3OYEA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound2
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyeA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyeA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyeA03
4L8RB 3DI6A 3DLEA 2EQKA 4N4GA 4PLLA 4CJSA 3NGYA 4A4GA 4KTWA 1NK5A 4HUFA 3TAEA 1XNIA 1OZ2A 3MP8A 5HP1A 4KAZA 4DQSA 4FJNA 4KI4A 4M3UA 1TAUA 2DAQA 2MWPA 3MEDA 1ZBIA 2RHIA 4FLUA 1BQMA 4DSLA 3KJVA 2GFUA 2RKIA 3NCIA 2EQUA 4Q5WA 3CFRA 3DLBA 4RW9A 2X78A 5EU7A 3META 4FLWA 4EZ6A 5KRSA 4ID1A 4E19A 3SJJA 1VSJA 2D0AA 3QJ6A 1S6PA 2RJEA 1A5VA 1VSHA 4H4OA 4LSNA 4FLYA 4DTPA 4F8RA 4DFKA 1ZBHA 4CEFA 1RNHA 4CIFA 1WJQA 3JYTA 4M42A 1C0UA 1WJSA 3S6WA 4WE1A 4B9MA 3SV4A 3OQ5A 1EKEA 3TAGA 3OYKA 2QQRA 2HB5A 1BI4A 3AVHA 4OPKA 2Q3SA 4DFPA 4OLAA 3TAMA 3M8SA 4JS5A 3MEWA 2GFAA 2FHDA 3C6TA 3ZT0A 2QKKA 2IDOA 4J2EA 2F5KA 2DFEA 3LALA 1SKWA 3LPTA 2Z1JA 3ISNC 5I3UA 4PQUA 1YT3A 4CF2A 3O8VA 3QBYA 3PV8A 1C1BA 1WSGA 2XRIA 3E9GA 2XY8A 4C5HA 3AA4A 3D45A 2XO7A 3VQEA 4FLTA 3QERA 2DFHA 2RJCA 3HP9A 3FFIA 5C25A 2XDPA 4BDPA 1RTIA 3NF9A 4IFVA 3PX4A 4CF1A 5C6SA 3VA0A 2PY5A 1TV6A 4FJ5A 4KHUA 2F8SA 5IAYA 2P1JA 3ME9A 2BE2A 5J39A 4N4HA 4CJ4A 4OPJA 5HRSA 4DTOA 3LWMA 5SWMA 1Q9XA 4AH9A 1SSFA 3AVFA 1G15A 3V1OA 3PO4A 4ELUA 4Z4FA 2EQMA 4CJWA 4KTQA 4RG8A 4CCHA 1TKTA 3D0PA 2P0KA 4AHVA 3OYHA 1UWBA 3L2UA 1HJRA 1CXUA 3MP1A 1U04A 1EXQA 4GMJB 4ID5A 1DTQA 2HNZA 3NGZA 1TKXA 1X9MA 1NOYA 4EP5A 3PO5A 5D3GA 2B5JA 1RBTA 2Z1IA 5D6YA 2VWJA 1NKBA 4NYNA 3LLRA 3IAYA 1HYZA 4AHTA 3O4NA 3E9FA 4CF9A 2GV9A 2G8IA 1KVAA 3U6FA 4F3TA 3NGIA 3OYAA 3FDRA 3TR8A 1K6YA 3EZ5A 3THVA 4FK4A 1YTUA 1KVCA 3SCXA 3NF6A 4UQGA 4FZYA 5KGWA 1JLCA 4C8NA 2M1HA 3LH0A 1VSKA 4F4KA 4FJKA 4DTXA 5FRNA 4OKKA 4AILC 3C95A 1FK9A 1S1WA 4QAGA 4LH5A 4KB1A 3DLRA 3FEOA 3H8ZA 3QEXA 5FDLA 2HHTA 4BDZA 1I3AA 3U3GA 4AHCA 4FZZA 2L3RA 3PFSA 1FKPA 1IG9A 3KD5E 3AVMA 3T1AA 1GOAA 2EKOA 1J54A 2OPRA 4OJRA 1D9FA 2P5OA 1TL3A 4M45A 2JLEA 4B9UA 3UIQA 2HHXA 2KFZA 4F3OA 3K5OA 3AO4A 3L2QA 1U49A 2YHBA 3SQ0A 3QKJA 1U48A 3RRGA 4QOZB 1TKZA 4JRQA 1U47A 3QLHA 1RT5A 1VSEA 5CYQA 4CGIA 1SL1A 3SUOA 3S3NA 2D9TA 4Q0BA 3E01A 3OS1A 4W5RA 3DMJA 2DY4A 3OYBA 1IO2A 4FCYA 1LWFA 1JL1A 2I5JA 3P5JA 3AA5X 1RT2A 5HRRA 4I2PA 4LD0A 4E1MA 4DQQA 4O44A 4KPYA 2FBYA 3SUQA 3HO1A 4O4GA 2HQEA 3NBPA 3K57A 3HP6A 4DTUA 4CHNA 1XHZA 3OYIA 1KSPA 3DLHA 1BHLA 1J53A 3HVTA 3ZSWA 1RT7A 2KFNA 4DSFA 1JLAA 1IH7A 1S9EA 2Y1JA 2E6MA 4B9WA 3DLMA 4N4IA 3RMCA 3V9XA 2HHQA 4ELVA 1YVUA 4M3XA 3NH1A 4W5QA 2HHVA 1WSIA 3AO3A 1JLEA 2X6NA 1C1AA 3IG1A 4AHUA 3ZSZA 2O4GA 4I9LA 2YNIA 3HXMA 3V9UA 3CEYA 4Q5VA 5KE2A 5D6WA 3L3UA 3QEIA 3MEGA 3F9KA 3C4SA 2JZ2A 3NFAA 3EAEA 4OKJA 5KE3A 3NAEA 1XC9A 1WSHA 1NJXA 4FJ9A 3QINA 3DB3A 3NTHA 1NK4A 1NJYA 4I2QA 3NH0A 4RW7A 4DLGA 3H08A 2O4XB 4B9LA 2LVMA 4FVMA 3RMDA 2OZSA 2HNYA 2YNHA 1G5VA 3U3YA 2A1SA 3NF7A 4OGEA 4W5OA 2NUBA 2X74A 4DQRA 4Y1CA 5FRMA 3LGLA 1IKYA 3QETA 1ASWA 1N5YA 5JS1A 2O4IA 2RO0A 1L3VA 3AVIA 2KZZA 4Z4CA 1TK8A 4FU6A 4CK2A 3OYCA 4FYDA 4IUUA 4E1NA 3Q1JA 3VN5A 3OYJA 2YNFA 3IRXA 4C8MA 4CF0A 1BISA 4CESA 2XY5A 1FKOA 2RN2A 5K14A 2KZMA 3LDSA 4R5PA 3NF8A 3LWLA 4FM2A 3O3HA 4E89A 4FW1A 4E3SA 4IDKA 3CG7A 2FBVA 2DIGA 3DOKA 3HSTB 3JSMA 3TABA 1NK6A 4EZ9A 3VA3A 3PMTA 4B9TA 3L2WA 3OYDA 2WONA 3BGRA 4PA1A 2YRVA 5J26A 3K5MA 4QW2A 3MECA 3MO8A 3SV3A 3RMBA 4FJ8A 4BE2A 3KKRA 3HPHA 3TARA 4NS5A 1HNVA 3LP0A 4CEEA 3NHGA 3AVNA 3CFOA 3OJSA 3L8BA 4LD6A 1UA1A 2X6SA 4CJEA 4CJTA 1VSFA 2Z1HA 1XWLA 4LH4A 3L2VA 4CJLA 4ZTJA 1KVBA 4HVJA 4PLIA 3O3GA 2XK0A 1SKRA 4C5IA 3M8QA 1QSYA 2BGGA 3DLKA 1ASUA 2QXFA 4C8LA 3RWUA 3M8PA 3HPOA 3NNQA 5J2MA 3NE6A 2GUIA 2EHGA 3MP6A 3AVJA 3ZT2A 4CK1A 2F8TA 3ASKA 4OVAA 2WACA 4BWMA 4K8XA 2RPIA 4FJGA 5HRPA 3GOXA 1WSJA 1DTTA 1JL2A 1I39A 1WLJA 2E6LA 5CZ1A 4CIGA 2W42A 4RW4A 1CLQA 3NTKA 2L8DA 4CF8A 1RBRA 1NJWA 1L3TA 1VSIA 4YFUA 4G1QA 2D0BA 3B6PA 4NZGA 1VSDA 4A4HA 1RT1A 4IG0A 4CJUA 4CE9A 3TAPA 3DRRA 4H8KA 1RDAA 2NLUA 4RG2A 1BIZA 4KKOA 2B4JA 2BIVA 4UC4A 5CYMA 3VQ8A 4CEQA 4DS4A 4DSEA 3TAQA 2FBTA 3WNEA 4N41A 1B92A 2KQ2A 3HL8A 3K5NA 2D5RA 1HMVA 4DTMA 4HCZA 1TK5A 4E7JA 3T3FA 1RDBA 4CJ5A 4DMNA 3KLHA 5J2QA 3LX7A 3LYIA 4IURA 3I8DA 4DTRA 2RJDA 3I0RA 4N47A 3PX0A 4NCGA 1ZBFA 5D6XA 2VG5A 3VQQA 3OA6A 1RI0A 4F2RA 3EYZA 3MEVA 1ZYQA 3SD4A 4KHNA 1GOCA 4H4MA 3LANA 4FLXA 1HRHA 3V9ZA 4HCBA 4FJ7A 4B9NA 3UWNA 3LP1A 3LPUA 4N76A 5FROA 4E7IA 4DS5A 1EETA 4FL6A 3ASMA 4CHOA 3LZIA 4LSLA 3WNHA 3CQ8A 4N5SA 2ZE2A 4B3OA 4J2AA 1BI4B 1KCFA 4CJRA 3AO5A 4JLHA 3SQ4A 1T8EA 1SKSA 4CFCA 1S1TA 2IG0A 2CKKA 4M3WA 2HVIA 1UA0A 1WAFA 2IAJA 1WGSA 4DF4A 2HW3A 3QESA 3ZSQA 4CFDA 5SZTA 1A5XA 3HPGA 4FM0A 4AHRA 3ZT1A 1F21A 1RDCA 1ITGA 1NJZA 4FJLA 3V4IA 3AVKA 4JS4A 4I7FA 4RW6A 5KRTA 2DTUA 1SL2A 2OYQA 3SZ2A 1U4BA 4Y1DA 4KI6A 1WNSA 1X1PA 1NOZA 3DLGA 4DG1A 4ZTFA 3P8HA 4HCCA 2EQJA 4CGJA 1KRPA 4DSKA 4GY5A 1JXEA 3LAMA 3MXJA 4C8KA 4ICLA 4OGCA 4FLVA 4NCBA 4KREA 3WNFA 4DFJA 4FJJA 3VQBA 2M16A 4B8CA 1WN7A 2P51A 4IBNA 1HQEA 4O55A 4CEOA 2RHUA 3PMIA 4CECA 2HNDA 1RTHA 3KLFA 3SQ1A 3TI0A 4I9QA 1XHXA 