3OYEA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound2
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyeA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyeA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyeA03
1RDCA 4CFDA 1WGSA 1S9GA 4FCYA 2I5JA 3NH0A 3U3YA 2HW3A 4EDUA 3OYCA 4LH4A 5CZ2A 1WSEA 2GFAA 4O4GA 3V1RA 4FW1A 2P5GA 1TKZA 1W9HA 1FKPA 3QIOA 3DRSA 4ID5A 2QQRA 1RT3A 3OYEA 4OJRA 4KFBA 1S1XA 4B8AB 3KK2A 1WJQA 2G8WA 3L3UA 2PQWA 5D6XA 4JLHA 4QVZA 4C5GA 2YHBA 3QETA 2B6AA 3KLGA 4QAGA 4LH5A 4E7HA 1B9DA 1JLBA 3VQBA 2Z1JA 4FLWA 3RMBA 1XI1A 1I39A 3I8DA 4BE0A 4CEDA 3DYAA 3MXIA 3RMCA 1J54A 2WOMA 5J2PA 1DTQA 3T3FA 1LW2A 3LGLA 4B9VA 5EU7A 3VQQA 3ULDA 4K8XA 2EQKA 1BL3A 1VRUA 4PA1A 1GOCA 4OPJA 1OZ3A 2HHXA 2AJQA 3E01A 3NGYA 4PWDA 4CGIA 5J39A 3VQ7A 2O4XB 4A4HA 1Q8IA 4O5BA 2RHYA 3DM2A 3KLFA 4NYNA 4DTUA 1CXQA 4KO0A 3LYIA 5KGXA 2EKOA 2EQMA 2OPSA 3PY8A 2IS3A 3ASMA 1D5AA 3PX4A 4CGGA 2X4WA 1D9DA 4I2QA 4M42A 2IC3A 1IG9A 2K3XA 3NNQA 4ZTFA 3DLBA 3HL8A 1BCMA 5HRPA 2M0OA 3PX0A 3DRPA 3K5MA 5IAYA 3G10A 1WAFA 3LZIA 3SNNA 2EHGA 3QBYA 2E5QA 1D8YA 1RT4A 4CEFA 4XIUA 1XNIA 3MEUA 4CJQA 4F3OA 1RDDA 2WONA 3MAQA 3PMIA 1L5UA 3QIPA 3OYMA 2LDMA 1NJYA 3O3HA 4CJ5A 2EQJA 3MEVA 1JLGA 1J53A 2O4IA 4PLLA 3VQ9A 5IN1A 4CIEA 2X74A 2YRVA 3ZSYA 4C8OA 3ZT2A 3TAQA 2DTUA 3HK2A 3KLHA 3PNWC 4FLTA 3CFRA 1NKEA 5D6WA 4OVAA 4CEBA 2E6MA 2LRQA 1BIZA 3PO5A 4I9QA 4B3OA 3JSMA 2M16A 1N27A 2RPIA 4E0DA 4CGDA 3QNNA 1B9FA 4I7FA 3E9GA 2GBZA 4O55A 3SUPA 3L3VA 2E6NA 2F8SA 1DLOA 3P8HA 1WSIA 4BDYA 2Y1JA 3NF7A 3OA6A 5DK5A 1S6PA 4PL6A 2B5JA 1Q9YA 1IKXA 1RT2A 2XY6A 4DTXA 4OKJA 4DSKA 3ISNC 5KI6A 4OGEA 5D3GA 4DFKA 4DU4A 2A1RA 1TKDA 1IKWA 4A4GA 3PO4A 2HNDA 4HTUA 4FLUA 1UA1A 3V9UA 1SKRA 1RNHA 2RF2A 2FC0A 3AA3A 2L8DA 3LWMA 1RTIA 5SZTA 1KVBA 2HB5A 1JXBA 4KHNA 3OJSA 1NKCA 5C25A 1KSPA 2LVMA 3LLRA 4RW7A 4MQ3A 3OJUA 4NCAA 3MEWA 1SL1A 3ME9A 3FC3A 4DWIA 2OA8A 3OYDA 4CJWA 1QQCA 3K59A 3VQPA 2XK0A 2E4LA 4CHPA 2LCCA 3EZ5A 1X9MA 4KTZA 1I3AA 3VQAA 4N4GA 2KZZA 3C6TA 3FLGA 1HYSA 2OZMA 3AVIA 3LP1A 3LP0A 1TGOA 4DQPA 4CERA 2GFUA 4ZTJA 4ELTA 2DAQA 1NK4A 3K5NA 5KCOA 1FK9A 1L3TA 3TAPA 1LAWA 1ZBHA 1QE1A 3KD5E 1WNSA 1T7PA 1A5VA 2PY5A 3AVBA 3LP2A 5E41A 2QQSA 3UIQA 2X78A 4R5PA 1XWLA 3CQ8A 3AA2A 5KTQA 1TAQA 3NTIA 2W42A 2DFFA 2VG6A 3L2RA 4IDKA 4KAZA 3VQCA 1JKHA 3S6WA 2P1JA 2F5KA 4RW4A 3SPYA 5I42A 1ASUA 1RCHA 3CYMA 4DFPA 3THVA 2BGGA 5C0MA 3OYJA 2QKBA 2DFHA 3P1GA 1ZBFA 2YNIA 4YNQA 2D0CA 5J2NA 2R57A 1FXXA 1XHZA 4CEQA 4AHUA 1H3ZA 2Y1IA 3LP3A 1MU2A 3AVLA 3SZ2A 4CIFA 1CZ9A 3AVCA 4CJSA 4Z4EA 2RO0A 3F9KA 2G8VA 2O4XA 1C1BA 1KLMA 3NH1A 4CECA 3SQ2A 3OYNA 3MO8A 4FM0A 1OZ2A 3QESA 4CIGA 3NF6A 1SV5A 2R7YA 2EFIA 1WAJA 3U6FA 1X9WA 1T8EA 4CJKA 1WSFA 4KHYA 4CJ4A 3V9WA 5HLFA 3V9ZA 3DRRA 3HP6A 5J2MA 1TK5A 2IDOA 3HP9A 2JLEA 3HPGA 4QQGA 4L59A 5KE3A 4DTMA 4DSEA 1GOAA 4OGCA 2P0KA 2DFEA 4C8KA 3UT1A 3H6ZA 2ETJA 4N41A 4GMJB 2ITGA 5KGWA 3RTVA 2LTOA 4M41A 4N76A 1QS4A 3KJVA 1ZBUA 4H8KA 2D5RA 3ZSZA 3KK3A 1LV5A 1WJSA 1UOCA 1TL1A 3OMCA 1S1VA 3E9FA 4FVMA 4FL6A 4ELUA 3KK1A 4IFVA 4B08A 4HUEA 4GW6A 5I3UA 2NLUA 4AHRA 4CJEA 3LPTA 1U45A 3M9QA 4DF8A 1F21A 1WJRA 3OY9A 1SSFA 3SYZA 3IS9A 2RHXA 4OLBA 5CY4A 2L89A 4HCBA 5HRNA 3V6DA 3SI6A 3L2QA 1TVRA 2GF7A 2JZ2A 4JS5A 3WNEA 2E6LA 1RBVA 4DF4A 3MEAA 2JGUA 3NF9A 4O44A 1KHCA 3DMJA 1BCOA 2FHDA 1LAVA 4FJMA 4CGFA 1YTAA 4KV8A 4CESA 3LX7A 3SV4A 5SWMA 4JS4A 2WACA 3TAGA 4E3SA 1VSHA 4PUOA 4DTNA 1U47A 3TI0A 1RT5A 2NUBA 1QSYA 4FZZA 3HXMA 2VG5A 1KFDA 4DQIA 3HO1A 4DG1A 3TAEA 4B9XA 4QOZB 2ZE2A 3SUQA 2K3YA 2XHBA 3OYHA 4CCHA 1ASWA 2D0AA 4IFYA 3TR8A 1J9AA 5JS2A 3S3MA 3HVRA 2RJFA 1K6YA 4EZ9A 1NK6A 3AVAA 2DY4A 3DOKA 2Z1GA 1VSLA 4NZGA 1RTDA 4CHNA 3RMDA 2R58A 2RI2A 4ZHRA 1SKSA 5HRSA 3LH0A 4CJFA 3NE6A 2R5AA 4Y1CA 4A4EA 2X6SA 1UAXA 2IOCA 2YV0X 3NAEA 3V1OA 4FW2A 3PX6A 4MFBA 4L8RB 3F73A 4F2RA 4B9UA 2HQEA 3M8PA 4OPKA 2HVIA 2Z1IA 4HCZA 1RDAA 5T7BA 4M3TA 3AVHA 3M8QA 3NBPA 3O8VA 4CEAA 2QXFA 1L3VA 4Q5WA 4IBNA 3ZT1A 1BQNA 3CM5A 3DLGA 4KPYA 4KI4A 1J5OA 3ZSXA 4CFCA 4HUGA 1O1WA 4N4IA 2O4GA 3A2FA 4CJUA 1RILA 3AVJA 4C8LA 4W5NA 1VK0A 4DTOA 4M3WA 4FM2A 1MHNA 3RR8A 3DLEA 3DB3A 4OKKA 1KRPA 4DS4A 1CZBA 3FFIA 4FLYA 3HVTA 2OZSA 3L2UA 3HM9A 3BDPA 3BDLA 4OVLA 4CJRA 5KCHA 4NS5A 1OYXA 4F8RA 2RI5A 3FEOA 2D0BA 3LAMA 4KB1A 4H4MA 3OMGA 4Z4GA 4B9WA 4AHTA 5KRTA 1VSKA 1U04A 5KH6A 4E7IA 4KREA 2HHQA 4E7KA 3RRGA 3DLMA 1WSGA 2KZMA 3LWLA 4KHWA 2F96A 1UA0A 5HRRA 2G8KA 3QNOA 2HNZA 4DQQA 2KFNA 3OS2A 1VSEA 3HT3A 3T1AA 1L3SA 4FK4A 2CKKA 1C1AA 3META 4A4FA 4QW2A 4LY7A 1YVUA 3OB9A 3ZCMA 2EQUA 2EX3A 3S3OA 3MXJA 1U49A 1QHTA 3ZT0A 4AILC 4CF0A 3ZEHA 2BUDA 2BE2A 3G0ZA 4J2DA 4BWJA 3LZJA 2OPPA 4IUTA 4I2PA 2B8AA 3SQ1A 1VSDA 1JL1A 4DSIA 4B9LA 2YKMA 2VYTA 4CK1A 3L2VA 3DLHA 4RG2A 1NJZA 1D9FA 2RHIA 3TARA 3ASKA 5D6YA 3VQ5A 1Z26A 1ZBLA 3L2WA 1NK8A 2G8FA 3CG7A 3I0RA 4FXDA 1NKBA 2MWPA 1JLAA 4E7LA 2FBVA 2JTFA 4PLIA 4FJKA 4FLVA 1KVAA 1NK5A 1ZBIA 4KRFA 2RI3A 3CFPA 3ZSRA 3DI6A 2PYLA 4CJPA 3DB4A 3TANA 2HHSA 3HYFA 2ATQA 1C0UA 4AHCA 4PY5A 4M3XA 3ALYA 