCA 2CUBA 4J00A 1R59O 2E88A 2F4MB 5TISC 1WSFA 4LH5A 1T38A 3NTHA 1VSLA 3RMDA 3NH1A 3LW5E 2R0QC 2HOEA 1BA0A 4D8KA 5DD8A 2XKOA 5FLMJ 1XGSA 2IS2A 2WV1A 4V19S 1IF1A 2XRIA 1O75A 2IS4A 4DR1K 2E4HA 3L2VA 2ELKA 5KYUB 3QSUA 3GDQA 5A2QO 1B9MA 1FP1D 4O0IA 2RAEA 1I07A 1I39A 3L9FA 4OMNA 1FZPB 1QQNA 3KP7A 3Q7CA 3FXQA 4XRFA 2F96A 3W0LA 4E7JA 1KO9A 4EZ6A 2O88A 4CJVA 1D9DA 2EX3A 1E6HA 3TO7A 3M1EA 2DL7A 2K5LA 3K4MA 2JMAA 3CDLA 2IS3A 2HQHA 2HPIA 3HK2A 4YIFA 3EZ5A 3BY7A 1HBXG 2VKEA 1IZ6A 3ZQIA 1VQNI 4L59A 2DD4A 1R58A 1NTCA 2MYSA 1NYFA 1SAXA 2M1BA 1JJ2P 1NKEA 1SVLA 2L01A 5HK3A 1ONVA 1O3QA 1HK9A 1SG5A 4UXNA 3CM6A 3OYYA 4Y7NJ 4IHXA 1WJSA 2K9LA 3RMSA 2COBA 1Y8QB 4BG9A 2Y1JA 1ORPA 1QZYA 3WGHA 4HOBA 5ILUA 3H9GA 3M53A 1IHWA 3SEZA 3GF5A 2R7XA 2DPPB 2VJ4A 5LMNK 4KH5A 3TI0A 2HWVA 1OLTA 2JSCA 4XLAA 1LE8A 5EX5A 4JJBA 2DE0X 4OJRA 1N8RR 1X9SA 4OFAA 1Z3YA 1OCPA 3X26B 2CH6A 1LWVA 1MIJA 1RI0A 4B9LA 4HBLA 3ERMA 1TTHB 2A28A 4MO4A 4HX7A 2KP6A 2OANA 4RS8A 2XGCA 3SWNA 4PA1A 1FMVA 1LFBA 2W82A 5DTDA 3HRMA 5D4RA 3CJ1A 4DZPA 2QGFB 3QIPA 4LDYA 1MMAA 1SEUA 1AT1B 3VEWA 4OWRB 3GIBA 3E6CC 4HVUA 4NB4A 2Q8KA 4IZZA 3PFYA 3N0UA 1HOMA 2KISA 2A37A 4PJOF 2FF3B 2QUFA 3H0FA 1R7JA 4Z02A 2QK9A 2ATCB 2BGGA 2Z1HA 3URGA 3A1YA 2JK3A 3F23A 4JK7A 3SZGA 5GAHJ 1QHGA 4Z4EA 3ZPLA 3CCJA 3DKXA 5HS8A 2DPNA 3OA6A 2FBKA 1OH6A 4C23A 1O3TA 4H5WA 1SFKA 2TDXA 4I6MB 3VB2A 2B6AA 3PIPA 4NUBA 1U1SA 2L9NA 3QP6A 1QSSA 1WXUA 3AT1B 2ZXHA 2BGCA 1VA7A 1MUYA 4DU1A 2XKOC 4E9EA 1NE8A 2LTPA 2MC4A 4B1UB 5AQTA 2VBYA 2FL7A 3W2AA 1PUEE 2ZJPF 3CCLQ 3N05A 4PL6A 5C24A 3QOEA 3WE2A 3CQZJ 1BJAA 1SD4A 3CCET 4RB0A 1DPRA 1KU2A 2E2HJ 1VYVA 4UUVA 2OAZA 3UKUA 1UGRB 3VEZA 1LAVA 4LD5A 4W97A 2W42A 2O01E 2DTHA 3CF5L 1QTMA 3V1OA 1CF7B 4NQWB 2KRSA 4M77D 3HOVJ 1VQOQ 4PK4A 3H9QA 3U1DA 2W04A 4C5HA 3ESWB 1WSJA 5J2QA 1D8JA 4PJOG 4II2A 5DCMB 4FIBA 1BCMA 2ECCA 3I58A 3NF7A 3AAFA 3KLNA 3QEPA 5GAGJ 2X6WA 4HNUA 4U67L 1YI2T 4YOWA 1RCHA 5LJ5d 2QWQA 2NOZA 2P9UA 2PU9B 5CKFA 4HNTA 2CYYA 2YUPA 1VK0A 5AZIB 3OJSA 1VIEA 1VSFA 5F0HA 5BR9A 1CZAN 2XIDA 1JXMA 5GAMh 3UB5A 3CMET 1C0WA 1ZELA 2QKKA 1DU6A 1XQPA 2OZSA 4BRKA 3CPWP 1PUFB 1MMDA 4IQ4A 4C5IA 2X0LA 1MGQA 3O08A 2YLCA 1YX3A 3LCNA 4ZHRA 4H5VA 3MMYB 3MXMA 2PJRA 1TSFA 2DEUA 3DWLE 5E1ZB 4KYWA 3JCMg 2AIRB 4IO9F 3SWNC 1JGSA 1LVAA 4GYIA 4NC6A 2K3PA 3QU6A 3K1NA 3S2WA 5C44J 4PJOE 2XSDC 3SPYA 1U6ZA 1YJ9T 4BJ6C 5J1RA 2EFWA 1ZRDA 2C0OA 4F16A 1FYLA 3LP0A 2QEXA 1D9FA 4PKGA 1V5EA 2HYGD 4F2SA 2B63J 3T3FA 1RTIA 2Y2ZA 4AHCA 4JI2K 3S93A 1Y8RB 3LM9A 2ZD1A 2NNWA 5HS7A 1H3ZA 3FXRA 1QCOA 4ZYAA 4FK0A 4RG2A 4B3SK 2FPDA 3PIPL 2QLZA 1C0GA 5AQYA 1X4PA 1OYIA 5GP9A 1G3SA 2M87A 3V4GA 4KFCA 3S1NJ 5CY4A 1J59A 1DTQA 3LDOA 3EETA 4HX8A 2D0QB 2EFOA 3CCRA 1WHHA 2EYYA 4KH1B 2AA4A 2ROLA 1OX8A 1OCCH 1VQ9T 3R61A 4FM2A 4A57A 3BZKA 2VXZA 2QA4Q 4B3OA 3S32A 2Q0OA 4DTUA 