3OYAA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and raltegravir at 2.65 resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyaA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyaA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyaA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyaA03
1DTQA 3OMCA 2RI3A 4DLEA 1DTTA 2GFUA 4KHNA 4W5TA 3RR7A 1TK8A 5CIUA 3FC3A 2YNIA 3H6ZA 2HW3A 3MEEA 3LGFA 3RTVA 1TV6A 1HMVA 1LAWA 1Q9XA 4CJQA 4PL6A 1S5JA 3VQ6A 4B9MA 5J1EA 2ZD1A 2BANA 3O4QA 4ZTFA 2Z1GA 4HUFA 1YTAA 2XK0A 4OKJA 4CJLA 1D9DA 2A1SA 2G3RA 4E89A 4DFJA 1D5AA 2E4LA 4LD0A 1U45A 1TVRA 3DOKA 4DS4A 4CF1A 1T05A 4BWMA 4B9VA 2BUDA 3MP1A 3OS0A 3L8BA 4FCYA 3UIQA 2I5JA 3LX7A 2DIQA 3V9UA 4WE1A 1SSFA 3GOXA 3OY9A 1J5OA 1C1AA 2HQXA 2X35A 1RI0A 2WOMA 1WSGA 3SCXA 1QSYA 2D5RA 3QEWA 3WNEA 1BIZA 3KTQA 2PYJA 1XI1A 2EQUA 1VSEA 1OZ3A 1Q8IA 2HNDA 2A1RA 3NNQA 1X9MA 2LRQA 2X74A 1FXXA 1WSEA 2RI2A 1VSIA 3LP2A 1A5WA 3H08A 3RMAA 4Z4GA 2XY8A 4DG1A 5C24A 2HVIA 1NK4A 1RT6A 1UA1A 4O55A 2YRVA 5SZTA 4CHYA 4M41A 1SUQA 3TI0A 1RDDA 4CEFA 3HO1A 3OS2A 2DFEA 4HCCA 3K5NA 2GUIA 1TKZA 2WONA 3VQPA 4W5RA 3VN5A 4J2AA 1WJRA 5CYQA 1BISA 4O44A 3PO5A 3OYNA 1S1UA 3DRSA 3ZSXA 3V81A 2B6AA 3CM5A 4KB1A 4OGEA 3TABA 3MXIA 3B6PA 3V1QA 4FW2A 3MAQA 4DQIA 3P5JA 3EAEA 1JXEA 3AO4A 4ELTA 3RMCA 1RILA 1RCHA 5CY4A 1BHLA 3UT1A 4DTRA 4KTZA 1SV5A 4DTJA 4CJEA 3SQ1A 1HYVA 2EKOA 2FC0A 3AVLA 1KVBA 1HJRA 1JLFA 3Q1JA 3HYFA 3TR8A 3OYBA 4CGGA 1VSMA 3SUOA 4HCZA 1IKYA 4ID5A 3OYJA 1KSPA 4RW8A 4F3TA 4RW6A 3MEGA 5KE3A 1RT1A 1TGOA 1HYZA 2B5JA 2YV0X 1WLJA 2E5QA 4CGDA 4M42A 3OYKA 2YNFA 4I9LA 4A4HA 3LAMA 2F8TA 4ELVA 3HJFA 3NH1A 1KHCA 1QS4A 3V1RA 4PLLA 5J2NA 2LCCA 4KHWA 2XRIA 2EQJA 1IKVA 1LWFA 4AH9A 3KIOA 5EU7A 1ZBHA 4JS5A 5C42A 3CYMA 4QW2A 5FROA 2JGUA 3AA2A 4IDKA 5M9OA 3QO9A 4DQRA 3RMDA 1KLMA 4M45A 3P8HA 1BI4A 3F70A 4FJ5A 2G8UA 3DLMA 3SUQA 4FM0A 1NJXA 3NTKA 5HRNA 1KFSA 3AVBA 2FBXA 1NK6A 5KRSA 3VQAA 2P5OA 1GOCA 3OYCA 4BE2A 3ZSRA 2IOCA 4CJPA 3I8DA 4CHPA 4Z0UA 2RHYA 4ZTJA 4OVLA 4E7KA 3FLGA 1ASUA 1I3AA 5HBMA 3HK2A 3I0RA 2IC3A 4CERA 2HMIA 3L42A 4J2BA 4CHOA 5HROA 3ZT2A 3ZCMA 1JL2A 1LAVA 3SQ0A 5HLFA 1RT2A 1WN7A 1L3VA 3G10A 3LH0A 2YNGA 3HP9A 4I2PA 3MEDA 2RO0A 5J2MA 1YVUA 4N76A 3EZ5A 4Y1DA 4NZGA 1XHXA 4F2RA 3OVNA 3IRXA 3DYAA 1IO2A 3M8SA 3SNNA 1EKEA 4DU1A 1UAXA 1VSLA 3OYLA 3NCIA 3NFAA 4L8RB 2HHTA 3DI6A 5D3GA 4DQSA 2VWJA 2BIVA 1DLOA 1CLQA 4KTQA 3U3YA 3O4NA 3MP8A 1ITGA 2L8DA 1EXQA 3NBPA 4RW9A 4M3RA 4OJRA 3LZJA 2QXFA 4TSXA 4DLGA 3IAYA 3PUFA 4Z4EA 4AHVA 4CHQA 1R0AA 1U4BA 2GF7A 4O0JA 3ULDA 1N5YA 3LANA 4E1NA 3DLRA 4KHQA 4FLYA 4FLUA 1RTHA 3VQCA 1FKPA 3QNNA 4QCLA 4FJ7A 5J26A 3H8ZA 1D8YA 2E6NA 3VQDA 4QQ6A 4CECA 1TL1A 1Y97A 4CK2A 1S9EA 3OQ5A 4DQQA 4PWDA 4B9UA 2HHUA 3OYHA 2Z1IA 4FXDA 3PMIA 1B92A 2XHBA 3MEVA 4C8OA 3DLKA 4GW6A 5C25A 2VWKA 3CFRA 3C6UA 4KO0A 5KI6A 1BL3A 3IG1A 4DSLA 4FL6A 2CKKA 4N56A 3WNFA 4KREA 4KI6A 3TAFA 3VQ4A 1LW2A 1L5UA 1HQUA 4FLZA 2KTQA 4BDZA 2DIGA 4M3WA 5K14A 2D0CA 5CZ2A 2OZSA 3TARA 3K5MA 3OJSA 4DTMA 1RT5A 3ALYA 3M9QA 3VA0A 1ZBIA 3HPGA 2Z1HA 2R5MA 2RJCA 4LY7A 1JXBA 5J2PA 5IAYA 2ITGA 3RR8A 2FBVA 2X6NA 5I42A 2QKBA 5DK5A 3NTIA 3K2PA 3QEXA 1ASVA 2VG7A 1Z26A 5KCHA 4DFMA 1UWBA 3K5LA 3KK3A 3ASKA 3FDRA 3NTHA 3EYZA 4KTWA 3DOLA 4KHUA 3DRRA 1SL0A 4FM1A 1NOYA 3SV4A 4I2QA 2F96A 2X4XA 4CF8A 1VRTA 4KHSA 4PQUA 4GMJB 4IUVA 3NF7A 4B9NA 2IS3A 3AVGA 3KLHA 4FLWA 4CGIA 4DS5A 4FJNA 2RJEA 5C6SA 1QHTA 3JYTA 1N6QA 1D9FA 4H4OA 4AHRA 4FK4A 3ZT0A 3U3GA 4KHYA 4C5EA 1NK5A 2RI5A 5JS2A 1ZBUA 3L3UA 5FRMA 5HRRA 3P8DA 1Z25A 3VA3A 4Q0BA 2AJQA 3C6TA 1B9FA 5I3UA 3QESA 5D6WA 1OYXA 4UC4A 4DWIA 1W0HA 4C5GA 4K8XA 4AILC 4HCBA 3ZSVA 3V9WA 3LALA 3META 2IG0A 1WAJA 4FJXA 3AVKA 1UOCA 2FBTA 2RJFA 1YT3A 3PNWC 1GOBA 1VSFA 4PUOA 1SKWA 4Y1CA 3M8RA 2O4XB 1K6YA 4BDYA 3ZSWA 1RDCA 3E9GA 3ZSQA 2K3YA 1HQEA 4BWJA 4Q5VA 4W5NA 1L3TA 4OKKA 2O4GA 3LAKA 4FJ8A 3MXJA 4KKOA 4FJJA 4AHCA 3D0PA 1CXQA 3OYDA 4B8AB 4KPYA 2XY5A 1KVAA 1S6QA 2NUBA 3LPTA 3U6FA 3QEPA 4DTSA 4CJKA 3AA4A 1WJQA 4FJKA 2PY5A 3LYIA 3B6OA 5CYMA 2OPQA 4PY5A 1JLQA 4CEBA 4DU3A 3ITHA 4RG8A 4C5IA 3LDSA 3WNHA 4KB0A 1T7PA 5KGXA 4DTXA 4C8KA 3BDPA 4EP5A 4KFBA 3LLRA 1U49A 3KKSA 3SJJA 5J2QA 2HVHA 1RDAA 4M3UA 2JTFA 4FM2A 3ME9A 2XDPA 1RBSA 1N27A 2EX3A 2RJDA 1T03A 3OS1A 3F73A 4NCAA 3LZIA 4DMNA 3IS9A 2QQRA 3SYZA 1NJWA 4OKEA 1SKSA 1JLCA 2OPPA 3LWMA 1Q9YA 2R58A 3KLIA 2OPRA 4QVZA 1TAUA 1O1WA 1JLEA 4F3OA 2WACA 1TK0A 3DMJA 4G1QA 3V6DA 3TAEA 2M16A 5KRTA 4IUPA 4OLAA 2VG5A 5FDLA 3SPYA 3CM6A 2VG6A 4JRQA 3LP0A 4ELUA 3KUFA 4CF2A 3DB3A 3BDLA 3DLBA 2ZE2A 3FFIA 1HNVA 2HNZA 1F21A 4E7HA 3AVHA 3TAMA 4DTOA 2D9TA 4N4HA 2ETJA 2BKDN 4ID1A 4CK3A 2M1HA 3HL8A 3SUPA 1REVA 1CZ9A 4RW7A 5JS1A 5DMRA 2LVMA 1C1CA 3KJVA 1VSJA 3M8PA 1MHNA 3NH0A 3V9SA 2OA8A 3F9KA 4H8KA 4RW4A 3PO4A 1KLNA 4PLIA 1WSFA 3NF9A 2LTOA 4FZZA 5D6XA 3QLHA 4IKFA 2K3XA 3V4IA 3MECA 3O3HA 4W5OA 3S3OA 1LV5A 1HPZA 1NKEA 4DF4A 3CG7A 3NGZA 5C0MA 2XO7A 2OPSA 2R57A 2FHDA 4CFDA 1LWEA 3HPOA 1CXUA 5HP1A 4B9XA 4ZHRA 4A4GA 1TKDA 1RTDA 5KTQA 3V9XA 4DSKA 3OYMA 