3OYAA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and raltegravir at 2.65 resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyaA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyaA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyaA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyaA03
1YTUA 3HM9A 1C1BA 2RF2A 1SL0A 4FJJA 1WJSA 2YNHA 3NF7A 1RILA 3NFAA 3AVMA 1TV6A 1NK8A 3V9ZA 2R5AA 1WAJA 4CF2A 4CEFA 1KVAA 1TKXA 1C1CA 4DTSA 4DFKA 3UWNA 2OPSA 3HT3A 4FU6A 2HHQA 1DTQA 2OPQA 3LP0A 3SQ1A 2YNFA 4KI6A 5KRSA 2R7YA 4RW4A 3AO3A 3LZJA 1RDBA 3PFSA 2G8HA 2JGUA 2DFEA 2QQRA 1TK8A 4I2PA 5EU7A 3ZT4A 3PO5A 4M45A 3OQ5A 3L8BA 2L89A 5FROA 1GOBA 4F4KA 4NYFA 3KK2A 3AVFA 4RW8A 4KPYA 2FBTA 4CEBA 2RI3A 5CZ2A 3LALA 4AHRA 4JS4A 3O3GA 5C25A 4CFCA 4C5IA 1S9GA 4FLYA 3IAYA 3KLGA 3ZSZA 3QIPA 2WACA 3SYZA 4O4GA 4EZ6A 4CJTA 4IUTA 4DU3A 1H3ZA 1RDAA 3K2PA 1XWLA 3SQ2A 5KGXA 4X34A 2DY4A 1TK0A 1NK6A 1KTQA 2X6SA 4B9WA 4B08A 1CXQA 2HNZA 3MXJA 1HYSA 4HUFA 1TAQA 4Z4FA 4N4HA 3NTIA 1LWFA 2RHUA 4CHYA 4CEQA 1A5XA 4Y1DA 2RKIA 1REVA 1VSJA 5DK5A 2AJQA 3RMAA 1WSJA 1JXEA 2BIVA 2DIQA 3KK1A 1RT1A 1QSLA 5HBMA 1UAXA 4B9XA 3VQEA 3KUFA 1QSYA 3M8RA 4BWJA 1IH7A 1C1AA 2KW4A 4KB1A 4PL6A 4R5PA 3O3FA 3VA3A 3KTQA 3PY8A 2BDPA 4DQSA 3DOKA 3D45A 5SZTA 4C8OA 4PWDA 3PO4A 4CK1A 5HRSA 4C8LA 3MEGA 4LH4A 4Z4GA 4N5SA 2PYJA 1HRHA 3P8HA 1DLOA 2O4IA 4DG1A 4M3YA 1S5JA 4FZZA 3LYIA 2IOCA 3OJSA 4LD6A 4FCYA 1SKSA 4E1NA 4AHTA 4FJIA 3AVIA 3L2UA 3RWUA 4KB0A 4UQGA 3CFOA 3ZCMA 3VQ7A 4QAGA 3CFPA 4C8NA 2VG6A 3E01A 4CHPA 1Z26A 4CEZA 4N4IA 2RI2A 1G5VA 1IG9A 3HPGA 4EP5A 3TAQA 3T3FA 3LGFA 4IG0A 1WSHA 2YHBA 4RW9A 1WJRA 1YVUA 1KFDA 3DYAA 