3OYEA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound2
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyeA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyeA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyeA03
5KE2A 1WJSA 2QK9A 1ZBFA 1XHZA 1IKWA 1KVBA 4FLVA 3NF7A 2X4WA 4N5SA 3G10A 3CFRA 4CESA 2RHIA 4EP4A 1CLQA 4M3ZA 2OZSA 1QQCA 4FU6A 2OPQA 3K59A 1JXEA 3META 4FLWA 1RTHA 4FCYA 1BISA 2RI2A 2YHBA 1SKWA 2AJQA 2KFZA 4DFMA 3OQ5A 3K2PA 2DIGA 2HHUA 1RT7A 1LW2A 3LAMA 3DOKA 3P8HA 4I9LA 3PX0A 2BGGA 4J2AA 3TR8A 3O4QA 3C95A 2HNYA 4KAZA 2FBXA 3SUOA 3HP9A 3HL8A 3M8PA 2RJEA 3NDKA 4CHNA 3P5JA 4CE9A 4E7KA 3NH0A 4CFAA 2L3RA 3QIIA 4XIUA 3SD4A 4W5RA 4B9WA 3TARA 3H8ZA 3QKJA 3IS9A 2FBYA 4QW2A 3OYAA 4NZGA 3S3NA 3UIQA 4HTUA 1OYXA 5HBMA 4LD0A 1W9HA 3TAFA 4FW1A 3SUPA 3AA2A 4E0DA 5C42A 4M3UA 1RTJA 2RHZA 2I5JA 4KREA 2K3YA 2HNDA 4FZZA 1B9FA 4CF0A 2ATQA 3L2WA 1KTQA 4MQ3A 1A5VA 3OYDA 4B9NA 4KO0A 1T7PA 4IFYA 2O4XA 5FROA 1G5VA 3NFAA 4CF8A 4BDZA 2XY5A 4DSIA 4GMJB 3OYHA 3AVGA 2DAQA 4RW8A 4W5NA 3QLHA 1RTDA 2D0BA 1KVAA 1KCFA 4CHPA 4C8OA 4N76A 1ASUA 1KHCA 3OYEA 4B3OA 3AO1A 3UWNA 3M8QA 3RMAA 1EX4A 1WSEA 1HRHA 3GOXA 2M0OA 4DTSA 3PO5A 4KPYA 5KGXA 3NF9A 1KLMA 3OA6A 4N41A 2E5QA 2R7YA 4BDYA 3DLKA 3LPTA 1SSFA 1UA0A 1BI4A 2R5AA 2X74A 3L2UA 3LP3A 4O5BA 5C25A 4LH5A 1A5WA 3WNEA 2W42A 3H6ZA 4Z4IA 3O3GA 4IUUA 1U04A 3LLRA 2RF2A 2RHYA 3MEAA 1TL1A 3V9WA 4E7HA 4KRFA 3KLHA 3ZEHA 3I0SA 1NJWA 2BKDN 2IG0A 1S9GA 3ASMA 3FLGA 1IKYA 4IUPA 4IUVA 4B9LA 3QEWA 2BDPA 4DF8A 1OZ2A 1YTAA 1EETA 3U3YA 2X6NA 3DB3A 4CGIA 4EP5A 3LGFA 3LP2A 2Z1IA 1LWEA 2P0KA 1VSDA 5IAYA 1I39A 5J2PA 4HCZA 1GOBA 3AO2A 3K5LA 3NHGA 3SQ2A 3C4SA 1MHNA 3OYMA 1RBUA 4DLGA 3OYBA 4FK0A 3B6PA 1RCHA 3MEEA 3L2QA 4CJTA 4L8RB 3EY1A 1UA1A 1SUQA 2M16A 3NF6A 4C8KA 3RMCA 3NTKA 4B8CA 3FFIA 4N4HA 2NLUA 1U4BA 5D6YA 3KJVA 3QEXA 1CZBA 3CM6A 2VYTA 1NK7A 1O1WA 3LP1A 3V9XA 4OGCA 2HHSA 2HNZA 3MP6A 1FK9A 3AO4A 3SZ2A 1BIUA 1BCOA 3Q1JA 3MEWA 1ZBUA 1S1UA 4QOZB 4E1MA 2HMIA 1BQMA 1CXQA 4PQUA 3IG1A 5KE3A 1HMVA 3VQBA 4LD6A 4N47A 3ZSWA 3ZSRA 1REVA 1VSIA 2FHDA 4PL6A 2XY6A 2MWPA 4NCBA 3NH1A 1X9MA 1VRTA 3ZSXA 1NJZA 2NUBA 4OGEA 4GW6A 4DWIA 1SL1A 5C0MA 4PA1A 1TKTA 2G8HA 3VQ6A 2LTOA 2GV9A 1JLCA 1SKRA 1X1PA 4M42A 4JS4A 2Y1IA 4QQGA 1RT3A 4F8RA 4FJGA 3E9GA 1L5UA 1L3VA 1VSHA 3U6FA 1JL2A 4CIEA 2OA8A 3O8VA 2D9TA 2GBZA 4FJ5A 2K3XA 3HM9A 3HJFA 1NK5A 1FKPA 4CGDA 1XWLA 3P83D 4AILC 3FEOA 3HVTA 1TK5A 1LWCA 4FJ9A 2B4JA 4ZTFA 4KB0A 4BWJA 2Z1GA 2E4LA 1WSFA 5FRMA 5I42A 4GY5A 1ASWA 4II1A 5T7BA 3DLBA 4FYDA 4OPKA 4FJ8A 3L2RA 4EDUA 3EYZA 4N4GA 3AA3A 1NK0A 4CEOA 2P51A 1NKBA 1WAFA 4DFPA 2EKOA 3P8DA 4CJUA 4DU1A 3DB4A 1TKDA 3NTHA 1RT1A 1WSIA 1S1XA 2JLEA 4AHRA 1RT5A 3RMBA 4OVLA 3MXJA 3NF8A 1JXBA 1WN7A 4DTUA 3NTIA 1UWBA 3VA3A 3OYIA 4I2PA 3M9QA 2PY5A 3NBPA 2XDPA 4BWMA 1WGSA 4BE2A 4ELUA 4BD3A 4CHYA 2QXFA 4CGGA 4DU4A 3MEUA 4Z4CA 4B08A 1D5AA 3LGLA 4DTMA 4J2DA 4O4GA 3HXMA 4CIFA 3QBYA 1QSLA 2JTFA 1RTIA 1S5JA 4IBNA 4FJXA 4C5IA 4ELTA 4E7LA 2ZD1A 4DSKA 1J9AA 1U49A 4CGHA 3OVNA 3LH0A 4FZXC 4EZ6A 1Q8IA 1I3AA 3OJSA 1OZ3A 2DTUA 4CCHA 2HHWA 4B9VA 3SQ1A 1TVRA 3MP1A 2HHVA 2KZMA 1TKXA 1JLAA 5I3UA 3TANA 2YHAA 1C0TA 2RN2A 2GUIA 1T03A 2GF7A 2WOMA 3VQCA 3OS1A 4FJMA 3M8RA 5HROA 3C6TA 4FM2A 1NKEA 3AVHA 5C6SA 5CYMA 4Z4EA 2L89A 4Z4GA 5FRNA 2G8IA 4KB1A 4CJ4A 3HO1A 4HCCA 3I8DA 2RJCA 3VQ8A 4I2QA 3NGZA 5J2QA 4I7FA 1NK8A 2QQSA 2RPIA 1K6YA 2QKBA 3AVFA 4CJFA 3HYFA 2Z1JA 3MP8A 4CJKA 3RTVA 5J2MA 3QNNA 3TAGA 4BACA 3O4NA 4CGFA 2YV0X 1S6PA 2YRVA 3LYIA 1WJQA 2VG5A 3QEPA 1QS4A 2VG7A 3AV9A 4Q5WA 2X4YA 1RBSA 3D45A 4IUQA 4B9SA 2L8DA 1BIZA 4PLLA 3ME9A 2B5JA 1A5XA 3CYMA 3L8BA 4CEZA 1B9DA 1WSJA 4GVMA 3DRRA 3OYNA 4M3XA 3ZT3A 3QETA 1IO2A 3V9UA 2MWOA 1J54A 4HUGA 2G8WA 2IAJA 5KGWA 4DMNA 4FJ7A 4CF9A 3LZIA 4W5TA 3IRXA 1TAQA 1IH7A 5HRPA 1VSKA 3EZ5A 5D6WA 3TWHA 1ZBLA 3OS2A 4I9QA 2BE2A 4B8AB 4EZ9A 2OYQA 2A1RA 3RMDA 3NAEA 4DQRA 3V4IA 1Q9XA 2JZ2A 3KLEA 3SNNA 1Z25A 1MU2A 3L3UA 3VQQA 3ZCMA 1Q9YA 1NK6A 2LSNA 2HVHA 4ZHRA 3TAQA 4KHYA 2IGIA 4DS5A 3VN5A 1WSGA 3AVNA 4FLYA 3IAYA 1RILA 3MXMA 3AVIA 4KHUA 1RBTA 3NH2A 3LAKA 4OVAA 4AHSA 4Z4FA 4KTZA 4KI4A 1C1BA 3ZSVA 2R5MA 4CEQA 2RHXA 1IKVA 3ZT0A 4CECA 3SCXA 4FLTA 4C8MA 2CKKA 1WSHA 1XI1A 4DTRA 2M1HA 3WNHA 3AVLA 4DFKA 3E01A 1KSPA 1UOCA 1J5OA 4E89A 3PMIA 4O55A 3OYFA 2QKKA 3AVAA 4PWDA 4KTWA 1QSYA 4A4EA 2X6SA 4MFBA 4CERA 4Q5VA 2G8VA 3ZSYA 2B8AA 2VG6A 1VRUA 1HPZA 3D0PA 4JLHA 3VQPA 3VQ4A 3T3FA 4DF4A 1EKEA 4R5PA 3CFPA 2LRQA 3DLEA 1ZBIA 3AO5A 3AVCA 1RT6A 3HPOA 2OPSA 3ASKA 1HYSA 4CJRA 2WONA 4OJRA 3CFOA 4NCAA 3SPYA 1QTMA 3OYJA 2OPPA 2OPRA 2O4GA 1T8EA 1DLOA 5CZ2A 2DY4A 3C6UA 2Y1JA 2LCCA 3LX7A 3KD5E 4DFJA 4QQDA 3P1GA 3LWMA 2D0AA 3DLGA 4KFBA 3OJUA 2BUDA 4CEBA 2KFNA 2RI5A 4OPJA 3SQ4A 1J53A 2HW3A 1RBRA 3WNGA 4Z02A 3QIPA 4IDKA 3PY8A 1KFSA 2RJDA 3SV3A 4OKKA 4CF2A 2G8FA 5KCOA 4M41A 4FLZA 2F8TA 1TKZA 3V9ZA 4CRIA 4DQSA 1HJRA 1BHLA 4FK4A 4CFDA 3DYAA 4DQIA 3QO9A 5HRSA 1TV6A 1RDCA 2IDOA 4FJLA 3L2VA 3O3FA 3ZT1A 2D0CA 1C0UA 1JL1A 5SZTA 4KHWA 3PMTA 3MAQA 5SWMA 