3OYAA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and raltegravir at 2.65 resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyaA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyaA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyaA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyaA03
3ALYA 4DQSA 1RDBA 1FKPA 4KKOA 3KD1E 1RTDA 2D9TA 4CK1A 5CYQA 3JYTA 4CECA 2HHTA 4RW9A 3AVMA 1ZBFA 3OMGA 3U6FA 4PQUA 1NOYA 3KLGA 3MEUA 3VQ5A 1HMVA 4AHUA 2EHGA 1JL2A 3OS0A 1DTQA 1RBVA 3S3MA 2PZSA 3T1AA 3DLKA 3SQ1A 1Z26A 1EETA 4FJXA 4Q0BA 4O0IA 4DSKA 4CIEA 4FJ5A 2E5QA 1WSJA 4UQGA 3T19A 1HYZA 4CF9A 2DFFA 3M8PA 4K8ZA 1JLAA 4QAGA 3KTQA 3HP9A 3ZT1A 2F96A 3TI0A 4W5QA 3O3HA 4RW6A 4PLIA 4FK2A 1G15A 1XC9A 3QINA 2Z1HA 1DTTA 4FLUA 1KHCA 4M3YA 4N56A 4CJPA 3V4IA 3LALA 1LWFA 1R0AA 3RMDA 4DLGA 4UC4A 4DSJA 1SKSA 1JKHA 1CXQA 4CJKA 3MO8A 4AHCA 1VSMA 3CEYA 5T7BA 2RPIA 4W5OA 1TKDA 3RMCA 3KIOA 3OYDA 3PMTA 1KFDA 2QXFA 4GVMA 4HCCA 1ZBIA 1TKXA 3MP6A 2VG7A 3HVTA 3KLEA 1JLBA 2ZD1A 4EP5A 4E19A 5FDLA 3QESA 2VYTA 1KVBA 1L3SA 4I9QA 4LH4A 4CJEA 1VSLA 4R5PA 3P5JA 4QQGA 1TAQA 4A4FA 1EKEA 4FLZA 4B9XA 1D9DA 4NYNA 4C8LA 1HNVA 2DIQA 3NAEA 2QKBA 4IUTA 3NH1A 4B9NA 1X9MA 2P5GA 4FJMA 4FLTA 2HW3A 2R5MA 3LGFA 3NHGA 5J2QA 4OVAA 3U3YA 3WNHA 3SPZA 4N4HA 3OYNA 3QEIA 1RT4A 1C0MA 4CJSA 3KK2A 4N76A 4LY7A 3TAGA 2FBYA 4CGGA 4LD6A 3NTIA 3LWMA 4Q5WA 3OMCA 5KE3A 3SZ2A 4JLHA 4DU4A 3SQ0A 4NCAA 2EX3A 3T3FA 4KI6A 4KHWA 3SNNA 2MWPA 1UA0A 3ISNC 2X35A 4B9LA 2GF7A 2XY7A 1SV5A 1WJRA 4CEOA 2B4JA 2OPRA 4II1A 2IOCA 3VQQA 1TGOA 4JRPA 4KHSA 3VQ7A 3TR8A 5HRSA 3AVBA 4FVMA 4ZHRA 4JS5A 3QIPA 4DU1A 3K5OA 3AA2A 3MAQA 3CQ8A 1N5YA 2D5RA 4BD3A 3NCIA 4ELVA 2VWKA 1B9DA 4M3WA 4ICLA 2MWOA 3PV8A 4DWIA 1S1XA 4FLWA 2B8AA 3LANA 2KFNA 4J2AA 3OY9A 1VSKA 1SUQA 3OYBA 4HTUA 3HYFA 4G1QA 4AHSA 4OKKA 4KB1A 1X1PA 2GFUA 1HQEA 2A1RA 4GW6A 3UWNA 4KREA 3ZSVA 2E6MA 4FM0A 3OYLA 4CJVA 1EX4A 3NBPA 1OZ2A 4DFJA 5HP1A 3OS1A 1ITGA 3LP0A 1IO2A 2X6SA 4O0JA 1QSSA 4KV8A 1ZBLA 4CEZA 3OA6A 1RTIA 5CZ1A 3PX4A 4ELTA 4E1NA 4OLBA 2FHDA 4PLLA 3D0PA 3ULDA 2F5KA 3SUPA 3L2WA 3KLIA 1X9WA 3DLBA 3HSTB 4IUUA 2W42A 3SJJA 3QNNA 5D6YA 2BE2A 1XHXA 3NGYA 3K5MA 4QQDA 2R7YA 5J39A 3KLHA 1RTHA 4KTQA 2IC3A 1BQNA 3CFOA 3NF9A 2FBTA 4B9UA 4FM2A 3EY1A 3SCXA 4B9MA 1UWBA 1S1VA 4RG2A 2DFHA 4CJUA 3PX6A 5C25A 3NDKA 5J1EA 2XHBA 2GV9A 4XIUA 1H3ZA 2ITGA 2VG6A 3QEWA 4L8RB 4N5SA 4KTZA 1T8EA 4RG8A 1WJQA 3CFRA 3HP6A 4CFDA 3DLMA 1VSFA 3V9UA 2X4YA 3PO4A 1XHZA 1XNIA 4FZYA 1O1WA 4IFVA 3SD4A 3LWLA 5FRMA 1UA1A 2X74A 1RDCA 2K3YA 2E4LA 1NOZA 4I2PA 4CRIA 5C0MA 3HL8A 3META 1I3AA 3QLHA 2G8IA 1BISA 3ZSWA 5D6XA 1WLJA 1J53A 3ZSYA 2QKKA 3E01A 3ZEHA 1RCHA 1JL1A 2DTUA 4KRFA 1NKBA 1HYVA 3MP8A 5C42A 2RI5A 1WNSA 2BGGA 3KUFA 4FJNA 3Q1JA 1VSIA 1I39A 1NK0A 3E9FA 2O4XB 5IN1A 4FJLA 4K8XA 4B8AB 1SL2A 2M1HA 1YT3A 2EFIA 1RTJA 2HB5A 4NYFA 1K6YA 1Z25A 4HUEA 3C4SA 1FKOA 2Y1JA 1BI4B 3D45A 1TK0A 2KZMA 3KJVA 4HCBA 4M3ZA 4E3SA 3TARA 4Y1CA 3HK2A 3P8DA 1U49A 3M8QA 3V81A 4X34A 2P0KA 1S1WA 1NJXA 1KRPA 4PA1A 4CF0A 1NKCA 3OYCA 3OVNA 1VSJA 3SUQA 3CG7A 4BE1A 3V9SA 4KI4A 4E0DA 3AO5A 4CF1A 4O55A 3HVRA 4NCBA 3O3GA 2GBZA 2O4GA 3MEGA 5D6WA 1C0TA 1B9FA 1RT7A 2OZSA 4CHZA 3QKJA 3WNFA 1SL0A 3S6WA 2WONA 5DMRA 3AA5X 3I8DA 5KE2A 1C1CA 2YV0X 1NK6A 5C24A 3NE6A 3U3GA 2OPQA 4J2BA 3AO4A 3QEPA 3RMBA 4M3RA 1T7PA 4CJ4A 4IG0A 4J2DA 4H4OA 2RHYA 3WNGA 2KQ2A 4BACA 2GFAA 3SQ2A 2HVHA 4OKJA 1TV6A 4C5EA 1KVAA 3K57A 4Z02A 1YTUA 4CJQA 1VSEA 3TAQA 4M42A 3H8ZA 2RJEA 4BDZA 3V9WA 4OJRA 2WOMA 1JXBA 4OGEA 5CZ2A 1MU2A 2G8KA 1HJRA 1Y97A 3WNEA 1QTMA 1KLMA 1G5VA 4IG3A 3K58A 2LTOA 4PL6A 2Z1GA 4AHTA 3MEEA 2QQRA 2HNDA 4KHYA 3EAEA 2YHBA 2ETJA 1D5AA 2PYLA 3DOKA 3SUOA 4C5HA 4IUQA 1X9SA 3BDPA 4CCHA 3ZT4A 3OS2A 2I5JA 1WSEA 3ZSXA 4FJ7A 4M3UA 2A1SA 4M45A 4FM1A 1IKYA 1JLCA 1JXEA 4CHNA 4OPJA 3QBYA 5C6SA 1D8YA 3L2VA 1LAWA 1IKWA 3P83D 3LGLA 3OJUA 4DQQA 3OYJA 3PO5A 4RW7A 1TKZA 2LRQA 4N47A 4FJJA 3ME9A 4A4EA 4HVJA 2YKMA 1NJWA 4FJHA 3ZSRA 4CHQA 1BHLA 3AVIA 4B8CA 4Z4EA 1BIUA 3UIQA 3AVFA 4OVLA 3S9HA 4DFKA 4DF4A 1NK4A 1C6VA 4KTWA 2OZMA 2O4IA 4CF8A 4C8OA 1A5WA 1EP4A 4WE1A 4BDYA 3NF6A 4PY5A 4KFBA 3VA0A 2F8TA 4NZGA 1VSDA 3NTKA 4DSLA 4M41A 1ASVA 5KRTA 1HQUA 1GOBA 4O5BA 4ELUA 3VA3A 4CJRA 3TAMA 4F2RA 4HCZA 3P8HA 3AVJA 4QVZA 3GOXA 3NF7A 4Z4CA 3SPYA 3QEXA 1LWCA 4FCYA 3DB3A 1KVCA 3QIOA 4CEQA 3V1OA 3HT3A 3K5NA 4C5GA 4CJTA 1WSHA 3L2UA 1N27A 3V6DA 1ZYQA 4A4GA 2M0OA 1REVA 4DG1A 4Z4HA 3NGZA 1TKTA 2BANA 5DK5A 2DY4A 2D0CA 4B3OA 4FJKA 4F2SA 2RI2A 2HNYA 1ASWA 2X78A 4Y1DA 2ATQA 2R58A 5KCOA 1NJYA 2XY5A 4FLXA 4F8RA 5HRNA 3TAFA 2YNGA 4QOZB 3VQ9A 2HHQA 3JSMA 4PUOA 3LYIA 3P1GA 5HROA 3AVAA 4DS5A 2P51A 1HRHA 4HHTA 3O4NA 1A5XA 1C1AA 2FC0A 4YNQA 4N4IA 4OGCA 2WACA 4QQ6A 4BE0A 1CLQA 2DAQA 1WSFA 3TAPA 3M9QA 1QQCA 4O44A 4BWJA 3OYEA 4BWMA 3FEOA 5JS2A 2YNFA 5IAYA 3LAKA 2L89A 1L3TA 2KFZA 4EZ9A 2AJQA 1D9FA 5KTQA 1N6QA 3CM6A 2OYQA 1NKEA 4DS4A 4CE9A 1S6PA 3OYMA 4CK3A 3LP3A 1L3VA 4E7HA 1VK0A 2HVIA 2O4XA 1BGXT 3AO3A 2HHVA 3QO9A 3V9XA 4CHYA 2B6AA 1NK8A 5CYMA 5M9OA 3HXMA 2ZQBA 