3OYEA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound2
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyeA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyeA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyeA03
1FKPA 3VQPA 4CEEA 3JYTA 1T03A 4RW6A 1TK5A 3LZJA 4CIFA 2VG5A 2B8AA 4YFUA 1SSFA 3SPYA 4C8KA 4KI4A 4I9LA 4O44A 2JTFA 3LX7A 1I39A 4W5QA 4DS4A 4E7LA 3L42A 4NYFA 1WNSA 4DLGA 3SQ4A 4Z4EA 4HCZA 1ZBHA 3O4NA 4Z4CA 4KB0A 1OYXA 1BQNA 3D45A 1H3ZA 1JLAA 3V9UA 1KRPA 1XHXA 3NF8A 4FZYA 2OPSA 3LYIA 4DSFA 2FHDA 2MWOA 3AVAA 4LSNA 2JLEA 4CEFA 2QKBA 2IAJA 2HHXA 2OPRA 2VG7A 3NCIA 5HLFA 3AA4A 4Z4FA 2M0OA 2DFHA 4IUQA 4M41A 4HTUA 3DLMA 3HPGA 4ELTA 2DIQA 3VQ8A 2KFNA 1TAUA 2X4YA 3U3YA 1UOCA 3VQ5A 2G8VA 4DSEA 1UA0A 4Z4HA 1MHNA 2DFEA 3LAMA 3O3HA 3DB3A 1KVAA 1U45A 1FK9A 1TGOA 2A1RA 3L2WA 3MAQA 3DLKA 2RHZA 4CK1A 1RDDA 3MECA 2RKIA 3VQDA 4A4FA 2IGIA 5SZTA 4CFAA 3RMAA 3LP2A 3SUOA 1UA1A 4CHQA 2AJQA 1RCHA 3QEVA 3VQBA 2RO0A 1DTQA 2HNDA 1U47A 3ZSQA 4EP4A 1X9SA 1GOAA 3DB4A 2Z1JA 2LVMA 1QHTA 3L8BA 4HCBA 1LAWA 3IRXA 3DRSA 2K3YA 4Z02A 2I5JA 1J5OA 4CE9A 1MU2A 1D8YA 1VSIA 4M3XA 3VN5A 2E6NA 4C5IA 4ID5A 1HNVA 2GV9A 4BE2A 4DTXA 1XHZA 4M3YA 4E7HA 4Y1DA 3OYFA 2IS3A 3AVFA 2PY5A 4BDPA 4OLBA 1HNIA 3ZT0A 1ZBFA 3ZT1A 2YNFA 3PMIA 2RHUA 3PMTA 1CXUA 1S6PA 1S9GA 4Z0UA 3OS2A 2YNGA 4E7KA 1RT7A 1Y97A 2BE2A 3P83D 3CFRA 3ASKA 5C25A 4LD0A 3LAKA 2G8IA 2IC3A 1NOZA 4GMJB 3SUNA 1SL1A 1JLFA 5J2NA 2PYLA 2HHQA 1QSLA 5CIUA 1WSGA 1HYSA 1N27A 2HVHA 4B9VA 3ZT2A 2O4GA 3L2UA 3G0ZA 1XWLA 2FBTA 4E7IA 3AO4A 4RG2A 1TL3A 4BD3A 3OYIA 3MP1A 4MQ3A 3E9FA 3K5OA 2NLUA 3VQ7A 4OGCA 3TAEA 3DLRA 2OYQA 4G1QA 3WNFA 3VQ6A 4ELVA 2EHGA 3O3FA 3DMJA 4OKEA 4FM1A 4BACA 2P51A 3ZSVA 1JL2A 1NJYA 2KW4A 1I3AA 4AHVA 3HM9A 2D5RA 4DTJA 4PQUA 2IDOA 2HNYA 1RBVA 5CZ2A 1WAFA 4CJLA 1C1AA 1IKYA 4HVJA 4DLEA 2O4XB 2CKKA 1G5VA 1S9EA 3KKSA 3QBYA 3ZSYA 5J1EA 4DQSA 1FKOA 1TVRA 2E5QA 3EZ5A 2R5AA 2RN2A 3B6OA 1KVBA 5J39A 3DLEA 5I42A 2YHAA 4HUGA 1BQMA 3F9KA 2BUDA 4EP5A 1X1PA 4CGDA 4B3OA 3UT1A 1S1WA 4DTOA 5JS2A 3BDLA 3LGFA 3KKRA 4DU4A 3AO1A 3ZT4A 3HPHA 4CFDA 4FK2A 1NOYA 2HHSA 3MXJA 4QQDA 1XNIA 1WSFA 2X6SA 4DF4A 3SV4A 3HJFA 5HRRA 2FBYA 3F70A 5KCHA 3K2PA 4FLUA 2PYJA 1KTQA 3TANA 4K8XA 3L2RA 5FDLA 4F2RA 4CEQA 1UAXA 4CJTA 3NF7A 3L2VA 4JLHA 3NH0A 4I9QA 4PY5A 2DTUA 4FM0A 4RW9A 1TK8A 3IG1A 4M3RA 4HHTA 2PQWA 3SUPA 1T7PA 4B8CA 1C1CA 1A5XA 4O5BA 4Q0BA 3U3GA 4IUPA 2ITGA 3VQAA 3TAGA 1RT2A 1Q8IA 1YTAA 4H4OA 1Q9XA 4OKJA 3QNNA 1J53A 3BGRA 5SWMA 4KTWA 3CFPA 1DLOA 4PA1A 2X4XA 4DU3A 3RWUA 3NGIA 4QVZA 3DLHA 4CHNA 1BIUA 2DFFA 1S1VA 1NJXA 4F4KA 3NNQA 1BIZA 1LW2A 5HRPA 3M8RA 1ZBIA 2B5JA 3T3FA 1RT5A 1JLBA 1WAJA 4JS5A 5J2QA 2G8UA 1S5JA 4O55A 3S3OA 3QEXA 1C1BA 3ZCMA 4GVMA 4BE1A 1L3TA 3RR8A 2P5GA 2GF7A 4KHUA 3HK2A 4C5GA 1TKXA 1KVCA 3VQ4A 4CIEA 3SYZA 2O4IA 3OYMA 2EX3A 3M9QA 3C6TA 3H8ZA 1B9DA 3VQEA 3KK3A 1OI1A 1S1UA 3OJUA 2XY5A 4M3ZA 1IH7A 1TAQA 3L3UA 3K5LA 1NKBA 1YTUA 2D0BA 2HMIA 3V4IA 2LSNA 4RG8A 4DTNA 2QK9A 2EQUA 1OZ3A 4FW1A 3P1GA 4OGEA 2BKDN 1QSSA 2HB5A 5C0MA 4IUTA 1WSEA 3ZSRA 4I7FA 4B9SA 2WONA 5T7BA 3DRPA 4CF1A 3DOLA 4IKFA 3EYZA 3SPZA 3H6ZA 1XC9A 1RNHA 3NF6A 3ULDA 5C42A 4WE1A 4W5RA 4FJ7A 4KB1A 4CJQA 2YHBA 2Z1IA 1SUQA 1QSYA 1SKRA 2D0AA 2RI5A 3DM2A 4N4GA 3ZSZA 1JLQA 1HRHA 3C6UA 1SKWA 4KHQA 1BGXT 4RW7A 3HYFA 1C0MA 3QIPA 4AHRA 2L89A 1NK8A 4IG0A 3RR7A 1RT3A 1HYVA 2HHWA 1WJQA 4W5NA 3CEYA 4E1NA 3SNNA 3MEVA 3LLRA 3AO5A 1N5YA 1IG9A 1W9HA 4E0DA 5J2MA 1RTIA 1QQCA 4DFPA 4FLZA 3QIOA 1BHLA 1S1TA 3SV3A 4DTUA 2Y1JA 4AHCA 3U6FA 2RJFA 3ZSOA 4LD6A 4C8OA 1B9FA 1TL1A 2YNHA 5HRSA 3RMCA 4ELUA 1NKEA 5KTQA 3OYBA 4F8RA 2L3RA 3SQ2A 2O4XA 1LAVA 3AVBA 4TSXA 1SKSA 3TAMA 3S6WA 5HROA 2QQRA 3AA2A 4CF2A 4C8LA 3M8SA 4M45A 4H8KA 3SQ1A 3NTIA 2JZ2A 1CXQA 5K14A 4YNQA 4DF8A 3AVCA 3LWLA 3EY1A 4CGGA 4BDZA 4Z4IA 1NK0A 3DLBA 1EETA 4OVLA 4RW4A 2E6LA 4DS5A 4FJMA 1NK9A 1CZ9A 3S3MA 3V9SA 2OZSA 4AHSA 2YKMA 4CHZA 4FLXA 1CZBA 3V1RA 3TAPA 4XIUA 2X4WA 3VQ9A 3THVA 4GY5A 1RTJA 1X9WA 1ASVA 1BCOA 4E7JA 1DTTA 5C24A 3WNEA 4CF8A 4O0IA 3K58A 3FLGA 2RHYA 3V9XA 3WNGA 2OZMA 3OYEA 4N47A 3OMGA 3KLEA 1JL1A 3CFOA 4FLTA 3MEGA 2HHTA 3OS0A 5FRNA 1SV5A 3NF9A 4N76A 3B6PA 1EXQA 2RF2A 3AVIA 3LANA 5CZ1A 5EU7A 3I0SA 1CLQA 5HRNA 3AA3A 3S9HA 1TV6A 4DTPA 3RMDA 1NJWA 4LH5A 3TAFA 4A4EA 4BE0A 4C8NA 4B9UA 4KHNA 2KZZA 3GOXA 4DWIA 3AVHA 1WLJA 3L3VA 3LALA 2XY7A 4J2DA 2DY4A 2RI2A 2EQJA 1S6QA 2VG6A 3MXMA 4FJNA 2X6NA 3QKJA 1EKEA 1BISA 5D3GA 4NCAA 1IKVA 2EKOA 1LWFA 2MWPA 3QERA 4C5EA 2E6MA 4II1A 4A4GA 2XY6A 4JRPA 3SZ2A 3PX4A 4CEBA 4E19A 4L8RB 4FJHA 2X74A 3AA5X 1IKWA 4DFMA 3ZEHA 1K6YA 2ZQBA 4CJWA 3TAQA 1ZBLA 4Q5WA 4CK3A 1NJZA 3NE6A 1L5UA 1L3UA 5KH6A 2F5KA 3ME9A 4CJUA 4DSKA 4E1MA 2IG0A 4CJPA 4J2BA 4B9TA 1JXEA 1WN7A 3LPTA 3OYHA 4Q5VA 3KLIA 2XK0A 2XO7A 1QTMA 4CFCA 4NCGA 1U4BA 2XY8A 5FROA 1B92A 4CEZA 4OVAA 3TR8A 4CGIA 4FZXC 2L8DA 4FJJA 1ASUA 3SD4A 4DQIA 2F8SA 4CERA 5CYQA 3LGLA 4KI6A 2X35A 4OJRA 5J26A 4NZGA 5C6SA 5D6YA 4FCYA 4LSLA 5IAYA 2ETJA 1U49A 2D9TA 3FEOA 1WSIA 4B9LA 4KKOA 1VSDA 3OYNA 