2VWJA 3OYLA 5FDLA 3NCIA 1C0TA 3IAYA 4FJLA 3TAFA 3ZSQA 4DQSA 2FBXA 2IG0A 4FJ9A 4QCLA 4CJLA 3QJ6A 1ASVA 3AO4A 4E7JA 3LPUA 3ZSOA 4B9SA 3VQ4A 2G8UA 3M8SA 4BE2A 4Z4FA 3EAEA 5J26A 3NF8A 3MP8A 4IG3A 1Y97A 1BI4B 2XY7A 4DTRA 1TK8A 3C95A 3V1QA 1IH7A 4QQ6A 4LSNA 1B92A 3SQ4A 3QKJA 4DTJA 3NTHA 3S3NA 2VG7A 4DMNA 1SL2A 1HNIA 2RJCA 4DLGA 4M3YA 4Q5VA 3QLHA 2L3RA 3ITHA 3NFAA 4F2SA 3O3FA 4B9MA 1ZYQA 3JYTA 3GOXA 3HPHA 1SKWA 1CLQA 1JLCA 2DIGA 4C5EA 2P51A 1EX4A 2F8TA 4IUQA 3U3GA 3V9XA 4GY5A 1NOZA 3OYFA 1EXQA 4CF8A 4BWMA 3WNFA 4B9TA 4UQGA 3KD1E 4G1QA 3SJJA 3B6OA 3HPOA 1RT7A 4O0JA 3NTKA 3VA3A 1HPZA 4AHSA 3LDSA 4FJ5A 3K5LA 3K2PA 4CJVA 4N47A 2QK9A 2HQXA 4KB0A 1FKOA 3AVFA 3C94A 3H08A 4TSXA 3KUFA 4FJXA 1HRHA 4W5TA 2FBYA 1S6QA 1UWBA 1HMVA 2RJDA 1CXUA 2HVHA 1A5XA 1JLEA 3QERA 5KRSA 4CK3A 3M8RA 4N56A 4IKFA 4C8MA 1QSSA 1C1CA 3OYIA 3KKSA 2XO7A 4IURA 1U48A 1VSIA 4GVMA 1BISA 4CHQA 1T03A 4CHZA 1KLNA 1IO2A 5C6SA 2D9TA 1OI1A 3SCXA 1VRTA 1KCFA 3CFOA 2GUIA 2LSNA 4FLXA 2YKNA 2FBTA 3LALA 4E19A 3ZT4A 3RRHA 2KTQA 1RBRA 5J2QA 3B6PA 4CHOA 4DU1A 2X4XA 2YHAA 4FK2A 3K5OA 4DTPA 4FYDA 3QO9A 4FM1A 4BDZA 3L42A 4CFAA 3OQ5A 3AV9A 4I9LA 4Y1DA 4FJNA 1S9EA 5FROA 2HMIA 4RW6A 2A1SA 2XDPA 1TL3A 1RBTA 1WSHA 3MEDA 4CEOA 3WNHA 1R0AA 3AVKA 1S5JA 3EY1A 1YTUA 1LWFA 3QEIA 4CEEA 2HNYA 5HROA 3D0PA 3VQ8A 4KTQA 3V9SA 3AA5X 3RR7A 4Z02A 4W5RA 3IG1A 4CK2A 5CYMA 1QTMA 4HUFA 4ICLA 4JRQA 1S1TA 4DFMA 1RI0A 3I0SA 3S9HA 3K58A 2RN2A 4AHVA 1C6VA 2ZD1A 2BIVA 4PQUA 3CM6A 5CIUA 4II1A 3SPZA 3TABA 5DMRA 2ZQBA 3MEEA 3MP1A 3C4SA 4UC4A 5J1EA 3QEVA 4H4OA 1RDBA 1A5WA 3VQ6A 2DIQA 4IUUA 1DTTA 4DSJA 4M3RA 5FRNA 3KLEA 5FRMA 1LWCA 2IAJA 1RBUA 1U4BA 1EETA 4CF9A 1S1WA 1WSJA 4WE1A 3PMTA 2OPRA 1W0HA 3RMAA 3L8BA 3HJFA 4EZ6A 2HHVA 1N5YA 2M1HA 1IKVA 4K8ZA 2OYQA 3MXMA 4IUPA 3ZSVA 3AO3A 3MECA 4CGJA 1RBSA 3P83D 4QQDA 3NDKA 4Z4IA 1REVA 4NCGA 1JLQA 4HHTA 3ZT3A 4B8CA 4FZXC 3NGIA 4RG8A 4LSLA 4CF1A 3TAMA 4EP4A 1HYVA 2BANA 2PZSA 1HQUA 2PYJA 4KKOA 2HHWA 4CGHA 4OKEA 3CEYA 5HBMA 3QEWA 1C0MA 2P5OA 4FJ8A 4DQRA 4W5OA 2Q3SA 1VSJA 4IUVA 3QIIA 1JLFA 3OYAA 1NJXA 1BI4A 2BDPA 2G8IA 2HHUA 5M9OA 1Z25A 2RKIA 4W5QA 2XY5A 3P8DA 3PFSA 2XRIA 3TWHA 3OVNA 1S1UA 3DOLA 4KHUA 4FLZA 4KTWA 1KTQA 4J2AA 2KQ2A 1L3UA 1XHXA 4J2EA 2G8HA 1XC9A 4FK0A 3P5JA 3OS0A 1JL2A 3SUNA 1NK0A 4FJJA 3VQEA 1QSLA 1VSFA 3RWUA 4DFJA 4CRIA 1TAUA 3KKRA 4BD3A 3C6UA 4M45A 1WLJA 3V81A 4F4KA 3SV3A 3MP6A 2HHTA 4NYFA 4CJTA 3H8ZA 3KLIA 2Z1HA 3QINA 2BKDN 4OLAA 3NHGA 4HCCA 4Q0BA 5C42A 1LWEA 2X35A 1NJWA 4CJ3A 3NGZA 4KHSA 3MEGA 3WNGA 1N6QA 3LGFA 4AH9A 4DSFA 3F70A 1Q9XA 2GV9A 1KVCA 5KE2A 3AVMA 3VN5A 4E1MA 3O3GA 4C8NA 2R5MA 1RT1A 2X6NA 4HVJA 3AVNA 4EP5A 1SL0A 3PUFA 5HP1A 3DLKA 1VSMA 2X4YA 1TKXA 4ID1A 2KW4A 4LD0A 4DU3A 1KFSA 4DS5A 1RTHA 2KFZA 4BDPA 4M3ZA 4JRPA 3VQDA 3ZSWA 2MWOA 1G15A 4YFUA 4RW9A 1NK9A 3AO5A 1HQEA 3DLRA 3OYGA 4KHQA 3SUOA 3EYZA 1TV6A 5JS1A 5K14A 1TKTA 3AVGA 4X34A 3QEPA 1RT6A 4FZYA 4IG0A 3KIOA 3AO1A 3OS1A 1X9SA 4E1NA 4RW8A 3BGRA 4Z0UA 1JXEA 4Z4CA 1HYZA 3NH2A 2OPQA 1LW0A 4J2BA 2IGIA 4BE1A 2G3RA 1WN7A 2VWKA 4B9NA 4DLEA 1EP4A 1BIUA 1HJRA 1SUQA 3IRXA 3KTQA 4FJGA 3QEXA 2XY8A 1HNVA 2YNFA 2RHZA 1T05A 2YNHA 4CFBA 3SD4A 3HSTB 2RJEA 4FU6A 5CZ1A 4CHYA 4Z4HA 3Q1JA 5C24A 3LAKA 3O4QA 4FJIA 3UWNA 1X1PA 4DSLA 1EKEA 4LD6A 1RTJA 3LANA 1NK7A 3OYBA 2QKKA 2B4JA 3VA0A 3T19A 1G5VA 4C5IA 3V4IA 1BGXT 2YNGA 1ITGA 1GOBA 4E89A 4KI6A 3O4NA 4M3UA 4NCBA 4FJ7A 3FDRA 4BACA 1NOYA 4FJHA 4O0IA 3AA4A 4CE9A 4N5SA 4CF2A 3AO2A 3PV8A 4ELVA 1TK0A 4C5HA 1IKYA 3D45A 1BHLA 3K57A 2RHUA 3OYKA 3SQ0A 1YT3A 4DTSA 4N4HA 4F3TA 1BQMA 4CEZA 5CYQA
chains in the Genus database with same CATH superfamily
4PFPA 5EGOB 5FFXA 1NGDA 1OVYA 1YIJN 2E1ZA 8AT1B 5CKBA 2I5JA 2Q2RA 3PSIA 1YJNI 3OYCA 2HDCA 2E2OA 3X24B 3VENA 4O4GA 1YHQT 4FW1A 2MC3A 3JCMf 2BE5F 3QYGB 2Q1NA 4XBFA 2WC9A 1XOVA 3A2KA 1YJWN 2K3FA 3TMOA 1WFWA 4KFBA 1S1XA 2P9LA 1PUFB 2MPXC 2G8WA 3CMAQ 3L3UA 3RSNA 2VQCA 4G94A 5AQLA 4QVZA 4FX0A 1M8VA 2AP1A 2V7ZA 1XNRK 5HLHA 2EINH 3T69A 1OPCA 3Q9SA 4JKEA 1T08B 2YPRA 2QENA 2PUOB 1XI1A 3OGDA 5GMKj 3IL2A 3FMQA 1LB2A 1S72N 4CEDA 3VMFB 1ENHA 2J6FA 1KC8O 3LSKA 3N0UA 1D3BA 1VYUA 3QSUA 1VAZA 5J2PA 3O9RA 4FWLA 4XRSG 3PQJA 3T3FA 4EJTA 1M90R 4RAGA 4RGSA 2EQKA 2JHNA 4CYCA 3UE5A 3H9JA 2XGDA 3IAM2 2K7LA 2CT3A 1YN8A 3C0BA 1H641 1OZ3A 2JJ7A 2KMTA 2HHXA 3OL4A 3E01A 3NGYA 4PWDA 3EPZA 4PJOD 4EW0A 2CH4W 5GAOp 1IHWA 2E5NA 1K61A 1Q8IA 2R7UA 3CLOA 1VQ7T 3VOVA 1VQ8T 1VOMA 3KLFA 2IW5A 4XRFA 4DTUA 1CXQA 4B3SK 2VT3A 3GWZA 3JRIA 2X48A 2K6DA 2X0LA 1JKQC 2BZYA 3DLLL 3L00A 4C2UA 4IOAL 2OPSA 3PY8A 1V3FA 4OMQA 2IS3A 4PJOC 1OX9A 4JRIA 1MSEC 4LG3A 1XC5A 2IVWA 2LP5A 4WQ4C 3REBB 1K73C 3PT9A 2WAQN 4DBFA 1K4SA 2F5FA 4CGGA 2EILH 4JI2K 4ESRA 1FBSA 6AT1B 4ZTFA 5FLVA 3CCLN 4M75A 4AC0A 3DLBA 1J5EK 2F5DA 4YRVA 3F72A 1ZK8A 3NVMA 4BC5A 5HRPA 4BY9C 3K70D 3I56T 1WQ7A 4M9XA 4WCIA 1R36A 1WAFA 3SNNA 3D6RA 1SFKA 4OPHA 2WADA 3CESA 3WHBA 3ASNH 2WSFE 1RT4A 4CEFA 4F3OA 2EJGA 3C65A 4EAHD 4KT6A 3PMIA 3G6EQ 3CJ1A 1REPC 2V1QA 4KULA 4I6MA 4IEIA 1Q7YU 1NJYA 3K70C 4LD9K 