3MCAB 2EZKA 2F9WA 2KZVA 4B9NA 2ACJA 1Z6TA 1ZX6A 3BG3A 1HPZA 5BN8A 1W7PD 4M3FA 3QINA 5J40A 4IJAA 2JZYA 4LLLA 2KDOA 2FJ1A 2BZXA 2PUOB 4I2QA 3O5BA 2X9DA 4PZJA 4C92B 3SUOA 5K5RA 2DA7A 2VV5A 3MKLA 1MMSA 2DI3A 3CJTB 2CG4A 3JRDA 4UVCA 5ICFA 3QOPA 2HHTA 4CJPA 4FLWA 2XF7A 3RMCA 3QEWA 4G6QA 1IN5A 1LNXA 5J1EA 3RPQA 4IEIA 3IHUA 5LRSA 2E1ZA 3VF4A 1UGVA 5D6XA 4N4IA 1YQLA 3VYGA 2XAQA 1SPKA 3CCMQ 4C8QB 2M7BA 1T0JA 4FYVB 1ABOA 5IYBJ 1RLQC 2ZJQL 5AIQA 4JD2A 3MN5A 2YUNA 2OJED 4DV0K 3SUNA 1HYZA 3LDPA 1BU1A 2HQAA 2GXAA 5HNFA 4IRGA 3WQTA 3DAWA 4NXNK 1SKRA 2P6SA 2AK5A 4XIUA 2NUPB 3MP6A 3CCEN 3HSFA 4GO1A 5BRFA 2RHKA 2HVQA 1KTQA 1Y1VJ 4Q4ZF 3WUHA 1PRLC 3EG1A 1VF9A 1I81A 3GBQA 3NAUA 1S1NA 2XY6A 4NC7A 4CJ4A 2HOSA 2CT3A 1JL2A 5LY3A 2BZ8A 1ETKA 3JRZA 3NEUA 1MBFA 3CUOA 2LQWA 1RZ4A 3GTGJ 4JI4K 4JKGB 3LANA 1PU8A 4HF1A 2XY5A 3NQOA 2C6YA 2AKKA 1U06A 1YI2N 3ZQCA 2RVCA 4EHTA 4UVAA 2JUCA 4A54A 3KK1A 1BI4B 4CJEA 2XU8A 4TVRA 3K70D 2MAMA 2G8KA 3AVBA 2DBBA 1P9QC 1WJAA 1HSQA 4LF4K 5HS9A 4IEJA 1I5ZA 2L9RA 3L2QA 4RTUA 3CMEN 2E6NA 1SD6A 3JRIA 3FBIB 3GVAA 1N34K 2X48A 2PFUA 2O6GE 4ELTA 3TP3A 3CWAA 4L9TA 1NYGA 3MWMA 3GMEA 1W2BS 1EJ9A 3QJ6A 1BW6A 1ZBSA 4HQEA 4MQ9F 3VSKA 4NCBA 2ZCWA 2F4OB 4A61A 1B1BA 3WTUC 4E7LA 4RB1A 3F8MA 3GOXA 3B6OA 5CYQA 4NO7A 5E26A 1FX7A 1TK0A 1XNQK 2IA2A 1B9NA 5IP7J 3JCMc 2MMPA 3QYBA 2M8EA 3H9NA 5LJ3h 1YJ9N 5BQTA 3CCEI 3BROA 3CC4A 2CS3A 3TDZC 4JRPA 3OSVA 1D1CA 2GF7A 2LCSA 5K14A 1BQMA 1YRNB 3VQAA 2O3FA 1G3YA 2CS7A 4OF1A 2D1HA 1RUWA 2PAVA 3HGYA 4YIIA 1WBBA 3VETA 3OHRA 1U9NA 2NOJB 2QQ9A 3F8BA 1YIJT 2BY1A 1LFUP 2LREA 1FYNA 4J2EA 4XAXB 2X6OA 5KNLA 1YTYA 4C92F 4KV8A 2LBFB 2EV5A 4DOWA 2I7PA 4FOEA 1IV8A 1NG6A 2JT4A 1YI2I 4DQ8A 1ZHIA 4OX9K 1VQ9N 3R6OA 2F8SA 4CSWA 4BJ5C 2RC4A 3TKYA 3ZRGA 4IOXA 5F64A 3CUQB 3I8DA 1PVEA 1ZSZA 3CW7A 2QWMA 5FDLA 4MEYF 3H08A 2R7FA 4M77B 5E8GA 2G8VA 1WWXA 5FU6B 4XOTA 2JTEA 4J9GA 4FISA 4IDHA 2V75A 2HHUA 4X9DA 5GAOr 2CT4A 1FEXA 4BRFA 4CA0A 2D0CA 5MLCQ 4CFDA 3DF8A 4LITA 1AKHB 2FBHA 1WEIA 2LVMA 4RDUA 4JQFA 4UHTA 2E1NA 4CCOA 4EHUA 4KUIA 1ZREA 1DQUA 4LB6B 1GFDA 2F2XA 2BE7D 2Y4XA 2NOLA 3CDHA 2D1KA 2DMTA 4D5CA 3CTAA 2BANA 3HOWJ 1S1WA 1U45A 3P9CA 2CH4A 4NNJA 3VEXA 1YJ9I 2ED1A 3FMSA 1IUYA 2YCHA 5M1KA 4F04B 1POGA 2E5ZA 4LUDA 4EQQA 3ZX2A 5FO5A 3OS2A 2F5EA 3EHQA 3U9GA 1XG1A 5EF6A 1U48A 4JOMA 4S04A 4C92G 2V4JC 1I1SA 5FU7C 3DI6A 1WAJA 2I5JA 2ZC2A 3CCLT 4F7UB 2HB5A 1AWXA 4IFEA 5LJWA 2FUG2 2O8FA 1WHUA 4D7NA 3T9NA 2XMFA 4CC3A 4XH1A 2HHXA 1EH6A 2BUDA 1WSEA 4FX0A 3EKUA 4B43A 4L5EA 2WV0A 3MX2A 2FZKB 4M78E 2DTZA 2CQQA 3BG5A 3H3VK 2EPDA 2WTEA 2BXYA 1S29A 3W3DA 2KZGA 1EX4A 1DP3A 2K9NA 4I7FA 2Y0SA 1ACIA 4N4HA 4XQFA 3SFIA 2EQKA 3WXMB 4CZEA 3HI0A 4HDVA 2DT5A 4KTQA 1UGQB 4CC4B 4BI4A 4LD0A 2DILA 3UNGC 1MBEA 1ZLJA 4CXFA 2P51A 2JA5J 2VJ5A 4M3WA 5HRRA 2XAHA 1X1AA 1X2MA 1YITI 