2DIGA 2KQ2A 2ZE2A 5CY4A 1F21A 4ZHRA 4CJ3A 4HUEA 4C5HA 1HQUA 1O1WA 2P0KA 1HPZA 3OQ5A 3LH0A 3H08A 3HP9A 4IURA 1RDAA 3ISNC 2FBXA 3ZSWA 1QE1A 4CIGA 1ZYQA 2BIVA 3QLHA 3OJSA 3QNOA 1T05A 1BI4A 4FJGA 3IS9A 1RBRA 1D9DA 1N6QA 1RI0A 4B9WA 3KTQA 4FL6A 3NBPA 3HVTA 1RDCA 2M16A 1REVA 3CYMA 1IO2A 1LV5A 2KTQA 3OA6A 4FLYA 1VRUA 3QEWA 3G10A 4IG3A 4JS4A 2HHVA 5IN1A 3QIIA 2B4JA 2QXFA 2YKNA 2RPIA 3O3GA 3NTKA 4F3OA 1A5VA 5DK5A 3OB9A 3KIOA 4CHOA 1LWCA 3OYCA 1LWEA 3TABA 1R0AA 4KRFA 3Q1JA 4DTSA 5M9OA 4CK2A 5KE2A 2F96A 4PLLA 2GFUA 4IFVA 3NGZA 3KLHA 3K59A 1KFSA 3IAYA 5JS1A 5KCOA 3O8VA 2E4LA 1Z25A 3M8QA 4LY7A 3OVNA 3QO9A 4JRQA 5I3UA 3PY8A 4FJIA 5FRMA 1EP4A 3KUFA 2IOCA 1TKZA 3AVKA 4AHUA 1RILA 5KRSA 4O4GA 2QQSA 4H4MA 3KLGA 2WACA 3NHGA 4OPJA 4DQRA 2HW3A 4J2AA 2F8TA 1RT4A 4MFBA 3VQCA 1C0TA 4CJFA 4CJ4A 3V9ZA 1UWBA 2OPPA 3QEIA 4KO0A 5HP1A 4KHYA 4KREA 3OYDA 2BANA 4I2QA 4CGFA 3AV9A 2G3RA 3CG7A 2EQMA 3ITHA 3MEDA 2VWJA 4FLVA 5J2PA 4F2SA 2YV0X 4FJ8A 4KHWA 2KZMA 4FK0A 4FM2A 3NH2A 3AVJA 4DSJA 2P1JA 3MEEA 2HVIA 4BDYA 1VSEA 5E41A 1SL2A 2GUIA 4N41A 1TK0A 1RBSA 3D0PA 4EZ9A 3SI6A 4AH9A 3LP0A 3EAEA 1KSPA 2OA8A 1RTHA 1KHCA 3AO3A 3VQQA 4CECA 3QESA 4R5PA 1LW0A 1HMVA 1Q9YA 2XDPA 3NFAA 3T1AA 1QS4A 4RW8A 1D9FA 4DG1A 1RT6A 3QETA 3META 4UC4A 3PX6A 3MEWA 1WSJA 4PLIA 3KLFA 3SUQA 1HJRA 3MXIA 2RJCA 1VK0A 3MP8A 4I2PA 3HVRA 3MO8A 3LDSA 4F3TA 4IBNA 2KFZA 4IUVA 2GBZA 4E3SA 4CJVA 1NK4A 1GOCA 4J2EA 4FVMA 1XI1A 3PUFA 3ZSXA 2X78A 1RDBA 2RHIA 3KK2A 4OLAA 1TKTA 4A4HA 4M42A 1IKXA 4KFBA 3OS1A 1JKHA 3AVNA 3CQ8A 4KV8A 3DOKA 3TWHA 4FK4A 1D5AA 4ID1A 4CEAA 2NUBA 5KGWA 3FFIA 2W42A 3OMCA 4L59A 2B6AA 4QAGA 3UIQA 4M3WA 4AHTA 1BL3A 1VSHA 3QEPA 3F73A 3PX0A 2Z1HA 3OYAA 3ASMA 3NDKA 3PO5A 3K57A 4DTMA 4QQ6A 1KFDA 1VSMA 3L2QA 1JLCA 3ZT3A 4IDKA 4FJKA 1WJSA 3OY9A 4AILC 3C95A 3AVLA 3TI0A 4FXDA 5KGXA 2QKKA 1L3VA 1NK5A 4FJXA 1RT1A 3MP6A 2VWKA 4DFKA 3LP1A 3DLGA 2A1SA 4QW2A 4CF0A 2ZD1A 1NKCA 4Z4GA 4CEOA 3V6DA 3S3NA 1J54A 5D6WA 3PFSA 1HYZA 2R5MA 3C94A 3PO4A 4OPKA 4ZTFA 3PNWC 3PV8A 2P5OA 4CJ5A 4NS5A 4CJKA 3LWMA 1BI4B 1EX4A 4CRIA 3QJ6A 1WSHA 4CEDA 3LP3A 2Y1IA 2G8FA 4FZZA 4DSLA 1JXBA 2RI3A 2M1HA 3C4SA 2YNIA 1U48A 4FLWA 1JLEA 2R7YA 4EDUA 1Z26A 1A5WA 3CM5A 4KTQA 3A2FA 1WJRA 4GW6A 3M8PA 4CJSA 2D0CA 3VA3A 1NK7A 2FC0A 3RRHA 4QCLA 4B9MA 4N4HA 1FXXA 1VSKA 3OYJA 2BDPA 4K8ZA 2BGGA 3LZIA 4FJ9A 5KI6A 3P5JA 4DFJA 4HUFA 3FC3A 5D6XA 3I0RA 1S1XA 2HQXA 3RMBA 5DMRA 3E01A 3HXMA 1ITGA 1HQEA 2G8WA 3NH1A 1U04A 3BDPA 1GOBA 3AVGA 4FW2A 5HBMA 3LPUA 4CGHA 2HQEA 4IFYA 1RBTA 1BCMA 2XRIA 4CJEA 1SL0A 1RTDA 4CF9A 1C6VA 2GFAA 3HT3A 4CESA 1NK6A 1RBUA 4O0JA 2PZSA 4M3TA 3UWNA 5CYMA 3JSMA 4NCBA 3NGYA 4C8MA 2G8KA 1T8EA 4EZ6A 1KLMA 3V1OA 4BWJA 3AO2A 3KD1E 1J9AA 1W0HA 3HL8A 4KHSA 1ZBUA 1G15A 3KD5E 1WGSA 2ATQA 3ALYA 4DSIA 4B9XA 4FYDA 2LTOA 2R58A 3P8DA 4BWMA 4QOZB 4B08A 3NAEA 4CGJA 3MEAA 4ZTJA 4KAZA 1YVUA 4KTZA 2Q3SA 2WOMA 3SJJA 4KPYA 3HO1A 5KE3A 4M3UA 3MEUA 4QQGA 4NYNA 1VSJA 4ICLA 3DRRA 3O4QA 3OYLA 2K3XA 3K5NA 2RJDA 3AVMA 3HSTB 1KLNA 3OYKA 3VA0A 2HNZA 3RRGA 2LDMA 4CHPA 2R57A 1C0UA 1OZ2A 2HHUA 2G8HA 3V1QA 1VRTA 1L3SA 3FDRA 4B9NA 1YT3A 4DMNA 4E89A 4N5SA 4PWDA 3KK1A 4DTRA 4DU1A 2FBVA 4LH4A 4PUOA 1VSLA 4N56A 4CJRA 3HPOA 4CCHA 3OYGA 3SCXA 3SQ0A 4DQPA 2RHXA 1KCFA 2EFIA 2RJEA 3QINA 4UQGA 3K5MA 3DYAA 4FU6A 3T19A 3I8DA 3RTVA 1VSFA 3V9WA 1TKDA 4DQQA 4W5OA 3V81A 1X9MA 3E9GA 4PL6A 4IUUA 3WNHA 2Z1GA 4N4IA 3TARA 3NTHA 4CHYA 2LCCA 3DI6A 4W5TA 3P8HA 4FJ5A 5KRTA 2EQKA 4FJLA 2VYTA 4OKKA 3KJVA 2JGUA 3HP6A 2YRVA 1ASWA 2OPQA 4B8AB 4Y1CA 4CFBA 2XHBA 1JLGA 4HCCA 2LRQA 4X34A 3CM6A 2DAQA
chains in the Genus database with same CATH superfamily
3TSZA 4RW6A 1TK5A 3WVDB 3PM1A 1Q95G 5A0DA 2LVSA 4LLNA 1X58A 3CWSA 1WNSA 3IUOA 4Z4CA 1E6HA 1BQNA 3B6CA 2YLBA 3LYIA 4YIIA 3AVAA 4U7BA 2IAJA 4Z4FA 3CCUN 1XCVA 1KG6A 4IUQA 2KRFA 1SAXA 1GBQA 3SEQA 4KJZA 4DSEA 1YLFA 1NJIC 1WHUA 3C6AA 4GV9A 3CW7A 5KN8A 3ZMDA 2KGTA 1M1FA 5CK9A 4CE9A 5M1PA 4ID5A 2GV9A 3AVFA 2DL5A 5IXFA 2DNUA 4M72A 2WSEE 3S93A 1YRNB 1N27A 2VWFA 3ZT2A 4J19A 4OB2B 4B1ZA 2QWQA 3VQ7A 4BL0B 1X3MA 3ABTA 3FSPA 2EHGA 4MDWA 3HKSA 2CP6A 1K4SA 5BPMA 1K1ZA 3MWTA 4BRNA 4BXFA 4RA2A 1YS7A 1IN7A 1W6XA 1KVBA 1KSWA 4NC6A 1CKBA 1RACB 1Y96B 2YS9A 3ZT4A 1NG7A 4MIMA 2HHSA 2F5TX 5KCHA 3K2PA 3TANA 5LJ5j 3RKQA 4IXCA 3RERA 4IEJA 2DM1A 1VQNQ 4P1WA 1XG7A 3VQAA 1HBXG 1RT2A 4OKJA 3H0GJ 5B8HA 1ORPA 2EGCA 2FNAA 3LSMA 5F64A 2J6OA 1FBUA 1N32K 3ZGKA 3NNQA 2CT4A 1ODDA 2F7TA 2YHTA 2AJQA 3W6VA 2AQFA 2KXDA 4CZHA 4CJ7A 2ZWHA 2QK9A 3V7SA 3RKXA 2L7FP 2O9SA 3EH1A 1R4MB 4IKFA 3WQTA 2EZHA 2B86A 1JBMA 1KQ9A 2DYSH 2FRHA 2OJ2A 4DYQA 3JCMP 1MV3A 1X1AA 2FBHA 1J2XA 4FETA 4WK8F 2L3DA 1G2HA 2HHWA 1MIJA 2DZ9A 3LLRA 3T8RA 2OQGA 3M53A 2BXZA 5I9EB 1LAVA 2AKLA 4BRLA 1EBMA 3NPFA 4K25A 4LF6K 3GOIA 4JI1K 3K10A 3HIFA 4E4HA 1VQPQ 2DRKA 2V51B 4IJAA 4ABZA 4CZEA 4FT8A 4O6JA 3QFUA 3WNEA 4CF8A 3CJTB 3O08A 1JUMA 2GM4A 3AVIA 3OIOA 2EZKA 3VDXA 1NJWA 5KYUB 3IDHA 2RF0A 2QA4N 2ASOA 1M3HA 1S29A 4PKHA 2LLKA 2JSCA 3RYPA 4GNIA 3ABLH 4EGZA 2XY6A 4A4GA 1Q81O 2UXXA 2KRNA 