4J2BA 4CJ5A 2HQEA 4BE0A 1XHXA 3KK1A 1JKHA 1YT3A 3TABA 4DU3A 3QNOA 1HYZA 1WJRA 2GFAA 1JLFA 4FXDA 3LDSA 2JGUA 3V81A 4FJNA 4M3TA 4DQQA 3QESA 3ITHA 4E7IA 1KVCA 2HVIA 4HUFA 1TK8A 2A1SA 3E9FA 3ZSOA 3QJ6A 4A4GA 1WNSA 1ZYQA 1NOYA 4CEEA 5CY4A 3OMCA 3PNWC 3K5MA 1LWFA 1TK0A 5JS1A 1QHTA 3QEIA 4CEDA 1RDAA 1LAWA 3KKSA 3AO3A 1X9SA 3BDPA 1EXQA 2R58A 2EQUA 5CZ1A 3S9HA 1HQUA 4TSXA 3VQEA 4W5QA 5E41A 4CHQA 1B92A 4RW4A 5J26A 4CJVA 4BDPA 3AVBA 3CQ8A 3VQ9A 4RG2A 1LAVA 4CF1A 4E19A 1XNIA 3PFSA 2IS3A 1TL3A 3UT1A 3OB9A 3DLHA 4DQPA 1GOCA 4F3TA 3ZT2A 4Y1DA 4LY7A 2YNIA 4FL6A 3B6OA 2YNHA 1BCMA 2G3RA 1JLEA 4W5OA 4HUEA 4DTPA 4FVMA 3MO8A 2DIQA 2WACA 3VQ5A 1NJXA 4DLEA 3A2FA 1L3SA 1RDBA 2FBVA 2EHGA 3TAPA 5KH6A 4B9MA 3H08A 3OYKA 3DLMA 2XO7A 3K57A 1NK9A 2YNGA 4OKEA 4E7JA 4CJSA 3PX6A 2XHBA 3LANA 2YKMA 1NK4A 4IUTA 4UQGA 4KTQA 5D3GA 3T1AA 2XRIA 4OLAA 4L59A 4DS4A 2FBTA 1QE1A 2GFUA 4OKJA 4KKOA 1KFDA 3V6DA 2KZZA 4CIGA 5DK5A 4C8NA 4A4HA 4Z4HA 5HP1A 1L3UA 4NCGA 3ISNC 4QCLA 3KKRA 4CK2A 3OYLA 3CEYA 3MXIA 3DRPA 3NGIA 4KHSA 3DLRA 4AHUA 3RR8A 4CJWA 2X78A 4M45A 2DFHA 2KW4A 3SJJA 3V9SA 2ETJA 5IN1A 3NE6A 3HP6A 5KRSA 2DFFA 4CJLA 3SUNA 3AA4A 1QSSA 4PUOA 1IG9A 1YTUA 1HNVA 4NS5A 4QQ6A 3MEGA 4N56A 3S6WA 2EQMA 1RNHA 2F96A 4CEFA 5J39A 3NNQA 3QEVA 5KRTA 4DSLA 5HLFA 2FC0A 4ID5A 4KI6A 2KQ2A 1CXUA 2YKNA 4FM1A 4DTOA 4KHNA 2E6NA 4ICLA 3AA5X 5KTQA 5J2NA 2G8UA 2QQRA 2ITGA 1FXXA 2P1JA 2P5OA 4O44A 1T05A 4YNQA 2RI3A 4CJPA 4FZYA 1VSMA 2ZQBA 1SKSA 2HHQA 3KLFA 1JLGA 1KRPA 2E6MA 4CK1A 3AVKA 4CK3A 2PYLA 3AVJA 1D9DA 1JLQA 3M8SA 1DTTA 4G1QA 3K58A 1U47A 4IKFA 4C8LA 4WE1A 3NCIA 2HHXA 3SQ0A 2HQXA 2DFEA 3SI6A 1C1AA 4M3WA 3ULDA 4E1NA 3BGRA 1RBVA 4NYFA 1WAJA 2RKIA 3L42A 4RW6A 1C0MA 3HVRA 3TI0A 3DI6A 4J2EA 3MEDA 3HK2A 4IFVA 4ELVA 1TGOA 3SYZA 1WLJA 4ID1A 4QAGA 2PYJA 3U3GA 2B6AA 4CFCA 3F9KA 4K8XA 3KIOA 1G15A 2F5KA 4FW2A 4FM0A 2G8KA 2Q3SA 1D9FA 4CHOA 3V1OA 3PX4A 1H3ZA 2HB5A 2D5RA 4A4FA 3ALYA 4RW9A 1ITGA 3S3OA 3OYGA 4IG0A 3HPHA 2EX3A 2KTQA 4NYNA 3JYTA 3RRGA 3KLGA 4FJKA 1N5YA 3QIOA 4CFBA 1HQEA 4FJHA 1HNIA 3KUFA 4FLXA 2XY7A 4OLBA 3RRHA 2XK0A 4H4MA 2BIVA 1SL0A 5FDLA 4HVJA 1VSEA 4CGJA 4FLUA 4KV8A 3HSTB 5HRRA 4AHVA 3AVMA 3KTQA 4AHCA 4IURA 3PV8A 3I0RA 4F2SA 3ZSQA 4LSNA 3VQ7A 1S6QA 1C1CA 4B9UA 1NOZA 3WNFA 4PLIA 1N6QA 2VWKA 5C24A 3DOLA 4JS5A 3CM5A 4PY5A 3RWUA 5JS2A 3FDRA 3C94A 4E3SA 5J1EA 4K8ZA 3O3HA 4M3YA 1BL3A 3MEVA 3SPZA 4QVZA 4DSJA 4H8KA 3CG7A 4F3OA 4F4KA 3OS0A 3BDLA 1UAXA 2PQWA 4CHZA 5KCHA 2F8SA 4O0IA 1VSLA 1N27A 4DSEA 4AHTA 1JLBA 3QINA 2O4XB 4CJEA 4C5EA 1RT4A 1L3TA 1ZBHA 4CJ3A 2EQKA 3EAEA 4RW7A 1BQNA 4C5GA 1ASVA 1TAUA 4ZTJA 3PUFA 3DMJA 3JSMA 4FJIA 1RI0A 1DTQA 1U48A 3OY9A 4H4OA 5DMRA 1U45A 5D6XA 3L3VA 4KHQA 1NJYA 1LV5A 2R57A 1IKXA 2IC3A 1EP4A 3F70A 1FKOA 1HYVA 4O0JA 2HHTA 4CJQA 3VA0A 3OYCA 3KK2A 3LP0A 1X9WA 3F73A 2LVMA 4LSLA 2LDMA 1XC9A 1VK0A 1YVUA 3TAEA 1LW0A 1Z26A 1BI4B 3KD1E 4B9TA 3PO4A 4B9XA 4DTNA 2RHUA 3T19A 2PZSA 2EQJA 5EU7A 1S1WA 5CYQA 3NGYA 1F21A 5CIUA 4X34A 1VSJA 1Y97A 1GOAA 5M9OA 4DSFA 4AH9A 4Z0UA 4FK2A 3ZT4A 4C5HA 3LWLA 1NKCA 3SV4A 3FC3A 4M3RA 1D8YA 1OI1A 4F2RA 4FJJA 1RDDA 1C6VA 4LH4A 2ZE2A 1S9EA 3VQDA 1VSFA 3DM2A 3TAMA 4HCBA 4DG1A 2Z1HA 2VWJA 2E6LA 3HT3A 3K5NA 1BGXT 1S1TA 2YNFA 3LALA 3G0ZA 3DRSA 3SUQA 4Y1CA 4DTXA 3MECA 4BE1A 2O4IA 3LPUA 3LZJA 3THVA 5HRNA 4RG8A 4JRPA 1CZ9A 1W0HA 3S3MA 5KI6A 2IOCA 3K5OA 2X4XA 1S1VA 1R0AA 3HPGA 4DTJA 1KLNA 2OZMA 3RR7A 2RJFA 3V1QA 5K14A 3ZSZA 1SV5A 1SL2A 2P5GA 4N4IA 4UC4A 2EFIA 2X35A 4JRQA 3KLIA 3QERA 4Q0BA 3OMGA 2RO0A 4YFUA 2BANA 3KK3A 4HHTA 2XY8A 4CEAA 4IG3A 3V1RA 3VQAA 1RT2A
chains in the Genus database with same CATH superfamily
5A0LA 3N4QA 3LDLA 2DK3A 4EMGA 1DP7P 4FWMA 1KVBA 1HBXG 2Q2RA 1ZUUA 1K8AU 5HY6A 4N5SA 3G10A 1IXRC 3S15J 2RHIA 2NNYA 2ZO4A 2V8JA 2OZSA 1K0SA 1NG2A 2XGEA 1QVFS 3CCRN 4FU6A 2IGMA 1FOWA 3CBOA 1RTHA 3E9LA 3FM5A 1YLFA 2YUQA 2L5QA 2HKQB 5LJ3h 2A68F 4UY8I 2YHBA 3AHUA 2AJQA 5E1ZB 4UV9A 1R6RA 3DOKA 4I9LA 1JJ2M 3I35A 3TOBA 4IO9L 2ZBKA 3C95A 4G7ZF 3SUOA 1IHWA 4C1NI 1FP1D 1X2MA 3HL8A 1JJ2P 2RJEA 1UEBA 3P5JA 4CBXA 2VC8A 4CFAA 3WVDB 1OR7C 4KUMA 2EPDA 3QIIA 4A4KA 2YG9A 1FIAA 4EMKA 4B9WA 4A3MJ 4RB2C 3IS9A 1GLDG 3OYAA 4NZGA 4BS9A 2DA6A 1OYXA 1XJWB 3T9NA 1ZGAA 3AGKA 4UVAA 5ERIA 4FW1A 3AA2A 1YW8A 3H0HA 2DF6A 2J4RA 3IKMA 3L00A 1VQNN 4FZZA 2O8BB 3O6WA 1M1KU 1VQOT 5GAMf 5LJ5j 3IAM2 1KTQA 2OCEA 4MQ3A 2DJIA 2EQIA 3ZX0A 5FROA 4DOWA 1KU2A 1U5SA 3NFAA 1NGCA 2C0TA 4IIOA 2WB1A 3RYRA 2ED0A 5DM7F 1WHHA 2VBYA 2WA0A 1M3AA 3QLHA 1RTDA 3O9SA 1CKBA 4J9EA 3CF5F 2R5ZA 4M75G 4B6MA 2LQKA 4OP0A 1Q7YR 3OYEA 2Z33A 1FEXA 4EJVA 4ESBA 1OX8A 3CJTB 3TREA 2DOAA 3ZMSA 3CCUI 3PUBA 1JU5C 2JXBA 3CCJQ 2OFIA 4FOIA 4DW6A 5DDGA 3D5SC 4A3FJ 4DTSA 3DU6A 4OFEA 5KGXA 5LJ3j 5JVHL 2EIMH 4N41A 1H1VA 4CCMA 3CCET 2L9VA 3LPTA 5ECAA 2NRXA 5BMZA 2R5AA 4PJOB 5HLTA 1O4XA 3I0XA 4CZJA 3INZA 4O5BA 1YHQQ 4PFPA 4BY9C 3CCJI 1A5WA 3R4KA 5TGTA 1X1CA 1H0MA 3H6ZA 2R7XA 1B4AA 4IUUA 1U04A 1HJDA 2VJIA 3FBNB 1QVPA 1UE9A 3ZEHA 1LQ1A 3JXUA 1NJWA 2W41A 3G0QA 2R7ZJ 1S9GA 3ASMA 1YIOA 1TQMA 