2DZ9A 4JYAK 2KXDA 2VOPA 4D6WA 4DBHA 4WTOB 5KI6A 1VRUA 1GCQA 4WF9L 1NJIC 4M75D 3IAS2 4UQGA 3AA5X 3RKWA 2MWOA 2KYBA 1I3QJ 4CEBA 4ZTFA 4UNFA 3I0WA 2RN2A 2IBDA 4ESBA 1NK5A 2ZPHB 1SHGA 3HYFA 1RAEB 5KCOA 4DQIA 2WAEA 2G9WA 4M45A 2K9MA 1TL8A 3FISA 3LAPA 1VSIA 3PM1A 2NOHA 2VJJA 2FXAA 4BVPA 1J75A 2ETJA 2AHJB 3KYDB 2IOCA 2PVGB 1HNXK 1P7IA 1ZSZC 3A1PA 4M7AB 3RPUD 2D45A 4HF2A 2BTTA 1S5LC 2PZ1A 1BR2A 2JTMA 3H1VX 4KB1A 4I99C 5D5VB 2OQRA 4FPAA 1VQMQ 1VQKA 3ZCMA 4IIOA 3C2BA 4DTOA 5EG0B 2IP2A 3OIPA 4ZYDA 1ZA1B 5HKCA 4BROA 1WH7A 4M77F 5KQ8A 1YG2A 4J9BA 1KYZA 3VOEA 3K9KA 1XGNA 4HXJA 4I2OA 4DR2K 1YIJN 2RQQA 2B9SA 1ZLMA 1C0UA 5EZGA 4H5TA 2RI5A 4ZN1A 2R7ZJ 1GLAG 5L23A 2CZ1B 4FZXC 2EGCA 2E4LA 1SFEA 2RK2A 1IG7A 2XPUA 5AQKA 2OQGA 4N0BA 4B21A 3I9QA 4LNPA 2QK0A 1X19A 2H56A 1Q81U 4B9VA 2V9PA 5KYWA 1ON2A 4I09A 2K4JA 1L3VA 4A4KA 1P2FA 4A3LJ 1NH3A 1JCFA 1O57A 1HR0K 2E3IA 4YRVA 3A01B 1HW1A 3FXOA 1K4US 1MBJA 5AQRA 2VKVA 1WJBA 3MVPA 4EMKB 5IXBA 3HT3A 1Y57A 4CCHA 2ETHA 2VC1A 2OAUA 2JN0A 1ZBIA 2EBIA 3DRSA 3VENA 1KSPA 5GADP 5K7HA 1XB4A 4MDBA 1ZHFA 3RNJA 4ENKA 4OKEA 3BP8A 4N41A 2ZMEB 2LDUA 2KKZA 3CESA 4LC9B 4M77G 1Y1WJ 1M90U 3CO6C 2ZBKA 4ENMA 4DTRA 1VI0A 4JI8K 5AR0A 3OYJA 2VKHA 2PFBA 5C6SA 3TAQA 1CLQA 3CCMT 3HBLA 2FSJA 2IIMA 3JSOA 5IT9K 1YIJI 1SL2A 1J9IA 1IKWA 2CP0A 3CCLN 4BACA 4Y1DA 1UE9A 5CZ2A 4DYQA 3L4IA 2X6XA 1M3AA 2E5LK 1GCQC 4U0YA 2E5KA 5CO7A 3M8PA 4WFBL 3W3CA 2RNAA 3ZEUA 4LMYA 4Y33A 3K4BA 2YUSA 4MZMA 1UCRA 1N36K 1SS6A 3R9PA 1I94K 4DFPA 5GANg 1SF9A 5KGWA 3L3VA 1Z67A 3CPFA 4M74A 2BY2A 2XB0X 3M6GA 2EB7A 1WVRA 1ZQ3P 4BDZA 1BO5O 2JRTA 1E3PA 3DEEA 3BT9A 3CWUA 2WFBA 2DXUA 5LBQA 1S3XA 1IREB 4PJ0C 2B5JA 3GF2A 2EFIA 1JGGA 3ELKA 2LD5A 1WJDA 4NCAA 5HK0A 4R79A 4O55A 4EDUA 4M7AF 3JCMV 1TQIA 1QGPA 1IGNA 5KYYB 1RAIB 4C2UA 3FFIA 4DSEA 2OTJA 4KITB 3FBNB 1O3SA 4BI8B 1KIKA 5FJ8J 2F1LA 3DB4A 2DBMA 1JLAA 4AUXA 3U9DA 3TSQA 5E79C 2OYQA 1RIOH 3ZMZA 5FLXZ 1LWWA 5ELZA 1IB8A 3P9IA 2ZGYA 2BE2A 2FBIA 1V54H 3QDFA 2UYTA 3SHFA 4GRIA 1LQ1A 3DPLC 1TT5B 5EGOA 1YS7A 1JT0A 3AGKA 1GDTA 2RH2A 1TK5A 3I9V2 1TQPA 2DPUA 3BF1A 2GXGA 4ID1A 4Y0WA 4M7DD 1FWZA 2VUBA 2VWKA 2P9KA 1LCUA 3CXCS 1RBRA 3DTIA 3V9UA 2YI1A 5IOYA 4KUDK 3J81O 2A61A 3C65A 4HZFA 1G99A 5AT1B 2EIMH 2PQWA 4M3RA 1YTAA 1U2VA 5F1JA 3CCSQ 4ZJZA 4C0DC 4CJTA 4M6VA 3HRUA 4II1A 4V2FA 5HLTA 2VB6A 2VXFA 2L9VA 1PSEA 3CVSA 1IGUA 3FJPA 4H0EA 1VQLA 1RAAB 4M7AG 2RDPA 2P4TA 1D3BA 3ULEB 3NH2A 2EGEA 1AWJA 4R55A 4FWRA 3G0QA 1U2WA 2TCTA 1EF4A 1X6OA 2HI3A 5GAOn 3N4QA 3BR6A 2WONA 4JI6K 1N3AA 2EA4A 2A0FB 1NGAA 1WLJA 1VQ7Q 1KQ1A 3HYIA 3L6QA 2JLEA 2NYSA 1YNZA 3SQNA 3OW2A 1BB9A 4CEQA 3CQXA 4ELZC 1BL0A 1UTIA 2JXBA 2CV0A 4KIBA 2Z2SB 4IOAL 1X43A 4CEFA 4P9UA 1QVGP 4JRKA 4G94A 5DUIA 4KUMA 1PP7U 1S72Q 2XAJA 1LDJA 5LJ5h 4KIFA 2ZSHB 3LGFA 5JLFA 2V1QA 3WNEA 1FKPA 2DFFA 4FJ5A 1OH5A 2QENA 