4XKVA 3NWSA 3WEEB 1NJZA 1MD0A 3WE2A 1PHTA 1HNWK 2DT5A 2DJNA 3E5UA 4J9BA 2OTLN 2CQ7A 1J9IA 2YJFA 5CYQA 4KI6A 4XTWA 4IOCF 2NNYA 4BC2A 1Z6TA 3CQYA 2DA6A 1P4AA 3UDCA 5AZJB 3LH0A 2HKXA 2CGHA 3UKRB 4FTHA 2HI3A 2MABA 5E18F 2E1MB 1O7FA 3OOUA 4EQQA 1N78A 4ITVA 3HJEA 5FRMA 3EHQA 3CI5A 2D45A 1TU0B 3VS3A 4OPJA 4FVUA 3VQCA 1OVYA 3RR6A 1W1WE 3H3UA 3A2KA 2FSNA 4JDSA 2DMPA 2J6KA 5J2PA 1EA3A 4FK0A 3AVJA 4XH1A 3JCMe 1XSVA 2HPIA 2YX4A 3JRAA 2Q36A 2BUPA 3CC7A 3CJAA 3KYLA 4B9QA 3VW4A 1IRFA 4I99C 1TQIA 3NWTA 4YPHA 1TXQA 2LC4A 3LA3A 3PSFA 2LX7A 3PVQA 3H1QA 3M5RA 4N9IA 4A5BA 2QA4Q 1XTAA 4P5OA 4LDUA 1E3MA 2IRFG 4KV8A 3E6CC 4ID1A 4QAGA 3K1NA 4M78E 3F73A 1N8RO 2Z1HA 2W10A 4WFNL 3AVLA 4B3RK 1XDUA 2DD4A 4ZZDA 2FZCB 5KYWA 3CF2A 4CCOA 3DLGA 3I9QA 2D1XA 5D6WA 3R1XA 3TCJA 2P5OA 1BA5A 4NB5A 1QP2A 2NRTA 1N25A 4A57A 2P4TA 4N4HA 1VSKA 3MMVA 1WQ7A 3BTLA 5C0YA 3P5JA 1KD1O 3C1DA 3NVMA 3E01A 3EPZA 2ZO4A 5GAOq 2KY9A 2Y4XA 1GOBA 2HQEA 4JV5K 2XAQA 3PIPL 4FT4A 1IJJA 1N34K 3TBIA 3QYGB 2YHWA 3NGYA 2XC7A 2MLGA 1WEIA 3AO2A 2A6AA 2AXLA 1NK3P 2DFUA 2V7FA 2HZTA 3P8DA 3ONQA 2K27A 2O31A 2Q3SA 5GMKh 4NL3A 1PCXA 3CCEQ 1Z3XA 2KRCA 3CCVI 4XH4A 2VQLA 4ICLA 3O4QA 2V1UA 2BE5F 3P4IA 4I7HA 1KLNA 4XSZF 5DM6F 2UU9K 2R57A 1C0UA 1NEBA 3OWTA 1I8FA 4PUOA 1LPLA 3OYGA 3SQ0A 1FT9A 2R93J 3QB0A 4HBLA 3G1MA 1X9MA 2EJRA 2P9IB 4BR2A 3G3ZA 1ZLJA 1YRNA 2EQKA 2HNHA 3EUHA 3SBTA 2LRQA 2AXTC 2PUOB 2F2XA 3GEZA 3JYTA 3ATVA 2HF4A 2RQVA 2B8AA 4YFUA 3SPYA 4E9HA 1T08B 1R1UA 2H6BA 3A8MB 4LFAK 3MK6A 1WQWA 1I39A 2BXYA 4AYBN 1NGIA 4W5QA 4AM7A 4A3LJ 4QS8A 2RPNA 1FTTA 1XC3A 4MFEA 5EF6A 2ZFUA 3WHBA 3VSLA 3BPVA 3F2KA 3B02A 1E3HA 1RNLA 4ILHA 1UA0A 2EIKH 3E9PA 5A2QO 2RHZA 1RDDA 2WAEA 4CFAA 2Y75A 4GYGA 2M9HA 2Z33A 2E20A 4KBMB 4M7DD 1HX1A 1HNZK 2KJCA 3E9OA 3KXTA 2AQEA 3K4KA 3KP5A 4UV8A 4I6ZA 4XM3A 3KE2A 1PVSA 3BEXA 1IZ1A 4BGDA 1MBFA 2K7LA 3F0CA 3OS2A 4J9FA 3THXA 3JAME 1WSGA 1WX6A 3C2GA 3PGGA 3MP1A 4EJOA 4C92C 2NUPB 1NJYA 2DTRA 4CJLA 2XGDA 3JRGA 1C1AA 4YOUA 3OTOK 2R7OA 4DQSA 3JAMZ 1FKOA 3S32A 2CH0A 3VV0A 3RUXA 3DTIA 1MUZA 3BDLA 3T8TA 5GTHC 1YXQA 4QQDA 1WSFA 1LDJA 3KX2A 3TGNA 2XSDC 3JRBA 1R9TJ 3O9TA 4R8HA 1UFFA 1FYKA 3NF7A 4I9QA 3M0PA 1TK8A 4IHSA 3MWMA 3ZQFA 2NNNA 2EFWA 2Y31A 3JRHA 1QWEA 3RWUA 1M2OA 2YG9A 3NGIA 3KZIC 3IKVA 1TUUA 3G0QA 5AQKA 4A61A 2ZPBB 3H8ZA 1OI1A 1YTUA 2EILH 4EHTA 4RG8A 5IT9O 4FW1A 1FZPB 3MVPA 2K40A 2ID3A 5BPNA 1T3VA 4RGSA 4CCLA 5C42A 3D2EB 2Z1IA 4JKDA 3WXJA 4IQ4A 2OFIA 1HW2A 4P55A 5B1BH 1U0JA 1DGWY 4RCCA 5GIOA 1WJQA 4W5NA 4OWRB 4H4KC 4KT0E 4AHCA 4AF1A 3GTOJ 4A5MA 5HLHA 4J7FA 3TAMA 1IV0A 3J8AA 4KHPK 3H1VX 5H6QA 4CGGA 5CAIA 4LD9K 3J7AY 2AA4A 3ABUA 4C8QG 2XPUA 5F0CA 5D8KB 3FLGA 2UYTA 1NLPC 2J5PA 3WE3A 2I10A 2BZYA 2CGLA 2NWMA 3FR0A 4RS8A 1OYWA 5EU7A 4GXOA 3O1WA 5D5XB 2RNAA 4C8NA 2KZZA 2DY4A 4JKEA 2EFPA 2DJZA 4OB0B 1YHQT 3UKUB 3QERA 5D4SA 3ZX0A 3H9NA 2OTJN 1VQNI 5KH6A 4N41A 1IDYA 4G12A 1U4BA 5AFUH 3M54A 1QP3A 4M7AF 4FJJA 4B48A 3CUQC 2EYXA 4EA5A 4B9LA 2FEZA 2ZE2A 4H0EA 1RKTA 5E1XA 5DM7R 4RBOA 3JB9F 2V7ZA 1LWWA 3LWIA 1OX8A 3VEYA 3NBPA 3BTIA 1IO2A 3BROA 5K7FA 4M75G 3KIOA 5M9OA 4DOZA 2IVWA 1D5YA 5KCOA 1WH5A 1EP4A 3M6GA 1TNSA 4CJ4A 2HZDA 4N4OB 1B7TA 5ILSA 3OYDA 3QAHA 2DI3A 2DO3A 3M5AA 3HYIA 1ZRFA 3CMAQ 4M3DA 4XU2A 4Z8AA 5J6XA 1H3HA 5AQJA 1WH7A 2EYYA 2Y0SN 1TWAJ 4EZ9A 2JM8A 3PIPA 4R5PA 2Z0WA 1B72B 1H88C 1D9FA 4LF4K 2RJCA 4DBHA 2OAUA 1M8MA 4F3TA 4YFNF 4E3SA 2LZ6B 4FVMA 1V54H 4F16A 4DBQA 2WSCE 3Q7CA 5DM7F 3S1QJ 1LCUA 2W04A 2VI6A 3KLNA 3OMCA 4V2SA 3UIQA 2Z1DA 1MDUB 2OTJA 1MBEA 3OYAA 4KGVB 3H0FA 4H5WA 5CVVA 4FJXA 5CKHA 3DF8A 2WTEA 5LD2C 3I55N 1QVPA 2X3WD 4FSVA 5FKOA 4DR7K 4CJ5A 1EX4A 1JXBA 3MHXA 1HJDA 4PJNA 1PP7U 1B6AA 2NOFA 3X28B 4ENJA 3FC3A 5D6XA 4DW6A 1OFCX 4LDWA 5F08A 4FW2A 5A2QE 3LPUA 2IS1A 2ZJRF 5J1YA 5AQMA 3OL3A 2VBZA 3MEXA 2CP7A 3HL8A 4M7XA 1MA9B 5KYNA 1R77A 2VUMJ 4M6VA 4BWMA 3T7ZA 4ON0A 1KFZA 4ZDOA 5EYRA 1ESVA 4KMFA 4EJVA 1IBMK 3DRRA 2ACJA 2K3XA 2RJDA 3HSTB 2KE9A 4AFUC 1K9MC 1P4WA 2JMAA 3EG2A 1Z9QA 2YX7A 2RD1A 5GAMg 2RJEA 3DYAA 1TKDA 4O3MA 2NOZA 3G71I 2M1BA 3K9TA 1UHMA 4M7AD 4BC4A 4CHUA 4WF9L 4A93J 2XHBA 4X66K 3MWPA 3DBRB 3PTAA 4KICA 4KGZB 1NEGA 4HCZA 4IHVA 3LFKA 3FKJA 4BU2A 3V9UA 2KMTA 3JAMO 1Q7YU 3ATUA 2M8GX 3DEEA 4B4CA 2QKBA 5IP9J 1G4DA 4CEFA 1HDDC 1VQOA 4C2UA 1W1FA 3VQ8A 2M7AA 2G8VA 5DLQE 1GXPA 1SFUA 3HRUA 1XNRK 2H94A 3OR1C 5LMNK 1Q7YC 1ZR2A 3DLKA 1YUWA 2CT3A 4YORA 3SFZA 5HNHA 2R7SA 4AIHA 5LJ5e 1V4TA 2O8FB 4HCBA 4Z02A 1OCCH 4IQJA 4M74A 4M3YA 2VV5A 1VQNT 4PJLA 3SLCA 5K7ZA 1OLTA 3Q0VA 1V76A 3VGLA 4C3HJ 2ZC2A 1T0FA 2V1DA 2DEQA 2EV5A 2CSQA 3GIBA 5D5WB 3DV8A 3G0ZA 1HKQA 4MQ3A 3SZPA 2K3BA 1C6VX 4GKKK 3RPUD 4ILJA 4K0KK 4BG8A 1AZEA 4IEIA 3D2EA 3M3ZA 3BQYA 4HUGA 4B3OA 4JI6K 5JS2A 2UXNA 2A3SA 2FRWA 4DCHA 2A41A 1PVEA 1NOYA 3GVAA 4B22A 4CC7A 1IB8A 4AG2C 2H8WA 2MF2A 4FLUA 2PYJA 1RDUA 3VSKA 3ML6A 4JKFA 3IG1A 4B8CA 4O5BA 1POGA 2GXAA 4MO5A 1BM9A 1TWHJ 4CHNA 2DFFA 5HRPA 1PJRA 1XGMA 2RNJA 1C1BA 1BI1A 4BE1A 1SVOA 3DFGA 2WAQN 5LEKA 1WJCA 3AG2H 1DPRA 4OIPF 2VC0A 5C0MA 3CPWP 2WONA 