1ZBFA 3WNGA 4CCHA 2RHUA 3RRGA 4IG0A 3KLFA 3OYGA 1XNIA 4N47A 1VRUA 2HNYA 1TL3A 4FYDA 4BD3A 4OGCA 4I7FA 1X1PA 3TAPA 4EP4A 2G8WA 3V1OA 3P83D 4N4IA 4FU6A 2OYQA 2IDOA 4F4KA 4FVMA 4MQ3A 3AA3A 1ZYQA 1SL1A 2XY7A 3SI6A 1X9SA 3SZ2A 3SQ2A 1EP4A 4KAZA 3DLHA 2PQWA 4J2DA 3NDKA 4BE1A 1RBRA 1G5VA 4YFUA 4N41A 2BGGA 4QQGA 1NK8A 2P0KA 4DQPA 4K8ZA 2RHXA 4EZ9A 1LW0A 4IUTA 2GV9A 4N5SA 2PZSA 2O4XA 1T8EA 3K59A 1NJZA 1JKHA 4CEDA 3K58A 4R5PA 2DY4A 2IGIA 3HT3A 1X9WA 2DAQA 1FKOA 3VQEA 1NKCA 2P1JA 4DSEA 3S6WA 2G8VA 4Z4HA 4LH5A 3V9ZA 1WSHA 4B9TA 3UWNA 1KCFA 5D6YA 4FK2A 2HHVA 4CJTA 2G8FA 3ISNC 3NGIA 1IKXA 1KTQA 3LWLA 3AVIA 4E0DA 1TK5A 3KD5E 2EHGA 3E01A 3QETA 4EDUA 4IUQA 3EY1A 2R5AA 4CHNA 4YNQA 4HVJA 2YKMA 4CEAA 2D0BA 4E1MA 2L3RA 4CFCA 3HVRA 3OYFA 2RF2A 4O4GA 4M3TA 3THVA 1NK9A 1SKRA 3LPUA 3OYAA 3OYIA 2DFFA 4FJ9A 4QAGA 3SUNA 2HB5A 3KK2A 4BACA 1C0MA 2DTUA 2L89A 4DSJA 5T7BA 5E41A 4Z4CA 1HYSA 3NE6A 3NF8A 2Y1IA 4BDPA 4CEQA 4IFYA 4DF8A 2M0OA 3P1GA 3RMBA 4CIEA 3SPZA 1LWCA 4DSFA 1IG9A 3ZEHA 4IUUA 3MEUA 3VQ8A 2XY6A 2RPIA 3DB4A 3PX0A 1IKWA 3S9HA 4HTUA 4DSIA 4CJUA 4CGJA 4F8RA 4B9SA 2NLUA 4QQDA 1JL1A 1BGXT 4L59A 1QE1A 4JS4A 2HQEA 5CZ1A 1HRHA 3OA6A 1ASWA 4Q5WA 3LGLA 4O5BA 3DM2A 2ATQA 1J53A 2YNHA 2YKNA 1HNIA 4CE9A 4J2EA 1RBTA 4O0IA 4E7LA 4CEOA 1BCOA 4NS5A 4MFBA 4PA1A 1S1WA 2RKIA 4FK0A 4JLHA 4CF0A 4DFKA 3LP1A 4FLXA 4C8NA 1L3SA 3AVMA 3ZT3A 3AVFA 5KE2A 5KH6A 3C94A 3AV9A 2RN2A 2Y1JA 3T1AA 4QOZB 2MWOA 1WJSA 5HRPA 1RT4A 5KCOA 3OJUA 4X34A 1YTUA 2RHIA 3QJ6A 1B9DA 4B08A 4HUEA 3AO3A 1VSKA 2R7YA 2BDPA 3ZT4A 1VSDA 4FJLA 4CGFA 4FZXC 2EQMA 4KRFA 4NYNA 3DLEA 4FJIA 2YHAA 4LSLA 4CJFA 4C8LA 4CJRA 4I9QA 2Q3SA 3ZSZA 1XWLA 4RG2A 2FBYA 1NOZA 1QSSA 4CFAA 3AO1A 2GFAA 4XIUA 4OVAA 4E3SA 4E19A 2HHWA 3DLGA 4DTNA 3QIPA 4CJ3A 3QIOA 4GVMA 1XHZA 1BQMA 2G8IA 1S1VA 3L2QA 2JZ2A 3KLGA 1FK9A 3L2WA 4OPKA 1C0TA 3QBYA 1XC9A 3C4SA 3CQ8A 1J54A 1KFDA 2IAJA 2G8HA 4KV8A 4JRPA 2P51A 4CEZA 3TAGA 5FRNA 3SV3A 4CRIA 4E7JA 4CJWA 1WNSA 1RTJA 3QKJA 2VYTA 3K57A 1JLAA 2G8KA 3NAEA 1GOAA 1S1XA 3TAQA 2EQKA 2E6MA 2KFZA 3AO5A 4H4MA 1OZ2A 5IN1A 4UQGA 1BQNA 3BGRA 3O3GA 1JLBA 4CK1A 4Z4FA 1RTIA 4FLTA 3OYEA 4A4FA 3QERA 3MO8A 3HSTB 1OI1A 3TANA 3HM9A 3KKRA 3C95A 2KZMA 1BCMA 3RRHA 4AHTA 3PX4A 3L3VA 2P5GA 2KW4A 3PX6A 3QINA 1ZBLA 3VQ7A 4C8MA 3T19A 3HVTA 1EETA 4GY5A 4CJVA 3T3FA 2GBZA 1CZBA 2F8SA 2X4YA 4NCGA 4DFPA 2ZQBA 3ZT1A 3OB9A 2LDMA 2HHXA 3CFOA 3NHGA 1S1TA 2F5KA 3A2FA 4FJHA 2Z1JA 4LD6A 1WAFA 4B9LA 2JLEA 4NCBA 2DFHA 2X6SA 2YHBA 4HUGA 4M3ZA 3PY8A 4C5HA 4CHZA 2W42A 3AA5X 2HHQA 1H3ZA 4DU4A 2HHSA 4CIGA 4CGHA 4B9WA 4IFVA 3NGYA 3SQ4A 1C0UA 3HXMA 3LP3A 3O8VA 1BIUA 3ZSOA 3L2RA 1A5VA 3AVAA 1WGSA 3ZSYA 4CJ5A 1QSLA 4CF9A 3ASMA 1NK0A 4FJGA 4M3YA 4IBNA 1RT7A 1RT3A 3PFSA 4FJMA 3AVNA 3PV8A 1G15A 4LH4A 3M8QA 3PMTA 2OZMA 1VK0A 4E7IA 4CEEA 4W5QA 1A5XA 3G0ZA 4B8CA 2RHZA 2B8AA 1C6VA 4IG3A 3CEYA 4BE0A 1I39A 4CFBA 3NH2A 3TWHA 2D0AA 3MEAA 3VQ5A 4FZYA 1TKXA 1W9HA 3MP6A 4M3XA 2E6LA 3I0SA 4II1A 4CESA 4EZ6A 3S3MA 3L2VA 4DTPA 1SL2A 1S9GA 1RDBA 4Z4IA 1U48A 3L2UA 3FEOA 4F2SA 5HRSA 3S3NA 4CIFA 3OMGA 4HHTA 4OPJA 1EX4A 5KGWA 1WSJA 3CFPA 2O4IA 2KQ2A 3QIIA 2PYLA 3JSMA 1NKBA 2QK9A 3E9FA 1NK7A 1KRPA 4LSNA 1RBVA 1RBUA 2X78A 3SD4A 1MU2A 3O3FA 3D45A 5SWMA 4AHUA 4AHSA 3QEIA 1QQCA 1RNHA 2LSNA 1TAQA 3HPHA 3DRPA 4IURA 4DTUA 1TKTA 4A4EA 4CJ4A 3KLEA 3MXMA 3AO2A 1S6PA 2EFIA 3VQBA 1JLGA 2QKKA 3AVJA 3MEWA 1KVCA 1L3UA 3HP6A 4Z02A 4CJSA 3K5OA 1U04A 4OLBA 3QNOA 2QQSA 3AVCA 1IH7A 2MWPA 4NYFA 3VQQA 1C1BA 2B4JA 1QTMA 1BI4B 1WSIA 3KD1E 1NJYA 2BE2A 4N4GA 1U47A 3RWUA 1VSHA 3KK1A 1J9AA 4B3OA 2KZZA 1UA0A 2X4WA 4FW1A 4KI4A 2KFNA 3VQ9A 3QEVA 5J39A 3NF6A 4ICLA 4FLVA
chains in the Genus database with same CATH superfamily
1GRIA 2QVOA 3SZPA 5K5OA 4BRPA 2ZGYA 5GAMg 3VYSB 2GFUA 4KHNA 1KC8C 4A5NA 4OMLA 2ZPIB 1XUPO 1NZ9A 3ZL7C 2P9UA 2R7WA 2YNIA 3H6ZA 2VGMA 2FLOA 2A61A 3MQ0A 1GLAG 3I35A 3K9KA 2W00A 4S0HB 2E1MC 3G71N 4XRSA 1IC8A 3GG4A 4B9MA 3VQ6A 4RAZA 5M3FJ 2WB1N 2EFNA 3CCEN 3BWGA 2BANA 4JD2A 1XMXA 2DT5A 3O4QA 4HUFA 2XK0A 4HXJA 3SB2A 4CJLA 4G8XA 2LKXA 1KQJA 1CF7A 2V9KA 2E4LA 3DXJF 4D8DA 4FM4B 2VE8A 4PKIA 4C92D 4DS4A 3FK7A 3UKRB 2ZMEC 3E5UA 4UNFA 4B9VA 2HPIA 2WAQA 1I1GA 1J6ZA 4PJOD 4XQFA 4E9EA 2QWLA 3UIQA 3HOTA 4Y91A 1C6VX 1UGVA 2I5JA 3I59B 4JI0K 2DIQA 1ATSA 2V7ZA 4WE1A 4ZYHA 3OY9A 1J5OA 2HQXA 2M4GA 1X58A 1RI0A 1QZ5A 3WNEA 2Z3YA 1QQOA 4KULA 3CF2A 1WHLA 1BC7C 2A1RA 1X9MA 3RI4A 3TQ7P 4FO0A 3ULEB 2STTA 3WT0A 1FXXA 1WSEA 1VSIA 4J8OA 1KHIA 4JKAA 2VXEA 3J80O 1YJNN 2J6FA 2DL4A 1NK4A 2OQGA 2FZGB 3FXOA 1UA1A 1X01A 3M3YJ 1FMKA 4O55A 4JKGB 1LCUA 4CHYA 4M77B 4CEFA 3CCQN 1FEXA 4HSRA 3OS2A 5AQNA 2DFEA 3O6WA 2DW4A 3HSCA 3K5NA 2QWRA 2GUIA 4XRFA 2BHZA 1UE9A 5BS6A 2WONA 3I56N 2CUEA 2DEQA 3VN5A 2VQFK 3KFWX 3CCLN 4CZKA 3FIFA 3PO5A 1XX5A 2ZSHB 2JMWA 1RABB 2AP1A 2QEXI 3MKYB 4XTZA 5CLSA 3TU5A 3MXIA 5K1YA 2Y69H 3MAQA 3EAEA 5EDNA 1YS6A 2WUSA 3FXKA 1MDUB 4RKUE 3JAMZ 3HYIA 2QEXQ 3V8KA 1VQOA 5CY4A 3X26B 4HW0A 2MH9A 4KBOA 2LR8A 4KTZA 4DTJA 2KJCA 4M7AD 2R7RA 4DBFA 4WXCA 1TWAJ 4C0ZA 3JR9A 4DEYA 