3OYEA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound2
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyeA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyeA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyeA03
1SL2A 4FLUA 4ELUA 3HM9A 5KI6A 3OYFA 1JLGA 1GOBA 4DTNA 3PNWC 4FM1A 1B9DA 3D45A 4M41A 4Z0UA 3MAQA 2MWOA 4LH5A 5J2PA 1JLAA 3S3NA 1WSIA 1WSHA 3KD1E 2BGGA 1WJRA 3OYKA 1RT1A 3RMAA 4PUOA 4FW2A 2GFUA 4L59A 3AVNA 1S9EA 4FJKA 3S3MA 2HQXA 3HPHA 3FC3A 4LH4A 3DRRA 4FK2A 2D0AA 4LSLA 4KHQA 2EFIA 2YNGA 3C95A 4AH9A 4HTUA 4C5HA 4M3UA 4DQQA 3AO3A 1Q9YA 4E7JA 2EQJA 3AO5A 3AVMA 3RWUA 4FU6A 2XHBA 4RG2A 2PQWA 1BISA 3V9UA 4PL6A 4CIGA 2LVMA 1JLQA 2RI5A 3FLGA 4CIFA 4C8KA 3NGIA 4CEFA 4E89A 1NKCA 1RTDA 3EY1A 1FKPA 2L3RA 4M3XA 2XY7A 2HNZA 3QESA 3OYBA 3CFOA 2RHYA 3CM6A 3O3FA 3S3OA 3FEOA 3HXMA 2AJQA 1S1TA 1QSLA 4DS5A 1EP4A 4QOZB 4FJNA 5D3GA 4DWIA 2DFEA 2GFAA 2IOCA 1ZBFA 4KO0A 3VQDA 2FBVA 3DRSA 4W5OA 4F3OA 3NF7A 2A1RA 3EAEA 1XHZA 4CHQA 3AA2A 4FM2A 4IUVA 1NK9A 4M42A 4C5IA 2E5QA 2RHZA 2JGUA 1L3SA 1TK8A 3IRXA 4CJ4A 4CEEA 3ISNC 4PQUA 3KLIA 5C24A 4I7FA 3SI6A 4F3TA 4KB0A 3LANA 1KRPA 4HUFA 4RW7A 4FW1A 2YKNA 2O4XB 2HHXA 1TVRA 1BHLA 1WAJA 3LZIA 1L5UA 1JL2A 1NK4A 2E4LA 3LPTA 1ZYQA 1WAFA 4FLYA 2G8WA 3C6TA 3OYAA 3U3GA 5HP1A 4KI4A 2BANA 2ITGA 2YRVA 3DLGA 2X35A 3VQ8A 3T19A 4WE1A 4FJGA 3K5NA 1LWCA 2HHTA 2BUDA 1SL0A 4AHRA 4CJQA 4CEBA 3VQ9A 3WNFA 4IUUA 5SWMA 3MEAA 4PA1A 1XNIA 1A5VA 5J26A 1NJWA 2FBYA 4A4FA 1JKHA 1X9SA 2BE2A 2EQUA 4I2PA 2F8SA 3L3UA 3SUOA 3QIOA 2Y1IA 1BQNA 4TSXA 2DIGA 1YT3A 1VRTA 1TKZA 1JLBA 3HL8A 4B9MA 4H4MA 3HO1A 1RT3A 1KVCA 2VG7A 2HVHA 2GF7A 4IFYA 3VQEA 3P8HA 1KLNA 4W5TA 4FLWA 1FKOA 4N47A 1RDAA 3EYZA 4FJHA 3V1OA 4B8AB 1CZ9A 2HW3A 4LD6A 2JLEA 3ITHA 4CE9A 4PLIA 3NH2A 5FRMA 2Z1IA 1NKEA 3I0SA 2OPSA 2ZQBA 3OYHA 1RNHA 2X6SA 4CHZA 1L3TA 1T05A 3WNEA 4NYNA 5KTQA 4DU1A 3P8DA 3VQQA 1KFDA 2RPIA 1QE1A 1JLFA 3F70A 1SKWA 3KD5E 4FCYA 2OPRA 4CJLA 1RDBA 2XDPA 1YTAA 1RBTA 1LV5A 5CIUA 1ASVA 4MQ3A 1QHTA 4CJRA 5HLFA 3VQAA 3SUPA 1LWEA 3DI6A 3OJSA 2G8KA 3DLHA 4CJFA 2CKKA 1KFSA 4DQSA 4MFBA 3VQ4A 5HRRA 3NE6A 2O4GA 3ALYA 1SV5A 3MP6A 2P1JA 1ZBHA 5J2MA 2P5OA 3E01A 3QIPA 3TAFA 1MU2A 4AHTA 3HK2A 1GOCA 1HPZA 1CLQA 4J2AA 3OS0A 4RW4A 4KREA 3DYAA 1RCHA 1J5OA 5C25A 3NNQA 1UA1A 1XI1A 4ID1A 3CFPA 3KK1A 2I5JA 4C8MA 3Q1JA 1KSPA 3LWLA 3JYTA 4CEZA 5IN1A 5CZ2A 2HHUA 4DTXA 4J2BA 4CK2A 3IS9A 1BCOA 3G0ZA 2YV0X 3MXIA 4PY5A 4OVAA 3LP0A 1D9DA 3K59A 3ASKA 1Z25A 1LW0A 3FFIA 1LAVA 4Y1CA 3RMBA 3OY9A 4CF0A 1HYZA 2BKDN 3L3VA 2EX3A 3QBYA 4J2EA 3NF6A 3KIOA 3AO1A 4FXDA 2P51A 4CEQA 2IDOA 2HQEA 4A4GA 2E6MA 1U49A 1W0HA 3T1AA 5FRNA 4DSIA 3LP1A 4HVJA 4II1A 4O4GA 2VWKA 2IGIA 4N4GA 4B9LA 1XWLA 1WSEA 5EU7A 4N41A 3NHGA 1Q9XA 1VSJA 4FJMA 4EZ9A 1EETA 3HYFA 2R58A 1WSJA 5C42A 4Y1DA 1KHCA 1OI1A 3AA5X 1TGOA 2X78A 5JS2A 2OZSA 1OYXA 5DK5A 4DQIA 3M8RA 4QQDA 3NTHA 3ZT0A 3EZ5A 4E1NA 2D9TA 4Z4HA 3KKSA 2RN2A 3QNOA 2EKOA 1S5JA 2GUIA 2M16A 2K3YA 1NJZA 3UT1A 4DTPA 4DTJA 2YHAA 2FBTA 3PMIA 3L2UA 4Q0BA 4OJRA 3KLEA 4BDPA 4OVLA 2M1HA 2QKKA 4AHCA 4Z4IA 2B8AA 3RTVA 2EQKA 4OKJA 1VRUA 3FDRA 1B92A 1BQMA 1HNVA 2MWPA 4OPKA 2XK0A 4JRPA 3WNHA 4A4HA 3AO4A 3KLFA 3DB3A 3D0PA 3LLRA 3PO4A 5HROA 4AHSA 4A4EA 3ULDA 2WOMA 3P1GA 4KTQA 2O4XA 3QETA 1RT5A 3SV4A 4F2SA 3META 3P5JA 3OMGA 4DLGA 1VSFA 2Z1GA 2A1SA 3RRGA 3ZSYA 4O55A 3OYCA 3VQBA 3OJUA 3H08A 3MEEA 5J39A 3F73A 3AVHA 3OYNA 3MXMA 3THVA 1S1WA 4N56A 4E7KA 2DAQA 1C0UA 4PWDA 5D6WA 4XIUA 5CZ1A 4DSJA 3QIIA 5I42A 2O4IA 2Q3SA 2QQSA 4QW2A 3NGYA 3M8QA 2DTUA 4L8RB 2PZSA 2W42A 3ZEHA 5SZTA 2B6AA 4JRQA 3O4NA 2LSNA 3AO2A 2KZZA 5KE2A 3U3YA 2RJEA 3LP3A 3K5LA 3TARA 3QEVA 4Z4EA 2IG0A 1KVAA 2WONA 3VA0A 3DLBA 2HB5A 4IURA 4Z4CA 1RBRA 3HVRA 1LWFA 3L2VA 1VSHA 4YFUA 3V4IA 3AV9A 2PYJA 4LD0A 3SQ0A 3NTIA 2ZE2A 4M3ZA 4CHPA 4FJ7A 1IKVA 4CFCA 2P5GA 3CQ8A 3VQCA 3PY8A 1R0AA 3RRHA 3O3HA 3AVCA 2RF2A 5M9OA 4KHNA 2RHXA 4CF2A 2RJFA 1RBVA 4KV8A 4FYDA 1RT4A 4QQGA 4E7LA 1TKXA 1SKSA 1TK0A 4KI6A 1TL3A 3C6UA 2VG5A 3QINA 3ZSQA 2RJDA 4ELVA 4DQRA 1WLJA 5KE3A 3DLKA 3ZT4A 4CF8A 1DLOA 5J2NA 1RT6A 3SPZA 3MP8A 1G15A 4DTOA 3UWNA 3G10A 1U45A 4EZ6A 1F21A 1NJXA 1BGXT 3AVGA 4EDUA 1C1CA 1N6QA 4UC4A 4DFMA 1ZBIA 4N76A 3C4SA 4ZTFA 5HBMA 1JL1A 4E1MA 4NS5A 4FLXA 3ME9A 3M8PA 1VSEA 2LRQA 4FJ5A 4B9SA 4DG1A 4DTSA 1KLMA 4UQGA 3VQ5A 4RW9A 4FM0A 4G1QA 3K2PA 3MEVA 3AVFA 3E9GA 5K14A 4KKOA 1EX4A 1ASUA 1RBSA 1HYVA 4ZHRA 4CJPA 4FLVA 4Z4GA 1TKDA 1JLCA 3LX7A 1RDDA 3QLHA 3ZT2A 3ZSXA 1IH7A 1LAWA 4RW8A 4CK3A 4HUEA 3V1QA 1EXQA 4CCHA 2L89A 1C1BA 4GMJB 3V1RA 1O1WA 1G5VA 2PYLA 4FK4A 2F96A 3OYJA 1RT7A 3PX0A 1VSKA 3AVBA 3OYLA 4LY7A 1WSFA 3QNNA 4X34A 4JLHA 3TAGA 3HSTB 3OMCA 4CGJA 3KK2A 2JTFA 3RR8A 1UAXA 4NZGA 4CJVA 5KGXA 4DFJA 1JLEA 4HHTA 2RHIA 1BIZA 4OKEA 4C8NA 3NF8A 1VSIA 2Y1JA 1I3AA 4JS5A 1D8YA 1RI0A 2GV9A 1WN7A 1NK8A 3LPUA 3CEYA 1NOZA 3LDSA 4CJWA 2G8IA 3RMCA 3OS1A 4Z4FA 5CYQA 5J1EA 1JXBA 4F2RA 2B5JA 2R5MA 3P83D 2G8VA 4ID5A 3OYDA 4BWMA 1NK6A 3SYZA 5KGWA 1WGSA 4DFPA 4O0JA 3LALA 4DU3A 1UA0A 1EKEA 3CM5A 1CXUA 5D6XA 