1VHXA 2DXCA 4B9LA 3EQLF 1VQ6Q 3QPSA 2BDPA 3U21A 4XH5A 3DXMA 3ULEB 4DF8A 1YTAA 1EETA 2X6NA 1NLOC 4HSTA 1T6CA 1K83J 1A04A 4ZYGA 2COBA 4IHTA 3LP2A 3KZYA 2P0KA 1VSDA 1I39A 2E1CA 2F1LA 4QVDA 2LT1A 2PZ1A 3NHGA 1WBBA 5GAN6 1W7PA 2VQGA 1NLPC 4EMKC 3AT1B 1QMCA 1S7AA 3EE8A 5KN8A 1U2WA 2EJGA 3L2QA 4H0XB 1OX9A 3EY1A 3RESA 2Y69H 2QA4A 2A5YB 1R58A 4XOTA 4C8KA 4B8CA 2VODA 4A54A 3FFIA 4BRPA 1H88C 3E1YA 3FZHA 4RAZA 3A8MB 3GOIA 1SG5A 4CZHA 3KBGA 3CM6A 2VPRA 1TQIA 2DA2A 1LEBA 2ZJPL 4KGZB 5TKYA 1ETYA 2HNZA 5KAFC 1YFNA 3NMZC 3GP8A 2OPTA 3ZPLA 5IT9O 3ESWB 1W6XA 3GWZA 3RKWA 4H0PA 3BR3A 4F7ZA 4WX9A 2HMIA 2DQLA 1BQMA 2DQRA 3IG1A 5D6FA 1S72T 4NBQA 1HMVA 1IC8A 2E34A 3IH4A 4WCGA 1I4K1 3ZMTA 4PL6A 4IDHA 3GIBA 5LJWA 3H41A 4M4ZA 1Q82R 2ZSIB 3ID8A 4EJZA 2KXCA 4M77E 4LFUA 4DWIA 5C0MA 5D8LB 5ILSA 3FXMA 1K8KB 1RZ4A 2ROLA 4MEYF 3R9PA 4WF2A 1IUFA 1K6OA 4LF5K 2CH4A 4BRDA 4HAMA 1MWMA 3K4KA 1USSA 4FJGA 1U3EM 2JPSA 2QW9A 4GYGA 2F9TA 2CJJA 5LJVA 1OCZH 1M3CA 4ZYAA 2DJQA 4YHHK 4N9HA 1Q18A 1VSHA 2JUCA 4CZMA 4LDWA 1JUPA 2VXZA 3E3VA 3HM9A 1XQSC 4N4OB 2X1CA 4E1JA 2O8EA 4C8QA 5EDNA 1FKPA 1X3UA 4CGDA 4DV2K 4M74A 4E2FB 3P83D 4AILC 3FEOA 4C3HJ 3URGA 4KFCA 3JCMP 4ZTFA 1X2NA 2G7HA 1J75A 5AIQA 1J6ZA 2UXBK 2XF6A 1WSFA 2HWVA 4LF8K 4B21A 4LK0F 2Q1NA 1XN7A 3D2FA 3LSTA 2WBMA 3GDQA 1MMNA 4D5FA 2X1EA 3FXLA 1VQ8T 2XHCA 5GAHJ 4WXHA 1IRZA 2PBDA 3EYZA 2K4YA 3AA3A 4XBFA 1IZ6A 4M3EA 1NKBA 5A0DA 3UA6A 2DLLA 4Z94A 2W6KA 3VERA 2RC4A 3DB4A 1YG2A 4MLHA 4FWSA 1TKDA 5J1YA 4HLYA 1RT1A 1WSIA 2R7DA 3MFKA 2HL3A 2KI7A 2AKLA 1D3BB 3RMBA 3BQZA 2VWFA 1KQ8A 2I2LA 1JXBA 1CQTA 4A0YA 3GZ5A 2FZKB 2A7YA 5DLQE 1MW7A 4WYBA 4HSRA 3DKWA 3VPZA 1UWBA 4OX9K 4PFOA 3BTLA 3OOUA 4OMZA 3ERMA 5GAN8 3UKGA 2XDPA 2QA4N 2AXTC 1WGSA 3LA2A 4OIRF 1DIZA 1BUPA 4BL0B 3CC7T 4CHYA 1ZGWA 4CGGA 2EBPA 4BY6C 1R0CB 1YJ9Q 1SFOJ 2D0NA 4B1VA 1QWEA 3CQXA 2IT0A 5FGMA 4RAGA 2Q36A 1O3QA 1VQMI 2KGTA 3RSNA 3MKWB 2JTFA 4M7AB 2WAQA 2QI2A 4Y3OA 2AKKA 2O01E 1BB9A 1NMNA 5AQRA 3TO7A 4JKGB 2VJ4A 4FJXA 4YG2F 4ELTA 5CR2A 3QSUA 1L3LA 5JLXA 5C44J 2V1NA 2W0ZA 2O8DB 2P9PA 3VMFB 1QW1A 3ASNH 3R0JA 3LH0A 4FZXC 3CCJA 3K2AA 4DV4K 4XEIA 5BRHA 1Q86U 5CE3A 1SD4A 2HHWA 4PJJA 3SQ1A 2V9PA 2L3QA 3ECOA 5D5XB 3QAHA 2M9HA 2DERA 3TU5A 3WU0A 2NVQJ 3CCLQ 3S32A 5AQLA 3JV3A 3BROA 3LSGA 3J81O 1U9OA 2M8GX 3BZKA 3RKYA 4J9FA 3I59B 1YHQA 4GKKK 8AT1B 1X6OA 3OS1A 4OMOA 4C8QC 2QDLA 4M9ZA 1WCMJ 3C6TA 3G25A 2FRWA 2FYKA 4ESJA 3ABTA 2A05A 3BR5A 2V52B 3CCLI 1TUCA 1NWKA 4Z4EA 4Z4GA 3TW7A 2UUZA 1KD1C 2IVPA 1WH7A 3JR9A 4KBOA 4HCCA 3VQ8A 1R49A 5J2QA 1OYYA 1I5ZA 4YOXA 1ZQ1A 4YRVA 3KCCA 3M8EA 3HPWA 1YJWI 1J2XA 4ZN1A 2EINH 1RAAB 4BR7A 1RACB 3I56T 1MUDA 2DKGA 1FOXA 1U8RA 2F5CA 3TAGA 3Q0UA 4KA4A 3BR1A 3WGIA 1E3HA 3DXJF 3HRTA 4JV5K 1ZH5A 4MDAA 1XPXA 1VQLN 1WOQA 3EHRA 4IOCF 1T6SA 2YRDA 4B1YB 2EFQA 4UNFA 1YIJT 4WFAL 2ZM6K 3O4WA 2X6XA 1A5XA 5EEHA 3VESA 1WHLA 5H2FC 2UXDK 4AD9A 1WSJA 1V5GA 4GVMA 1YITT 3NRVA 3G6EQ 1HYOA 4M3XA 3RYPA 3ZT3A 3V9UA 3K9TA 4WK8F 4HUGA 1QZ6A 1JB0E 4CHUA 2QYZA 2DT5A 2RN7A 2XKPA 4DR6K 2IAJA 5KGWA 3OOPA 2PI0A 4FJ7A 4HYEA 4DQ2A 3CTAA 1K79A 1I07A 1P8ZA 2X48A 4FTHA 2XDVA 3PVQA 4AI4A 2WTUA 2MH2A 4HQEA 2ZPIB 4F52A 3ZETB 2FQ3A 4U7BA 3G4SI 5AQNA 1M4ZA 4XAXB 2BE2A 4BRAA 1SFEA 2QQ9A 3CC4T 3OBWA 3LDNA 2OD5A 3LSIA 1IJWC 2HOTA 3NAEA 1P4AA 2CZ0B 2JZ2A 3KLEA 3SNNA 1BBZA 2CQNA 2Q1ZB 3QU3A 3EH2A 1VNDA 5EZHA 2WAQN 5HNHA 2NUTB 4BVOA 5BPMA 4J01A 5GAGP 1TTHB 4YEJA 4L18B 4XLHA 2IVOA 1CSKA 3M57A 4XKWA 1WSUA 1YI2T 3IAYA 3VFZA 1H641 4C0ZA 3M9AA 1YQAA 1A31A 4OVAA 2Y31A 3LAKA 1BR4A 3CCSQ 2E10A 4FPBA 1NBEB 3CCJN 1HW5A 2VBWA 1C1BA 3ZSVA 1OCTC 3ROUA 4XQFA 2VBZA 1E17A 2EA2A 4CECA 4JRKA 4C8MA 2PN6A 5AQUA 2JPCA 1ORNA 3EFOA 2CKKA 3GTPJ 2GTJA 1HJOA 4YOTA 4MZPA 1Y0MA 4IFEA 2M1HA 1HF0A 5BN8A 3RZOJ 1ETKA 3CCSI 4FYVB 1YHQN 2E71A 1APLC 2M1BA 3BTJA 1B72B 1J5OA 4ZC3A 2LREA 1R8OB 4A3JJ 3QXEB 3JCMg 4M7DA 2DDAA 3PMIA 3X2QH 2RQVA 4UB6C 2XPVA 4KTWA 1L0OC 1YFHA 4ZZDA 2NUPA 2EA4A 4MFBA 4CERA 3ZSYA 5KVRA 1VQ6N 2BGCA 4ATOA 4EM2A 4RBOA 3D0PA 4JLHA 3VQ4A 1OEBA 3VYTB 1EKEA 3TO9A 1M2VA 2DZ9A 1J0RA 3U9ZA 4RGUA 3O1WA 2FSWA 3IQLA 1RAGB 1TZLA 2YUNA 3ZBDA 1ZBIA 3QWLA 1RT6A 5F0XA 2GBYA 3KTUA 3RERA 3PSIA 2JNGA 3G71Q 1UCRA 3EYIA 3LCNA 2JK3A 5J40A 3DTIA 1LCUA 4XICA 4JPBW 2A61A 3HG9A 1VOMA 3HXLA 1M90U 4E7ZA 1DP3A 3OYJA 1EFNA 3EFSA 3E5UA 5CZ2A 3C6UA 2Y1JA 2WC9A 1WI9A 3LX7A 2PJRB 3E2UA 1YJ9A 1HW2A 2YUSA 4DFJA 4XIDA 3LWMA 3DLGA 4KFBA 3CPEA 1N25A 4RCHA 3A03A 1VTNC 1MBGA 3OJUA 1ACIA 2WAFA 4DQ8A 2B7EA 1GBRA 1IDYA 3M6GA 3P7NA 2ID6A 5CVUA 5IT3A 5FU6B 5CHIA 2LBFB 3CCVI 1J53A 2HW3A 1IDZA 4IVNA 3H46O 3QIPA 3OTOK 4CCNA 3JSPA 5GAN3 3H9NA 3GFIA 4BQAA 3C65A 1MMAA 2XAHA 3S1QJ 3FMSA 4H5WA 3M0UA 1RKWA 5DYMA 1YBYA 3V9ZA 4OF1A 2D1XA 4XONA 1P92A 2X3WD 3F72A 4AQYK 1N9SA 2N8GA 3Q3SA 3QPHA 1ORKA 1OKJA 3QO9A 3CCLA 4ZDOA 1YTYA 4FE7A 1AVZC 1JL1A 3JRIA 4A57A 2VXFA 1JEGA 1ERDA 3PMTA 2B86A 1J5EK 3ZQIA 3BG7A 1JKHA 1YT3A 2R7FA 5CAIA 3M59A 4BC4A 3SAHA 1YJWA 1WHUA 3ULRB 3HGGA 1HNXK 3JREA 3LDSA 3V81A 4M3TA 1JJ8C 1W36C 1VQOQ 4M7DC 3S93A 