2BBYA 1ZLJA 5JVGL 4HDUA 1A5JA 4PLLA 3FF5A 1UGPB 5IN1A 4CIEA 1PSEA 2E2NA 3ZSYA 4ENJA 4L9VA 3HUGB 5F6FA 1RAAB 2CG4A 3LCNA 4OIRF 3KYDB 1N77A 1IV6A 1Q81C 3N4QA 4FLTA 1EF4A 2DF6A 1VQ7Q 4OVAA 1ZX6A 5AQSA 3ERED 1BIZA 2QDLA 2R7DA 1K73U 4DV0K 2M16A 2KR3A 4CI0C 4M77E 4AIHA 3E9GA 4O55A 4EPCA 1JXOA 3SUPA 2A5XA 2BVMA 3L3VA 2E6NA 2PVDB 1TYQB 5FKMA 1NWKA 4IF4A 1A31A 4GXOA 1NGAA 1WSIA 4HNTA 4V2GA 2FSWA 2ID3A 4PKCC 2TCTA 4A53A 1AWWA 1IJJA 2VOOA 1S6PA 3IKTA 1E3MA 3GTOJ 1QQNA 2XHKA 1N33K 4ME7A 2ISYA 2XY6A 3D2FA 4OKJA 5FU7B 2YUNA 4DSKA 2ZXJA 5KI6A 1QVFA 5J1YA 1YXQA 4E7ZA 5D3GA 1YQAA 4DFKA 1VQOQ 5CR4A 2OAZA 4DU4A 1D1AA 4L5EA 1ZRDA 4A4GA 4MO7A 1O75A 2RC4A 2MYSA 4HTUA 2IA2A 4KT0E 1KIKA 1BU6O 3JB9I 4HF0A 3DP7A 1U5TB 5A2QE 2RF2A 4ZYHA 4G8XA 1QVGP 2L8DA 3CCQT 1YX3A 3LWMA 2RREA 4B44A 4OF1A 1M1GA 1KVBA 1PJRA 1JXBA 1N25A 2MOXA 1NKUA 1M2VA 5IHKA 2LVMA 3LLRA 5CKTA 1T39A 4MQ3A 3OJUA 4XTUA 5GAN5 4A3IJ 2VYPA 3ME9A 4L0ZB 3C7NB 5FLXO 4DV1K 2K5IA 4CJWA 1OU9A 2LP0A 2QEXQ 1GLFO 2DI3A 1FBQA 2XK0A 4RGXA 2E4LA 4CHPA 3PIPL 2GTOA 3EZ5A 2WSEE 5IXBA 1X9MA 1B7TA 2O8BA 3CWUA 4KTZA 4OB2B 3UF4A 3VGMA 1I3AA 2KZZA 4LD5A 2BXYA 2K9MA 2NLXA 3LP1A 3WG9A 2FU4A 3O8MA 4ELTA 4KH0B 4A59A 1FK9A 1YWOA 4HXJA 3A02A 2KXCA 1YCSB 3EYYA 2LLKA 1IZ1A 3F8MA 2P7CB 3MKDA 2ZFWA 3W6JB 1Z6TA 2PY5A 3AVBA 1P7IA 3E19A 3MJXA 3CPWA 4CSWA 4G7ZF 1HX1A 4PSXA 2WFBA 3SQNA 3M55A 4DBRA 3PLAA 1FMVA 1KA8A 4KISA 3CCMQ 4GO1A 3CQ8A 4M7DF 1S72T 1MBHA 1GFCA 3NTIA 3BROA 1F5TA 3A0HC 1TTHB 4XL9A 4ASNA 4KAZA 1ARKA 2JMCA 1VQLT 3G71N 1M1KR 2O8DB 1PD0A 4M7AE 2LBFB 1YP5A 5I42A 1HF0A 1SEMA 1ASUA 3MMVA 1HSTA 3I55T 4DR4K 3THVA 3OYJA 4BR2A 4LLLA 1TWFJ 4GLKA 5AQPA 1LFBA 5K1YA 1FBUA 1V4RA 1OCTC 2DCEA 4ESBA 2DLLA 2PBDA 3LP3A 3ABLH 4M75F 2KLAA 4CJSA 2DFIA 3LFKA 3NARA 1KQ8A 2M87A 3ZCOA 3SB2A 2G8VA 1IRXA 3NH1A 4CECA 1VQ9N 3CJNA 4JK1X 5L3FA 3OYNA 2OTLQ 3DLAA 3MO8A 5CQEA 4BI3A 2E19A 1R22A 1KHIA 2GWRA 3BFMA 5I9EB 2G7UA 1AWOA 2FD5A 2M0MA 2FX0A 2X6WA 2ZZDA 1SV5A 5GPAA 4ESFA 2R7YA 3U6FA 4RLQA 2M9HA 1HU0A 2W7NA 1WSFA 2CQXA 2FJ1A 4G6QA 4KHYA 3CMAA 1Q7YO 1NGBA 5GJWB 2F2EA 3KP5A 2JRMA 5HLFA 1XGSA 1X6GA 1FOXA 3V9ZA 5GMKm 3IRQA 4XKWA 3HP6A 3HRTA 4CD1A 1TK5A 3H41A 3I4NJ 3HP9A 5KE3A 1SANA 2Y2ZA 4A3FJ 2JK3A 1YQRA 5EYRA 2CSIA 2KMUA 4HYEA 4N41A 2FZKB 4PHTX 4U67L 1RLPC 1QS4A 3KJVA 2MG4A 1WBBA 4DQ8A 1BA5A 3ZSZA 3KK3A 1WJSA 1WJ5A 4A5BA 1C0WA 2WWYA 3DF8A 3ECHA 4FVMA 3RSEA 3LOCA 4QTRA 1VQ7I 3LDOA 1VQ8I 4CZCA 3I55Q 3WTSC 3CPEA 3LDNA 4IFVA 4B08A 5HVQC 2LK2A 4ISEA 4NNJA 4OMFB 3BR2A 1LOJA 3BY5A 2ZMEA 1SSFA 5CY4A 1M3AA 4HCBA 4CCKA 3SI6A 4B1WB 2KNBB 1GLBG 4FPAA 4GKJK 1RBVA 3MEAA 4ENMA 5M1PA 2VGMA 5GTIC 3KP6A 1VQOI 5FW9A 4XSXF 3M9AA 2F6CA 4KV8A 1ODDA 2GXAA 3EG2A 4EEFG 2KT8A 3H0FA 1K0XA 2RHKA 2WACA 1W2BS 3I56I 4OAZA 4XTWA 5KYXB 5JI6A 1U47A 1I0CA 3CP8A 3TI0A 1OH7A 3JTHA 4C3JJ 5CKDA 3I35A 1KO9A 1QSYA 3FJ5A 2E3HA 4DR6K 2ZJPF 3HO1A 4YFNF 1VRLA 4DG1A 2CS7A 4BG9A 3HPWA 4VUBA 3RJPA 3B6AA 2Q0RA 5CO7A 3OYHA 3PNVA 3GW2A 4XLNF 5L23A 1KC8R 2O03A 3CDLA 2QEXI 2D0AA 1YQLA 2GQVA 3CWSA 4I6ZA 3TEDA 1ZBXA 3V7SA 3KETA 3G3ZA 3S3MA 1XUPO 2KZVA 3AVAA 1VSLA 4NZGA 3Q7CA 3G6EA 3K7AJ 4ZN3A 3F6OA 1Y07A 1NGFA 4BRFA 1SKSA 2LY1A 4PL7A 5IYDJ 2DT7B 4CJFA 1W5SA 4J6YA 3K69A 3CXCA 5CQGA 2QM3A 3ENHA 1P9QC 4BUGA 2R5AA 4Y1CA 4XU0A 4UUSA 4A4EA 4JRKA 2X6SA 1DU6A 1BYMA 4MEYF 2F5EA 3JAMK 5JLHA 3M4YA 2KEAA 2HNIA 3V1OA 3KLOA 1VQ7A 1RESA 1NLPC 4C8QD 3M1FA 2HKQB 5AQJA 1IDZA 1Y1VJ 3H3NO 4OPKA 1WI3A 3RNJA 4HLXA 2HVIA 1ESVA 2VUMJ 3KX2A 2OQRA 2JA8J 4JI7K 4J6WA 4M3TA 3AVHA 2X4JA 3S2HJ 3CCMI 3ZEUA 3CF5L 3K9JA 2QXFA 5CE3A 4Q5WA 1FJLA 3QPTA 2K02A 4C92B 2R7FA 3DLGA 4KPYA 3WXKA 4KI4A 3LDQA 3VEVA 4F7UB 3ULRB 1O1WA 1AKHA 4Y13A 2WSCE 4C8QC 1ETKA 1RIOH 1Q82R 2X1CA 2BHYA 1TWAJ 2HZYA 2B9SA 3CO7C 3AVJA 1VQOA 3UKGA 4W5NA 4C3IJ 2NZTA 4HSRA 3DTEA 5GIPA 4FM2A 4JX4A 2CP6A 1BBYA 2HD0A 2YX4A 1MHNA 3PIOA 2JOYA 2TRTA 4BG8A 3BWGA 1E4FT 1OU8A 3UA6A 3RR8A 3FIWA 3M56A 4OKKA 1JUSA 4DS4A 4FISA 1CZBA 3JRDA 4XK8E 2ZJQL 3OW2M 1B9MA 3RTRA 2PEXA 3CCRT 3U23A 4CJRA 2NXNB 1YITN 4X9CA 1RI7A 2OTLI 1GLLO 1ETYA 3FZVA 1ETQA 1FX7A 3FEOA 2ZAEA 3BCAA 3DEWA 1RKWA 3ESWB 4XRMA 4KB1A 1MV3A 4XU1A 4DYQA 2FPEA 2DTZA 4D5FA 2QEXA 2RNGA 5J3LA 2IVMA 5ILVA 4MHGA 2P6SA 4DR1K 3CMMA 2KT0A 4E7KA 3BG9A 3CIPA 1CF7B 1BIAA 3BG5A 1PKSA 1B6AA 1WHHA 5HRRA 4AWXB 3VUBA 5H6RA 3MVPA 2CH5A 4AF1A 2QBYB 1VQNQ 2W40A 1VSEA 3HT3A 4E9FA 1LQ1A 4KDPA 1E17A 1L3SA 1X3UA 1BWFO 1R4MB 1OH5A 3EUKL 3WVEB 1SD4A 3COAC 1NBEB 3H1QA 3CC4N 2EQUA 1LDDA 3ZT0A 2L4AA 2G0EA 3VYGA 3ZEHA 1RAEB 3S17J 2BE2A 4J2DA 4FQGA 4C23A 4M7YA 3AG3H 4J6XA 3GFLA 2LOOA 4IHXA 1VSDA 3I55I 5E26A 4JI0K 3CCMA 3BLYA 3SLCA 4CK1A 2HKOA 3MAJA 2KGTA 2RHIA 3UKRB 3M1CA 2RQWA 4D8DA 2QVOA 1SHGA 1X75C 3A01A 1Z26A 4IJNA 1ZBLA 1NK8A 1YF5L 4KMUX 2F4OB 2KRCA 4LC9B 1U6ZA 4RMNA 3CCRQ 4FSVA 3FE1A 4E7LA 2PJRB 2WTEA 4PLIA 1VHXA 3H36A 1WBDA 4KRFA 5BS6A 1XD7A 1T3SA 2IVPA 3CCJT 1BR1A 1D5YA 4IQ4A 3BR0A 3DB4A 4XN0A 3TANA 5GADP 1GDTA 2HHSA 3RKXA 3HYFA 3QUIA 1X2MA 4B3XA 4AHCA 4PY5A 4LLNA 4M3XA 2OTLA 3MN9A 2HZTA 