4CFBA 4KTWA 5FDLA 4DSEA 3PMTA 2WACA 1HYSA 4CJ3A 4E3SA 2E6NA 4B08A 4N5SA 1RBUA 4FLTA 3AVLA 2QKBA 4CRIA 2F5KA 3QEPA 3I0RA 1HJRA 4IUTA 4CHNA 3VQ6A 3TANA 1NJYA 4BE0A 1ITGA 2QK9A 3DLEA 4CJ5A 4DTRA 4E7IA 3HPGA 2G8HA 1HNIA 1HQEA 3H8ZA 2KFZA 3B6PA 1RTHA 3QKJA 1HMVA 1CXQA 2D0BA 1OZ3A 4ELTA 4B9TA 1C0MA 1QTMA 3I8DA 2DFFA 1RTIA 3KUFA 3SUNA 2X6NA 1N5YA 1B9FA 4CESA 4BDYA 2RI2A 4OKKA 4M3YA 2ETJA 2XRIA 4DU4A 1BIUA 3ZSOA 3IAYA 3C94A 4IFVA 3DB4A 4KTZA 1LW2A 1VSDA 2JZ2A 2G8UA 3S9HA 5I3UA 3K5MA 1GOAA 3V9WA 2XY6A 2DIQA 4CGHA 4HCCA 3AVAA 3BDPA 2XY5A 3TI0A 4H4OA 4C5EA 4DSKA 3SZ2A 3LGLA 3L8BA 1S1VA 2FHDA 3VN5A 4AHVA 2KTQA 1YVUA 1J9AA 3KTQA 4GY5A 2F8TA 2X4YA 5HRNA 1QQCA 2LDMA 4NCBA 2XO7A 4AHUA 4BE2A 2L8DA 3QEWA 1NK0A 3M8SA 2B4JA 1SUQA 2YNFA 3K5OA 4HCBA 2R5AA 3O3GA 3DOLA 3B6OA 4B9WA 1XC9A 4FZXC 4B9XA 1S9GA 4N4IA 1S1XA 1X9WA 3TABA 2VG6A 1QSYA 3NCIA 3KLHA 4KFBA 3SUQA 1A5XA 1WSGA 5J2QA 1VK0A 3AVJA 3L2WA 4W5RA 2XY8A 3SNNA 3AA3A 2IAJA 2HMIA 4NCAA 2HHWA 3LH0A 5E41A 4CEAA 2M0OA 1QSSA 4K8ZA 1Y97A 1IO2A 5JS1A 2HNYA 4HUGA 1BL3A 2OPQA 4NYFA 2YKMA 3BDLA 3SQ2A 1KVBA 2P0KA 5D6YA 2D5RA 1TAQA 4QAGA 4YNQA 2IC3A 4B9NA 3CFRA 4DMNA 4FJIA 4W5NA 5KCOA 4ZTJA 3ZSVA 3SJJA 4QVZA 3UIQA 3MXJA 2G8FA 4IG0A 4CFAA 3SD4A 4N4HA 4OLAA 2Z1HA 4CJKA 3K58A 4OPJA 3DM2A 3LYIA 1U48A 3SQ1A 1J53A 2HNDA 1XHXA 3TAPA 1S1UA 4I9QA 4BACA 4DSFA 4BD3A 4HCZA 2OPPA 4JS4A 5HRPA 3V6DA 1X1PA 1ZBUA 5KCHA 1S6PA 3L2RA 1BI4B 2DFHA 1TL1A 3K57A 2RO0A 2ZD1A 2NUBA 4DFKA 3DLRA 1HRHA 3VA3A 3NDKA 3V81A 2DY4A 2LCCA 4GW6A 4OGCA 3ZT1A 4W5QA 4DSLA 1RILA 3V9ZA 3MP1A 5KH6A 1REVA 5FROA 3NTKA 3NH0A 1ZBLA 4FZZA 2KZMA 1N27A 1DTQA 4IBNA 3MEWA 3VQ7A 3LWMA 4OLBA 4CJEA 2HHQA 5CYMA 4IDKA 3ZSWA 3MO8A 3OYEA 1C6VA 3DOKA 1NOYA 2X74A 4CJUA 1ASWA 3VQPA 4DF4A 4DF8A 4DLEA 1HQUA 4AILC 1VSMA 3NBPA 3CYMA 1UOCA 3HT3A 4H8KA 4M3WA 2R57A 2FC0A 1RT2A 3HP6A 4IUPA 3OYIA 1WJSA 4M3RA 3TWHA 4K8XA 3TAEA 3GOXA 1U47A 4FJ8A 4E0DA 3NAEA 3T3FA 2PY5A 3HP9A 2BDPA 1NKBA 1FXXA 1JXEA 3PFSA 1X9MA 3QEIA 3PUFA 4Q5WA 5T7BA 4CJSA 2LTOA 3DLMA 1T7PA 4OGEA 4CEOA 4B3OA 1IKXA 4I9LA 4FVMA 4R5PA 1I39A 2QXFA 2D0CA 2RI3A 3KKRA 1RTJA 1IKYA 1WNSA 1T8EA 1K6YA 4CGFA 2X4WA 3MEUA 2KQ2A 4CHOA 4KHYA 4KRFA 5DMRA 4ICLA 5KRSA 4QCLA 3QJ6A 4FL6A 2YHBA 4IUQA 4CGGA 5IAYA 2R7YA 2GBZA 3E9FA 3HVTA 5CY4A 3PX4A 3MEDA 3QO9A 4C8OA 2HHSA 2RHUA 4LSNA 3L42A 3TAQA 4IG3A 3AVKA 4FLZA 4O5BA 3PX6A 4FJ9A 4BWJA 4CECA 1S6QA 4RW6A 2K3XA 1DTTA 1UWBA 1KTQA 4O44A 4CGIA 3BGRA 3A2FA 1TV6A 3O4QA 1VSLA 3RMDA 4FZYA 3SV3A 2KW4A 4Q5VA 3IG1A 4CEDA 4CIEA 2KFNA 1U04A 4KHWA 4CERA 3ASMA 3PO5A 3F9KA 2VYTA 3HPOA 3KJVA 4J2DA 3AA4A 4KHSA 4F4KA 2NLUA 3NF9A 4FK0A 3OYGA 2EQMA 4Z02A 1OZ2A 4B8CA 3V9SA 3NH1A 1W9HA 4EP4A 1MHNA 1J54A 4BDZA 2X4XA 1D9FA 3U6FA 4FJJA 1C1AA 4NCGA 2E6LA 4QQ6A 4F8RA 3S6WA 1QS4A 4E19A 1CZBA 4RG8A 4CF1A 3SPYA 2G3RA 1YTUA 3V9XA 3DMJA 3LZJA 3LAMA 3M9QA 1RDCA 1WJQA 1NK5A 2OZMA 3SCXA 4M45A 4DTMA 4DQPA 1KCFA 2QQRA 4C8LA 1SKRA 3HJFA 5C0MA 2IS3A 3MEGA 3LGFA 5KRTA 3JSMA 1U4BA 1BCMA 1FK9A 3O8VA 2OYQA 1TKTA 4B9VA 4DS4A 3CG7A 1IKWA 2YNIA 3OVNA 3ZCMA 4KAZA 3OQ5A 1SL1A 4IKFA 1TK5A 3LP2A 2BIVA 3TR8A 4CHYA 3KK3A 4GVMA 4FJXA 3ZSRA 4PLLA 3LAKA 3OYMA 2Z1JA 1SSFA 3OS2A 1Q8IA 3AVIA 4FJLA 2FBXA 4O0IA 2OA8A 3OA6A 1L3VA 3WNGA 3QERA 4CF9A 3TAMA 3PV8A 4E7HA 4B9UA 1L3UA 2VWJA 5HRSA 3ZT3A 4KPYA 4M3TA 3QEXA 4CK1A 4KHUA 1A5WA 2HHVA 3H6ZA 2ATQA 1TAUA 4I2QA 2HVIA 1T03A 4EP5A 3MECA 3SQ4A 1IG9A 1BI4A 3KLGA 1H3ZA 4BE1A 4KB1A 4C5GA 3RR7A 2RJCA 3ZSZA 1Z26A 2EHGA 1D5AA 4DTUA 1C0TA 3NGZA 4CFDA 3OB9A 5C6SA 2YNHA 3DRPA 4CJTA 1NK7A 3NFAA 4CGDA 2RKIA 3L2QA
chains in the Genus database with same CATH superfamily
2O8KA 1FOWA 4FLUA 2P8TA 2DJIA 5KI6A 2I10A 2ZXWH 2DT5A 2OAWA 1GOBA 4C3HJ 3CXCM 4DTNA 1NPPA 1WQ7A 4BY7J 1FYMA 3V7CA 3EH1A 4JK8A 4B3SK 1TUGB 1O57A 2VE9A 3MKWB 2VI6A 1GLJO 3C2BA 4BR9A 4A5MA 1PRMC 2FQ3A 2W00A 1WSIA 2VXDA 1NGHA 1RRQA 1WJRA 4Y91A 3OYKA 1Z0XA 2L5QA 3GTJJ 4FISA 4AVPA 2BZYA 1OJLA 1WLPB 2K5LA 2EINH 1XC3A 1MBKA 5ERIA 3AVNA 2VQLA 2KEAA 4M7YA 4RLQA 3HOTA 5BN9A 3PO2J 4EGYA 3HPHA 2QYZA 2XI9A 5AQLA 3P38A 2D1HA 4PKCC 4FK2A 2HBMA 1JU5C 1Z7LA 2DZCA 4TVRA 3CCQT 2K02A 3CC7A 4C23A 4J9BA 4C5HA 2JTVA 4HX7A 1HBXG 4E7JA 1BU1A 2LT4A 1TZLA 4XR6A 2Z3YA 3BG6A 3CC2A 1PD0A 5LJVA 3SHWA 3RYRA 1VOMA 3A0BC 2JN6A 4V2GA 3KYCB 1HKSA 2PUOB 1ZYRF 2H3GX 5GANd 4C8KA 3LL7A 5IT9K 3NGIA 3ROUA 4M75C 2DTIA 2ZMEB 2IIRA 3MKZA 2M4KA 2ZWHA 1TQIA 2L3RA 2A08A 5H20A 3PGGA 3M8EA 3AAPA 3OYBA 3CM6A 1RNLA 5B1AH 3QJYA 4I98B 2F48A 3FEOA 4DEXA 3HXMA 3ZQHA 3K4KA 3NMUA 2TDXA 1EP4A 3C12A 2CQXA 4FJNA 4OMQA 3P9CA 3SZPA 2QWNA 2IOCA 4KO0A 3S14J 2FBVA 4W5OA 4F3OA 2L7KA 3EAEA 1PP8F 3VRZA 4IRGA 5DLQE 5IT9Z 1SC7A 1FLIA 1KU9A 3CETA 1NK9A 4M42A 2GA1A 5HL7L 4AIHA 2D0OA 5CCAA 1TK8A 3A0HC 3GVAA 3PUBA 4CEEA 4PQUA 4FIBA 2XC7A 5GANf 2M30A 5LFAA 1YI2N 4F3TA 4KB0A 4X0GA 1NG2A 5DUKA 4I7HA 4X1VA 4DV3K 5EX5A 1OYWA 2QQ8A 2E3IA 5HY6A 1L5UA 2L7ZA 2Q1ZB 1R9TJ 1SEMA 2JT1A 2ZGZA 3ZEUB 2R93J 4BQOA 1Z9ZA 4FLYA 2G8WA 2KXDA 1KXPA 5K5QA 4KI4A 1NM1A 2UUCK 3BY5A 2FQ4A 2YRVA 2K57A 