4GV9A 1HMVA 2Z5UA 3F8FA 3M8JA 2ZNZA 3DWLA 1U8BA 2CFOA 4FYXB 3EE9A 2KHOA 2WC9A 3BY5A 4ZDPA 3WU2C 4M3YA 1M3BA 4FX4A 1WAFA 4CJWA 2K9SA 3NMUA 2A68F 3NF9A 1RT3A 3O6BB 3CCMN 3HL2A 3ASNH 4PJOA 2NRZA 2K3XA 3DB3A 3L0QA 4CD1A 3ZETA 1FBUA 4GY5A 4BC5A 2P9LA 1YT3A 4CEZA 4E7HA 3E9FA 3QZ9B 5D6YA 4RW4A 2RJDA 4QIWN 1HYSA 1Z21A 3VTIA 2HDCA 2ABLA 3IKMA 4DYCA 3FMQA 3KK7A 3L2CA 4L9JA 3ZGKA 4X65K 4CFCA 1R6RA 3HSRA 1GOCA 3GXOA 3HP6A 3HZJA 4BRPA 3LDNA 4ICLA 2DODA 5I21A 1QBJA 5DM7L 3MAJA 3IL2A 4BU2A 5GIOA 2Q1NA 2CQNA 3SI6A 3QU3A 2R92J 4AF1A 2ZO4A 5E3MA 1UAXA 1M3CA 2ZJRL 1PNJA 2G6FX 3A98A 4ESFA 2COYA 1A5JA 2F5DA 3IRXA 3ABKH 4RUGA 4WXDA 1IRZA 2V1XA 2VE8A 2KIMA 2NNNA 3LH5A 4KPYA 1X01A 4OMLA 4L8RB 3VQ9A 2FMYA 5SWMA 1QVFM 1Z9QA 4ESJA 2OZMA 4H0VB 2E1YA 2HF3A 4YOUA 3L42A 2NUZA 4IHTA 1RRJA 2LK2A 3PX0A 3U1KA 4A0YA 2GX9A 3OYNA 5GAN8 1WXBA 1RETA 1DLOA 1IGQA 4DFMA 2YHTA 1RILA 2ZFUA 1NOZA 3DPUA 3CCMI 3M4OJ 2QTXA 2XDDA 2O4IA 1AA7A 3I55Q 4X1VA 2LYCA 4CF2A 4YORA 4AU7A 3VS4A 3OYCA 3BZ6A 1T03A 3IFRA 2Q2EA 2DNUA 4V19K 1YJWA 3OBYA 1ITYA 2P81A 2EAYA 3K0SA 4X0GA 1Q95G 4AHSA 2EZLA 3PFSA 2L89A 3NARA 4KTWA 3JRGA 1VQMT 4MFBA 3QHSA 4CJLA 2ITMA 3H46O 3DPTA 3NGPA 3QAHA 2FC0A 5K5OA 4AIJA 2JJ9A 1B7TA 5J6XA 1Y0UA 4Z89A 4CESA 3DQVC 2CMPA 3MEGA 4E9FA 2V9KA 4OIPF 2NYXA 4A2BA 3RSNA 4N4NB 4LGWA 3RUXA 2DTUA 2ABKA 2L3PA 3D0PA 2WOMA 2VLAA 2HKNA 1VQ8A 1Q8IA 4CYDA 4C2MJ 1LE8B 2A40A 3JCMe 4AIKA 1WB9A 4YFXF 1HDPA 3CLQA 2Y9YA 2P4WA 4X9CA 4BE1A 1V4TA 2Y48A 2YJFA 4EP4A 1YBYA 1VQ5T 3SMSA 3MN9A 4C8MA 1K73U 5J2MA 5AQXA 2A7YA 1Q18A 3M8SA 4PJOC 3SWNB 4Z94A 4M75F 2HNDA 3DJCA 3TO9A 2DO7A 4NZGA 3ZXSA 5HRPA 3TPQA 2KMUA 2MH2A 1M9SA 1RDDA 2HBKA 3PX6A 4E1JA 5GANj 1TUUA 3CC7I 1JLQA 5EG2A 3KP4A 1MNEA 1BA1A 3J81K 4BR9A 4Z4HA 1W2BM 2NAZA 5AQLA 5CKBA 3TW7A 1Y07A 1WJCA 2ZPEB 3QWXX 1KFDA 2XB5A 1RABB 2MC3A 4OMFB 1NKBA 1IRFA 4BGDA 5BPMA 2O4XA 4XKVA 1WXTA 4CGIA 1HNWK 1K9MC 3CD6I 2JW4A 3OMYA 5EOYA 2XGXA 3M7GA 3X25B 1FPQA 2LMDA 1FXXA 2ZXIA 4IRIA 3J7AP 2VYTA 1NM1A 4FZZA 4IL6C 1DIZA 5IYDJ 4XU3A 2XAFA 1V3FA 4ZH4F 5J39A 1GOBA 3S2DJ 4YY3K 3CQ8A 3ZOBA 3LSTA 3CWTA 3P38A 1BOAA 2R93J 3OS0A 4YPRA 4MHGA 4LFBK 5DK5A 1ZSGA 1R4NB 2QBYA 4DSLA 4RA2A 4M3EA 3JW4A 5IT9Z 2ZPGB 3KLGA 1JQQA 1FNNA 1V5FA 2E65A 1SL0A 4ENJA 4J2BA 1BCOA 3WHBA 3KEYA 1YW7A 3UKUB 4FJ8A 4XQ3A 4JRQA 4FL9A 1ZUYA 3NAEA 1G15A 2HVHA 1QVPA 3GFIA 3ZMUA 3ZX0A 2ZWHA 4CJKA 2XAUA 1STZA 1LKXA 2DBKA 4ZDOA 2ZPFB 1M5Q1 2MD5A 2EH3A 1JCEA 4FJ7A 1P92A 3HM9A 2EQIA 2RHYA 2HTJA 3R3LA 4F4KA 1P6RA 4BG8A 3C3WA 4XU1A 2P9UB 4EJWA 1PKSA 4IO9L 2DETA 3ID8A 1BWFO 2M4GA 3SD4A 3HHGA 2XRLA 3QBWA 4GKJK 1P4AA 5CQYA 1JLCA 4QPQA 5GAN4 2VXEA 3ZEHA 2JVHA 2A08A 3JV3A 3HM8A 3KX2A 4RTFD 2CV1A 3L8BA 3QJYA 1Q82O 3GTKJ 1VAZA 4RAZA 5F1XA 3FHFA 1E4GT 3I8BA 4PQUA 1YFNA 4M75E 4N4GA 1DT9A 2CQXA 3QDKA 5LMUK 4FJ9A 2KI7A 4EAHD 