4J2EA 4CGDA 4RW8A 4DLEA 4IKFA 3NGIA 3O3FA 2DFEA 3VQBA 4F4KA 5SZTA 4DQPA 2EQJA 4EDUA 4CGIA 5HBMA 5HRPA 2RI3A 4JRQA 3MXJA 1RBRA 4FYDA 4E1MA 2EQMA 3H6ZA 3F73A 5FRNA 3AVLA 4DMNA 4CERA 3HO1A 2G8UA 4DTRA 2Z1IA 4MQ3A 1S5JA 1JLEA 2RJCA 1UAXA 3ZT2A 5D3GA 4H4MA 4AHVA 3OB9A 3DB4A 1JLQA 4GMJB 2FBVA 3MECA 1U04A 4NCGA 1JLFA 3KK1A 3FDRA 1LW0A 3RRGA 4EZ6A 1IG9A 4YFUA 3K5LA 1RT2A 3FC3A 4FW2A 2BUDA 1VRUA 3RWUA 3IRXA 3E9GA 1CZ9A 1YTAA 3AA3A 4CEAA 3QJ6A 1U4BA 4CJWA 3SUNA 4DTUA 3SI6A 1J5OA 1OZ3A 3DM2A 4I2QA 3MEVA 5J2MA 2FBXA 1KFSA 4IDKA 4Z0UA 1HNIA 4DTOA 3VQPA 3CM5A 4B9TA 1MHNA 3ASMA 3AVHA 1RDDA 1TVRA 1WN7A 4DSEA 3PMIA 3A2FA 3EYZA 2KW4A 5KH6A 3SV3A 4DTPA 2HHSA 4DTXA 1SL1A 3K2PA 5KGWA 1DLOA 4FZZA 3LH0A 1ASUA 3I0RA 2RHUA 3LAMA 3AVNA 4FU6A 3ZT3A 1BQMA 1B92A 5I3UA 3DLGA 2HHXA 2NLUA 1S1TA 2CKKA 3MEAA 2YHAA 4CEEA 2JGUA 3KKRA 4NS5A 4DU3A 3V9ZA 3OYKA 4W5NA 2M16A 3VQ6A 3PX0A 4N4GA 4ID1A 1RBTA 4C5IA 3HPOA 3B6PA 3RR7A 4OLAA 2QK9A 1U45A 1RNHA 2XRIA 1BIZA 1W9HA 3AO2A 4W5RA 2OPPA 3LX7A 4CF2A 2X4WA 1KTQA 3HM9A 2YKNA 2EQKA 3CYMA 4KHQA 3OYAA 4KHNA 5J2PA 1NK5A 3M8SA 3RR8A 4B9WA 4CFCA 3AO1A 4ZTFA 1FK9A 3VQEA 1RT5A 3C94A 3PY8A 3SYZA 1W0HA 1OYXA 4AHRA 3DOLA 1BL3A 5I42A 4FXDA 4AILC 3AVCA 4QCLA 2YNHA 1BCMA 3DLRA 4L59A 2G8FA 4F3TA 1VRTA 2HHWA 3VQ4A 1IKVA 4E7IA 3KD5E 4N41A 3SV4A 2L3RA 3KK3A 1KLNA 3NNQA 4BE2A 1NK9A 2F8SA 2HHUA 2OA8A 4CGJA 3DLHA 1WSIA 4CFAA 3HPGA 2BDPA 2X6NA 2EQUA 4M3XA 2RO0A 2XY6A 1RDAA 1RILA 3NH2A 2RJFA 1WAJA 1T03A 4FK4A 2R5AA 3C6UA 3M8RA 3L3VA 5K14A 4Z4IA 3DMJA 3V1RA 3F70A 4MFBA 4FW1A 4C8KA 3QERA 1RT6A 4CEDA 4KPYA 1EXQA 1RT1A 2HQXA 3MEDA 4FJ9A 3BDLA 3AVGA 3QIIA 4FLYA 4DSFA 3L3UA 3PUFA 5KCHA 4JS4A 3VQDA 4KO0A 1Q8IA 3ITHA 1QSYA 4BDPA 1TAUA 4DFMA 1NJZA 4Z4FA 4FZXC 3OQ5A 1LW2A 2RHXA 4FJGA 3IS9A 1TL3A 2L8DA 2E6LA 3NF8A 2PYJA 2YRVA 2KZZA 2JLEA 2Y1IA 4Q5VA 3ZSQA 2G8VA 2PY5A 3FLGA 4IBNA 3FFIA 3S3NA 3OYIA 3THVA 3RMAA 4CHPA 1LWEA 3KLFA 3K59A 3L2RA 1HYSA 4E7KA 1RBSA 2RHZA 4CEFA 2HQEA 1IH7A 4TSXA 4H8KA 4IUPA 1CXUA 4DTSA 3AVKA 5KGXA 3C6TA 2YNIA 3DYAA 3QNOA 4EP4A 4CEBA 2LCCA 1KSPA 3NH0A 4M3TA 3IG1A 2DIGA 4GY5A 3MP1A 3VQ8A 1WAFA 4HUFA 4KB0A 3RTVA 3SQ4A 2IS3A 2RJDA 4FLVA 1L5UA 3LZIA 2XK0A 4AH9A 3MXIA 4PWDA 2PQWA 1JLGA 3PFSA 4CJ3A 4B08A 5KRSA 3L2QA 5EU7A 2ZE2A 3O4QA 3CFPA 1C0UA 1KCFA 5CIUA 3DRSA 2BIVA 3H08A 4B9VA 2RKIA 1FXXA 3B6OA 3OYFA 2EKOA 4DTJA 1U48A 4C8NA 1F21A 2G3RA 2GUIA 5J26A 1YVUA 4DTNA 3S3OA 1T05A 2P5OA 4CJLA 3G0ZA 2XO7A 3ZT0A 1SSFA 4CIFA 1WGSA 1ZBHA 1GOCA 1CZBA 1L3UA 5CY4A 3QETA 4CESA 1TK5A 3PNWC 2B5JA 4I7FA 4DFPA 3AV9A 3VQCA 3ZCMA 4E7JA 3DRPA 2IGIA 4FJIA 2Z1JA 4ZTJA 4ID5A 1Q9YA 3LP1A 2D0BA 3ZSOA 4CGFA 1RBUA 1U47A 4CK2A 1LV5A 1BI4A 3MEWA 1J9AA 3NFAA 2G8HA 1GOAA 1ZBUA 1LAVA 2JTFA 4B9SA 4I9LA 4LSLA 5E41A 1XWLA 3LP2A 2JZ2A 3KKSA 4OPKA 3LLRA 2XY8A 5HRRA 1TK8A 3BGRA 4DF8A 4FL6A 2IDOA 2E6NA 2OPSA 4LSNA 4OKEA 2D0AA 2X4XA 4A4HA 4KHUA 3DLEA 3I0SA 4CJ5A 3VQAA 2HMIA 4IFYA 4FK0A 3LPTA 1RI0A 1QS4A 3DRRA 3ASKA 3IAYA 4C8MA 5JS1A 1A5VA 4DTMA 4E89A 3TWHA 4CFBA 1SKWA 2VG5A 5FROA 2LSNA 1WSGA 3L8BA 1J54A 3TABA 2RN2A 3AA4A 1BCOA 3TANA 5SWMA 2NUBA 4DQRA 3OJSA 3HPHA 4CJFA 1QHTA 2BKDN 2LVMA 3G10A 4W5TA 3ZSZA 3O8VA 3TAEA 1QSLA 2Q3SA 2G8WA 3MXMA 1HPZA 1S9GA 4QW2A 1S9EA 3C95A 3LPUA 2KTQA 4CGHA 1S1UA 2HNZA 1QE1A 2IAJA 3LDSA 1XI1A 4E7LA 1NK7A 4IUVA 1S6QA 4CHOA 4O4GA 1OI1A 3QEVA 4IURA 3V1QA 2RF2A 4FJ8A 3EZ5A 3VN5A 1VSHA 3HJFA 1TL1A 2QQSA 1IKXA 3L42A 3F9KA 4LH5A 3OYHA 4HUGA 2P1JA 3DI6A 3NTHA 4DSIA 2XDPA 2RHIA 4DQIA 4CIGA 2IG0A 2K3XA 3OYGA 4LD0A 1UOCA 5KI6A 3UT1A 2LDMA 4F3OA 1WJSA 3LZJA 3RRHA 1C1BA 1SKRA 1RT3A 5HLFA 4RW4A 2R57A 4KAZA 1Q9XA 2VWJA 5J2NA 4Z4GA
chains in the Genus database with same CATH superfamily
1SD5A 2VE8A 3ATUA 5IHIA 2X1DA 4IRIA 3QB0A 1FKPA 4ANJA 3QPSA 1ZKGA 1QVGP 1RTDA 3KHYA 4CK1A 2DMQA 4CCMA 4CECA 2O9SA 4CA0A 1I4K1 2GA1A 4JKEA 1PYVA 3KLGA 4BY1J 3H0GJ 1RAAB 4KITB 4HDVA 2X6OA 3ZR8X 4M7AF 1S72N 2CUZA 2KT8A 2C0TA 2RA2A 1DTQA 1RBVA 3QDRB 1RUOA 3DLKA 4NL3A 1Z26A 4R79A 1K73R 3ZP5A 1RR7A 3CC4Q 2VVKA 3CCRT 1HF0A 3AG4H 2A28A 2J7IA 4K8ZA 3AAQA 1XSXA 3FM5A 4QAGA 3KTQA 3HP9A 2XGDA 2BYVE 3WHCA 2Y90A 5M3MJ 1M9SA 1X6BA 2RF0A 3IHOA 3NVKA 1QVUA 3FXJA 2DKGA 4B1WB 3VB2A 3RQ4A 5HLTA 3HOVJ 5DD8A 5JMVA 3BTIA 1Y96B 5AQTA 4RLQA 1F4KA 4BKXA 2OBPA 3G6EN 4IHXA 2JUCA 1KHCA 2X9DA 2PMZN 4JKCA 3R6MA 4N56A 4ZGDB 1U5SA 3V4IA 4M3EA 3ZX2A 1D5VA 2P4WA 2V79A 1R0AA 3RMDA 3VS2A 2HEOA 4PDKA 4UC4A 3I5UA 2VC0A 4CJKA 5MLCQ 1JO8A 3MO8A 3E6DA 5KVRA 1MUZA 5ELZA 2RPIA 4EM0B 2DYBA 3RMCA 2L4MA 3AFHA 1NGIA 3EH1A 4GVMA 5CO7A 5KK1A 2EYYA 4U87A 4HCCA 3J7AY 1YFNA 3I54A 3TQNA 1F43A 1K9MU 3Q5FA 1S5LC 3K9KA 3HZ6A 1NYGA 2HCKA 5FDLA 3QESA 4G12A 4LH4A 1IREB 3J80Z 3P5JA 1YO5C 2NRVA 4PFPA 4JD2B 4K2EA 1A6IA 4A4FA 4FLZA 1V5FA 4NYNA 5ADXH 3VYGA 4C8QE 2QKBA 3ECHA 3NH1A 2O0YA 3FSPA 1WZ2A 4Y33A 5D8KB 2P5GA 4RGUA 3D7SB 2DU9A 3K70C 1A35A 3MEXA 4FLTA 2YG9A 2F4IA 3VOEA 2KISA 3BQZA 2LCLA 3DWLE 3FDYA 3V7RA 3WNHA 2DTZA 2P9IA 2JN0A 3FHZA 4N4HA 5J40A 3S6IA 1HNXK 3QEIA 4RDUA 4FSXA 1HLUA 4CJSA 3KK2A 5HNFA 