4DIQA 3H6ZA 4CJQA 2QQAA 2IVPA 1O4XA 2P84A 2D0AA 2K2VA 4N4GA 3C6UA 1VQKT 3W0LA 3PNTA 3ZYYX 1NPRA 5CQEA 2XKOC 5L3FA 3QIOA 2B9SA 3U6FA 3AL0B 2Y0MA 4XTZA 4M78F 2L3RA 1SKSA 2Z5UA 2COMA 5LJ3f 5CVIA 5AONA 3GX4X 3G71A 1NK0A 4ISGA 1EETA 1M90C 1NK9A 2E2PA 3E97A 2W41A 2V1RA 1T8IA 1TQPA 2P9IA 2X4WA 3CMAA 3I35A 1QQMA 3G4SN 3A8OB 2RVCA 2ESNA 3BZKA 1YJNI 3LANA 2CSOA 3LALA 4C1NK 3MXMA 1D5VA 4BQLA 1RAIB 2X6NA 1EKEA 1PU8A 4NCAA 5GJWB 4C5EA 3SZ2A 2A6EF 2JPCA 4JJCA 4IIOA 3PIOF 4DR2K 5HDKA 3GTQJ 2HBPA 5B66C 4MDAA 4CZGA 4Q47A 2LCLA 5HS7A 3CCEI 3LGLA 4M7DG 1VQ9A 2GQIA 3L4QA 1V5GA 3U9ZA 5CY4A 3NMZC 2O01E 1I94K 1ZYQA 4EJTA 3H5AA 1UGQB 1UUEA 4FSSA 2F2VA 4N0AA 1EH6A 3RQ4A 4FLYA 1G6NA 1VRUA 1AWJA 2B4JA 1UG2A 4CHOA 3OYCA 3PQJA 3OVNA 2IOCA 2FNPA 1MDMA 1WKMA 4BHCA 3HBTA 3FM5A 5GAHP 4KREA 3SEZA 2R5ZB 4UUSA 3QSUA 5TKWA 2MH2A 1JGSA 3HEFA 2HFHA 5HKCA 1X6BA 3NH2A 2P1JA 3CF5L 2HYGD 2FF3B 2HMAA 5K7HA 2VIXA 3HRSA 1Q9YA 1W5CC 1UECA 4DG1A 3CJNA 3NAUA 4MHGA 3ASNH 2VLAA 3A1PA 3QYEA 2DXBA 1K83J 5ERIA 4H0TB 4RB3C 4IUVA 1IV8A 1I81A 3JS6A 1ZSGA 2I5WA 1VQLI 4JRIA 1IKXA 3AVNA 5IOYA 4YTLA 4X65K 1JKQC 4J83A 2FVUA 1JLCA 4KITB 2QWWA 1JQQA 4CICA 1FOYA 2QKKA 4HF1A 3CZ6A 2IGMA 3LMMA 3INZA 4FYWB 3K4CA 1KYZA 1DJ7B 5FLXO 2NUPA 4M77B 3KWIA 3LP3A 2M1HA 3C4SA 3K1MA 3E19A 3ROUA 2O5RA 1A5WA 3E5XA 5L3EA 3QQAA 5A2QK 4BBRJ 2JSPA 5FD6A 1MV0B 2ZPGB 4DFJA 3I0RA 5CHZA 2EGAA 4M3FA 2R7DA 3CPWS 3CMET 2E1HA 4R56A 3CJQB 2JA5J 1TBXA 2L01A 2EINH 2QEXT 3KD1E 4YOTA 2YRDA 1D0YA 3FHZA 2IJLA 1WLPB 5C3EJ 4IOAL 3FDRA 1K6OA 1D4XA 1HR0K 1ATRA 1MBHA 4FU6A 1M90O 2FZKB 4DQQA 2BTTA 3G73A 3FXKA 1JJ8C 1YJNN 3JB9I 3KCCA 3DLLF 1U2VA 3IL2A 1TQMA 3CHWA 4RLFA 5GMKm 1MBKA 1SD4A 3VTHA 1Z91A 3WT0A 2JWLA 9ANTA 1L0OC 3S1NJ 2JTFA 4M3GA 1VQ9N 4HEA2 4PK4A 4F92B 4I09A 4M3EA 1LE8B 2OF7A 3WXKA 2KT8A 1NGJA 3R6SA 4G6TB 3P7NA 4B1VA 2VONA 3DLMA 4ELTA 3U3YA 1VQMT 1JO8A 1QA6A 1QVFA 3DBLB 3AAQA 3SUOA 4CHQA 1NYGA 1YIJT 4EVVA 3IMXA 3ZX2A 5B3SH 2H3EB 4C5IA 2HBJA 1S9HA 1XHZA 5GAOr 1HSQA 4DR6K 4BC3A 3TDUC 4MDXA 2YWWA 1RT7A 4A12A 4CYDA 2PYLA 5J2NA 3RBBB 1HYSA 1TW2A 1YW7A 3L2UA 2XDVA 5GAN7 1TUGB 3AO4A 1VTNC 1B72A 3K5OA 1J6ZA 2RDPA 3GLLA 1O3TA 2ITMA 4XOPA 4OO1J 3HI0A 2KJBA 2D5RA 1ZBXA 4AMCA 4A3BJ 2CKKA 1G5VA 2XPVA 1CKAA 1YE9A 4MZPA 4PJOC 5I42A 5LRRA 1M2VB 1N9SA 2XAJA 4UB6C 3H3OB 1IGNA 3IRQA 3HPHA 1U5SA 3SV4A 2YHXA 2XIGA 3WG9A 4PY5A 1F5TA 3U2RA 4MMKA 4KA4A 3HZ6A 4Q0BA 4AIJA 4M77D 1E2XA 3ISPA 2FSKA 3QOPA 2M30A 1UJ0A 4WQ5C 4M75B 1IF1A 3LAJA 3P9KA 2MGQA 4WXDA 1LW2A 2VQFK 2B5JA 1TG0A 5AR0A 1H9TA 3P8BB 4O8UA 2E1YA 2DD5A 1QRYA 4RAFA 3SHFA 4A3FJ 4Z94A 1IH7A 2HQNA 1K76A 2E34A 1VIEA 2ZGZA 1R22A 3L2CA 5IT9K 3WXMB 2DMUA 4BQAA 5GAMe 3J81O 3NF6A 2M45A 2YHBA 2VT3A 1P7MA 1WHLA 1P4XA 1HYVA 1D8JA 4EVIA 5M1FA 1JCGA 1W9HA 3QODA 3NEUA 3VPZA 4DTUA 2Z9OA 3RMCA 3M4GA 1X2KA 3U23A 4C0GA 5K14A 3DLBA 4W1UA 1WA7A 3HOWJ 4GBQA 2E6LA 1KAZA 1JJ2S 3V9SA 1J75A 2EFNA 2VASA 2WBMA 4WQ4A 3BDUA 3TAPA 4E7JA 5C24A 5CKTA 4PCQA 2DOAA 4YG2F 1C0WA 2HOTA 1XCBA 3CMYA 2DXUA 4Z89A 1YHQI 1OH6A 1QZEA 2X1CA 2MCNA 3BW1A 1R0CB 1ZSZA 4A4EA 4KHNA 1KQJA 3HKZN 1U8BA 4FJNA 1DGRM 3UKUA 3R0JA 5D3GA 1XSXA 2RH2A 4R0KA 4LB6B 4E19A 4DFMA 1K6YA 1R59O 3CC7T 3DKMA 1WI9A 5FO5A 1R23A 1G83A 1IN5A 3O5BA 1ZYRF 2YU9J 1ZBJA 5E79C 2JZYA 2E19A 3C2HA 5GIPA 4BRDA 4IHYA 3D5RC 3FXLA 3H41A 2E2NA 3CCMA 3ISNC 4IZZA 2WB1A 2D8JA 5FPNA 1D9DA 4FJGA 4L9VA 4B9WA 2VWBA 3HTSB 1VQ5T 1ZUUA 3CD6N 1DIZA 4F3OA 2QXFA 3MD2A 1K73O 5CKBA 2IBDA 3S17J 2CREA 4M78B 5C2FA 3CC4Q 3O8MA 2E4LA 4M3WA 1YF5L 4L5GA 5IXBA 5IT3A 3V9ZA 2NYXA 1RDWX 3LM9A 1HW1A 2BANA 4F7UA 2R0QC 3DEUA 3CG7A 3BJOA 4L9NA 3D5SC 4LF8K 4M7DC 4O8KA 4DSJA 2HVIA 5M5XJ 2GUIA 1TK0A 1K0SA 1KHCA 3AO3A 1CSKA 1YS6A 3HXLA 1MJAA 3N4MA 3NFAA 4RW8A 1X19A 3MEWA 3MXIA 3Q0UA 4WFBL 4CBUA 3HHTB 2W6LA 4Z2YA 3M8EA 4C8QD 2EPDA 2KLAA 4F93B 4RTVA 2J7IA 1OQYA 4PKCC 4FK4A 1IJWC 5EDNA 1HA8A 2XI9A 3FFIA 2W85A 3QU3A 2QENA 2DDAA 3R60A 3CJBA 1YO5C 2DA4A 4JYAK 2K5CA 3VFZA 5BNGA 2KAFA 3Q0WA 2XG8D 1KZHA 4J01A 3U9GA 1PP8F 4CEOA 3PO4A 3I59B 1WFXA 1ZSZB 2XIDA 5KPTA 1KA8A 3PV8A 2EV6A 4NS5A 3MPUB 3F8NA 3QJ6A 1VQ9I 5JMVA 4ILGB 4BQOA 4GW6A 3VA3A 1FMKA 4ZYAA 1YJWQ 4MNUA 2DA9A 3D1NI 2BDPA 1OVQA 2VN2A 3CLOA 1AZGB 1S1XA 2HQXA 1NG2A 4C0FA 4M3UA 2P5VA 3EH2A 3OR2C 3HT3A 2HDCA 3GF5A 4O0JA 5L3CA 4M78C 3G1OA 1K78B 1R5GA 3V1OA 1YQRA 4B9XA 2LJ0A 2ZJPL 2FEIA 2P7VB 2HNIA 4KAZA 1X4PA 1WYXA 1VSJA 1KQSM 2DQRA 1KQSS 7AT1B 4EEFG 4CCMA 1AT1B 4CJRA 3CP2A 1GLJO 1KG5A 1IO6A 3QRFF 1NNEA 2BV6A 3RPQA 1VYTA 4HV5A 4H5TA 4CZFA 2LTPA 3ABMH 1KG1A 4OX9K 5JVHL 3UATA 2DDBA 1SRLA 3ZQQA 2F2EA 4HZFA 1GFDA 1M90R 1UJ8A 3CCMQ 4I9LA 4ZYHA 3FZHA 4ESRA 5HS9A 4JRKA 3O4NA 3BJ6A 1AOYA 3D45A 1JLAA 3OSVA 2OPRA 4FWPA 4GKJK 1DPUA 2DFHA 3L7WA 3I5RA 2CW8A 3S15J 2KFNA 3C2BA 1TGOA 1X6GA 1ORKA 3VQDA 3CD6T 5J1RA 4GGGA 3ESWB 3H9QA 4EJYA 4EP4A 4PL7A 3KP7A 5GMKl 1MSFC 4KH1B 3L8BA 1SFOJ 2M0MA 4FM4B 1Q81U 4S05A 2K3PA 2K5LA 5EGOB 4S04A 2IS3A 1NPPA 2VJIA 1ZG5A 2F5EA 3VKIA 2YNFA 4Z0UA 1IGUA 1VRLA 4XLFA 2HWVA 3JTHA 2R3SA 3IH3A 3TPQA 1D1BA 4DYCA 