2E4LA 3MAQA 4NYFA 4N56A 1GOBA 1BQNA 4CHYA 4CHQA 4IUQA 2E6NA 3AV9A 4CRIA 3AVAA 1H3ZA 1CXQA 4Z0UA 3O4QA 3V1RA 1HPZA 4CHZA 3NH2A 1JXBA 4KHQA 2BANA 1T03A 2RHXA 4MQ3A 3SUNA 3OYFA 1JLQA 4BD3A 4CGHA 3SUPA 3AVGA 3AVCA 2DIQA 4C8OA 3HK2A 4J2DA 4W5TA 4FJIA 1KHCA 3RR8A 1CZ9A 3SPYA 4PY5A 3LZJA 1RDDA 1KLMA 1KTQA 1SUQA 4B9XA 1QS4A 4KHWA 4KTZA 3B6OA 4E7KA 4L59A 2OPPA 5KI6A 1WSEA 2P5GA 1R0AA 2G8HA 4DWIA 4DU1A 1VK0A 4NCAA 4PWDA 3KLEA 4FZXC 3M8RA 1MHNA 2ATQA 3QNOA 3CM5A 4E7LA 1OZ3A 1C0MA 4FK2A 4II1A 3S3OA 2WOMA 4FXDA 4GVMA 1VSMA 3KLGA 1TAQA 3PUFA 3H6ZA 2LRQA 1OI1A 4BE1A 1LAWA 5M9OA 2LSNA 2L89A 3V81A 2M0OA 2A1RA 2FC0A 1KFDA 3OMCA 4KRFA 3RMAA 4X34A 1SV5A 4IUVA 1WAJA 1JKHA 1J5OA 4QCLA 3AO1A 2HQXA 1QE1A 1U45A 3OYNA 4CJVA 3HVRA 1ZBUA 3ZSXA 3SQ2A 3PNWC 1C1CA 1QSLA 4DSJA 1HYVA 4DSIA 4IFYA 1KFSA 2HHSA 1RCHA 1WJRA 3L42A 4CERA 2E5QA 5C42A 5E41A 2OZMA 4OKEA 4O0JA 1TL1A 5I42A 2IGIA 4K8ZA 4B9VA 1S6QA 1W9HA 3L3VA 3ZSYA 3FC3A 3A2FA 3F73A 3MXMA 2OPQA 2YNGA 3TAFA 3ZEHA 1L5UA 3C94A 4BE0A 2OPSA 4CEZA 3OJUA 3QO9A 3K59A 3RTVA 5J1EA 1RBUA 2OA8A 4KHSA 2HHUA 5CZ2A 3VQ4A 2F96A 3WNGA 3LGFA 4PUOA 3SI6A 1D9DA 1QQCA 3I0SA 1HNIA 3QEVA 2RJFA 4HTUA 2HMIA 4IG3A 4FJXA 4M3ZA 1TKDA 2LDMA 3KTQA 2X4XA 3OYLA 1A5WA 1D5AA 1MU2A 1S1VA 1RBVA 5CY4A 3QEPA 2ETJA 1BGXT 1KLNA 1TK0A 2YKNA 2PQWA 3P1GA 4CHPA 2VG6A 1NK0A 5KGXA 3AO2A 1TVRA 1C0TA 2B8AA 1BCOA 3K58A 3SPZA 5KCHA 4DTJA 1EX4A 3FLGA 2RI2A 4E7HA 1RTJA 1LWCA 4DTSA 3V6DA 4CFAA 3T19A 4BWJA 3ZCMA 4Z4HA 1RBSA 1BCMA 2BDPA 4Z4EA 4QQDA 3OS0A 3VQ7A 4FJMA 3L2RA 3VQ6A 3MEEA 1RT4A 3KKSA 3V1QA 1ASVA 2R58A 3AA3A 1NK9A 4ZHRA 1N27A 3LP3A 3RR7A 4W5NA 4CJPA 5HRNA 1RTDA 4C5GA 5IN1A 1T05A 3OYMA 4DTNA 1BL3A 4GW6A 3O3FA 3KLIA 4KB0A 1NKEA 4BACA 1VRTA 2IOCA 4FJHA 5KTQA 4CEAA 5J2PA 1S1XA 3MEAA 1Y97A 4CJKA 3M9QA 4FLZA 3VQAA 4EDUA 4CEDA 4CEBA 4CJFA 2XHBA 4DQIA 4QQGA 2LTOA 3DRSA 1X9SA 1X9WA 2G3RA 2IC3A 3MEUA 5DMRA 3ZT4A 1J9AA 2X4YA 3UT1A 3HYFA 4CGGA 3DB4A 1RILA 4RW8A 4HUEA 2K3XA 4HHTA 2D0CA 3MXIA 3F70A 5C24A 3KIOA 1IKWA 3TWHA 4DFMA 1NK8A 1IKVA 3OYEA 1LW0A 3LAKA 2JGUA 1LAVA 3ALYA 2BKDN 5J2NA 3TANA 2PYJA 1HQUA 4J2BA 4EP4A 5KCOA 3OB9A 1B9FA 3OVNA 4B08A 5HROA 2R57A 3G0ZA 4HUGA 1LV5A 2G8WA 3K2PA 3S9HA 2VYTA 2X35A 2RHYA 1BIUA 3QIPA 4CGFA 3HT3A 2RI5A 3K5LA 4M41A 1VSLA 1REVA 2Z1GA 3HM9A 3RRHA 2G8KA 2QKBA 1FXXA 3QIIA 3CYMA 4M3YA 2BUDA 3KUFA 1JLGA 2ITGA 4LY7A 4OLBA 2HVHA 1UAXA 2VWKA 1L3UA 2KW4A 2DFFA 2O4XA 1VRUA 1IKXA 2MWOA 5DK5A 4DU4A 2XY7A 4KFBA 2QQSA 1LW2A 1QHTA 3EY1A 4FM1A 2Y1IA 5KH6A 2RF2A 5JS2A 4O0IA 3V9SA 2G8UA 2PZSA 2RI3A 2GBZA 3C6UA 1DLOA 1QTMA 1S1UA 3QNNA 3IS9A 3OY9A 2KTQA 4PL6A 1NK7A 2IS3A 2EFIA 1LWEA 4DLEA 1Q8IA 1UOCA 4OVLA 3ULDA 3AVBA 4A4EA 3QIOA 4KO0A 1EP4A 3ZSVA 5T7BA 1XI1A 3P8DA 4E0DA 4IUPA 5HLFA 3NDKA 4BDYA 3CM6A 3DRPA 1D8YA 2XY6A 4Z02A 1T7PA 1QSSA 4DF8A 3HJFA 3KD1E 3ZSOA 4F2SA 3BDPA 3LP2A 5C0MA 2YHAA 4CK3A 3OMGA 4CFBA 1NKCA 4FK0A 1C6VA 1JLBA 1S5JA 1WSFA 3G10A 1RT6A 4CJ3A 4AHSA 3CFPA 2HHWA 4ELTA 2LCCA 2RHZA 1YTAA 2ZQBA 2YKMA 4TSXA 3VQ9A 3VQDA 1OYXA 3VQPA 4JRPA 3V9WA 2FBXA 3QEWA 2R7YA 1Z25A 2YV0X 2GF7A 3AA2A 3KK1A 4IUTA 3AVLA 5HBMA 3KK2A 1L3SA 4KV8A 2K3YA 3DM2A 4CIEA 4A4FA 3S3MA 3PY8A 2EX3A 5CIUA 1ZBLA 1N6QA 4CJQA 1W0HA 4FW2A 2G8VA 4O5BA 4DU3A 2ZD1A 4CGDA 4QVZA 3PX6A 4DQPA 3VQ5A 3SYZA 4M3TA 4Z4GA 3OS2A 1S9GA 1Z26A 3KK3A 3NTIA 3BDLA 2PYLA 2AJQA 2X4WA 4B8AB 2G8FA 4M3RA 1JLFA 1HYSA 4XIUA 4MFBA 3P83D 3VQCA 4YNQA 2QK9A 4B9SA 1Q9YA 2JTFA 3ZT3A 3OYGA 3DOLA 4IKFA 2VG7A 1CZBA 1TGOA 4Z4IA 3DYAA 3SNNA 1SL0A 4C5EA 2R5AA 1RT3A 3ZSRA 4KHYA 2B6AA 3ITHA 2R5MA 1B9DA 1O1WA 4QQ6A
chains in the Genus database with same CATH superfamily
4Z94A 4H0TB 1SQKA 3I53A 1XCBA 2KRHA 3NEUA 3MMYB 4E1JA 2CP3A 3EGXA 1EWRA 4FWOA 1FJLA 2A5XA 1FOYA 3QYBA 5K7FA 4IZ9A 2LQNA 2WSFE 4FE4A 3HBTA 2GBYA 1GBRA 2R5ZB 1GUUA 3M8SA 3F8FA 2OF7A 1IREB 1SKWA 2KRSA 1C1BA 1PUFB 2LT4A 3QERA 2NUZA 4MEXF 3VW4A 3VEYA 3FBIB 1K8AC 1W70A 4IFVA 4M78D 2CT3A 1IUFA 1W97L 3TSWA 1RR7A 1HLVA 3AVFA 1HYOA 4XM3A 5IPAA 4RG8A 4BQZA 3FZHA 3G4SA 2XAQA 5DD8A 4MQVA 4NNJA 4WCEL 1V29B 4M7YA 1JCGA 1X9MA 2DU9A 3EE8A 3J7AY 1FBQA 2ZZDA 1KVAA 2CYZB 2IGKA 3VDXA 1KVCA 3SCXA 5AQQA 1FX7A 4AYBN 2QTXA 1KQ9A 2RKHA 4IIMA 4LH5A 4AIKA 5KN9A 3CDHA 4F52A 4AMCA 4C92D 2LY9A 4M45A 4IVNA 1S7OA 2Y9ZA 3B6AA 1PP8F 3MD2A 1B8IA 3S3NA 2BBYA 3AT1B 3OS1A 4W5RA 4NQWA 4M7AD 3P5JA 3I5SA 2BOLA 2MYSA 1VQNQ 1XHZA 3H3ZA 3FZFA 9ANTA 4OMMA 3ZSWA 1BBZA 3KVGA 2OD5A 1YHQT 1WI3A 4N0AA 2JUGA 2X6NA 2YNIA 3JB9I 4WYBA 2JVGA 5D6WA 3MEGA 1IN6A 2HF4A 5I2MA 3CLOA 1NE8A 4IPAA 4UV9A 2X74A 2QA4Q 2PVOB 3F8BA 2DXIA 1OH6A 3JCMV 3QU3A 4FSXA 2F2VA 4BRLA 1Z6TA 4R5PA 4FW1A 2HDAA 1PYVA 5J26A 1WH7A 2K86A 1K78B 3VODA 1NGJA 3TL4X 2IJLA 2W25A 1ABOA 4CJEA 1G59A 1ODDA 4MTDA 2QWQA 4ZH4F 4G8XA 2LVSA 1NHAA 1P7JA 2NNWA 3ZN0A 4A3IJ 2GELA 2YRDA 3KP3A 4OVAA 1AZGB 4B23A 4JK7A 2DJZA 5BR8K 4C8QE 1ZAOA 4XKWA 3FK7A 5GAOm 2Z5UA 1ENHA 3R0AA 1YIJQ 1HJDA 4C8QB 2E4HA 3HZ6A 3TAQA 3WNEA 2D5RA 1C6VX 4M71A 2ICWG 5BN9A 4NCGA 2O61A 4F7UE 2RM4A 3SFZA 4YIFA 4FJ7A 4B9NA 4KUIA 2EYWA 