4LY7A 2FBYA 3AG3H 1HD3A 2R7DA 1WOQA 4CGZA 2NYSA 1D5YA 3LWMA 1CGPA 4Q5WA 4XTXA 4AYBN 1WXUA 4XU2A 3SQ0A 3LA7A 4CH7A 5J8CA 3ISNC 4IIMA 1J2XA 2X35A 4B9LA 3GTQJ 1MDMA 2XY7A 1SV5A 2Q0UA 3WGHA 3CCEI 4C1NK 5DM6F 5F08A 4M3FA 2YHTA 3AARA 1Y1VJ 3SDZA 1WYXA 1IHWA 1TGOA 2JUGA 4V2FA 4BS9A 1S1NA 1HNWK 2PUKB 3WEEA 3VQ7A 3SFZA 4M78C 2VQCA 2WFBA 5A0GA 2M9UA 3DU6A 5GAOn 1S6LA 3SBTA 3HG9A 4DU1A 2NOZA 4DQ8A 3AA2A 3EUAA 2NOHA 1B8IA 1N5YA 1NGDA 3NCIA 4DV0K 4ELVA 2VWKA 4EIKA 4M3WA 2L7FP 5DV5A 1YW9A 5GAOr 2B8AA 6PAXA 1KEAA 1Q81U 1MMAA 2EYZA 2P9NB 3H0DA 2ZGZA 4H0XB 1NBEB 2BZTA 2NLXA 5EZGA 1LVKA 3CDIA 4DOZA 4MEXF 3U8XA 4OKKA 4F93B 4YPHA 3CHWA 2RQWA 1HQEA 3UWNA 1DQUA 2DBBA 1XTDA 1Z7LA 2E6MA 1SMTA 4PJOA 1Q7YO 3OYLA 4PL8A 2BBYA 4CC7A 1WH7A 3CMEQ 4S04A 1SPKA 5C2FA 3MN9A 1ITGA 3F0ZA 3H46O 2X6SA 5DDGA 4YOWA 4JX6A 4CEZA 5CZ1A 2KRFA 4HNUA 4E1NA 2CGLA 2FHDA 3ULDA 1Z9CA 3CWTA 3BPXA 3SUPA 5FKKA 4D0PA 4FASD 2JTVA 2Y69H 4GLMA 2W42A 3SJJA 2UXBK 3X28B 3QNNA 3DTEA 2R7ZJ 4QTRA 3BG3A 3REAB 1NGHA 1EBMA 3NGYA 1W36C 3MK6A 4LF5K 2UXXA 2KT1A 2E2IJ 1VQ8Q 4KTQA 4EPCA 1BQNA 3ZFJA 1S7EA 1YTYA 1IRGA 4FM2A 1P59A 4JJBA 2E70A 2ID3A 4DV3K 4B9MA 4HOBA 1DGRM 1G4DA 4KH1B 2XAFA 3C3WA 2CSOA 4C92F 1E3MA 4KJZA 2ZSIB 5J1EA 2D1VA 1OCOH 4LDVA 2VASA 2YSRA 2YX4A 4XIUA 3JCMV 2VG6A 3RKYA 4DV2K 2DMOA 3QHSA 1SFXA 2DE0X 4CBXA 3DLMA 2A37A 4HX7A 3V9UA 3IMXA 1YIJT 3BW1A 1XNIA 1D8KA 3BFMA 4FZYA 1WSUA 3WVEB 3WODF 2ZCFB 1LE8B 2E4LA 1KJWA 3O4WA 4B23A 1QA6A 1M3QA 1ZUYA 2V51B 3FHNA 3VWBA 3HL8A 2Y4YA 1I3AA 3QLHA 3U9ZA 2P8TA 5EF6A 3G4SQ 3I0XA 1NLPC 2QWWA 4IHYA 2QKKA 1FBSA 2QDLA 4HT9A 2R5YA 3E01A 1NGBA 3CCJN 2E19A 1WNLA 4KRFA 1STZA 1HDPA 4MLEA 2AIRB 2KP6A 3KUFA 4J00A 5BN8A 3M4YA 2L7ZA 4ESBA 4OAYA 1IN5A 4B8AB 4JI8K 1R1VA 1O3RA 3K70D 1SKUB 3PT9A 4I7HA 1SHGA 1G2BA 2F5EA 3MD2A 4DBQA 2JPBA 4HUEA 2W85A 1FX7A 3G25A 4CZZA 1BI4B 5EEHA 5KPTA 2OV7A 4BUPA 4QT7A 1NG2A 4HCBA 3KJVA 5D6EA 2GQQA 2HBLA 4R8HA 4GBQA 3CCVN 2UWMA 1JI8A 4HW0A 1VQNI 2O61A 3ROUA 1P7JA 4LD5A 5CR2A 1MUYA 1X2MA 2AQFA 2JMWA 5D6FA 1KRPA 3IAM2 3K9JA 3EUKL 5J3LA 1XDUA 3F6OA 4CF0A 4KT5C 4X66K 4B4CA 3BCBA 3CG7A 1IXDA 2CU7A 4BE1A 4JPBW 1YP5A 3IWZA 2ZMEA 3CCSI 1OR7C 4CCOA 2L3DA 3TO9A 2NNYA 1G83A 1JU5C 4O55A 3S1RJ 1BI0A 2QM1A 2YU9J 1BOBA 1ERDA 4M75B 3MEGA 3PIOA 4MO4A 2DRKA 1S22A 2WONA 2HXIA 1C1CA 3A5LC 4P9FA 1MDUB 5I2MA 3RMSA 4BI4A 4EQQA 1M30A 2LF8A 2F5FA 2VB6A 3IWFA 1J75A 2QASA 1BR4A 1FPQA 3CWAA 3VF2A 4CYCB 1T7PA 1IDZA 5AQUA 5LEJA 1FYLA 3I55I 2L0AA 2CP0A 1IGUA 2XDDA 3SWNB 4FOEA 1NGFA 5M1PA 4ATOA 3UKRB 4BACA 3SQ2A 2HVHA 4EHUA 3U2RA 1VSEA 1ITYA 1K9MR 3FXLA 1NBWA 1QZ6A 3A5OC 3GFMA 4B44A 1ZQ1A 1ZR4A 4JKFA 1KZHA 5CZ2A 2LKXA 1HJRA 1Y97A 1VQOT 5J4VA 1KLMA 3OH6A 3JCMg 2NRRA 2E2JJ 1TS9A 4XLCA 4ZYDA 2LTOA 4OMLA 3TREA 1YITT 2BE9B 2DA4A 3JRFA 2VBZA 2K2MA 1Y64A 3EPZA 5KNLA 3PNVA 3JAMO 1HSTA 2I7PA 4UHTA 4G9ZA 2EBPA 5GPAA 2PYLA 3SUOA 1JXSA 1WPKA 2A5YB 4ZH4F 2OC6A 1V76A 3BDPA 1QKXA 1R8OB 2FZKB 3DBHB 4IPAA 1WEIA 1WVRA 4B3SK 1DGKN 3WVDB 3OS2A 1FNNA 1WSEA 4FJ7A 1BA1A 1NG7A 4M45A 3BJOA 2DILA 1UZCA 1IKYA 2Y0SA 1XB4A 2KEAA 1AKHB 3FZKA 5AZJA 1RACB 4V2SA 1T0FA 4OMMA 5C6SA 3HGGA 1VQ9T 2ASPA 1IKWA 4QPOA 2DODA 4LF9K 3PO5A 3FJ5A 2Z9OA 5LGUA 1TKZA 3V8KA 1GFCA 3NPFA 5GAMh 4A2AA 1VQPA 4WQ5A 3S32A 4A4EA 2BY3A 2HI3A 3X26B 2E1CA 1Z91A 5C15A 4FJHA 3C18A 4R1HA 3DTKA 2FZCB 1YW7A 3JCMh 1QVFS 1MNEA 2GX9A 3F9MA 5AQHA 4B8CA 1I0CA 3OS5A 4Z4EA 3KPHA 1I50J 1LWYA 3CPWS 5GMKl 1HW5A 4RTWA 4FX4A 2C0OA 2K5FA 5BPMA 1C6VA 1VYUA 2YRCA 5C44J 2A36A 3GBTA 2E5NA 2LZ6B 3K4MA 3CCQN 4RTFD 4WCGA 5KRTA 2XKOC 2FMYA 3D4VA 1YAGA 3WE3A 4PJOF 4O5BA 4ELUA 4D8DA 4IQ4A 4JI0K 2MD0A 4JK9A 5GAOm 5CQGA 4F2RA 2QCOA 4HCZA 2FX0A 1ZSZB 2HOEA 2V9KA 1NJIC 1KXPA 3AVJA 1PUEE 3NF7A 3BJ6A 3CWSA 4CC2A 2KKZA 4C8QC 2OCEA 1Q81R 3QEXA 3CCRQ 3TW6A 3DKXA 3L1AA 1T95A 3SDGA 1KVCA 5M1NA 4ZDOA 1VOMA 2O6GE 4A62A 3GL1A 3AY9A 4ENNA 3ER0A 3G71N 5IXFA 1ENHA 5E8IA 4AIJA 3TTFA 1EWQA 4CJTA 1Q81O 1FOKA 5DLQE 1E4FT 1ABQA 2GCXA 5GAN3 1N27A 4BRIA 1OMIA 4UY8O 2XHKA 2JN6A 4B1VA 2M0OA 1KK7A 2LG4A 3RKWA 4Z4HA 1D1AA 4AVPA 5DK5A 4FJKA 3ATVA 1RL2A 4K42A 1ASWA 3J7YJ 4DR5K 3Q3SA 1OULA 2ATQA 5KCOA 2X51A 1W4MA 2IAIA 1KQJA 4XK8E 3TAFA 2Q1NA 2M0YA 3EGUA 3HOSA 5E84A 1K7AA 3CDLA 2HVQA 2L4AA 1WQWA 5HROA 3AVAA 5H20A 3P9IA 2FF6A 2H3JA 4D5CA 5F04A 1RUNA 2NOBA 3KX2A 1T39A 3VSKA 4OGCA 4JK7A 4BE0A 1NG9A 4RCHA 2W04A 4OPHA 1WSFA 3TAPA 4YDUA 2EJGA 1X3MA 2A05A 4BWJA 1WI3A 1IN6A 4KNYA 3FEOA 3H41A 1LWVA 3M9AA 4RAZA 4E9GA 2YNFA 2L89A 2F5DA 2GXBA 2AJQA 1D9FA 1NGEA 2KYBA 1N6QA 4KGZB 4OOIA 3I53A 1IN7A 3VEOA 2GEMA 4CE9A 3ULRB 3UE5A 4XLEA 2Y0MA 4BYYA 4E7HA 2DFIA 3RSEA 4OAZA 1OCTC 2GAUA 5EG0A 3H5RA 3LMMA 4C0DC 4A2BA 4OB0B 1LJ9A 4B6MA 2HGCA 1EH6A 2ZFUA 2CUEA 3I35A 3O1WA 1B34A 5BRDA 5GPCA 3QO9A 1C0FA 3V9XA 2XGCA 2B6AA 1NK8A 4A3GJ 4KMFA 2ABLA 3HUGB 3HSCA 4EJTA 2EGCA 2JPSA 3OGDA 1XCVA 3DEUA 5ICGA 4AFQC 4CGDA 2F4OB 2PMUA 1QVGS 4L9TA 2CZ0B 1U6GA 3CMAA 4F4KA 1YHQN 4B3RK 5CHZA 4EDUA 2L2OA 3MN6A 5HBMA 1PVEA 1U06A 2YUPA 3E0JB 1I1SA 2KDOA 4ZNXA 5HVQC 4PHTX 4FYDA 1VQ6A 3MKYB 