5FRNA 2O4GA 3VQAA 4AHCA 4MFBA 3NTHA 1KVCA 3SNNA 2X78A 3AO1A 4W5RA 4IKFA 4IUVA 5I3UA 3QEPA 2GFUA 4IFVA 5KH6A 3V4IA 2KFNA 4DU1A 1EXQA 2OZSA 3K5LA 2GV9A 1X9SA 3NF8A 3NTKA 4CJRA 1T05A 1DTTA 4K8XA 3QETA 1CZBA 1QE1A 1HQUA 3QIOA 3V9UA 4M3ZA 3L42A 1JLAA 1HMVA 2OA8A 4BDYA 2RJFA 3S3OA 4CGGA 1D5AA 1R0AA 1TK5A 1TL3A 1WSGA 4FK4A 1WAFA 1XHXA 3QKJA 2DFHA 1SV5A 3SJJA 3TANA 1KFSA 2A1RA 3S9HA 1JL1A 4DTJA 2E6MA 2P1JA 1VSMA 2MWOA 4KRFA 2KZMA 1X1PA 4E7IA 3OA6A 2QQSA 1ZBIA 1JKHA 4HCZA 4CCHA 4KHWA 1JXBA 1NK5A 4DSIA 4Z0UA 2L8DA 4IUPA 4DF4A 4FM0A 3MP6A 2QKBA 4GW6A 4FJ7A 1I3AA 2JLEA 4RG8A 2BANA 3P83D 3ISNC 5J1EA 4LY7A 5DMRA 1NJXA 4J2EA 5CIUA 3U3YA 2VG7A 2VYTA 1EX4A 3HYFA 3LWLA 4OKKA 2RHZA 1EETA 4JS5A 1JLCA 3NDKA 2JZ2A 2M1HA 4N47A 2RJEA 4CJSA 3QEXA 1T03A 2B4JA 4OGCA 3TAMA 4CGIA 4IDKA 2RHIA 3I8DA 3V1OA 2FBXA 2F8TA 4J2DA 2LCCA 4YFUA 3VA0A 4CJ3A 4HHTA 3KLEA 4AHUA 4FZXC 3MO8A 4CJVA 4FJLA 5KTQA 5JS1A 3PMTA 3F70A 3LGLA 3AVBA 2B6AA 2HHTA 3OS1A 3QJ6A 4FLTA 3EZ5A 2HVIA 4O0IA 4CK2A 4L8RB 4O5BA 4M3TA 4E7KA 2QKKA 1SL2A 3O8VA 2E6LA 1U04A 2YKNA 3ZSVA 4AHSA 4KTZA 5D3GA 4CJLA 1LW2A 4IUUA 4IBNA 2D5RA 2O4XB 1HYVA 1W9HA 3FDRA 3PV8A 2Q3SA 1SKRA 1K6YA 3SD4A 4C8KA 1HNIA 3IG1A 3NGZA 2IS3A 4I2QA 4HCCA 4UC4A 2K3YA 4CE9A 1WSEA 2CKKA 3ZT3A 4E7LA 4KREA 2BGGA 1BISA 4Z4CA 3SUQA 4OKEA 3HPOA 2RJDA 3LDSA 3PUFA 3QESA 1X9WA 3QINA 4B9MA 4DSEA 2RJCA 3PMIA 1ASWA 1U49A 1VSHA 3OYMA 4IG3A 4HCBA 4DSLA 4DTUA 3AVNA 3SV4A 1NK7A 3U3GA 3G0ZA 3MXIA 3LANA 3VQPA 3C95A 4DWIA 2G8KA 3V1RA 1WLJA 2LSNA 5HP1A 4DS5A 4I7FA 4M3XA 2HHWA 1BIUA 4O55A 1SKWA 1WSFA 3DMJA 2ZQBA 1L3TA 3V9SA 1NJWA 4E19A 4FJKA 3AA3A 3EY1A 1VRUA 4CF0A 1OYXA 1JLFA 4CHNA 3QBYA 