4MMKA 3SWNC 1HPMA 3IDHA 1T8EA 2FJ1A 2ZPGB 3AG1H 2GWRA 5IP9J 2X6OA 3CJRB 2DEUA 3G1LA 2Z3YA 3WHBA 1TNTA 4Y1DA 3EETA 4DG1A 3LSPA 4RKUE 4NCBA 4KREA 4DFJA 1C0GA 2MFZA 4YIIA 3BTLA 5HLIA 1YJWN 1NJIO 5LHIA 1VQ5N 3ZETB 3RVCA 2LF8A 2BANA 3SUPA 4I98B 4CGHA 2OTJT 2VUBA 3K4JA 2JTMA 4A3JJ 4BRQA 1FSEA 4PY5A 2P7CB 1SUQA 5E1WA 3S2DJ 5F64A 4LG3A 4XLAA 4BI8B 2X9DA 2XF6A 5K7HA 2IEKA 2XI9A 4U88A 2DI3A 4IF4A 2B7EA 4B21A 1BW6A 2WB1A 5LLQA 4IUVA 4CJVA 1WVRA 4JI5K 2LTPA 3ZMDA 4Z2YA 2DKGA 2F4MB 4ISFA 4DK9A 3CCLA 1N34K 2NLXA 2V75A 3H36A 4IL6C 3L3VA 4C8QG 1QPMA 3JAMK 5IT9E 4GLKA 4BE0A 2RVCA 3QO9A 1T98A 5K7ZA 4KT5C 4J9CA 5FLXO 2RJFA 4ZDLA 1TKDA 1XC5A 3P1GA 4CVNE 2QWPA 1C0TA 4JI7K 1RLQC 2OTLN 2F48A 1O3TA 3RR6A 5KYYA 4N4OB 4GW6A 3HOTA 3KLIA 2C0OA 2CS3A 4AFZC 1SPKA 1WJAA 4JK8A 2Q31A 4GGGA 1VQ4Q 2DYSH 4PSWA 2D0CA 2HQ5A 1TUYA 1W2BA 3DEEA 2LDUA 4XLPF 4HUGA 2G8KA 4PGHA 1DP7P 3E6DA 2KW4A 1AWWA 1IN5A 4J8OA 3EGDB 3RPUD 2FBKA 4YOVA 4XLNF 2QENA 2IS3A 2L9RA 3GOIA 4JX5A 3ULDA 4F7UA 4KO0A 4RGXA 3P8DA 4A57A 2L2PA 4AIHA 4J8FA 1UG2A 2PUKB 4CK3A 1K8KB 2IA1A 4B1WB 3JSPA 2K3FA 3I71A 2NOJB 4BI3A 3A01A 3VQ9A 1AWJA 1HJOA 1D0YA 1H8AC 2V26A 3K9TA 4GV3A 2P9KB 1SFXA 2OI3A 2KROA 4CJQA 2G8VA 2BTTA 4B3MK 1NZ9A 3KBGA 3M57A 1B4AA 1K73C 1ON2A 2P5KA 3QP6A 4K2EA 1YW9A 3RUXA 2LK2A 2X0LA 5GMKl 1MPGA 1G99A 1H89C 3DLEA 3MWMA 3N97A 2W10A 1HSQA 2ESWA 1YHQI 1M1KO 4IZZA 4KAZA 1TAUA 2VOOA 5FU7C 1RACB 1WJCA 2PBDA 2PX9A 1IDZA 4FPAA 3META 4B9QA 2BHZA 4E19A 3RSEB 1TP4A 3GIBA 1MBEA 1YCYA 2VIXA 4CEFA 1C0UA 1WJSA 4WE1A 3CCQN 4KBOA 1T56A 1B34A 2V1DA 4JS5A 2GFAA 3WXIA 3U2RA 4FX4A 3A8OB 2XDDA 2CUFA 2JSPA 3BR2A 4M77G 4B1XB 1Y8QB 1FT9A 1GCQA 3A8MB 3HEFA 4U7DA 2YJFA 3UKRA 3TU4K 2FZGB 1SSFA 1RZ4A 3MVPA 3OGDA 4MLOA 2VKHA 2CH5A 1R23A 2DK3A 1UWBA 1SMYF 4XLHA 5HDKA 4FWRA 1HYZA 2G8IA 1AKHB 2JA6J 3VGMA 1LMZA 1ETQA 1BW5A 4DV4K 4L5EA 3VYGA 1V55H 4CXFA 3FEOA 5C10A 4AHCA 1FKPA 1IG9A 2P9NA 4XK4A 1PWTA 3WHCA 3CBPA 4Y33A 2YHBA 2RV8A 4B4CA 1GCPA 1NM7A 2CQQA 4L3QA 1B1BA 2RPNA 4I2PA 1VA7A 2CGHA 1HDDC 4WQ5A 4ZYHA 4N4IA 3PO3J 2HBJA 2M8EA 2COBA 3LDPA 3HSCA 1KU2A 3CEYA 4PL8A 2JPSA 1U9NA 1NPPA 5ICGA 4NOYA 2YG8A 1I50J 3BROA 4QPQA 4BQAA 1W4SA 3ZYYX 4M78B 2H94A 1N8RC 2DO7A 1VQ6I 2DMUA 2OTLQ 3CCVA 1YJWT 3F10A 2HBLA 4CESA 4OIQF 4FM2A 1TWAJ 1O4XA 3JSMA 1BI2A 1R1UA 3MO8A 5BPMA 3RMBA 2JTEA 3TARA 1VYTA 2DRKA 1N32K 1VSFA 3I4PA 1SMTA 2EZHA 1M30A 1QSYA 2D4WA 2XRNA 1YG2A 1BB9A 3I56N 3P31A 3CVTA 4M77C 2QEXA 2KYMA 5D5WB 1LPLA 4FJGA 1WSJA 4EVVA 1WRJA 2HKQB 2HTSA 4F16A 3L9FA 2V1NA 1RDAA 5LRRA 3FHNA 2J5PA 3IL2A 1E4FT 5DM7L 4NLCA 3FZMA 2VB6A 5J2QA 4GCVA 1T44A 4XOTA 4N47A 3CCVI 5D6XA 4XKVA 2M7AA 3MEVA 1TBXA 3UWNA 1M2VB 4F2RA 2GZWA 4YFXF 2ZE2A 3IH7A 2JQ7A 1NGEA 2IG0A 3M4OJ 4BBSJ 1YITI 2HW3A 2O8BB 4BR0A 2DL5A 1A5XA 2A40A 1RDCA 3EG9B 3GX4X 1TUCA 5DLOA 3CCUA 4S0HB 4JI3K 5LGTA 1Z1DA 1SFOJ 3P8HA 4C0FA 3CCMI 3FHGA 1UGSB 1WN7A 3K9JA 2XDVA 1XHXA 3QDFA 2E2OA 2Q0UA 3V1RA 1T03A 3D1NI 2DT7B 4GKKK 4J2DA 1NG2A 3F23A 4PKGA 3LZJA 4B9XA 1MNEA 3NWSA 1VQNI 1B72A 4J6XA 2G8HA 3L00A 4LB5A 4DU1A 3CC4T 3G6EQ 3QNOA 4GVMA 1BN5A 2FPEA 5C2FA 2B86A 4M9SA 3PUFA 4JZ3A 2DPDA 3M3YJ 4LUEA 1P7MA 2DA5A 1SHFA 3O5BA 3AO1A 3HUGB 3THXA 4ENMA 3L42A 3TKYA 4I99C 4CC4B 1FWZA 3O1WA 3URGA 5ICFA 4RM2A 3GMEA 1L5UA 2VT2A 1QWFA 3OJUA 2F2EA 1VQ9Q 2LT1A 5AZIA 3QEVA 2J6FA 4OIRF 1TWGJ 1NBEB 1JT6A 1OX9A 1RUNA 3CW7A 2NXNB 3DTIA 2CUBA 3H41A 3OIOA 2DMQA 5FPDA 1DT9A 1NJIR 2X3WD 2CH4W 3LP3A 4DGWB 3DPUA 4AQYK 1N75A 4EJUA 2FSJA 2ASPA 2HEQA 3WEEB 4B24A 2K79A 5CKEA 2JT4A 2QDYB 5DMRA 2NOFA 2J4RA 5AQOA 1HCRA 2Z99A 2DEQA 1LAVA 3K0LA 1HNZK 3MEXA 5EGOA 1X75C 3JCMJ 3VRYA 2QKBA 3G1OA 1JLGA 2LCLA 1I27A 3H35A 3U9GA 1IBKK 2JRTA 2O3FA 2XF7A 2DA3A 2VE8A 2CQ7A 3TQNA 1K6OA 4AFSC 4IUPA 2QBYB 4Z02A 3CCSI 1TOVA 2RQPA 5CCAA 4R56A 2FEZA 2DD4A 3S8PA 1VQ5T 4ORZA 4ELTA 1BR1A 3VQDA 2PJRB 5IT9Z 2ZCFB 3FWEA 4M7DE 4ZDPA 2YU3A 4U87A 2K3YA 1QZEA 1T6CA 3S3MA 4ILGB 5IYDJ 3SAFA 3PX6A 4IIOA 4TVRA 4D1QA 4B8AB 4ETSA 3CCLI 3TEEA 2E1OA 4HBLA 1QCOA 3HKZN 3CDLA 2O8EB 1RAFB 2KT1A 3CIPA 4XH5A 4N4GA 4KTWA 1OZ2A 4Z89A 2X85A 2VJIA 3K2ZA 2E71A 4BGDA 2RC4A 2KKOA 2X78A 4RW9A 1ZN2A 4EJTA 1KG4A 4M75D 1BR2A 3TSZA 1KC8C 4KICA 3S6WA 2NVTJ 3KZZA 2GXAA 2BXZA 1ZR2A 2FHDA 3ZT0A 5JI6A 3QPHA 1MBFA 2F5KA 4XKCA 3O8VA 2CSIA 4DOWA 1QZ5A 3H1VX 2K3BA 1R1VA 1M1GA 3CCMQ 3LWMA 1X2KA 3FDYA 2KLOA 3BCAA 2M51A 3M1EA 1I5LA 2VQCA 2ESHA 2LX9A 4ZYDA 1U8BA 4LF4K 2KSSA 3MP1A 5J4VA 3PO5A 2Z1IA 3K4NA 1ACMB 1SF9A 2DLPA 3LW5E 3RERA 3O4NA 3CC2T 4M63C 2VBWA 1O3RA 2COYA 5IP6A 3V7RA 3THVA 3ZGKA 5GAMh 4LIUA 4WF2A 2ZSHB 5FRNA 2X51A 5LBQA 3OSVA 3EGDA 3AAFA 3NVMA 3LM9A 3EUAA 5DPKA 2KFZA 2F5TX 4DR3K 3CQYA 1WNLA 1U48A 2LMDA 1SL1A 1IG7A 1TT0A 4M3FA 2OANA 2P7VB 1W7PB 4KPYA 2L01A 4J19A 3O5ZA 3NBPA 3HP6A 2E7XA 1V4RA 4P55A 4QIWN 1H9GA 1P2FA 3I5UA 5C44J 3GTGJ 4DSFA 2IW5A 4M3XA 2O9VA 2XPUA 2I7NA 3I8BA 1F1BB 1LJ9A 1FJGK 5LMNK 1LEBA 2VWBA 2IVPA 4RW7A 2LVMA 6PAXA 2NRVA 3NF7A 4W5OA 4DQRA 2M30A 5LEKA 5FRMA 3LGLA 1ASWA 3UA7A 1ZG1A 4EFHA 4A3MJ 4FU6A 2V1UA 4U0VA 4FYDA 