3DLGA 3F22A 1KFZA 5HLIA 4BRCA 2CUEA 1VQ9I 4FJGA 2ISYA 5HLGA 5F0HA 1POGA 2BUDA 2GWRA 3CVTA 5CR2A 1X2NA 4IUUA 2HFHA 2MPXC 4PA1A 1A5VA 3H0HA 2R7VA 4ZGJB 4NXMK 2IS6A 2XKOC 2YCHA 5BPMA 5EYRA 1X9SA 3JCMb 3M5RA 2EQUA 2F8SA 4OWRB 1P4WA 1P7IA 2D5VA 2Y1IA 3PL8A 1BQNA 4V19S 4QIWN 5E3NA 2EIKH 2FBIA 4IDHA 1VRTA 1TKZA 1JLBA 1XGOA 4BQZA 4H4MA 3GTLJ 1T0JA 1UHMA 3MFKA 4RM3A 4DCHA 2DAOA 4P1WA 5E3MA 4JX5A 2AS5F 4FO0A 2YR2A 4W5TA 4FLWA 1M2VA 4ITVA 1Q86R 3VEPA 3BQYA 1K73C 1B7TA 1KQSM 3V1OA 4B8AB 4PJOC 4IHYA 1X4OA 2VKHA 3UKUA 4XLPF 1VQ5I 1VQNN 3V8KA 1YFNA 1NKEA 3QYBA 2GIVA 4B3XA 1J3TA 2DVJA 2X6SA 1FJLA 5EZGA 5TKYA 3LM2A 3VODA 2K3BA 4R55A 2LBFB 2Y90A 2KYMA 1J5EK 2QQBA 4IHVA 3FXJA 3R0AA 4Y15A 1QE1A 3F70A 4B24A 1TWGJ 3GCMA 3IDHA 4XU0A 1X01A 2RQVA 3FLCO 2AT1B 1RBTA 4HVWA 5TKWA 1ASVA 2RD1A 2DNUA 3DU5A 4XLFA 3G6EA 4L5EA 2DXCA 3VERA 1MH4A 2R7XA 1QQNA 3KBGA 1VQ9T 3OJSA 3DLHA 4CJFA 2NOZA 2GIZA 4MFBA 1OOTA 2LQKA 3WXKA 4RTUA 2P1JA 1JJ6C 1KG6A 5HDNA 1ZUUA 4C92B 1YJ9Q 2QGUA 3CCMT 2ZAEA 1SQKA 2CP0A 4U7BA 1KIKA 3CF2A 1J5OA 2ZPFB 3VEWA 2HPMA 1RUWA 1G59A 2JWKA 2VT2A 3M0TA 4ID1A 4RCBA 3VYHB 3CFPA 3TSQA 1F1BB 2GELA 3LWLA 3BE3A 2CQ7A 3RPUA 3I55N 4X9CA 2HXOA 3DBLB 4HNUA 3FHZA 2Y4XA 4JP0A 3F0CA 3JYTA 1OH8A 2MA3A 2DA7A 5M1QA 4BVPA 2R4GA 4C92G 4DYRA 2KT8A 2ABKA 3BCBA 1QP3A 1AD5A 3BZKA 2O31A 2Q2EB 5GAMg 3K2ZA 1VQ5T 2JUFA 4CK2A 4D7NA 3OW2P 4UOBA 2YV0X 1G3SA 4XTWA 2KJBA 1E6HA 1RI9A 1OH6A 1LW0A 4BI4A 1LAVA 3RMBA 1JBMA 2BVLA 1HYZA 1WI7A 1MMAA 3WE2A 2ZMEC 3ZYYX 4L9TA 2M0CA 2EX3A 1PNJA 3DJCA 2WTUA 3EFSA 1FMVA 4RBOA 5DV5A 4FXDA 2ZKZA 2NS8A 2XF7A 1WWXA 5FPDA 4D5FA 5GMKj 2EYXA 1G3WA 2E6MA 4XQFA 1W0HA 1V3FA 2HTJA 4JI3K 4LLNA 4HVJA 2KDSA 4Z88A 2UXDK 3VS1A 1EV7A 1IGNA 4XMYA 4B9LA 3LAPA 4IOAF 2XSJC 3URGA 2L3QA 1XWLA 2NUPA 4EMHA 1ATRA 1SANA 3CPFA 4U0VA 1Z91A 1Q9XA 4F7UB 3H9NA 5L8RE 3HYFA 4ISGA 1IXCA 1LDJA 3QYEA 1Z3XA 5LGTA 1M30A 5CYVA 1KHCA 1FWZA 3M0SA 2DO3A 5AFUA 4I2OA 4W97A 4B43A 1Q81R 4M3GA 1ZUYA 4CI6A 4DQIA 3M8RA 1Z77A 4QQDA 4GRIA 3ZQCA 1BYMA 2EV0A 4EVVA 4XEIA 1VYUA 3ZGKA 1BW6A 1T44A 2HQ5A 5GMKh 2DTHA 5F1XA 4F7UG 2GTJA 4U0YA 1Z1DA 4BGBA 3O8GA 4DEYA 2YI1A 4BEHB 4DTPA 3VPRA 3QHSA 1K9MR 3EGUA 2X85A 1MDUB 1LDKB 1ZHIA 3HRMA 1G3TA 3OWTA 4ZYHA 3PMIA 4PL8A 1N32K 2JPSA 3HC7A 4BDPA 1I5OB 2QKKA 4C3JJ 4Z4IA 3THYA 2DQLA 4MEXF 2D8JA 1WI9A 1BQMA 2MWPA 3U23A 3MKLA 3S8PA 3LFUA 1VQLT 3VUBA 2KZVA 3LDNA 2FZGB 4LC9B 1IGQA 3S2HJ 3L1AA 3FXQA 4FSSA 4CUGA 3K4NA 5AZJB 1XMKA 3CCEN 1J59A 2WAQN 2JSCA 1ULYA 1HYOA 1PUFA 2DILA 2FXAA 2HYJA 4DR6K 4JYKA 3M0QA 3RESA 3META 3P5JA 2EFWA 3OMGA 1P92A 2GUPA 2LTPA 2A1SA 1I27A 5GANe 3H08A 2XAGA 2YG8A 4UV8A 7AT1B 2L9VA 3FMRA 2V9PA 5CE3A 2WTEA 4M7DB 3THVA 4LF5K 3CCLN 2VQHA 2BE5F 1I5LA 4PWDA 3QOEA 3CD6N 2BE7D 1G4DA 2LMDA 2QQSA 4QW2A 3M8QA 3GTKJ 4Z94A 3AL0B 2PX9A 3S1MJ 3VYRB 3G71N 2HCKA 2R7RA 1YHQA 4FT2A 3AO2A 3VOEA 4A62A 3LAJA 1Z05A 2AK5A 4FYYB 3I53A 1YWPA 2X6XA 3LP3A 5D6FA 5DM7R 2CS3A 3H0FA 3VGMA 2BZTA 3CCUQ 2IG0A 1KVAA 4M7DG 4UVBA 1K73O 3M55A 2PJRA 3CCJT 2EIFA 4CCJA 4UB8C 3VW4A 1LWFA 1IRFA 2OJED 1RKTA 2DD5A 1YNZA 4O3MA 3NPFA 3JAME 4AI5A 1WPKA 1UFMA 3NTIA 3RQ4A 1NLPC 1J9IA 2F5CA 1V1CA 2X1EA 4FJ7A 3WUHA 1XG7A 1E6GA 1R0AA 3RRHA 3O3HA 3E1YA 4C92C 4RTZA 4CC3A 1HK9A 4AIKA 1WEGA 4CYCA 5CVVA 1LFUP 4RCCA 2HSEB 1IXRC 4BHCA 3OS5A 4HV6A 1M3AA 2K9NA 4KV8A 5B1BH 2M8GX 5LEKA 4E7LA 2HL5C 4LUEA 3Q9SA 1M1KU 3SWNA 1X58A 2KP6A 3ZSQA 3Q7BA 1MWMA 3MCAB 3J7ZO 3VWBA 2K4BA 2DYSH 4M73A 3AY9A 5LBQA 1WLJA 2X3WD 3G4ST 4XOTA 2DJNA 4QWQA 2ZPHB 3Q3SA 1HSQA 2K27A 5H6RA 3ZQ7A 2YLBA 3X25B 2VJ4A 3G10A 4C0FA 4M7AG 4R0KA 2XPUA 4EDUA 5AQPA 1WEFA 4LG0A 1Y7XA 4G9ZA 3V8LA 5A2QO 2W48A 1Q18A 2M4GA 4NL2A 1JL1A 1VYVA 3A0IX 5D5VB 3FJ5A 3J80Z 4C0GA 1WQ2A 3KEQA 4XRFA 2CW7A 5AR0A 4BH9A 1TL8A 2K6DA 4RW9A 1A31A 3K2PA 3KYDB 1NGIA 3TGNA 4KKOA 1EX4A 2UUZA 1M1GA 4EAHD 1RBSA 1EQYA 1FIPA 4ZHRA 1SPKA 2F5TX 2BZ8A 2BXYA 2ETHA 2M9HA 4XKVA 3H92A 3ZSXA 1B6AA 2BHYA 3T5XA 1LUJB 4D8KA 4ZGDB 2JA8J 5CHIA 4IVNA 3KZBA 2ZM6K 1L0OC 4JX6A 3R1XA 3KLOA 3UE5A 1LAWA 2PMUA 1F43A 1SVOA 3THWB 2A41A 3D5RC 4RW8A 2LLKA 4XL9A 3DPLC 3PIOL 5KNLA 1I8FA 3V1QA 3RKQA 1W7PB 2E2QA 5HCKA 2M3AA 1C1BA 3ABKH 3V1RA 1O1WA 4NOYA 4IZZA 3N5BB 3AGKA 1NGCA 5D6EA 5BPDA 2E41A 1Y8QB 3CC7N 3JB9I 1H3HA 2EFOA 2LK2A 2HDCA 3CC2N 5DM7F 1ZSZA 3Q9VA 1FC3A 3AVBA 3OYLA 4JEPA 2L2PA 2P5VA 3OMCA 1R36A 2MIOA 3ATUA 3A1YA 4BBSJ 3I33A 3S2WA 2EGEA 4NZGA 3O5BA 5KGXA 2K40A 1E3HA 1UEBA 2D1XA 4HHTA 1QZ6A 1UMQA 1BB9A 1YITA 1NBWA 2AQEA 1VSIA 1TTHB 1LOJA 1LEAA 5C15A 3HHTB 3MZHA 2NVUB 1X2MA 1A04A 1I3AA 4EJTA 2ROLA 1RI0A 2MF2A 3LSJA 3GTGJ 2L0AA 1YJNA 1NK8A 3W2WA 4J7IA 4BJ6C 1TG0A 2G8IA 3RMCA 4Z4FA 2HAXA 4MDAA 5CYQA 1JXBA 1YIJA 3CESA 3B8AX 3P83D 3OYDA 3EKUA 5KGWA 1BU6O 4C8QB 3BR0A 1O9SA 4JZ4A 2FO0A 2J06A 5J3BA 2LY2A 3DXMB 1UA0A 4XLEA 1VIEA 3CM5A 3OW2S 1R7JA 2ZF5O 3N05A 4OMFB 5F2RA 2VJ5A 4OIQF 1YYVA 3KZZA 1RBUA 4DR4K 4CRIA 1KQSA 1K79A 3X2QH 5I11A 3KP7A 2QUFA 2JA7J 4HQMA 1G3YA 4BQQA 4IUTA 1AWOA 2GOXB 1NJYA 4A5NA 4HG2A 4LJZF 4CJ5A 3HPGA 4C8QG 2G8HA 1HNIA 1XNRK 