1D1BA 3ALYA 3LQRA 2DYIA 2DA4A 3OYLA 5AT1B 3H3ZA 3IP4B 3NCIA 4A62A 3S1NJ 5AFUA 1WJAA 1I5ZA 4BR0A 1TNTA 3ZSQA 5E79C 4DQSA 2IG0A 4FJ9A 4QCLA 5TRDA 1IN5A 4X6AJ 2PQ8A 1IZ6A 3CXCP 3CJ7A 2DA5A 2NRAC 3G1JA 3CWTA 3LPUA 3HG9A 1YVNA 4Z4FA 5J26A 1FWZA 2AXTC 2V6EA 3F3XA 4BU2A 1B34B 1PRMC 4BHCA 3FGUA 3RESA 2EYXA 1IXCA 2XGXA 1TT5B 4DTRA 3P4IA 3C95A 2Y0MA 4WCEL 4NDLA 1IH7A 4QQ6A 4DTJA 1KU9A 2PUKB 1GVDA 4YOUA 1JJ2S 3O08A 4ISGA 4K41A 1WNLA 3VS0A 1X19A 2XRLA 5CVJA 2MBFA 4M3YA 4Q5VA 3H3UA 1LVAA 3I8BA 4IHYA 4H5NA 4J9HA 4R0KA 1E3PA 2HOTA 1ZYQA 3I55A 2WB1A 1GT0C 5LRSA 1YI2N 2HPMA 2FSJA 5E3NA 2DIGA 4XH5A 1U2WA 2QQAA 1EIFA 3THYA 4IUQA 1NOZA 3TP0A 1EXQA 1S7AA 4CF8A 2KPMA 1W6XA 4BWMA 4I98B 1XSDA 1YJ9Q 3CCJQ 1YNZA 2IGMA 1RT7A 4O0JA 4AHSA 1FYNA 4FJ5A 3K5LA 2DDBA 2Q31A 2Z16A 3C94A 4TSXA 1OYWA 1HNWK 3FMSA 1LDJA 2YUSA 4FYVB 2X1DA 2XAQA 1WHGA 4P9UA 1HMVA 1WHLA 1XG7A 4EGYA 4V19K 1M30A 1H89C 2H8HA 1Q7YR 1A5XA 1BOAA 1JLEA 2FRYA 5JLWA 1IGUA 1OYYA 4CK3A 4IKFA 1NMDA 3SZTA 2XKOA 4YFKF 3OYIA 5J6XA 3TDZC 2X9DA 4NBQA 3FHGA 4BR9A 2NOFA 1U48A 3CJBA 5GAOr 1VSIA 2JWKA 2EJFA 4UVAA 4CHQA 4H5TA 4YHHK 4CHZA 1KLNA 3EHQA 4H0VB 1JCFA 4MIMA 5C6SA 2D9TA 1JT6A 3W2AA 3PJRA 2QSFX 5CVIA 5L3EA 2NUZA 1VQMN 1JUPA 2ME0A 4H0OA 2OC6A 4M78E 1GLAG 2RDPA 2EZLA 3HSBA 2L7MP 3HHTB 4DV2K 5FKKA 5DCMB 2KRMA 1JO8A 1RBRA 4RTZA 4XN3A 1VQNI 2EZHA 3B6PA 1FW6A 2JXBA 2EPDA 3PE0A 4QVDA 2EZIA 2KBTA 1OCZH 4GRIA 1X43A 4I9LA 4Y1DA 4EMKB 2FQ3A 4A6EA 4RW6A 3CMYA 1TL3A 5K5OA 4M6YA 1WSHA 2E34A 3I0XA 1S5JA 1K8KA 3EY1A 1LWFA 4EMSA 1PM3A 1HLVA 2KT1A 4H0XB 1JB0E 3D0PA 2XAFA 2ZPHB 5EY4A 4OB1B 1NM7A 3S2DJ 1ZRCA 5CYVA 3JW4A 3FXLA 1MDUB 1WCMJ 1GLEG 4IEEA 3ZMDA 3E6CC 1OFCX 3CC4T 2AT1B 2VC8A 4ICLA 4PDKA 3KYLA 4UB6C 4MDBA 4AHVA 5HKCA 4L3QA 4B4CA 2ZD1A 2BIVA 3AFHA 3CM6A 2DJZA 3CCRI 5ADXA 3URGA 4XOPA 3MX5A 2P5VA 4II3A 2JTMA 3SFZA 3LSTA 1ABQA 2P5LC 4AFQC 1DGWY 3RZDJ 1J9IA 3O1BA 2DJNA 2L01A 2CV0A 4D6WA 1Z9ZA 2YLCA 5L3CA 1WSUA 2CYZB 1YQMA 1ZKGA 4OP0A 4UC4A 5J1EA 2CH6A 4H4OA 2A28A 4GYGA 3CCUQ 2AZSA 1A5WA 1EO1A 1BI0A 3VQ6A 4IUUA 3G4ST 1JI8A 2VQGA 4JX6A 4ZYGA 4M3RA 3WXJA 1M1EB 2YT6A 3RDVA 2P7VB 2RB6A 1FJGK 3A1PA 3CCET 1Z7LA 2CREA 1YW9A 4XNFA 3EFRA 1U1SA 3CCVN 2KAFA 1EETA 1UB4A 3PMTA 1KAYA 3RMAA 2O8KA 2R7QA 1HC8A 4YFXF 1D5VA 3CD6N 1FYMA 1BR2A 3UKUB 3MKLA 3P83D 1ZBJA 3NDKA 3FXRA 4Y92A 2YU9J 1T3LA 4NCGA 2YUQA 4U0YA 3JB9J 1VQNA 1XQPA 4BRCA 1MDMB 4RG8A 3CBMA 1WB9A 4EM0B 1K9MU 3J80K 4JAXA 1HKTA 4RBOA 2BANA 3O8GA 2DA9A 2X6OA 1YOVB 2PYJA 5DV5A 2PI0A 1LFUP 5HBMA 2NYXA 4KMFA 3HB9A 2R7TA 2BW3A 2P5OA 1LJ9A 3HOXJ 3A03A 2P9LB 4HG2A 2RD1A 2ASPA 2A3ZA 2YHXA 1VSJA 1OISA 4PJOG 3SDBA 4M7AD 3AAPA 2IAIA 3ABKH 4XRSA 2ZCFB 2HBKA 3TPQA 3RERA 3GZ6A 2BUPA 1BI4A 2G8IA 2HSTA 3K4LA 4Y0WA 3W3DA 1HNXK 3PFIA 3NEUA 2RKIA 5E8GA 1QPIA 3P8DA 3CC7T 3KP7A 2XRIA 3BY7A 4FLZA 5M1KA 4IRIA 1E3HA 2KQ2A 1YJ9I 2PTKA 5LRRA 3CCJI 3LSRA 4M7AC 4LB6B 4NQWB 3CC2N 3HI0A 5F1RA 2ZKZA 3ZXSA 4FTHA 1YI2T 2FF4A 4FK0A 4ZZDA 1IRFA 4CYCB 5JMVA 3CCEQ 1JL2A 3SUNA 3G2BA 4FJJA 4ABZA 1P7MA 3PNTA 2I10A 1VSFA 2OAUA 4OPAA 4DOVA 2YRCA 4BI8B 2XV4S 4M45A 5KQ8A 2P0WA 2QASA 3CW7A 2DRMA 5J1RA 4M7DB 3GTMJ 1JQQA 2BKDN 4HSBA 2P4WA 4Q0BA 4CO8A 3K4BA 2K2MA 2KXDA 3HM8A 2EWSA 4PJ0C 2UXDK 3HSCA 2MK5A 3AHUA 2NRZA 4KHSA 3EZWA 1YQKA 2DA2A 4MTEA 1UHWA 3LGFA 1MH3A 2OCCH 5IT9O 2OTJN 2FOKA 2VV5A 2CH0A 4XICA 3AAQA 1KVCA 1DGKN 3N97A 4NL2A 1LPQA 1ITYA 2HQNA 4E1MA 2DZ9A 3DBHB 4M75B 2R5MA 3JCMh 2P81A 2UUBK 2HQ5A 5ILUA 3PUFA 1NPPA 5EGOA 1TKXA 1YFHA 4ID1A 2RA2A 4O8KA 2RM4A 5C4XJ 2W41A 4L18B 5GAN2 1B07A 3BQZA 5EEHA 1N32K 2DZCA 3OMYA 2ELKA 4DQ2A 1N78A 2FYKA 1TQMA 4I76A 3OV8A 4NC7A 3BUZB 3IUCA 1VQKT 3VQDA 1Y8QB 3TDUC 1SC7A 3FZMA 1ZELA 1QVGM 2A36A 1HQEA 3UATA 4BRPA 4KHQA 3GO5A 4LN2A 1LE8A 1D0ZA 1W0TA 1NTCA 1B72B 2JPBA 5K14A 4CI6A 1IBMK 4KH6A 4A0YA 2JPCA 1DQUA 4DOWA 2HR3A 1YJ9A 4IG0A 4FYYB 2VT2A 5DTDA 4WK8F 1W7PA 4M75D 4E1NA 4RW8A 3WXMB 4Z0UA 3WQTA 1JXEA 1BBZA 3NH2A 2CJJA 4HA8A 2H27A 3VEPA 4U7DA 2DYSH 5ELZA 4B9NA 1B1BA 4DLEA 1X1BA 5GAOq 1R59O 3RUXA 3M3ZA 3H1VX 4FJGA 3KTQA 1QVTA 3QEXA 5AQIA 2XY8A 4FX4A 1ZSZB 4NB4A 5C2FA 3CCUI 2ASOA 2QGFB 1QWEA 2DODA 2CV1A 1WEIA 2D8HA 4M75C 4EIKA 1R7JA 4JK8A 5M3FJ 4IL6C 4OB0B 4G6TB 2IS2A 1YIJQ 1X3MA 3CBOA 5IOYA 2QUFA 1X1PA 4E6KG 1RAFB 4YIFA 4DSLA 1EKEA 3CCSQ 2CP5A 5HS7A 2LJ3A 3CI5A 2NNYA 1QGPA 2DLPA 4HDVA 1UJ8A 2B4JA 1X69A 1YJWQ 3NFCA 1U9OA 1MBGA 1ORNA 2UU9K 1RR8C 2YNGA 1K9MO 1XDSA 3JAMZ 1KG3A 1E7OA 2X3WD 4BRMA 5GMKi 1TTYA 1QMCA 4X9DA 3F5TA 5AYFA 3OOUA 1Q95G 1VQKQ 5DPKA 3CCVT 1NOYA 3S6IA 2FRWA 2IIMA 4DB3A 4HZFA 3I59A 3AA4A 1YWPA 3NVKA 4CF2A 1R5ID 4C2MJ 4FWPA 1TSFA 3PV8A 2O9LA 1IKYA 1JUMA 1BHLA 3OYKA 3LNQA 5E17F 1YT3A 5CPRB 2DEQA 3VF6A 4N4HA 1VQ5N 2O8BB 4CEZA 2LX7A 2DK8A 5DD8A 4ZDLA 4Y7NJ 3E0JB 2Y30A 4B1RA 2HW3A 3K2AA 2K86A 2P5GA 4IRGA 4FASD 5BPNA 2L2PA 2FA5A 2VIXA 1XGMA 1XMXA 1IO6A 1FKPA 1S7OA 5BPLA 3QIOA 2YWWA 3RVCA 2H8WA 3ZFJA 3OYEA 3PM1A 4UHTA 3CZ6A 2K9GA 4KUIA 2IA1A 1ZLKA 5DCFA 2NOIA 2CZ7B 1Z1DA 3JAME 3KXTA 2PQWA 5D6XA 4JLHA 3K9TA 5K7HA 4LIUA 4G9YA 3HUGA 