2VQEK 2FSKA 3VS1A 4C92G 1JLFA 3Q1JA 4XTXA 1SEMA 3OYBA 1KGSA 2K5IA 2GQVA 2M1BA 5EG0B 1TL8A 5LY3A 3VEOA 3EFOA 4HCZA 1RI9A 3OYJA 4AQYK 4F3TA 2KE9A 1R1VA 1UG2A 3MEGA 4PJOG 4EMGA 3MKZA 1DT9A 3L09A 1HYZA 4G9ZA 4F7UG 5E26A 4F55A 2ATCB 1HKGA 4LF8K 2B5JA 4CBXA 3M54A 1WLJA 2RK1A 2DL3A 2E5QA 3H0FA 4XLFA 2NS8A 1SD7A 2PEXA 3ZLJA 2NNNA 2E1MB 1AU7A 1UAAA 4WK8F 1WI7A 3V1RA 5IP6A 4PLLA 1K73R 4YOUA 2LCCA 2XRIA 2NAZA 1NKUA 3NMZC 4F14A 2ELJA 2W1OA 3BR3A 1MSFC 2YRDA 3CYMA 4QW2A 4KGXB 5FROA 3TVTA 4J8FA 4KMUX 1BA5A 3K9JA 3QO9A 3V8JA 4DQRA 2HXOA 4A3EJ 4M45A 1ZH5A 1RKWA 1LJ9A 4LLNA 4JI8K 3M56A 5LJ5h 5LJWA 2O88A 2G8UA 3DLMA 1IJWC 1BU6O 2VONA 2KRNA 2OAZA 3CCYA 2GEMA 2ZMEB 1RFQA 5DD8A 1FC3A 5IXBA 2RNGA 2ZM6K 3OBWA 2CS7A 3HEFA 2H09A 1VAZA 5KRSA 1Q86U 2ZPEB 4CH7A 4XMYA 3ZSRA 4PJLA 4CJPA 2VIXA 2K85A 1K0XA 5EX5A 3R6MA 3FLGA 3S14J 1U2VB 3P31A 1ON2A 3K0SA 4HX7A 5HS9A 3TMOA 3JRGA 1JB0E 1ONVA 3I0RA 1X2QA 2HMIA 1S72T 2PMZA 4BB7A 3RDIA 5AQVA 3ZT2A 3ZX3A 1MBJA 4AU7A 3SQ0A 5HLFA 4GKKK 4JI7K 3K4JA 3N4MA 1QVFP 4PL7A 2DBBA 4I2PA 3B73A 2KGTA 2RO0A 1YVUA 2RM4A 1VQON 5M1OA 4M7AG 4BR0A 5KYXA 5JHFA 4MEYF 1IO2A 5F6FA 3M8SA 2K7LA 1EKEA 3FXUA 3HXLA 2ECZA 4CZJA 2HHTA 3CQXA 2H56A 1YJ9I 1RUWA 5FWBA 1Z7UA 4OPHA 5D3GA 3C7NB 4PKGA 1JJ2A 3H5NA 4KTQA 3CCMT 3AGRA 1FTTA 5CKBA 3M8EA 1EXQA 3O6BB 5JVHL 1YJ9Q 1IV6A 3A5OC 2QXFA 4FYXB 1VHXA 1DJ7B 4A12A 4Z4EA 1U4BA 3C3WA 4UY8I 1N5YA 3TP3A 2VE9A 4U7DA 4KHQA 3JSPA 2OFIA 3X28B 4FLUA 5DPKA 1ZQ1A 1FKPA 4P1WA 5KQ8A 1ESVA 3QNNA 1NEBA 2X4JA 1GXPA 2JA7J 1J59A 3FDYA 4IF4A 1FBQA 3L6QA 4UHTA 5J26A 3H8ZA 2X1DA 4XOTA 3WU0A 2YT6A 3W6JB 1TL1A 4CC4B 4CK2A 4M78D 1JHFA 4FTHA 2LBFB 2F5VA 4ITVA 4PWDA 3BF3A 4RLQA 1AOYA 4N9IA 3QBXA 1IDZA 5ICEA 1YJNI 1MBKA 2QWMA 4G6DA 1DPUA 3MEVA 2W84A 4C8OA 1IGQA 2RMOA 3CUOA 3DLKA 5C25A 5H6QA 5F1JA 4H5RA 4KO0A 5KI6A 4X64K 4WCGA 2XAJA 3CCQI 2V51B 1BUPA 4DSLA 1X69A 2QTXA 4A2AA 1YJNQ 3VQ4A 3VPZA 3IRQA 2KTQA 3Q7CA 1JQQA 2D0CA 3K5MA 3THYA 1BWFO 4XH4A 4E6KG 5HK3A 3CCQQ 1YITT 4AM6A 1RT5A 2PMZN 1G3TA 1ZBIA 3HPGA 5E17F 1KSWA 2V8IA 1O4XA 2RJCA 4LY7A 3M5RA 1PD0A 1ETXA 2DA7A 1ZA2B 5IAYA 3RR8A 3I56Q 1BM9A 3WQUA 2XHIA 4FIBA 2F5EA 4A3CJ 4M3BA 3JRBA 1EFNA 1QKWA 2EINH 2X1CA 1Z26A 1G6NA 2YCHA 2HOSA 3H1VX 2W25A 2E35A 3KK3A 1E3OC 2V79A 2ZCWA 3O9SA 2RH2A 5L3FA 2V1DA 4M9XA 3NTHA 5FU6B 2TCTA 3KBGA 5HLIA 4KA4A 3DOLA 3BZKA 3MCPA 4KHUA 2LRDA 3GL1A 1IUYA 2HQAA 4KFCA 1ETYA 2D1HA 2EGAA 2UYTA 1S3JA 3NQOA 4XKVA 3IH4A 3CC2I 2F96A 4Z89A 4CF8A 1ZA1B 4IUVA 4AFQC 3EGXA 2CGPA 2IVWA 4B9NA 4AYBA 1FT9A 3ZRGA 2OTLI 4N9HA 2A41A 2WFBA 4C23A 1TP4A 4DS5A 3BG9A 2RJEA 5C6SA 3D5RC 2CU7A 3CC7A 2P4RA 1QZZA 4BNCA 3CC2Q 4MHGA 4G7HF 3EUAA 4H0PA 1D9FA 1DPRA 1ZHIA 4XKCA 1K4US 4F52A 5L8RE 3O1BA 4M78G 3M3ZA 1NK5A 2J4RA 2VODA 3EL2A 3EFSA 9ATCB 1GLEG 2OTLQ 2DDBA 3F3XA 1IHWA 4ZDPA 1M2VB 5HRRA 3JCMX 5CK9A 3M1FA 1Z25A 2A6TA 1ZBSA 3DBHB 4Y13A 2F4VK 2ZNZA 3QESA 4HG2A 3A5ZB 2DOEA 3OOPA 4DWIA 2E2OA 4GV6A 1MZBA 1T6DA 5GANj 4X6AJ 2EYZA 3NRVA 1XCVA 1M1KU 4LIUA 5DCMB 1MMAA 4I6ZA 5E84A 2IG0A 1WAJA 1B72B 3AVKA 4PKCC 4B3XA 2WTUA 4IJAA 2ZSIB 1GOBA 2HTJA 4G7ZF 4PUOA 4ESRA 1M27C 2O4XB 5IT9O 1SRMA 3ZSWA 2A5YB 4KGZB 1RDCA 3KFVA 3RQIA 4IEIA 1YQKA 4XLNF 2QM3A 1B07A 4PUSA 1HQEA 3WTZA 3MVPA 4BWJA 2XDDA 4W5NA 1WPKA 4CDGA 3BY7A 1M3CA 2O4GA 3WTYC 3LAKA 4FJ8A 3MXJA 2EWNA 5D8LB 4FJJA 1MSEC 3RESA 2ASPA 3LFKA 3OYDA 3R1XA 2XY5A 4JV5K 4AD9A 2VBYA 3JB9F 4DTSA 2XRNA 1QCFA 4RUGA 3JREA 3AA4A 3MX5A 3VSLA 4ESJA 3I64A 4RBOA 2OC6A 2A40A 2GNCA 1ZRDA 5JLFA 4M75D 3DKXA 5D5XB 5BQTA 1YI2T 3FZMA 2MA3A 4EA5A 3QRFF 2TRTA 4KB0A 3L7WA 4DK9A 1VQPT 1Q7YR 5HY6A 3MK6A 5D5VB 4IL6C 1J09A 1U49A 1WEFA 1XJWB 1M90C 3KKSA 1ZR2A 2G6FX 1YTYA 4M3UA 2EZKA 5F1XA 2DAOA 1TG0A 3O9UA 3DQVC 2QTDA 2QQAA 1M1GA 4IRIA 1EIFA 3G3ZA 2QUFA 3CD6A 2KRCA 2EX3A 3VEVA 2QA4N 2RJDA 4AYBN 1N77A 3F73A 3LZIA 4DMNA 3D5LA 3L1PA 1TYQA 4UUSB 4L0YB 3SYZA 4FYYB 3CC7N 4OKEA 3WXIA 2IXSA 1LE8A 3T5XA 3QYGB 1D0YA 2OPPA 3WVEB 2HNHA 4BRDA 1CQTA 3S93A 4GGGA 4Z2YA 2OPRA 3LA2A 5GMKm 4DV2K 1U9OA 5LEKA 4OO1J 2IIRA 2FOKA 1JLEA 3PO2J 4F3OA 2D45A 4CD1A 2WSEE 3VS3A 3MJXA 5CKEA 3ZYYX 1TK0A 2HL3A 1KD1R 4OFEA 3NAUA 1M8MA 1MIJA 2XIDA 2XD0A 4CZLA 3S16J 4ELZC 4ELUA 1RDWX 3KUFA 4MEXF 1MA9B 3BDLA 2QI2A 3K0LA 1VTNC 3OL3A 3ZETB 3DFGA 4N4NB 1PC0A 2QBYA 4QIWN 1U3EM 5ADXA 3W6KB 2HKOA 3DTEA 4P5NA 4ID1A 3CCJT 3F8BA 2KMUA 3HL8A 1FZPB 3SUPA 3E97A 1SEUA 3I0TA 2LVMA 3KJVA 3M8PA 1PVEA 2LT4A 2HSPA 1QU3A 2OA8A 3F9KA 4H8KA 1GXQA 3CJAA 3OSFA 1UUEA 2GTJA 3NF9A 2F5TX 3W2WA 2LTOA 2M0MA 3EG0A 1TNSA 5DM6F 2CRGA 2ZNYA 2EAYA 1I3QJ 5D6XA 4IHSA 4I6MB 3QLHA 3WEEB 2IAIA 2DK3A 1BYMA 3V4IA 3MECA 3JCMV 2DPNA 3S3OA 1LV5A 2DYIA 3H0GJ 1NKEA 1NWKA 5FD6A 2JVHA 1KQSA 5GAOl 1ZUUA 3NGZA 4LFAK 5C0MA 3REAB 1J75A 1WKMA 1XD7A 4IEJA 4XICA 2ZAEA 2FHDA 1P92A 2JA6J 3HPOA 4C8QA 5EOYA 3C65A 2AKKA 1XSXA 5IP9J 4ZHRA 4LGWA 4M3EA 4BL0B 2CYYA 3A8LB 4X9DA 5FGMA 3WU2C 2XKOC 2HAXA 4DSKA 2AO9A 3OYMA 1OX9A 1ZBFA 4OF1A 4CCHA 1YYVA 2HMPA 3HSBA 3F8FA 3TREA 1XNIA 2O7OA 4N47A 1I94K 1U5SA 2EJRA 2STWA 3CD6N 3FE1A 1FSEA 4OGCA 2AA4A 