4GVMA 3RRGA 2X4WA 1XC9A 4HUGA 1WNSA 4FLUA 4IFYA 3AVHA 2R5MA 2X35A 1NOYA 1C0UA 1ZBFA 3SUPA 2F96A 3NAEA 3PNWC 4OLAA 2M16A 4O44A 3MAQA 3AVJA 4DTXA 2ZE2A 4KI4A 4DQQA 1OI1A 3S3MA 4NCGA 3OYHA 1Q9XA 2P5GA 1RBTA 4BE1A 5KCHA 1QTMA 1RDCA 2BUDA 5CYMA 1RBSA 3MECA 2HB5A 4E1MA 3CQ8A 2ATQA 1CXUA 1JLGA 1RTHA 3ZT2A 3KKSA 1J54A 2FBYA 3SCXA 1RTDA 1NOZA 4Z4IA 3HPHA 2B8AA 4FJ9A 4E7HA 1O1WA 4JRPA 1HPZA 2XY7A 4A4EA 4CJPA 3RMBA 3ZEHA 3LX7A 3DM2A 3M8SA 2YRVA 4CJQA 3DLGA 4ELVA 2HHSA 2RHYA 1WJQA 4B9UA 4N4GA 4CJ4A 4FW1A 2GUIA 4F3TA 1B92A 3P1GA 4CJFA 4PY5A 1S1XA 2WONA 4Z4HA 3TARA 2ZD1A 1A5WA 4EZ9A 3LWMA 3I0RA 2X4YA 4NCAA 3AA5X 4QVZA 3AVLA 2JTFA 4FXDA 4C5EA 3KIOA 3RMCA 3DLMA 5J39A 3TAPA 1LWEA 1QSSA 1C0TA 3MEDA 5J2PA 1RT5A 3OYCA 3S3NA 1VSEA 1J9AA 3LP1A 2VWKA 1UA1A 4AH9A 3HP9A 3OYGA 3AV9A 4AILC 2D0AA 3L3VA 5HRNA 3MEUA 3OJUA 2EQKA 1J5OA 3LH0A 3ZSXA 3NBPA 3OYFA 3C6UA 2W42A 4PA1A 1HQEA 4XIUA 3MXMA 1ASVA 3SI6A 2YNIA 3A2FA 2IC3A 1LAWA 4FJGA 5CY4A 3UIQA 4Z4EA 2G8WA 2I5JA 5C6SA 3KK3A 5C24A 4DSFA 1ZBHA 4CF9A 1QQCA 4CHQA 2G3RA 2OZMA 1FKPA 3SPYA 3BDPA 3IS9A 1QS4A 3M8PA 2YV0X 3ULDA 2EX3A 1NK9A 2O4XA 2HQXA 4C5HA 4DTMA 4KHSA 2HHXA 1HYZA 2IGIA 1YTAA 3V9WA 1RTJA 4LH5A 4AHVA 3H08A 1VSFA 2RO0A 3B6OA 3LPUA 1RCHA 4MQ3A 1D8YA 4DTPA 2EQUA 2NUBA 4W5TA 3MEWA 3FEOA 1FK9A 3F9KA 2GBZA 1KCFA 3JYTA 3K5NA 3AO4A 3CM5A 5HRRA 4DQRA 4OPJA 1XNIA 5J2NA 2QXFA 4DF8A 2EKOA 1TGOA 2WOMA 3HXMA 3MP8A 2LDMA 4CK3A 3V81A 3OYEA 1JLQA 1BQNA 1T8EA 3HL8A 3H8ZA 3QO9A 1JLBA 5M9OA 1T7PA 3NE6A 3SZ2A 3DB3A 4QQDA 3RMDA 3NCIA 1EKEA 4FJMA 4W5NA 4BDZA 3ASMA 4H4MA 1TVRA 3QNOA 3K5OA 3ZSQA 4B8AB 3DRRA 3PX6A 2XY6A 3OY9A 4M41A 4BDPA 4CHOA 4F2RA 2PZSA 3TABA 2EHGA 