2NS0A 3HO1A 4I2OA 4B9QA 1YHQI 2DDBA 4DTRA 2K27A 4E4HA 2Z1IA 1QMCA 1U5TA 2R93J 4HZFA 4Y13A 3RVCA 2CZ7B 2RJCA 5GAN8 1UAXA 2V52B 3T7ZA 4DV1K 3GFJA 1MBEA 3PIOF 1JJ2M 1A04A 3OB9A 3DB4A 4RCCA 1GLCG 2FBVA 3O9TA 5DM7L 3MECA 1UCRA 3X25B 3RRGA 4EZ6A 1AD5A 2FSJA 1XGMA 1HBXG 3JSCA 3JB9J 3O8MA 3CCMA 3H9QA 2QAZA 1G3TA 5AQPA 2MW8A 9ANTA 1P6RA 4XQ3A 2VKNA 2CJJA 2GGRA 1C0GA 1TNSA 3GG4A 4X64K 1GXPA 1KYWA 2QEXT 4BR7A 5FLXZ 4N0AA 1SVOA 1VRUA 5FU6C 3VODA 4H0PA 3IRXA 4P1WA 2EYXA 4I98B 2XRLA 4MQVA 4HV6A 4AWXB 2FU4A 1YFHA 3K2AA 1FW6A 1M1FA 2LQWA 3DM2A 2V1XA 4FTHA 3FFKB 3GTGJ 4M77E 2D8JA 2NXNB 1KFSA 2DXCA 2JNGA 2LF7A 4DTOA 1FYNA 2DZCA 4M7AC 1Q82C 1N75A 1WHJA 2EFQA 5FKOA 3AVHA 2QQAA 1RDDA 2Q97A 2DX1A 4EJOA 4DSEA 2JUFA 2O8DA 3U9DA 3EYZA 5BPNA 2QXLA 2LY1A 3SV3A 2CQQA 2L3QA 1ZGAA 2YWWA 4DTPA 1WEFA 4CJ7A 4DTXA 1W5CC 4ME7A 1SL1A 3CQTA 3S1MJ 2PG4A 5KGWA 1LPLA 1LDJA 2EIKH 1K4SA 5C2DA 3LAMA 2EVRA 4KUMA 4FU6A 4H5VA 1BQMA 2CP7A 2F5TX 1ZXOA 3VS1A 5I3UA 1VQKT 3FZFA 1RC9A 3BF3A 1F9NA 2HHXA 3WU2C 2DT6A 2EIFA 2NLUA 3CMAT 3RI4A 3TSZA 1M2VB 2ZC2A 2JGUA 1KA8A 4F14A 1YJWA 1NWKA 2X48A 3OYKA 3UR3C 3FM3A 4A12A 4EMHA 3G1JA 3EN9A 4L5EA 1KG4A 4RTZA 2HBWA 1ETVA 2STTA 2CYYA 2WWYA 9ATCB 2E12A 4C5IA 1U2VB 3HPOA 4DR7K 4OIRF 1ZHFA 2HZDA 4KBMB 1YI2T 1BDGA 4A6DA 3CCUA 4KBOA 3ABUA 1U45A 1RNHA 2M0MA 4RTYA 4JD2A 1KG7A 1W9HA 3AO2A 3CXCM 4OINF 2UXCK 4NQWB 3CJNA 2MI6A 5FFXA 1TWHJ 2DYRH 1FP1D 4KHQA 3OYAA 1PHTA 1VQLA 3GTLJ 2E34A 2HDWA 4KHNA 4R56A 5J2PA 1YIJQ 3V8JA 4PJOE 1PSFA 3RR8A 1WJCA 3CCMT 4HT8A 2HZTA 2DL4A 1YJ9A 1Y39A 3KEQA 1KIKA 5AFUA 2COWA 5JHUA 2HEQA 3GFIA 4FXDA 3AT1B 2EGAA 2YNHA 2K57A 3DLRA 4F17A 1Z9ZA 3F72A 2HHWA 1QQMA 3C2HA 1IXRC 4JKAA 2P5VA 4E7IA 3KD5E 2L3RA 1MMNA 3BR6A 4YIRX 2QWMA 3HIFA 1GCQA 3FRNA 3RUXA 2F8SA 3CJAA 2J06A 2OQRA 1S3JA 3UKUB 4EM1A 2NAZA 2YUNA 5A2QE 4WFNL 1W97L 1VYTA 2EQUA 3GTPJ 5LMNK 1IW7F 5EDNA 1H92A 1TTHB 1W2BP 5FKMA 4X9DA 1PU6A 3NH2A 4AT1B 3RERA 1T03A 4FK4A 2YJFA 2R5AA 1USTA 1M3BA 3C6UA 2M8GX 2BHZA 2OAWA 4BHCA 1VQ5N 3ABTA 1WUAA 4FOIA 2M1BA 5AQXA 3LQRA 4IOCL 3THYA 2RV8A 1T6DA 2W24A 2VXDA 4XSXF 5E3LA 1XSDA 1RT1A 2GQVA 4DR6K 3MEDA 4KULA 1VQ4A 1VQ5I 2E3IA 3BDLA 3AVGA 1ATNA 1TNTA 3ZGKA 3GPLA 1I94K 4CXFA 3JSPA 3L3UA 3PUFA 5DUIA 3QWYA 4M75G 2RM4A 2E60A 4LN2A 3UATA 2QSFX 5L3GA 1DKGD 4XICA 3MPUB 2MSYA 1MSEC 1AWWA 3CMEN 1L0OC 3THWA 2E1MC 1PD0A 2WAEA 3FK6A 3J80O 2OFKA 1LW2A 3A5NC 1PCXA 3REOA 4X65K 2OAZA 1JHHA 2WB1N 1FYMA 2YG8A 2PYJA 4BRFA 3B02A 5IP6A 5AQRA 1VQLT 3ONQA 2OX7A 4J9IA 1F5TA 4ASNA 3PIPA 1J7KA 3CCLT 4B22A 2VOOA 4IOXA 3HSRA 3FFIA 1A6QA 1KHIA 3S3NA 2KBTA 5D5VB 5J3BA 3OYIA 3B6CA 3QSUA 3KLFA 4AU7A 2CGHA 4C0ZA 3L2RA 1BJZA 1PU8A 1RBSA 1BR1A 5J4YA 4TSXA 4H8KA 1NNEA 2DJIA 3L09A 4QSHA 2L2PA 2YNIA 3DYAA 3OSFA 3QNOA 5A2QK 4EJYA 1WB9A 1VQOQ 1X1AA 5JFRA 3OW2P 2B9SA 3NH0A 3IG1A 4CCLA 4EV0A 3GTOJ 2DIGA 4M9ZA 1YITQ 4VUBA 2IIRA 1REPC 1IZ1A 2ME6A 4AUXA 4G8XA 2PVOB 2EZIA 1V1CA 1JUPA 3S1QJ 5DD4A 3JSOA 1G99A 4M7AD 4BXFA 2IS3A 1L5UA 3U1DA 3FISA 5AR0A 1JQQA 2C0IA 3F8CA 3T8TA 3L9FA 2VPLA 2FPDA 4CJ3A 4XBFA 2QA4N 4JKDA 4QWQA 4BQAA 3PVQA 3KFWX 2ZE2A 3O4QA 2HMAA 3DP7A 4K43A 3C0CA 4PKCC 2ISZA 5LJ5d 3IC7A 5CIUA 2IS2A 3E19A 2QA4I 1HJDA 1VQ9Q 2K3PA 1LEAA 1GLNA 3GX4X 1FZPB 2A08A 2CMPA 1W6XA 2XAHA 3CC2T 1J0RA 2EKOA 4DTJA 1U48A 4IRGA 4L5IA 4BEHA 4XKWA 1P9QC 1QKWA 2ZO4A 1B72A 4TV7A 3A8YA 3TTDA 2LT1A 2XO7A 2QTDA 3K4JA 1SSFA 1Y56A 1ZBHA 1GOCA 2A42A 3LDPA 1B7TA 3R4KA 4B24A 2H8WA 4UXNA 1ZQ3P 4N0BA 3QETA 2JW4A 3A2KA 5JLFA 3QYGB 3KVGA 3BG6A 2QYOA 2PMHA 1VQPI 1U3EM 1TSFA 4HF2A 2DL3A 4E7JA 3QYFA 2IGIA 3CF5F 4FJIA 1NGJA 2X4JA 4ID5A 3LP1A 4MQ9F 4EEFG 3P9CA 1RBUA 4F9OA 3V7CA 1LV5A 1BI4A 1JKOC 2ZPBB 3E9LA 3DLAA 3F8BA 1GOAA 4B47A 1MJBA 1LAVA 4NXNK 2CFOA 4LK0F 5E41A 1XWLA 3LP2A 1M3AA 3KKSA 3M8FA 5AT1B 4OPKA 3BZCA 2AQEA 4XKCA 2DL8A 3C7NA 4BVOA 2OCCH 4XONA 4MDXA 1R77A 1R5HA 2P9UB 2ZKZA 2D0AA 1J59A 4KFCA 2OZUA 2HTSA 3EFOA 2STWA 4A4HA 1RAGB 4K0KK 2QSGX 3M8JA 5FD5A 1O3TA 4EMSA 4FIBA 2NOFA 1K78B 4IEIA 3VQAA 2Y31A 3KP6A 2B86A 3JCMe 4GXOA 3I56T 4WK8F 1XPXA 3CO6C 2DMUA 1E7OA 2O8CA 2CP2A 1QS4A 3L2CA 1BW5A 4J5YA 1M90U 5H6RA 2FG0A 3HSEA 3VYRB 4A5NA 5GAHJ 3P31A 2OTJT 3TWHA 2PFBA 5FROA 2CSIA 4KIGA 1A0NB 3IKTA 1WSGA 5BPLA 3CC7N 4IO8A 1DU0A 5FO5A 1NM7A 3CF2A 4DJAA 2E2NA 4LIUA 3TANA 3JCMQ 2KMTA 2PLYA 3M0TA 1XQHA 3IKMA 2XDBA 2D0PA 5F1XA 3OJSA 1K6OA 2R7UA 2LYCA 4MGRA 3E9PA 2BKDN 3C6HA 2LVMA 1K0SA 4P5OA 2A3SA 3CC7I 3TAEA 3EG1A 4EHTA 1GRIA 2G8WA 1HXDA 5EEGA 3GCMA 3MXMA 1I6XA 2W03A 1PDNC 2Z99A 4M78A 4BQNA 4IUVA 2KVQG 1S6QA 1R0BG 3OHRA 2RH2A 1QVPA 5FLMJ 2XAJA 3V1QA 1IBKK 3I9V2 1KU3A 3WU0A 3EZ5A 3VN5A 3VYSB 5JR3A 2HVRA 1ZYRF 4EW0A 1WWXA 1TL1A 2XAUA 1QQJA 1IKXA 1WX6A 4OFEA 3OYHA 4G7HF 1KAYA 3TGNA 1R1UA 4G7OF 1SAZA 2MG4A 3LQQA 2KIFA 2AS5F 4AM3A 1WJSA 3QFUA 2RGVA 1DPRA 5CCAA 1C1BA 2Q1ZB 3ERMA 2KI7A 5J8FA 1Z77A 1RT3A 5FWBA 2VN2A 3WG9A 1DIZA 2A3LA 3GBQA 4BRCA 4ZN1A 1S7OA 3MKDA 1AKHA 2DVJA 4Z4GA 2ACJA 3J7AF 4AF1A 1R59O 1BWFO 1NGAA 3ZMZA 3EGXA 1E3PA 2CT3A 1RDBA 2KK4A 4J01A 3KZZA 3KD1E 2D9TA 2LBFB 1K8KA 