3ULEA 4ETSA 4E7IA 3N05A 2L2PA 3A0HC 3ZSVA 1JL2A 1I3AA 1KC8U 1FOWA 2DL3A 2BY3A 2DQLA 1IKYA 2FL7A 1K78A 5JLFA 1YAGA 1R58A 3LSHA 2HOAA 3D2FA 2IGNA 2KFDA 4DU4A 1S3JA 2X6SA 1XNIA 3OA9A 4DF4A 2NRWA 4S0HB 1ZHFA 5BS6A 5CVRA 4G6QA 3VYRB 2L3SA 3L2RA 5FDLA 4F2RA 1LDDA 1NBWA 1T2KA 2STTA 3LNQA 1A5XA 3BR2A 1BJAA 1TT5B 3RIRA 5FLMJ 4BRFA 4M6XA 2X4XA 3ENOA 3I56A 5ILVA 1D0XA 1KHIA 4FWKA 4DV2K 2QSGX 3VQ4A 3HBLA 3V7CA 1TWGJ 3C6TA 2PEXA 3KZBA 5IWAK 5LJ3d 1TAQA 3O1BA 3DXJF 1JCFA 2L9VA 2HMIA 3JCMb 2L0KA 2EA4A 1RI7A 5KVRA 3TSQA 3SPZA 3GFIA 1QZYA 2FU4A 4FJ7A 3I0WA 4MTDA 2R7UA 1P59A 1JLQA 1IN8A 2OTLT 2WBNA 2MIOA 1D0ZA 3VEWA 4RM3A 4IG0A 4E1NA 2E2HJ 4ZYGA 1JJ2A 2HBLA 3MEVA 2HR3A 2PMUA 3N97A 5AYFA 1MMGA 4F8RA 3CCUI 4BQZA 1ACMB 3G2BA 3U1DA 3MN5A 5L3GA 2DA1A 2P9KA 2VJJA 3H3VK 5IP7J 2AKKA 2F69A 4BC5A 2C0TA 1GRIA 1N5YA 2O8CA 2OZMA 3EUKL 3VERA 3OYEA 1PNJA 3CFOA 1Q18A 2PN6A 1BB9A 2E60A 2NS0A 4BR4A 5FFZA 1FP1D 2YXYA 2MK5A 4I02A 4C2TA 1TWCJ 3TAFA 3O80A 2VVKA 1OCPA 1VIFA 2RK2A 2EQJA 4FE7A 1S6QA 4CBXA 2LG4A 3D0SA 1PU7A 4W97A 1BISA 4MDBA 1Q81C 4U88A 4B1UB 1Q82O 2IPQX 3CCVT 2X74A 3NVKA 3BCAA 1E4GT 3CCRT 1NGGA 4CJUA 3LPTA 2JA7J 1QTMA 2XO7A 4DV5K 2CWEA 1F1BB 3WQUA 1JTYA 1HDPA 5BPIA 4OJRA 5C6SA 2ZZDA 2D9TA 2JM9A 2NLXA 4KKOA 4ZHRA 2O8KA 3CIPA 2UUCK 1HPZA 4DBFA 1VQKI 4IURA 2FBXA 4JK9A 3SAFA 3CESA 4CI6A 2K6DA 4C23A 3RSEA 4G7HF 3G10A 3CCJI 1OX9A 2ZJRL 4K41A 2LQWA 1WI7A 2QBYA 4A0YA 3K59A 3VEVA 4NO7A 2I7NA 3RPUA 4YIFA 5KRSA 1QCOA 3QEIA 3HOSA 2G8WA 5HP1A 1OPCA 1VI0A 4UUSB 1VQ4A 3PUBA 4AQYK 4A6DA 4KHWA 1HKSA 4P9FA 3ZETA 3D4VA 2I7PA 3KHYA 2NUTB 1JUSA 2JJ7A 1M3AA 1FIPA 5LLQA 3QYBA 3VQQA 3QESA 3ZLJA 5GAN5 2HOEA 2LNBA 1BA1A 3GMEA 1E4FT 1X4OA 1X69A 4BREA 4H5VA 3CCSN 5AQRA 2BY2A 2GBZA 2CRGA 2A6TA 3GTMJ 1GFCA 3KK2A 3NFCA 2VKDA 3CCRI 2QTXA 5GANe 2L0AA 5J8FA 5GANg 4C0DB 2B6AA 4AHTA 1KU3A 3GF2A 2IT0A 2LCSA 1NZ9A 1KU2A 2E1OA 1NMDA 1IW7F 4G8XA 3TI0A 5IYCJ 2VC1A 1HF0A 3D6RA 2DO7A 1VQ8A 3RVCA 1OH7A 3U8XA 2HYJA 1VQ8N 1XB4A 3PNWC 1U2WA 1JI8A 1ON1A 3RMQA 4GV6A 1X3UA 2VODA 4XU1A 2FBKA 2HOSA 3E6BA 1M2VA 4RMOA 1VQ5N 3A98A 4X6AJ 1ITGA 4PJJA 3AVGA 4CGHA 2W40A 2XRIA 2HVQA 2D2WA 2GFAA 4F7UG 1WHHA 4B1YB 2DMOA 1Q1VA 5M3MJ 1NK6A 1JXMA 2M87A 2E70A 3Q9SA 2V1NA 4GVEA 4EZ6A 3CMEI 1VQ6I 4A3JJ 4ZTJA 1REPC 5AIQA 1NGNA 4KH5A 4DKWA 4FPAA 3OL4A 3AVMA 1SQKA 4D7NA 4CHPA 4IHXA 1OZ2A 3I8BA 1X75C 3CCST 4PWDA 5GADP 4A3KJ 1LDKB 5DD8A 1VQLT 2MPXC 2R5YB 3CCVQ 4N56A 3KYDB 1IDZA 2QXLA 5D4RA 3RTVA 1VQNA 3DPUA 3KZYA 2DTIA 4AFZC 2LCCA 3DI6A 3P8HA 3HPWA 2WAQA 4HLXA 5LRSA 1MZBA 1ZGWA 4Y1CA 3FIFA 1RR7A 5ED4A 2YHYA 3F6VA 5GAGP 2IIMA 2ELJA 4DLGA 3QP6A 4DK9A 3THYB 1OYXA 4ZN1A 1GLBG 4U0WA 3OW2P 3NF8A 2A6HF 1VQMI 2MAMA 2JTEA 1R49A 2BH1A 5HODA 3WODF 3FJ5A 3RZDJ 1HU0A 4QS7A 3N5BB 5SZTA 4LDXA 5ICFA 4D5FA 1JXOA 1JT0A 2O9VA 2RC4A 2X3XD 4J8OA 3AGKA 1JHHA 1RESA 2QA4A 3IRXA 4EA4A 4Y7NJ 1D8YA 3SJHA 4D7MA 1HNVA 3QPLA 2IAIA 3DTKA 1I07A 4C3JJ 5L3BA 1ZG3A 4HSTA 3PMTA 1S9GA 2JA2A 2JVGA 1X3NA 1FYNA 2IGOA 3SDZA 4LD0A 3CCRN 4ZZLA 4DV1K 5CIUA 3QPSA 1KC8R 4AUXA 4L5JA 1YITQ 1ON2A 4HX8A 3C18A 3A8GB 4Y3OA 2FPFA 4WQ4C 3UA7A 2JW4A 4B1RA 4AI4A 1U47A 3MJXA 2C06A 1Y07A 2WA0A 2OC6A 5I22A 2XB0X 5D6FA 3QWXX 2IS6A 3UT1A 4G6DA 4ENKA 3J7YJ 1T0JA 4A0ZA 2CP0A 1GLDG 4EJZA 3VEZA 2KIMA 4C92E 2F4MB 4OAZA 3DU6A 3SUPA 4RGXA 1H0MA 1OULA 1K4US 2E10A 3MN6A 2L7MP 4QVZA 4XBFA 3HFOA 1NJXA 2JRMA 4NL2A 4JYKA 5ICEA 3S3OA 3KEOA 3OSFA 1MNEA 4CIEA 2E36A 3G6EQ 4BH9A 1KC8C 2QEXQ 3J80Z 1PKTA 3K0SA 4XLAA 3I56N 1QPMA 4EMHA 3K2ZA 1APLC 1TNTA 3THKA 4UUVA 5IT9E 3P1GA 3PT9A 4RGRA 4BRPA 3G71N 4FHTA 4IFEA 2AP1A 2EFQA 4LIVA 3GLXA 1SKRA 3CCQN 2K9SA 4LDVA 4CBWA 1SKWA 1K73R 1BGXT 2A28A 2LKSA 2DERA 2NZTA 3RI4A 4QPQA 2VQGA 4KGXB 1BI3A 4ZGDB 3CPEA 5GMKe 3CO7C 1VQ9T 4M45A 3NTIA 3ZMZA 1CXQA 3LL3A 3VRZA 2A08A 3I59A 2DJQA 1K9MU 3S3MA 2R5ZA 4XNFA 2O8EB 1ASVA 4NOYA 3H5RA 1HW5A 2QG9B 4HQMA 1LUJB 2HHTA 5GAOm 2Q2RA 3P31A 2QEXI 2R7VA 1G3YA 3DXMB 2Y48A 2RI2A 2P6TA 4HWIA 1D1AA 1YI2Q 1EH7A 3TW7A 4L8RB 3JAMK 3BFMA 4EJWA 2QK0A 1YITT 1L3UA 1VQMQ 4CJPA 2DL7A 4KIGA 4YDUA 3TR8A 4C8QC 1ZK8A 3RDIA 4DQIA 3LOCA 2CFXA 4JLIA 2E6ZA 2QSFX 2QYZA 2LQKA 2D0PA 3X24B 2BHZA 1Y39A 5I2MA 5KYUA 5C12A 4HUEA 1R4NB 5HCKA 3KYCB 4C5HA 4BVPA 2UXBK 3TSPA 2RQTA 1N6QA 2E1NA 3I64A 4B1WB 5IN1A 4UVAA 2KDSA 3VMFB 1LWEA 5KPRA 4PLLA 1FY7A 4XH5A 2MYSA 2DCEA 5I3UA 5BRFA 3KLGA 5AQWA 4ZDPA 4GDFA 3RZOJ 3CVSA 3LDOA 4I2QA 2VKEA 1IRXA 1SSHA 1VQ6Q 5H2FC 4PGHA 4FM2A 3L4IA 3MEEA 2DPPB 2ZMEC 2OA8A 2FG0A 2VKHA 1VQON 3QETA 4B3MK 3HUGA 3LW5E 1HJRA 4M7DB 1B8IA 1QCFA 1YWPA 5LL6Z 4IHWA 1TKTA 2QEXA 1I3QJ 2CUJA 2XF6A 1JKHA 3LSRA 2O8EA 1VSHA 2RNGA 3LFUA 1VSMA 1AOJA 2GAUA 2IA0A 2ED1A 2DXTA 2QM1A 1VQ7A 5BN9A 1NK5A 4CO8A 5M1NA 2A1SA 2DAOA 1H1VA 4KDPA 3V6DA 3S3NA 5ECAA 2K85A 4LOCA 3ELKA 2D0NA 2DMQA 1Y7XA 1XQPA 1YIJN 3RESA 4LB5A 3VUZA 2FC0A 4HVVA 2HEOA 2Q1ZB 2RQRA 3WU1B 5IHNA 2KIFA 3SB2A 3D2FB 2FD5A 2QCOA 1JB0E 1K8AU 4EW4A 2V9PA 2LBFA 3OW2A 4ELYC 4CESA 2QGFB 2E8AA 5EX5A 5CYMA 4F52A 2X1EA 3K2AA 4HTLA 1QVFS 1S72I 2VJ4A 3MAJA 4DSIA 