4EW0A 3E9FA 4OB0B 2GZWA 2LOOA 3QJ6A 4A4GA 3S2HJ 2FL7A 4HVWA 2ELHA 5A2QO 3W2WA 4CEEA 2E2JJ 4UUSA 3PNWC 1HD3A 1WZOA 1UGRB 2BE7D 4M77A 5IT9E 5JS1A 4U0VA 5DY9A 4B24A 5GMKl 2DBKA 2Z9OA 1PDNC 2GQIA 3A98A 4P5NA 1MBFA 1LAWA 2JJ7A 1SRLA 3AO3A 5FU7C 3M3ZA 1SZ2A 2MC4A 2XRLA 2MCNA 3VEWA 3FXJA 3W6KB 3F3XA 1YCYA 3S9HA 4TSXA 3BG5A 4W5QA 3D5RC 3HOZJ 3E5QA 4CHQA 1OVYA 2MA3A 2YT6A 4BDPA 3CCEQ 4GV9A 1WHJA 2J05A 1V29B 2QLZA 3G4SA 3F8CA 3QMLA 4KGVB 3VQ9A 3G6EA 4NQWB 2A37A 1S9HA 3S17J 4CF1A 1TL3A 2R7SA 4ENNA 3DLHA 3DPTA 1QZYA 2HYJA 3A8OB 1DJ7B 4DYRA 1P4WA 3ZT2A 5AZIB 4Y1DA 2OU2A 4LY7A 3B6OA 1BCMA 2CGLA 2OTLI 3D6RA 3CCEI 3CD6T 4DTPA 4FVMA 4DV6K 2R0QC 1YJ9N 2L0AA 1TYQA 2WACA 3VQ5A 2G0EA 2GUPA 3ZQGA 2HBLA 1L3SA 2LC2A 1YQRA 5AZJA 5F1RA 4F14A 1RGIA 2YR2A 2EHGA 3JCMh 1WPYA 4M7XA 2NS8A 4KT5C 4B9MA 1B34A 2PAVA 3DLMA 2XO7A 1V4RA 2KMUA 1GUUA 1WKMA 4JD2A 3KP6A 1KQJA 4A59A 2KJBA 2DD5A 4CJSA 3JB9I 5J3LA 3TQNA 1I1JA 2EYZA 4Y15A 1WJ5A 1S29A 3B73A 1NK4A 3CCSA 2D1HA 2FNPA 3Q5FA 1VI0A 1K73O 3VF4A 1VF9A 3LAPA 1OMIA 4FIBA 2FBTA 4F93B 5CCAA 2MI6A 3VS7A 1SRMA 3JB9H 1ETXA 3GCMA 2EIKH 1KFDA 3V6DA 3TDUC 4M75B 2R7TA 3B02A 3OA9A 4C8NA 4A4HA 4Z4HA 5HP1A 3QODA 1L3UA 3CCLN 4I6ZA 4QCLA 1JUMA 3FKIJ 3KKRA 4UVBA 1G2BA 1YWOA 1AU7A 3MXIA 3DRPA 3NGIA 4KHSA 4L9VA 1NJIU 4IX7A 3DLRA 4AHUA 1OKRA 2DETA 4ELZC 5BPIA 4PJ0C 3TP0A 1QVGM 2E19A 1WJAA 3MWTA 4QSHA 2ZJRF 4IHWA 5DD8A 2DFHA 4M77C 2M3AA 1P9QC 4RS8A 1T44A 1IAWA 3FXKA 1Y0UA 2QCOA 1QVGP 3L0QA 5IN1A 4GBQA 4XRMA 3NE6A 4BRFA 5HNFA 3HP6A 4BJ5C 2DFFA 4CJLA 2DTOA 1QSSA 2CO5A 2KY9A 3D1NI 1YW9A 4FX4A 1KC8O 4H4KC 3HSFA 3F22A 4JKCA 1IGQA 1HNVA 2H3EB 4LDXA 4YOYA 4BU2A 3S6WA 1GCQA 2E35A 2HEOA 3G71A 4XH4A 1RNHA 1TT0A 2JMCA 3WU1B 3NNQA 1FN7A 2YHWA 1DDNA 2QKLB 5KRTA 3R6SA 4W1UA 2FC0A 4ID5A 3JCMd 2HZTA 2KQ2A 1ZG3A 5K5QA 4HT9A 1WXTA 5C2DA 5HS7A 3CCVA 5I21A 4JUVA 4LG0B 2M87A 2FVUA 2YKNA 2Q0OA 5C4XJ 4G8XA 3Q9SA 4DTOA 3J81E 2Z0WA 2M02A 3N4MA 3QPTA 2YG8A 2HZDA 3QOEA 5I2SA 4P96A 3HBLA 4X6AJ 1PSEA 4M6XA 3NARA 3HYIA 2VLAA 3G6EN 1JKPC 3C0CA 3SHFA 4BQNA 3I3LA 3FXUA 3WTWC 2E12A 2RI3A 3VODA 2KJCA 3CVTA 4FYXB 1VSMA 1SD7A 3CJ7A 1EJ9A 2FRYA 3EGUA 5DM6F 4B1RA 1SMYF 3WHCA 2JUFA 3EG9A 4CK3A 1Q7YC 2JVVA 2NVXJ 2KNBB 1JLQA 2FPDA 5L3EA 4H0OA 1VQ8Q 3U1DA 1OQKA 5CKHA 3VYHB 2J5OA 2LX7A 4C8LA 3VS4A 4FYYB 2ATCB 3SQ0A 2HQXA 3JCMc 4L5JA 3ML6A 1C1AA 3C6HA 2RGVA 4QVCA 1UHSA 1UGQB 4E1NA 1YS6A 4HQMA 2RKIA 1U6GA 3CUQB 1C0MA 3U9DA 3HVRA 4IFVA 2O8CA 3F5TA 1TQPA 4D7MA 2M0YA 1LOTB 5KAIC 2LT4A 4QAGA 2PYJA 3I4PA 1QQNA 4K8XA 1X19A 3KIOA 3CCSN 1G15A 2NYXA 4A93J 1UGSB 2DOEA 4B8XA 2HDDA 2DYBA 4KH1B 2DU9A 1A36A 3HRMA 1D9FA 5LEJA 5GAMe 3V1OA 3BY5A 1KAYA 2OI3A 3CC7Q 3TOAA 4HNVA 1E7OA 2P6TA 3LAJA 4RW9A 3K4LA 4II2A 1ITGA 5B5EC 2ZB9A 2WV0A 2DTHA 4JJDA 5GADJ 4AG2C 4RTTA 1V5EA 4IG0A 2H09A 2XHIA 3VS1A 1V1CA 2EJ9A 3JYTA 3RRGA 3KLGA 1N5YA 2HTJA 5L3FA 3QIOA 1HQEA 4JN4A 3BCBA 5B1AH 2VUMJ 1CF7B 3JAMK 2XK0A 2BIVA 2P9UB 4QPOA 1SL0A 4M78B 3FBIB 2YCHA 4JI1K 5FDLA 4C23A 5JVTA 1GCQC 2MLGA 3JCMb 4CGJA 5DTDA 1Y57A 3WQTA 1W1WE 3EGXA 1QLYA 4AHCA 3UKUA 5AN4A 3K1MA 2AHQA 2M8EA 1RAFB 2XDBA 4B9UA 3THYA 1TW3A 2OTLA 1D8JA 3CCEA 4AWXB 1ZA2B 2F5FA 3TTDA 5J6XA 3THWA 1D8KA 3OGDA 3DOLA 1A0NB 4JK7A 1FMVA 3G71N 3RMSA 2M7BA 3RWUA 3I64A 3C94A 3FDRA 2GEMA 1MDMA 4E3SA 3RTRA 5J1EA 3L2CA 4QS9A 2CQ7A 4M3YA 3TEDA 3EUKL 1LB2A 2K3BA 2OQRA 3TL4X 4HWIA 3O3KA 4DSJA 1DQUA 3FKJA 4H8KA 3U8XA 1BC7C 2WSEE 2MH9A 3CJNA 4F4KA 3GG4A 5LLQA 3OS0A 4CC7A 1H9GA 5FKLA 1FSEA 5KCHA 3C6AA 5AQVA 5JVGF 2LNBA 1S5LC 5CVVA 3FXOA 2DPDA 2CUZA 3K69A 2P81A 4DSEA 4QIWN 1RDUA 1JLBA 2PLYA 1Q82C 4CJEA 5BRDA 4C5EA 1GLJO 3HUGA 4AVPA 1RT4A 2O2OA 2MD5A 5LJ5f 3MD2A 4RW7A 3I56Q 1TAUA 3PUFA 5IXFA 4HG2A 1AOJA 5IYCJ 1NU0A 3KYLA 3C7JA 4HV6A 3K4CA 1DTQA 3OY9A 1PU6A 1IN6A 2X4JA 5DMRA 3HL2A 4LGWA 1K73R 5D6XA 2RD1A 1LEAA 1Z0XA 3EGDA 1NGJA 4GNIA 1B7TA 2R57A 2DL3A 1YIJQ 2MAMA 1MPGA 1MNDA 4KUDK 3CLQA 4AFSC 1YRNB 1FPQA 3CCMT 5LGNA 1OH8A 1YN8A 2O3FA 1YITQ 1MKMA 3VYUB 1XC9A 1YVUA 5I2MA 3CWTA 2EFWA 5BOXA 1S8NA 1BI4B 2DAOA 3QP6A 1WLPB 2O8FA 4B9XA 5LJ3f 1YS7A 2CU7A 3T19A 2EBIA 4ESRA 2PBIA 2LY9A 4JHDB 2NS7A 1VQON 4X34A 1ZSZA 5GANg 3S14J 2MK5A 3CC4Q 1R22A 2EV6A 1PD0A 3HSRA 4C5HA 1NG7A 1GLAG 4B3AA 3FC3A 1KC8R 2P0WA 1OI1A 4DR7K 3R6OA 3CQZJ 2EILH 3T69A 4LH4A 1S9EA 4GGGA 4BRMA 3NMUA 5B1BH 3KETA 1ABOA 3QUIA 2EIJH 1HR0K 2AP1A 3CC4I 1N8RU 5LMUK 1GT0C 4H5RA 1Y64A 4XQ3A 1HW1A 3K5NA 1TUDA 1I5LA 1YAGA 2A5WA 5K1YA 4JKBA 2E7XA 3DRSA 3VS2A 2QSFX 3QPLA 2E1HA 2DO7A 4Y1CA 5D4SA 1RR8C 1WJEA 5AQOA 3CCEN 5J4YA 3DXKB 5AQTA 4FWQA 2JM8A 4LITA 3THVA 3VRYA 4RG8A 3TPQA 3N05A 4LDVA 3DPLC 3K70C 2IOCA 4WXCA 4LN2A 4FISA 1KLNA 3M1EA 3M1FA 4BC3A 2PG4A 3HSEA 3C2HA 2NOZA 4KN4X 1XUPO 1JKRC 2P0QA 5K14A 1SV5A 5F0HA 3AFHA 1K61A 3QERA 2L9NA 4MDBA 3JSCA 2CW7A 2GTDA 5A2QE 4DR5K 4YFUA 4PGHA 3OHRA 3OSGA 5LY3A 1WJFA 3N97A 3HOUJ 2IVNA 4HHTA 2K5LA 3FIFA 4RB1A 1YQKA 1RT2A 4NO7A 2O0YA 2E2PA 4LFAK 1ZBFA 1QWFA 2ROTA 1VQPT 3D7EO 1XQOA 2I5UA 5K7HA 4XLFA 4BG8A 2WSCE 2W6LA 1VQ5T 3VYSB 4EP4A 1XG7A 2HVSA 1CLQA 