4J9DA 2YR2A 3JYTA 5AQZA 5KYYA 1RR8C 2V75A 4V2GA 4RW9A 3H0IA 2OTLN 2DA7A 3JCMc 4NDLA 1ZBFA 3T1YK 3OMGA 4OMNA 4NNJA 2O8XA 3VEWA 1LKXA 3B73A 4FWLA 3EE9A 5CLSA 4AHUA 3KETA 1JL2A 3OS0A 2K5CA 2GOMA 1VQ6I 2OTLI 3K6GA 4AIAA 2PZSA 3CLOA 3SQ1A 1JCFA 1EETA 3RDIA 1OH5A 2HKOA 4FJ5A 3R60A 2DA3A 4OP0A 5KAIC 2P9SB 4BRKA 3CCRN 3TPQA 3M8PA 4DR2K 4JRIA 2QWNA 2JM9A 4C92D 4OMQA 4I76A 3PIPF 5IP9J 3CO7C 3LWIA 2QEXQ 1KSWA 3BTJA 2LQNA 3DF8A 2E2OA 2YS9A 4DHYA 5LJ5f 4HCKA 1XC9A 4PJMA 1P7IA 1BC7C 4X1EA 3RTRA 2Z1HA 3F2KA 3KK7A 1DTTA 2KLAA 5K7HA 4IHSA 2V7YA 3FXOA 3BCAA 4FLUA 2K3BA 2JZYA 5AIQA 1VQMT 2H3GX 4M3YA 4EW4A 3A03A 4PJOC 3GOIA 4DLGA 1EQYA 1JKHA 1USSA 1FJLA 2FF3B 2LCSA 1JB0E 2NUPA 3OH9A 2NVXJ 3H36A 1TKDA 3OYDA 3OBWA 2QXFA 1N8RC 4CZKA 4FSVA 3VS0A 2NRAC 1HYOA 2BZ8A 5E20A 5EEAA 5IT9Z 1TKXA 3MP6A 3TCJA 3HVTA 5A2QZ 5BREA 1JLBA 3UA7A 1QPMA 2VYTA 1KVBA 1L3SA 2XPWA 3V4GA 2OANA 4I9QA 4U0VA 3CJ7A 3ZETA 2Z1DA 1UG2A 1VQKQ 1VSLA 3CUQB 4QQGA 3CMAQ 4XN0A 5I21A 1T3SA 1G6NA 3E6CC 1EKEA 1D0ZA 2CYZB 4XTVA 2QKMB 5BRHA 3QODA 1B59A 4F91B 2ICWG 2EWSA 1V55H 4DBHA 3HKSA 4RAFA 1X9MA 2Z2SB 5A0DA 4N9IA 1QQIA 3I9QA 3I71A 3P9KA 3HGYA 1YI2Q 3UPUA 2RDPA 3CTAA 3LGFA 1N9RA 3NHGA 4OVAA 3NMUA 2O01E 4H5TA 1FC3A 3KE2A 4H5WA 3Q9VA 1A5JA 2HOAA 2HWVA 1YJWI 1A31A 3BLYA 2PVGB 1FYKA 3QDFA 3JCMX 3ZMSA 5JHFA 5I11A 1C0MA 4LUEA 4BH9A 3ZQCA 3ZQ7A 4CGGA 4G94A 2M02A 4LD6A 3ZXSA 3LDLA 3CCMQ 1NJIR 3ZQQA 4Z94A 4YELA 2DMTA 5LRRA 3E5QA 3H92A 3CPEA 3OMCA 5KE3A 1BU1A 3CD6A 4Y0WA 4CC4B 3FKJA 3T3FA 1UFMA 2HXOA 4LB6B 3TDUC 4D7MA 1NJIO 5HDNA 3RZOJ 5ILVA 1RRSA 1J5YA 5KYWA 2MD5A 5FW9A 4BRMA 1YQKA 2BZXA 2F9TA 3J8AA 3CJBA 1WCMJ 1WJRA 4LJZF 1ZH5A 2OPRA 4JHDB 3VS7A 2A5XA 3N4PA 1A36A 3VQQA 5TGTA 3D7EO 2ZWHA 2ELHA 3BR2A 3JTHA 3TR8A 3WXJA 4UV9A 1SFOJ 1YNZA 1TYQB 3MCAB 3PLAA 5M1FA 1BR2A 3M54A 1OPKA 2K9NA 2HDAA 4XQFA 1YLFA 3MAQA 3O9QA 2EJRA 1VYVA 4BVPA 4BD3A 4A57A 2K7AA 1B9DA 1ATRA 4FPAA 4ILJA 4XH5A 4XTUA 3PV8A 4FLWA 3R6NA 3LANA 1WLPB 4J2AA 3OY9A 1VSKA 5LJ5j 2LRDA 3VUBA 5HL7L 1ETQA 3MN5A 2CUBA 4KB1A 3WUHA 1W5TA 2CQKA 4EMKA 2A1RA 3SEZA 3K4NA 4BR2A 1VQ4N 2P7VB 1I8FA 4KRTA 2DQLA 4O3MA 4JKBA 1R0CB 3NBPA 3M53A 3P4IA 4WF9L 3LP0A 1QRYA 2KY9A 4PJ0C 1NHAA 3WXIA 3HRGA 1VQ4I 2ZSHB 3PX4A 4OLBA 4PLLA 2VBXA 1M90R 3HKZA 3D0PA 3L2WA 2YI1A 3KLIA 2GIZA 4M78F 2CGKA 1BI3A 1VQLQ 3COAC 4IUUA 3CCLQ 4UUSB 1LPQA 4BB7A 1WHMA 4WXCA 2V4JC 1MBJA 3KLOA 5E3MA 5J39A 3KLHA 1RTHA 3EG0A 3TQ7P 2IC3A 1N78A 1NGNA 1IRXA 4ZYGA 2ZNYA 3EY1A 3SQNA 3VJPA 2DFHA 3GLLA 3GIBA 1Y1WJ 3ENBA 3PX6A 3NDKA 1QHGA 3ZX0A 5EVZA 3CI5A 2XHBA 3A8LB 3IQLA 4C30A 4XRMA 4PJOD 2R92J 5BNGA 1V5EA 1KD1C 4L8RB 1O4XA 1S72A 1T8EA 3O6BB 4ENJA 4OMPA 2XKOA 4FWKA 3HP6A 2JHJA 1M1GA 2Y75A 4FX0A 4AQYK 1EH8A 3BJAA 3PO4A 3M56A 2ZXIA 4DYCA 3TSQA 1XHZA 4D5FA 3S2DJ 2X74A 1RDCA 1YQRA 1NOZA 1U9OA 2L9VA 5HKCA 3VYUB 4CRIA 5M5XJ 3TSWA 2ZZDA 3CXCP 5AQGA 5FU7B 2DLPA 3ZYYX 3ZPLA 2XMFA 1AWXA 1GLEG 1T0FC 4C3JJ 5D6XA 3O80A 2ZPHB 1J53A 1KQSM 3ZSYA 2V8KA 4F7UB 3BDUA 3BC8A 1ZLJA 1OKJA 5C42A 2ED1A 3CC2Q 4HVVA 2RI5A 4WQ5C 4FJNA 3G6EA 3SFIA 2BGGA 2MBFA 4ON0A 1ORKA 4LB5A 1M1KU 4KGXB 1UFFA 5F2RA 2O8FB 4K8XA 2XIDA 3Q7CA 2X1CA 4NYFA 5AQYA 2DYSH 1Z25A 1TWAJ 3C4SA 3K10A 1FKOA 5K5RA 2Y1JA 2EV6A 5CKHA 4ISFA 3VESA 5C3EJ 4I02A 2DT5A 3FMQA 4NC6A 2LP0A 4XOPA 5FD6A 1Q82R 4E3SA 2JM8A 4Y1CA 2E36A 2XG8D 2DTHA 1ESVA 3M8QA 2BTTA 3V81A 4BC2A 2ZPFB 2IA0A 5TJJA 1HW1A 1NJXA 2UYTA 2HPMA 1QCNA 4P55A 4G6QA 1BN5A 2V6CA 1Q82O 2OUMA 3WTXC 2KJBA 1M5Q1 4PA1A 3FZHA 2JTMA 2HBKA 4MZTA 3B8AX 1NKCA 1IZ6A 1VTNC 3CBOA 3OVNA 1VSJA 3LH5A 2X6XA 4PNOA 4V19S 2DCEA 3F0CA 1T98A 5B5EC 3E1SA 3VS3A 1XG7A 4BC4A 2CP3A 4JEPA 2P0PA 2K4JA 1QWEA 2Y2ZA 4RBOA 3R6OA 5KQ8A 1B9FA 2MPXC 2IA1A 2COYA 4BY9C 3KBGA 1AOJA 5DMRA 3AA5X 3I8DA 1FP2A 1SEUA 1NK6A 1QZZA 1OOTA 3NE6A 3ABKH 3U3GA 2OPQA 4J2BA 3H45C 3QEPA 1Q86C 1PUFB 3SHFA 4U7DA 3V7SA 3I56Q 2HYGD 4H4OA 3MKWB 1EV7A 2WBMA 3WNGA 3SAGA 1M1EB 2KQ2A 3REBB 2E1OA 2GFAA 4XH4A 3G1MA 3T0YA 3A98A 2QBYA 2OTJQ 4CD3A 3NMZC 2XHCA 1KVAA 3K57A 3OW2S 4AYBA 1HDDC 1IC8A 4CJQA 1MD0A 4AM6A 2Q36A 2V1NA 4BDZA 1GL5A 2WOMA 4OGEA 1JXBA 2ROLA 4J19A 3MWMA 2JA5J 1MU2A 5FFZA 4KH4A 4XU0A 1T8IA 3I0WA 2LNBA 3WNEA 1G5VA 4IG3A 1VQON 2M9HA 4WQ4C 3K58A 2RQPA 2IGKA 1D3BB 4J9BA 3R3LA 1YITN 4YDUC 3HBLA 2Z1GA 3O2PE 1YWPA 4E9FA 1UMQA 4AG1C 4JRKA 2QQRA 2GIVA 4KHYA 4M6XA 1B9MA 3PSIA 1TG0A 1MWKA 1OH8A 3JRGA 2M7AA 2QUFA 2QQ9A 2J6OA 2M4GA 2FXAA 2K7LA 1YQAA 1O75A 4UUVA 1SFEA 2E1NA 1QVTA 3MZHA 4CHNA 5KYXB 4LDWA 4XU1A 3JRIA 3QBYA 1YOVB 1LAWA 1I6HJ 3JB9H 4KT6A 1VQ9N 3DLLL 2E8AA 5AJ3K 3OJUA 4DQQA 5LFAA 3BT9A 1UE9A 1Z67A 4CDGA 2LRQA 3B6AA 5J1YA 4M75E 4CSWA 3ME9A 2XSDC 4HVJA 2DO3A 2XV4S 2V1RA 4BRHA 3GZ5A 3AVIA 3ULEB 5B1AH 1XNQK 1JT6A 1H8AC 3VPZA 3AVFA 4IL6C 3MX5A 3CETA 4H0YB 4DFKA 2JK3A 1IDYA 5DCFA 2HHHK 3TU4K 1WXTA 4WE1A 1YS6A 2EFOA 4KFBA 3MMVA 4F04B 1U5TC 3VA0A 5GMKj 4D6WA 4NZGA 2ADUA 1H88C 1HQUA 4WXHA 4ZC3A 2DOAA 3VA3A 5LHIA 4MLHA 4UUTA 3WHBA 2E1YA 2LREA 2DW4A 3F21A 1AU7A 2DXTA 1C0WA 2CUDA 3P8HA 3CCET 3N05A 2A41A 1IO6A 4QVZA 1G8XA 3GOXA 2ZJPL 