2IGKA 3MEAA 1YW8A 1BJZA 2WOMA 5IYDJ 1YBYA 4F7ZA 3K5NA 2Y2ZA 4XONA 4AC0A 3QBWA 5CQXA 5EVZA 4DTRA 3VS5A 4X64K 3HRMA 1KCFA 3R6NA 1WI3A 1GVJA 3I8DA 3KZZA 4W5OA 2HAXA 1YJWT 3JRIA 2EW3A 3EGDA 4I2OA 2HSTA 2CZ0B 4B8AB 3X25B 3FZMA 3HM9A 3LZJA 1M1KO 4KI4A 1ZELA 4P9UA 4MZMA 1VYUA 1JKRC 2GX9A 4DV7K 2OZUA 1N3AA 1BOBA 1YFHA 3HL2A 5CVJA 3X20B 4HOBA 2L9RA 1GCQA 2RAEA 3CQZJ 4PUSA 3C6HA 2YI1A 3O3HA 2HDWA 3I33A 1FK9A 1PRLC 3WTVC 3L2WA 1V55H 2RKIA 1UA1A 3RNJA 1VQ4I 2CGKA 5JS1A 4RKUE 2UWMA 1O13A 3VEOA 2YJEA 4E70A 4JBAA 3BR1A 4M3XA 2ICWG 1BBZA 3CCEA 4BE2A 1AHDP 1UGVA 3OOPA 4C8QF 3FK7A 3VEXA 5L23A 3ASKA 5FLXK 2W7NA 1N6AA 5DCFA 2O4GA 3J81Z 1TL3A 3OYIA 2AS5F 2Z16A 2NLUA 1WB9A 4LK0F 3GZ5A 1SVLA 3WNFA 5LJ3e 3BZCA 2KLOA 3IHOA 2RB6A 5FU6C 1EZZB 1YHQN 3QZ5B 1IC8A 1UE9A 1SL1A 3PFIA 3MFKA 5C4JJ 3QBYA 3KKSA 1I1JA 3J80O 2KZVA 5J39A 1VNDA 2YHAA 2QGUA 1IBLK 5EJCA 3SWNA 1DU6A 3AG4H 2VC8A 4CZKA 1YOVB 3PLAA 4ATOA 1ZLKA 1YJ9A 1JGGA 1T39A 4E6RA 4RW9A 3GTGJ 2EQRA 2NYSA 1UJYA 4CXFA 4AYBA 4QIWN 1K8KB 3CFPA 4E2FB 5I21A 2ZNZA 3RR8A 2QWRA 1WCMJ 5FKKA 3FMRA 2GF7A 1TKXA 2VGNA 2A0FB 3ZX3A 3M9QA 2WTUA 1B9DA 2HTJA 4FOEA 1NKBA 5M5YJ 4IO8A 3F0ZA 4AT1B 2K4YA 4FT2A 3GFJA 2K9QA 2XDDA 1T6DA 3JCMc 5BOXA 2ZXJA 2A07F 2P5KA 5T7BA 1G3WA 3CC7Q 4KB1A 3LDNA 4M9SA 1W36C 1XUPO 4H03B 3K9JA 2RI5A 3MX5A 1OYYA 1ILYA 4ZGEB 3T69A 3EG9A 1FX7A 1QZ5A 4IIMA 5GAMd 5GAOl 1VQ4Q 3VOVA 2IXSA 2H3JA 5JHFA 4CUGA 2PVOB 2G7UA 4XU0A 1K73U 1PG5B 3L1PA 2CV1A 2DE0X 2DBKA 3M8SA 1WJ5A 3F8MA 2KT0A 3LWLA 4L3QA 4OVLA 5J4VA 4RW4A 3M56A 1Z9ZA 1GV5A 2E2JJ 3CC4T 1R1VA 4HT8A 1RTJA 4M75E 1A0NB 3K58A 2QWNA 3V9XA 4U0YA 2A3ZA 4LJZF 1O3RA 1M5Q1 1HLVA 1WJDA 5FRNA 3U9DA 4OAYA 2RF2A 3QJYA 1FIAA 4C8QB 4M75F 4LH5A 4B9UA 2VXDA 4BE0A 2ECCA 3L3VA 3RKYA 1ZUKA 3GBQA 2PTKA 2VBWA 2CS7A 1X1BA 3QHSA 4G9ZA 5FB2A 3Q3SA 3M0UA 3TAQA 4BGBA 4J2BA 2XUBA 3OYHA 4BRMA 1X2NA 4OVAA 3VU3C 1S3XA 1T44A 3GNFB 4A53A 4J8FA 3JCMV 4HDVA 4U67L 1VSDA 1F21A 4CJ3A 1UGRB 1NGDA 1Q82C 1KG7A 3GL1A 4M7AE 3QP5A 4KT5C 3CCLQ 3GE1A 4RTYA 1VQMN 4BUPA 3F10A 1S6LA 1MUDA 1A6IA 3U1KA 5AQIA 1LV5A 4JS4A 2PU9B 3ZQHA 2A7YA 4Z88A 2IW5A 2YKNA 3NTKA 3OB9A 1YI2A 2A37A 3PY8A 1TKZA 1I6XA 5GAGJ 2F8TA 1C0TA 1YHQA 3WTWC 5DY9A 2G3RA 2KZMA 1Y0MA 4K11A 2JWTA 5HNFA 1QU3A 1YJ9I 2H27A 4UNOA 1DQUA 1KSPA 1W97L 4D1QA 3PL8A 5F6FA 2XDPA 5GADJ 1BUPA 1K9MO 4OIRF 3MO8A 1ZBSA 1XI1A 3BF1A 2M9UA 3ZSXA 5L3DA 2RHIA 1VQLN 1LNWA 5CKEA 5C15A 2OBPA 5KAFC 3J80K 4PDKA 1D5AA 4CEAA 4ENNA 4CZZA 4PJOB 3HSFA 4QVCA 2DT7B 1QQOA 5CO7A 4RCBA 3BQZA 1WJSA 2HSEB 1R36A 1QKXA 1C0GA 3LA2A 1RT1A 2H1LA 4D8DA 3CF5F 2COBA 2E41A 1K79A 4OOIA 2P4RA 3EL2A 4BB7A 4M77G 4JKGB 2NOIA 5GAOp 2QTVA 4DSLA 3H35A 4HDUA 3CM5A 4FWMA 4J6XA 2HU9A 4B9MA 2BGGA 4IWVA 1U06A 5M5WJ 3FZVA 4XLEA 4WX9A 3NH1A 1S7OA 5HBMA 2JN6A 2HQHA 3DLLL 2HKQB 2YG8A 1RR8C 1T8EA 2DU9A 5TISC 3KK7A 1WVRA 4V2FA 5EGOA 4FYDA 5JI6A 1VQ7I 1X01A 1WEGA 1QVGA 2PMHA 3X26B 3TQ7P 1YQMA 3ZEUA 3CCSI 1PSEA 4EIKA 3OYLA 1RADB 1AHJB 3CD6A 2KDOA 3CXCP 3QDFA 2VT2A 3RRGA 4LLLA 1Q7YO 4XICA 3TSWA 1VSLA 3DXMA 4XR6A 3G6ET 1GLFO 3QWLA 1VQ7Q 2FJ1A 4N4IA 2Z1GA 1MSEC 5EZHA 3NTHA 2W4SA 2DK8A 3E2UA 2EZIA 2CP2A 1UFMA 2D1HA 1HUXA 1PUFA 1YQAA 2OPQA 4NB4A 2RA2A 4HCCA 2DJIA 3VQPA 4PIIA 3DCFA 3JCUC 1Y8QB 2DVEA 5JLHA 1PUEE 3VYSB 3WG7H 1S72A 1RFQA 1NLOC 2ETHA 3B8AX 3M8FA 2MD0A 4XMYA 2X9DA 1KRPA 2VOPA 2GWRA 1AD5A 2MWOA 2JOYA 1FSHA 2XROA 1GXQA 2LC2A 4A69C 4CGZA 2CO5A 3DLLA 4CK1A 1KQ0A 3S1MJ 2IGIA 4FYXB 3LP2A 3KETA 4VUBA 1X9SA 5JVGL 1YHQQ 3OS5A 2LVMA 4FWRA 2Q2EB 4KYWA 3T1HK 3J80E 1M30A 1FPQA 1VSIA 3OW2S 3VN5A 2XU8A 3BC8A 4E7HA 2FSJA 3FFKB 3V8JA 3ZT0A 3CWTA 2ABKA 2RHUA 3W6KB 2FO0A 1NE8A 3UKRA 4E7KA 5LEJA 1NGEA 3PIPF 4RUGA 4JLGA 2D4WA 2H6CA 4BR7A 5KYYA 1I4K1 4OGCA 5FD5A 3CCVN 2N8GA 1FLIA 3G6EI 3I4NJ 3I5UA 1D1CA 4BY7J 1Q86U 4DTJA 4F9OA 2O8FA 2W03A 3HOUJ 1M3BA 3CMAI 2L7KA 3BG9A 4EP5A 4RTFD 2CQNA 2VQCA 1BI2A 2QWPA 3U4LA 1LJOA 1SF9A 2X48A 2BTFA 1WEFA 3VJPA 3M0QA 3O8HA 2FMYA 3U3GA 1Z6RA 4X0GA 3EGUA 1DLOA 2CV2A 3DLHA 2HXIA 4LNPA 1ZBIA 3CCLI 4I0BA 1S5JA 3QBXA 4E6KG 3CC2N 2K86A 1KVCA 5HY6A 3KVGA 1VZ0A 2C0IA 2AHQA 1SZ2A 3CCYA 1YITI 3EG1A 4PJOG 1WHJA 1QLYA 2LSNA 4DTNA 3BG5A 3G7ZA 3MN9A 2OJED 4JKAA 2HB5A 4JNEA 3UB5A 1MNDA 2O9LA 3HFNA 2RQPA 3ZQ7A 3CCVA 4B23A 2L89A 4MO4A 1NK8A 4XK8E 1RT3A 4X1EA 3CCRA 4PJOE 2BBYA 1W5TA 1QVGM 4G94A 3JB9J 1RTIA 2KROA 3ID8A 4MLEA 3VF6A 2YNHA 5GMKj 3JSPA 1F4KA 4TSXA 2NNWA 4CD1A 3WTUC 3FHGA 2TRTA 3CCJA 2PVGB 1GLAG 1KG3A 2CUEA 2EPFA 4LFCK 5A0LA 3FWEA 1RLQC 4PKIA 3R9PA 1EIFA 2E5NA 2VGMA 5E3NA 2V1QA 3O3KA 1XPXA 3B6AA 3CCQA 2EKHA 2RM4A 5LJ5f 2JK3A 3DU5A 1E0EA 3J81E 5GAHJ 2HQRA 4QTRA 2AHJB 2EKOA 1B34A 3PX4A 3PSIA 4QVDA 3AA5X 2M4GA 2ZQBA 4CK3A 2OFKA 1Z7UA 1T56A 3JTGA 4CEZA 4FZXC 2L8DA 2D6FA 4DEYA 1ZUYA 3HSEA 4M9XA 4NZGA 2C6YA 5AQQA 3OW2M 5LMUK 5DM6L 3G71T 5C25A 3ZSWA 1FYLA 3IS9A 3A5ZB 5M1KA 3HSRA 1UGPB 3KTQA 4G7OF 2M16A 1YG2A 3NQOA 3G4SA 2Q97A 1NH3A 1VQ6N 4BJTA 1A5VA 3P9CA 1R0AA 3SMSA 4JX4A 3F9MA 3KLHA 1Z25A 1OCRH 2EYWA 2QQSA 3K4JA 5AQVA 1RT4A 4CJFA 4BRCA 2HBMA 3F8BA 