3RQIA 4C30A 5B66C 2L7FP 2ETHA 2CGKA 2OPQA 3K59A 2XV4S 3LSJA 3HSBA 4BI4A 2ZJQL 2DM1A 1YJNT 2M7AA 5K5RA 3TGNA 2RI2A 3J80O 4BI8B 1SKWA 1RESA 1QKXA 4DFMA 3HOVJ 3OQ5A 4NC8A 2DIGA 1RT7A 1OH6A 2XRNA 3BTCA 4J2AA 3O4QA 4N0BA 1NG6A 3VF6A 2VE8A 2ZGWA 2HKOA 1ZSZC 2Q2EA 3F6VA 2O6GE 2M45A 1X3NA 4E7KA 1U5TB 4C92F 4W5RA 4PKCC 3H8ZA 4J7IA 3QKJA 4QW2A 2ZSHB 4OB3B 3CCQT 2A6HF 2HMPA 1QNTA 3UIQA 5H1SQ 4HTUA 5HBMA 4LD0A 1W9HA 1FBQA 3TAFA 2ESHA 4H03B 4A6DA 2V75A 4M3UA 1X3WB 1RTJA 2RHZA 1QVFA 2LNHB 3ERED 2DFUA 3FK6A 1B9FA 3BEXA 2XGXA 5HLGA 2IGNA 3L2WA 1YQMA 2K27A 5KPZA 1A5VA 4AM6A 4L5EA 3OYDA 4B9NA 2DRMA 1HKBA 2M0CA 4KO0A 2NS0A 5CVRA 4JNEA 3CIPA 2O4XA 3CLOA 1R1VA 1G5VA 2QGFB 2HOEA 2HDWA 1VRLA 4DSIA 3DLLA 1QP3A 3AVGA 2DAQA 4RW8A 1YOVB 4FWRA 3ATUA 4Y91A 3E19A 5FLXK 1KCFA 4CHPA 2P9KB 4JI7K 3TTCA 2VB6A 3W3CA 5M5XJ 4HF1A 4N76A 2KYBA 1FBUA 4IO9F 4B3OA 3AO1A 1ZK8A 4KMUX 3RMAA 1WSEA 3TO6A 3WVEB 3GOXA 1T0HA 1IRGA 1PP7U 1K4US 3PO5A 4KPYA 3H3ZA 2PUKB 4Y17A 5JHUA 1W2BS 5KYWB 1W7AA 4C92D 2E5QA 3DLKA 5GANh 1UA0A 2KDSA 3JS6A 4X64K 3VS3A 2B63J 4LD9K 3DAWA 2ZWHA 2CZ7B 1YVNA 2X74A 2M2EA 1YXQA 4BHPA 3H3VK 1E6HA 2LKXA 4LH5A 1VQ8N 4UNOA 3I54A 1VAZA 4JLGA 2DL5A 2W42A 3BG9A 4PK4A 2DBBA 4X1EA 4KH4A 4MQ9F 4Z4IA 2DL4A 4M7AE 1AZEA 2KKZA 4PKHA 3V8LA 3HOWJ 4MEXF 1ZR2A 3LLRA 2RF2A 4FWPA 4F55A 1TL1A 3V9WA 3MJXA 2LKPA 2ZPHB 3KLHA 2L2PA 3I0SA 1ZN2A 2IG0A 3G1OA 3I5RA 1QQMA 3FLGA 4IUPA 1H3HA 4HNTA 4IUVA 3QEWA 2HGCA 3DV8A 1G6NA 1OZ2A 1EIFA 1PYVA 3H5RA 4XKVA 3ELKA 2DN0A 4CGIA 3HIFA 2G6FX 2EKHA 2L01A 2EYXA 2L7ZA 1U8BA 2E4HA 1N6AA 1W5SA 1I5OB 2J6FA 4HCZA 3K5LA 1G59A 1DKGD 3CD6Q 1HNWK 1KD1U 3H9GA 3C4SA 3CC7N 1VYUA 3CC4A 4FK0A 3IV5A 3B6PA 2NRRA 1AOYA 4GXOA 1WEGA 1BBYA 1UA1A 4W97A 3ENHA 2JUGA 4JKEA 2M16A 2COWA 2AIRB 2ELJA 4OIQF 4MTEA 3NTKA 2CMPA 2VN2A 2MPXC 5TJJA 2NLUA 4A63B 4B23A 5E3NA 2V26A 3I9V2 1XQHA 3CJAA 5D6YA 1FYNA 3KHYA 3COAC 4JJCA 1NK7A 1O1WA 3LP1A 2FF6A 3V9XA 1O3TA 3JRZA 4N0AA 4OGCA 3V8KA 1DPUA 1R36A 5LL6Z 1XGSA 1BCOA 2CT4A 3Q1JA 4QOZB 2E60A 3B6AA 1Y96A 4XOPA 2FLOA 5GANd 3W2AA 3ZYYX 1UELB 3K4NA 4ENJA 1CXQA 4NNJA 5GANj 4CD1A 2JRMA 5BS6A 1GVDA 3FF5A 4GY2B 3M56A 4N47A 3ZSWA 3ZSRA 2LMDA 2FHDA 3VWBA 2ELKA 2VT3A 3R6MA 2F2XA 3RIRA 3R60A 1KQSS 3F8NA 4YOUA 1X9MA 2BZTA 3ZSXA 4RMOA 1NJZA 1POGA 3CQYA 4GW6A 2KT8A 2H8HA 4F7UF 1LDJA 4PA1A 2M34A 2LTOA 3QBWA 4XRFA 3ZXSA 4K42A 3KZIC 1S6LA 4M78F 2E1MB 5FPEA 1X1PA 1T0JA 3PLAA 1KXPA 5IT9Z 3HOTA 1RT3A 3DWLE 1SQKA 1Z1DA 1CZAN 2E1NA 4MHGA 5L3CA 3E6BA 3U6FA 1V4SA 2OA8A 2ITMA 3GMEA 3I56N 2GBZA 2AO9A 1BR1A 1NK5A 2FF4A 3IWFA 4H0EA 4O8UA 3VETA 2ZJPF 3TSUA 5HDKA 4JRIA 1P7IA 2DK8A 3HVTA 3WUHA 4GV3A 4KT6A 2VVKA 5CQGA 1I1SA 2B4JA 3AG4H 1KQ9A 4GRIA 4BWJA 1QGPA 2Z1GA 2E2NA 1YIJN 3GBGA 2M4KA 4GY5A 1ASWA 1M5Q1 4II1A 4KYWA 4LIUA 3VW4A 4AI5A 3KP5A 3KVGA 3DLBA 3M53A 1BR2A 4FJ8A 1YITN 1TT5B 3SMPA 3L7WA 4N4GA 3AL0B 1R5HA 5FLMJ 4U7DA 5AQXA 3RMQA 4LDUA 1K4SA 2V6EA 4BUGA 3E0JB 3NTHA 1S1XA 2JLEA 3SQNA 3NWTA 1YX5A 1ZRDA 2QXLA 5M5YJ 5KYNA 4PSWA 2QENA 2O9SA 1HNZK 1WN7A 4DNCA 1T3SA 3GLLA 4P9FA 1C0WA 3D0SA 4M78D 4DEXA 4CJ7A 5IY5H 3CC4N 3E9PA 4XK4A 3VA3A 3SWNB 3IH2A 4N0AC 1Y56A 1ZTRA 4I2PA 3M9QA 2PY5A 3NBPA 4BWMA 1DGWY 4BR5A 1BN5A 2O03A 3CUOA 2B9SA 4BD3A 2H94A 3U23A 4BRCA 3AGRA 2CUFA 3MEUA 2E2OA 1PD1A 1KU9A 1FMKA 3LGLA 5E1XA 4J2DA 3H1VX 4E47A 3KK7A 2P6SA 4DEYA 3SZTA 3OMYA 3JAMZ 2AQEA 3VEOA 4PJOA 2LYCA 3QBYA 5DS9A 5DCMA 1QSLA 1D0YA 4LLGF 1RTIA 1S5JA 4BUPA 4ME7A 2KRFA 3ABLH 4IBNA 1A6IA 2WY7Q 5K7FA 4C5IA 2K85A 3H6EA 1M9SA 4E7LA 1J9AA 1U49A 4OMQA 3REAB 3ABKH 1VYVA 3ZX3A 3OVNA 1VQ9T 4EZ6A 3OJSA 4AIAA 2DTUA 1BI1A 1SD6A 2WWYA 4ZYDA 4B9VA 4R79A 4F16A 3MP1A 2HHVA 5I3UA 1XGOA 3ULEA 4OMLA 4LIVA 2HPMA 3CMAI 2YHAA 4V19S 2W24A 1V4TA 3BG3A 5LRSA 1T03A 3QQAA 2GF7A 2WOMA 3LM2A 3UR3C 4L6V5 4IIMA 2KPMA 1NTCA 4FJMA 4KISA 1MBKA 2M4GA 3M8RA 1WQWA 5GMKj 4I99C 4CYCB 4C2MJ 1NKEA 1XNQK 5C6SA 3PO3J 2KQWA 1KYZA 3SBGA 4XSZF 3M7GA 2UUBK 3CCRI 2L89A 3S1MJ 1D1AA 1ZGJA 2ADUA 4XLCA 2I7NA 4CJ4A 2JVGA 1OCPA 4NLBA 2L9RA 2MOXA 3I4MJ 1MUNA 4B3XA 4I2QA 4I7FA 1NK8A 1MNEA 3GFJA 3WE2A 2RPIA 5DM6L 2QKBA 4BXXJ 3W0LA 3AAFA 4CJFA 3QDRB 3HYFA 1K78A 5I22A 3ZQ7A 3Q0VA 1Y71A 4XSXF 2XSDC 4V2SA 1R9TJ 1TWHJ 5JLWA 4XORA 4BACA 4XMYA 3LW5E 2K5FA 4AFZC 4HNUA 1S6PA 2CFXA 1LPLA 3LYIA 5FKKA 2BW3B 2Z99A 1HOMA 2E3IA 4GLKA 3JRAA 1FBSA 3PIPA 4B47A 3QEPA 1QS4A 4Q5WA 3D45A 1RBSA 4IUQA 2L8DA 3ME9A 2BVMA 1HKQA 4IL6C 3CYMA 2I0NA 1H8AC 2GX9A 2OTJT 4B3SK 2YHTA 1JT0A 1AKHB 3DRRA 1W1FA 3FE1A 1I1GA 4WTOB 2NRZA 4CBWA 3QETA 1IO2A 1VQNI 2BY1A 4UVCA 3UKRA 1IN5A 1E6GA 4KMFA 5M1QA 4U0WA 4W5TA 1SAZA 5HRPA 4PJOC 3QFPA 3WHBA 4DA4A 1REPC 3DKMA 2Y30A 1RFQA 1OULA 2RAEA 2DI3A 1RAHB 3CCMQ 1WHMA 3HGYA 2P9SB 3M1CA 4EZ9A 2OYQA 4GLMA 3K9JA 2OC6A 3O8MA 3IWZA 2V9VA 4PL7A 2AS5F 1R5GA 2HXIA 3EUHC 3E6DA 3V4IA 4FQGA 1Z25A 4K43A 5BRFA 3H45C 2E88A 3J80E 3C0BA 1SKUB 1VQ7T 2FBKA 2MG4A 1NK6A 3CERA 3ATVA 2IGIA 1PCXA 4EPCA 1NGGA 2HVQA 1HXDA 1Z21A 1MSFC 4X1VA 3KLOA 3AVIA 3AG1H 3T1BA 3BJ6A 2VT2A 3Q7BA 3I0TA 1UAAA 4X66K 3J7AP 1YCSB 5CR4A 