1K0SA 4KULA 3SJHA 1LB2A 3NF8A 3O3HA 4E3SA 4II2A 4YIRX 3TABA 2DL4A 2GWKA 3V7SA 3SV3A 3LDNA 5GMKi 3ATUA 3ZEUB 3BG6A 1BA5A 3ABLH 2E5ZA 4ZTJA 2J7IA 4IJAA 4Y4RA 1Q86O 5IHNA 2AHJB 3E9LA 4PKHA 3CCJQ 4OO1J 2O5RA 5L3BA 2OJ2A 3NE6A 1AOYA 1E17A 1I39A 5E3MA 2IIMA 2FLOA 2RD1A 2F5FA 2AQFA 2CH6A 3ZXSA 3O8MA 4DSEA 2CSQA 5A2QK 1T95A 4EJZA 2E2HJ 2FF3B 1RI0A 3IAM2 2CZ7B 2ME6A 4BROA 4H4MA 4QS7A 3V9ZA 4V2FA 5EEHA 5F0XA 4J9FA 2JSCA 2W84A 4LFUA 1WAFA 4DF4A 5ILVA 4XEIA 2QAZA 3ZSQA 4H0YB 1MDMB 3CWTA 1FYMA 3FM5A 4FJLA 1N3AA 2W04A 4BUGA 4C92G 4I0AA 4KI6A 1BR4A 2KIUA 3M8FA 1M8VA 1KQSM 2DBKA 2XPWA 3MXJA 4ICLA 1XQOA 1ACIA 1ZGAA 1BG3A 2NWMA 8AT1B 4B8CA 1Z9QA 1HNXK 1XN7A 4FL9A 5LD2C 3KLFA 4NYFA 3WU1B 1RKTA 2DW4A 3AV9A 1CXQA 3DP7A 4XRMA 2RHXA 3GNGA 4P9FA 4OMZA 3FMQA 5HK0A 2VXFA 1QVPA 2HVQA 2E5NA 2TDXA 3L0QA 4KTZA 2P5GA 4IO9L 3CMYA 2G0EA 4M7DC 5IHKA 3GBGA 4J00A 4RCCA 5BR9A 4RTVA 4HLYA 3VEPA 2CQXA 2RAEA 2YPRA 3ZOBA 1X69A 3OYNA 3TDZC 3P38A 1HYVA 3I59A 3C2GA 3PIOF 2F2WA 3RKWA 2NRTA 4XL9A 2QWMA 3CCMN 4PDKA 4V2GA 3SHWA 2LY1A 3REOA 5GAMe 2D45A 2JRMA 2LQKA 3AY9A 2HHUA 1RBUA 4M3BA 4XTXA 5EZHA 2X1DA 4DYCA 2WAQA 5GPCA 2HMIA 3JW4A 3C0BA 3OYLA 2K7LA 3SDBA 3I56T 3EG1A 3VS7A 2YUNA 3PGGA 1BCOA 4IXAA 3V6DA 3T19A 4Z4EA 3HIFA 1SEMA 3R6SA 4ZHRA 1EJ9A 1ZLMA 2V7FA 2NRHA 4CEAA 1S1XA 4CJKA 4NC8A 1X6BA 4B1ZA 1BC7C 1W7PD 4QS8A 1X9WA 5LJ3h 1O13A 1RAIB 1RILA 1NG6A 2L54A 5J2NA 2F7TA 1VQNN 1OPCA 5HROA 4CGFA 2XGXA 3SFMA 3HM9A 4QTRA 3ULEB 3CYMA 1UAXA 2LRDA 3CF5F 1N6AA 4KFBA 1ZBXA 5AZJA 1QTMA 1LE8B 1NK7A 3CZ6A 2NVUB 1X2NA 3ZSVA 4EZ6A 2D1VA 4LDWA 2HZTA 5J1UA 3LP2A 5J8CA 4CFBA 1IN8A 1OH7A 4XRSG 2Q1NA 3CFPA 2RHZA 2ELHA 2ZQBA 1PSFA 1KQ8A 4LF8K 3HBLA 1L3SA 4IUTA 1FC3A 1GLDG 4E4HA 5EGOB 2NOEA 2DM1A 5DM7F 4E47A 5J4YA 1B3QA 2EJRA 1K9AA 2R7FA 4EVIA 1RAGB 1S72N 3OYGA 3QODA 4P5OA 2B6AA 1MMAA 1KD1U 4FSVA 4WWCA 1BUPA 2EQKA 1DKGD 2Q0RA 1XNIA 1QQOA 3FX3A 3OHRA 3RYRA 3K1MA 5CVJA 1KC8O 3FBNB 4JD2B 4X6AJ 1KG5A 2RJEA 2KDSA 2DTOA 2FD5A 4C0DC 4AVPA 4IEIA 1QVFA 3OQ5A 2JJ7A 3AVHA 3SDZA 2Q3SA 2X4HA 2UU9K 3IKVA 5GAEP 5GINA 3JRCA 3ENBA 1BA0A 4V19S 4F04B 3NF9A 2QA4T 5J40A 1XMAA 2HEOA 2BE2A 1RESA 4N4HA 3CCRN 5E20A 2XB0X 4HG2A 1D5YA 3I55Q 2P81A 3T1BA 3I56Q 1E6GA 1N8RU 2P0QA 2DYIA 5CVRA 3OYHA 3B02A 3REBB 4BQQA 3PVLA 4ESJA 1TKXA 5D3GA 3LQQA 3C6HA 2M02A 3GTMJ 5AQUA 1BIBA 1UEBA 2JUFA 1VQKN 2ID6A 4K43A 5GAN2 4AWXB 3GLLA 4WQ4C 3LH0A 1M3HA 4F4KA 2ENMA 3T5XA 4OKKA 1EF4A 2CREA 2L3RA 2RQTA 3L2QA 2YR2A 4CGIA 3C6AA 1HF0A 2KZVA 4A3EJ 3QYEA 4M6XA 2O01E 4RAYA 4CCJA 3MFKA 1U06A 4LDVA 4O4GA 3W2AA 3HVTA 4XN3A 5GAN8 1JLAA 2DK8A 3H3OB 1NLOC 4OB1B 1GLLO 2IT0A 3JRIA 2DILA 5B3SH 1NJXA 4BR2A 2E65A 1QHAA 1X6OA 3J7YJ 1VI0A 2YNHA 4LLNA 2PQ8A 1HU0A 2KHOA 2R7ZJ 3OYJA 2LJ3A 3IRXA 3HOUJ 4WK8F 4E89A 4DV6K 2A5WA 2FBVA 3DOKA 2LF7A 1IW7F 5GANh 2A37A 3K5MA 4BY1J 4DR5K 4L9JA 1VQ4I 2CP6A 2JTVA 2Z1HA 2VQGA 4HVJA 2ABKA 4BRHA 2BGGA 4GXOA 4BJTA 2MCNA 4C8LA 3Q3SA 4Y3OA 4K11A 4DBFA 5CVUA 2YDLA 5BRHA 2FZCB 4BQOA 1BL0A 3GTLJ 4K8XA 2HXIA 3FMSA 3VYSB 2YUQA 1WLJA 2W42A 1RBRA 1QA6A 1KQ2A 4F9OA 1X58A 4DZPA 4RG2A 2B4JA 2HFHA 4XSXF 1FPQA 4EV0A 4HX7A 3KLHA 4HVVA 3PM1A 2VGNA 4G6DA 2BW3A 2ETHA 3KEQA 4N76A 1SRLA 4E7IA 1U4BA 4B3OA 4IO8A 2EW3A 1NLPC 1DDNA 5IWAK 1J5YA 5CE3A 3X25B 4FOEA 1Y1VJ 2OYQA 1EQYA 1X2QA 3SZ2A 4MGRA 5M5YJ 5HLGA 4OGCA 1CQTA 3PL8A 4ISGA 1GOBA 3F8MA 8ATCB 1LOTB 4J9IA 5GANe 3OW2A 1P4WA 1JXBA 2DQLA 4BD3A 1G8XA 2CJJA 1VQ5I 2HBPA 1MSEC 4JI8K 2VJ4A 2CP5A 1QS4A 3S6IA 2AHQA 1KQ0A 3DXKB 3M8RA 1MHNA 3UE5A 2JUCA 3F6VA 2O8CA 3CLQA 1ULYA 3LWFA 4BE1A 3H0DA 1X3ZB 1IF1A 2MGQA 2FMYA 2GA1A 1QCNA 3C12A 4GFBA 3SQ2A 1VQ7T 3BF1A 5CKTA 4NBQA 1YJWI 3HRUA 2E64A 5GADP 2FBHA 4JHDA 1RUOA 2UUAK 3MXMA 2Q36A 4BRGA 2R7TA 2VCPA 3C18A 3K59A 5CZ2A 2H56A 2BTFA 4B43A 4PZJA 5F08A 5LJ3e 4M75F 1IGNA 2FPFA 1S1VA 3P9IA 3FE1A 3JAMZ 4RLQA 2FUG2 1K61A 5KGXA 3J7AO 3FLGA 3ZCMA 2ISZA 4OMNA 3GE1A 2R7RA 4FJMA 1GLEG 3JSCA 1RT4A 4C92B 2MLKA 3EGUA 4BXFA 2EQIA 1T05A 3KEOA 1G4DA 4PFZA 2EZKA 3VEXA 4DUZK 2FMLA 1KD1R 1K4US 1Y97A 2UUCK 4EDUA 1F1ZA 1BYMA 3A03A 1J6ZA 1J9IA 4NL3A 1X3NA 3LAKA 3GUDA 1G3TA 3E1SA 5D7UA 2PYJA 1S7AA 5AFUA 1OCRH 1HKTA 2YX4A 4RUGA 2X35A 1UAAA 4M41A 1VIFA 3ASNH 3MHXA 2V8KA 1HK9A 3LSKA 4UB8C 5CO7A 5KYWA 4XLFA 3TMOA 5KVRA 5T7BA 2CV2A 4E0DA 1D8YA 3NDKA 1I1SA 3KD1E 4FYWB 4L5GA 1D3BB 2DVJA 5C0MA 2YHAA 1ZARA 1MDUB 1JKPC 1SFUA 5AZJB 1LWYA 1RT6A 1SD6A 1A6QA 5GAGP 4I01A 3BDUA 4FWQA 3CCUQ 3TP0A 4H0XB 2DA1A 3SBGA 3SFIA 4AFQC 4DU3A 1R71A 3J7YP 1XMKA 2M0CA 2JPBA 3EE9A 3VQ5A 3SYZA 2AJQA 4JZ4A 1U5TA 4CZEA 3FXMA 4HVWA 4DEYA 4E7ZA 1PHTA 1R4NB 5E84A 3DYAA 5AQKA 5FJ8J 2P6TA 4UY8I 3X24B 3NQOA 2FL7A 3D5LA 3AL0C 1FYLA 5DM6F 3EUKL 4FJNA 1POGA 5HP1A 2JA8J 4QVCA 2LLKA 5TRDA 2MWPA 4NL2A 5D4SA 2DTHA 4DSLA 3ZMUA 3KJVA 3JCMd 2EQUA 4BRFA 2D0AA 1A5VA 1NYFA 2GCXA 3OYKA 2QQRA 4DFPA 2ACJA 3RMQA 4M77F 3A2KA 1Q81C 2IDOA 2ITMA 3PV8A 2V1RA 3E9GA 3TEDA 4BDPA 2QWWA 2YLBA 4M3GA 4WQ5C 2M0YA 3KYDB 3LDOA 4FPBA 3RPQA 5SWMA 3F0CA 3GLXA 3EGXB 1K73O 3ULQB 4LC9B 3PO4A 3CMAN 1WX6A 3TO7A 4B1RA 5LMUK 