4BAYA 1HKCA 4BREA 3THKA 5K7ZA 2IGMA 2AK5A 2VT2A 3V1OA 1MSFC 1B4AA 1WI9A 3WTZA 3N97A 2AZSA 2VKDA 2CP6A 1JKQC 1TUDA 4LFUA 1XJWB 2W7NA 4DR1K 5TISC 3HHHA 1WSHA 2DRMA 5K7FA 3BG9A 5D5UB 3V6DA 2EJ9A 4DG1A 2FRYA 3NGZA 3J80K 5CKDA 1MBFA 5KCMA 2R7SA 2DY4A 3VRYA 1ZSGA 4B3OA 5AQJA 3QXEB 2X1EA 1YJNA 2HNYA 1VQMQ 2RAEA 1KGSA 2A3ZA 4EAHD 3FE1A 3F8NA 3E2UA 2P9UA 2R58A 3R2XC 3J81Z 1ONVA 4FLXA 4GNIA 5A0LA 3BZKA 1MJ9A 4RGXA 2XUBA 2ELKA 2VBYA 1K78A 3F23A 1S9HA 3O08A 2PTKA 4PUOA 3LYIA 3P1GA 1GDTA 1M8MA 4M7AB 2P51A 2CGJA 1IG8A 4OMOA 3CCJA 1A5XA 2RC4A 1TUCA 4KHPK 3A8HB 4WF2A 4J7FA 4A3LJ 4L9NA 2YU3A 2DK3A 3ESWB 1X19A 5F1RA 4MTDA 3FKIJ 3BUZB 4BWMA 2RN8A 4DB3A 3LAKA 3DKMA 3HRSA 2O8EA 1OX8A 2LR8A 4EZ9A 2FBHA 3WTUC 4BI8B 1GLAG 3CM6A 1PRLC 3CCVA 2OYQA 2V1UA 4OPAA 3VTIA 2IA2A 3LP3A 1L3VA 4PUSA 1UJ0A 2QWOA 4DNCA 1VK0A 3KZBA 3A02A 4ZDLA 2O4XA 4FISA 2P5LC 2SRCA 1Y8QB 4CHYA 3LM9A 4OWRB 2EH3A 5AQQA 3A5ZB 2MFZA 2DO7A 1GBQA 1T33A 1HKQA 2XB0X 5E1XA 3HXMA 4J2EA 2MA3A 1KONA 2RREA 3MQ0A 3NGIA 3EGDB 4M9SA 3LSIA 5FJ8J 2EQJA 4CGIA 1OQKA 3NWSA 1MKMA 1ABOA 1Q7YU 1RBRA 3E97A 1GCPA 2EQMA 4FM4B 2RQTA 2KZVA 5FRNA 5HY6A 1TLHB 2EZKA 1YYVA 3O9RA 4KT0E 1M1KR 4C2MJ 1YQMA 3ZBDA 1GCQC 1S5JA 1JLEA 4M63C 2F2XA 3ZT2A 4A3BJ 3PIOL 2DPUA 3CD6I 1Y07A 1JLQA 1Q1HA 4Y17A 1FWZA 2JXBA 1X1DA 1U04A 2HF3A 2VPRA 1V4TA 2E41A 1JLFA 3NGPA 3FDRA 1IBMK 1LW0A 1CZAN 2EQRA 4BJTA 1IG9A 2WC2A 4YOVA 2LH9A 3S1NJ 4YFUA 4XAXB 5CVRA 4D8KA 1PKTA 2E71A 4G9YA 3K5LA 1JGSA 1EF4A 2Q0OA 2VI6A 1YS7A 2F2EA 3RMQA 2P6TA 1U8RA 3UKGA 1HK9A 1RT2A 2JWKA 4FW2A 3LFUA 5TKYA 2HQ5A 2JQ7A 1AZGB 3AL0C 1QW1A 3DXMA 2QEXN 1JJ6C 2BUDA 3IL2A 1SEMA 3D2EB 3IAS2 4UVBA 5D5WB 1RNLA 4NBQA 4ISGA 4B1YB 3HHTB 1VQNT 1YBYA 3SUNA 3SI6A 1J5OA 1X6OA 3WQUA 4ILGB 1B07A 3QYHB 2H8RA 5AZIB 1JTXA 1XTAA 2CGPA 3HTSB 4A2UA 2FBXA 1ARKA 2M34A 3EDPA 3VQPA 3RYPA 1MHNA 4UVCA 3CCST 3ASMA 5CK9A 1NTCA 5HODA 2JVHA 3O3KA 3HOTA 3PMIA 1WN7A 3A2FA 3T9NA 4YOUA 5HS9A 2P9PA 4FL9A 3F10A 5KH6A 2IGOA 3ASOH 4MEYF 2NOEA 3GO5A 1ZX6A 2QWLA 1QVFA 1KAXA 3LDOA 4Q4ZF 4AD9A 2ABKA 1O57A 2XF7A 3HDDA 1P92A 3LH0A 3CPWA 3I0RA 2Y30A 3CWUA 1H9TA 1K9AA 1N9SA 2JOYA 3A0IX 1HKTA 5ECAA 1X2NA 2BVMA 2XI9A 2I0NA 3H9NA 1VQKN 4HVUA 3HZJA 4PGHA 5EX5A 2YHAA 4CEEA 5FPMA 2R4GA 3FGUA 2IXSA 2KRHA 3HRTA 3I55T 1K1ZA 4CCJA 2WAFA 4KISA 1X75C 1QHHD 2M16A 1VZ0A 2F5VA 3JAME 2DXUA 4Q48A 4XLAA 1EA3A 4ID1A 1N33K 4C3HJ 1VQKI 2WV1A 2KT0A 3KXTA 3CCQA 4HG2A 3RR7A 4XTZA 1ODDA 2XB5A 1ON2A 3G73A 3H35A 3CUQA 2MK5A 5GTIC 3JB9F 3LX7A 2BY0A 3JR9A 3SB2A 4IZZA 4FWPA 4CF2A 3D2FB 4ENKA 5D7UA 2AT1B 2W57A 1K73C 1Z05A 2JTEA 3LL7A 1TUUA 3AKZA 3G2BA 2AXLA 1NK5A 2M8EA 3A1YA 1WEGA 3EHQA 4LFAK 3MMYB 4B9WA 1WH5A 1D1BA 4CFCA 1I27A 4ZTFA 4YY3K 4IVNA 3VQEA 2CUFA 3C94A 1SD6A 4JX4A 3G71A 3SYZA 1W0HA 1OYXA 2V9VA 1BU6O 1FOXA 1S72I 1QLYA 4IRHA 3TMOA 2EFNA 2DOEA 1LMZA 4F7UG 4E47A 5CVIA 1E4GT 2VJ5A 3DBRB 5LJ5g 3SV4A 3VEVA 5GAGP 1TU0B 3CQXA 2EIMH 2OA8A 3ZOBA 3DLHA 1WSIA 2M30A 4CFAA 2LKSA 2V9PA 2I5UA 4C92B 2BDPA 4NC8A 2ESHA 2X6NA 3TOAA 4BBRJ 4M3XA 2RO0A 2K3FA 1JJ2S 4A63B 4LXCA 2K86A 1Z3XA 2BZYA 5LD2C 3CDHA 4W1UA 3Q0VA 1V4RA 1EWRA 3G6EI 2V1DA 2WV0A 5JLXA 2D0NA 3GFLA 3L3VA 4H0OA 3DMJA 2FD5A 3F70A 2AZVA 2HKQB 3QDKA 4M4ZA 1QVGM 4MFBA 4EFHA 4FW1A 4ISEA 2NWMA 5F0CA 1RT6A 2VGMA 1E6HA 1K61A 4YFNF 4KPYA 1OQYA 1U78A 2HQXA 4FJ9A 1N8RO 3QIIA 5HS7A 1B1BA 1KAZA 2JA8J 3OL3A 3BDDA 4YOXA 2B0LA 3AAFA 1XQPA 4KO0A 4YOTA 5LJ5h 1QSYA 2FOKA 4YOQA 2NVYJ 3D5LA 3E9OA 4C8QG 1GLLO 4MDBA 2NNWA 2HSPA 5A2QO 4BDPA 1CF7A 1TAUA 3M0SA 2VQHA 4DFMA 3S14J 4HSRA 2LNVA 4OFAA 1WPYA 4BRLA 3PVLA 1AZEA 2L3PA 2V8JA 1QVGA 2RHXA 2DI3A 4FJGA 3IS9A 3K4CA 2KZZA 2VQFK 1PWTA 2G8VA 2PY5A 1VF9A 2ZPIB 4BQOA 5LL6S 3CCLN 2NRTA 2NRWA 3NEUA 1YHQA 4B21A 4DYQA 5ERIA 3RMAA 2EBIA 1Y8RB 2X0LA 4P96A 4A3CJ 4E7KA 1BM9A 1LFUP 4M77A 2WAQN 3DTIA 1CXUA 4DTSA 4XIDA 5KGXA 3CCLI 3C6TA 4EP4A 2ENMA 1D4XA 3AG1H 4JKGA 2BE5F 1KSPA 1WFXA 4JV5K 3SWNC 2Q0RA 4H0TB 1MGTA 4ZN3A 1ZRCA 3N0UA 4NC7A 5GP9A 1UHCA 2A61A 4H03B 5C4XJ 3EG9A 3C65A 1FIPA 3RTVA 3G0QA 4DBRA 5GAMd 1FY7A 2RJDA 3WT0A 3CIPA 5JLWA 2GELA 2KE9A 1JHFA 4XLNF 4PWDA 2PQWA 3CXCS 2NYXA 4B08A 3IP4B 1W70A 3L2QA 5IHNA 4I6MA 2V7FA 4XORA 3TEDA 3DLLA 1KC8C 3EUHC 3VMFB 3K1PA 4CZEA 4H0EA 1YX5A 2EYWA 3QWLA 2CH6A 4CZFA 4CUGA 4HVWA 1W7PA 3MX2A 2P6SA 6AT1B 3A01B 3DRSA 2BIVA 3H08A 2FPFA 4M7DD 4B9VA 3H5NA 4N9HA 1LFPA 3OIOA 4ZJZA 4OB3B 3HRMA 2A7YA 2VQGA 2UXNA 1LEBA 2O88A 1F21A 2ZJ2A 3CC2N 1NK3P 3IV5A 1T05A 2P9IB 2H56A 4CJLA 2O03A 1Q7YR 1NEBA 1YG2A 3G0ZA 2A5WA 4RTXA 3ZT0A 4MZMA 2FA5A 1RZ4A 2I5WA 3TKYA 4FE4A 4BQZA 1UELB 4A5MA 1GLDG 1Z6TA 3CC2I 1KQSP 5AQKA 4M3DA 2VXZA 4MDWA 2GBQA 2D2WA 2OAUA 4DUYK 1Y71A 3PNWC 4EMGA 5HS8A 4DFPA 4YRVA 5D4RA 2AP1A 2HMPA 3TW7A 2HS5A 1TW2A 5CVUA 1EIFA 2OPTA 3QU3A 1K0XA 4K41A 3DRPA 4FWSA 4LOCA 3CF5L 4QVCA 4RMNA 5GIPA 1WI7A 2MF2A 2O8FA 1QQNA 3JB9I 2D0BA 1PNJA 1GXIE 1G3SA 2A40A 4J6WA 3PQJA 1MDMB 1U47A 1JKPC 4C0FA 1D0YA 3WTSC 1ETXA 1RRQA 1B9NA 2GWJA 1YHQT 2G8HA 2Q8KA 3CCEQ 2JTFA 2DDAA 3WEEB 3I59A 4II2A 4DYRA 1NGGA 1KG1A 2JZ2A 1O7FA 5LLQA 