3I0SA 4CIFA 4N41A 1BQMA 3K58A 2HVHA 3AO2A 4FJXA 3K5MA 4B9NA 1Y97A 4BD3A 4FLVA 3DLBA 4CERA 2GF7A 2F8SA 3CYMA 1J53A 4QQGA 3OYNA 4CGHA 3CFRA 3ZSRA 1VRTA 3NH2A 2Z1HA 2HHUA 5D6WA 3KD1E 3L2VA 3RRHA 1B9DA 1CLQA 4C5GA 1LW0A 3JSMA 1VSLA 3KLHA 3HP6A 3TAFA 3SQ4A 1KLMA 4OKJA 4HVJA 3CG7A 4E89A 1HJRA 3P5JA 4Q0BA 2X74A 4FJNA 2KZZA 4NCBA 1IKVA 3E9GA 3K57A 4DSKA 1FXXA 3VQCA 4O0JA 4IURA 1C6VA 1ITGA 2BE2A 3DLEA 2KFZA 3HVRA 3OB9A 1RBVA 3MEAA 3H6ZA 2Y1JA 1NJYA 3AVAA 4CJEA 1GOAA 3OS2A 4DQIA 4IUQA 2OYQA 1BHLA 4CHZA 2RN2A 1S6PA 4KO0A 3U6FA 1NK4A 2QK9A 1S1UA 2VWJA 2HW3A 4YNQA 2P5OA 1VK0A 1S1WA 5J2MA 1N5YA 3DRPA 4DTNA 2LRQA 1BCMA 2FC0A 3LAKA 3TAEA 2Z1IA 4QW2A 4CJKA 4LD0A 2FHDA 3VQ9A 3LAMA 4CESA 3T19A 5K14A 1WSIA 1KSPA 3IRXA 4II1A 4FM1A 3WNEA 4ZHRA 1RBRA 2R57A 3HJFA 4KHYA 3MEVA 3ASKA 3VQQA 4DLGA 3HO1A 1NKCA 3DLRA 4KV8A 2M0OA 4I9QA 2KQ2A 2VG5A 4LSNA 3SUNA 4GY5A 3LP3A 5D6XA 3HSTB 3ALYA 1WN7A 5KI6A 4PLIA 2OPRA 3SUOA 3OYLA 4PQUA 2ITGA 4ZTFA 3LLRA 4M42A 3KLFA 1RBUA 4QCLA 2E5QA 2HNDA 4K8ZA 3NF9A 1ZYQA 2G8IA 2IG0A 2Z1JA 4Q5VA 4CGDA 4RG2A 3MP1A 1GOCA 3L2QA 5T7BA 1ASUA 4KHNA 1KLNA 2HQEA 2EQJA 1TKDA 3OYKA 1IO2A 2YHAA 4KAZA 4HTUA 4QOZB 2BKDN 1LV5A 4OGEA 2HHVA 3L3UA 1WGSA 1MU2A 1Q8IA 4W5OA 3QEVA 5KE2A 2LTOA 3KKRA 3HK2A 1SSFA 1UOCA 3RTVA 3C4SA 3O3HA 3VQ8A 2XDPA 5E41A 4CRIA 5J2QA 3BDLA 5FRMA 4CF8A 3SPZA 3ZT0A 3TWHA 2P51A 2G8VA 4GMJB 3NGIA 3OYBA 2NLUA 3NH1A 3UT1A 4OVAA 2HNYA 4J2AA 4FL6A 2E6NA 1RT3A 4RW7A 1S6QA 2KTQA 3T1AA 3SV3A 4FZYA 2X6NA 1BI4B 4NZGA 3QIIA 5IAYA 3ZSOA 2Z1GA 1UA0A 3PX4A 3O4NA 5IN1A 4CECA 4FLZA 4CIEA 4FJ5A 4DLEA 3V9XA 2R58A 3P8DA 3LZIA 3TI0A 3C6TA 3EAEA 4CEOA 3OS0A 1XHZA 4FLWA 4E7JA 2P0KA 