3QETA 3CCEI 3EGDA 3I5UA 3EG1A 4F52A 1B9DA 5GANg 4RAZA 4C2TA 4PIIA 2E8AA 4JZ4A 3W2WA 3CCUA 3I8DA 3ULEB 1QHAA 5GAN3 4HX8A 4B1ZA 1VQ4Q 2F9TA 1PYVA 3OW2S 1SD6A 3MXIA 3IRRA 1ORKA 1J54A 3CCLQ 1LW2A 1UHCA 2YJFA 4QLCU 1LDKB 3LGLA 4Y91A 1KQ2A 3ULDA 2X9HA 4BXUA 5J4VA 2D2WA 1U5SA 2NUPA 3ID8A 3CWAA 3AL0C 1VRUA 4PA1A 1GOCA 4E4HA 4OPJA 2QW9A 4BBSJ 2CT4A 1HCRA 3HTVA 1D0YA 3VQ7A 2LQ8A 4A4HA 1IN7A 3TKYA 4QKUA 3SAGA 5J4YA 2RHYA 1USTA 2EBPA 4NYNA 3QP5A 2JPSA 3CJ9A 2LNVA 2EKOA 5LFAA 3HKZA 1LNWA 4I02A 2A6EF 4M3FA 2L9SA 1WEGA 2ZJPL 1VQ6N 1WJBA 3FR0A 4JK7A 3KFVA 3RMSA 1K1ZA 3ASMA 3FFKB 3C7NA 4AU7A 4YOYA 2OTJT 4O8UA 1OPLA 1WRJA 2HDAA 2CZ1B 3PNYA 4I2QA 2ABLA 4M42A 3JB9D 2QA4N 5EZGA 2IS6A 2OCEA 3WU0A 1RRJA 1MSFC 1OULA 2AKLA 2HU9A 3NNQA 4A63B 4DR3K 3HL8A 1SFOJ 4YOTA 1GXPA 1BCMA 2M0OA 3N05A 3DRPA 3K5MA 5DDGA 3E6DA 5IAYA 3LZIA 2LREA 3U21A 2E12A 3ZN0A 5IPAA 1D8YA 1XNIA 2A61A 3MEUA 1TQPA 4E1JA 3J7YP 1RDDA 4BQZA 2AHQA 3EE8A 4DV3K 2ZMEB 1WPKA 4M6VA 4CYDA 3O3HA 1PVEA 4MQ9F 5M1OA 2EQJA 1JLGA 3L4QA 5BRFA 5E20A 2M45A 2IGOA 4RUGA 3OWTA 1IHVA 4UV8A 1OOTA 1M90C 3GTPJ 1QU3A 2VXZA 5DM7R 3WTTC 2AO9A 2ZPFB 3H5RA 3M1EA 3WEEA 3HSRA 2DTUA 1V5GA 3HK2A 3C1DA 3CCSI 4CEBA 2DL5A 1T0JA 2FB7A 1KG6A 3JSMA 2XDDA 1N27A 1IRZA 2HQHA 4E0DA 4CGDA 2HPIA 3I0TA 1YJWI 3QNNA 2J5PA 1EV7A 4OFHA 2GBZA 5LHHA 2F8SA 2GM4A 1DLOA 2HYGD 3OS5A 3NF7A 5GTHC 1RFQA 1BI3A 3CQZJ 4DUYK 3OA6A 3Q0WA 2PFBA 3D5RC 2ZGWA 4PL6A 5AQGA 3ZMSA 3TQNA 3SZPA 4CZEA 1WKMA 1XTDA 5LMNK 1PP8F 3JB9H 2R5YB 1VQKI 4M7XA 2PAVA 3ISNC 2JVHA 4C0DB 2KIFA 5C15A 1MNMC 4OGEA 3QDRB 4C8QG 3IHOA 4BQAA 2XD0A 5EOYA 2W84A 5I22A 3TTFA 4J19A 3GNFB 4FLUA 4YIIA 3K0LA 4OIOF 2E2QA 4HF1A 2Y4YA 3V9UA 1UA1A 2Y9YA 1SKRA 2CP3A 4ZZLA 1XMKA 3JRHA 1NM1A 3CUQA 5J47A 4PJOE 4H0PA 2ZPIB 4P9FA 4R56A 3TREA 4IIMA 2ZMEC 5I21A 2A42A 2QKMB 2BXZA 2D1VA 3ZX2A 1KSPA 1GXQA 2VGNA 2VKEA 2P5KA 3T9NA 3DCFA 4RW7A 1UMQA 1YJNN 2O7OA 2I7PA 1SL1A 1UGRB 3FC3A 3F8BA 3OYDA 1QQCA 4UUSB 3G71Q 2PNIA 2UV1A 1WXTA 3TSPA 2ELJA 3BG6A 4M74A 2LFBA 1JXMA 4OFAA 3JCMg 3C6TA 2OZMA 3AVIA 3LP0A 3D5SC 4HNVA 1MMDA 3R3LA 1DDNA 4HQMA 5AZIA 4MGRA 4XTVA 1M5Q1 4DQPA 3O1WA 4CERA 2A3LA 2GFUA 2DAQA 4B3TK 3QYEA 4DV4K 1NK4A 3SWNC 2X51A 4YY3K 2R7RA 4A3JJ 1GRIA 1VQ9Q 1QWFA 1YIJA 1VQ4I 5KCOA 1ACIA 2WAEA 2WUSA 5BQTA 2E3IA 3TAPA 5C2DA 1AKHB 1LAWA 1XJWB 3R0AA 1ZTRA 4RTXA 1WNSA 3CCSA 2XGCA 1T7PA 1LNXA 1YJWA 4M3DA 5GAGJ 2Q0OA 4BVPA 3DKXA 1IG8A 2M02A 2W6KA 4RB2C 2Q97A 2XG8D 3AA2A 5KTQA 2ESNA 3V7RA 2E41A 2NOGA 4ELZC 3L2RA 3THXA 1JKHA 3E6MA 4MLEA 2DA3A 2HBLA 5AQMA 1VQKA 3S6WA 2P1JA 3VV0A 1I50J 2DQLA 4RW4A 1U78A 3OIOA 3EL2A 1J3TA 1RCHA 2NOLA 4LDVA 2BGGA 2P9UA 2AQFA 4HSTA 1HBXG 2KK4A 3MN2A 4M9ZA 1IREB 2YNIA 2PFUA 5J2NA 1LEBA 4WFAL 4AHUA 1IXRC 2JMAA 2ZXWH 2EFOA 2HBWA 4CIFA 1CZ9A 2FNAA 1UECA 4Z4EA 1J0RA 5IP7J 5JFRA 2P0PA 3R0JA 2O4XA 1C1BA 1KLMA 5FKLA 3SQ2A 5KYWB 3QWXX 1WGXA 2ESWA 4BROA 4BRLA 5AJ3K 5M3MJ 4YIRX 3BZCA 3VEOA 5GAMe 3WE3A 2KRHA 3QESA 1KAXA 2JMWA 3AGKA 3JCMb 2M0YA 2W25A 1M27C 2DJQA 4CIGA 3NF6A 1VQ6T 2JJ9A 4I09A 1X9WA 3TP3A 2VKNA 2D8JA 5H6QA 4QVCA 3EKUA 4B3RK 4IZ9A 1WI9A 2J6KA 2FMLA 4XU3A 3VU3C 4EVVA 1ZHFA 2QQ8A 2WBNA 1NJIO 4PK4A 1VTNC 1G3WA 5IWAK 2GLOA 1C0FA 2DVJA 3CDHA 2P0KA 4C8KA 1K9MR 2WAQA 1WOQA 3TQ7P 2PMZN 4GMJB 1VQ4A 5D5XB 1CSKA 4HKEA 3A01B 1TUGB 4N76A 5KAFC 4XKCA 4PFOA 4H8KA 2L2OA 3CCLA 5FPMA 4XLAA 2CUJA 4CZIA 1QZZA 5BRHA 4OFEA 2BE9B 3E9FA 4KUDK 1MJ9A 2LJ0A 3H6EA 4FL6A 4YELA 2JHJA 4XLEA 1Z9QA 1NGIA 3I5RA 2HF4A 1S5LC 3ZLJA 2DA7A 3GZNB 3I3LA 1T38A 3KK1A 3PIOL 2LNHB 3EKSA 5BNGA 4B22A 1M1KC 4D5CA 4GW6A 5I3UA 4CJEA 3LPTA 3P9IA 5LLQA 1U45A 3Q7BA 1QCOA 2E2HJ 1WJRA 1ZUKA 2EVRA 3SYZA 2RHXA 3ABUA 3L2QA 4HT9A 2YRDA 3DBRB 2LKXA 2C0IA 4CCMA 2R7OA 4JYAK 4XSZF 3NF9A 1NG7A 3QPLA 1KHCA 2E1MB 3DMJA 4CA0A 3O5BA 3LMMA 4XMYA 4H4KC 3DFGA 2JA6J 1LAVA 2W85A 4RLFA 5GAMj 3N5NX 2EFPA 5M1QA 3SXYA 3CMEQ 3LX7A 5TKWA 5SWMA 1PVSA 2ADUA 3GX4X 2XU8A 4ISFA 3CERA 3VERA 1SKUB 4U7BA 1EH7A 1O3TA 1BUPA 1HXDA 1RGIA 4FZZA 2O01E 2KHMA 5TJJA 4NL3A 2D5VA 4DQIA 1FT9A 2MH9A 2W24A 5I11A 4BQNA 5KQDA 4HW0A 4HF2A 2QM1A 2D0NA 3J80E 3S15J 5CVVA 1ASWA 5LGTA 4EHTA 2CFOA 2YUPA 4BNCA 4E9EA 1J9AA 5JS2A 2QTXA 3EUAA 1MUDA 3S1QJ 2DTRA 4FL9A 3M5AA 2VLAA 3QFPA 1NK6A 4J9GA 2Z1GA 3BE3A 1RTDA 3EN9A 3VWBA 4CHNA 2W03A 3HRMA 3RMDA 3FKJA 3LA7A 5F04A 2R58A 4XK4A 2RI2A 1KK7A 3VYHB 4BR7A 5HRSA 1U2VB 4GV3A 4QWQA 2VQLA 2OFKA 2ZNYA 3RPUD 3NE6A 1O4XA 4F93B 1LFPA 1PU6A 4J9IA 2Q8KA 1P4XA 5C10A 1CGPA 2BVLA 1VQ9I 1YITQ 3IKVA 5FO5A 2CUDA 2GZWA 1N6AA 1PC0A 5GINA 3J81O 2YV0X 2A5WA 2FF3B 3IKMA 4FW2A 1AWJA 4FYXB 4IXCA 4IX7A 3MK6A 1YW8A 2HQEA 3FXOA 5DM6F 2KRSA 2Z1IA 4HCZA 2FEZA 1IXDA 4A5NA 2DXUA 3SJMA 3M8QA 3O8VA 3S32A 1L3VA 1HPMA 4RB1A 3O5ZA 3CVSA 3OH9A 4M77G 2IVNA 3QBWA 2I0NA 4JI5K 1J5OA 1RRQA 1HA8A 3ZSXA 2P9SA 4HUGA 1AU7A 3A4CA 3J7AO 4N4IA 1QBJA 3LSIA 4CJUA 4XLHA 1X1AA 3GEZA 1X01A 4DOZA 1ZG3A 2QSGX 1S6LA 4WQ5A 5ERIA 2P9KA 2LH9A 3JRZA 1UDLA 2PX9A 3TCJA 1G6NA 3ZN1A 3J7YJ 3DB3A 1KRPA 4Q47A 3FFIA 2O9VA 4FLYA 2OZSA 4WXDA 3L2UA 4MDAA 1W2BM 1Y0MA 