2XY8A 1TK8A 1DPUA 2TCTA 2CG4A 2J05A 2IDOA 2EYQA 3U23A 1B8IB 2E6NA 1R49A 5KYUB 5M3FJ 4BBSJ 4OKEA 5LJWA 1YN8A 5JLHA 2G7HA 1X58A 1EO1A 2VQEK 2WSCE 4JI2K 3LM2A 4KHUA 3GTKJ 2UUAK 2HQHA 4LLLA 1ILYA 3I0SA 4ESJA 3WXMB 3ZL7C 3E5UA 1LVAA 4YPRA 3W2VA 3FB9A 4A54A 2DETA 2O8KA 2QGUA 3I56N 3ASKA 5FLXE 1HR0K 4C8MA 3FXRA 5LHGA 5JS1A 2PJRB 1A5VA 5GAN5 1V4SA 4KIBA 2NUZA 1ULYA 1YJNN 4IF4A 4HQEA 4CFBA 4NUBA 4AG2C 1KD1O 1OFCX 2K6DA 2OTJN 2Q2EA 2LSNA 4CZJA 1NG6A 3LA3A 4JNEA 2PUOB 1PUFA 4AFZC 3L8BA 4M7AG 1R23A 1ZG3A 1MWMA 1VA7A 3OR1C 3VOVA 2BGCA 1YJNI 5GAN6 3NQOA 4KIFA 4KMUX 2CW7A 3L2ZA 4C2TA 1XQOA 1U2WA 3HPHA 3HC7A 2KPMA 2NOIA 4EJUA 1QHTA 2K2VA 3G10A 4W5TA 3ZSZA 2Y9YA 3O8VA 2Q3SA 5I2SA 1N25A 1R00A 3U21A 4BHBA 1B6AA 3N5NX 3JREA 1HPZA 2CH0A 2Z3YA 3FX3A 3OIPA 2Y9ZA 4QW2A 3C95A 2KTQA 4CGHA 5HDKA 1S1UA 2L3SA 3EO3A 3CCJI 4O4GA 1OI1A 2Z16A 3QEVA 4XRSG 2MAMA 2OU2A 3VETA 2YX7A 4BY6C 2I7NA 1VQ5A 1D3BA 1HSJA 1VSHA 4EJZA 2DEUA 3F9KA 3L42A 3DXKA 1ETYA 3FMSA 1NEGA 4HUGA 2BVLA 3DI6A 2NOLA 3NTHA 1ZC6A 1CKAA 3SMSA 1X01A 1H641 1TT0A 3VSLA 2K3XA 1OCCH 3OYGA 1UOCA 1IRZA 4QS7A 3JS6A 2A6HF 3O8HA 3LZJA 2D8HA 3M1EA 3CCVI 4EM2A 3AGRA 4C23A 2DMNA 3M3ZA 2ED0A 2DTIA 3O9SA 4KAZA 2WA0A 2KIMA 1Q9XA 3CESA 1RETA 2LLKA 5J2NA 2E20A 1OEBA 3GNFB 3CW7A 3ALYA 5AQNA 1VNDA 4XN3A 1VFCA 4HSBA 3CMEA 5CJ9A 5LJVA 4KKOA 1SMYF 5FLXK 5CYQA 2DAOA 1ZK8A 3PO2J 3NAUA 2Y48A 2WB1A 4CICA 4CZHA 1GV5A 4M78D 3EG2A 4L18B 2KHOA 2IBDA 4LFCK 3VDXA 3MEUA 4UVAA 3VQ5A 5KAFC 2VJIA 4M9XA 2QWPA 3ZRGA 4F52A 5FB2A 4O8KA 1V5GA 4IJAA 4DA4A 2RN7A 1NLOC 1K9MC 1Q86O 1NGCA 3JAMZ 5LJ3d 3S3MA 3KYLA 4MFDA 3T1AA 5GMKh 1VQ8A 3EHRA 4Q0BA 4O0IA 4XEIA 5GAMf 2IS4A 2E5QA 1WSJA 1NE8A 4UQGA 3T19A 3L4IA 1X4OA 3E6BA 1JLAA 4H4KC 3HSBA 3K7AJ 3VRZA 1UG0A 2SEMA 2NOJB 2F96A 3PIPL 1ATSA 4W5QA 1OPCA 3WGIA 4R0KA 3S15J 4RW6A 4PLIA 1D8JA 1X2KA 4N4NB 1M3CA 1G15A 1VQNQ 3UNGC 3KWIA 2CDTA 1HU0A 4QS9A 2XVCA 4EMKC 1X3ZB 3I4NJ 4M77F 5DPKA 4KN4X 3M1FA 2DEQA 3X20B 2ZMEB 2QA4A 4IX7A 2KZGA 4CJPA 1VQMN 1KQ8A 2AHJB 3ZQGA 3MDQA 4DSJA 1SKSA 1CXQA 3CCSQ 1VQ5T 3Q0UA 3CBMA 4FYXB 3A5MC 2XICA 4BR4A 2PN6A 4Y4RA 3R0JA 3KIOA 3SZGA 3PMTA 1D3YA 4BI3A 1UHFA 4BNCA 2HBPA 1TZLA 1K76A 5CHIA 4BROA 2DXIA 2VG7A 4JDSA 2ZD1A 3ZQHA 4OX9K 2K4YA 3DLLF 3AG2H 1W36D 1ZLMA 1RAIB 1RGIA 1T56A 4RM3A 4MMLA 1PU7A 1TAQA 2PQ8A 4B9XA 1HPMA 1HNVA 2LP5A 3I55Q 2VIXA 2ZXJA 5C0YA 3NAEA 2L5QA 4KUIA 1X4PA 4B9NA 3WTWC 5H1SQ 4CYDA 1JUSA 2P9KB 3IFRA 1UGQB 1T3VA 4FJMA 4YTLA 2BXZA 2HW3A 1KQ9A 3SXYA 4K25A 2WUSA 2XGXA 3QICA 2YXYA 4KGVB 5GAN7 3U3YA 3H3ZA 1AVZC 3CJ9A 1FSEA 3QAHA 3SPZA 2HTJA 5KN8A 3OYNA 2Z5UA 1RT4A 4Y92A 2UUZA 5F6FA 4F7UF 5K1YA 1Q81C 1QZYA 3KYCB 4LDUA 3ZEUA 5BOXA 5FPEA 2DK5A 2VKHA 3BG7A 4A4KA 4Q5SF 3CCQI 1XX5A 1ZTRA 4JJDA 1KQ2A 2GTJA 2O5RA 2ZJPF 3GDQA 4O5FA 1NPPA 1VQ7N 1SF9A 4JLHA 2EX3A 3BF1A 3M8EA 4KI6A 2O8BB 2DMPA 1BJAA 2MWPA 1UA0A 2GXGA 1TWCJ 2EK5A 3W6JB 2QZ8A 1MA9B 4B43A 4AI5A 1MH3A 4FO0A 4XOTA 5AZJB 1VQ7I 1JRIA 4II1A 2ECZA 1YVNA 4ZYEA 1P2FA 2X3WD 2FSKA 2IOCA 1BI2A 5BQTA 1DP7P 3EGDA 1U9NA 2Q31A 2QA4T 2OJ2A 5IPAA 4C92G 3G71I 2JA6J 5DCMA 1YWOA 4FVMA 4ZHRA 4E7ZA 2COBA 3S8PA 4HX4A 2W82A 3SAFA 1OVYA 3K5OA 4JJNK 5BN9A 2NVUB 5GAMj 1WA7A 4E2FB 1QCOA 3CQ8A 4QKUA 2D5RA 3CC7A 3V8LA 3WG7H 3JV3A 2WADA 3TOBA 1YE9A 1FTTA 3M0PA 5J6XA 2DN0A 4OFHA 5CKBA 2MWOA 2NOGA 3EKSA 4ABZA 2ZGYA 3RYRA 1HOMA 4YFXF 4HTUA 3VTHA 3HYFA 4RWTA 4YFKF 2RNAA 3AGKA 4AHSA 1O3SA 4NO7A 4H5RA 4WQ4A 1VQPT 1TOVA 1ZBSA 2GFUA 3BY7A 5F0FA 1VRLA 3O5ZA 5EGOA 3ABLH 4GW6A 3FZVA 3I4MJ 4FHTA 4FM0A 3DQVC 5AQLA 1EX4A 3KP4A 1W1WE 4DFJA 4XSZF 1IGQA 5HP1A 4KYWA 1O7LA 1ZHIA 2VJJA 3M0RA 2JG6A 3D2EA 4OB2B 5FWCA 3K1MA 1QNTA 4OU0A 1YUWA 4O0JA 4GYGA 2K5LA 2QK0A 4ELTA 2D0QB 3VGKA 1R5ID 1KC8U 1G3WA 2F5KA 3NWTA 1X9WA 3FK7A 3DLBA 5GAEP 3ZQIA 5JVGF 1KU2A 4A59A 4FYVB 4Z6YA 2BE2A 3TEEA 2H6BA 2R7YA 4QQDA 4BGAA 4KA4A 1KU7A 3CFOA 3URGA 4B9UA 3KP2A 2KROA 2E88A 2F1LA 1UWBA 1S1VA 2EJFA 4CJUA 2HR3A 5LJ3f 4JQFA 5GJWB 5C25A 3QRFF 5GIOA 2GV9A 1H1VA 2OTLA 1U1TA 2QG9B 4JLIA 2L9SA 1Y0MA 4CW7B 1X3UA 2KKOA 1E3HA 4KTZA 2HZYA 1EFNA 1UGPB 4RG8A 1WJQA 3CFRA 2CW8A 2W00A 5LJ5e 5GAOl 4CFDA 4FSSA 2VWBA 2BUPA 2HSTA 2X4YA 3O8GA 4I01A 2VYPA 1O1WA 3JXUA 2CZ1B 4IFVA 1HW2A 2G7UA 3LWLA 5FRMA 3A8GB 2EZLA 3CC7T 3CCRA 2K3YA 1XS9A 4I2PA 2DL7A 3META 4BQLA 3CC4N 3ZSWA 3JRHA 2ZFWA 1WLJA 1ACIA 4M6YA 4BG9A 3ZEHA 2LTPA 1RCHA 1JL1A 2DTUA 3MP8A 3ID8A 2FE3A 5EG0B 3QU6A 4BQQA 3QOEA 2K40A 1VSIA 1OH7A 1I39A 3CC4I 2R3SA 3M4GA 1B34B 3ZLJA 3J7AO 2M1HA 2H27A 2YX6A 3F3XA 1K6YA 2YUSA 1TC3C 4UB6C 3D45A 4EIAA 4ELZC 5H6QA 1TK0A 1FSHA 4AIKA 2KZMA 4M3ZA 2DPNA 3TARA 1U49A 1H9GA 1XN7A 3FMRA 4X34A 1Y96A 3SMPA 2P0KA 4RTVA 5GADP 3M3YJ 3JRDA 4JOMA 4YEJA 3INZA 1KG6A 2X9HA 4FYWB 2HAXA 1LOTB 2BXYA 3RBBB 4CZIA 4NOYA 1U5TB 5CQYA 3SUQA 1R22A 2KYMA 3AO5A 1YHQQ 2E1ZA 4C8QD 2DBMA 3A0BC 3IH7A 3FF5A 2QTXA 3FJPA 3IDHA 3S16J 4A3KJ 2W48A 4NCBA 2GBZA 2KRNA 3JRAA 4HBLA 1AWOA 5D6WA 1IRFA 3U9GA 1RT7A 3BTCA 5KPZA 5KHDA 2E7XA 2IRFG 3RPUA 4H5NA 3HOUJ 3WNFA 2F69A 5EXWA 3KP7A 2EPDA 2YV0X 3HPWA 1VQ6T 3NFCA 2OTLT 