3AO5A 3KD5E 1B9FA 2X4XA 3AA4A 4WE1A 3L2WA 2XK0A 3QEIA 2YNGA 4KFBA 4FW2A 3NHGA 3DOLA 3LPTA 3L2RA 3NNQA 3ZSWA 4CF1A 2K3XA 2LVMA 2A1SA 1L3UA 4BE0A 3QNNA 4DFMA 1A5VA 2HMIA 4FM2A 2GFAA 1RT6A 3CEYA 4FVMA 1YT3A 5FDLA 4Q5WA 1RT2A 4H8KA 4M3WA 5J26A 4CGJA 2MWPA 2XRIA 3HVTA 4FJ8A 2XY5A 4RW6A 1U4BA 5HLFA 3VQ5A 1VSIA 1F21A 1Q9YA 3OYIA 2PYLA 4JLHA 2IAJA 3V6DA 1U45A 3O4QA 1SUQA 4M3RA 4ICLA 1W0HA 4DFPA 4L59A 4LSLA 4DQPA 2IDOA 4B9VA 1TKZA 1NK0A 1HNVA 4OJRA 3PX0A 4J2BA 2XO7A 2D0CA 1VSKA 1S1VA 4E0DA 1G15A 1UWBA 2RHXA 2DFFA 1VSDA 4ZTJA 2DTUA 3AVGA 4B8CA 3KJVA 4FJHA 1RNHA 4JRQA 3LP2A 3RR8A 1IKYA 5JS2A 4I9LA 3ZT1A 3Q1JA 5D6YA 1L3VA 3VQ6A 1N27A 4DFJA 4OPKA 1BIZA 1TAUA 4Z02A 3B6PA 4CGFA 1N6QA 3VN5A 5KGWA 4B9TA 1EP4A 3KLIA 1L3SA 3S6WA 4G1QA 5C42A 3DI6A 1TL1A 3AVKA 1BCOA 4QQ6A 3DRSA 3FC3A 4ID5A 3QLHA 4KHQA 4FK0A 4N56A 1JL2A 4Y1CA 1NJZA 4B9SA 1ZBUA 4B9LA 4CFAA 1C0MA 4H4OA 5CYQA 4A4FA 3DB4A 5SWMA 3G10A 3C94A 1RI0A 5CZ1A 3SQ0A 3BGRA 4OLBA 3ME9A 1I39A 3TAGA 1LWCA 2PY5A 4CJWA 1RT7A 1TKTA 4CFBA 3F73A 2EQMA 1JLEA 5KCOA 4F2SA 3V1QA 1ZBLA 4KKOA 3OYDA 4B3OA 4DTOA 3AA2A 1OZ2A 1L5UA 4EP4A 3VQBA 4NYNA 3WNHA 5HROA 1KRPA 4DSJA 5HRPA 3OYAA 1D9DA 3FLGA 4CIGA 4CFDA 3MEEA 2L3RA 1S1TA 1U48A 4N76A 3NGYA 4A4GA 4KTQA 4BE2A 3E9FA 4ID1A 3DLHA 3M9QA 1FKOA 2D9TA 1CZ9A 3OMCA 2PQWA 4CEEA 2RPIA 4FLXA 3D0PA 4ELTA 3THVA 1BI4A 1QHTA 3VQ4A 1MHNA 4FYDA 4M3UA 5C0MA 1RTIA 3K59A 4E3SA 3FFIA 5KRTA 1U47A 1KVBA 4DS4A 3CM6A 3RR7A 2ETJA 3META 2D0BA 4CJUA 5KE3A 4TSXA 4CEDA 2XHBA 1S9EA 3QERA 4BACA 2F5KA 4KHUA 4EDUA 4PLLA 2DAQA 3NF6A 4CJ5A 2E4LA 4ELUA 2Y1IA 4DMNA 1LAVA 4HUEA 3OVNA 4PUOA 1BL3A 4DU4A 4BWMA 4A4HA 3WNFA 1XI1A 4F3OA 1BGXT 