2PJRB 4FU6A 1JU5C 1R4MB 3K4LA 2OF7A 3HUGA 2CP7A 3O80A 4J6XA 4DR4K 2M0YA 1VQMN 3EGXA 1S7EA 4RKUE 1PU6A 4CJSA 2YSRA 2WB1N 4ZGDB 1MUDA 1KD1O 1QZ5A 4H5RA 3BR5A 3QG1A 3J80K 3EG2A 1YJNI 4DW6A 1ZC6A 4AI4A 2VBXA 3E1YA 2HXIA 4CZIA 2VI6A 3MDQA 3KTQA 1GOAA 3CC4Q 4IX7A 4CIGA 4DOZA 4CIEA 4M3ZA 3CCST 2E7XA 3T69A 1ABQA 4XSXF 1MNDA 5DUKA 2HR3A 3ABUA 5HY6A 2DOEA 1S7AA 1MV3A 3A5ZB 4CVNE 4CEOA 1EFNA 3IH3A 1IJJA 1BI3A 2KHMA 2BKDN 1VQ5N 4XOPA 3L09A 4A5NA 1TW2A 2HD0A 3CBOA 4L5IA 5GMKl 4KICA 5I3UA 5FKKA 3AL0C 3AHUA 1S1TA 4LFCK 2V8KA 3TAEA 5CZ1A 2VT3A 4PJNA 4MFEA 1VQ7T 4A0XA 1WX6A 4B44A 3IMXA 3EGUA 1I1JA 4GXOA 3OMCA 3R8EA 5LL6Z 5ICEA 1T6CA 1Y0NA 1X75C 1DGWY 4OPHA 2HBJA 1BISA 2GWJA 1C1BA 3SK3A 1EWQA 3THXA 1UFFA 4N9IA 4JBAA 3M4YA 1HW5A 1IKVA 3TQ7P 1EXQA 1S6PA 3QO3A 2KLOA 4FYYB 1S72T 5M3MJ 1V29B 4FWPA 3CETA 2L7FP 3GYHX 4J83A 1WCMJ 1QLYA 5LJ3g 3R6MA 1RESA 5AYFA 1EZZB 3BW1A 2JGUA 1ULYA 4XK8E 3CYMA 3SUQA 1VQMI 1RDUA 4DTXA 3MEAA 2KAFA 3KK2A 2QF7A 2K85A 2TRTA 1W9HA 2Z33A 5M1OA 1SD5A 1XCBA 1WRJA 1K4SA 2JOYA 4PJMA 3GW2A 4AG1C 1TL3A 3WNFA 3OH9A 2UUAK 1KQ8A 1M8MA 2A1RA 3FZMA 4RTVA 1B34A 3MECA 4JD2B 3OYDA 1VQNQ 2LH9A 2ECBA 4HCCA 2J05A 2VJIA 3I0TA 3CG7A 2RI2A 3DBLB 4E19A 1ATRA 2LVSA 3QBYA 5GJVB 5H6RA 3BEXA 2HS5A 3H5NA 2RHUA 2K5IA 3TABA 1J54A 1VQ5I 1OOTA 3DM2A 1MUNA 5CYMA 3FGUA 5AQZA 4CGJA 3FXUA 3VODA 1VQPQ 1LEAA 3AFHA 2ZJQF 2Z1JA 3BR0A 3EHRA 3RTRA 5CVIA 2FXUA 3M9AA 4ZDLA 3RSEA 2DYIA 4JV5K 3R0AA 4X6AJ 3D2FB 2CP5A 2D8JA 2O03A 4DR5K 1BA5A 1IO2A 1HQCA 2P7VB 3RKXA 4LG0A 2J4RA 2M9HA 2DDAA 3QXEB 3K58A 3VQ6A 4A53A 4HVWA 3QIOA 3MN6A 3JAMZ 4LSLA 3WE3A 3MN2A 3A5NC 4YG2F 3U23A 1HKQA 1QQIA 1B72A 2OC6A 2K2MA 3ATVA 5HBMA 2W57A 1W7AA 1USSA 2KRFA 4FCYA 3BDUA 1F43A 4AIDA 4IVNA 4C1NK 4DZJA 4JI0K 5BNGA 4K42A 3TMOA 1RDBA 4IJNA 3TR8A 2K79A 2BW3A 2VQEK 3VGKA 3DYAA 3ABTA 5IH2A 2VKDA 4O8KA 1J5EK 1V4SA 2HMIA 2IGIA 3G1OA 4GY2B 4ZNXA 2GUPA 1KSWA 1KGSA 1E4FT 2DTOA 3L1PA 5J2NA 1Z77A 2AS5F 2O0YA 5KCHA 3BZCA 2KR3A 1YE9A 4FSVA 5AQGA 2MF2A 3UR3C 4BRHA 2RN8A 1UECA 3AVNA 5F2RA 5M5YJ 1CKAA 4R56A 1Q1HA 1GLDG 4C92C 1NJYA 5KPZA 1WFWA 2P5OA 2STTA 2DMNA 2EV0A 4KH6A 3CMAQ 3CCSN 1EP4A 4MIMA 4M7DE 3FHZA 5HDKA 1XHZA 3I71A 4HYEA 3CDIA 3QZ5B 2LBFA 3DKMA 2G7HA 1F4KA 5A2QZ 1K0XA 5CHZA 2E2IJ 3OS1A 3O9UA 2NS0A 2WSFE 3M0SA 2YJEA 2QW9A 2WSEE 1EV7A 1LWEA 3RDIA 4F55A 1GHCA 1HD3A 2RK1A 4JKDA 5ICCA 2NRTA 4AYBN 2GWRA 4M77A 3UATA 2OTLA 1R71A 5JLWA 1VQ7N 1ZSZB 1RPWA 2GZWA 3CCRT 1S9HA 3M56A 3C7JA 2FF4A 3E1SA 4H0OA 1Y96A 2YX6A 1IV0A 3NWSA 5GPAA 4K43A 3LPTA 3VRYA 4AM7A 3EYZA 3IAYA 3A2FA 1E2XA 5J1UA 2KZMA 3I56A 4C0ZA 2ZCFB 2O8CA 3D5SC 3Q0WA 4EGYA 2Q97A 2EIFA 2PMZA 1SD7A 2QQAA 3RR8A 3FDYA 1S72N 3BUZB 1BOBA 2JHNA 2OPQA 3DLMA 4O4GA 1Z05A 3U21A 4AH9A 1HU0A 4AQYK 5FPDA 1WJ5A 1T44A 1CGPA 2HGCA 2BY0A 2EJGA 1ZUUA 2LCCA 1ZBJA 5GADJ 5L3FA 2OD5A 2DYSH 