2DTOA 3THWA 5D8LB 3S8PA 2P9PB 5ICGA 4XKBA 4M78D 2YPRA 5GAN3 1FYMA 4HSBA 2YUSA 4BI4A 1SL2A 4BY9C 2JPSA 4GFBA 2XMFA 1TUCA 2ZSHB 4BG9A 4HNVA 3A1YA 4PLIA 4IBNA 5GAEP 4CJVA 2L9SA 2F4OB 1GOCA 2D0OA 5HDGA 3EG3A 2L9NA 3E9LA 3ZN0A 2DXIA 2O8DB 3GPLA 2CP5A 2KI7A 3FXOA 3EEQA 1E17A 3ZEUB 4BEHA 3L2QA 3EFRA 2B7EA 1KC8O 3GG4A 2PFBA 5KN9A 1KXPA 2KBTA 2C0OA 2OANA 1WHMA 4BY1J 1VQLA 1BIBA 4LC9B 3ZFJA 4GY2B 1SD6A 1YIJQ 3CJ9A 1UMQA 2Y1IA 4PKGA 4JAXA 3VS6A 4FLWA 3C0CA 1OJLA 3BWGA 3CPFA 4QCLA 1MW7A 1KQSA 1U9OA 2YDLA 3LZIA 3TP3A 2FYKA 2NXNB 4K2EA 5A0GA 5J40A 3EHRA 3RMBA 1UELB 1BKBA 2FX0A 1OH5A 4CJEA 1RBTA 1C6VA 4J00A 3BY5A 4NCBA 2G8KA 1KLMA 4BWJA 4OIOF 1HLUA 4IRIA 4Y17A 2WY7Q 2NRRA 1GXIE 4KTZA 1NJIU 3M58A 4M77C 3FXRA 1GVDA 1SKUB 1XN7A 4ELZC 4I0AA 5E17F 1FOKA 1YX3A 2Q2EA 1IXDA 1SD7A 4B9NA 4C8QA 2IS4A 2FBVA 1IRGA 4DQPA 3SWNC 2LR8A 5EG2A 5AQFA 4IVNA 1VSFA 3V9WA 2LQNA 4JEPA 2KYMA 3CCLN 4W5TA 2M7BA 1OH8A 4JI2K 4CZLA 1N39A 2A5YB 2LOOA 2RN8A 2KQWA 1Z9CA 4E7SA 4HW0A 3FM3A 5IPAA 2O8XA 2Q8KA 4M77A 4A3MJ 3EG0A 1VQLQ 2H56A 2L4AA 2PMZN 3FZFA 2EB7A 5HLFA 1NGBA 1TZLA 2M0OA 3F3XA 2Q31A 3OHRA 3I4PA 1XOVA 1MHNA 2JUFA 3TSUA 4J2AA 3O9SA 1IN6A 2KKZA 3HB9A 2HNDA 2KNBB 5DS9A 4WCIA 2Z1JA 2DK3A 1NGFA 4L9TA 5EXWA 3CD6I 4RGUA 4DV6K 4A2AA 4JK8A 4LN2A 1DUXC 4CC2A 1Y97A 2GWJA 1MJ9A 5CPRB 3CCRQ 2P9SB 1T0FC 1B3QA 1ZHIA 4TVRA 2EWNA 1QSLA 1VF9A 5F2RA 3W6JB 5CYVA 2ZPHB 4HG2A 5E8IA 4RB2C 4RG2A 4EGYA 2LSOA 2QWMA 4BACA 1W7PB 1I0CA 3VGKA 3IAS2 1VQ4N 2IDOA 3GZ6A 2X85A 1RL2A 2HF3A 2O4XB 4EMKC 3ZSYA 3CMMA 1TVRA 4LMYA 1RUWA 3O6BB 2GELA 2E5LK 1OR7A 1BQMA 2DPUA 1U2VB 5EY4A 5IP6A 2F2WA 3ZRGA 1KQ1A 1VQMA 1GLLO 2NVXJ 5LJ5h 3Q7BA 4HXJA 3D7EO 4R79A 2DXCA 2E5KA 3KLOA 2GIVA 3BR6A 1FTZA 3CCQQ 3BGRA 1KQ2A 2KMUA 3LH5A 2JG6A 2E7XA 1BIZA 1WHGA 4XAXB 4CH7A 2F9WA 2QM3A 5I11A 3GFMA 1B4AA 8AT1B 1PDNC 4M3ZA 2D0BA 1Q82R 4CZMA 5LBQA 2EQUA 2K2MA 2ZPEB 2Y30A 1QSSA 4QS9A 2P0WA 3K69A 3UA6A 3DTEA 2OTLI 3DOLA 1XC9A 2KISA 4JI7K 4WWCA 3JRFA 1KK7A 2OUMA 4MGRA 4RW7A 4AHRA 4H0OA 1HQCA 3RCOA 4E0DA 4M7DF 2O8CB 1QQCA 4DNCA 4FLZA 2A5WA 2XRNA 4B09A 2V52B 2RJFA 3ZSOA 2X9HA 3HHGA 2BVMA 4ELUA 3N0UA 3NGPA 2GTOA 2QQRA 1ONVA 4YFKF 2V8IA 4DV3K 4MO7A 2B0LA 3GO5A 4K42A 1I5ZA 1WBBA 3CC2Q 2DA3A 8ATCB 3CDIA 1VQPI 3ERED 4F91B 3CCMI 4N47A 3PO2J 1GL5A 2PMZA 3DLAA 1SV5A 4N76A 4RB0A 2DMNA 5HRNA 2DA7A 1UHSA 4LIUA 3AG3H 3AVHA 1HKGA 2EBIA 4AU7A 1T3SA 2JA8J 1IKVA 1NYFA 4II1A 2O6GE 4FJHA 3NE6A 3CCLA 3FHNA 1XQHA 3MKZA 1TT0A 1Y1WJ 4Q5VA 3ABKH 1B92A 2VL8A 3AGRA 4HT9A 3CCSQ 4AM3A 1NG6A 3I58A 2GXBA 3CDHA 5D6YA 4LSLA 3MKWB 2QAZA 5BR8K 1WUAA 5K5OA 5ICCA 4FIBA 4AIDA 4BGAA 4YEJA 1BI4A 1R71A 4FL6A 5EG0A 4CCJA 4IG3A 3W2VA 3GZNB 3TABA 4DTSA 3GBTA 2F96A 3QICA 1E6GA 3DBHB 4AFQC 1O3QA 3KUFA 3AVKA 2NOJB 3PIOL 3NHGA 1H8AC 5KPZA 1S22A 3G4SI 4DB3A 2DOFA 2NVQJ 3PQKA 4J7IA 3EFSA 2R7RA 3JXUA 1OU8A 2M51A 2EK5A 2OV7A 3FXMA 4FWNA 3OBWA 1X1CA 5LJ3j 2DMTA 5D6EA 2RQQA 4XRSG 1OCZH 3DJCA 2Y9YA 3OS1A 2Q1NA 4JHDA 2L3PA 2W42A 4A3IJ 1VQ7N 2AK5A 3EGDB 5LY3A 4FXDA 4LG3A 3R6MA 5CR4A 3LP1A 4F7UE 1N77A 1KAYA 1BR4A 1XMQK 2M0CA 4QPOA 2NRXA 1NKCA 2R5MA 4ZTFA 4B3AA 2TDXA 1FMWA 1NK2P 2Z99A 3JCMg 2D8HA 1VQ8Q 4ZGJB 1YJWA 1OYIA 5HLTA 1DP3A 4CDGA 3S6IA 1FXXA 4JUVA 2W25A 1E3OC 2A68F 2CZ6B 4ISFA 1ETVA 2PFUA 1S5LC 3DKYA 1ZN2A 5IYBJ 5GAN2 5GAN4 2DBBA 4RDUA 1VQOQ 5DPKA 3C12A 1IHVA 3JSMA 5J1UA 4RTUA 2JA6J 3LSPA 1W0HA 4J9GA 2M3AA 1FNNA 5FKNA 3Q5FA 4CGJA 4C0ZA 4OP0A 1YVUA 1F9NA 2COYA 2XDBA 2CQKA 2I0NA 5KE3A 4NYNA 4NUBA 2LF7A 1OISA 2D1KA 4A6EA 1VRTA 3S41A 1QMCA 1YT3A 3KK1A 1G3SA 3M1CA 3L09A 2EBPA 2KK4A 3CCET 2EFIA 2HMPA 3JRZA 3LDLA 4NC7A 2KIUA 4PSWA 2ESWA 1YQLA 4PL6A 1NLVA 1YNZA 2QQBA 1Y0UA 1B34B 2NOLA 4FJLA 2AZVA 1G99A 1DGKN 1FKPA 2DBMA 4BQQA 3OIPA 1GHCA 4CIFA 4KUMA 1GUUA 2V1XA 1W2BS 1SFKA 1W7PA 3GW2A 5GAEJ 2JHJA 3ZP5A 2KRMA 2F6CA 3TU5A 2F9TA 4KB0A 4ESBA 2KSSA 3OSSC 4A2UA 1IBKK 5F04A 2A42A 4A62A 4C92G 2KRSA 1WPKA 1YI2I 1XNQK 3K7AJ 3T9NA 2L3QA 3EE8A 2EJ9A 2DFEA 3DB3A 4HYEA 5MLCQ 3KEQA 2CMPA 4A4FA 1FMVA 3L0QA 1YJ9T 1QVUA 3DKWA 2EIJH 1B59A 4XRMA 3UPUA 2K3YA 3VYUB 1GDTA 4FL9A 2E6NA 1R1TA 1Y64A 3HRTA 4JD2A 1IRZA 3W3CA 4JI4K 2YNGA 2FPDA 3EN9A 2BE2A 3VODA 3QDKA 1YIOA 2HHQA 2ID6A 4D5CA 2RK1A 3S14J 1EH8A 5H1SQ 2JHNA 3M0RA 4NQWB 4EMSA 1JE8A 4OFAA 2D0QB 2FBTA 3BP8A 4CZCA 4DEXA 3TAEA 5DUKA 2OYQA 3LSGA 1MDMB 4FM1A 3TTFA 1LMZA 4ZYDA 5CZ2A 4XN0A 3CBMA 1QHGA 3AG1H 1WXUA 1W0UA 1MPGA 1RABB 4DTOA 3LGFA 3CC2A 3QU6A 3I54A 1GLEG 4LUEA 3LDQA 1V3FA 4KFCA 2AO9A 1KTQA 1RI9A 1ETYA 3RKWA 4FM0A 2OCEA 2WB1N 1T7PA 3JW4A 2A5XA 3CCMN 4OFEA 1Q9XA 3DP7A 1MWMA 5SWMA 2LNHB 4KTWA 3ZBDA 3TOAA 1VUBA 5E1WA 2XRLA 1JLBA 2EWSA 3QEXA 4M73A 4BRGA 2F4IA 1SMTA 1PYVA 2X6YA 1VQ6T 1AVZC 4RM2A 1S1UA 2ZJ2A 2D1VA 2W57A 1JJ2P 4FWLA 3FBIB 1ZTRA 1HNXK 4IPAA 1U3EM 4XLNF 1KG2A 4V2GA 3LQQA 2RQUA 2HQAA 4LFUA 4BAYA 2IEKA 4CI0C 4CF1A 1OCTC 2E1MC 4BS9A 4WXHA 3F23A 1U3OA 4C92F 2DW4A 1JXSA 4ORZA 4QLCU 2WAFA 1C0MA 2KQRA 4C92B 2QGGA 2K5IA 4IOXA 3CC7N 2Y1JA 3MN7A 1PSFA 3LA7A 2FZGB 3ZXSA 3VESA 2L02A 5HLGA 3MN2A 3SQ1A 3I71A 1Q82U 