3JW4A 1EZZB 2RQPA 3LSGA 3G6ET 1X1PA 4EP4A 1R1TA 2CQQA 5BMZA 3K70D 2XHKA 3QWYA 5M1NA 4FU6A 1N8RR 4LMYA 2FXAA 1OCTC 5FJ8J 2COWA 2IDOA 5GAMj 2DTZA 4F4KA 2XY7A 2DO7A 1ODDA 3CCSI 1X43A 1UB4A 1JI8A 3TU4K 4OMFB 2M8EA 3ZQHA 2WA0A 5M5WJ 4J2DA 3O8MA 1QVFM 1FLIA 5EVZA 2V9PA 2X9HA 1G5VA 5FPEA 4YFUA 2NZTA 4NO7A 2BGGA 1IXSB 4B21A 3EH1A 5DTDA 2K5CA 1SSHA 1WQ7A 3VU3C 3X2QH 4C1NI 3CCRI 4BS9A 1ZSZA 2A5XA 1RRJA 4K8ZA 3QDKA 4C30A 2Y4XA 4HX8A 5J8CA 2HBWA 4IUTA 2A6AA 1NGCA 1P7JA 1NJZA 4CEDA 1QQMA 4KT6A 3CCRQ 2DAQA 4UB6C 4HNVA 2P1JA 1E6GA 4KH1B 1NLPC 4ZN1A 4LH5A 1QZEA 2VN2A 1KU9A 4ZNXA 1Q1VA 4E9HA 1T3LA 4OPAA 3CPWP 2EJFA 1NGNA 3DV8A 2NRAC 4J9GA 2ZJPF 2EFPA 1KTQA 3M9AA 2A0FB 1D3BA 1H92A 2YUSA 3LWLA 3AVIA 3A5NC 4NLBA 3JCMe 1WZ2A 4UV8A 3HJEA 2DODA 2XGDA 4H0YB 2HL5C 3SYTA 5AQLA 4YIFA 1TK5A 1ILYA 3BG7A 4H5VA 2QDLA 1Q81R 4DR1K 3QETA 4BR5A 2JA2A 3I8BA 4EDUA 1VQMT 1T0HA 4XKWA 2A3ZA 2R5AA 1NJIU 1PHTA 2H3JA 3NVKA 3EG3A 4BXXJ 2QWOA 2VXDA 2P9KA 4E1MA 3NWSA 4CFCA 4XLAA 4BUGA 4RGUA 2CV0A 1SKRA 1TSFA 2FX0A 4P55A 4JK1X 1N39A 2DFFA 3V42A 4XRSG 2MMPA 3MN5A 4IHYA 2H3GX 1AHJB 3FHFA 2AHJB 2LNVA 3S2WA 2RB6A 4B1ZA 4E70A 1V55H 1KQ1A 1OOTA 4CC2A 2HEQA 2PG4A 3F5TA 2QA4I 3OV8A 2RQQA 2OX7A 4CCOA 4A3KJ 3H92A 5A2QO 1Z67A 4FT2A 4RM3A 2KFDA 4CEQA 4IFYA 2F4MB 2Q0UA 4TV7A 3KYCB 3PIPF 4D1QA 2Z2SB 1R00A 5DM6L 5HDGA 4DSFA 2QA4Q 2KROA 4L18B 2UWMA 4B24A 1JJ6C 1QMCA 1JCFA 1K8AC 4IUUA 4EMKB 3MEUA 2K7AA 3CC7Q 4RTUA 1UGSB 3CMAI 3NVMA 2CZ0B 2HOTA 1FBUA 4HV5A 3JS6A 3DB4A 1D1CA 1P4WA 2M45A 3S9HA 4HTUA 1WFWA 1QWFA 3WVDB 1Q7YO 2HKNA 4CJUA 3G1MA 2ESHA 5EYRA 2HCKA 2NLUA 2V6CA 3CMAQ 1BGXT 4L59A 3PVLA 4JS4A 5L3DA 2I7NA 3PT9A 2VPLA 4FWPA 4IRHA 1VIEA 4XH1A 3QB0A 4DR5K 3LDLA 1O57A 4O5BA 5KYXB 4DBQA 3DM2A 1G2HA 1HNIA 4J2EA 1RBTA 3BCBA 3KLNA 1Z9ZA 3RYPA 4OIOF 2FBHA 5BNGA 1PUFB 2E19A 2FSWA 2K86A 1ATNA 1S1WA 1B8IA 2E1HA 2RKHA 1G83A 2DVEA 3RPUD 1I8FA 1YW9A 4OMPA 5KE2A 1CKAA 2IS1A 5K7ZA 3MN6A 2DTIA 3LSMA 2K79A 3AT1B 1F1ZA 2HOAA 2P0PA 3VS6A 3EPZA 3A01A 2JS0A 3DBLB 5GMKj 2CH6A 1KD1O 2GOMA 4BI3A 1OH6A 1UECA 3K1PA 1ZGWA 4FJLA 4FETA 3EHQA 4CGFA 2C0IA 2P9LB 3SFMA 3LDNA 5F0FA 4OMMA 2GIZA 3ULQB 1YJWI 2L3DA 1BW5A 3DLEA 4FJIA 2XRLA 1FMWA 4LSLA 3GLLA 4I9QA 4A53A 3ZSZA 4FE4A 4D5CA 2VXFA 4EW4A 5AQZA 2JHJA 2FBYA 1KONA 3AO1A 4XIUA 1WJEA 1YJWQ 2KVQG 4E19A 2B9SA 5E20A 5HS8A 3E5QA 2VJJA 2ZJPL 3K2ZA 1XHZA 2G8IA 2KKZA 4JUVA 3L2QA 1PKTA 2P9SB 1FK9A 2PBDA 5KYNA 3L2WA 1XNQK 3HTVA 2LCLA 4JEPA 3T1BA 3Q0UA 4KV8A 4JRPA 1HOMA 2DBKA 4IHXA 2LG4A 1ZYRF 3SV3A 4CRIA 4E7JA 1JUSA 2IA2A 1HKCA 1RTJA 3BG5A 3QKJA 2VYTA 3UA7A 3KVGA 3AG2H 1F1BB 4DR3K 2NUPA 4ANJA 1E3MA 1N36K 1GLNA 1WXTA 3SAGA 3I5UA 5LRSA 3I33A 2VCPA 1G99A 1VQ7I 1TS9A 3QU3A 1BQNA 4X62K 2EPFA 4AIJA 4ZGEB 3WG9A 2LQ8A 1L0OC 3VTIA 4CK1A 1RTIA 4DV3K 2GUPA 3CCMA 4C92F 4FLTA 1X9JA 1SD4A 1TC3C 1OV3A 3QERA 2E36A 4KIGA 2JVVA 3I9QA 1VQ7Q 2BY2A 2LVSA 3N05A 2D5VA 4B1RA 4PJOF 2M7BA 4DHYA 2K4JA 3FKIJ 4WXDA 1B1BA 1MWMA 3E7LA 2VBWA 3BDUA 1ZBLA 3PIPL 4C8MA 4JDSA 1CZBA 1GVDA 5GANd 3DXKA 1LB2A 3UNGC 2HHXA 2MABA 3CFOA 2F5KA 1QVGA 2B63J 1ZQ3P 3D7SB 4OB0B 4OIPF 2BXZA 2KT1A 4JKHA 4LD6A 4A3FJ 3RERA 4K25A 2JLEA 3BY5A 5C2FA 1KAYA 4NCBA 2J6KA 1GL5A 2K9GA 4PZJA 3ZCOA 1VF9A 3C2HA 1C0FA 4C92E 2VC0A 4KUMA 3GZ5A 1DEJA 2L7KA 4EVVA 3EGDB 1BK2A 2HQ5A 3VF6A 1MDMA 1J5YA 4PJOE 5AZJA 4F7UE 4CYDA 5GAN8 5B8HA 2UXNA 2NRWA 3AAFA 2IS4A 1UGQB 3FXJA 1W6XA 3KETA 1KAXA 3E6CC 2DLLA 4YORA 3QYBA 4YFXF 1SKUB 3RQ4A 1IN7A 4DOWA 5I9EB 4BI4A 2NWMA 3G4SI 3URGA 3I54A 1M5Q1 3UATA 5FB2A 1HLUA 4PFPA 2KJBA 4C8QC 1YW7A 3O2PE 2CZ6B 3QAHA 3LSIA 2DL8A 2DETA 4JNEA 1JT6A 1OKRA 2E2IJ 3G4SQ 3WE3A 3ABLH 3E9PA 2VVKA 2RREA 4CO8A 2Y30A 4M7AF 1SAZA 2TDXA 1OPLA 1VK0A 4CEEA 4KHPK 2RVCA 2O9VA 1SQKA 2ZCFB 2CP7A 2OFKA 3G0ZA 2BYVE 1R22A 2HR3A 4C2UA 2NVQJ 1S7AA 4RMOA 3EG9B 4IG3A 3CEYA 3K9TA 4BE0A 3LSKA 2OTJA 4CFBA 3WHCA 5IOZA 3NH2A 3CCMN 3JV3A 4KIBA 4EJVA 4IJNA 3PIOF 5AQMA 3VEWA 3TWHA 2F9WA 1K4SA 2P9NB 4KGVB 5CJ9A 4M3XA 2YDLA 2E6LA 4II1A 3LOCA 2O01E 4EZ6A 1XNRK 3SK3A 3H1CA 2GWJA 1P4XA 5CVUA 4K41A 4XTVA 1HU0A 1U1SA 1IAWA 4YOWA 4DR7K 4ILHA 3L2UA 3N5BB 2E12A 2L0KA 4B1YB 2XKPA 4GVEA 2O61A 1IBLK 4XLEA 4OPJA 2EV5A 1ZSZC 5IHIA 2YS9A 1X3UA 1IXRC 1G59A 1HJOA 2F9TA 3RKQA 1AZEA 2DN0A 3HUGA 3MAJA 3H0HA 3R8EA 4M7AE 3ZQIA 2KIUA 1HW2A 3QQAA 4AHUA 4OB1B 1QQIA 2M02A 3E2UA 3CP2A 2D1XA 2VBZA 2D8JA 4E1JA 4OB2B 1X19A 1KC8O 2CH0A 3ZBDA 3P9KA 1R77A 4BRLA 3MN7A 1BA1A 4JI2K 2IVOA 1LDKB 5J1UA 2HDWA 2P5KA 5E8GA 1QZ6A 3RNJA 1ETOA 2BOLA 3SBTA 2KPMA 3KLEA 2V52B 2QK0A 3F2KA 1V4RA 3AO2A 4HEA2 1S6PA 2JJ9A 3VQBA 2DXTA 3Q3SA 2IT0A 1YITN 5KPRA 1X27A 5HVQC 4O8KA 4RM2A 2V7YA 5K7FA 1K76A 1HC8A 3HP6A 4Z02A 4AIHA 1U04A 2K9SA 3J7AY 3HM8A 3QNOA 4LOCA 2MWPA 3VQQA 4A3MJ 4PIIA 3GNGA 1C1BA 4K43A 1OULA 1WSIA 1QRYA 4A3GJ 2ECCA 1QVFS 1NJYA 1U47A 1XQHA 4WQ5A 1VQ9T 2MLGA 1X3WB 5AZIB 4BRHA 3Q0VA 1AKHA 5EZHA 3BZCA 4RTZA 2MFZA 4DYQA 2X4WA 3Q0WA 3UE5A 3E6BA 4GY2B 2FF6A 2LKSA 1PRMC 5J39A 2OTJN 2W03A 1VQPA 3HOXJ 4DCHA 3DKMA 3THWA 2O8EA 4MFEA 5GAMd 5D4SA 4GCVA 2RI3A 4DLEA 1XQOA 2DA1A 