4EJYA 1JJ2A 2QM3A 4JX5A 1D8KA 5KAFC 5KE2A 1MWMA 4I0BA 4BVOA 4DTNA 1OZ2A 3CXCM 3VQCA 1TWBA 1AZEA 1K8AO 3MCPA 2HSEB 1CXUA 2JJ7A 1IH7A 1SKSA 2Y0MA 1UELB 1KD1R 1EO1A 4BQLA 3IC7A 3SYZA 5D5UB 3O6WA 1K8KA 3FIFA 3EFSA 1R5ID 5GPCA 1O4XA 3PE0A 1RTJA 3CM5A 3GWZA 4BS9A 3HKZN 3T1YK 3F8CA 4GV3A 1QVFP 3CCUA 2O8FB 1PSFA 4WQ5A 4GBQA 1R0BG 4AM3A 5GMKh 1N78A 3OIQA 3H45C 2GTJA 4EVVA 2YV0X 2NVQJ 2YHBA 3TAGA 1Q81C 3AO4A 4HF0A 2DW4A 1ETYA 4DKWA 3P4IA 2BZTA 2R7WA 1KQ9A 2E1OA 2HHWA 3PTAA 3ZR8X 3D5LA 1BI1A 2VQFK 3S16J 2JT1A 4M3UA 4MNUA 2ENMA 2NRRA 4KN4X 4XKWA 1IBKK 1NJIR 3EKSA 1X69A 4IUVA 1OYYA 5K1YA 3EUHA 4BNCA 1QP3A 1SSFA 1PWTA 1SUQA 4C9YA 2P8TA 2GEMA 3EFOA 2OZUA 1Q7YC 1GLCG 2P6TA 4MEXF 3VF2A 1GBQA 1TUGB 3EG9A 1W7PA 1NKUA 1TWAJ 1YX5A 1GL5A 5GANe 1ASUA 1I3AA 3GNGA 2AZVA 3LWIA 3AVJA 2QKBA 1M90C 1F1ZA 5FWBA 5J26A 4WX9A 4IOCL 1IBLK 3V9WA 1ZGJA 3FJ5A 1TLHB 3LSPA 1K1ZA 4EMSA 4QS7A 1TAQA 3OYKA 2Z9OA 3CCJI 4CI0C 1K0SA 3VS5A 4E7IA 1KLMA 2HMPA 4XTYA 4B8CA 3CUQC 3Q5FA 3O3FA 3AVKA 2NRXA 5KYNA 1WOQA 2QWNA 4MLOA 1USTA 2IEKA 2CW0F 4M77C 1WA7A 3JS6A 2FD5A 1WHGA 3RYRA 3RTVA 5FU6C 3VW4A 4LOCA 2HKOA 4ZZDA 1BM9A 4DQQA 3QMLA 3TOBA 3SCXA 5LJ3j 3M8EA 3GLLA 5F0XA 2H3GX 1TH7A 4QQGA 4JI5K 4Y17A 2RV8A 2RO0A 4BR5A 1KG5A 2ZGWA 3QESA 5AIPA 5JMVA 3CC4T 4RTYA 2MA3A 1R5HA 3D2EA 1REVA 2VQGA 2O8DA 1W2BP 2DVJA 1GLEG 4DIQA 2AP1A 3AGRA 3J80Z 3A0HC 2IDOA 1UG2A 5JVHL 2DL4A 1OH7A 1IZ1A 2X1CA 2AXLA 4F93B 1W5TA 2FNPA 4Z8AA 1RT5A 3T7ZA 4KHYA 2W40A 3FF5A 2ZZDA 4WYBA 2E10A 3OYIA 4KH4A 3VOVA 2HQRA 1FMWA 3LSGA 1BL3A 5FD5A 3S3OA 3CQYA 3CCRN 4A3MJ 2PTKA 3E01A 1F21A 5GIPA 1NMDA 5AZJA 3WU1B 5KYWB 1Z91A 1VHXA 4JK1X 3UT1A 4F3OA 3E6BA 4DTJA 2W25A 1KG2A 4DV2K 1YOVB 5KPTA 5KGXA 1M1KU 2IPQX 5B1AH 1VRTA 3K10A 4DV5K 3KLIA 4JAXA 1KQSS 4HRIA 3M8FA 4KN7X 5CQEA 1OEBA 4YOXA 3TP0A 4HVVA 2M0MA 2D0AA 5JR3A 1JUMA 1RAGB 4HKEA 4JNEA 4KJZA 1PU7A 5IOZA 2DT7B 3HTVA 1FIPA 4XLPF 2Z16A 2NOEA 3SHWA 1VQ4Q 4J9EA 3LWFA 1D0ZA 1ITGA 2H94A 3VV0A 3JB9G 4EW0A 3G10A 4KREA 4CF0A 3HHHA 3KEOA 3LAJA 1TZLA 3A0BC 5J2PA 1NK6A 2DA6A 1PHTA 1Y97A 3T0YA 4DFJA 2ZJ2A 3KE2A 4ZGEB 3VQPA 1U84A 1S6LA 2PZSA 4DUYK 2LY1A 2QQRA 2GCXA 1OZ3A 4JDSA 4EW4A 2QEXI 3EUHC 1U49A 3JRCA 1ILYA 2QSFX 3PO5A 3IAM2 2EKHA 3E6DA 3CCEQ 1OPLA 3RBBB 1JUPA 1Q86C 3OYAA 1N27A 2RHZA 3SAHA 2QAZA 4KGXB 3WXLA 4CZZA 1YI2A 4OB2B 1J2XA 1T0FA 5GAOm 3PSIA 4KFBA 3BDLA 2HAXA 4IXAA 1FLIA 3ZEUB 2IAIA 4JKHA 3OWTA 3KZIC 4FASD 1J0RA 2HVIA 2IRFG 3CCRI 3HIFA 3R6NA 4BGBA 1VQPT 1HKCA 1RKWA 4BB7A 3SBGA 3LFKA 4CERA 4M7AC 2AO9A 3CMEA 3NVMA 1HF0A 4ZZLA 4RLFA 2WY8Q 1BYMA 1AWCA 4DSKA 4XMYA 2H27A 5LJ5g 3QETA 2ROTA 3QKJA 5M9OA 4H0YB 3WTWC 3VUZA 4B4CA 1VSEA 5FPMA 2ID3A 3PL8A 4FHTA 4GDFA 5CKTA 3LGLA 5DCFA 4JS5A 4BRNA 2L02A 2YU3A 4XTZA 2XDPA 3JCMW 1WNLA 2W6KA 4KA4A 1B07A 1RBTA 2JTVA 1YJ9A 1N3CA 4F7ZA 1JT6A 4B08A 5KN9A 