2HVSA 4LK1F 5KCHA 2YXYA 4NS5A 3AG4H 2RPNA 2LZ6B 1OYXA 2KIUA 1KC8C 4F8RA 3TTDA 1QVGS 2O0YA 1EZZB 2GA2A 5K7FA 5ILSA 1B34A 2P9IA 3GFJA 2JTEA 2K4BA 1I4K1 4HEA2 4LJZF 3NAUA 1KD1O 4IHTA 3G71A 2V7FA 4A2AA 4D7NA 4K25A 2K5LA 4HTLA 1BOBA 4CZJA 2NNWA 1FMWA 4P5OA 2F96A 3OHRA 1UA0A 2EH3A 3GTQJ 5GAHP 3VJPA 1GCQA 1MPGA 5HODA 3R1XA 1H0MA 5DUIA 2CKKA 2DX1A 1VQ9A 3ZYYX 3HSEA 2E71A 4A4FA 1YIOA 2EYZA 3OB9A 2EX3A 3TOBA 4A69C 5JR3A 2YU3A 2E7WA 1VI0A 2BUDA 4ZNXA 1E6HA 1ZUUA 3BPVA 4BWJA 3E3VA 2HMPA 3IMXA 3BR1A 3VTHA 4I2PA 1K9AA 4J9BA 2B8AA 1TW2A 4IVNA 5E3LA 3G73A 1VQ7N 4U0VA 1VQ8N 1KU2A 3H5NA 3ELKA 1P8ZA 3FRNA 3QO3A 2DYBA 2YKMA 2VYTA 3L2VA 4RG2A 4XTZA 1Q82C 1ON1A 2QZ8A 1R0BG 3TARA 5D6YA 1FSHA 3BDUA 3VQ5A 2XB0X 1GLDG 3F9MA 2DU9A 1ETOA 3E97A 1VUBA 4RCCA 1SVOA 3P9KA 4DYCA 1GFDA 2D45A 3I0RA 3EYIA 3PL8A 2FXUA 4JZ3A 1Y1WJ 1KSWA 3ABMH 3QYBA 5DM7F 4M7AG 1ZR4A 1G8XA 1TP4A 4BRGA 1OV3A 2W57A 2HVQA 4FLVA 5KPTA 3CMEI 2P9NA 2M4GA 1ZBIA 2A41A 2RI3A 2H3JA 3CFPA 3DI6A 5LGNA 4WXHA 1FC3A 2VL8A 2PYLA 5EZHA 5AQZA 3I56N 2A6HF 1C0UA 1BC7C 5AQYA 3U2RA 1PU8A 2DOEA 2N8GA 2LNBA 3RDIA 2VWJA 4RS8A 1Q86U 3WE2A 4CZKA 1OCOH 2NRHA 5FDLA 1H9GA 3VYRB 4DEYA 4AIAA 3HZ6A 1G83A 5IOZA 5JLFA 1T44A 1QNTA 1U9NA 1GLCG 3JCMP 4HWIA 2DOAA 1T2KA 1UGQB 2BW3B 4Q4ZF 1B8IB 4CC4B 1UHFA 1QZEA 1HSJA 3HRUA 1S9HA 1QQMA 3OTOK 2G8UA 3MCAB 1AEYA 3EAEA 3CJTB 4W97A 3MP8A 2D4WA 4EMKA 1O3QA 4EA4A 4EFHA 3KP4A 3SEZA 4HNUA 2HWVA 2EPFA 1BI4B 1QVUA 4FOEA 3RIRA 3VEWA 3JRGA 3WU2C 3SHFA 3WXLA 2GQIA 3DJCA 4CGZA 4LSNA 4BC3A 3QKJA 3JSOA 3OYYA 3NTHA 5HK3A 3S3NA 5IYCJ 3W3CA 3ID6A 3VS5A 2RJCA 3H5AA 3QBXA 4ZGDB 3CJAA 3TGNA 1KONA 2ZPEB 3ITHA 2BEOA 2RMOA 2DN0A 2RQUA 1T0FC 4BXXJ 4F7UE 3NFAA 4LDUA 4KYWA 1Z91A 3CMAT 3C6AA 1R23A 3JYTA 2MD0A 2P84A 2MH2A 4XLCA 2H3GX 2L0KA 1HW5A 3NWTA 2F8TA 3PFYA 2XAHA 3H1CA 3SK3A 1KFZA 1VQMQ 2PZ1A 3WTWC 4B9TA 4HV6A 5FWBA 1MKMA 1HSQA 1FEXA 2DTOA 4CH7A 1YRNB 3VA3A 1WI7A 5HOOA 2K5CA 1AHDP 2O9SA 3CCQN 1XS9A 3I58A 5A2QO 4RAYA 2HQXA 2F48A 1X2QA 3KUFA 4JV5K 2XPVA 2XDBA 1TUYA 1DPUA 2UWMA 2QWOA 4EJOA 3CMEA 1U1TA 2DDAA 1YCYA 5CHZA 1UWBA 2VXDA 2I7NA 1OVQA 2DA6A 2ZGZA 2AHJB 1NLVA 5EG2A 2YHTA 3IWFA 2NRWA 2B0LA 2A6AA 5KRSA 4N56A 2JG6A 2K9SA 1WUAA 4C8MA 5GAOl 4BHPA 3WTVC 3KKSA 4IURA 2L3SA 5H2FC 4G12A 2OTLN 1Y39A 1OKJA 1BISA 4JUVA 4MMLA 1Z0XA 3SDGA 2KSSA 4J00A 1MDMA 3HRGA 3L2ZA 1NZ9A 1OI1A 1KCFA 3HBLA 4F14A 3CFOA 5ECAA 4B9QA 2EJRA 2FG0A 4FLXA 2RK1A 4Z2YA 3LALA 4E19A 3QPSA 3HOSA 2HMAA 3ZT4A 1Z9CA 1QHGA 3RRHA 3A8OB 1ETVA 3W2VA 2AKKA 4CC3A 5E3OA 2COZA 1LE8B 3MKYB 4DU1A 2YHAA 2OA4A 2UXXA 3D2EA 2VPLA 1YG2A 2FSNA 4CFAA 1D4XA 2GAUA 3WHCA 1O13A 1JJ2M 4BJTA 1YITA 2HMIA 1HDDC 1MA9B 5BN9A 4JI3K 5LJ5g 2OQGA 1W7PB 1GHCA 1RBTA 3DLLF 1SVMA 3G7ZA 2DVEA 4IOAF 1ZXOA 2HEQA 1G4DA 1TBXA 2ZXIA 3H9NA 5KN9A 1YTUA 4YDUA 3QEIA 1K6OA 5HROA 1VQLN 3VQ8A 4ORZA 2KLOA 3V9SA 4S05A 3AA5X 1YW7A 4NQWA 2UXNA 3G6ET 5F0FA 3VDXA 2L54A 1NNEA 4W5RA 1W0UA 2OX7A 4KT5C 3I55N 4HVWA 1QPMA 4RDUA 1BO5O 3UA7A 4WF9L 1HKCA 1QTMA 4KIFA 2ROTA 3BF1A 4JRQA 3HXLA 1SF9A 4DFMA 2CW0F 4BY6B 4H5WA 3K58A 2DD5A 1XMAA 1LEAA 4PQUA 3M3YJ 2GGRA 4C0FA 4NLBA 1M3QA 3SPZA 1Q7YC 2V9PA 2F2WA 4MO4A 1BJZA 4PJOF 3TW7A 1V76A 5JHUA 3QG1A 4LNPA 4RA2A 1UEBA 2XPWA 4M7DA 2L3QA 1ZUYA 2QWQA 1W7PD 2B63J 5FPEA 1Q86O 4CJ7A 1K4TA 1TW3A 3H0HA 1N8RU 3LL3A 1A6QA 1NHAA 1RDBA 2X6YA 5GAEJ 5TKYA 1R6RA 4LF8K 2X85A 2MD5A 1DTTA 1V5EA 2DL3A 3QOPA 2K40A 3I59B 1RBUA 2VE9A 4DCHA 4O3MA 4CF9A 1SQKA 1WSJA 2GIZA 3HJFA 3BG7A 1VNDA 1VQOT 3F2KA 3LDLA 2XVCA 1IKVA 3BTIA 4XLPF 5DLOA 2OYQA 3GBTA 4IUPA 4EA5A 4E70A 3DXMB 2KDSA 3CC2Q 3JRFA 2UZKA 4KNYA 2CH4A 4CGJA 4DGWB 2BY3A 2V8IA 2CFXA 1I8FA 3K1MA 4FZXC 4ZN1A 2EYYA 4KITB 4LFUA 2VJJA 3V8LA 1QCFA 1L3LA 4M72A 4LSLA 1MBJA 4CF1A 3TAMA 2ACJA 5C3EJ 4A3LJ 4EP4A 3DKWA 4G9ZA 2IJLA 2PZSA 2HYFA 1BOTO 2K4JA 2HHWA 2BYVE 4BL0B 2X6XA 1ZG1A 1AOJA 3QEWA 2VPRA 3LSJA 2QEXT 4FJ8A 4PNOA 1B72A 5IHIA 4H5VA 2OPTA 3FMRA 4AUXA 2LT1A 1WHUA 1JLFA 3L6QA 1LCKA 3X2QH 1M3BA 3EGDB 3KYCB 1LWVA 3QPHA 5D8KB 3N5BB 4I7HA 2FNPA 3GTGJ 2XY5A 2L02A 5M1NA 2GTJA 1VQMI 3R6MA 5A0GA 4XR6A 1S1UA 3M8FA 3I33A 4KHUA 2OV7A 2DO7A 4KTWA 3BTJA 2E70A 1CKAA 2OI3A 3L7WA 4GLMA 1DKGD 1N75A 1ZSZA 1X3NA 4J2EA 2G8HA 1W4SA 4F04B 4JOMA 3PIPF 4EM2A 1GUUA 1XC9A 1XX5A 3ZQGA 3D0SA 3OS0A 1XQHA 2E5KA 2NUPB 3R9PA 3JB9G 3VPRA 2LQWA 3GNGA 3SJHA 4X66K 1KGSA 3CPFA 3BEXA 1QSLA 2Y0SN 3CCMT 3RWUA 4DFJA 1TAUA 2VJIA 4MFDA 2VKHA 2XSDC 4F17A 1WLJA 1XC3A 4F4KA 3R6OA 4AM3A 3C2BA 2HHTA 4CVNE 1RAGB 1SFUA 2K3BA 5KPZA 4OLAA 3NHGA 1XN7A 3C0CA 2NVXJ 5C42A 3VSKA 1SAZA 5KYUB 1GCPA 3WTXC 1LWEA 2DPPB 3E9PA 3IUOA 2L9VA 2FXAA 1T33A 5TISC 1DP3A 4KUMA 4P96A 1N6QA 4DYRA 3ZQ7A 1JTXA 1UAAA 2YUOA 1O7LA 5EDNA 2IIRA 2OTLT 5AZJB 1R77A 3VS7A 3CMAI 4C8NA 4D1QA 1MJAA 2WA0A 4FWKA 5HDNA 2X6NA 3AVNA 3ROUA 1SL0A 2HOEA 5GAMd 5HP1A 1HYOA 3EG0A 3REAB 2NS0A 2OANA 3ZQCA 3K4MA 1OEBA 2EYWA 1RTHA 2KFZA 2VN2A 4BDPA 5FPNA 2JN6A 4JRPA 1OR7A 3VB2A 8ATCB 5FU7C 2MWOA 4XTYA 4L9NA 5F0CA 2BTFA 1NK9A 3IWZA 5DYMA 5J3BA 2ZF5O 2MFZA 4GGGA 3OYGA 3OW2A 3SUOA 3C7JA 