4W5TA 2Q8KA 3CPWA 6PAXA 2ZBKA 3CMET 3E5XA 2E60A 2LX9A 2W04A 2E88A 3S17J 2BW3B 4DR4K 3SXYA 4HDUA 1KG7A 1HMVA 1Q9XA 2E41A 3J7ZI 5J1EA 2KY9A 1ZAOA 2V75A 2IPOB 2O8XA 3HSRA 1F9NA 4BH9A 5GMKl 2YSRA 2DFUA 2LTPA 1YTAA 3LQQA 3NPFA 2PMUA 4HLXA 2YHXA 4EMSA 2ZXIA 2G3RA 3HOUJ 4E89A 1B9NA 2YJEA 3KHYA 4WFNL 1YJ9T 4M75B 4AI4A 1T3VA 1U45A 4M78F 1MGTA 2JMCA 4A59A 3DOKA 2HZYA 4MO5A 4YOVA 4M3FA 4YIIA 4ZJZA 1M1KR 4FYWB 2F6CA 3M6GA 1MW7A 3GTPJ 3H5AA 3OS0A 3L8BA 4GO1A 1N33K 1XGNA 5LJ3e 2E2PA 1XGOA 2CW7A 2L3QA 3GOXA 4MO4A 3PIOL 1C1AA 5JVGF 2WOMA 3SCXA 2L01A 3CUQC 1ZSZB 3KTQA 2QCOA 5JLWA 3KYLA 2PYJA 2O8CA 4GLMA 3L4IA 1EH8A 2XHCA 2DO3A 2EQUA 1PYVA 2RK2A 2XPUA 3FFKB 3BP8A 3NNQA 2FF3B 3OIOA 2LRQA 2X74A 4FASD 1H3HA 2M0YA 1D3YA 1S72I 2DERA 4EJZA 4AIDA 4Y0WA 4DG1A 3EG2A 2D1KA 2JNGA 1XMAA 4CXFA 2ELKA 3TKYA 1BL0A 4M78E 1RT6A 3D2EA 4OFAA 3CBPA 4E9FA 4EV0A 3RR6A 1SUQA 3TI0A 1S72Q 1XC3A 4LF4K 1HK9A 3QYEA 1D3BB 4EJOA 1K78A 4CHUA 4UVBA 1TKZA 1P6RA 3IKTA 5FWCA 5KN8A 2EA4A 4J2AA 4DIQA 1VQPN 1BISA 1LFUP 1R58A 3OYNA 5DM7F 4FWRA 1IV8A 4HSBA 2B6AA 5CQXA 3EZWA 7AT1B 2K9LA 1XTAA 3REBB 3FJ5A 3O9TA 1XGMA 4ON0A 4R1HA 4BRFA 1WYXA 2QG9B 3RMCA 1U5TA 1RILA 3G6EA 1BHLA 4BHPA 3UT1A 4C1NK 4FLVA 2FBIA 3I55T 4GYGA 4XSZF 1NTCA 5ED4A 3SQ1A 3VS4A 1QHHD 1JUMA 4Q5SF 1M4ZA 3AVLA 1KVBA 1T3SA 3TR8A 3FBNB 1M90U 1QGPA 2YX4A 2FSNA 3AG4H 1ZR4A 3SUOA 2KBTA 1K73C 3TO9A 1O3QA 2K4YA 3BG6A 2P9PB 3D2FB 1WPYA 3J7AP 4MIMA 3H9QA 1RT1A 4D7NA 1QPIA 4FX4A 1Z77A 2EYYA 4B1VA 2YV0X 3WGHA 2M4KA 1V3FA 1V5FA 2XF7A 4CGDA 4M42A 3THXB 2YNFA 4A4HA 4HF2A 4AI5A 4XH5A 3H0IA 3HJFA 2YX6A 1KHCA 1QS4A 3K7AJ 4MZTA 5J2NA 4C8QG 3RKYA 1WRJA 2EQJA 3MHXA 1LVAA 2OTLT 1U8RA 3J7AF 1IKVA 1LWFA 2E1ZA 4AH9A 1O9SA 3LFUA 5FKLA 1W5SA 3JTHA 2G7UA 1ZBHA 2IGNA 5C42A 1NGEA 2M2EA 2J7IA 2IRFG 4WFBL 2ELHA 3KTUA 3AA2A 2VUMJ 5M9OA 2A07F 3O5ZA 2K9QA 1PVSA 1YITI 3RMDA 1S1NA 1KLMA 3ZMZA 2O2OA 3QBWA 1N3AA 2HEOA 3F70A 2NRXA 3CC4A 4I99C 4N0BA 3FXMA 4LLLA 3SUQA 5AQKA 3D4VA 4FM0A 2P7CB 1Q1HA 2A68F 3CERA 1YITQ 4CZCA 2XB0X 1SMYF 1NK3P 2LT1A 3VQAA 1VQMA 2BH1A 2P5OA 1IW7F 3WTSC 3KEQA 2E5LK 1ORPA 2VJ4A 1KFZA 1U2WA 1TH7A 3CUQB 4JLIA 4JLGA 3OW2P 2ASMA 2F1LA 5CE3A 1I3AA 4L5IA 1W4MA 3HK2A 3JCMg 2CMPA 1VIFA 1O7LA 4NLCA 4CERA 2DEUA 4J2BA 4FSXA 3VJPA 3IAS2 1W0UA 5JVGL 4OWRB 2HBLA 4XIDA 2FBKA 1RT2A 3TO6A 4KNYA 3NHNA 2KP6A 4C2TA 3LH0A 5IYDJ 3MEDA 2DYRH 1SS6A 3GZ6A 1XN7A 2X6OA 4YOXA 4NZGA 1RPWA 1IRGA 3G6EN 1TUGB 4BRNA 3OVNA 5BPMA 5IP7J 3DYAA 3EGUA 3BZ6A 3GMEA 2NOBA 4BEHB 1ENHA 3NCIA 3NFAA 4I98B 1HR0K 2QM1A 5GIOA 2EQRA 4ZYAA 2P5LC 3DI6A 4M9ZA 2W85A 1I6XA 2YUPA 3UKRA 4C9YA 4DQSA 4JX4A 4DEXA 4M75E 3EUKL 1P2FA 3O4NA 2DTRA 2QF7A 1IHVA 4UY8O 1USSA 1HDPA 3IC7A 2Q97A 2H94A 4UVAA 4GNIA 1LNWA 3NBPA 1BR2A 4RW9A 4M3RA 3I59A 2OD5A 5L3CA 3VYTB 1YWOA 3E66A 1PUEE 4CCLA 4TSXA 4DLGA 3FXQA 4ZC3A 3PUFA 4UVCA 2FA5A 5GMKe 3FR0A 2EW3A 3D1NI 4L0ZB 5DM7L 3GEZA 5H1SQ 4O6JA 3JRAA 2X3WD 4AIKA 2CFXA 1OFCX 2DPDA 1U6ZA 2ABKA 3V4GA 2PU9B 4QCLA 5DCFA 1FOWA 4U7BA 2BE7D 4FJ7A 4AM3A 3JRHA 3M59A 2O9LA 4BRIA 4QQ6A 1Y97A 3WQTA 2Y90A 3DWLA 2Z9OA 1OR7A 2Y2ZA 3CC4N 4JKGA 4IQJA 2VBXA 3D5SC 2E6ZA 1LEBA 5A0LA 4M77A 4OAYA 4P96A 4FXDA 2A37A 5KCMA 4B1UB 2M3AA 3FXRA 2ZXJA 3JRZA 1PU7A 2VWKA 3QPHA 3C6UA 3CFRA 1VQMN 1WA7A 3QG1A 4BKXA 5J3LA 1R4MB 1YCYA 4EHUA 2FOWA 4FL6A 1OH5A 3S1MJ 1VUBA 2GGRA 3VUZA 3WNFA 3JCMJ 4KI6A 3TAFA 5GANf 1YI2I 1LW2A 2DIGA 2AT1B 1QQNA 2DF6A 4BBSJ 2RD1A 2OZSA 2ROTA 1QVTA 4ILGB 3DXKB 3ALYA 3M9QA 1IV0A 2A36A 2DFIA 3OGDA 1JCGA 2Z1HA 2VOPA 2NYSA 2KZGA 3FRNA 1YI2Q 2YUQA 2X6NA 1D1AA 2DOAA 5FPNA 4LFBK 5I42A 3A1YA 1OU9A 3NTIA 1Y96B 1YRNB 3QEXA 1M1FA 1ASVA 4JJDA 2OJ2A 3JB9D 2AHQA 2Z99A 3I4MJ 5FO5A 2ADUA 3ER0A 5EG0A 3RSEA 2XF6A 3BPXA 4XK8E 3CVSA 3EYZA 3CQTA 3IAM2 2GM4A 3FZHA 4PGHA 1T2KA 1VZ0A 2M30A 3MZ8A 3JCMb 2GQQA 2IW5A 1SL0A 1R6RA 3QZ9B 3HGGA 2DMUA 3AARA 3DPTA 1MJ9A 3Q9SA 2HNIA 2X4XA 3RCOA 4B9QA 2XSJC 4IXCA 3FM5A 5BPIA 1M3HA 4IIOA 3SEQA 2IS3A 2PN6A 2LQNA 3BC8A 2ZPHB 2CUDA 4CGIA 2HF3A 3B6CA 1B34B 4F9OA 5JLXA 2QW9A 1K61A 3CCJI 1IBKK 4H4OA 4AHRA 4A3DJ 1K8AU 4FISA 3U3GA 4KHYA 4C5EA 4BVPA 4A69C 3F9MA 3H9JA 2RI5A 2X3XD 3FHGA 3EKSA 1VNDA 5JS2A 1ZBUA 3CCST 3GFLA 4P9UA 3P8DA 2ZMEA 4M7XA 1ZELA 2C0TA 2RN7A 2AJQA 4JQFA 1OU8A 4NXMK 3C6TA 2CSQA 1B9FA 3CCJQ 3UKGA 4A54A 4DJAA 2YSQA 3N97A 1W0HA 4C5GA 3NARA 3AG3H 4RB0A 4RMNA 2PI0A 1M90O 1W36C 4GBQA 1TQMA 1ZRCA 1YQMA 2HF4A 3M0PA 1U2VA 2FF4A 4FJXA 1UOCA 2CV1A 2FBTA 2EJGA 2RJFA 1YT3A 4M7DB 1VSFA 3M8RA 2Q1ZB 1K6YA 4BDYA 2RQRA 4PJNA 4QVCA 1JGSA 3C2BA 2J06A 3LWFA 2YHTA 4KMFA 2EGEA 3ERED 1U1TA 4KKOA 1FY7A 2DPUA 4LC9B 4I0BA 3D0PA 1NPRA 1ZLJA 4KPYA 4OMQA 3M57A 3CXCA 3U6FA 1IXCA 4J9EA 2MF2A 5I22A 2G9WA 3ML6A 4ME7A 1WJBA 1WJQA 2EA2A 2FU4A 3EE8A 4FJKA 3KNTA 2JWKA 2PY5A 3LYIA 3B6OA 5CYMA 2W4SA 4U0YA 2CO5A 4EGZA 3C7NA 3WTTC 4DU3A 3ITHA 1EQYA 2ZFWA 5GANh 4B47A 2PJRB 1T7PA 1KYZA 2XICA 3LSTA 4BY6C 2V8JA 1DQUA 5BRHA 1NG7A 4V2GA 5EGOA 2HKXA 4BXFA 3H3UA 4OIRF 5AYFA 2KRHA 3SJJA 5CO7A 1HX1A 1GBQA 2HVHA 2LZ6B 1RDAA 3MMYB 2PJPA 1P59A 4FM2A 3L2CA 1XTDA 3AL0C 