3O8GA 3OIOA 2LQNA 2R7WA 2BV6A 2P9PB 1I50J 4BRKA 4EA5A 3THKA 4YFKF 2XGCA 4RKUE 2P9IA 9ANTA 3GF2A 5M1NA 1JCGA 1XI1A 4KIFA 3ZQCA 3AVLA 3QOPA 2HYFA 1UUEA 2IS4A 2EZHA 5KN9A 2XAFA 1D3BA 3PT9A 3E01A 3I4NJ 4B43A 4E89A 4OFHA 2KIMA 1ULYA 3WE3A 2AZVA 3OWTA 4O55A 3DPUA 4PWDA 3MEXA 3WEEB 4D1QA 2BY3A 2JN0A 1FW6A 3MPUB 2X6SA 1NPPA 3IMXA 2MGQA 3J7ZO 1R7JA 2B8AA 1MJAA 1VRUA 3VQPA 2QF7A 5FPMA 4R5PA 4JJNK 3CFPA 2XD0A 1RL2A 3N0UA 4I09A 3DLEA 4M75E 2STWA 3AO5A 3AVCA 2IAIA 3CMET 3JCMQ 4MGRA 4I6MB 1HYSA 4RUGA 3CD6N 4DCHA 3VGLA 1LNWA 5LHIA 4M7AA 3BZ6A 2Q31A 4CBUA 2X9DA 3HKSA 5CPRB 3DLAA 4BVPA 4JKGA 3CC2T 4PSXA 1QTMA 2OPPA 4Q4ZF 2HR3A 3P9CA 2O8DA 3PQKA 2DY4A 1IN8A 1TH7A 1VQPQ 2QQAA 3GO5A 5TKWA 3IKVA 4LOCA 1VQ5Q 3QO3A 2DTIA 2DTRA 3KXTA 4CZCA 2BUDA 2EV5A 3C18A 4I7HA 4XRSA 1YJNQ 1JKOC 4OMFB 2L7KA 1YW7A 5AYFA 1RI9A 3RSEB 3FMRA 3I59A 5KQDA 1V76A 3WG7H 3PY8A 1XSDA 3FISA 5E26A 1U2VA 2ZGYA 3CMAA 3WU2C 3JCMJ 4EFHA 4C9YA 5C10A 4YPRA 4XH1A 2FA5A 2COYA 4ZDLA 2CDTA 4BR0A 4FLZA 2F8TA 3DLLL 4AU7A 1U06A 4RTUA 2NOIA 1RLQC 4FK4A 2YX4A 1W5TA 1XMAA 2UXNA 3HRSA 2PU9B 1RDCA 2IDOA 4Y4RA 2W00A 3ZFJA 3CI5A 2D0CA 5H6RA 2BZYA 3CCQQ 3MVPA 1LVKA 3VSKA 3MAQA 4J2BA 4CJ5A 4IOXA 1SFUA 4CZGA 1GLCG 4D0PA 4R56A 1E3OC 3BTIA 4A69C 5FLXZ 1Z6TA 4DU3A 2EGCA 2A3ZA 2Y48A 1JLFA 4FXDA 4DUYK 2OJ2A 1X1AA 2GWJA 1QPIA 3CCQI 1KVCA 2HVIA 1T33A 2WV1A 1O75A 3LWFA 5KCMA 1WNSA 3HJEA 4Y52J 1NOYA 1FX7A 4R1HA 3OMCA 5GIPA 1RRJA 1MD0A 4CI6A 1HDDC 1TK0A 4XTZA 1WA7A 1GLFO 3KKSA 4Q47A 2JTMA 2WBNA 3SZGA 3BDPA 1BYMA 2P0PA 5GTHC 4QS7A 2R58A 3K1PA 4LF4K 3DWLA 5CZ1A 1VQNA 1KC8C 2ISYA 1HQUA 2F4OB 1JRIA 4M7AC 2JHJA 5LJ5e 5GAOq 5AQKA 2NUPB 5M1KA 5J26A 1K9AA 2CP2A 2KEAA 4KHPK 3KYCB 2C0OA 5BN9A 3ZR8X 1Y07A 3IHOA 1VQ4T 1LAVA 2K9LA 2PFBA 1OISA 1XNIA 1OVQA 3CP8A 3LWIA 3GNGA 1SS6A 3UT1A 4QT7A 1OYWA 2NUTA 4CI0C 4DQPA 2RF0A 2CP3A 3LH5A 1TNSA 3MZYA 1UECA 4DOVA 3THXB 2E5LK 2YNIA 2YNHA 2G3RA 2IJLA 4W5OA 3CCMA 3T5XA 3MO8A 2WUSA 1N75A 2DCEA 2DIQA 1NJXA 4ZZLA 4XK8E 2AT1B 1IG8A 3IRRA 5LJ3e 5LEKA 3O9QA 4S0HB 1BU1A 1WRJA 2XB5A 3A5NC 1XOVA 1AHJB 4BJTA 3K57A 2MD0A 4ZYEA 1ARKA 2F4MB 5GAN4 1B72A 4ENKA 1P2FA 4I02A 4QWQA 4Z89A 5CVJA 1T3VA 4L59A 2R93J 3EUAA 3S2WA 1SD5A 5EX5A 3H9QA 2DA7A 3KEQA 2K9MA 1RNLA 4K2EA 2E3HA 4OAZA 1R77A 4C1NK 4CCJA 2FQ4A 1ZR4A 2YDLA 1EBMA 3ISNC 1P90A 4DR2K 4KN7X 1MMGA 1JE8A 3CEYA 2V1UA 4FL9A 4ZJZA 2DT7B 4I0AA 1YUWA 2HAXA 1SF9A 2HQ5A 1MA9B 2QWPA 1Z6RA 3TMOA 2HOAA 3NQOA 3HTVA 2KW4A 4JK8A 3L09A 3TVTA 1K76A 4NC7A 1QQJA 2COMA 2E70A 1NGIA 2AK5A 3HM5A 3AA4A 1VQLQ 1RIOH 1ATRA 2NVUB 2PJRA 1RAIB 3QWYA 1WX6A 5ILVA 1Q81U 3FXRA 1IV8A 3QYEA 4NS5A 4QQ6A 3MEGA 3CWSA 4N56A 2XICA 2A6AA 5FPNA 3I5SA 3B6CA 2EQMA 2F96A 1TUYA 4CEFA 3VS6A 3DP7A 3SFZA 2ASOA 1T2KA 5LHGA 3KNTA 1VQLI 2ZPEB 2QAZA 3EDPA 3CWAA 3BR2A 5GAGJ 4C92G 3EYYA 1Y1VJ 4OB1B 4IPAA 1W7PD 1M1GA 2V1XA 3HHHA 1XTAA 3HKZA 1AWJA 2KLOA 1TBXA 4KHNA 2E6NA 2HDCA 2STTA 3AA5X 4FO0A 2NAZA 1M30A 4ILJA 4P5OA 1Y1WJ 2ITGA 3IRQA 1QCOA 2P1JA 2YXYA 2BE5F 4HOBA 4CJPA 3SAGA 4RTFD 4FZYA 2DODA 2A28A 4S04A 2D8HA 3TSPA 2EK5A 2XIGA 2HQRA 5M1FA 2DPNA 2P7VB 1WH5A 2VJ5A 4Y13A 4NB4A 2PYLA 1D9DA 5AR0A 4M7DE 3GLXA 4C8QF 4ASNA 4U67L 1HA8A 3GL1A 2KZVA 3CCMN 1QHAA 5D5WB 3BY7A 1UMQA 4IKFA 4G6TB 3WXLA 2Y90A 1O3SA 4RTXA 4I2OA 3CPWS 2HHXA 1I6XA 1SMTA 4NB5A 3X25B 4PL8A 4M3WA 3FLCO 4ENMA 4C0DB 4IRIA 3GNFB 4RW6A 4EEFG 3LDOA 4EHUA 4LB6B 2DL7A 3CCQA 4DV5K 3SYZA 2ACJA 3P9IA 1WLJA 1N3AA 3HTSB 1ZBXA 5GMKm 4BQLA 2UZKA 3A0BC 5HDGA 3VOEA 3F9KA 4QS8A 4E70A 4FW2A 2F2WA 2UUCK 4CZKA 2Q3SA 3VB2A 3QWXX 3G1LA 1TTYA 4CHOA 1H3ZA 2QQ8A 4IO8A 3ALYA 1YHQI 5GAOl 4FWOA 2F5VA 3H5NA 4XTVA 2VUBA 2W25A 3LDQA 2EX3A 1FIPA 2KTQA 4NYNA 3SLCA 2EV0A 1T56A 4CICA 4CFBA 3KUFA 3CO6C 2IS2A 1XMOK 1FJGK 5LGTA 2LCLA 1T6DA 2QVOA 4C8QD 1VQ6I 2KRSA 2HYGD 1GXQA 3ZMVA 1SSHA 2YUOA 1TWFJ 1A35A 5KYYB 4L3QA 5AZIA 5FU6C 4EMHA 1I81A 2X4HA 4G6QA 1VQ9Q 3MKDA 2JZYA 3AVMA 3VJPA 1JTYA 1XGMA 2BHYA 4KICA 2MW8A 2NXNB 3I0RA 2RB6A 4LSNA 3BOQA 1IJJA 2IP2A 2P5VA 3S6IA 4KGXB 4ZNXA 2E1OA 4HZFA 3VQ7A 1S6QA 1C1CA 4CD3A 4DV1K 1RKTA 1NOZA 5M1PA 2NNWA 3IAS2 4PLIA 1B9NA 1N6QA 2ME0A 1T0FA 4K0KK 3I53A 4OOIA 5JS2A 1HSJA 3PIPL 1N39A 1VQ9I 2P9NB 4B48A 3AAPA 2FO0A 2X51A 4K8ZA 3O3HA 2DVJA 4H0VB 2FSKA 2XI9A 3DEUA 3MEVA 1QVTA 3CXCS 1VQKT 2DEQA 3HB9A 3R0AA 2CUDA 3I71A 2CYZB 3R8EA 3A5MC 3WG9A 1VQPN 4EM1A 4FT4A 3HKZN 4OB2B 4FSXA 3CG7A 3SZPA 4KIBA 4C0FA 3BDLA 1VQ5N 1N36K 4CHZA 2OAZA 2ZPBB 2F8SA 2W82A 3TSZA 5GJVB 1QZEA 4J6YA 2Y0SN 1RUNA 4M75A 2BY0A 1BDGA 1N27A 2EYQA 4Y33A 2DMNA 2F5TX 2CZ1B 1YJNN 2OANA 1F36A 4LE9A 2DOFA 3OS5A 2W84A 2EQKA 4UOBA 1I27A 2KMTA 3DBRB 4C5GA 3WTSC 4ZTJA 4OMMA 4YTLA 1TOVA 1ATSA 1UG1A 1OQYA 5K5OA 2XROA 1XDUA 1X4PA 3QZ5B 3BDDA 4B3TK 4PZJA 4H4OA 3CCUT 2GA1A 1U45A 4CUGA 1NJYA 1LV5A 4F7UG 1RPWA 1EP4A 5E79C 4YORA 1FKOA 3CJ9A 2EJRA 4M78G 4CJQA 2OTJQ 3WT0A 1QVFM 2PVDB 1Y7XA 3QYBA 2A07F 3KK2A 3LP0A 2M30A 3F73A 3CCQN 1KGSA 4LSLA 3VDXA 3K2ZA 3TAEA 1WJCA 3VV0A 1QVFP 1UG2A 1M27C 3KD1E 4B9TA 3PO4A 2VKDA 2RHUA 2FPFA 2C6YA 2P8TA 2QTVA 2P84A 1S1WA 