5C24A 1T44A 3D0SA 2HDCA 2H1KA 3FXQA 3X24B 1XG1A 3D6RA 3Q7BA 3RMBA 2F2VA 4C1NI 4YORA 1PVSA 1WJAA 1GVDA 5EOYA 2EGEA 3PFYA 4A69C 1WJBA 2L9RA 2VC8A 5AFUH 3PNTA 1OCZH 2LT4A 4PK4A 2C06A 3MZ8A 4NB5A 5LY3A 2KSSA 4MO7A 3M6GA 1TV6A 2LQ8A 1QO0D 4Z02A 4F7UE 4PJOG 2E5ZA 2NZTA 4LDXA 2BH1A 4IWVA 1FMVA 3H8ZA 2RJEA 5LJ3j 3V9WA 4OJRA 1K73O 1ZAOA 2DLLA 1HCRA 4LNPA 2ZPEB 5J1RA 3VYHB 2O8DB 3DV8A 5BPDA 1MV0B 3OIQA 3OTOK 2OQGA 5IYBJ 5GANe 2EWNA 3VPRA 2GTOA 1APLC 4O8UA 2FL7A 1TWBA 3MEEA 1BBYA 2HNDA 3EAEA 2X6YA 3BY6A 2ETJA 5IT9E 4C3IJ 3DOKA 3ML6A 4C5HA 4IUQA 3VF6A 3GMEA 2P81A 2FBIA 3H1VX 2VWFA 2CV0A 2I5JA 3CCYA 2A1SA 2KMUA 4ZGJB 4FM1A 2AO9A 1JXEA 1PG5B 4L0ZB 1XC5A 3BE3A 2ZJQF 2AKLA 3SZPA 5E3NA 3DEWA 4GV3A 3LGLA 3CUOA 4DR3K 3OYJA 4B1RA 4N47A 4FJJA 3LFKA 2GBYA 2FVUA 1KQSS 5DY9A 5AQMA 4RTUA 1NJWA 3ZSRA 4OF1A 2J6KA 2H8HA 1IV8A 2VXEA 1BHLA 3A01A 1MV3A 4Z89A 3ZMDA 1YCYA 2P9LB 3TSPA 5DTDA 1YJWT 1BIUA 4XLFA 1I1GA 3UIQA 3JTGA 4OVLA 4J9GA 1NM1A 5CR4A 4DF4A 2VODA 1FMKA 5ADXA 4KTWA 2JS0A 2EA4A 4J8OA 1ZN2A 2P9NA 2IVPA 3RKQA 2M0CA 3NF6A 4WX9A 3CCUT 2QKLB 1VSDA 3NTKA 4M41A 1ASVA 5E3OA 1R5GA 3RSNA 1TQPA 2HSEB 1GT0C 1GOBA 1WJEA 2JA2A 4QIWN 1BOAA 4JYKA 1O13A 3CMEI 3M0UA 1UJ8A 2DERA 2F9WA 2NRHA 3CCEN 1R58A 1MMDA 1YJ9T 3HBTA 1RLQC 4KICA 1LNXA 2E65A 4MLOA 1W2BM 1BW6A 1VQ8N 2W0ZA 3HT3A 4IOAF 1OU8A 2DD4A 4HAMA 1TT5B 2MCNA 5IWAK 2ATCB 5IT9K 2KIQA 4RCBA 1R71A 4FWOA 3L2UA 3SDBA 1TL8A 3JB9D 4WWCA 5C4JJ 4A4GA 5EY4A 1REVA 4BR5A 3THYB 1TKTA 1VQ8I 2BANA 3AL0B 2QYZA 1T0JA 2D0CA 5M5YJ 5E1ZB 4PJJA 2EB7A 2L01A 3OL4A 3MKZA 3HSFA 2KHMA 1F36A 1ZBXA 2X78A 4WYBA 1YIJA 2LNHB 2LMJA 2VGNA 2YSQA 1NJYA 4EA4A 5KYUA 3CJCA 3QQAA 4BGDA 2WSFE 1V29B 4IXCA 2EAYA 2YNGA 4QOZB 1MBGA 3RDVA 1VQ5Q 2DA2A 1KC8R 1YXQA 3QWXX 1W2BA 1ETKA 2BOLA 2WY8Q 3RPQA 4DS5A 4BR0A 1HRHA 1T6CA 3EYYA 2KIUA 3O4NA 1HNZK 1W0UA 1KC8O 1NJIU 1C1AA 3THWB 2IIMA 1PM3A 1B3QA 2NS8A 3NARA 2WACA 4QQ6A 1CLQA 2PJRA 1HA8A 2CV2A 3ID6A 3P38A 1WKMA 3P8BB 3G4SN 1TWFJ 2K79A 1KYZA 3O1BA 4RUGA 5GMKe 2FF4A 1VQ4T 4O44A 4U67L 3G1OA 4JI1K 5JICA 3OYEA 2L54A 1KG3A 5JS2A 1RUWA 1LE8A 2RD1A 5IAYA 4TVRA 1L3TA 4M7DB 5KYNA 3G4SI 4A0ZA 1YIOA 1WQ7A 3VKIA 1Y57A 4DS4A 3ENHA 2GWKA 2ITMA 1NZ9A 2A07F 4A5BA 4WCIA 2A6AA 3N4MA 5DM7R 3CUQC 2HVIA 5HK3A 1U0JA 4LIVA 2L7MP 3FHFA 3QFPA 4ESRA 2DM1A 3OW2M 2KR3A 3QOPA 2HHVA 3M5RA 3E3VA 4D9JA 2DOFA 2WY7Q 5CYMA 1N36K 4S0HB 2HFHA 3WTTC 1MUDA 1BG3A 5M9OA 2ZCWA 1VHXA 2FLOA 2ZQBA 4WTOB 4RW8A 2JT1A 4IKFA 3O3FA 5SZTA 4DQPA 5ICFA 2EKHA 3KP5A 2RI3A 1HUXA 3LSTA 4B8XA 3MXJA 2GOXB 3BP8A 4FWMA 2YPRA 4JLGA 2FEIA 3H6ZA 4D7NA 3HM5A 2PAVA 2GZWA 2W10A 1RKWA 4L9VA 3ECOA 2JT4A 3OOUA 4OIQF 3KWGA 5IOYA 3S2HJ 3VW4A 4B48A 3PGGA 3OW2A 4OIPF 1ZELA 3TP3A 2ISYA 4H4MA 1S29A 2QA4Q 3ZMVA 5ED4A 2H09A 2FNAA 2R7VA 2BW3B 4GMJB 4A3FJ 1F1BB 4BEHB 4M75A 3GE1A 2HQAA 4NCGA 3H1QA 1B72B 4M7AE 4IO9L 4RMOA 4GY2B 4FWRA 2PJPA 1S8NA 4FT2A 1I3QJ 4XR6A 5DEQA 2JHNA 2V8IA 4JI6K 1QZ5A 1ZGJA 1YW8A 1FN7A 2DK8A 4A0XA 1JT0A 3FC3A 3VS4A 2VCPA 2QM3A 4CYCA 1VQOA 1YQLA 5KN9A 2FZGB 3H0FA 3VEZA 2DYIA 2E4HA 2J5PA 2KRCA 3RIRA 1YITA 3E9GA 1WRJA 2KLOA 4CEAA 3FZMA 3SWNA 3QJ6A 1VQPQ 4BU2A 4CJWA 5GAN4 3UKRA 1WQ2A 1O3QA 1VQNN 4HYEA 2DVEA 4KN7X 1OPLA 4I2QA 1UTIA 2K9GA 1Q1VA 2K9MA 2A6EF 5AONA 3K9TA 5GMKm 4IDKA 1HNIA 5E79C 3CM5A 3MHXA 4E9EA 2PZ1A 4D1QA 1X3WB 4IHVA 4GGGA 3CMMA 2ID6A 3RESA 4RS8A 3CCSN 3EUHA 5GANd 3C6AA 1SG5A 2KW4A 3C7NB 1IN8A 3JCMP 3KTUA 2HD0A 1VQ9A 3WTYC 4X0GA 2D45A 3K2PA 2DL5A 3K4LA 1R9TJ 1MW7A 2ZPGB 4RKUE 1IUYA 3EFOB 1ASUA 2RPNA 1N3AA 3ZT3A 2ZF5O 4DOVA 2I10A 2D5VA 2VKEA 1RAEB 3HOXJ 3HL2A 3DLGA 1OVQA 1ZR2A 2O8CB 4A61A 3PL8A 5BMZA 3MEAA 4AMCA 2WTEA 5GAGJ 1XGSA 4DU3A 4WCEL 4LF6K 4U0YA 3V9ZA 4M77C 4NL2A 3I55N 5L3BA 1P7MA 2V7ZA 4DEXA 3PX0A 1G2HA 3F5TA 1YRNB 1ZREA 2ZXHA 5J47A 2M45A 2KFDA 1OYWA 2QK9A 3GTJJ 4B3MK 5D8LB 2DA6A 2O9LA 2W6LA 5FPNA 3KZYA 1BIZA 2NNNA 4JX5A 1UECA 4W5RA 3CQZJ 2KRMA 4DGWB 3HM9A 1UEBA 1Q82U 2YKNA 4BRGA 1BL0A 3JCMb 1P8ZA 1ETWA 3M0QA 5JVHL 4II3A 1M27C 2YLBA 5IT3A 2GNCA 1WGXA 2P9KA 1I5OB 2EV5A 5FKLA 1OX9A 1CQTA 3CC7Q 4PFOA 2FRHA 4HWIA 3O5BA 5GAMg 2HKNA 1U3OA 3C2BA 1RT5A 1MGQA 2DJNA 3FXKA 4M78B 2KXCA 1IUFA 1XQSC 1FBQA 3L0QA 3PY8A 4J7IA 3DOLA 1SAXA 4P5NA 1BL3A 5I42A 1K9MO 2D1XA 3BQYA 3OBYA 2QQ8A 2KRSA 1VRTA 3VQ4A 3UA6A 1D0XA 2RMOA 3PNYA 4NB4A 3KK3A 2HU9A 3HYIA 4BE2A 1ZSZA 1NK9A 3G3ZA 3LSRA 3CCRI 4AFSC 4FT8A 2PNIA 3EYIA 3WXKA 1LUJB 5B8HA 5FU7C 5HLHA 2QQBA 3KYDB 3FBNB 2O8BA 3HRUA 2E35A 4X6AJ 4JN4A 2MC3A 4HKEA 2XY6A 1RDAA 1ZUUA 4WFBL 3DPTA 3CZ6A 2RJFA 2VV5A 2QWRA 1IXSB 3PE0A 3SEQA 3LAJA 2VOPA 3GNGA 3EGXB 3M8RA 2WSEE 5K14A 2W41A 3SZTA 1MBKA 5GINA 2V1QA 1N77A 1K8KB 4C8KA 2AXTC 4CEDA 4CC3A 3J7ZI 5KYYB 2PBIA 4JI5K 1ORPA 2E1HA 2D6FA 1X27A 4A5AA 1KQ1A 1VUBA 1FT9A 5JVTA 1WBBA 5M1QA 1QU3A 5BS6A 2LJ3A 4J6XA 4PFZA 1NLVA 4G6DA 1J5EK 1V3FA 1JCGA 2AA4A 1Z21A 1SD4A 3KLNA 3OOPA 1VQ6Q 1ON1A 2OTLQ 3LWHA 2IW5A 5BR9A 3OQ5A 4F7ZA 2CP5A 4Z88A 2CFXA 4IHWA 2DPPB 4BC5A 1Z7UA 3MVPA 1X2QA 1TL3A 2IVWA 1NK2P 1BB9A 4RB3C 2VUBA 5IP7J 2JLEA 2Y1IA 4Q5VA 3FXUA 3ZSQA 2IJLA