3J81Z 1QVFS 1HKCA 3B6PA 1MV0B 3TSPA 5GAGP 4M7DC 4HDUA 4QS8A 1HMVA 3AHUA 1Q82C 4P5OA 4JI1K 4BRLA 5C4XJ 1IRZA 1OZ3A 3R8EA 4VUBA 4FX0A 1LFBA 3SZGA 4B21A 1ZG3A 2F4MB 3KUFA 3CF5L 2O03A 1EBMA 4FSVA 1W2BP 1N5YA 2E1HA 2R5ZB 4M78E 2D0NA 1HD3A 3CJ7A 4JOMA 5GIPA 1PU6A 9ANTA 4BDYA 2RI2A 3K1MA 1K83J 4V2SA 4OKKA 2CFXA 4C2MJ 1VRLA 2WSFE 2ETJA 2XRIA 3ZXSA 3ZSOA 1SZ2A 2G8UA 2KIMA 5JVGL 3NFCA 3S9HA 4OMYA 2QK0A 1G2BA 4A3CJ 2AA4A 3V9WA 5JHUA 3AAQA 3MWMA 4HCCA 3CCSI 3BR1A 3NEUA 4C5EA 2HNHA 2GWKA 3HL2A 2YUQA 1KG5A 1JJ2A 1BBYA 4IZ9A 2X9DA 2ESWA 5J1UA 5HRNA 3E5UA 3BZ6A 4M7AC 4BRIA 5DM6L 1V5FA 5D4SA 1S29A 1LDDA 2VJJA 1NG6A 5BMZA 3VUZA 3VSLA 2KVQG 1SUQA 3NVMA 5F27A 3WTTC 4CD3A 4DW6A 3AG3H 2EIJH 1O3TA 2J5OA 1MIJA 2NRTA 1YQRA 4L9VA 1BOTO 4B9XA 4XKWA 3K9JA 3HUGA 2QLZA 4PHTX 1QSYA 2F2VA 3WTXC 2NRRA 3U4LA 2COYA 1VK0A 5LJ3d 1TS9A 4W5RA 4HSRA 2H6CA 2HZTA 3AA3A 4Y0WA 2V4JC 1VQ8I 3HTUA 3CJBA 4ENKA 2P9NB 2E7XA 3M07A 2DL7A 3QU3A 3LH0A 3G6EN 3VMFB 1RABB 2DLLA 2VLAA 1QSSA 1X1DA 3REOA 1Y97A 2HMAA 1YJWA 4BRHA 5JS1A 1PD1A 3QO3A 2ZJRF 2X48A 3SDBA 1VQKI 3BG9A 2OPQA 5B5EC 2A3LA 1QZZA 4XRSA 4PSWA 3BDLA 2P0KA 5D6YA 2X51A 1JTXA 4FOIA 3MKDA 1HNXK 2IC3A 5AQOA 4B9NA 1XG1A 3CFRA 1I6HJ 3SEZA 1C0FA 3WTYC 1DEJA 2P0QA 3E5XA 4W5NA 4YRVA 4N0AA 3GF2A 3OSSC 3CCST 4P55A 3V7RA 4QVZA 2NRZA 4CH7A 3MXJA 4XLHA 2G8FA 1RRJA 4D0PA 1NHAA 3O9SA 1LEBA 4ABZA 4CJKA 3EG0A 4OPJA 3TO6A 3WQTA 3EHRA 3UATA 1GXQA 3PIPA 1DKGD 4EMKB 2LOOA 1K4SA 2JS2A 1SD6A 2WB1A 2RDPA 3A5LC 2XAJA 5EVZA 2D45A 2DA9A 4AG1C 4BACA 3RPQA 3C7NA 1RRSA 1BR2A 3H1CA 4HWIA 3CUQB 1HSTA 3PVQA 2P9SB 5FLXE 1IF1A 4ASNA 2QWLA 1TL1A 2KRFA 1GL5A 3ERED 2JPCA 1K61A 2P4TA 3ZMZA 2VYPA 3DLRA 4V2FA 1HRHA 3K7AJ 1M27C 3V81A 3BJOA 2LCCA 3I5SA 2Q2RA 3J7ZI 4P96A 4W5QA 5AQSA 2QM3A 3V9ZA 3MP1A 2ZCFB 3EEQA 5AZIA 1WJFA 4FOEA 1VQMI 4W1UA 1VQ8T 3NTKA 5AQHA 3JB9D 1DTQA 2AP1A 1DDNA 2RQPA 2FEZA 3DBRB 3VQ7A 2OCCH 4Y92A 2XIGA 3SMSA 1XMAA 4OLBA 4RGRA 5CYMA 4IDKA 3ZSWA 1VQKT 4C8QC 4M3BA 4A54A 4DOWA 4I01A 3T1YK 3U1KA 2A69F 4BQAA 1YF5L 4L9NA 3HXLA 2FZKB 3MVPA 3JCMV 1HQUA 3P8BB 2LJ3A 1M90R 1UOCA 1ILYA 1CF7A 4M3WA 2XAQA 3UPUA 1BW5A 2QQAA 3OYIA 5J8CA 3CPWA 2YDLA 1BIAA 1U84A 3A8LB 3V42A 3KEOA 4BR4A 1Z9QA 2E2OA 4QS7A 4CVNE 3OOPA 2CH4W 1U47A 2EZHA 4E0DA 5GAMd 1ZK8A 1JCFA 1FIAA 3CP2A 3NAUA 2OTLI 1IN8A 4NC7A 4JPBW 1FX7A 3HP9A 3CJNA 2QA4I 2XHCA 4RTVA 1Q7YU 3VYUB 2BDPA 1TW3A 2VUMJ 1JXEA 3PFSA 3CWAA 4Q5WA 3M9AA 4DV4K 4N9HA 4J5YA 4XN0A 1JQQA 3HSBA 4NLCA 3CCRT 4BC3A 3T8RA 1IKXA 3D6RA 2MK5A 1RDWX 2KQRA 1RUOA 1NJIC 2VN2A 4NC8A 5KCMA 1I39A 4F52A 2QXFA 4CZMA 1TH7A 1Y07A 2RI3A 5BRHA 3G7ZA 1RTJA 3TOAA 1IKYA 1WNSA 4BXFA 4M75F 4X65K 2HHHK 3FHNA 1HOMA 5JFRA 1VQMT 1K73R 2KQ2A 1Q82O 1O7FA 2IXSA 1G2HA 1LJOA 2J6OA 1VQ7I 1YOVB 3WQUA 3F23A 2X9HA 2GBZA 4ZN3A 3EUKL 1PG5B 1O7LA 2RN7A 2OTJQ 1FNNA 4G12A 4B6MA 2A7YA 3QO9A 4A59A 4IG3A 5GAHP 4MO7A 4B47A 3UB5A 4JKHA 4J19A 4CECA 5JICA 2DX1A 3IAM2 2K3XA 2NXNB 4AU7A 1DTTA 2XICA 4BR7A 2YG9A 4O44A 2I7PA 5M3FJ 2A3SA 4L5IA 1TV6A 1VSLA 2VONA 1JGGA 2KAFA 1MUYA 1ZXOA 1YHQN 3QZ9B 3I56I 2OTLT 5AQMA 3M59A 4EQQA 2EIMH 1XMXA 3RDIA 4QLCU 2I7NA 2QA4T 3ASMA 3GEZA 3EO3A 3J81O 1KC8C 4OIRF 3CCEQ 2AKLA 4IEEA 4DR7K 1IN5A 3KJVA 3B6AA 2NUTB 5J1YA 4J2DA 2J4RA 1WIEA 1XX5A 5I2SA 1B9MA 3OA9A 4J9FA 3OSVA 4Z02A 3PVLA 2F4IA 1OPKA 1X6BA 4LK0F 4B8CA 5IPAA 3QUIA 1W9HA 4EP4A 1MHNA 1J54A 2X4XA 3U6FA 1HSJA 3C0BA 2CP2A 1AWXA 2CZ7B 4NCGA 3RIRA 4M78D 5D8LB 2ASPA 4A3EJ 1W2BS 4RGXA 1CZBA 4CF1A 2EJRA 2G3RA 3H5RA 1OX8A 2VL8A 4ZNXA 3OIPA 1YJ9A 3SBGA 3M8FA 3CXCP 1Z6TA 4ON0A 2QSGX 3CCLQ 1VQ7T 3CWTA 3RCOA 2GGRA 1TUUA 3LAMA 1C0WA 4P9UA 3M9QA 3VS2A 4YOYA 1NMNA 4DTMA 1KCFA 2JXBA 3HSRA 2QQRA 1SKRA 3HJFA 4NC6A 4RA2A 4UXNA 1Z9CA 2I0NA 3MEGA 2LT1A 3C7JA 4BRMA 5KRTA 3QWXX 1BCMA 3D0SA 1LQ1A 3K4LA 1W5CC 3CLQA 3CLOA 1RACB 3LOCA 1D3YA 4NO7A 3VF2A 1IKWA 3HTRA 3ZCMA 2GXGA 3CUQC 3M53A 5CKBA 1SD4A 2CP3A 4IHTA 5AIPA 5C3EJ 2ECCA 1I0CA 3KEYA 3TR8A 1OCZH 4PJOF 1SG5A 3SK3A 4LF9K 3ZSRA 4PLLA 3LAKA 3M0RA 2DBMA 3RTRA 4WFAL 2HDAA 1SSFA 2LRDA 1M2OA 4X9DA 3I56T 2H6BA 1WJEA 3LL3A 3AVIA 4M9ZA 3VEVA 1IN4A 1KG7A 4Z89A 4FJLA 5C12A 2OA8A 3JRBA 3OA6A 2Y75A 4CC7A 1Q82U 5FPNA 1SFXA 2YUSA 1LB2A 3FDYA 4DV5K 2R7ZJ 1TXQA 2O8EB 4KJZA 3IKVA 1N36K 1H92A 3ZT3A 4M3TA 4A3LJ 1WOQA 4MZMA 3HM5A 4CK1A 3L00A 3FBNB 3ZETA 2G7HA 4I2QA 5JR3A 4KUDK 4ESJA 1VQPQ 3U8XA 2O3FA 1LMZA 5AQYA 3GO5A 2LFBA 3CMAN 2O8CB 3DQVC 4DYCA 2ZXHA 1BI4A 1VA7A 4HSTA 4BE1A 4HX4A 1I6XA 2OQGA 5LJ3e 3VYSB 4LLGF 3RR7A 1VQ6I 3NRVA 1QWFA 5FPMA 1Z26A 4XQ3A 5J47A 5FJ8J 3IWFA 1D5AA 4C0ZA 2ISZA 1C0TA 2RF0A 3VEXA 2YX7A 2HKXA 4GLKA 1T39A 3E9LA 3A2KA 1KEAA 2QBYA 1YITN 3FIFA 3A5NC 1MBFA 4AG2C 3C3WA 3JCMd 3ULRB 2RQTA 3BPXA 1YJNN 3FKIJ 2MD5A 5GAOl 2K7LA 5KAFC 1CGPA 3F10A 2E35A 3OYFA 2FPDA 3EUHC 3JTHA 4G6DA 4JKEA 4LIUA 1SD7A 1WHLA 2LNVA 1YIJN 3D45A 1ZAOA 4Q4ZF 4RS8A 2EYQA 3MAQA 2MWOA 2Z33A 1JLAA 3KD1E 2DDBA 2ZBKA 5HLHA 1RT1A 2KYBA 2P9IA 3RMAA 4PUOA 2YS9A 4B9QA 4FW2A 2GFUA 4RTFD 4L0ZB 1JEGA 2KKOA 2PU9B 3ZR8X 3S3MA 3MHXA 1UTIA 4XNFA 4YPHA 3OW2M 1JO8A 2MG4A 