4LITA 1WH5A 3TU4K 2FLOA 1VQMA 4ZDPA 1XMQK 4DBHA 1U5TC 4BQOA 4L5GA 2Z3YA 2RV8A 2OAWA 4KN4X 2A0FB 1KXPA 4DZJA 3E6BA 3AO1A 1R1TA 1QLYA 2NRTA 4RWTA 2QTDA 3WEEB 1I6HJ 1O7FA 4AM7A 4IJAA 3JCMJ 3ULEA 3ZX3A 3BGRA 3VETA 2OZ6A 3HC7A 4Z4CA 1ZA2B 1LW0A 2IGIA 3CCRN 1N8RO 5L3GA 2G3RA 3RKWA 1NGGA 3DWLE 5BMZA 4A54A 4C8QA 3V8KA 1C6VX 2CGPA 2JA7J 2QAZA 3IRXA 4IDHA 3Q3SA 4PKGA 5A0DA 1WA7A 4IO8A 2HS5A 1SRLA 2RHZA 3QP6A 2YNHA 4PJMA 2R93J 3HSTB 5AQWA 2M8EA 4CHYA 4WFBL 4Z4HA 1GLJO 1M1FA 2KIMA 3Q1JA 2CWEA 1Q1VA 1Z67A 3DXKB 5C24A 3DPUA 3LAKA 3HFOA 3CO6C 3SYTA 4FSSA 2JW4A 4RTVA 3M0PA 3LANA 2ENMA 3MZHA 4FETA 3S2WA 4MFEA 2ZJ2A 3VA0A 5ICEA 1W5TA 2DM1A 2STWA 1G5VA 4C5IA 3K4JA 5IT3A 4WXCA 1ITGA 3CUQB 1YO5C 3PGGA 4E89A 4KI6A 4NCBA 4FJ7A 2O8FA 3FDRA 4BACA 1FP2A 1U3OA 4MMKA 1TG0A 1SAXA 3ISPA 5GANd 4O0IA 4M78G 2CQQA 3E5QA 4XM3A 4H0YB 3G6EI 3AO2A 2MCNA 4ELVA 4LDXA 1CKBA 4CC7A 3D45A 2RHUA 1KG2A 1S1NA 2JRTA 5I2MA 4I01A 4XTXA 4DTSA 3CQYA 5CYQA 3FSPA 4G6DA 2O8CA 2F2VA 1RDCA 3HTRA 2QXLA 4JX5A 4A3EJ 5AZIB 4LF6K 3SEQA 3U3YA 1PP7U 2ZGYA 1U0JA 4S0HB 2IP2A 4FWOA 1OLTA 4LH4A 5CZ2A 4BR4A 1WSEA 4UY8O 3MWTA 5LJ3d 1QVFP 3MWPA 1TKZA 2LCSA 1IGQA 1N5ZA 1BW5A 3DRSA 1LOTB 2DL4A 4ID5A 5M5WJ 2QQRA 4OOIA 1RT3A 3GUDA 2NOEA 3OSVA 1X1CA 1YJ9N 2HGCA 3CCJN 2HL5C 3LWIA 4D9JA 2OJED 1K8AU 3A8LB 2PBIA 2AXLA 1P6RA 3X25B 5AQNA 4MLHA 1WJEA 2NS8A 4QAGA 3JCMW 4E7HA 1AT1B 3VQBA 2DMTA 1VFCA 2Z1JA 4M3BA 4FLWA 2ETHA 3ZMZA 1I39A 1WQWA 4BE0A 1KAZA 2QTVA 1BI2A 1ZC6A 3THXB 3WGHA 1NK2P 5FD6A 1YX5A 1TWGJ 3AG2H 2QA4Q 5GP9A 2DD4A 3RMCA 3FZHA 3U1DA 1FPQA 5F1JA 4M75E 1RI9A 4E7SA 2P9UB 1HKGA 1I81A 4B9VA 3BF3A 2OF7A 5LL6S 4K8XA 2KYBA 4EHUA 2R5YA 2E2IJ 3QU3A 2ED0A 3EE9A 2O88A 3CC2A 3QZ5B 5HLIA 2AJQA 3RQ4A 2FL7A 2HTSA 3JV3A 4GVEA 2O4XB 4K42A 5GAMf 3FXKA 1UGSB 1SPKA 2YG9A 3PUBA 4FYWB 4O5BA 2DPUA 4BYYA 4IZZA 4QSHA 3LYIA 3OW2P 1TLHB 3FZLA 2EQMA 4LUDA 1BG3A 2YLBA 5E84A 3T1BA 3CPWP 4QS9A 3I4MJ 2I5WA 3MFKA 4AM6A 3DV8A 1T6SA 3WTZA 5GIOA 1IXSB 2NVTJ 4WWCA 1D9DA 2ZJQF 2JUFA 2K3XA 3DBLB 3DPLC 1VQNT 1Q86R 5LGUA 2JSPA 2R4GA 4RTUA 1QP2A 2HDDA 4AI4A 5LBQA 3PX0A 1ZA1B 4EJUA 1XQSC 2Y31A 4C8QF 3EG3A 2D6FA 2KP6A 4F16A 3K1NA 2EHGA 2C0TA 2HVRA 1UHSA 2F1LA 2E5QA 2M30A 1SD5A 3DTIA 1NGHA 4M63C 4M9SA 3K4NA 2E20A 4CJQA 1BJAA 2WONA 1WDXA 3MAQA 3OR2C 4J01A 4AVZA 2VI6A 1H3HA 3QIPA 5HCKA 2V6CA 4F91B 4JQFA 2ZJRF 3M07A 1SFEA 3OYMA 2H3EB 2NRVA 3HOWJ 4YOWA 3VRYA 2Y75A 2O4IA 2W10A 1DGRM 3VQ9A 1IF1A 4LE9A 5FLXK 2X74A 4Z94A 2YRVA 1KG1A 4KHPK 1VQPT 3DEEA 1UJYA 2XKPA 4Y28E 4AQYK 1H8KA 3KLHA 4JDSA 1YJNQ 3CFRA 1N3AA 1NKEA 4ZDOA 5D6WA 1D8JA 1O9SA 2GXGA 2E6MA 1LKXA 3ONQA 3PO5A 3UB5A 3V4GA 3T5XA 5EEAA 4CDGA 1B9FA 3HBTA 4I7FA 2E2PA 4QT7A 2Z1DA 4JBAA 3I9V2 2LJ1A 2FBHA 3M53A 4C92D 5F2RA 5GANf 3BPXA 4BDYA 2Y1JA 4ETSA 2FZCB 4OINF 4BAYA 2YG8A 3HFNA 2IPQX 1U8BA 1Q9YA 2HKXA 7AT1B 1ZR2A 2EGCA 4KH1B 4DTXA 1P4WA 4A6DA 2Q36A 1M2OA 3DPTA 5KYWA 1OCRH 3MKWB 1RRSA 4O5FA 3L9FA 1TKDA 1IKWA 4FVUA 3PO4A 3ZQQA 3T7ZA 3IV5A 4C92C 4X1VA 4AYBN 2HTJA 3VS6A 1QZ5A 4EATA 4OIPF 2ZPGB 1RNHA 3P7NA 4R79A 4IPAA 4OMLA 1JE8A 5FU6B 2KZGA 1ZGWA 1RTIA 2CSQA 4NXMK 4LF7K 4XQFA 5LJ3f 1Y0UA 2J6OA 1N9SA 2HB5A 4KHNA 2CV2A 2ITMA 1NKCA 5BPMA 5C25A 2KL4A 5GJVB 2PMUA 4UNOA 1FP1D 5C0YA 2V52B 3R61A 3MEWA 2OA8A 1K8AO 4WTOB 4JHDB 2RVCA 3VQPA 1G99A 4M77A 1WH7A 2O6GE 4J8FA 4RB3C 4CCJA 1JKOC 4UOBA 1I27A 1Z77A 1X1DA 1VQPQ 2RKHA 3JSPA 3ML6A 4H5RA 4CC2A 3J7AF 4ZYDA 1HYSA 3G4SN 4CZFA 2LDUA 1R1VA 1MD0A 1TGOA 3CCEN 4XH1A 1BA0A 4ZTJA 1KQ9A 3QDFA 1IW7F 4BJ6C 3D1NI 1QVPA 3K5NA 1QZYA 1YJ9T 3FHZA 3LAJA 2QA4I 3T1YK 2P9SB 2DBBA 1L3TA 1WXBA 3ERMA 2JM8A 3J81Z 1SVLA 5D4SA 2CQNA 1A5VA 1F36A 1A36A 1PWTA 3LP2A 5E41A 2QQSA 5FKNA 1XSVA 1MUNA 2P9KB 5CK9A 3HOVJ 2X78A 3Q0UA 3D7EO 4G7OF 4R5PA 4BVOA 3GDQA 1B59A 1XWLA 2CGKA 1TAQA 4X1EA 1KQSM 1QRYA 5DM7L 4IOCF 5D5WB 1X6BA 1CZAN 4IDKA 2QWWA 5AQUA 2F5KA 4MEXF 4D7MA 2P9IB 1TU0B 2JWLA 1RR7A 4YPHA 5C0MA 2XSJC 2QKBA 3SZGA 4A3CJ 4DV6K 3S8PA 2JS2A 4HRIA 4A4KA 2R57A 1Z7UA 1FXXA 2NWMA 1PDNC 1H3ZA 2Y1IA 3HYIA 2BV6A 3AVLA 3MHXA 4A12A 1U06A 3CC7N 2Z9OA 3DEUA 2RO0A 5FFZA 4LIVA 3F9KA 1IGNA 1W1FA 2VBYA 3EHRA 4U0WA 5CVUA 5JVTA 2H1KA 1N8RR 1E4GT 3VF2A 3KBGA 1APLC 1ACMB 3OA9A 2ZM6K 1JKRC 4BR5A 5J8FA 2CUEA 2LY9A 2AK5A 4YEJA 4FM0A 3TSZA 3GXOA 2QLZA 2HYJA 4LOCA 5LJWA 4DW6A 3WUHA 2YS9A 3BZKA 2K85A 1KJWA 4JI8K 2QK0A 2KFDA 2EFIA 2YSRA 1WAJA 4UVCA 4HBLA 3FK7A 5CAIA 1U2VA 4JLIA 1FN7A 2SRCA 3CJCA 4IO9L 3GVAA 2V9VA 4IHWA 3A0BC 3VGKA 4WQ5C 5E1XA 4EW4A 1ZAOA 3H3OB 3V9WA 3ZGKA 1JJ8C 1IB8A 4RKUE 4M7AA 3DRRA 4CICA 3CQXA 5J2MA 2IDOA 3GBQA 3WQUA 3HPGA 3DWLA 4QQGA 2BZ8A 2NRRA 4DSEA 1FIPA 2UUZA 4OGCA 2XB5A 2DFEA 2ECZA 1YAGA 4IHVA 2R7SA 2AS5F 3H6ZA 1DJ7B 4RB0A 3KP2A 4M41A 2QA4A 2EB7A 4B21A 2HBJA 1ZQ1A 4XORA 3HOUJ 1T95A 2A05A 1OCPA 3R4KA 1WXUA 4FPBA 3OMCA 1S1VA 4FM4B 4B24A 4PJJA 1VYTA 2BY0A 4BJ5C 4X65K 1WPYA 4IWVA 4EJYA 4ELUA 4C0GA 2H6CA 5GAN4 3CCSN 2RQVA 1SMYF 1NGNA 4HUEA 2P9NB 4AHRA 3VS3A 2RN7A 3FDYA 3ABTA 1P59A 3CDIA 2HFHA 1QVGA 4UV9A 3C6HA 2YHYA 3REOA 3IS9A 4OLBA 3D4VA 3CCUT 