3GX4X 2DW4A 4H5NA 5CYQA 1X6GA 1OV3A 2R7QA 4YIIA 2P5LC 3VUZA 5CIUA 1Y97A 3H1CA 1O57A 5M9OA 4DSFA 1RI7A 2DJNA 1P59A 4LG0A 5K7ZA 2PNIA 1ON2A 4U0YA 1VQLA 4FK2A 4A61A 5FW9A 3K9KA 3F8BA 2KP6A 4DGWB 2QWMA 4M3RA 1D8YA 1VQ7Q 4FJJA 3QFUA 1R4MB 3W2VA 1KG5A 1UFMA 4JYKA 3Q0WA 3VQDA 1N77A 2V4JC 3V7CA 1ZRCA 3DM2A 4HDUA 3TAMA 1BC8C 4DG1A 3FZFA 4RM2A 2EB7A 2XKOA 4IEIA 2ASPA 5EG0B 1BI2A 1V3FA 2K5IA 3TU4K 2O7OA 2E6LA 1LJOA 1T0FC 4BHBA 1BJAA 2DA4A 2AXLA 1NGBA 2ABKA 4Z6YA 3O80A 1VQ7I 3A4CA 4MFDA 3G0ZA 3P39A 3M5AA 2HKXA 1ZREA 2JA2A 4DTXA 1I0CA 4EVVA 1UHCA 3CBPA 4AIJA 2VQCA 4BE1A 2O4IA 1XX5A 4NDLA 3LZJA 3CMYA 2V51B 4MQVA 4K11A 5HOOA 3R2XC 3DEEA 3L4QA 5AQZA 3CUQA 3THYB 3HPGA 4J83A 1FLIA 3ZEUB 2E64A 2RJFA 1TSFA 4M75C 1HCRA 3V1QA 2PFUA 3ZSZA 1WHKA 1YJ9I 5EXWA 2P5GA 1FC3A 2TRTA 2CV2A 4N4IA 6AT1B 2ABLA 1MMDA 1ZELA 3KE2A 2EFIA 2FF3B 3KLIA 5HS8A 4B3MK 1MBHA 2R3SA 4IXCA 3IUOA 2RO0A 1PUFB 3N5BB 3FHZA 3ZLJA 2Z2SB 3W6VA 5DM7R 4E6RA 3EN9A 1A5JA 3OW2S 5DPKA 3M5RA 4M7DF 4FM4B 1IO6A 5KE2A 2EPFA 1WJSA 4KJZA 2QK9A 5FO5A 1JGSA 1IKWA 1TUUA 2UWMA 4CDGA 2GQQA 1ESVA 3CPWP 4IXAA 4FLVA 4IF4A 2I10A 5B8HA 3NF7A 2X4WA 4CESA 3CMEQ 2VKHA 4M3ZA 2OA4A 5FKOA 1HX1A 3MAJA 4FLWA 1V5FA 1CF7A 2YJEA 5H6QA 2FB7A 4TVRA 3JCMV 3ZQHA 4FCYA 3CC2Q 1BISA 3I0WA 1QVUA 2RN8A 3MK6A 3RDIA 3KFWX 2IXSA 5GMKi 2KFZA 3NVKA 4DIQA 2RQWA 5FKMA 1R00A 1LW2A 2OFKA 3P8HA 2XAQA 3PX0A 1VQ6A 1PNJA 5H20A 2HNYA 4XLNF 2L02A 2YHYA 2RQTA 3VKIA 3M8PA 1PP8F 4CHNA 1YF5L 4C3IJ 4CE9A 4GFBA 2LJ0A 1M90C 3NH0A 2L3RA 4J8FA 1IRFA 3G2BA 2HU9A 4C2UA 3ZL7C 4CZEA 1ILYA 1KA8A 2EWNA 1KAXA 1K9MU 3ABUA 4XU2A 4KUIA 5F27A 4ANJA 3WTUC 3SUPA 4E0DA 4A3CJ 1BOBA 4AUXA 1VQ9A 4BROA 1FYLA 2XKOC 1W36D 5BR9A 3RI4A 4M7DD 2I5JA 4KREA 2RQQA 2HF3A 1RUWA 2HNDA 3J80Z 3JRCA 1KAZA 1Y0NA 3QDKA 3SEQA 4CF0A 3J7ZI 4OWRB 3H0IA 3U2RA 2EZIA 1X58A 2KVQG 1T7PA 4IFYA 4A2BA 5EZGA 4BBRJ 3TTFA 2DPPB 5FJ8J 2DMPA 2GTOA 5IOYA 1IRXA 2ZJQF 1NBWA 5FWBA 4BDZA 3JRHA 4GMJB 5F2RA 3HM8A 2H1KA 3OYHA 3CXCM 3EG1A 3F2KA 3CUQC 4MNUA 1LJ9A 4EJYA 2QTDA 3HHTB 4JZ4A 4JI6K 1Q95G 3C7NB 3C2BA 4IEEA 4C8OA 2JRTA 3KWIA 2UXXA 3CXCP 4FE4A 1NGAA 3I33A 3GUDA 2G7UA 3UB5A 2L7MP 3G6EI 1PJRA 1FMWA 4J8OA 3ISPA 2JSCA 2CWEA 3WGHA 1AZGB 2DRKA 3UWNA 4J9IA 3M8QA 5EOYA 2CG4A 1JXOA 2DA5A 5F6FA 4D5CA 2Y9ZA 1HSQA 4N4NB 1YRNA 1OPLA 1AWXA 1WQ7A 1BA0A 3NF9A 2C0IA 1KLMA 2HS5A 1VQMT 3OA6A 2IS1A 2NRAC 4J9CA 5BQTA 5J8FA 1SSFA 1BI4A 5GPCA 3BW1A 3P38A 2HQNA 3L2UA 5AQGA 4M77F 2NVYJ 5LMNK 1TUGB 3WNEA 4A12A 1ETQA 4JHDA 3J7AF 3H92A 2D4WA 3O3GA 2FSJA 2DTZA 2K4JA 4YPHA 1QQIA 3D4VA 3REBB 3M4YA 5LJ5g 2CFOA 2IVWA 1IKYA 3CW7A 4DZJA 3BR0A 1O13A 1M8VA 2YLCA 1BL0A 1JJ2S 2K9QA 1VQ4Q 5ED4A 1IXDA 2F4IA 3ZRGA 3MN5A 5A0GA 3RQ4A 2X6WA 3U3YA 2LTPA 3BE3A 3DB3A 3WODF 2Z1IA 2D8JA 1LWEA 5IAYA 5J2PA 1TXQA 1EO1A 1GOBA 5D4RA 3LSHA 2V7FA 3SQ2A 3BC8A 1X43A 1JCFA 1MHNA 1W2BA 2D5VA 2DA1A 1RBUA 4DLGA 3H35A 2KE9A 3M0RA 1VQ4I 4JKAA 1RCHA 4XLPF 3T8RA 3A1PA 4NXNK 4O8KA 3A02A 1QCNA 1FNNA 4L8RB 3TCJA 3H0DA 1WIEA 3OSSC 3IP4B 3DXKA 1WXUA 4DR1K 3RMCA 3FWEA 1VQ7A 1N5ZA 1YJWT 2VOPA 3LSKA 1U4BA 5LJ3g 2UXCK 4G7OF 3KJVA 1IZ1A 1KU3A 1WFXA 1CZBA 1LDDA 2LJ3A 4ILGB 3AY9A 2VYTA 2JMAA 2P4TA 1GLLO 4V2GA 2VGMA 3ZQFA 1X3MA 4JX4A 4OIPF 5BPLA 2X1DA 4M77D 4JI3K 2H1LA 2Z5UA 2VJJA 3P31A 2HHSA 3PJRA 3MP6A 1FK9A 4CYDA 2KZGA 3AO4A 3PGGA 1VQ9N 4YY3K 1B8IA 4BAYA 3HZ6A 1BIUA 4BB7A 3MEWA 1ZBUA 2D0PA 4JAXA 4F92B 2LSOA 3CVSA 2CSIA 1B6AA 2L3DA 3G71I 4Z8AA 1JTXA 2OQGA 5FFXA 4PQUA 1S3JA 4RTVA 4XTXA 2PMHA 1I94K 1X1DA 2ECZA 4HBLA 4HRIA 1XNRK 3VQBA 3GZNB 3EETA 1REVA 5IOZA 2FZCB 1TU0B 2XY6A 4EAHD 3MCZA 3BF3A 2MWPA 2PQ8A 4IZZA 4LFBK 2E2QA 4GVEA 5GJWB 3VTHA 1H89C 3J7YJ 2ZF5O 4JP0A 3MQ0A 5LL6S 2OJED 1TKTA 2GLOA 2PJPA 2E7WA 3G4ST 1UHMA 2E41A 4V2FA 3EG0A 2OV7A 5DUIA 4KH0B 4MLOA 4M7YA 3OW2M 4L0YB 5HDNA 1LVAA 4JS4A 3QU6A 4P55A 4II3A 4QQGA 4F8RA 5M5WJ 5LGUA 1NJIC 2CUBA 3OW2P 3E9GA 2BTTA 1L5UA 5MLCQ 1L3VA 4CXFA 4LUDA 2XB0X 2HD0A 3PO2J 1LMZA 2Z3YA 2D9TA 1D1CA 2BVLA 3WTXC 2K3XA 4A5NA 1Z67A 1U5TA 1WPKA 1XSXA 4C3JJ 5DCFA 1PSFA 2R7RA 2A41A 1UHWA 5EF6A 4YOQA 1LWCA 4DYCA 1OU9A 5BNGA 2XG8D 5FRMA 5I42A 1MWKA 3HOXJ 1KQSA 2OTJN 5AQYA 2CQXA 4FYDA 4JQFA 4OPKA 2PVGB 1AWWA 3L2RA 2CQKA 4BY7J 4EDUA 3M8JA 4RCBA 1TWCJ 4CEOA 1KSWA 2F4VK 1WAFA 2QM3A 4DFPA 3DQVC 4KH6A 2EKOA 3P8DA 2IA0A 4DU1A 1FYMA 3NWSA 1VQOI 2QBYB 1FOYA 4AHRA 1RT5A 1EWRA 4RGXA 3WXMB 5F1XA 2D1KA 4OVLA 2VOOA 3MXJA 2ZXIA 1ZUKA 3OH6A 3NTIA 2BE9B 3JCMe 2P9KA 2CW0F 3OYIA 2QKMB 3GFMA 4DHYA 2O8XA 4M6VA 2L2OA 3RZDJ 1KU7A 2PTKA 1ZBJA 4ELUA 1VQ7N 2X6OA 2QXFA 3KPHA 3LQQA 4DU4A 2JPBA 3M4GA 1ETOA 1OLTA 2LK2A 1D5AA 5KYWA 4O4GA 3HTUA 4BXFA 2XF5A 2RHKA 4CIFA 3A8HB 1K7AA 3C12A 3JRDA 1D0XA 2OZ6A 3JCUC 1OCRH 1RRQA 2RVCA 2LQWA 4FT2A 2CREA 3R6NA 3E97A 4CGHA 1QHHD 5ICGA 4EHTA 2BY2A 1K8AO 1Y96B 1NEBA 4MZTA 2PMZA 3RKQA 1I3AA 3GFLA 4C92B 4A5MA 1OZ3A 2DK5A 3JCMW 4BRNA 5EGOB 1KHIA 2UV1A 4OMPA 4CCHA 4A2UA 5C4JJ 3CCVT 2BUPA 2ZC2A 2ZMEB 1TKXA 1JLAA 1BJZA 3SFIA 1TW2A 1E2XA 4HX8A 4G94A 2D45A 3TANA 5TISC 5C0YA 2GUIA 2YSQA 4FSSA 1DUXC 3EHQA 1O7FA 