3A8OB 3PIOF 2RPNA 1MSFC 3CC2Q 4AH9A 2VKDA 2W84A 1LFPA 4HTUA 3CPEA 5IYDJ 2VOOA 1LVKA 2FBHA 1YVNA 3HOUJ 2DU9A 1MSEC 4HF1A 2CZ6B 4JK9A 1TT5B 3H45C 1X19A 1Q9YA 3AO5A 2WAEA 2RREA 3AVMA 3DV8A 1NJIO 2XHBA 4JV5K 4RG2A 3V9UA 4CIGA 2P9KA 2O61A 1S72T 2LVMA 2Y31A 4CIFA 3DLLL 4CEFA 1H8KA 1QVFM 2ENMA 4LUDA 3SYTA 3BR3A 1YUWA 4YORA 3V8JA 1VQ6T 1PKTA 3KZIC 4C1NI 4M3XA 4YFKF 3O3FA 5HVQC 4MO5A 2E34A 5BN8A 2IA0A 1R58A 3S3OA 2XV4S 4XTZA 1S1TA 3GMEA 1QCOA 1B72B 4LF6K 3PT9A 4QOZB 4AC0A 1I5ZA 2M5WA 1NGAA 5D3GA 4DWIA 5HS7A 2D1KA 3VQDA 3DRSA 2RQQA 1M1FA 3NF7A 4CCLA 3THYB 2A1RA 3CCUA 1XHZA 2COMA 3QRFF 4CHQA 2VWFA 2ID6A 4I0BA 4NDLA 1UJ0A 2K79A 4O8UA 3MX2A 4UVAA 2NOBA 2JGUA 1WX6A 4JKFA 3ELKA 2DMOA 4I7FA 5K7ZA 3SI6A 3CIPA 1P9QC 2IT0A 1Y8RB 3WXMB 4HUFA 1U5TB 1OCPA 5GAMe 6PAXA 3TVTA 2W40A 3OTOK 4ILHA 2ECZA 5E26A 2IVOA 1PUFB 3I35A 1YG2A 1D09B 1JL2A 1NK4A 1KC8O 1PUEE 1ZYQA 3FK7A 4YTLA 5EGOA 2I5WA 4M77E 1WAFA 2CDTA 4QPQA 4A3BJ 3C6TA 1VIFA 2KRSA 2RNJA 1SFEA 3U3GA 1VFCA 3RVCA 2BANA 2MC4A 4B1VA 1XNQK 3CF5F 1LJ9A 4WE1A 4IO8A 2DTOA 1LWCA 2VE8A 1QCFA 5IHKA 2E2HJ 1NYGA 3GP8A 1SL0A 4CEBA 4RKUE 3ECHA 2JA2A 3I58A 5SWMA 5E18F 4ISFA 3MEAA 2HPIA 1XNIA 3QYGB 3RDVA 4NHJA 1RUNA 1R77A 1WA7A 2I2LA 3O08A 1PVSA 4FM4B 2F4VK 4MZTA 3HHHA 3VJPA 2Y48A 3JRGA 3WEEB 1JKHA 4EM2A 1YJWN 2O9LA 3O9RA 2NYXA 3ZFJA 4Y28E 3L3UA 2F2WA 2MABA 5JVGF 2CV0A 2EBIA 4TSXA 4GBQA 3ZMDA 1BBZA 2DIGA 1YT3A 1FY7A 2LCSA 3LNQA 4ZDLA 4BRQA 4B9MA 2O8FB 2EV6A 4TV7A 4A2BA 3H5NA 1ZSGA 3HO1A 4E9FA 1RT3A 1NGBA 2VG7A 3BQZA 4MLOA 1AZGB 2HBLA 2O8DA 2A5YB 3VQEA 3DEEA 3DPUA 1RAAB 2M2EA 1D1CA 3LH5A 3NQOA 2XGCA 4ZGEB 4YIFA 1FKOA 3RERA 2AQFA 1RDAA 2P84A 4FJHA 4RAFA 4U87A 5DM6F 5HKCA 4JI7K 1CZ9A 2JLEA 2XHIA 2OI3A 4PLIA 3FZLA 5FLXK 1UB4A 5TGTA 3Q0WA 3FZFA 3LQQA 2ZQBA 4JKAA 4BL0B 1NJIU 1G8XA 1QVGP 4AIDA 4CHZA 1T05A 4NYNA 3VDXA 2FYKA 5KTQA 1LE8A 3P8DA 2WB1N 3VQQA 4C92F 1IV6A 1KFDA 2VVKA 4GO1A 3P9KA 4F04B 3SWNB 4Y3OA 4IHWA 1M4ZA 3M1FA 1BI2A 1Q86C 1JLFA 1VQNI 1YI2T 3KD5E 1UHFA 1M5Q1 4CYDA 4PFZA 4DUZK 4JQFA 2XDPA 2V7FA 2PAVA 3O3KA 1PSFA 5LY3A 2HBJA 2DDAA 4WK8F 2KMTA 5KHDA 3QOPA 4XU2A 1QHTA 1V4RA 2XVCA 3SUPA 3EE9A 1IO6A 1PC0A 1KFSA 3IH3A 2V1QA 5AJ3K 2IRFG 2HZYA 5E8IA 3NE6A 5GAN3 1SV5A 4D7MA 3K10A 3KX2A 5J2MA 3TAFA 4H5VA 1MU2A 5ADXA 4NXNK 4AHTA 3TO7A 4A0YA 1GOCA 1HPZA 3OS0A 3HG9A 4UNOA 3DYAA 4HA8A 2FRWA 4RTYA 1RCHA 5JI6A 2WC2A 3I4MJ 5AFUH 3NNQA 5F64A 3ZMUA 1OLTA 4FX4A 1UA1A 2IAIA 1VQ4N 2FNAA 2DL5A 2DE0X 3KK1A 1UGRB 3L4IA 3Q1JA 2ZC2A 3E6MA 5DYMA 2OU2A 2HGCA 5BR8K 2WY7Q 3BLYA 5GAN2 4FYXB 1DIZA 4B8XA 5CZ2A 1OU8A 2DXBA 5D5WB 2JJ7A 2HOEA 4DTXA 4LN2A 4J9HA 2Q0OA 2EAYA 2BE9B 3W6VA 1Y1VJ 2MW8A 3IS9A 1IAWA 5IOYA 2JUCA 3G0ZA 3MXIA 4OVAA 1BA0A 3N97A 3LP0A 1D9DA 1Z25A 1RDUA 4F7UF 1R1TA 2V26A 4Y1CA 4CF0A 3W2AA 5LJ3j 4O8KA 3H9JA 3L3VA 1VQNT 3HIFA 3QBYA 1I07A 4WWCA 3ABTA 2HVSA 2D0QB 1FEXA 3MDQA 2DPDA 4ESRA 4CHUA 5IT9E 3DLAA 2HQEA 4PIIA 1NZ9A 3OOUA 2RKHA 3T1AA 1JTYA 5E1WA 2GQQA 3KWIA 3GL1A 3GBGA 4XU3A 1QZ5A 4YOUA 1OPLA 4LDVA 4II1A 1DP3A 2P9PA 2ESNA 4N4GA 4XM3A 4AYBA 2EJGA 2FSWA 1WPYA 5EU7A 3QMLA 3QPLA 4RDUA 2VPRA 5E79C 3EL2A 3R61A 1Y1WJ 2YSQA 5ED4A 2OANA 1EETA 1BO5O 5DD4A 5LRSA 1WUAA 2R58A 1IV0A 1XCVA 5IHIA 4A53A 1OI1A 3AA5X 5FKOA 3RSEB 3WU0A 2X78A 1FMKA 1P59A 5LJ3h 2OZSA 1Q95G 1U5TC 1ESVA 5AQXA 3F8MA 2E36A 3OR1C 2DK3A 1TUCA 4JK1X 1JJ8C 4RMNA 4XK4A 2D9TA 3CBPA 3KKSA 2RN2A 3RKXA 3QNOA 3DF8A 5EEGA 2DA6A 2EKOA 3HM8A 2ZB9A 1VTNC 2M16A 2K3YA 1NJZA 4UHTA 5CVIA 2RHKA 3BTIA 3FFKB 1U0JA 1QHHD 3I55T 4DTJA 4WX9A 1YCSB 1ITYA 5GJWB 4OJRA 1BA5A 2Q31A 3GG4A 1VAZA 4XONA 4J01A 4FYVB 2V51B 2M1HA 4OVLA 2B7EA 3RTVA 3C6HA 1MH3A 3FDRA 2XD0A 3VGLA 5JVHL 2CREA 4M7DF 5ILUA 4L9JA 3T1HK 4U0WA 3WNHA 4Y7NJ 3DB3A 3LLRA 3ZP5A 2V52B 4RGSA 1U78A 5HROA 1XJWB 3I8BA 2EYWA 3MWTA 3VS5A 5E3OA 5AN4A 1C0GA 2WUSA 4ZC3A 2WOMA 3P1GA 2C0OA 3V7SA 2OFKA 3SV4A 4F2SA 3GTOJ 4BC4A 4UY8I 4J9IA 3IUCA 4PJMA 2AXTC 3RRGA 3ZSYA 2HI3A 4E9GA 2UXBK 2AZVA 3E97A 2IJLA 4D8DA 3MEEA 3FBIB 2B63J 2E19A 1N25A 2C6YA 1S1WA 4JHDA 4YFNF 2CH4A 1B8IB 2F5FA 2FXUA 3R4KA 1C0UA 2O8BB 4XIUA 5CZ1A 1UE9A 1YRNA 3ID6A 2O4IA 4EJWA 5GAMj 2L54A 3LWHA 1ON2A 4AD9A 2VC1A 2X4HA 2PQ8A 3ZEHA 5FU7C 2KSSA 1FN7A 4A69C 2B6AA 3O4NA 2LSNA 2BHZA 2KZZA 2H8HA 3U3YA 3Q0VA 3WGIA 3CMEI 3CCYA 2Z9OA 5KAIC 3EH2A 1SAZA 2RJEA 1X3WB 3JRDA 3LMMA 2DTZA 4KIGA 2LZ6B 1GLDG 1H89C 2E1OA 3AT1B 3BR2A 1BKBA 3E19A 3DXKA 3BW1A 3S17J 3OL3A 4OOIA 3RKWA 2PYJA 4OPAA 2M0MA 4J7FA 1AWWA 2YWWA 4O6JA 5L23A 3RJPA 2LKSA 4YEJA 3JCUC 4CHPA 4CFCA 3VQCA 1T38A 1HC8A 1TT0A 4JD2B 5BRDA 4IWVA 1XQSC 2RF2A 1Q86O 3H0GJ 5M9OA 5IHNA 1UGQB 4Y52J 3OW2A 5GAMh 4A3GJ 4CZIA 2L3SA 3G1MA 5C10A 2QEXI 1SRLA 4KN4X 4M75A 4FYDA 2BTTA 3REBB 2O5RA 3HOWJ 1QZEA 2BBYA 1N8RR 1TKXA 3UKRA 1TK0A 4KI6A 2DXUA 2TRTA 4LF4K 2LC4A 3ABMH 4DQRA 4L5GA 2EYZA 1PCXA 5CK9A 2MD0A 2HZDA 3ZMVA 3GTPJ 3DLKA 3ZT4A 4CF8A 4FASD 2P4WA 1RT6A 3SPZA 3KYLA 1SSHA 1U45A 1OV3A 2STWA 4XICA 3BG3A 1FW6A 2JA6J 1N6QA 4UC4A 4C9YA 3M3YJ 3M0UA 4N76A 5HBMA 3C7NB 4L18B 4LIVA 4E1MA 4NS5A 2E1YA 1E7OA 1E3PA 