1DP3A 1RBSA 2NRZA 1VQ5T 5CR4A 2COYA 1T03A 4NCAA 5HLGA 1KD1C 2F4IA 4TVRA 4XTUA 1U5TC 2H6CA 5CR2A 5FFZA 4J6WA 5CCAA 2BE9B 5M1QA 1B3QA 1Q9YA 1LPLA 2V6EA 4J83A 3CCVT 2FUG2 2R58A 2RE2A 2LBFA 1R9TJ 1OYWA 1AKHB 5GADJ 3SDBA 1AWCA 2NVYJ 3F72A 1QO0D 2QEXA 5GAMf 3E1SA 5CQYA 4B1XB 1KG1A 5GAN7 2NOGA 4G1QA 3V6DA 1Y07A 2M16A 5KRTA 2LJ3A 4OLAA 2HVQA 2DOFA 4Y28E 3VYGA 3JCMW 3SPYA 2O8EB 2L5QA 4JRQA 3CMAT 3LP0A 4XEIA 1FX7A 1VQNT 3RVCA 1LVKA 2P6TA 3VGLA 3DLBA 4H0OA 3JCMc 3FFIA 2XGEA 1IF1A 3AY9A 1VQ6I 1HNVA 1HXDA 2HNZA 1X2NA 4E7HA 3AVHA 2CW8A 2P0QA 5C12A 3AFHA 2ETJA 3BPVA 3J80Z 2HSEB 2KDOA 3VF4A 1JUPA 1BU1A 4CK3A 2M1HA 2Z5UA 5TJJA 2KIFA 2KT8A 3ULRB 4RW7A 3R6NA 5BN8A 1VQMQ 1JJ2P 3KWGA 1VSJA 2BGCA 3FMSA 1UELB 2DD4A 1HNZK 2H27A 2YLCA 1WSFA 3CCUI 4WX9A 2H1LA 2L9VA 5J40A 4XM3A 4HF0A 1OISA 2CZ7B 4IKFA 1JKOC 2RNJA 4HBLA 3HFNA 3BDDA 2P6SA 3O3HA 3EE9A 5GAEJ 2EYWA 1DIZA 2PQ8A 1O75A 4W5OA 2PTKA 1TQPA 2L7ZA 3ZOBA 3CCUQ 1Z0XA 3QOPA 4B3RK 1MKMA 3QXEB 2YJFA 3KP4A 1N8RC 5HP1A 3IRRA 4JK8A 1G4DA 4GLKA 3QP5A 4CZMA 1TKDA 1RTDA 4PSWA 1BIAA 3RRGA 4BVOA 4RWTA 4DQ8A 3OYGA 3S1RJ 1YE9A 4LITA 3K4CA 3IP4B 3K10A 4PDKA 1VQ9A 2MOXA 2O8KA 2PZ1A 4BD3A 2D0PA 4GKJK 4HSTA 5MLCQ 3ID6A 3TAPA 3BTJA 2XUBA 1A31A 1K9MR 2XDBA 2OYQA 3W2AA 1NYGA 2YUNA 2DBMA 2DKGA 2IBDA 3IWZA 4FVMA 1UCRA 1LUJB 1SL1A 1T95A 1M2VA 1X9SA 3MMVA 3JRDA 2EWSA 1ITYA 4KAZA 3DLHA 3U9GA 3A03A 2JA5J 3QP6A 4BY6B 3NGPA 3CMEA 1SFEA 5H6RA 1NM1A 4QQGA 2E2JJ 2V1NA 5DCMA 3E6DA 3BJ6A 3WODF 3GTMJ 4MLOA 4H5WA 4EM2A 4RS8A 1B72A 4V19S 3HKZA 4BRGA 3ASOH 1LW0A 3PNVA 1E17A 3AL0B 4JI1K 1T8IA 4N5SA 2PZSA 2O4XA 1W2BA 1T8EA 2KRSA 3K58A 2VT2A 4M74A 2DY4A 3ROUA 5D8KB 6AT1B 2KMTA 3QDRB 2CH5A 1X9WA 2FJ1A 1IO6A 1U5TB 1VQ7T 3ZXSA 3OW2A 1Q81C 1QPMA 2G8VA 3COAC 1I81A 1YJ9A 1BI1A 1WSHA 1N34K 4K11A 4OX9K 1MV0B 1GVJA 2G8FA 2K40A 3NGIA 1IKXA 4BQOA 5GAMh 1FNNA 4D6WA 4XU3A 1ZK8A 3U21A 3SAHA 1X3MA 1OR7C 2P8TA 1WHUA 4EHTA 2KIQA 1P4AA 5HDKA 5JMVA 1UGRB 5TRDA 1WI3A 3P38A 1RIOH 3HBLA 3M4YA 3EY1A 2EZIA 2E1CA 4WCEL 4CHNA 4YNQA 4HVJA 1FOYA 1SFXA 2D0BA 5ELZA 2DQRA 5IY5H 2NUTB 1H89C 1SPKA 3OYFA 4O4GA 1KO9A 3TEDA 4E47A 1LOTB 1U78A 1VQLT 3OYAA 3ZP5A 5FLXO 3FMRA 5LJ3g 2RA2A 4K42A 4O8UA 4DBHA 4U87A 1J0RA 1MMNA 1WHKA 3OSVA 4DB3A 1V4SA 4QAGA 4BYYA 1YJNA 1W7PB 4ELYC 3KK2A 2CH4A 4AFSC 2R7QA 4UUSA 1VQ9N 1C0MA 1ZHFA 5IYCJ 2EJ9A 2ZFUA 4G94A 3GTOJ 4RLFA 4LK0F 5T7BA 1YW8A 3CCQA 2E5ZA 4Z4CA 1HYSA 3LDOA 2W24A 3ATUA 2Y1IA 4BDPA 1QCNA 2CYZB 2VPRA 2O9SA 2M0OA 3P1GA 1LWVA 4CIEA 3SPZA 2LC4A 1I07A 2DTHA 4XTYA 2NYXA 4U0WA 3CMEN 4ZZDA 5B1AH 3ZPLA 5FU7C 1K9AA 3G4ST 1E3HA 2JUFA 2XY6A 4KH5A 4ZYEA 1SF9A 3ZETA 2OCCH 3G71T 3HKZN 3WU1B 3V7RA 3DEWA 1GUUA 3K6GA 3LDQA 1D09B 4F8RA 3BJAA 5FD5A 4B9SA 2BZ8A 1PSEA 1YUWA 4JHDB 5AQRA 5HNHA 4QQDA 5HDNA 2CG4A 4BG8A 2LD5A 2H6BA 2BTTA 2D6FA 2XV4S 1ASWA 5GIPA 3LGLA 1YJ9N 2L54A 2OJED 3WXLA 4CE9A 2YNHA 2FEIA 3HSFA 3PQJA 1GBRA 2DA4A 3OMYA 2PAVA 4MGRA 3VPRA 2HPMA 1BCOA 4OIQF 5LJ5f 2RKIA 2X85A 4I6MA 4CF0A 3WEEA 1MMSA 3CC2A 5KH6A 3EYYA 4FWQA 1ETQA 1WFXA 1Z9CA 3C2GA 2MWOA 3HGYA 5F0CA 4ZGJB 1RT4A 5KCOA 2OTLA 3OJUA 4X34A 1CKBA 2RHIA 3QJ6A 4HA8A 1N32K 1AHDP 1KZHA 3AO3A 4CW7B 5GMKi 4FOIA 5AONA 2BDPA 1RAEB 4OINF 2LF7A 1VSDA 4FZXC 2NRRA 2LK2A 3DLLL 1KU3A 2MAMA 2YHAA 2CGKA 4CJFA 2R7ZJ 4CJRA 2Q3SA 5J4YA 1XWLA 4KBMB 1NOZA 3F0CA 4HQMA 1BKBA 4CFAA 1MJAA 4E3SA 3SAFA 1R5GA 3DLGA 3ZMVA 4HNUA 3JB9I 4CJ3A 5LLQA 3PNYA 3VMFB 3QIOA 4GVMA 5D5UB 2KSSA 5J8FA 2JZ2A 3CLQA 3CCLT 1PM3A 2L9SA 9ANTA 2ZKZA 4HVUA 2OA4A 3F0ZA 3QBYA 2D0QB 3BR5A 3CQ8A 1OCPA 1J54A 3P4IA 1KFDA 1QVUA 4LFCK 2IAJA 2X48A 2G8HA 4CEZA 2KNBB 5GMKh 1YHQI 4R79A 4CCMA 4RCBA 2BZXA 3ZQ7A 3R6SA 1B9MA 1WNSA 4XR6A 2VKEA 3LSRA 2FRWA 2A3SA 2G8KA 3NAEA 2VWBA 1SG5A 3SDGA 2D8HA 2H3EB 3CQYA 3TSUA 3GNFB 3FK6A 1YXQA 3CWTA 3H3VK 1JCEA 1GT0C 1LFPA 3VYRB 2NRTA 3GYHX 5IN1A 1QHAA 3O3GA 3J80E 3C6HA 2VC1A 3CO6C 1U0JA 1KQSP 3FB9A 4JZ4A 3IWFA 4HCKA 1FP1D 1JTXA 2ZPBB 3WGIA 4A4FA 5E1ZB 4JJBA 4M77D 1NMNA 5I2SA 2GAUA 3RSEB 3TANA 1K9MO 1R49A 2B86A 1WQWA 4EEFG 1A04A 3M1EA 4FWOA 5FU7B 2EV6A 5IT9Z 5L3BA 3L3VA 3CC2N 2P5GA 2CW0F 2KW4A 3PX6A 3HVTA 4LIVA 3T3FA 3N4QA 3E19A 2F8SA 1Q86C 3E9LA 4L5GA 1FJLA 3GTLJ 2OTLN 2PLYA 1MJBA 2IGOA 3GUDA 1R0BG 2ZQBA 3TPQA 2SEMA 3OB9A 2LDMA 4C8QF 1DGWY 3RDVA 4A0XA 3LA7A 3FLCO 2P81A 4G7OF 2A7YA 3A2FA 4IOAF 4JKCA 5JFRA 1WH7A 4ILJA 5AQQA 3AG1H 1WAFA 3THKA 5AIQA 2VQCA 2EH3A 3U2RA 2DZ9A 2DFHA 2GOXB 2YHBA 5J3BA 3J8AA 4M3ZA 3GTKJ 1YQRA 4LG0B 4PGGA 3CJ9A 3CMMA 4GDFA 3AA5X 2JM8A 2HHQA 3AAPA 1DDNA 4F7UA 4G6QA 4CIGA 3J81E 1HSQA 1VQ9I 3BQZA 3T0YA 3VENA 1YOVB 3JXUA 3GIBA 2DYSH 4B9WA 1ORKA 3A0HC 1C0UA 1NMDA 1ZN2A 2ZXHA 2MC4A 1NPPA 1WXUA 3G0QA 1JJ2M 3LP3A 5FU6C 3O8VA 3ZSOA 3L2RA 4EMKA 1Y8QB 1VQ9Q 4FSVA 2LDUA 3CWSA 2IPQX 2XKOA 2EIJH 4CJ5A 4C8QE 2IIMA 3JB9J 2HOEA 3TTFA 1P7IA 3VF2A 4FJGA 4M3YA 1NK2P 3CMEI 1H1VA 3MDQA 4YPRA 3EYIA 4FVUA 2LJ0A 1NYFA 2VYPA 1KK7A 1ORNA 2F5DA 5AQYA 2RQTA 3UKUB 1IREB 4MQ9F 2NOIA 5GAGP 4Y52J 1YX3A 1UJYA 3WE2A 3CMEQ 4HTLA 1A5XA 4B8CA 1QP2A 2B8AA 3VERA 3D7EO 3M0RA 3ESWB 2KDZA 4M77G 