4EJYA 1HUXA 5JLWA 1UHMA 5FU6C 3ABTA 4GO1A 5KPTA 2B5JA 1NKBA 1TUUA 3T8RA 3L4IA 5GAN3 4PJOA 4O5VA 2YHWA 3T0YA 4J9EA 1R5HA 4FO0A 4AF1A 3ECOA 1S1NA 4FWLA 5EJCA 5J8FA 1NKUA 4E9FA 2R0QC 3JCMh 4AFUC 3QKJA 4LE9A 5EXWA 3SUOA 4UVAA 3J80Z 2D9TA 2HBKA 3M55A 4FCYA 5AFUH 5DCFA 4M78A 1JJ2S 4CCMA 2KFNA 1L3TA 1IH7A 2E6MA 4WCGA 2NOBA 5AQLA 1LOJA 2HKNA 4QWQA 3R1XA 3H9GA 3DJCA 2WTUA 2IP2A 3DKYA 3NAEA 4BC4A 4B22A 1NK4A 1K73U 2OZUA 4F7UB 3RMSA 3J7AF 5KCMA 4EM2A 1S72T 4Z4CA 2V1QA 3CCRI 4CF0A 3GTQJ 5K14A 3F6OA 5EDNA 2OTLI 1NLVA 1RETA 1XC3A 1JHFA 2K9SA 3D0SA 4FJ8A 3WGHA 4QW2A 3MECA 3IP4B 4KMUX 2K9GA 1UA1A 3K0SA 5C0YA 2M3AA 3WVEB 2X1CA 1QVFM 2ZB9A 3DLKA 1ASUA 1NMDA 5TISC 3PQJA 3ABMH 2QSGX 4V19K 3CMAQ 2Z2SB 2RPIA 2X6YA 1CLQA 4CI6A 5JVHL 1NJWA 2G9WA 2QDLA 4YFUA 3OOPA 2BHYA 1K79A 1YWPA 3RBBB 4AM6A 2XGEA 2NRRA 2F1LA 1IXCA 4BR7A 3CD6Q 4C2UA 1PNJA 4EIAA 1Z0XA 2NAZA 3VYRB 2FA5A 1IGUA 4FT2A 2VG5A 4AI5A 3K10A 2OTLA 1YI2A 3WG9A 4DS5A 2UUBK 3WNHA 3HUGA 2Y48A 1BI4B 3AO5A 1WHHA 1YQMA 2VXDA 3V42A 1KONA 2Y69H 4IQ4A 3M8EA 4J83A 1XB4A 2DTUA 3KHYA 2H3EB 2YLCA 3FM3A 3FR0A 3S1MJ 1YFHA 4WXDA 4PJLA 3MAQA 3IC7A 2O2OA 1MD0A 2C0IA 2E6NA 1VQON 4OB0B 3I9V2 2NRAC 1S72A 4C2MJ 1CZ9A 3I59B 2ASOA 2BEOA 3WQTA 4LFBK 4JI4K 3E5QA 2CP7A 4H0OA 4BR9A 3KLOA 4OP0A 3CERA 1KFDA 4IHWA 1JCFA 2HPIA 1X2MA 4HSBA 3MWTA 3K4CA 2RNJA 1QSLA 1VQMA 4DSIA 3HSRA 2HHSA 3DAWA 1D1BA 2ZC2A 2PVGB 4A3CJ 4MMLA 4QKUA 3THYA 1QQMA 2OPQA 3TAFA 2QM1A 3OW2S 3VYHB 3FIWA 3RTVA 4B09A 5M3MJ 1YITT 4BI4A 4FWKA 4DR6K 3CD6I 1ITYA 4A5BA 1VQ4N 5E1ZB 1D5AA 1UHFA 1MU2A 1RBVA 4CHPA 3QHSA 4U7BA 1KAXA 3VKIA 5F2RA 2IBDA 1K8KA 4CFAA 4BWJA 4GLMA 4JRIA 1BU6O 2CRGA 3CCMT 4WXCA 2R58A 2ZGWA 1UJYA 3FHFA 2EYYA 1KAZA 4M7DG 3BG9A 2GA2A 1VQ4T 3O80A 3PNVA 4OB2B 1R6RA 1W6XA 2VQFK 4FISA 2P0WA 4CEDA 2CH0A 2W1OA 2LTOA 1J5OA 1J9AA 2D0QB 1XMOK 4PJOD 1S22A 1VQLI 3TGNA 3OBWA 4C8QD 3S9HA 1Q1VA 5EX5A 5FWBA 4FYXB 4S04A 2NRZA 1J2XA 3S14J 2RDPA 1VYVA 1XQSC 2Y1IA 2E36A 1DLOA 3IS9A 2JVVA 2F4VK 3FK6A 4YOTA 1EP4A 4XQFA 4RBOA 2DA6A 2KRFA 3DRPA 2DA9A 3PQKA 1CKAA 3C3WA 3E3VA 2Z16A 4RTTA 4UUVA 2NUTB 2XAUA 1YVNA 6AT1B 2FBXA 2E2QA 3KK1A 2X6WA 2BUPA 1FOXA 1K8AR 5CIUA 4JNEA 1ZBLA 4L9VA 3MKDA 2YSQA 4H0PA 1VQLA 4MZMA 5AQWA 2L3SA 3COAC 3M07A 2ZAEA 1T0JA 4LUDA 3AG4H 4M75B 2DT5A 1R5ID 2KRNA 1CZBA 2MC4A 1YITA 3L2CA 2CYYA 3M7GA 2DL3A 1AZEA 2X1EA 2NYXA 4Y52J 1AKHA 1MMGA 4HUFA 4JKGB 3TAEA 4KI4A 3GBTA 2V79A 5AT1B 1VQLQ 1P8ZA 5I2SA 3I55I 2RQUA 4LF9K 4CDGA 1VSJA 2EV5A 3QJ6A 2H27A 3M53A 4EMSA 4DTPA 4FLYA 1ZBHA 1WJQA 3W6VA 4Y28E 4G7OF 1DUXC 1BOAA 3BW1A 2UXXA 4GBQA 1TZLA 3LPTA 4OAZA 4KYWA 2Z1JA 3NFCA 2XRIA 4U0WA 3LSRA 2I2LA 3AA4A 1MJ9A 1T33A 2DFHA 4BHPA 2HVSA 4B3XA 2XKOC 3LH5A 3OTOK 1VQOQ 3PX4A 3H5NA 3WQUA 1R9TJ 4XAXB 4JI6K 1WXTA 2HKXA 1N8RR 2VBZA 1IV8A 1OISA 1LWWA 1N33K 4WFBL 1Y71A 4LD5A 2VKEA 4CC3A 2WBNA 3A5MC 2XRLA 1WPKA 5L3GA 3I0WA 4X1VA 2DX1A 2P0KA 2W6KA 3KK7A 4AHVA 1JUMA 1CXUA 1LUJB 3MN5A 1T3VA 2VWJA 2DA7A 3LLRA 3E9FA 1O3SA 2DODA 2XVCA 2P6SA 4C8NA 3KP5A 1TTHB 3H92A 5GAEJ 2R7QA 4BDZA 1I3AA 3KFVA 3DWLA 1B9MA 5J3BA 3UA6A 1MUNA 1U47A 3A0IX 1IO2A 4E1MA 3QP5A 1NU0A 1OV3A 3WE3A 1J53A 3JB9G 3RMCA 4NC6A 1QP2A 4B9WA 1WJFA 3CC7Q 2LCSA 3NH1A 2HHVA 1ZTRA 5CQEA 5E26A 4EATA 4EMHA 3QEIA 2STTA 1ZG3A 4FJ9A 2VJ5A 1ZUKA 1AWOA 4C92A 3OSFA 3NH0A 3V7CA 3QETA 1VQ8Q 1ATRA 1TK8A 2A5YB 3Q1JA 5K1YA 2YNFA 1VQMQ 4EIKA 4HT9A 3LWLA 2HTJA 5EEGA 5B5EC 3QQAA 4FVUA 2GLOA 1NK6A 5GAN7 3J7AP 4FIBA 3H3UA 3THWA 1RAHB 3CJBA 2WADA 1WQ2A 3M6GA 2XHCA 2DMTA 2LY2A 4KBMB 4YDUA 5GMKj 4PLIA 3O3GA 2VPLA 3DXMA 1NEBA 1TWHJ 4YOUA 4BEHA 3QWLA 2GUIA 2R92J 3O1BA 1WGXA 1YYVA 2HVRA 2WACA 5KN8A 3CCMA 1P59A 2DTRA 3LSGA 4BJ6C 1JGGA 3KP6A 1JT0A 1JXOA 5GP9A 4CD3A 5DS9A 1VSIA 5KYNA 1MZBA 2YUSA 1BIZA 4DS4A 1X3WB 2L3DA 2YHTA 1PVEA 2KT8A 4EMKA 5FKNA 3JCMP 3INZA 4Y17A 4IURA 2KFDA 1VQNT 5JLXA 4I76A 5E3LA 1T8IA 3FFKB 1BI1A 4FL6A 4JLHA 1W5CC 2EV6A 2HVIA 2AIRB 3M5RA 2SRCA 5LEJA 3VEWA 5SZTA 3HPGA 3VENA 1GVJA 2A3ZA 5LJVA 2FSWA 3OIPA 1KK7A 2L4MA 1HKGA 3U8XA 2VQEK 4Y92A 1HX1A 2WTEA 4RLFA 1OR7A 3GXOA 4UB6C 2WC2A 3W3DA 3JCUC 2D0NA 3BR0A 5AQYA 2Q97A 3IRQA 4N5SA 3UATA 2SEMA 1ZGWA 4DR2K 4MZPA 5B8HA 1I94K 5A0GA 2AK5A 1XQPA 4MFDA 3FJ5A 4W5TA 2EGAA 2QEXN 3EDPA 1VIEA 4A5NA 1KC8R 4L59A 3CCRA 1YE9A 3K4KA 2Q8KA 4MQ9F 2H3GX 1UFMA 2Z0WA 5GTIC 1NG9A 2A1RA 2JMCA 3QG1A 1SV5A 4ZNXA 4M78F 1NJIC 2EA2A 2K85A 2QA4I 3H3NO 4KHPK 1KFSA 1WFXA 1Q81O 1MJBA 5B1BH 1F5TA 2HPMA 3F73A 5DY9A 3GPLA 2GXGA 1D5VA 1IHVA 3CCLQ 2DBMA 3C94A 2HXOA 4JK1X 1AWCA 2MAMA 2JXBA 4YHHK 3SDGA 1XPXA 3OR2C 4PHTX 5CY4A 2A3SA 4M7DA 4AT1B 2I7PA 2UXCK 3AO2A 4DTJA 5GMKe 5DM7R 2FX0A 3L2RA 3RR7A 3WG7H 3QUIA 3J80E 2JA7J 4JPBW 4KB0A 5EEAA 3NARA 3CC4Q 1H641 3A5ZB 3M0RA 2IC3A 3UT1A 4DFMA 1IKVA 4BG9A 1TWCJ 2TCTA 3LFKA 5GAOr 2G6FX 2LP5A 2LX7A 2G8WA 4G94A 2G7UA 3BG5A 3BPXA 1E2XA 4M3YA 2QI2A 3KUFA 4OAYA 2O4XA 1JBMA 1LW2A 2LQWA 2DLLA 2RF2A 3SQNA 3S32A 5KNLA 1UOCA 3EHQA 5FLXK 2JPCA 3VSLA 4RS8A 2QSFX 2MIOA 4A6DA 2EIFA 2L9VA 2XMFA 2O9LA 4A0ZA 1XDSA 4B1YB 4AC0A 3UB5A 2QQAA 1KG1A 