1ZELA 4A6EA 5LGUA 1WNLA 2RC4A 3CCLT 4FJ5A 3JB9G 4DG1A 1SAUA 2E1MC 3CMET 3VQ5A 3CD6T 4EIKA 4D9JA 4J9EA 4FM0A 4G1QA 1TLHB 1BA1A 5CKHA 2HOTA 3E9GA 1QVGS 5K14A 1ASUA 4M74A 3JCMP 2QASA 3G71T 2F9TA 2QF7A 2CV2A 3J7AO 3QLHA 2K5FA 2NVTJ 6AT1B 4BY6B 2CWEA 5GINA 1VQ5N 1X9JA 1EJ9A 4IHXA 3CMAQ 2P4RA 4RGUA 2DW4A 2JTEA 2DMTA 4HUEA 1YO5C 4CCHA 2O7OA 3RI4A 2XAUA 3CC4Q 4GMJB 5GP9A 2R7TA 3JCMc 1XDUA 3JV3A 4ENMA 3ECOA 4K0KK 1K6OA 3MPUB 3L2ZA 4FK4A 2EA4A 1HNWK 5LRRA 3PX0A 3QFPA 3HI0A 2FPEA 3O8MA 4C8QF 3SEQA 4OIOF 3SEMA 1HKGA 2OTJA 1CF7B 3CUOA 2XKOA 3TAGA 1K8AC 3D2FA 4CGJA 5JLWA 3KK2A 2JTFA 1YITQ 1B34B 3CC7I 3EGXA 1M8VA 1U5SA 4ORZA 3DP7A 4CJVA 2QDYB 3O1WA 1XD7A 2RHIA 1KC8R 3I59A 1ABOA 1HUXA 1BIZA 4A3KJ 3P4IA 1OISA 3W3CA 3UKGA 2NVXJ 2E5LK 1R1UA 1X6GA 1D8YA 1YIJQ 1JXSA 4YOVA 3LDSA 3HKZA 1QNTA 4XAXB 4CJWA 4KIFA 3OS1A 2L7MP 4BRAA 3AKZA 5AQIA 1XMOK 5KYYA 4B1UB 2B5JA 3S6IA 2G8VA 3IH4A 2G9WA 4DFPA 4PJOA 1QQOA 2CH6A 1SMTA 3DWLA 4BJ5C 4H5TA 4O0JA 3VS3A 2J7IA 2WC9A 2WBMA 4DU3A 3CCUN 4ME7A 2VT3A 1GCQA 1CXUA 2E2IJ 4CFBA 1OR7A 5L3GA 3I9QA 1GUUA 3A5MC 1Y96B 1Q86U 3BFMA 4KTWA 4S04A 5F1RA 1W5TA 4GGGA 2K9QA 4D1QA 1HYSA 1UHWA 4CJ3A 3ZL7C 2E6NA 1JUMA 2ZJQL 1OH5A 5FB2A 2FX0A 3F0ZA 5GTHC 4PKIA 4RMOA 4WFBL 1BOBA 4IRIA 4CC4B 2DPNA 2K9LA 3OBWA 2QTVA 3I0RA 4I6MA 3TANA 3SJMA 5GJVB 4DTRA 3GIBA 2QW9A 3H8ZA 4JKGB 2KFZA 3QKJA 2CUFA 2DPUA 3LA2A 1QP2A 1CXQA 2D0BA 4ELTA 3DLLF 2IVPA 3LSHA 1LVAA 5LEJA 2E2JJ 4M78B 2IIMA 3LSMA 2KRHA 4B1XB 3PFYA 3EYIA 4RTTA 2QEXQ 3CC7T 4JJBA 5GAN7 3I5RA 4CESA 2F7TA 4MNUA 3F8NA 5FFZA 1R5GA 4M3YA 4JBAA 3FM5A 1AVZC 3CQZJ 3IAYA 2ZSHB 3I0XA 4B44A 4KTZA 3BOQA 2JZ2A 4GY2B 2DJQA 3PNTA 1QBJA 3QWLA 4PNOA 3R6SA 1RAGB 1UB9A 1E4GT 1GOAA 1QHAA 3LDQA 4DYQA 2DIQA 3BDPA 2KT0A 3ZMSA 4M78G 2QCOA 3TI0A 1K8KB 1RAIB 2A6AA 4KITB 5IY5H 4R56A 5CAIA 3VN5A 1YVUA 1EH8A 4NLBA 1J9AA 3BJ6A 1JUPA 2X4YA 2K85A 4GKJK 1QQCA 2DPPB 4NCBA 4M9SA 3JRAA 2HOAA 2GAUA 2A0FB 5CO7A 4AHUA 2OTLA 4QTRA 5L3CA 2B0LA 3G1JA 1IV8A 2VGNA 2ZMEA 2DK5A 4WCGA 2FBKA 2YNFA 2FF3B 2G0EA 3JCMh 3BR5A 1DU0A 4HNTA 1X69A 3DOLA 3WU1B 3PIOA 1VQPA 1XC9A 1VI0A 4J6WA 2YRDA 4DJAA 3TABA 1VQOI 2DA5A 3CP8A 5ILSA 3J80E 2LP5A 2DOAA 1IN7A 2QENA 5LJ5f 1TNTA 3F6OA 5J2QA 5C2DA 1WZ2A 3DU6A 3OSGA 3AG2H 3CQTA 2IAJA 9ATCB 2DT6A 4FHTA 2GXBA 4CEAA 2F69A 2OZ6A 2VXEA 3EFOB 1S5LC 2KJCA 2YX4A 1YBYA 2H56A 1BL3A 3H5AA 4DNCA 2E5KA 1UJYA 2K5IA 1KVBA 1H8AC 5FW9A 2P0WA 4XH4A 1O3RA 2V6EA 3S1QJ 2D5RA 2WWYA 3SDGA 3G6EI 5M1FA 4MEYF 1UGSB 1QQJA 1TAQA 2XGDA 2X1CA 3VS4A 1GV2A 1CSKA 4PGGA 2RAEA 3FZVA 2YHXA 3L0QA 1HLUA 3TW7A 4DMNA 1T56A 2A42A 4FJIA 1W7AA 4RCHA 2NRVA 5KCOA 4BY6C 2DEUA 3LFKA 4BRGA 2P5KA 1Q81U 1F1ZA 1YLFA 3O1BA 4ZTJA 3CWSA 5GAEP 3S1NJ 1ETXA 3ZN1A 5DDGA 2J6KA 3CO6C 1FOXA 4GYIA 5TRDA 3V4GA 1KQJA 3GOIA 2V1UA 1U1TA 3LYIA 3VKIA 3I56A 2VOPA 1R5HA 1TWBA 1GT0C 3D4VA 1N6AA 1S1UA 1K9MU 3LSGA 1X3NA 1MBEA 1IGUA 3A8GB 4HT9A 2RA2A 1WH7A 2BY1A 4HCZA 3V6DA 1RIOH 1WQWA 1X1PA 4HLYA 5KCHA 5A0GA 1BI4B 1MUDA 1M3HA 1N3AA 2CP5A 3I5UA 2CW8A 3HOYJ 2M34A 3VGKA 1T0FC 2Y0MA 2JHJA 1VQOT 1NEBA 1J7KA 1OU9A 3VA3A 1QO0D 5A0DA 1Z7UA 2UXXA 4CGZA 2GCXA 3K4CA 1YW7A 1J0RA 5EJCA 3ZT1A 5LMUK 1TOVA 1KD1C 3EG2A 4U88A 5EY4A 3TMOA 4IXAA 1N75A 4G6TB 1BC7C 3NH0A 3O9QA 3HPWA 1R59O 4IXCA 4IJAA 4RTWA 4CW7B 1R49A 1VQ4Q 3LWMA 4PJJA 4CJEA 2HHQA 2HWVA 5EC7A 1K8AO 3VESA 4AYBN 2CZ0B 2X74A 4DHYA 4CJUA 3G6ET 2BTFA 3KP5A 4AF1A 4DLEA 2AXLA 2EWNA 3WT0A 4AILC 3JRHA 3J81E 3NBPA 4H8KA 2GOMA 1A35A 1W2BA 2HBKA 1ZG5A 3KE2A 1ZA2B 2HTSA 1RT2A 1TQMA 3VRYA 2H1KA 1WRJA 1JJ2P 2HYFA 3KP3A 4M3RA 4HX8A 3TWHA 1HJDA 1H9GA 4XBFA 1LWVA 4FJ8A 4LD5A 3SBTA 1M90C 1ZN2A 2MBFA 1WKMA 5AYFA 2YHTA 2P9LA 3HZJA 3MEXA 3JRZA 3EYYA 2CUZA 2PZ1A 4IPAA 3M5AA 4AFUC 3CCQQ 4M78C 1ZGJA 3QEIA 5EG0B 2P9KB 2DXTA 1HA8A 4C92A 2EZIA 5A0LA 4PFOA 5FKNA 3PSIA 3JREA 4OU0A 4I9LA 2CGLA 2RNAA 1DGRM 3K1PA 1ZH5A 2EYYA 4OINF 1MGTA 3GFMA 3CCMI 4LFUA 1EH7A 2HQAA 1K6YA 4CGFA 3O8HA 2DQRA 4CHOA 4KHYA 2JWLA 1CZAN 4UB6C 2YHYA 4ICLA 5KRSA 3FHFA 2Z5UA 4J9GA 3S16J 1SFOJ 2GQVA 2YHBA 2A07F 2Q2EA 1TUDA 3QZ5B 3E9FA 4JJNK 1H1VA 1ZQ3P 3HVTA 2DMQA 5A2QZ 1D5YA 3DKWA 4EJVA 4CC2A 2UXNA 4KMUX 2RQWA 2PFBA 3KP4A 4OB1B 1ODDA 1IC8A 2VODA 5AQNA 4O5BA 3PX6A 5D5UB 3PFIA 2PMZA 4FJ9A 1D3BB 1GCQC 3TTDA 3WTVC 1FBSA 1OR7C 2TCTA 1E4FT 1K0SA 5AQFA 3JAMO 4CGIA 1FPQA 3A2FA 3QQAA 2LQWA 1U6ZA 2QZ8A 3RMDA 2DK8A 3THXA 1ETKA 2F2XA 1IBMK 1Z67A 4Q5VA 4CO8A 2ZNYA 4CEDA 4XIDA 4AFQC 2FF6A 1HDDC 1BJAA 4F55A 2VBXA 2D8HA 4CERA 1USSA 4RB0A 3F9KA 4P9FA 3MD2A 2VYTA 1P90A 4F7UA 1YHQI 1UHSA 3HPOA 5M5XJ 4C2TA 5B66C 2E1ZA 3C65A 2NLUA 3CMMA 1MUZA 3FJPA 5HS9A 3EUAA 2HL3A 1XPXA 3PJRA 1OZ2A 1EO1A 3I4NJ 4Z8AA 1V54H 3OGDA 3NH1A 1OYIA 2MC3A 1MMNA 3PIPL 4FJJA 1QQMA 2HBWA 1I50J 4QQ6A 1T6DA 4BROA 4BHBA 3WXIA 3SJHA 2E2PA 4RG8A 3SPYA 1U9OA 2CH0A 3VEOA 1YTUA 1U3OA 4DV7K 3V9XA 4JJCA 4CZLA 3VS6A 3BCAA 3VF6A 3DTEA 1RDCA 3QICA 1WJQA 4ILJA 4XRMA 2OZMA 3SCXA 3R6OA 1XCBA 2Z1DA 3E6CC 3T8TA 4DR5K 3G0QA 4FWLA 2IS3A 3KNTA 3LGFA 2A5WA 4JKBA 5CR4A 2CYYA 3TO9A 4OFEA 3M1EA 3IH2A 3T0YA 2OYQA 