1V4TA 1WQ2A 1PUFA 4CC3A 4XORA 4F04B 4LXCA 3VQ5A 3C18A 4JK7A 1TKXA 3RZOJ 3ZQLA 3KPHA 3VEYA 3UB5A 2XC7A 1VOMA 1AWXA 1SMTA 1D5YA 4DNCA 3P8BB 3F22A 4M6YA 5EGOB 1U48A 3KZYA 2O6GE 5JVTA 4J9BA 3OMGA 3BE3A 4KH4A 4UB8C 1EX4A 4WXHA 3ZQCA 3LW5E 3IHUA 2FO0A 4LUEA 1XQPA 3CFPA 3H36A 4XLPF 1PP7U 2KQ2A 2HXIA 1VQ4I 2MC3A 1X1BA 2P9LA 3RIRA 1KQ8A 1IGNA 1ACMB 3H45C 4I0AA 4M9SA 4AIAA 5ICCA 3E9FA 3CCSA 3SHFA 1K4TA 3R6OA 3OS5A 2JK3A 3QJYA 1NK7A 1RBVA 1VQ4Q 1C0WA 1RBUA 2X78A 1YLFA 2KZVA 1AA7A 3SD4A 1MU2A 2GWKA 3D45A 5SWMA 5CHIA 1BO5O 1I1JA 3CCRA 3WTUC 3ATVA 2LSNA 4D0PA 1HKBA 1HA8A 2KLAA 1F5TA 1K0SA 4GYIA 5KAFC 2FYKA 1D8JA 1YN8A 2P9SA 2R7OA 4ATOA 4RDUA 2A6EF 3I53A 1TUYA 4A5BA 3J7YJ 3RZDJ 2CUFA 2DQLA 3MXMA 3TSZA 2EFIA 3HTUA 1W7AA 1BI0A 4ZDLA 1ZG5A 3DLLA 5GJWB 2L9RA 3X24B 4G9YA 1L3UA 4IQ4A 1D0ZA 1UB9A 4OLBA 4BQNA 3UA6A 2D4WA 2COZA 2DLPA 4HQEA 3A8GB 1PDNC 5LJ5e 2PBIA 3K69A 1BI4B 1QTMA 1W0TA 3OR2C 4IOAL 1M30A 1SFUA 3FZVA 1TXQA 1QQJA 4B22A 1Z3YA 1VSHA 3DBRB 3UPUA 2Y48A 2FXUA 4B3OA 1I5LA 3T9NA 1W1FA 2HQHA 1UA0A 3I55I 2P9IB 4NC6A 3RKXA 1K1ZA 4FW1A 2LQKA 3H5RA 3P9IA 1ZREA 3VQ9A 4Q48A 3K4BA 3ECOA 2K3BA 3NF6A 4G6TB 2Y4YA 2P5VA 2EVRA 1MMDA 1IN6A 3OMCA 3A4CA 3J7ZO 4BR2A 3I55Q 4JKDA 3BTCA 3RR7A 3KZIC 1UHFA 1TK8A 2R7SA 4HNTA 3W3CA 4B09A 1V54H 2RF0A 3FC3A 2EV0A 3GBQA 2HW3A 2FPFA 2O03A 3LSHA 4YFNF 3MEEA 3LGFA 3RTVA 2JUGA 3KEOA 2DVJA 2JUCA 4B44A 4CJQA 2LJ1A 4XU0A 1N25A 1UHSA 3J81K 1M1KC 2Q36A 1VQ8I 4ISGA 2G7HA 3JRFA 2FB7A 1Y7XA 2OUMA 2LH9A 2QA4A 3JTGA 1TT0A 2Z1GA 4EJTA 1Z21A 1JHHA 2R7DA 1D9DA 1PJRA 2R7VA 2VLAA 1YIOA 3CCSN 3BTLA 2E2HJ 1MNEA 2ISZA 2CT4A 4HV6A 2RC4A 1JKQC 4RAFA 3EGDA 2E8AA 3BUZB 2YG8A 3CMAA 3MP1A 3KCCA 1T6CA 3CCRN 2M9UA 4FCYA 4F17A 3LX7A 3V9UA 1JU5C 3TO7A 1NG6A 3REOA 1QSYA 2O8FB 2D5RA 1WEIA 3QEWA 1BIZA 1NM7A 1XI1A 4GRIA 1K83J 1VSEA 4XL9A 2LLKA 4IOXA 1ARKA 5AQWA 3RTRA 1Q8IA 1DGKN 2NOZA 2DCEA 2VI6A 1YO5C 4OMOA 1WHGA 2IVNA 1KG2A 5KAIC 2EIFA 2RI2A 5TISC 2C06A 3LP2A 1A5WA 2NXNB 3H08A 1Z6TA 4I2OA 5A2QZ 2HVIA 1K73O 4BQQA 5E79C 1RGIA 1XMQK 4IIMA 2YRVA 5DLQE 3KZBA 5SZTA 4M71A 1AWJA 4M41A 3HRUA 3OH9A 3INZA 4RTXA 3CWAA 4J01A 3HO1A 4XQ3A 3JAME 2F2WA 3LL7A 3EG9A 4HCCA 5AIPA 4KIFA 2C6YA 1OH7A 5F0XA 1M1EB 1SFKA 2LKPA 4AG1C 2E70A 3VQPA 5LMNK 8AT1B 4W5RA 1AWOA 3QSUA 2P9NA 1XMOK 5CYQA 4CZZA 5M5XJ 1QVGP 4O44A 5EZGA 1U06A 3ONQA 1OYYA 3V8LA 3WXMB 1L3LA 3DRSA 3V81A 1B4AA 4KB1A 1Q7YU 4OGEA 3TABA 1YJWA 1FIPA 3VS7A 3V1QA 4FW2A 4DQIA 2W7NA 5E1WA 2EGCA 1BBYA 3GCMA 1RKTA 2L9NA 3QYFA 1JXEA 3AO4A 5FLVA 4L9VA 1UHMA 2AIRB 2E65A 5IT9E 3QDFA 4IO8A 2NVTJ 4WQ4C 5BPDA 3R61A 1V1CA 3M55A 4E9GA 1XGSA 1SV5A 1FBSA 2W6LA 2AQEA 2BY1A 3RJPA 2FC0A 3H46O 3EUHC 1R8OB 3HYFA 2PX9A 2ID3A 2QLZA 5AFUH 1IRFA 4CJ7A 4FQGA 4RW8A 1RI7A 1HKTA 1ZLKA 5KE3A 2UU9K 4DZJA 3I4PA 1XMKA 3CJTB 1H641 2PVOB 3EQLF 5B3SH 5C44J 1V76A 3CMAN 1MUYA 3ZMDA 3GWZA 1VQNN 1KD1U 1KIKA 5B5EC 2KRMA 4I9LA 1FOKA 3LAMA 5GAHP 2F8TA 2YU3A 4BU2A 4ELVA 2DA5A 2FG0A 4YY3K 1GLJO 5GINA 2NOHA 4KHWA 2FSJA 2B0LA 2RV8A 1VQ7A 1KQSM 4HYEA 5CQGA 5FLMJ 4KRTA 4JS5A 1X3NA 1A6IA 2JGUA 2KT0A 4IDKA 2V8KA 4DR6K 4WCIA 4ZDOA 1VQKI 1FOXA 1YVNA 2MCNA 2UXDK 1BOBA 4WTOB 3HOSA 3OBYA 1N78A 2AKLA 3NTKA 5HRNA 1K6OA 5AZIA 3I5RA 4C92C 3AVBA 1Y1VJ 1M3AA 1PD1A 3C0CA 1VQKQ 2CSOA 3RMQA 3K4NA 2A5WA 1F4KA 1LMZA 4PJOC 2BZYA 2R5YB 3I8DA 3MCAB 4A5MA 2XSDC 4CHPA 1X75C 4Z0UA 4FWMA 4IEEA 5ILVA 2JZYA 5LJ3j 3FM3A 4Y3OA 2DMNA 4DYCA 2H8RA 3SEZA 1SHGA 2BY3A 3JCMd 1LEAA 5HBMA 1MUZA 3MZYA 2LQWA 2H8WA 2M5WA 2CT3A 5HROA 2BW3A 1TZLA 3MZHA 1YJWN 2E7WA 4B43A 4MLHA 4EMKC 1L3VA 1ABOA 2HWVA 1ZRFA 3ZEUB 3PVQA 4CYCB 1FYNA 5J2MA 1SC7A 3CD6T 3EZ5A 1XHXA 1AD5A 2ETHA 3IRXA 5TKYA 3M4GA 3FBIB 2V9VA 4DU1A 4PL8A 1UAXA 4M75A 3M0UA 4L8RB 3E1YA 4DV5K 3GFMA 3ISPA 2BIVA 1CLQA 1ZGJA 3HL2A 1Q82R 3U3YA 4BRKA 2CQKA 1Z91A 1P9QC 1YF5L 3MWMA 3G4SA 2EIKH 1VYVA 4B48A 3CJQB 3K1MA 2LNHB 2EFQA 4EM1A 2VWFA 4OJRA 3W0LA 2DMTA 2HZDA 1T39A 3IMXA 4L9TA 3HKSA 1R4NB 4CHQA 3GXOA 1R0AA 3CCSQ 3U4LA 2GF7A 3DF8A 3I71A 4O0JA 5BPNA 3ULDA 3LANA 3JAMK 3A8OB 4JBAA 3HFOA 3DLRA 5CVRA 4FLYA 2FPDA 2M7AA 4BC4A 4C3HJ 1RTHA 1VQ7N 3VQCA 4EMHA 2K5FA 5GAOp 5M5YJ 1IG7A 3G1OA 2MI6A 4JOMA 1VRLA 3CZ6A 1D8KA 2HFHA 3VQDA 4R8HA 1U6GA 2K3FA 4M7AC 4CZIA 2VB6A 4CECA 2E71A 3LH5A 4DQQA 5GAN2 2XB5A 5I21A 3M8JA 2O8DB 4WF2A 3A8YA 1JJ2S 5IPAA 1R5HA 2Z1IA 1XB4A 4ZH4F 5F1RA 1XG7A 2KK4A 3PMIA 1B92A 3KK7A 1NG2A 2SRCA 5IT9K 1UMQA 4JRKA 4GW6A 4BRCA 3HRMA 2K3PA 3F10A 1BL3A 4DV6K 3IG1A 1NEGA 5E3LA 1M2OA 1VQ6T 4N56A 1IDYA 4KREA 4EIAA 4LDVA 2X6XA 2GXBA 2AXLA 4FLZA 5J1RA 1FSHA 2HQRA 2ED1A 4EQQA 4AC0A 5GAOm 2HBMA 3OJSA 1PCXA 5DYMA 4DTMA 1TWCJ 5D6FA 2WC2A 2R3SA 4YIRX 3NEUA 3LQRA 4II3A 2FBVA 1I50J 4OOIA 3PFIA 2GX9A 2QKBA 3JB9H 5M1PA 4C92B 1R0CB 3CCUT 1VQ5I 5GADP 3KP3A 5KCHA 3K5LA 1HCRA 1BI3A 4PJOB 3ASKA 3PL8A 4HF1A 3VS5A 4F7UB 2P9PA 3D2FA 5KYYB 5AQGA 3CCVI 3LAJA 4FE7A 1VQ5Q 1LNXA 2MSYA 3VS0A 1O3RA 4IO9F 3G73A 5LJVA 1BI2A 5F64A 3G4SN 4ORZA 1NOYA 2DI3A 3BROA 3THXA 3BQYA 2X0LA 4R0KA 1Z9QA 3CCVQ 1VRTA 3VV0A 3GOIA 4KHSA 1PRLC 4PQUA 1VQNI 3NF7A 1KU7A 