3KWGA 2VWBA 4F52A 3GL1A 3V7RA 3FZLA 4ESRA 2DX1A 4BH9A 3M55A 2X3WD 3OIOA 1E17A 4AHTA 2PYLA 4RMOA 5DYMA 4QAGA 4DJAA 2GFAA 3T1HK 2PEXA 2GAUA 1WIEA 4N0AC 5EGOB 2A6HF 1E6GA 3SAGA 4XLHA 5LL6S 1BBYA 4PSXA 4WXCA 2JWLA 1S9GA 3DBRB 4Z4IA 3WGGA 3DTKA 1ATNA 1NLPC 2P9KB 4HNVA 4EMKC 4DV3K 5L3EA 2COWA 1YCYA 1DDNA 5ILVA 4KDPA 1VQ9A 1NM7A 4B1YB 2P5GA 3CC4N 3MEWA 5J3LA 3M4GA 4IUPA 3IP4B 1KC8U 3CMAT 3OYEA 1U2VB 3K70C 1RI7A 1WQ2A 2ESWA 1H88C 1TK8A 2PVOB 4JLHA 4L9VA 3NVKA 3MZ8A 1LV5A 1FIAA 1MJBA 3DKYA 2W41A 1ZLKA 4HLYA 2A1SA 1AWOA 2XDVA 3TEEA 1IRXA 3K5NA 1IN7A 4D0PA 2A5YB 3E97A 2G8WA 3E3VA 1D3BB 3TREA 1KAXA 4MZPA 4BI3A 3FLCO 4KRFA 5LGTA 1XMOK 3LA3A 3NWTA 2VPLA 4KAZA 2K3BA 2JA8J 3ENBA 2I5WA 3IQLA 4OIOF 5I22A 3D1NI 2DT6A 1NK7A 3VDXA 3PNVA 1ZR4A 3N97A 3ASMA 2YXYA 2GTDA 1PM3A 5BN9A 4BRLA 3SDBA 3CJNA 3F6OA 4K8ZA 4CYCA 1OFCX 3CCVA 4ANJA 3VPZA 3M0QA 3BJAA 3H6ZA 2NOGA 2FB7A 1YITQ 5F0CA 4R1HA 3EH2A 2B4JA 4B9TA 1JXSA 3LNQA 1VOMA 1TBXA 1Z6RA 4XORA 5A0LA 4DU3A 3W6JB 1I0CA 4M75A 2LSOA 2OPSA 5BPIA 5GAMe 2PNIA 3ASOH 4A3IJ 3HJFA 4GW6A 4A2AA 2DYBA 2VGNA 2P9SA 3CBMA 1BU6O 2V7FA 2MPXC 4IOAF 2RREA 5E41A 1CKBA 1W36D 4OMYA 1ACMB 4OFEA 3CC4I 4CHNA 1ZRFA 4PJOB 2YKMA 3RMAA 3ZETB 1JO8A 4M78D 1SFUA 2P9LB 3GG4A 2DDBA 3RPUA 1K61A 4PY5A 2BXZA 4B1VA 4Z6YA 1TTYA 3LDQA 1EH7A 4I76A 4TV7A 1M1FA 3NNQA 4AIAA 3PGGA 2O8EA 2CW7A 3HRGA 3ZLJA 3OYBA 2RQTA 1VQPN 1K73C 4H4KC 2ZNYA 2M3AA 1J5OA 3R0JA 3M58A 3VQ7A 4FTHA 2VT2A 4KO0A 4QVDA 1QS4A 5EJCA 4RCHA 4E1MA 2XF6A 3JB9I 3C6HA 3P7NA 3LX7A 2OCEA 1KHIA 3KBGA 2L54A 3LDLA 1KLNA 5GINA 1U47A 1TYQA 2VBZA 4EJOA 4DUZK 5DM7F 4FYWB 2BE9B 4CZLA 3QBXA 3JTGA 2CDTA 2VXDA 5B8HA 2F9TA 5M5XJ 4J5YA 2CSIA 2FPFA 2M45A 1RC9A 1WHLA 1SL1A 2CGKA 4DLGA 4NL2A 2ZJRF 2RE2A 3F10A 2OTJT 3UE5A 1S9EA 1QZZA 1H89C 2CUEA 1I6HJ 3LZJA 4BC4A 3G2BA 4AMCA 3L3UA 2Z99A 2F5TX 3LSRA 4AM6A 1WN7A 5I11A 2HU9A 1WPYA 2YKNA 2E19A 3EGDA 1HC8A 3VA3A 5CYVA 3DRPA 1FP2A 1L5UA 2Q2EB 2BY3A 1BR4A 5KRTA 4CC7A 1LMZA 2HNIA 1OVQA 2DJNA 3C1DA 5AQWA 2PG4A 3OYFA 3TEDA 5FPEA 3FX3A 2KPMA 1UDLA 8AT1B 1X6GA 4G7ZF 5GAN2 2MG4A 1OV3A 3L7WA 1SFOJ 1UB4A 2HBWA 2ZXJA 4G9YA 3CMAN 4CCKA 3JCMQ 2W4SA 1YIJQ 3Q7BA 3SZTA 1VQPI 2QDLA 3CQTA 3D45A 4LDWA 4HCBA 2R7QA 3C2GA 4P5NA 1ZA2B 2ECZA 4RGXA 3SV4A 4H8KA 4M75C 4WFAL 3JSPA 2E7WA 2EZHA 4NHJA 2HBPA 5GMKi 3EZWA 2YNHA 4KT5C 1VQLT 1F5TA 3CXCP 2BEOA 1RUOA 3HSBA 2Q2RA 2PN6A 1GLJO 3HRSA 5LD2C 3RR7A 2XRNA 3VS6A 1P59A 3FXLA 2ZF5O 5CHIA 3J81E 2KMTA 1JUSA 3VGLA 4JX6A 3E66A 3A02A 3CO7C 3A2KA 1D5VA 2F8TA 3A8HB 6PAXA 4MQVA 2R5AA 3MX5A 3RDVA 5DPKA 1M1GA 2Y4YA 2CW8A 4J7IA 2GNCA 2J6KA 2QXLA 1Y56A 3WXIA 2BYVE 2CH0A 3RESA 3AVAA 2QM1A 3D0SA 1QSLA 1FSEA 4JPBW 1X2NA 4IUUA 1LW0A 4QT7A 4WQ4A 2LZ6B 5LJ5j 4JI7K 1XDUA 2HHSA 2O4XB 3CCLA 2KEAA 5AJ3K 2X4YA 3W2WA 2IGMA 1RT4A 4AVPA 1VQ4T 1ZKGA 1VFCA 3KZBA 4YDUA 3K4NA 