4DR1K 5DLOA 4HBLA 2YNIA 4KAZA 2CUJA 2XUBA 1WH5A 3OQ5A 3WHCA 5JMVA 4IKFA 2XB5A 1PU8A 4HTLA 2YPRA 3KK3A 1RI7A 2JNGA 3P39A 2VKEA 5AZJA 2XRNA 3CPWP 4BGDA 3R60A 4N9IA 3OYMA 2JMAA 3IV5A 1DT9A 4UVCA 1VQLI 1DPRA 2NVYJ 2PTKA 1TQPA 4XOPA 3OS2A 2NOJB 1FJGK 2VPLA 5KPRA 2DN0A 2FBXA 4O0IA 2D1VA 1QVFP 1IRXA 1L3VA 4JRIA 3GX4X 4HZFA 4KGZB 2KKZA 4CF9A 1ZGWA 1YHQT 3VFZA 4E7HA 2RH2A 4A2UA 1ORNA 5KYXB 3H3VK 4PL7A 1QVGM 1L3UA 1VNDA 4ELYC 1HW5A 1W36D 4JI2K 3MMYB 2J05A 2NUZA 4M7DA 4KPYA 2NOLA 3QEXA 4OIPF 4DOVA 1GLBG 1IDYA 1TW2A 1DGWY 1VQ9Q 2O0YA 3A8MB 2HVIA 2MMPA 4G6QA 3CBOA 1T03A 1L3LA 2NOIA 3HBLA 1RGIA 3JCMQ 1IG9A 1KD1O 5GAOm 2K86A 2W1OA 3KLGA 3IH7A 4B1YB 1HW1A 4KB1A 4C5GA 2P81A 4WCEL 3AFHA 1G6NA 3ZSZA 4BQNA 2OTJN 2ITMA 3H9QA 3IQLA 4R8HA 3UA7A 3M4YA 4CFDA 2R7SA 2COZA 3FXOA 2YNHA 4XH5A 4CJTA 1KU2A 1S1NA 4NBQA 4CCNA 1P2FA 5DCMA 1IXDA 5HNHA 3BP8A 4E47A 1WI3A 3WE3A 2LSOA 1QGPA 2KMUA 3HM9A 3CCJI 2PI0A 3HKZN 2AO9A 4A6DA 4CBXA 2EFQA 2W7NA 3MN2A 3J7AF 5HDKA 2FB7A 4M7AA 1GLAG 1VQ5Q 4M41A 4Z0UA 2CGKA 3G1OA 4LH5A 1XGSA 5J2PA 2NOFA 4Y17A 5GAN8 2BGGA 2A68F 5JLHA 4LG3A 4H0TB 2CP6A 4CD1A 2MAMA 1M90O 4A3FJ 3L1PA 2OJ2A 2ELHA 2E1CA 4HOBA 3PQJA 4N4NB 2A3ZA 3C2GA 4LH4A 3BR6A 4H0PA 2D0AA 4KHQA 3DKXA 2EFIA 3C95A 4BR0A 3WGGA 3FM3A 1NG9A 2VQEK 4DQQA 1W6XA 5AONA 1ZG1A 2QSHX 2W10A 5GIOA 3G4SI 5DY9A 4F17A 1R71A 3RWUA 4FU6A 2FMYA 1D0YA 3EZWA 2PQWA 3M57A 1BISA 4PL6A 5F0XA 4AQYK 2RI5A 1RC9A 3L9FA 3SHFA 2E64A 3MCZA 4M6XA 5AIQA 4E9HA 3O2PE 2YJFA 3UNGC 2F4OB 3HSEA 4E89A 4X64K 3JCMW 5GAN4 3HJEA 2QVOA 4WQ4C 4PGHA 1RTDA 3EY1A 1UELB 1UGPB 1O3SA 2KIUA 2XY7A 2EVRA 2HNZA 3CFOA 4ETSA 2MOXA 4WTOB 1UFFA 2YXYA 4QPOA 2E60A 2PVDB 3FB9A 2GEMA 2QXLA 2FU4A 3HEFA 1WJAA 2XAHA 5FU6B 3CXCA 1QSLA 1R1VA 4BQLA 1M1EB 1ZBFA 1JJ2S 3KP2A 4GVEA 4BI3A 1W7PA 4I99C 4E7ZA 2CT3A 1ZLJA 3C0CA 4PKGA 3N5NX 1E2XA 2Q97A 3OIQA 4J8OA 4BR5A 3OH6A 1YJNT 4M9XA 2ZJQF 4CJ4A 3KLIA 3LDLA 3ZOBA 3LANA 1IBKK 1RAEB 1YIJT 2HQHA 2OTLN 1WXBA 2YKNA 1VQLQ 4YG2F 2DERA 1BHLA 5M1KA 3J80K 3KVGA 4M77B 1YIOA 2E4LA 3LPTA 1KG2A 5D4RA 5LJWA 4PDKA 3CCVI 4Q48A 3O6BB 4DOZA 2E6ZA 1GRIA 3ONQA 2XDDA 2KRNA 3QDKA 4ZYAA 1VQPN 3BTCA 5FWBA 1JT6A 1T0HA 1ZBXA 2ITGA 1MDMB 2FOWA 4UNFA 3OHRA 2X35A 4X1EA 2DD4A 2DBKA 3GBTA 3VQ8A 3T19A 5IP7J 2E70A 4C8QA 2BY3A 4HF0A 1FYKA 2W57A 1HCRA 3DFGA 5EG2A 1W4MA 4EW0A 4CJQA 1JCEA 3DXMA 2YU9J 1LOTB 3SB2A 2CRGA 3ISPA 1D0XA 5E8GA 2JG6A 4M63C 5ADXH 1BR4A 2M02A 3KETA 4BRNA 5MLCQ 4IO9L 2FBYA 5GMKl 4BXUA 4A4FA 5EZHA 4XTVA 3D7SB 2LJ0A 4HPQA 5TISC 3HFOA 2EH3A 2WSCE 2NOGA 1P7JA 1XTDA 2OZUA 3DXKB 1GVDA 1T3LA 1M90U 3HL8A 3QDRB 4KT5C 5B3SH 3J7YJ 3C1DA 3TREA 2DFIA 2HVHA 4M3DA 2GF7A 4IFYA 1AHJB 4A5BA 1KLNA 1IBLK 1KYZA 5E1ZB 3KK7A 1K8AR 3CCJQ 4FT8A 5HS8A 4YDUA 4MDWA 2HW3A 4LD6A 4G7ZF 1H9TA 3ITHA 4CE9A 5FRMA 2Z1IA 3CMAA 3W6KB 2OPSA 2R5ZA 4GV9A 3C6AA 1RNHA 3I56N 1X4PA 1HKTA 3MAJA 1WB9A 3WNEA 3CJAA 4E7SA 3CC4A 1HX1A 2L4AA 5F0CA 5JLFA 2J6FA 2Q0UA 2RPIA 4A0XA 2NNWA 2YUNA 1KK7A 2DA1A 1MJBA 1MMDA 5IYCJ 4UUSB 1SKWA 3HKSA 2OPRA 2CSQA 3CCVT 3A98A 4CJLA 3GYHX 2QWPA 1AA7A 1YTAA 5CIUA 1Q1HA 2E7WA 4KIBA 3GFIA 4DGWB 3CQYA 3I4PA 4BY9C 1ENHA 3VTIA 5HLFA 2R7WA 5H6QA 3DLLA 1PP7U 4M71A 3DI6A 1N34K 3PTAA 3WXJA 1OVYA 4LFBK 1K73U 3L09A 4DQSA 2ZJPL 3G4SQ 2HKOA 2ED1A 3QP6A 4HYEA 1CQTA 4X6AJ 1UCRA 3HRGA 4EJOA 3E9PA 2BV6A 3F8FA 1ATSA 1E0EA 2P5OA 3E01A 3J81K 3HK2A 3S2DJ 4CSWA 4CA0A 4J2AA 1EH6A 5K1YA 4KREA 4GYGA 5C25A 1U9NA 2NVQJ 2XPVA 2HF4A 1T6SA 2HQRA 1X1AA 4C8MA 2E1NA 1YJWT 2RN8A 3CPWS 1Y0NA 1E17A 4DV6K 2CMPA 2EFNA 3U9ZA 3BEXA 1YAGA 4FWNA 5IN1A 3AG4H 3W0LA 3WTSC 3UR3C 5AQVA 4CCKA 2HHUA 4CCOA 3OH9A 3GNGA 4J2BA 2P9NA 4WXDA 2H3EB 3GFLA 1BCOA 4ZH4F 3CDLA 4PY5A 3HRTA 3BG7A 3HRUA 1M3BA 3K70D 1AOYA 3K59A 5DD8A 2VBYA 3S41A 4O5FA 3AL0C 1GDTA 3BWGA 3KIOA 2P51A 2P9UA 2ATCB 3I59B 3JB9H 4CEQA 1S22A 2OA4A 1R6RA 2QEXA 1U49A 2DL4A 4GFBA 1MA9B 4DSIA 3LP1A 2A5XA 4BBRJ 1RLPC 5F0FA 4O4GA 2O01E 2R7QA 2H8RA 2VWKA 3CMYA 2O9SA 4N41A 3CJ1A 2WAFA 2ZZDA 2ZPGB 3NHGA 4BC2A 4PJ0C 4AIAA 2F2EA 4PJOB 4EZ9A 1X75C 3QDFA 4MHGA 1T95A 4RB3C 1UAAA 1WSJA 3P7NA 5CLSA 4F93B 4U67L 3E9OA 3RNJA 3CUQA 1TGOA 4KULA 1R5ID 5JS2A 5DK5A 1OULA 5DM7L 4F16A 4OX9K 1AKHA 2V1XA 3IRRA 3NTHA 4YIRX 1FTTA 2MSYA 2BW3A 4PJLA 2RGVA 2VXFA 4HF2A 3ZT0A 4E1NA 2PMZN 2ZSIB 3G2BA 3GZ6A 1WHHA 3L4QA 2B9SA 1S5JA 2JRTA 3A4CA 5GANj 4KH0B 3UT1A 5CVUA 1PHTA 3SMPA 2COBA 2NS7A 2LQ8A 5LL6Z 4KICA 4Q0BA 2QKLB 3KLEA 1P8ZA 2E5ZA 1SS6A 3HOZJ 4AHCA 1V4SA 1G83A 2B8AA 4B23A 2EQKA 3M54A 3VS7A 2LQNA 5GAOn 2V8KA 3ZCOA 4RUGA 2EFPA 1B92A 2HYGD 2ASMA 1F36A 3EG9B 3FX3A 4LOCA 1XSVA 4A4KA 2XK0A 4JRPA 3Q0UA 4YY3K 4LE9A 3AO4A 4XTXA 3KLFA 1GLCG 4OF1A 3R0JA 1QVGA 4LF7K 1WHUA 3OL4A 4E4HA 4AHSA 4A4EA 5KYWB 5GAOr 2Y9YA 2OX7A 1NLOC 2O4XA 1NTCA 1U2VB 4A57A 4A0ZA 4H0EA 2CSIA 2Q1NA 4DLGA 5GANh 1VSFA 2I5UA 1JHHA 3QSUA 2COWA 4FL9A 5BQTA 3BZCA 1U8RA 3TW6A 2ZFWA 3OYCA 1W1FA 3G1LA 1T3SA 2V75A 1ACMB 5J39A 3F73A 4KRTA 3MXMA 2Y69H 4QS9A 2W25A 5AQZA 5D6WA 3WU2C 1YJ9I 3EUHA 5I42A 1SKUB 1WJBA 2Q3SA 5JHFA 2V1DA 3JSPA 3JRCA 3B6CA 1KD1R 3QPHA 