5HRNA 1Y8RB 4PJOB 4IEJA 1IG7A 1GCQC 1TVRA 4OMMA 3F8CA 4JS5A 3WNEA 3OBYA 5K5RA 2E6LA 3KWIA 4CBWA 4DF4A 4IFEA 1BDGA 4MZTA 2LT4A 4O44A 1VQKN 3S1MJ 5IY5H 1STZA 2HNHA 2XGEA 5IP9J 3WTYC 1HNZK 2K57A 2YDLA 4FJMA 3ZPLA 3U1KA 3O6WA 4CGFA 3O3KA 1YTAA 1VIFA 3GMEA 3K10A 4JS4A 1IC8A 1RADB 2E1YA 3L4IA 4BGAA 1MH4A 4BGDA 3TAGA 3I64A 4JJNK 1VSHA 3QWLA 2F4VK 2EQIA 5L8RE 3TOAA 2NUBA 3GP8A 1GVJA 4M77F 1EA3A 3HXMA 3RKQA 2E10A 4JI6K 2VG5A 1KFDA 2CDTA 4ZH4F 1NYGA 4B9XA 1ULYA 2DBMA 2ZE2A 1EH6A 2MIOA 2XHBA 4CCHA 4GV6A 1KU3A 4BC4A 4AI5A 3TR8A 1QO0D 2M7BA 3RCOA 2KQWA 2EWNA 4YTLA 3JCMc 4H03B 3F22A 2OZUA 3DXJF 4S04A 2RJFA 3HVRA 3DOKA 4N4NB 1K9MC 1VQPI 2XIGA 1H1VA 1YHQQ 3LH0A 4QIWN 3CVTA 1GV5A 3L2CA 2KE9A 2WY8Q 1PU7A 2M1BA 3A8YA 4GFBA 2UXBK 2LMDA 4EMHA 4AIKA 1VQ4N 3WGGA 3HOZJ 2COMA 1YJNA 3NAEA 1IUFA 1J6ZA 4UUVA 3HM5A 2AA4A 2ISZA 4MFBA 3GE1A 2LTPA 3P39A 1Q82O 1WHMA 3A5LC 4F2RA 3VF4A 3PTAA 2CP2A 3IQLA 3M8PA 1D0XA 4EMKC 5GAOm 2FSKA 4HCKA 1AD5A 4EMGA 1TH7A 4CEAA 1K78A 3TU5A 4IBNA 3BG3A 2OD5A 4V19S 2Q2EA 4IRHA 3ZT1A 3SAFA 1BQNA 3CM5A 3ZETA 1K4US 4CHUA 3AARA 4LDWA 1S29A 5CKHA 3QU6A 3KCCA 3FK6A 2G9WA 3J7ZO 3BR3A 4UUTA 2O4GA 3A2FA 3FIFA 1RILA 5A2QZ 1I5LA 4C8LA 1R9TJ 3M6GA 4PKIA 3C18A 3I54A 1VK0A 2MGQA 2VKVA 3ECOA 5JLXA 4KJZA 2QGGA 3W6KB 3ASOH 1MV0B 4BRDA 5FGMA 2EFWA 4HV5A 4EJZA 3OIQA 1IBKK 3M0TA 2LF8A 5IXFA 3QJYA 3HHGA 5KVRA 5DD4A 3HM9A 1B8IA 4LFAK 3AT1B 5DUKA 1N36K 5C44J 3BDLA 4B6MA 4OVLA 3RPQA 2DQRA 1VQ8Q 2LG4A 2A5YB 4XEIA 4MLOA 1KEAA 3EH1A 2ROLA 1H92A 1MW7A 3LAMA 3D2EB 3HJEA 4RTWA 3VEXA 3OMGA 4Z4GA 4B9WA 4AHTA 5KRTA 4M7AF 3JAMO 4X62K 2VQFK 1RKTA 3TTCA 1U04A 5KH6A 4BUPA 3DLMA 1WSGA 4XQ3A 4JKGA 4R8HA 3EUHC 1VQPA 4KHWA 1F4KA 4AT1B 3QDKA 1UG0A 3FHFA 3CQTA 2G8KA 2E5ZA 3QNOA 5ICFA 2WY7Q 1AWCA 2DL7A 4NHJA 4BEHA 2CSOA 4UY8I 1V4SA 4CZZA 5FWCA 1B9NA 2KFNA 2BE7D 1IN4A 3VS1A 2VONA 3GZ5A 2H94A 5GAN6 4FK4A 1S7EA 4AIJA 3ENOA 3I56Q 5AONA 4M3EA 1W36D 1YVUA 3ZCMA 3S3OA 3MXJA 2Z0WA 1QHTA 4AILC 4CF0A 4DR2K 4XU2A 2XICA 3U8XA 5ICGA 2DMUA 1OX8A 3LZJA 2OPPA 2GIVA 4IUTA 1SD7A 1YRNA 3SQ1A 1Q18A 4A0ZA 2AZVA 1JL1A 4Q5SF 4DSIA 2X3XD 1Q81U 2VBZA 2R5ZA 2HSEB 3NMUA 2M8GX 4GCVA 1W36C 1NJZA 2FBKA 2VVKA 4DR7K 3ASKA 3DKYA 5CQYA 2CGLA 3IH3A 2KISA 2DMQA 5BREA 1YYVA 1YIJT 3L2WA 3H0DA 2G8FA 4LG0A 3M0QA 2QWLA 1M3CA 4FXDA 1NKBA 5B3SH 2CW7A 1X27A 2MWPA 1Z6RA 2PMZA 3CCST 1ZRFA 1K8AR 4HQEA 3CJRB 1USSA 2MF2A 5KYYA 3ZMUA 2CRGA 2JTFA 1YJWT 2KI7A 4YDUC 4B47A 4QPOA 4OX9K 1SEUA 4U88A 1V1CA 1JT0A 2QI2A 4CJPA 2VASA 5B1AH 3E66A 5D6FA 2ATQA 1ETXA 4MZPA 2JUCA 1TQIA 4PSWA 3ULQB 1HD3A 4M7DD 4PCQA 5DLQE 5HL7L 2FBIA 2LCLA 3EFOB 1MWKA 4FJLA 1N3CA 4YORA 2DILA 3TAFA 1WJFA 2CUZA 3U4LA 1P7JA 1A35A 5GADJ 1R71A 3C2HA 2FOWA 1IBLK 4FE4A 2GELA 1YUWA 2CW8A 4E7JA 2CUBA 5F08A 1MIJA 5L3BA 1ATRA 4R1HA 3ZSOA 1RLQC 1X2KA 3CCQQ 1X6OA 2JNGA 4M7DC 2NRXA 3UR3C 2IBDA 1Y97A 2WC2A 3VOEA 1MZBA 1TK8A 1E0EA 3ZQLA 3SDZA 1GV2A 4ESJA 1YHQI 3RBBB 4OMZA 1LJOA 2VG7A 1I5OB 5EF6A 1HNIA 5FJ8J 3THWB 2GOMA 5CR2A 3FLCO 2BY1A 3TSWA 5CHIA 2CZ6B 3VEZA 1BW6A 1F9NA 2D1HA 4BRHA 1XQOA 1JJ6C 4F2SA 4EJVA 4FWSA 1T6CA 2HXIA 2DXBA 4A2UA 4B9MA 2IS1A 1PUEE 3HPHA 1G3SA 4EGZA 1JLCA 1YE9A 2F5VA 1FTTA 1EX4A 5AIPA 3U3GA 3V9XA 2XIDA 3SHWA 3OYFA 4XKBA 4KH5A 5FLMJ 4UQGA 4JKFA 3DKMA 4G1QA 5M5XJ 1VQ4T 3HPOA 2W04A 4GKKK 3IH7A 1HPZA 2K9NA 3LDSA 3CCLT 3GTJJ 3K2PA 4CJVA 4A5MA 1UUEA 3U9DA 1VYVA 4N47A 2QK9A 2DXIA 4KB0A 1FKOA 2HQRA 4ANJA 2PG4A 1Q1HA 5GPCA 5LJ5d 1S6QA 1SSHA 2OU2A 5LEKA 3ZOBA 5EG0B 2EJ9A 2DL8A 1CXUA 2HVHA 5CQXA 1LUJB 1S72Q 1K73O 4BH9A 5KN8A 3CUOA 2DXCA 1ABOA 2FRHA 4KA4A 3A8GB 3QERA 1MJBA 1VQLQ 4HX7A 1XGOA 2I5UA 2A69F 3GFIA 3DXMA 2W4SA 1QSSA 2O61A 1C1CA 1GBRA 2XO7A 2CP0A 1RZ4A 3VYUB 1GLNA 1WEFA 3OSFA 1Y56A 1JBMA 4GVMA 1ZSGA 1TUCA 5HDGA 3DQVC 5KCMA 3MN6A 2DETA 1ZSZC 1IO2A 3O9TA 2K5FA 2ICWG 3VUZA 4B1XB 2O8XA 3O4WA 5FLXZ 2GUIA 2LSNA 4IOXA 2J7IA 3I71A 3NGPA 2YKNA 3ATVA 2FBTA 3A5OC 4NC6A 3I5SA 2BZTA 4Y52J 1QKWA 5KPRA 4JI1K 4LLGF 2KROA 3ZMTA 1YHQA 2JQ7A 2VBWA 2X4XA 1EWQA 4FK2A 3H0IA 4FWNA 1X4OA 2LYCA 5HS8A 4DTPA 3QO9A 1N39A 2COWA 3L42A 3OQ5A 3B73A 3MZ8A 4FJNA 1S9EA 5FROA 1T0HA 2XDPA 1XB4A 3GLXA 4ATOA 3MEDA 4CEOA 1G3TA 4A93J 1Q81O 4HOBA 3TL4X 2EGAA 2EZKA 2XI9A 1ZREA 3VW4A 3D7SB 3SWNA 1WLPB 1BB9A 2XUBA 4P55A 4KBOA 1UCRA 1G3YA 3JTGA 3JCUC 4ENNA 4C8QB 2EV5A 4DK9A 4BHBA 4FT8A 3IG1A 1LPLA 1MNEA 3FXJA 4CK2A 4GNIA 3WXIA 4AIDA 4ZYEA 1H9TA 3Q5FA 4O5VA 2IEKA 1DT9A 5LY3A 1Z05A 1QVFM 3A1YA 1S1TA 2IGNA 3LL7A 1RI0A 3I0SA 4UB8C 2K9QA 3AGRA 3JRBA 2E1NA 5FLXE 5CIUA 3T8RA 4II1A 4M78A 4I0BA 5DMRA 4FT2A 4JKCA 2MLKA 2ZQBA 4G7HF 1OR7C 4ZGEB 3MEEA 3MP1A 1NEGA 3C4SA 2STTA 3CMEN 1NJIC 1WIEA 1MNDA 2ECBA 3BJ6A 4LB5A 5KYUA 1BKBA 2CS3A 2O8FB 3JXUA 4FT4A 2DIQA 1VQ8A 4JI4K 4B1YB 4DSJA 4ILHA 2GBQA 1R8OB 4V2SA 1D8KA 3KLEA 1LWCA 2IAJA 4FO0A 1U4BA 1XCVA 3QZ9B 4WE1A 1W0HA 2XC7A 3L8BA 3BP8A 2R7ZJ 5AZJA 1EBMA 2NOHA 2HSPA 2K3PA 1HDPA 3FM5A 4AG1C 3JB9F 2DT5A 3ZX0A 3AO3A 3CCQI 2CQKA 4QQDA 4Z4IA 3BTLA 3K9KA 2O8CB 1JLQA 2P4TA 4HHTA 3CCYA 4ON0A 3O9SA 1OPKA 1R49A 3C12A 3NGIA 4OO1