1U5TC 3MMVA 3K6GA 1LUJB 2MMPA 3K4MA 2P9LB 2CH0A 1XSVA 3CCYA 4NOYA 2ASMA 1W4SA 1UB4A 4CA0A 2KHMA 3SHWA 2G8IA 1Y39A 4AFQC 4KB1A 1Q81O 1K73U 3CMEN 2XAUA 2MC3A 1VQ4A 2NOHA 5FLVA 2YHXA 2F48A 3NGZA 1BA5A 2LY2A 1D3YA 2CP0A 2HI3A 2YJFA 1K6YA 3CC2N 1PC0A 2NRHA 3AVFA 1JBMA 1VQKQ 1YWPA 2F7TA 5L3DA 2Z1JA 2ICWG 4CJKA 4EGZA 3CMMA 1KJWA 4BGBA 5E3OA 5J2MA 3CWUA 3CPFA 4CO8A 1S72Q 1M1KO 3GEZA 3O4NA 3F8FA 2YV0X 2YRVA 1OCOH 1WJQA 1WB9A 2LF7A 4F17A 2HDAA 3VGKA 2W4SA 2AQFA 2XAGA 1VQKI 3AV9A 2X4YA 4B9SA 1BIZA 5DEQA 2OAWA 5LJ5d 3VU3C 3L8BA 3JB9F 2XIDA 2R5YB 3D7SB 4CEZA 2YPRA 1B9DA 2CUJA 5TRDA 3RPUA 1S72I 4FASD 2LQ8A 1KC8U 2J5PA 1J54A 1UTIA 3WTZA 3CCUQ 1G3SA 3HRUA 5F08A 2G8WA 3SEZA 5LRRA 4CF9A 3PFYA 2GGRA 4E4HA 2JWKA 3IRXA 3MWPA 2QK0A 1IH7A 5DV5A 3M54A 5IT9K 1VIEA 5D6WA 5HCKA 5AQMA 3TWHA 1ZBLA 3OS2A 3QRFF 4M9XA 4WWCA 3RMDA 2RDPA 4DQRA 2NOGA 3F21A 4E9GA 3L3UA 3VQQA 5LJ3d 3ZCMA 2DPUA 3AARA 3G73A 3CDHA 4HVVA 3ABMH 3RPQA 5IP7J 1ETWA 3UNGC 1ZAOA 3CBMA 1HUXA 4ZHRA 3VPRA 2OTLT 5J47A 3VYRB 1E4FT 2I8DA 5F64A 4FLYA 2FPEA 1RILA 5BR8K 5DCMB 2HXOA 2HNIA 4KHUA 1NYGA 5C3EJ 1QZZA 3IDHA 4AHSA 1GV2A 4A6EA 4DYQA 1YP5A 1NGDA 2EIFA 4KTZA 4KI4A 2PMZN 3SAFA 4Q5SF 4B09A 4JI5K 4CEQA 4C8QG 2RHXA 4BEHB 2ZNZA 1NMDA 3SCXA 3HI0A 1D0ZA 4FLTA 5EYRA 4JBAA 3K70D 3JB9D 2JN6A 1VQ8I 4M3FA 1KQ1A 4ZDPA 3PIOA 4DTRA 5C2FA 4AIHA 4XU3A 1W97L 3BG6A 2MIOA 3CESA 1GLBG 4LMYA 1KSPA 1UOCA 1UGPB 2DBMA 3BF1A 1JUSA 4PHTX 3VRZA 1VQOA 3ZN1A 2QKKA 1G83A 3AVAA 5KHDA 1ZLKA 2DL8A 4G9YA 1ENHA 1QSYA 3SWNA 1PKTA 3OR1C 1E0EA 4X9DA 5GIOA 4A4EA 2KXDA 4WF9L 4Q5VA 5J4VA 1JHFA 1Z9CA 2VG6A 4A3GJ 5AQJA 1TS9A 1HPZA 1VQ4N 4WCEL 3T3FA 1NGEA 4HT8A 4DF4A 1N8RC 3FR0A 2Y4YA 4PJMA 4IHSA 1MH3A 3GBQA 1ODDA 2LRQA 4F7UB 4DBFA 2GIVA 3CC7I 4FWLA 1U78A 1Z7LA 1N9RA 3HPOA 3MCAB 1MNMC 4J6XA 4BC5A 1SHFA 1BKBA 3SMSA 3SEMA 1AEYA 4CJRA 4HXJA 4IHVA 4CSWA 4OJRA 1K78B 3CFOA 1WJDA 1Z9QA 3CDLA 1GRIA 2FUG2 3SPYA 3UATA 4D6WA 2A0FB 3VEVA 3DBLB 4M63C 2OPRA 2O4GA 1DLOA 3BCAA 2UUAK 3DKYA 4JI2K 3FMQA 3MN9A 2LCCA 1NZ9A 3KD5E 2GWKA 2EYYA 1B07A 2E1MC 4QQDA 4ZYHA 3EE9A 1TWBA 2O31A 1FY7A 2YSRA 3CZ6A 3RKXA 2IW5A 1ZX6A 4AT1B 4CEBA 1P7JA 2KFNA 2RI5A 4MO5A 3FIWA 2RMOA 2FRHA 1F9NA 2WB1N 1U6ZA 3R1XA 4IDKA 2KROA 1OH5A 1WI7A 1KFSA 3UDCA 4BRGA 3UKRB 3BZCA 1Y6IA 4OKKA 3LFUA 4CF2A 4CYCA 3OIQA 4OMYA 2SEMA 5KCOA 4GDFA 1K8AR 4M41A 5FWCA 3QG1A 2FZGB 1XG1A 4HPQA 1WXBA 1Q1HA 4KNYA 4CRIA 2J6KA 4DQSA 3V8JA 1CKAA 1HJRA 1DEJA 1USTA 1BHLA 1MBJA 5CKDA 3DYAA 4CFDA 2PUOB 4J9DA 5HRSA 3NGPA 1TV6A 1DPRA 4FJLA 2QM1A 4KULA 2QYOA 3L2VA 4HA8A 4KHWA 2BXYA 3SXYA 3J81K 3AL0C 2HFHA 3CJBA 2VV5A 3IL2A 2R92J 5L3BA 2HQEA 3GF5A 1NH3A 4BE0A 1XHXA 3KK1A 1QP2A 4U87A 1HYZA 3ZX2A 3DU5A 3M0TA 1KQ2A 5GAEP 2V79A 2GOMA 2GFAA 4ETSA 3I56I 1QCFA 2DO3A 4FJNA 5ELZA 2D0OA 4BREA 3FK7A 2LP5A 2BW3A 3JCMX 4EIAA 3CQTA 5CK9A 1Q81R 3ZSOA 4XLEA 2LCSA 3SWNC 2VC1A 2LP0A 2KDZA 5AIPA 4XTWA 3K5MA 4UV8A 1LWFA 2P9IB 1W5CC 1YIJI 3KLNA 1AKHA 1RR7A 1VQKA 4LG3A 1RDAA 1IBKK 3JAMO 2QWOA 4PJOE 5F04A 5CJ9A 1T8IA 4GKJK 1YITI 4ZH4F 2K3PA 1S72A 3WXJA 4FWNA 1M1KR 1XDSA 2EQUA 3D2EB 3V7SA 3DLLF 3IH3A 5EC7A 1D5VA 1IN7A 3QP5A 3X28B 3KZBA 1SAXA 5E41A 4BR9A 2P9SA 5CVIA 1ZUYA 1LNXA 1VQMQ 1WYXA 4D8KA 4CJVA 3OL4A 1GDTA 3AVBA 3CQ8A 3S16J 2K02A 1YI2Q 5GAOp 2L9SA 3A8YA 3TSWA 4RG2A 2DVEA 4ORZA 4JI0K 1TG0A 2RREA 3PFSA 5KYUB 3ZQLA 3CCUA 4ZGDB 2QWNA 3LA3A 1WWXA 4LLLA 1GOCA 1STZA 4J5YA 1ORPA 2KAFA 2K57A 4H0YB 3HZJA 1Q86O 2A6TA 4FL6A 1QKWA 4JKHA 2ESWA 1PG5B 1JLEA 4HUEA 5L8RE 1Y8QB 1JXSA 1OOTA 1X1BA 1YI2I 2KR3A 4OU0A 1NK3P 3A2FA 1T95A 3VF2A 2FBVA 4RM3A 2NUZA 2O61A 3TAPA 2ZKZA 2A08A 1ZYRF 4B1ZA 3H08A 3TW6A 3OYKA 1G3YA 4NL3A 2Q8KA 1V54H 3D5LA 2QSHX 4IWVA 1NK9A 4HSBA 3HC7A 2YNGA 1NM7A 1VQ8A 1PU8A 4E7JA 4LF7K 4A5BA 3NVMA 2XHBA 2K9SA 4ISEA 3EH1A 4BC2A 1ZG5A 3LANA 3BPVA 2YKMA 3QHSA 1SC7A 2ZZDA 2E2IJ 4UQGA 5D3GA 2VQHA 3ID6A 3S41A 2XRIA 5BPDA 2CS3A 4RTZA 1T39A 1LE8B 3WEEA 1KEAA 1U2VB 4DS4A 1ZBSA 1YJWQ 4WCIA 2K9NA 2WSFE 4DUZK 1LOJA 4CIGA 4O5FA 5DK5A 1SFXA 1MMSA 1PRMC 4B4CA 2CS7A 1P6RA 2RNAA 4RLFA 4M7DG 4CZIA 3GTGJ 1K9MO 2IPQX 4CJWA 4I6MA 4RB0A 2VPLA 5CQYA 3CC7A 4M45A 5JHFA 3SJJA 1NGFA 3V9SA 4XNFA 2V1RA 5KRSA 4DV3K 2M5WA 2DYRH 4DKWA 3SUNA 4JX6A 4QPQA 4PUOA 2NOEA 4D7NA 2V8IA 3RBBB 3WTTC 2EZLA 2E6ZA 1YTUA 1XMKA 1VQKN 2K79A 2DNUA 1M3BA 1WVRA 2RPNA 3G4SQ 3RSEA 3JRBA 1S72N 2A40A 5HLFA 5KPRA 1BWFO 1X01A 4KI6A 3RJPA 1WHGA 5IXBA 3KX2A 3HFOA 5LHHA 4CC3A 5GANe 3B8AX 1IHVA 3LSMA 1BW6A 5KYXA 2XSJC 3FM3A 4ICLA 4MO4A 1E4GT 4AIDA 1BW5A 5J8CA 4L9NA 2HPIA 1T38A 2FOKA 2ZXJA 3A01A 4L5GA 2CZ6B 2P5OA 2BXZA 4A3LJ 4F04B 4O44A 1T05A 4YNQA 1NKUA 1ZXOA 3S1NJ 3CCUN 3KLFA 1VFCA 1U84A 1JLGA 4CK1A 3AVKA 4FOEA 3CHWA 3AVJA 3GYHX 2J06A 5EG2A 4G1QA 1WNLA 3VENA 4Y0WA 4WFNL 3K58A 3K0LA 2XPUA 3FB9A 4YIFA 1EH6A 4BQQA 2IA2A 2DFEA 3SI6A 3UPUA 3C1DA 3I56A 3BGRA 3G1MA 2GM4A 1RBVA 4NYFA 1WAJA 5GINA 2CGJA 2FSNA 3TI0A 3DI6A 4JKDA 2GXGA 3MEDA 3HK2A 5L3GA 1TGOA 4OINF 2V7YA 4B1XB 2A6EF 3K0SA 3U3GA 2P7CB 3FZKA 4CFCA 3H0FA 4X65K 2UYTA 2F5KA 1YIJA 3C3WA 2G8KA 2DMUA