2DJZA 2DTUA 3BY7A 4L8RB 2PZSA 3VB2A 3ZMTA 2FD5A 4KYWA 4E2FB 1IJJA 2Z0WA 3M3ZA 3DKYA 5KE2A 1KGSA 4FSXA 3C18A 3J7AY 1QW1A 2KZGA 4MDBA 1M1KC 3CCRI 3CJRB 4KBOA 3TARA 3QEVA 5HODA 5FLMJ 3ZQIA 1KQ1A 4Z4EA 3K9TA 1QKWA 3OR2C 2QKMB 2WONA 3VA0A 4ATOA 5GADP 2UXCK 3CJTB 1X43A 1BN5A 4ZZDA 4PZJA 3JB9F 4FWQA 4L5JA 2V1RA 1VSHA 4RAGA 3V4IA 3AV9A 3ID8A 5CKDA 1SVMA 3WTZA 2OCEA 5D5XB 3TCJA 3GZNB 2ZE2A 4M3ZA 2P5GA 2PBDA 3DTKA 3CQ8A 3PY8A 2CP7A 2NRHA 3ZRGA 4EHTA 3PIPF 2VKNA 5M1PA 3WTWC 3RYPA 1JKRC 4CF2A 2RJFA 1VQ4A 1RBVA 5CVJA 2C0TA 5BPIA 3BDUA 5D7UA 1SKSA 4II3A 5L3FA 2KQWA 1K4TA 1ZREA 3C6UA 4OMMA 1RETA 1TSFA 2OPTA 2RJDA 3TDZC 3NARA 2QWQA 2EPDA 1RAFB 3QPSA 2NNNA 1HDPA 5KE3A 3I3LA 2DT7B 1EIFA 1WHGA 2FVUA 3UWNA 3H41A 1ERDA 4EZ6A 5LJ3g 1QLYA 3CCSQ 1NJXA 3OMYA 1Z3YA 3AVGA 1YJ9T 2NUTA 4LNPA 1N8RC 1IG8A 4DBRA 5HDGA 3MN7A 4F92B 4DQ8A 2KNBB 4YDUC 4J8FA 1MBGA 3ME9A 2VV5A 3M8PA 4BY1J 2ZJRL 1WYXA 1QU3A 2NRAC 1IW7F 1MWKA 4KH1B 1Y0UA 2L9SA 4BRFA 3BUZB 4DTSA 2EPFA 3TBIA 3CCQA 5KYUA 2EWSA 4K41A 2ME6A 4HDVA 3MEVA 2LKXA 3AVFA 3GTQJ 4A3JJ 3JXUA 4FLVA 1DPUA 1TKDA 4WF2A 2M1BA 2LYCA 5H1SQ 3ZT2A 2R0QC 2KFDA 2ELJA 4BRPA 2CG4A 2DMPA 3GWZA 4JJDA 3TPQA 2CH5A 1IZ6A 3O5ZA 2PVGB 1ETQA 4FE4A 2K4YA 2DRKA 5AQJA 2E3HA 3EFRA 1USTA 1EXQA 1VQOA 4LB5A 2L89A 2GM4A 1VQ8Q 1AEYA 4XSZF 4DA4A 1BOAA 4H4KC 1G5VA 4HV5A 1MNMC 2PYLA 2F96A 2ZJ2A 1T8IA 4PJNA 3H6EA 3OYJA 1VSKA 1VQKQ 4JI4K 4X34A 2JN0A 4JI5K 4JLHA 2GX9A 3FSPA 3HSTB 5J8FA 2XG8D 3RR8A 2IA1A 1WXTA 2M45A 1UAXA 3GLLA 4NNJA 1W4SA 4DFJA 4XTUA 2FUG2 4OKEA 1APLC 3NF8A 5JVTA 4BRKA 1D1BA 2Y1JA 2FF4A 2W03A 2W4SA 1ZTRA 3M4OJ 2GV9A 4A3MJ 2P7CB 2Y2ZA 1Y56A 5IP6A 3CEYA 1NOZA 2O8EA 2EW3A 2P9LB 2CQQA 2ZPIB 1LNXA 4ZYGA 5J1EA 3ABLH 1ORKA 4KT0E 4M7XA 2QWOA 2LNHB 2R5MA 5HK0A 2VQGA 4XK8E 1BWFO 4ID5A 4BWMA 1WGSA 1YP5A 1X27A 1PSEA 1WZOA 4EHUA 4C3IJ 2CUBA 5BPLA 1IHVA 1EKEA 3VU3C 4NL3A 2NRWA 2O8CA 1JJ2M 2C0IA 3M8JA 4M78F 4MZPA 2X6OA 3PMTA 1BI1A 2R5YA 1KG1A 4G94A 4E3SA 2DI3A 2JUGA 2E65A 4B08A 5CQGA 2KISA 1J6ZA 1ZR2A 4FLTA 4FVUA 3AVLA 3TSWA 3CCUI 3CCRQ 3QU6A 3VV0A 3QEPA 3VF4A 1R00A 1HJRA 4CHNA 3VQ6A 2O88A 3HFNA 2JVGA 1I94K 4BE0A 1ITGA 3DAWA 4MO4A 2V7YA 3ZN0A 4E7IA 1SFKA 3F5TA 3GUDA 3IKMA 1VQMQ 3FE1A 2IPQX 3FMSA 4DUYK 1O3QA 2G7UA 1M2VB 2UV1A 3SXYA 3QYHB 1JKOC 3SZTA 4A5AA 1C0MA 4EMKC 4IF4A 2IP2A 1QTMA 2JPBA 3I8DA 2DFFA 1N33K 1B4AA 4OB2B 1AOJA 4GDFA 3SUNA 3UKUB 2DXIA 4CICA 2X6NA 2RV8A 1B9FA 4WQ5C 3MN9A 4IIOA 1EFNA 5KYNA 5LHHA 1XDSA 2YHWA 5KN9A 1KYWA 4IIMA 3R9PA 5BOXA 4HSBA 2LKPA 4FWRA 2WSEE 4CZZA 4PFPA 2ZFUA 3THXB 2JWTA 1LW2A 2CS7A 3QFUA 2AHJB 3SFMA 5I3UA 4EA5A 1J5YA 2ACJA 1NYFA 4C2UA 1MJAA 1YQLA 5AQWA 2XY5A 4BXXJ 1KAZA 4H4OA 1XMQK 4JUVA 3SZ2A 2QWWA 2ABLA 4EGZA 1UDLA 4E6KG 1S1VA 4YOXA 4I02A 2KRCA 4K25A 2OTLQ 4AHVA 2F5VA 3KTQA 4GY5A 2F8TA 2QA4Q 3TP3A 2WY8Q 4JAXA 2MFZA 2FSJA 2XO7A 2VCPA 2FE3A 2L8DA 1A36A 1M1KO 2Y9ZA 1ZRFA 1Z6RA 1I1GA 1HXDA 1NK0A 4RM2A 4H0XB 1XB4A 3M8SA 4EMGA 2E12A 2V6CA 4HCBA 3K5OA 3F3XA 2HKQB 1X1BA 2BXZA 1V5EA 1OCTC 3CVSA 3CCUT 4OFAA 1MNDA 3O3GA 2XDBA 1S72I 1VQ9A 3ULEA 3B6OA 1UHCA 5ILVA 2EK5A 3LSPA 4FZXC 3CC4N 1X9WA 2CU7A 2UUAK 2VG6A 3FIWA 2L9RA 1B72A 2EA2A 1B3QA 3NCIA 3I9V2 2NZTA 3KLHA 3SUQA 3L6QA 3SFZA 4EM0B 4Z6YA 2H94A 3CCMA 5LMNK 3AVJA 1JB0E 1ZARA 1VQ7Q 3SNNA 4ZN1A 5ICEA 3LCNA 2F6CA 4NCAA 2IVWA 2PVOB 2IBDA 1K78A 3H0DA 3NVKA 5E3LA 2LREA 4K8ZA 1P7MA 1IO2A 4IO9F 2FL7A 2L3PA 2ZGWA 1LPLA 4HUGA 1NMDA 4ENJA 3IP4B 4NYFA 4M4ZA 2FRHA 2XB0X 3E5QA 3SQ2A 2MYSA 3H3NO 2ZCWA 3THKA 2E5NA 1U5TA 2EJ9A 2HBPA 2V8IA 4H03B 4YNQA 3NWSA 1K7AA 3BF1A 5M1NA 3VETA 1J09A 4D6WA 1VQ5A 2JQ7A 2UWMA 3F8BA 3ZSVA 1N8RO 1K1ZA 4EIAA 4IG0A 3I56Q 3CWUA 3RUXA 3SD4A 4DBHA 4KHPK 3K58A 1ZX6A 2HSPA 2NUPB 3NHNA 3E6BA 3DM2A 4EJYA 2QSFX 3SQ1A 1J53A 3CPWM 3EQLF 1IG7A 2HNDA 1DQUA 3CMEN 2LVSA 5IT9O 1XHXA 2E20A 1B9NA 4I6ZA 2K2MA 3DXJF 1UECA 4L0YB 3CJQB 1Q1VA 4DSFA 2XAFA 1M8MA 4BD3A 3IC7A 4RLFA 4AM7A 1ZBUA 1KQ8A 4LDWA 1S6PA 2A6TA 3Q5FA 3L2RA 3ENHA 3WEEA 4YHHK 2CW0F 4EMSA 4CDGA 3K4BA 2V1NA 2RO0A 3I0TA 2NUBA 4AUXA 3QWYA 4B22A 3QBXA 5E17F 2JHNA 2LJ1A 3B02A 3NDKA 2V79A 1E3MA 2O8FA 2EGCA 5KH6A 4UY8O 1W97L 4MQ9F 5DPKA 1ZBLA 1TWCJ 2KZMA 2ZJPF 2LP0A 3MEWA 3VS0A 2QEXN 5DCMB 2A28A 3K69A 1MJ9A 2QWMA 4J9CA 3HB9A 2M87A 5LJ5g 3F8CA 2A40A 5K5RA 2GTDA 3MO8A 1Q7YC 1ZLMA 1MW7A 3OYEA 1C6VA 4M7AB 1NOYA 1VF9A 5IYBJ 5AT1B 4DF8A 4BB7A 3EGDA 4B1WB 1XQOA 2O6GE 2K3FA 4J00A 4QVDA 1VSMA 3INZA 2KIQA 3CYMA 1QZYA 3HT3A 3BC8A 4Q47A 2BH1A 2R57A 2JZYA 2MI6A 2KL4A 4IUPA 3MK6A 1SF9A 3K1NA 3ZX2A 2VBWA 2VWBA 5KQDA 2R92J 4DKWA 3K6GA 3RR6A 3VOVA 4K42A 2VUBA 1YI2I 3A5ZB 5K7FA 1VQLA 1IJWC 1H88C 4H0YB 4YPRA 3S1RJ 1W0TA 2PY5A 1HU0A 1WXUA 3KFVA 3JCMg 1NKBA 1FXXA 1JHFA 4II2A 2G6FX 2ASOA 1KA8A 3E66A 3FXKA 3F9MA 1AWCA 1BUPA 3PUFA 2HSTA 2BEOA 5FKLA 5I2MA 4XORA 4JNEA 4FTHA 1OCRH 4BREA 1T7PA 4OGEA 3BJAA 4CEOA 5KPTA 4B3OA 2PMHA 2K3PA 2FOKA 1HLVA 1PDNC 2BZXA 5ECAA 3WG7H 3DTIA 4R5PA 1TWAJ 1KQ0A 2FRYA 1S72Q 1BIBA 3K0SA 2D0CA 4KMFA 3KZYA 1T8EA 3ZQFA 3KWGA 4EFHA 2X4WA 2BVMA 2W41A 1WFXA 3I71A 1VQ6Q 3EE8A