3G6EQ 3ZQHA 2EJ9A 4J9IA 1ZBUA 1XGMA 2E70A 3QDRB 2HYFA 4RTWA 3HTRA 1PJRA 4CICA 2A6EF 3CVTA 4N9HA 3AL0B 3ZMSA 3JCMb 3DOKA 3CMAI 4CBXA 2F5KA 9ANTA 1PP8F 3N4PA 1VQOA 3BGRA 3Q0VA 1ZGWA 4ILHA 3SFMA 4ILGB 3A8LB 2JNGA 2K7AA 2W03A 5FRNA 1BKBA 4LB5A 4M7DA 2EILH 1NBEB 1W4SA 2ZE2A 2UXDK 3BPVA 5LJ3e 1V55H 1MPGA 5CKEA 2QBYB 2FBVA 3OR2C 4BRAA 1T56A 2Q0UA 4RCBA 5AONA 2A5WA 4S05A 5E3OA 1N5ZA 4IEEA 1IV6A 2F2WA 2GTOA 3OQ5A 3OYMA 3QERA 2XHKA 1LCKA 2CSQA 4LSNA 2KYMA 3V9SA 2NOBA 3QYGB 4OAZA 1HLVA 4XH4A 2Q36A 3IUOA 1BBZA 1UHSA 1A04A 1IUFA 4W5QA 2FRYA 4EV0A 4HV6A 1PG5B 2QTVA 2KFZA 3TL4X 1LW2A 2E36A 3U3GA 3ZSWA 5J4VA 4ITVA 1RDCA 4CJ5A 2L2OA 3MMVA 2DVEA 2DA9A 4DV6K 4OIQF 5GAN7 4XN3A 1FKOA 2LP0A 1ZGAA 4DSJA 4JLGA 2X35A 2EA2A 1ZAOA 3M8QA 1NU0A 1G5VA 2D0BA 2EYQA 2YRVA 4MLHA 2DL5A 3DLLA 1OKJA 1T8IA 2H09A 4V2SA 3DFGA 2OTJN 3BTLA 1XWLA 4CZJA 2W24A 2MI6A 4BXUA 2E2JJ 1WI3A 2E34A 1ZR2A 2X85A 4D1QA 2LF7A 2OV7A 2YUOA 3THKA 4ILJA 2ZPIB 2J7IA 4DS4A 3FC3A 3R4KA 2HZTA 1K9MU 1YQAA 3PVLA 3D5RC 3MKZA 2XKPA 2DA4A 3VESA 3O9TA 2K3YA 5LFAA 3HUGB 1ETQA 5TGTA 1GLBG 3PQKA 3EGXB 2CU7A 2QI2A 3IUCA 2HVRA 4E7SA 2R7OA 2I2LA 2RB6A 1W0UA 3WG7H 3I0XA 2D0OA 5HODA 2DO3A 3D4VA 5AQSA 2QA4A 2D5RA 2FRWA 5D8LB 4DK9A 4GGGA 4M7XA 3BY6A 3HSCA 1Q81O 3VUBA 1NEGA 3E0JB 4M63C 1XSXA 1BGXT 4WQ4C 2GIZA 4DR7K 4E6RA 1V5GA 5GAMd 4KBOA 1NK0A 2QTDA 2Q1ZB 4A69C 2QVOA 5LGUA 1M30A 2LNVA 5J47A 1HA8A 4Q48A 3DXJF 2GBQA 3DTEA 2KJCA 3ZBDA 1VQLN 4YDUC 4JHDA 1R77A 4B3AA 3L2RA 2ASMA 1VQ8T 1TUYA 3PY8A 4HSRA 4BDYA 5JLXA 2ED0A 3FZHA 4M3DA 3TAFA 5JI6A 2OTLQ 1OH8A 5KAIC 2OTJI 1DUXC 3FR0A 1SQKA 1LEBA 4IO8A 3THXB 4DA4A 1VUBA 3VMFB 2R7SA 1FTTA 1ZBXA 4I0AA 3CCMA 3G71Q 2CGLA 4FM0A 2BVLA 1YITT 4CF8A 2LFBA 2KT0A 3O8GA 2KFDA 3E5UA 4CZKA 3CP2A 4ZN3A 3SXYA 1VQ4N 1QWEA 1TKDA 5AQFA 1I8FA 3J7ZO 3VQEA 4IXCA 3WTTC 2NS7A 3CJQB 2V1RA 4G8XA 2F7TA 2MD0A 4MO5A 4M42A 2ATQA 2E1MC 3NGYA 2EJFA 5HRNA 1QZ6A 4ORZA 1IXRC 1DGRM 3DLLL 2HL3A 2HPMA 1SAZA 1FJLA 2CSOA 4BWJA 2CH5A 1HJDA 1B34B 2ESNA 1TC3C 1FK9A 3DLHA 1ETOA 2MIOA 2EQMA 2EW3A 2VWJA 4IKFA 4XN0A 4CHQA 4MTEA 2FEIA 1T08B 3BQYA 1UJ0A 3AO1A 3P8BB 4BRDA 2HXOA 3EG3A 3VQ4A 1E7OA 4GKKK 1VQLI 2VE9A 1EH8A 1OMIA 3O9QA 3EPZA 2EYZA 3ZP5A 1IC8A 2WY7Q 1KG7A 4OIRF 2M7AA 3QNOA 3CCQQ 3F3XA 3D2FA 5FLVA 2JM8A 3JCUC 1XSVA 4KISA 1QE1A 4IHWA 4A4HA 3IKTA 4XRMA 3RSEB 1RKTA 2DU9A 2YT6A 3O8VA 4JI3K 4HSTA 2XG8D 1QVGA 2M51A 4LG0B 2CRGA 3OVNA 2P4RA 3PLAA 2CWEA 2F6CA 4UVBA 4DG1A 1EA3A 1PCXA 1IJWC 4GFBA 5FLXK 3QPTA 2MFZA 3ZQQA 5CVJA 1KQSM 3VS0A 4KHWA 1IAWA 4WE1A 3CERA 3S9HA 1D5AA 1B72B 3OMGA 2FSNA 4C8NA 1ZXOA 1WJFA 3I59A 1A6QA 3PUBA 3CC7Q 3EUKL 1VQ4I 1G3TA 4KMUX 4P55A 4JEPA 2HNZA 4BL0B 3A5OC 4B9UA 1RDWX 1VYUA 2NRAC 1YWPA 2BW3B 3FZFA 4HX4A 2ID6A 2VG6A 3MEXA 5L3DA 4M78F 4RB2C 1Q82U 3AG1H 1M2OA 2E12A 2E5QA 4BQQA 4Y3OA 4FVUA 1MJ9A 3CD6Q 2LT1A