4DS5A 4LLGF 3R8EA 1GLCG 4XIUA 1SVMA 1IGQA 3THVA 4JX5A 4WCEL 4PFZA 1UTIA 1UHWA 4B43A 4M7AA 3EFOA 1YI2T 1JL1A 3FXJA 3I56Q 3H45C 1VFCA 2ISYA 1PD0A 3NF9A 2XGCA 3G6EN 2ECZA 4B8XA 1SG5A 1TV6A 3FBNB 2DZCA 4BRIA 3WXLA 2JN0A 5TKYA 1H92A 3CWUA 2OTLA 3H1CA 1T95A 3FJPA 2FQ4A 1MMAA 4Q5WA 4EM0B 1XGNA 1JXEA 2L4MA 3EO3A 3CCUA 4OPHA 1N8RU 2K4BA 5FROA 4CGIA 3HTRA 5AQYA 2PLYA 4KN7X 3SD4A 4JN4A 1B9MA 3MDQA 2X35A 1X27A 3GUDA 5J26A 1PRMC 3N5NX 1Q7YR 4H0VB 3LWHA 4I01A 2DODA 1RAEB 4IOAF 3JREA 2JPBA 3A0BC 1XGOA 3QNOA 4BRQA 2EJGA 2I8DA 1DEJA 2JUCA 3HDDA 2BW3A 1QVFM 3C3WA 4NLBA 1HJOA 2FLOA 4A63B 1ZQ3P 1LWCA 1ETQA 2CUFA 5KE2A 2XV4S 4M78A 4H0YB 3BCBA 1P92A 5DM7L 2RREA 3BJAA 3L6QA 2E2IJ 4LITA 3ITHA 3MEDA 4PSXA 2YV0X 2LKXA 2VQHA 3CD6Q 1R7JA 3TMOA 1VSEA 1OPKA 1WWXA 5KK1A 4RAGA 4EV0A 3A02A 1EWQA 3MP8A 6PAXA 3VYTB 2GEMA 5CE3A 3REAB 4J2EA 4M75C 3ZN1A 2X78A 1RDBA 1P6RA 1RRSA 5GANd 4A4HA 2JTMA 4F17A 1TSFA 3MCAB 1TTYA 4HVUA 3M57A 3H5NA 3ZT3A 4M7AB 4FJKA 3HUGB 3PFYA 1IAWA 1PUFB 5CQYA 5FWCA 1KU7A 1T3LA 3JRDA 4XSXF 3MP6A 3J7ZO 4DFKA 2BVLA 3H0DA 4JI0K 5IH2A 2LFBA 1Z77A 4CJKA 3BTJA 3LWMA 1F1ZA 3URGA 2YNIA 1LPQA 4XQ3A 3RSEB 4KTQA 3A2FA 1XMAA 2D0CA 1X3WB 3AAPA 5KI6A 4EIAA 4HUFA 2V8JA 2COWA 4L9JA 3QXEB 1PC0A 2DA5A 2Y90A 1CF7B 1W2BA 4J9EA 4IFYA 3UR3C 3ZOBA 1S72T 4Q48A 4A5AA 2ZJQF 3DWLE 4C8MA 3ZETB 2VCPA 2ME6A 3HOVJ 3A5OC 5LHHA 2JT4A 3I55T 3HTUA 4XTVA 2ZXHA 2YLCA 4B08A 2HYFA 3JCMh 3GCMA 4XU3A 4E9FA 2L54A 5DV5A 1HSJA 4HX7A 3BG3A 5CKFA 1OKRA 3V4GA 3ZMTA 1ZQ1A 2RMOA 4DGWB 3DAWA 4H5NA 4MLOA 1AWOA 4GYIA 4E1JA 3V81A 1I6HJ 3OV8A 3TARA 5EZGA 2QLZA 3WXIA 4FJ5A 1RGIA 4R1HA 2JGUA 3EZWA 2LJ3A 4CFBA 3CC4N 1YN8A 1T03A 2GWKA 1QVFP 3ZMVA 1D09B 2YUNA 2K7AA 2K3FA 1TLHB 2OAZA 4O44A 4ME7A 3FKIJ 4DS4A 3L42A 3SQ4A 4FO0A 5F0FA 3J7YP 1FEXA 3HG9A 2QASA 1MUNA 2OPSA 2P8TA 2R5YA 2MOXA 3KFWX 1V1CA 4HTUA 4IOCL 2PQ8A 4OMNA 3HPGA 4UVBA 3CXCS 3CJCA 1DU0A 1U45A 3VS7A 2HHHK 4RTWA 1A31A 2HSPA 2RO0A 1DTQA 2F4VK 4EAHD 3CCSA 2COZA 1LAWA 5K5QA 2AZSA 2JQ7A 3OYFA 3OMYA 2XHIA 4JJBA 2R7WA 2XB5A 1SHGA 3H36A 3ZT1A 3PMIA 1WNLA 1S7EA 3LAKA 2LDUA 3MZHA 3TO7A 2QSHX 4B9VA 4BJ5C 3WEEA 4HF0A 1MGTA 4KH0B 5F0HA 1ZC6A 1WJFA 5AQXA 4WYBA 4XL9A 3DLRA 1M8VA 3FXUA 1SAZA 1IG7A 4AHVA 2HQ5A 4HVJA 2HNYA 2A61A 1HXDA 5D7UA 4DHYA 1EF4A 4OMFB 2YUPA 1Y96A 1U1TA 1YI2N 4FK2A 3TDZC 2F5DA 2QW9A 3MX2A 2VXEA 1UAXA 3L2VA 1WXBA 3FX3A 4J6WA 4HCKA 1YWOA 3QNNA 3MKDA 1J53A 3H92A 1UHFA 4FSXA 3CO6C 4A3CJ 5HOOA 1PD1A 3WGGA 1TUYA 2LY2A 1JEGA 2BZ8A 3DPLC 4KIBA 3CCQI 1FJGK 2DN0A 1X1DA 1K61A 1JUPA 5DEQA 1KONA 1UDLA 2BKDN 3CCQT 4M71A 4B9SA 3BUZB 1Z0XA 2P5LC 3CC2I 4J9IA 4W5RA 1GV2A 5D5VB 1MGQA 3PNVA 3VTIA 1QZZA 2LF8A 3MMYB 2NRAC 3RR7A 2JNGA 2P7CB 2K02A 4DR5K 1IG9A 3J7AO 2CH4A 4LD6A 1HKBA 4JI5K 2PAVA 3AVBA 3S6WA 2E5ZA 4DF8A 3AVCA 1UZCA 2LMJA 3E6DA 4OB1B 1CZ9A 2EQIA 2XHKA 1KD1U 2RGVA 1BCOA 3G4ST 1X9JA 5IY5H 2GTJA 1STZA 1ETOA 2B63J 3MEGA 2NRHA 1ACIA 3I0SA 3AA3A 1P2FA 1TW3A 5IOZA 2ZCFB 5GANf 3GOXA 3F21A 3HSCA 3ZQCA 2DRMA 1Y71A 3QKJA 2CGPA 3HOZJ 4B44A 4BYYA 4BBSJ 3TL4X 1IKWA 1UB4A 3ZEHA 2DKGA 4CJWA 4Y28E 4RB1A 4WTOB 3ME9A 2IG0A 5ADXA 2FMLA 2UZKA 3KLIA 1TWBA 1N33K 4NCGA 2XY8A 3ZQLA 1R5ID 1ASUA 5FLVA 4RTZA 2HBKA 1KO9A 2CZ1B 3BPXA 1IXCA 1SPKA 3K4MA 1WSIA 1OOTA 2KQ2A 3JCMd 1CQTA 4IDHA 3FZKA 4CIGA 3JCMQ 1H8KA 2JMCA 2BIVA 3QLHA 2K5FA 2GIZA 2P4WA 1RBRA 3FISA 2KT1A 1OR7C 2PBIA 1RDCA 3CYMA 3VS2A 4A5NA 3IRRA 4HLYA 2YUOA 1QPIA 5KCMA 4EMKB 5DK5A 4C1NI 5LFAA 3Q1JA 2VKVA 3I53A 4IFVA 2M4KA 4C8QE 2HGCA 3E3VA 4OMLA 3A5NC 4DQRA 5D5UB 5GAMj 3DKXA 2HL3A 4CC3A 3AV9A 2BY1A 2KIQA 4LGWA 3ZPLA 1YITA 5IHIA 5E41A 2G7HA 1ZREA 3SI6A 2LH9A 3F6OA 4PJOA 3HM8A 4DOWA 1QS4A 3SYTA 1VHXA 4AFSC 3C7NB 4MFDA 2K9MA 1TS9A 1J5EK 1CZAN 1J3TA 2MBFA 2HKNA 1VA7A 3LWFA 4F14A 2QWOA 4M42A 3DWLA 3SAHA 1XX5A 2FUG2 3IAYA 1O3SA 3PO5A 3IKTA 4HV6A 2BYVE 4IDKA 1EJ9A 5F1XA 2QEXN 1SANA 4B24A 1AWXA 5KYWB 4JZ4A 2XAFA 2ZD1A 4A0XA 3C94A 4BKXA 5HDNA 4CRIA 3G4SQ 1PM3A 5DLOA 4CZJA 2RHKA 3L9FA 2KEAA 4CW7B 3P38A 4FWOA 4FX0A 2DLLA 4C0DC 4E9EA 2Q0RA 4FJ9A 5AJ3K 4C30A 4XLCA 2EFOA 3QYFA 1R00A 4XK4A 3MCPA 3M07A 1LNXA 3HXMA 2JXBA 4ZN3A 2IIRA 3M59A 1SL0A 2HVHA 1U6GA 4H5RA 4ZDLA 2EH3A 3HOYJ 1RBUA 4CVNE 3IAM2 1EO1A 1M1EB 2IPOB 4IF4A 5EEAA 3ALYA 4DYRA 1KAXA 3NAEA 1IXSB 5GJVB 1BN5A 1YITN 1QO0D 5GMKi 1VQ7T 1SFXA 1IREB 2HNZA 2G8HA 3V1QA 1YJWN 4DMNA 4RMNA 3T5XA 2ZXIA 2IA1A 1MMDA 1M27C 3C65A 2P9KB 2K79A 2QUFA 5CJ9A 3TEDA 3QMLA 3SMPA 5BRHA 2GQVA 3V42A 1G2BA 1ZXOA 1NTCA 3BF3A 2KL4A 2ZJPF 2ZGWA 2V79A 2OPTA 3LX7A 1JJ6C 4NYFA 5CHIA 4Z4EA 4B47A 3C0BA 1H3ZA 2KR3A 1H641 3M0SA 4N0BA 3AARA 1FOXA 4BY6C 4J9HA 4UNFA 4YOVA 3E1SA 3LAMA 1OCOH 3K4BA 3MAQA 1R5HA 2XD0A 4KN4X 3WGIA 1RCHA 3QEVA 3VQBA 1ZRCA 1GOAA 4NDLA 5C2DA 4KIFA 2CSIA 5AQNA 1M1KU 1J5OA 2DVJA 3A0IX 3I0TA 4P96A 1ZKGA 3BTCA 3W3DA 4OLBA 1HNIA 2LKPA 3VPRA 1FSEA 3TP0A 2ECBA 2DOEA 3CFRA 2WV0A 5FU6B 2IC3A 4KMUX 4GMJB 3AHUA 4EATA 4WCGA 3SBGA 4PFPA 1K9MR 1NGCA 4NXNK 2NOBA 1DT9A 4BD3A 5LJ3h 1XSDA 4G1QA 3OIQA 3DMJA 4AD9A 3VGMA 2STWA 1JT6A 1TUDA 4II3A 1N8RC 3UE5A