4ZYAA 3CTAA 2BZYA 1MNMC 1LNXA 4H5WA 4KV8A 2A6TA 1N6QA 5BOXA 1IBLK 1SANA 4DQPA 3NTIA 5E17F 4KGXB 4IXCA 3V8KA 4RTUA 1NJIU 3MDQA 3I64A 1OLTA 2QK9A 5CQYA 1Q9YA 1TS9A 1UGVA 4JYAK 5GJWB 4LDXA 1L3LA 4IX7A 1YRNB 3EL2A 2ZXHA 5J47A 1HSJA 4CCNA 2HD0A 4PLLA 3NGYA 4M7AE 1CF7B 3HO1A 4KT6A 1VF9A 3L4QA 1RC9A 2V7ZA 1EH6A 1KQJA 2ECZA 5AR0A 4DNCA 1VQ6Q 3KPHA 2O9SA 1VQOA 3WT0A 5M5XJ 3BR3A 2V9VA 1ORPA 2HCKA 5ICCA 3ZMSA 3ZMVA 4PQUA 2KE9A 1M1KC 1U5SA 3S93A 2E2IJ 5JMVA 1QW1A 3X20B 4HV6A 3G0QA 4HF2A 2P1JA 3RYPA 5FD5A 2CP2A 3MN9A 3V1OA 2EIMH 4EEFG 2FPDA 1T0HA 3O6BB 1HJRA 3SBTA 1ZELA 1EXQA 2F5CA 2HNZA 2UXBK 4KH6A 3H0HA 3C65A 4NYNA 2XC7A 1YITQ 2E3HA 3S2WA 4BEHB 5I22A 2H09A 4DBHA 5LL6S 2FVUA 4BY9C 3WTVC 3G4SN 4BAYA 1WWXA 1NBWA 5IT9K 4NLBA 3QEXA 3SZTA 5FW9A 1TL3A 2HHXA 1Q81R 4WX9A 1PSEA 2W03A 2OFIA 2Q2EA 1PD0A 2FBYA 2YS9A 2D8HA 2K57A 2EKHA 3DLHA 1GBQA 3CCSQ 3C2HA 1VQLN 2WC9A 4JLIA 4N4NB 1B07A 4BC2A 2DOEA 4XU3A 3JRFA 5L3CA 1WSHA 4F14A 2B9SA 1UGQB 1B7TA 2FOKA 1ETWA 2ZPEB 5FKOA 1Q86R 2HNYA 1YJNT 4OGEA 1XG7A 3Q7BA 3A98A 1YI2T 2F5VA 2H1LA 1KXPA 4K42A 3GTPJ 1ZRFA 1FKOA 4IHSA 3LDSA 2GTDA 3GZ6A 5CVIA 3ULEA 1M9SA 1N36K 1OKJA 4B9TA 3L2WA 3JB9J 5KHDA 2EZLA 4IEJA 4BE2A 2L7KA 4OMFB 1OVYA 2LOOA 2NRXA 3OJSA 3T1HK 3E97A 3PIPL 2O0YA 1XWLA 2A6AA 4CJLA 3GYHX 1RGIA 3RWUA 4DYRA 3I55N 3N4MA 5J2MA 2HL3A 4A54A 1VQ7A 2OAUA 3ZT2A 5AQHA 1QQJA 3CCJN 4CJ7A 4R55A 1TLHB 2AKKA 5EY4A 4DV0K 5D5VB 1TXQA 4N41A 3HL8A 3A8HB 1AD5A 4HSTA 4KGVB 1RDBA 1OQKA 2VKDA 1YX5A 1ZYQA 3FXOA 3LP1A 3WUHA 3L7WA 5C4JJ 4CHOA 3LZIA 3BTIA 2HSPA 1WGSA 4DV1K 3BUZB 1T3SA 2D0PA 3PO2J 3THXB 4AHRA 3EUHC 3CC4A 2V51B 5C15A 1S3XA 3QFPA 4DCHA 4XTZA 3AVKA 1JQQA 2GQQA 2XGCA 2XSDC 5KRTA 1R58A 2BE5F 1I6HJ 3CO7C 3AL0B 1X1PA 3G6EI 3PNYA 1WEIA 4RM3A 3ZQHA 1KG2A 3QSUA 5HCKA 4BU2A 1Y0MA 1NG7A 2M16A 1GLAG 1VQMN 2JN6A 1RTHA 4BR4A 3M4GA 2E4LA 4A3DJ 2Y90A 2P5LC 1ARKA 1JU5C 2W85A 4LB6B 4LN2A 3GW2A 4KHQA 4ZGJB 1BJZA 3RDIA 1M1KU 5E79C 1FOKA 5GIPA 4OMOA 2IS6A 3JXUA 1WOQA 1C0MA 3KWIA 2HOAA 4A6EA 2WOMA 2OAWA 3KLGA 4LOCA 2LSNA 1CF7A 4RTXA 2FC0A 1FP1D 3WTZA 1JKHA 5FKKA 4BUPA 2C6YA 4KT0E 2QTVA 2QGGA 1ZHFA 3QYFA 3TOAA 1KEAA 3K1NA 1PKSA 4FHTA 5J3LA 5GAHJ 4YFNF 5J1YA 3PVQA 4U0YA 4HQMA 1G3SA 3AG3H 3QFUA 1QQCA 2K5CA 2LDMA 5IY5H 3KTQA 3FHZA 4GY2B 3QEPA 2YKNA 1NK0A 5LHGA 2EJFA 3SPZA 4DTSA 2ZJQL 4Z4HA 1TW3A 1IRZA 1V5FA 4AYBA 4I6MB 3VF2A 3RTRA 5F0CA 4DV2K 4BBRJ 1XJWB 1VRTA 3B6CA 3ZMTA 4BRNA 5KTQA 4H5NA 3MEAA 4FLZA 1YTYA 2XHBA 5EZGA 3DRSA 2EWSA 2G3RA 3ZT4A 2BXYA 3FKJA 3G3ZA 3U9ZA 3P8BB 3KIOA 2W6LA 3JAMO 2V4JC 1HQUA 1QVGS 2R57A 3BQZA 3CCYA 1R5GA 1A31A 3FXLA 2R93J 2RQVA 2ISYA 2ITGA 5KAFC 2RH2A 1IKXA 3HGGA 3HSFA 3I4MJ 2EJ9A 2G8UA 2RI3A 2MOXA 1HXDA 4LG0B 3BG3A 2HAXA 3OY9A 1VQMT 4EMKC 3GFIA 3GNFB 4OB3B 3OOUA 4CCLA 4CYCA 4OVLA 3M5AA 1E3MA 2HMAA 3A4CA 4WQ4A 3HRGA 3ATVA 1S3JA 4LLGF 2CGJA 3R6MA 2OUMA 4C3IJ 3ZSOA 4L5IA 2HSEB 2DE0X 2NOGA 1NKCA 1EV7A 4FK0A 1USSA 3TTFA 1S5JA 2W24A 5GAN6 3ZEUA 3HHHA 5IH2A 2YKMA 2EYZA 1JKQC 4C92E 5HBMA 4WCIA 3DM2A 2F5DA 3KYLA 2EX3A 3PNTA 5TJJA 2GOXB 2JK3A 5ADXA 4E7SA 3BEXA 3DBLB 5GAGJ 2LKXA 1F43A 2RK2A 3OS2A 4KH4A 1WIEA 3BDLA 1BI3A 2X4WA 4RTYA 4XH4A 1GV5A 2M1BA 1SZ2A 2MPXC 1VQ9A 1M2OA 4B9SA 1MBJA 1JUSA 1Q82U 1W1WE 2KRCA 1RNLA 4FTHA 2LJ0A 4RB2C 3OH9A 1D09B 3SLCA 2LNHB 1I3QJ 4A4GA 3J81Z 1ZHIA 3CXCP 4M3UA 2MI6A 4FWSA 4KUDK 5FPNA 2XHIA 5BQTA 5LFAA 3BTCA 3M59A 1SVOA 4M6YA 5KQ8A 1R7JA 3CD6A 5L8RE 1IXDA 1QLYA 1QVGP 4M42A 2CSOA 3CC4N 1VQ7Q 3KZYA 1EFNA 1A5JA 4OLAA 2FG0A 3QYHB 3UF4A 3ISNC 2K9QA 1QKWA 4CZCA 3CMAA 4FX0A 4PJOB 3W6KB 1VQ6N 5IYBJ 2WY7Q 4O6JA 1N5ZA 4M75G 3DTEA 5TGTA 2P4WA 4IHYA 1WZOA 5CK9A 1IN7A 5BPLA 3L2UA 2ESNA 1YS6A 5EOYA 4WFNL 3NGZA 4GV9A 4EP5A 5BRDA 1BIAA 4PJ0C 4M78G 3K2AA 5M1KA 3F2KA 2O8FA 5FU7B 4A3KJ 1M90U 3EZ5A 3QWYA 2ZXWH 2J6OA 4FZYA 1Q82R 2F2XA 3H45C 2M34A 1YJNA 3H8ZA 3MMVA 2K9MA 2DJIA 3G71Q 3VV0A 2P5OA 4LMYA 5AQRA 4ENJA 2M7BA 4RWTA 1VQ7N 4AIAA 1RT2A 2OQRA 4CBUA 1KSPA 3HM5A 4F3QA 3VSKA 3KNTA 2Y1JA 4EJOA 3AG2H 4DR7K 2DVEA 3TREA 4W5QA 1WSIA 1RAAB 3E19A 3MK6A 1LFBA 2ZWHA 3O9UA 3QINA 3DB3A 2KT0A 1M2VA 4W1UA 3TPQA 3LWHA 4DLGA 3IUOA 1W36D 5IHIA 2GNCA 4BYYA 2A1SA 4J9DA 3IKTA 3BY5A 1B9NA 1PM3A 2O4IA 1L3VA 3P9CA 1HKCA 4F55A 4GKJK 2ZXIA 4EPCA 3BGRA 1MMSA 3CMEA 4JN4A 2O31A 4C92F 2CW0F 1Z67A 1Q86C 3R60A 4LH4A 1KU3A 1RL2A 1SKRA 1VOMA 1HKQA 2QXFA 3MX5A 3EG2A 4KFCA 4EGZA 4M7DD 3TSQA 1WH5A 2IA0A 2OTJA 1P6RA 4GNIA 1JL2A 4BRKA 3D2EA 3K69A 3GG4A 2DXBA 1UG0A 4G1QA 2D0BA 1RT1A 1YN8A 2X9HA 4KKOA 2ADUA 3F9MA 3CCJA 2K6DA 2FBTA 3TU5A 4HQEA 3RKYA 1B92A 2KQ2A 3K5NA 1Y8RB 3GF5A 3LSIA 4JI0K 4IHTA 2QZ8A 4II3A 3I35A 3LYIA 3I8DA 1I1GA 3OA6A 1XMXA 4JBAA 2GTOA 1WJBA 4XNFA 3CQ8A 1CZAN 1LVAA 1KCFA 3V8LA 2CKKA 1TSFA 4LF6K 2EAYA 2E1MB 2HDDA 2BZ8A 1HOMA 1WJEA 4BH9A 1WJDA 1HKSA 2OBPA 3CCQT 1ZUYA 5B1AH 4HDVA 1MW7A 2M4GA 4P9UA 4ZTFA 3KETA 1I07A 2VE9A 3VQBA 1K9MR 2PZ1A 1NGHA 2D1HA 4CEOA 2R5YA 4CECA 2VQHA 4I9QA 4QS9A 4CHYA 4KGZB 2TRTA 3O4QA 1W36C 3CCJI 1ZG5A 2EFPA 5I42A 4ESRA 3AVCA 2L3PA 1DGKN 3SYTA 1KHCA 4QSHA 1NPRA 