5K7HA 3AVGA 4MDAA 3DJCA 3KLHA 4AUXA 1EWQA 4XU1A 2QENA 2GLOA 2AXTC 2YRCA 3QPLA 2M9HA 1QHTA 2ROLA 2X4HA 4UOBA 2DJQA 1N6QA 2IP2A 1VQNQ 4DBRA 2M51A 3ZT0A 2A69F 1KC8U 3S1NJ 3WUHA 4KH6A 2MW8A 2UUBK 4K2EA 3NWTA 3VA3A 4Q0BA 2Q2EB 2XG8D 5GAEP 3OR1C 4E7SA 1DU0A 5D6WA 1OYXA 4R56A 3H0DA 5A2QE 4HT9A 4NC7A 4ENKA 5KYUA 4HCBA 4K8XA 1GV2A 1GLLO 1WHMA 3VWBA 3META 3CUQA 1H88C 1TLHB 4B8XA 2IVMA 2OAWA 4A62A 4PNOA 2R0QC 3PNWC 3IUOA 1XCBA 4EIKA 5LRRA 3TQNA 2XU8A 4I76A 4J6XA 1RLQC 3ZSQA 4CBUA 1Y71A 1JJ8C 4OMZA 5D4RA 4M7AB 1EJ9A 4OKKA 4PJJA 2NNYA 4IWVA 4ZYDA 1NU0A 1CXQA 4LFUA 5GPAA 1KVAA 2NUBA 4R55A 3CWUA 4CJKA 4M78C 4XNFA 5EEHA 2L2PA 4BEHA 3DU5A 1IN5A 3S2HJ 3VEPA 2M0CA 1N9SA 3H3NO 2ZGWA 1RADB 2OPQA 4PY5A 1MBGA 4CEBA 1YFHA 4ZZLA 1JO8A 3H3OB 4FYVB 1SVOA 3LDSA 3WNHA 5KGXA 4DTXA 1JRIA 2DL5A 4H0VB 4C8KA 4NQWB 3TL4X 2NRVA 1S72A 3LLRA 2IA0A 3GVAA 2JTFA 1OEBA 4JI5K 2YHYA 2JS2A 2QWQA 4UV9A 4F3QA 4HLYA 2HHHK 1Y39A 3ME9A 1RDUA 2XDPA 2ZO4A 1U84A 2HDAA 3ABMH 1S7EA 3OS1A 1Q18A 1RLPC 1HSTA 1ZUYA 1DUXC 3IS9A 2QQRA 1NJWA 3DKWA 1ACIA 1QVGM 1J5EK 3J81O 2IGKA 4BY9C 1JLCA 3A8HB 3AAQA 4Z8AA 5D6EA 1PWTA 2OANA 1ZG3A 3ZGKA 3GDQA 4BQLA 1TAUA 1LCKA 4B6MA 2P7VB 5GAN3 5FFXA 2WAQN 1V29B 2VQLA 3DMJA 1EBMA 3LDPA 3TAEA 3SZGA 2VG5A 1POGA 4MFDA 4RGSA 4S05A 1N8RO 2YG9A 1MBHA 2W82A 4CF2A 5JI6A 3DB3A 1E7OA 1HDDC 1Q82O 3W2VA 2ZE2A 4ISEA 2Z1DA 1F21A 3GBGA 4IO9L 2W57A 1TW2A 2D9TA 4N4HA 2LY9A 1AZGB 1NGGA 1JT0A 1JTYA 3DLAA 4BHCA 1QCOA 1LWYA 1RAAB 1REVA 4MZMA 2JXBA 5JS1A 5DMRA 5LHHA 2MK5A 1RZ4A 1C1CA 5AQOA 1VQLI 1R23A 3ABTA 1MHNA 2LP5A 1S7OA 1ETWA 1RR8C 5E3OA 4BQAA 3V9SA 2KQRA 2VJ5A 1Y96A 2Y0MA 1YRNA 1WJCA 4H0EA 2VKDA 4RW4A 3S41A 3PO4A 1KLNA 2WSCE 3TGNA 4YEJA 3U23A 1Q86R 1U8BA 2WBNA 4FZZA 3RPUA 1YAGA 3AHUA 1X4PA 1VQLQ 2COBA 2K3XA 3TSQA 2OZUA 5AQHA 2OV7A 1Y0MA 2LREA 1ETVA 4M7YA 1X4OA 2DJIA 4NOYA 2FRYA 1H8AC 1Y64A 3CG7A 1P8ZA 3WTVC 4DV1K 2E3HA 4F93B 1J2XA 2XO7A 4J19A 2KI7A 1Z05A 2R57A 1KAZA 3VEXA 4JK9A 1K9MC 3MKWB 5BREA 5GPCA 1O3SA 4MDXA 1LWEA 1YIJT 4EM0B 2WV0A 1YITA 4B9XA 2OI3A 1S72N 1JKRC 1OYIA 1Q81O 1GCPA 3V9XA 4RTVA 3WNGA 2ZXWH 4IG0A 1T33A 1FYLA 3CDIA 2WY7Q 1KQ9A 4VUBA 1NH3A 3WXJA 3O1WA 5A2QK 2JW4A 5EG2A 1TL3A 3G71I 4FYDA 1B34A 3T1YK 4RGXA 1IZ1A 3CCEI 3L2ZA 4M78B 2NRHA 4I7FA 5CHZA 2O5RA 2G8WA 2JWTA 2M34A 3V1OA 1TU0B 3P83D 3V7CA 3ZN0A 3VRZA 4N4IA 3OIQA 2P4TA 3HZJA 2FE3A 2W41A 3AA3A 5ILUA 4ISFA 3CDLA 3G71Q 4MDBA 2DT7B 2ENMA 2L7FP 2MYSA 3IH3A 5TGTA 4RTYA 3CCEQ 1AEYA 4M77F 1EP4A 5LJ5g 4M75C 5CVVA 2PQWA 3VFZA 5M3MJ 4BE1A 1KQSS 1RBRA 4N41A 4DKWA 1CSKA 3VETA 4O3MA 1YHQT 1NK8A 4F16A 3QU6A 4DQPA 3CP8A 1MGQA 2JTEA 1B7TA 2FQ4A 3G1JA 2HDCA 4EZ9A 4W1UA 4M7DA 3IHOA 3VS2A 3F8MA 1RRSA 2GV9A 1OMIA 3VODA 3K59A 2WY8Q 1LOJA 4R5PA 1EH7A 3HT3A 3KP6A 1FKOA 2WAFA 2RHKA 3VQEA 4M72A 4DSEA 1GFCA 2EZHA 4Z4HA 2PNIA 5HS7A 1O3TA 1JGGA 3UWNA 4B3SK 1KCFA 5D6YA 4FK2A 1STZA 2HHVA 3C0BA 4A63B 4HVVA 3DWLE 4CBWA 1VYTA 5C15A 1X1DA 3VSKA 4E0DA 2Y9ZA 2HGCA 4M77E 3KX2A 1S9HA 2F4OB 3O9RA 2EHGA 3E01A 1X1CA 2CQ7A 4IUQA 1FP2A 2PJRA 3BFMA 2KDSA 5L3EA 4S04A 2OCEA 3I56I 2FZCB 1TWFJ 2YKMA 4EJYA 3H41A 4CEAA 2KYMA 4LF7K 3A0BC 3QPSA 3CCLI 4BJ6C 2J6OA 2L3RA 2O31A 2QWNA 5HOOA 2RF2A 4M3TA 3T8TA 3DXMB 1N5ZA 1HSJA 4J9FA 2V1UA 5ECAA 3CPWM 2AZVA 2JN0A 3OYIA 5DLOA 1GV5A 5LJ3d 1FYKA 2Q0RA 4GFBA 4FJ9A 4QS7A 3FZKA 2JTMA 3CCLQ 1X6BA 3FHNA 3SUNA 4FX0A 5DV5A 2L4MA 4UNOA 2Z33A 3C12A 1QBJA 1REPC 3CJCA 1LDDA 5E41A 3JRIA 2DJNA 4C0FA 2R7XA 1R36A 3RMSA 2EQIA 5DY9A 4CSWA 3BJOA 3M58A 1LFBA 2UV1A 3W3DA 1YI2A 4JPBW 2OTJT 4DF8A 4MMLA 4OP0A 4DUZK 4X9CA 2MG4A 2LP0A 2IA1A 5D5WB 4A2BA 3FKJA 3JCMf 3AGKA 3G2BA 4IRGA 3VB2A 1JXMA 4C0DC 3GF2A 2DILA 1AOJA 3VQ8A 2RPIA 5DEQA 2Q31A 4JKBA 3PQKA 4JI4K 3W6VA 3OHRA 2YR2A 1Z1DA 4OMNA 5EC7A 3CXCP 4J5YA 3HOVJ 5LL6Z 4DSIA 1K79A 1JBMA 3VYUB 2EBPA 3R2XC 2R7UA 4B3AA 2UXCK 1JL1A 1EA3A 5GP9A 3BEXA 1VYUA 1QE1A 1S29A 3QFUA 2HQEA 3LWIA 3K4MA 1ULYA 2XI9A 3OA6A 1HRHA 3JAMO 1TWBA 3F6OA 1HNWK 3VTHA 3K70C 4BRAA 1WH5A 2ATQA 1J53A 5KYWB 2NOEA 2I10A 2EBIA 4O0IA 3BW1A 3CJNA 2VUBA 2FEZA 1YFNA 2F5CA 4CEOA 3V7SA 4E7ZA 2XDVA 4NS5A 4A4KA 4PA1A 4FK0A 2F7TA 3P39A 5HL7L 2DTOA 4DFKA 3LP1A 4LUDA 4C8NA 4V19K 1L3SA 1FJGK 4CCJA 3AVFA 1BJAA 2RN2A 2Y1JA 1TWGJ 1WB9A 2XAHA 1RAFB 5HRPA 2X9DA 5BOXA 1RRQA 4CD3A 1FN7A 4AVZA 3QOEA 2LF8A 3SJMA 1B9DA 4B08A 2MD5A 4BBRJ 2QQBA 4CI0C 1VSKA 2V1RA 1VQ4T 3CCJA 1K8KB 2C0OA 4C8QD 2KYBA 4B1WB 4MNUA 1WOQA 4LNPA 3TP0A 3BR6A 1W5CC 1Z7LA 3HBTA 3M7GA 4D9JA 1J7KA 2PVDB 3GF5A 1ZSGA 4ASNA 1JXSA 2LCSA 1KG4A 4RG2A 3KE2A 2BTFA 1VQOI 1SVMA 1AVZC 3BR1A 1HYOA 2V4JC 2GFAA 4OVAA 2J5OA 4FWLA 3R0AA 2E20A 1LJOA 2JM9A 5IOYA 3QIPA 4XK4A 1BW6A 5I11A 1WJFA 4JRIA 1S1VA 4BGDA 3GTJJ 3KLGA 1YI2N 4DA4A 1VQOQ 4DYRA 4OPKA 3BCAA 1C0TA 4L5EA 4IOCF 1Q86O 1XC9A 1WXBA 3FZFA 1YCSB 3O08A 4BR9A 4ZGDB 4RB1A 3C1DA 2QKLB 1LPQA 3DTKA 4UUTA 2WV1A 3CVTA 2BVMA 3FX3A 4CZEA 4CJWA 2E1YA 5AQPA 1WJ5A 3K57A 1GOAA 3HC7A 1OVQA 1S1XA 1OQKA 4LDXA 2E6MA 1WJAA 2KFZA 3M07A 3DPUA 3AO5A 4QPOA 3BTIA 3VYHB 4XLHA 5GAOq 1S3XA 1JLBA 2LMJA 2CGHA 3O3KA 2NLXA 1TUU