1M3QA 5KI6A 1GXIE 4DWIA 3O4WA 1OZ3A 2ZMEC 4II1A 2HQRA 1VQ6T 1F36A 1BOBA 2VBYA 3F8CA 3V81A 3D5SC 3JRZA 3IV5A 3OMCA 2R4GA 3ONQA 2P0PA 2K5LA 1TQPA 1C0FA 1U45A 2BZXA 1XD7A 5JVGL 2IIRA 5AQGA 5MLCQ 2LSOA 3M9AA 4FWPA 2DJQA 3CJAA 2W00A 3KZIC 2IGIA 1I5ZA 3ZSYA 2XIDA 3ZFJA 3F0ZA 3O08A 4IJNA 5I21A 5EG0A 5GAOq 4JLGA 4Y15A 3LSTA 1S72Q 3NAUA 3CP2A 1JXMA 2Y0MA 2CFOA 4M3ZA 3HOVJ 3R2XC 2PVDB 4F91B 4E9GA 4BGBA 1EZZB 2MD5A 1JHHA 3MJXA 1YXQA 4AUXA 4KHNA 1RTJA 5HY6A 1NGAA 3JS6A 2WWYA 4XK8E 4DJAA 2BDPA 1VQPQ 2DXUA 2IGOA 2E70A 3MEEA 1SVLA 4EQQA 3KZBA 5HRNA 1JKRC 3BPVA 1ZSZB 2K9NA 4FJHA 2Y2ZA 3JRHA 4DQIA 3SWNB 2KYBA 1WDXA 3MEUA 1IBMK 4CGGA 3KLNA 5FPEA 3TWHA 3QO3A 4EM0B 1Z6RA 2CUEA 4C1NK 2IVNA 3CJTB 1O3QA 1BIUA 1VQ8N 2RI5A 1HBXG 4M7AB 2KKZA 4YPHA 3F3XA 1UG1A 3S1NJ 2VWKA 1V1CA 4GDFA 5BRFA 1IZ1A 1ZSZC 2JMAA 4FM4B 1N3CA 1QHTA 4FM1A 5KH6A 2XB5A 1M3AA 1TTYA 1K9MC 4IRGA 3PIPF 4PL6A 2A07F 3C1DA 4JJCA 2HZDA 5D5UB 4JEPA 4FSSA 1RAEB 3G6EN 2HOTA 2PU9B 3BJ6A 1WSFA 2M2EA 4F7UG 1AWXA 3A8YA 3DLLA 2KK4A 3SEQA 3N0UA 1Y57A 4A4FA 4XOPA 4OX9K 3GP8A 1W0HA 4FW2A 2E10A 4O5BA 2HHHK 3KK3A 1DEJA 4A3LJ 5CKHA 1PUFA 1KIKA 4D8KA 3ZT3A 4RTWA 3JCMe 2UYTA 3IQLA 4DZJA 2R5AA 2R5MA 3AHUA 3LM2A 3DI6A 4A53A 2BV6A 3SAGA 3TO6A 2DK5A 1NH3A 4FWMA 2DAQA 4X65K 2JA5J 4HX8A 4RGRA 4IEEA 4DFKA 1U6GA 1KU7A 1KFZA 2VXEA 2KPMA 2HB5A 5L3EA 4IOXA 4M72A 4OMPA 3HOSA 5EG0B 3N05A 3VF4A 2RQRA 4F92B 2HU9A 1PD1A 1CSKA 4FJ5A 2F8SA 3DCFA 3ZN1A 2ID3A 1UTIA 3H9JA 5FKLA 1VQPA 1G15A 1SHGA 2GBQA 4DW6A 2VC8A 3Q0WA 2DA2A 2O8CB 2I8DA 1QNTA 2ASMA 5LJ5d 4EM1A 3HDDA 1VQ9T 4X62K 1A04A 2EB7A 2RK1A 3MKYB 4M7DF 4B3AA 3RZDJ 2M5WA 5D6FA 1HC8A 4A4KA 1K9MO 4CCKA 3K9KA 3SAHA 1LDDA 1WCMJ 1VSKA 1YRNA 1M90R 1YIJT 2BE7D 4AILC 1FK9A 4UNOA 1JJ2P 1GOAA 4B48A 4HCKA 3C2BA 3EFRA 1RT5A 1VSEA 4HRIA 1TC3C 1I8FA 3E01A 1MKMA 5GJVB 1W2BS 2I5JA 4DQQA 4CD1A 3K57A 4CBWA 1IV0A 3G71I 3LSJA 1X01A 1JLEA 4AHUA 3HXMA 1WBBA 4PK4A 4PJOE 3F9KA 4OKJA 1YCSB 2XPVA 2X3XD 4I6MA 1IG8A 5JLHA 1JUPA 3C7NA 5GIOA 3SHFA 5HVQC 1WEGA 3IUCA 4PFPA 4CYDA 1JEGA 1KQSS 4F7ZA 3J81O 4IUUA 4FT4A 3UDCA 1RKWA 1RDUA 2JA2A 5GAOl 3H3VK 2FB7A 2DO3A 2ME0A 1BU1A 4LJZF 1R36A 2NVYJ 4BXUA 5EG2A 4M77A 1XMQK 3G1JA 2RN8A 3L8BA 4B3SK 1FBUA 2FSNA 3OBYA 4I09A 3VWBA 1Z21A 3M8QA 4IOCF 5M1PA 5HDGA 1IRFA 1ZLJA 3RKXA 4YORA 1PRLC 2EHGA 3AVJA 3I0XA 3ASKA 1ZSZA 4UUTA 2P9IA 1T38A 5CZ1A 1GCQC 4XU0A 2MA3A 3FXRA 1UJ0A 1HKBA 2QEXQ 1VSDA 2FRHA 2A3LA 2FE3A 4CE9A 3DLAA 4H8KA 1SD5A 1BC8C 5LJ5j 4YDUC 5HLHA 1HMVA 1S72I 4HCZA 3UKUA 4E7JA 1Z3YA 4CZJA 3WTXC 3UR3C 2IGNA 2DOFA 4BL0B 3AARA 1GOCA 1ORKA 3L2ZA 5FROA 1OCZH 3DU5A 1ZA1B 1VQ8A 1SKSA 2EFWA 3OR1C 4JP0A 3EFOA 3QESA 3CCVQ 4FM0A 3IHUA 4I7FA 4M74A 2XSJC 4YELA 2CT4A 3DPLC 4M77E 3DU6A 3K6GA 4EW4A 4JKBA 4OMYA 2XU8A 3JCMg 4J01A 2MK5A 3FZKA 2MW8A 2GWJA 5ILUA 4N56A 3CPWM 1BQNA 4CHQA 4IUQA 4C9YA 1M1KR 3AVGA 3VS6A 3RR8A 2EVRA 4M3EA 2EGEA 3R0JA 1LNWA 4A59A 2ZXJA 1RIOH 1WSEA 3DV8A 3I58A 3IH2A 1B34B 3GWZA 4C92C 3GL1A 3CM5A 2RNGA 5FLMJ 1WI9A 1PCXA 4FYYB 2XIGA 4FXDA 1KD1C 1TAQA 5IT3A 2V6EA 3MKWB 1FZPB 1YHQQ 1T3LA 3HVRA 1XQHA 1W7AA 3HFNA 4B6MA 5KYXB 3LSHA 2H6CA 4DHYA 1J3TA 4B9VA 4M6VA 3A2FA 4MFEA 1BKBA 1AA7A 4CEZA 3D5RC 1XS9A 5TKWA 4DR1K 3I0SA 4OPAA 1ZH5A 4HTUA 4A3GJ 3EHRA 2LREA 5F1RA 1ZX6A 1IXRC 2EA4A 1U2VB 1HD3A 4CC2A 2K4JA 3A0BC 2B8AA 4HTLA 1RLPC 2FQ3A 4B1VA 1VQOI 5FB2A 2PFBA 2LNBA 1MNDA 3VS1A 5LJ3f 1W0TA 3BT9A 5ICEA 3OYMA 1BL3A 1MUZA 3QB0A 4AM7A 2IXSA 4EJVA 5ADXH 2KP6A 1YQRA 4NDLA 2O8EA 1UMQA 2LMJA 2DF6A 3HYFA 5JR3A 2A41A 3HM8A 3BCBA 2DZ9A 5KCOA 2PBIA 3CJCA 3N5BB 1OH5A 2ATCB 3A0HC 3K5LA 5IXBA 1O7LA 3RRHA 1WI7A 4MHGA 4YOWA 3OWTA 3A5LC 2HVHA 4KH5A 1VRUA 4WTOB 3JCMf 2VYPA 3V9SA 2F9WA 3H0GJ 3M0SA 1S1UA 3HOZJ 4HX4A 3HOXJ 1GRIA 1APLC 3QIOA 4BDYA 1T7PA 2CG4A 3R6OA 4DEXA 4CJ3A 1YTAA 2MMPA 3J7ZI 5HODA 1Z25A 4C8QF 2VASA 1IHWA 1X19A 5ED4A 3HFOA 2W4SA 4RTZA 1J0RA 2QQ9A 1ZLKA 3VUBA 4Z4GA 2H6BA 4EJWA 3G71N 1G2BA 3GZ5A 4Z4IA 3O9QA 1WBDA 3J8AA 2NOZA 2ZPHB 4J6WA 1GT0C 5LJ3d 2QXLA 2XICA 3E0JB 4A5MA 2WSEE 3K7AJ 3W0LA 1ETOA 2KNBB 4M78C 5GAMj 3MEDA 1ZBIA 1M1FA 4FLUA 3TO9A 4RCBA 3BF3A 2GFUA 3NCIA 2I0NA 4Q5WA 3I56I 1GXQA 1SS6A 3PIPA 2P9LA 2ZJ2A 2E60A 2O03A 4LSNA 3WTWC 3LAJA 4F8RA 1RNHA 4CIFA 5F1XA 1DIZA 2RN7A 3MPUB 3CJ9A 2DFEA 3LALA 1YT3A 2XG8D 1MSFC 4DA4A 2O88A 3VUZA 3K4LA 3FFIA 3DFGA 2BY1A 4CF1A 5C6SA 1VQ7I 2O8FB 4KHUA 1UHSA 4ITVA 3CCUN 2I5UA 1U1SA 4B44A 4AH9A 2HF3A 4XTVA 1HW1A 3PJRA 3NHNA 1STZA 1XX5A 1LEAA 4GMJB 1QVFS 1SKUB 5LJ3g 5DD4A 3CDIA 1FOWA 2ZBKA 3NGIA 5FKMA 3I56A 3J81E 5KGWA 3CMET 3MAJA 1ZQ3P 3CC7N 5GAOn 4DTXA 1VTNC 1YAGA 4BHBA 2YRCA 1QPIA 1K0XA 1MH3A 4OFEA 1PVSA 3KD5E 1SRMA 3UIQA 4B9UA 3VU3C 3D2FB 3CD6T 1I5OB 2JW4A 2DY4A 1LWFA 1JL1A 4LD0A 3AA5X 1M90O 3U1DA 3CC7T 2R7OA 2K9LA 2EFNA 3RPUA 1W5TA 4OFAA 5AQJA 4BRIA 2AXLA 3ZQLA 4ZDOA 3V9XA 1OH8A 4E6KG 4HF0A 2CZ0B 2JS2A 1BDGA 4HPQA 1AU7A 3VS5A 3CD6N 3BY7A 3NFAA 2VN2A 5DTDA 2AO9A 3E66A 3JTGA 4B9LA 2K7AA 3EPZA 1J5EK 3HPWA 3E9OA 4Y1CA 4XU1A 4H0EA 1DPRA 1Y6IA 1BISA 5E3NA 4M4ZA 4HWIA 1LVKA 3CPWP 3HSTB 3CCRQ 2R7DA 1FP2A 2XAJA 4EZ9A 1MMDA 3C7NB 1WYXA 3H0FA 5KPRA 2ED0A 3NHGA 3AVNA 1OYYA 4RA2A 3L2VA 3M0UA 1G83A 4ZZDA 3FSPA 1D1CA 1TU0B 4MTEA 4WFAL 3M0QA 3FZLA 3G7ZA 4BREA 4LF7K 1TT5B 4JX4A 1VQPI 4NQWB 1J09A 3U1KA 1RPWA 3N4QA 2A6HF 4O5FA 3LA3A 5AQZA 2FSKA 5A2QE 1NNEA 2A05A 1TK5A 1GFDA 2KGTA 3OYYA 3LMMA 2RJDA 3I0RA 1ZUUA 5F04A 3CI5A 4HCBA 1H88C 3ASMA 5LJ3j 2KISA 4X9CA 5EF6A 4CFCA 2IAJA 4C23A 3ENHA 3VPZA 1NJZA 3C0CA 3GFLA 3E5UA 3IKMA 3QWXX 1OPLA 3CCEA 3DF8A 3PSFA 3MWPA 1X3UA 1NOZA 3EH1A 3VS4A 1OMIA 4JKFA 3VERA 2E20A 3S15J 2P51A 3ASOH 2COZA 3TI0A 1FIPA 3CUQB 4EAHD 2L5QA 4NB4A 2NVQJ 1NGFA 2CMPA 1WA7A 2QTDA 1MMNA 4Z0UA 5L3FA 2KI7A 3NH2A 4XIDA 4MQ3A 3SUNA 1P9QC 2A68F 2OFKA 2K40A 2H1KA 2MF2A 4YFKF 4S05A 4A62A 2L7ZA 1D0ZA 5D6EA 3E6CC 4KHWA 4JX6A 3CUQA 2OTJQ 1VQLT 2M45A 3KLEA 1O57A 2ATQA 3E1YA 4Q4ZF 3S3OA 2AT1B 3A1PA 3OV8A 3M1CA 2CUJA 1XUPO 1E0EA 1QE1A 1C1CA 2LJ1A 4EHTA 4RCHA 4OKEA 4DB3A 4F17A 2UZKA 1U5TB 5DCMA 3JAME 1S6QA 4M77D 3O9RA 2ZPFB 4LG0A 3ZQ7A 1ETKA 4M77B 2OPSA 1DQUA 4XQ3A 5J1EA 1D8JA 3G1MA 1S5LC 2W48A 1HNIA 3CF5L 4DV3K 1IV6A 3P39A 5LRSA 4RB3C 2DMNA 3QXEB 3OS0A 1BWFO 3VQ7A 5KAIC 1NK9A 3WEEA 1W5SA 4PJMA 4W5NA 5AQSA 1MH4A 4I7HA 2IOCA 1OCCH 3VRZA 1TYQB 2E7WA 4KUMA 1AHDP 1X9SA 3CCEN 4ANJA 2UXDK 4GYGA 1IKWA 1U3EM 1MBKA 4ASNA 3TANA 1VQKI 4EP4A 5LGUA 1PRMC 2RHYA 3EUHA 5CR2A 2W7NA 2IGMA 1ZSGA 3T8TA 2KL4A 2RMOA 5DK5A 3CHWA 4DU4A 2MD0A 1HSTA 2MBFA 2HDWA 3SZPA 4A3BJ 3QNNA 1MUDA 5K5RA 1IRGA 2XGDA 5LJWA 2Y0SN 1QHGA 4C1NI 4KH1B 1AOJA 4PL7A 3DXMB 4KA4A 2YCHA 3BDPA 4CC7A 4FQGA 3QPLA 3WXMB 4AHSA 4B8XA 5DYMA 2YT6A 3N5NX 3EG0A 2DT6A 3U4LA 1Z9CA 1N25A 1DU6A 2ZD1A 2PMHA 3IH3A 4M75E 4DOVA 1IRXA 1GHCA 1VQ9N 3VQCA 3CESA 3DOLA 1TGOA 5M3FJ 5FU6B 3F70A 3ZQCA 1WHJA 4BQLA 5AQXA 1XGSA 3RNJA 4XBFA 1QP3A 4OIOF 4NXMK 2M9UA 5EU7A 4XLEA 4FLWA 1E6HA 2BY0A 3CCUI 1QZYA 1B6AA 3JYTA 2E12A 1EKEA 1BI4A 1YX3A 1SC7A 3QOPA 1G6NA 2QKKA 2WA0A 3M54A 2C0TA 3KEYA 3HP9A 2RJCA 5K5QA 2LG4A 3VA0A 1GLBG 1K76A 3HRSA 5IAYA 4XKBA 2E19A 5HNHA 3IFRA 2EV0A 4ESFA 2L7MP 2PG4A 3HL2A 1OEBA 1GLNA 3RESA 3JCMX 3VTIA 2GV9A 2P9PB 4ABZA 3TR8A 1L0OC 3EFOB 1YTUA 1TG0A 1BA1A 3HSEA 2QVOA 3CCSN 2ECBA 2A6EF 2L0KA 4A12A 1J54A 2OPRA 3DEUA 3CJNA 4QOZB 2ZPBB 1U49A 2WBMA 3ZX2A 3RQ4A 2ZF5O 1SVMA 3S2HJ 4H5TA 2NOIA 4B1UB 3MQ0A 2ZGZA 2A28A 2LKPA 1KQ1A 3ZL7C 2NYSA 4OF1A 2JWTA 2V9PA 1R1TA 1BHLA 3ZQIA 1KA8A 1TWFJ 2YSRA 3IWFA 3VOVA 2KDOA 2ELKA 2PJPA 4I9LA 2FBIA 3WGGA 5GAOp 5EVZA 1FMVA 4MDWA 1XOVA 1QVTA 4E2FB 1NJYA 4I2QA 1W2BP 5BS6A 3H08A 4L0YB 1GFCA 1KAYA 2P9SA 2PEXA 2HBMA 1YJWQ 1IUYA 3I4NJ 2ZFWA 1BI0A 3AVIA 2VI6A 3GTJJ 3THKA 3DKXA 2XY5A 2AKLA 3K4BA 3H5AA 1JB0E 3RZOJ 3CG7A 2DIGA 2CFXA 2P9SB 3PMTA 4PIIA 5CKBA 2CGPA 2RE2A 4CEEA 4C0DB 2QASA 3FIFA 3CC4I 2QYZA 4MEYF 4KN7X 3VYTB 3CWAA 4ON0A 4DBQA 5LJ5f 3HXLA 1M3CA 3HPOA 2ZNYA 4JKAA 3MZ8A 4G9ZA 3D4VA 2XDBA 1DTTA 2E6LA 1HNWK 3UPUA 1VUBA 2VVKA 2QKLB 4QLCU 1WHKA 3HG9A 1UDLA 4CEQA 3DXKA 2BY3A 2DNUA 3QZ9B 2QGUA 2DJNA 5DCMB 3WODF 3GZNB 4BRAA 5AIQA 1ZBFA 3VQQA 3DLLF 5BMZA 3SWNA 1KYWA 3JCMc 2R5ZA 1O75A 1GV2A 1S1TA 1SAZA 4OPHA 1S8NA 3QPTA 3ZQQA 2NS7A 5KPZA 4IOCL 3PFYA 3OS5A 3ROUA 2OZ6A 1RI9A 2XKOA 2K5FA 3RCOA 3Q5FA 4D6WA 5CHIA 1WNSA 1D4XA 3ZBDA 1FY7A 4X66K 1U1TA 3JR9A 4CCOA 4FLVA 1YJ9T 1IGQA 4O55A 5AZIB 3SQ1A 3O3KA 3T69A 5HS7A 1Y0NA 1A0NB 4BJ5C 1JXSA 1LFPA 2E2NA 4ELZC 1QO0D 5GAMg 2FXUA 2EPFA 2HQAA 2LZ6B 4IOAF 2DIQA 4HXJA 1EBMA 1U9OA 4FJIA 3HJEA 3DKMA 1OFCX 2K02A 1RDDA 4E6RA 3B6OA 4E7KA 2EINH 4LDYA 4M73A 3CP8A 2PUOB 5AQMA 2JNGA 2PJRA 1WSUA 2XROA 1VSMA 2ECCA 1KYZA 3DWLE 3R3LA 4X0GA 5BPIA 4X34A 4E9HA 4JYKA 5GMKh 1VQ8T 4K41A 3ELKA 1LKXA 1UB4A 2HQHA 4K8ZA 2AZSA 5KYWB 4W97A 3CQZJ 2ZMEA 1IXSB 2J06A 2LBFA 2L3QA 2WAFA 1GVDA 1FW6A 4PKIA 1D8KA 3VOEA 1XNQK 1YQKA 5J6XA 2EIKH 2HYJA 2VC1A 2X4XA 1A5WA 3P4IA 2NUTA 2ETJA 1KLNA 2VG6A 4HEA2 1ETYA 2ZPIB 5KCHA 3F5TA 1KSWA 3GTOJ 3GFMA 4XORA 2QLZA 2DERA 4PJOF 4LD9K 3V1QA 1N9SA 3AA3A 1RTDA 2AA4A 1IO6A 3H1CA 1RADB 3O3FA 5CAIA 2KDZA 5JVGF 3CCJT 3RQIA 3E2UA 4Q5SF 3M8JA 3OMYA 1XDUA 3WXLA 3DB4A 4UOBA 3ABUA 4KRTA 1YI2I 2ZFUA 3CPFA 1MV0B 4J2BA 1U2WA 3DBRB 4ZGDB 2AS5F 4GYIA 2J05A 1YIJN 2DFFA 3ERED 4X64K 2QQSA 3EY1A 5GPAA 1P4AA 1PKTA 1HLUA 3A8LB 5DM6L 1XI1A 1WEFA 1ZBJA 4IRIA 4DF8A 1QSSA 2KJCA 1X1AA 4CZGA 1ZK8A 4CHUA 3CXCM 2DETA 1MGTA 4LK1F 2VQLA 1C6VA 5GANg 3QOEA 1X6GA 3E9PA 4GV6A 2HHWA 3F22A 5IT9O 3V9WA 1WPYA 3M0TA 5GAN4 2YV0X 5AN4A 3KK2A 1W7PA 2JOYA 1DJ7B 1I0CA 4ELYC 4DV7K 5FFXA 3CMAI 2A0FB 4M3RA 5ELZA 4XIUA 3T9NA 5BPDA 5FLVA 2BZTA 5FD6A 3SNNA 3CWSA 4EHUA 2OQGA 1ZR4A 1UUEA 3ITHA 3GEZA 1ONVA 1B9DA 2P4RA 2Q0OA 4HNTA 4B47A 1BM9A 4MZTA 2KVQG 2P84A 1UJ8A 1BQMA 2YG9A 4RAFA 1X1CA 2K5IA 3T7ZA 5KRSA 2BYVE 3QJYA 1YF5L 1R0CB 1YIJI 5E3OA 2E1YA 2LFBA 2OPTA 1M5Q1 4FT8A 4OPKA 1ZQ1A 1B72B 4KIGA 4J2EA 4J7IA 3QBYA 3VEVA 4C5HA 3L09A 1Q82C 3J80O 2L7FP 2EBPA 2KMUA 2VODA 5J39A 4OPJA 3SEZA 2BGCA 2R3SA 3CETA 4DQ8A 1Q9XA 2YHXA 4ISEA 4ELUA 2W41A 4Z4FA 4CCHA 1LDJA 2GQVA 1QHHD 1XNRK 3CCVT 1YJWA 1DTQA 1NOYA 5H2FC 3VTHA 3EG3A 3U6FA 3FDRA 2BW3B 1K6YA