3OYJA 5I42A 3VQDA 1X9MA 4DTRA 1RT4A 2G8FA 1D9FA 2XY8A 1IKXA 2G8UA 3QEWA 2DIGA 1RDDA 3ITHA 2B5JA 1NKBA 1Z25A 3M8QA 4C8MA 4CEAA 1IKWA 1KHCA 3DLKA 3ZSYA 4W5QA 3OMGA 3WNGA 1NKEA 2RI5A 2EFIA 2FBVA 3NH0A 1OZ3A 4FK2A 3GOXA 4F8RA 3EYZA 1SL1A 3TR8A 2YKMA 4OVLA 4KTWA 4NS5A 2OPPA 3AVCA
chains in the Genus database with same CATH superfamily
2IVOA 3VV0A 3HM9A 1JTXA 5D5UB 2CH4A 1C1BA 3DPLC 2RF2A 1LDJA 4FJJA 2NUTB 3AVMA 1P9QC 2KR3A 3GO5A 4C92F 1XMOK 2FXAA 3V9ZA 2R5AA 4C8QA 1WAJA 3BC8A 4CF2A 2OA4A 1T44A 2E64A 1RDWX 3CMEN 3WHCA 1TKXA 4MZPA 2PVGB 4IOXA 5DM7F 4PJ0C 4XKVA 3HT3A 4FU6A 4AI5A 3LP0A 2YNFA 4Z94A 1YWPA 4HG2A 3P9CA 3PIPF 4HXJA 1Q81O 3GOIA 4B1VA 3VS3A 3DTKA 2IS4A 3BY5A 2JGUA 2DFEA 3BJ6A 2QQRA 1RUWA 2Y4XA 1TU0B 2MLGA 5DLOA 4I2PA 3ZT4A 4M45A 1TWAJ 2W40A 4HLYA 4GV9A 4IXAA 1C0WA 5FLXZ 4J9HA 3KK2A 4RW8A 1K79A 2DX1A 5MLCQ 4CEBA 2RI3A 4DR4K 3HFOA 5JLFA 2YHXA 4DBQA 1QVGA 1CKAA 3F22A 1N6AA 5AIQA 3LH5A 3O3GA 3BDDA 4EJOA 1Z77A 3RDIA 4CFCA 1RESA 1S9GA 3IAYA 2ASMA 1D8KA 3QWLA 3ZSZA 3FXJA 5LJVA 2H3EB 2PNIA 1W6XA 4MDBA 1T0HA 4C0FA 4XL9A 3EGXB 4IUTA 4UVAA 2DCEA 2RHKA 4DU3A 4KA4A 1H3ZA 3BEXA 1PKSA 1LE8B 2VV5A 3HOUJ 3RPQA 5BPNA 1NK3P 2PBIA 9ANTA 3CQZJ 1KTQA 2MIOA 1YHQN 1B34B 4QIWN 5EG0A 4AM6A 5AQYA 1TAQA 1R22A 4N4HA 3DLLA 2QA4N 2KIQA 4OO1J 1UHSA 3HRTA 1LWFA 3KHYA 2NVYJ 4CEQA 1A5XA 3U23A 4Y1DA 2RKIA 1REVA 2JJ7A 1VSJA 2KLAA 2EZHA 1VQ9T 3RUXA 3WHBA 1XTAA 3WTYC 1CF7A 2IAIA 2BIVA 5A0GA 2XAJA 1RT1A 1QSLA 5HBMA 3URGA 4GRIA 3KUFA 3QYFA 1QSYA 1N75A 1T56A 4BWJA 1C1AA 4HQMA 4PL6A 2NLXA 1BC8C 2KZVA 2IEKA 1FOWA 2EFQA 2G0EA 2QM3A 2ZJPF 3T8RA 3JRFA 2BDPA 2O31A 1O3QA 2E5KA 1KZHA 5CKTA 3GE1A 2G9WA 2L3SA 3L1PA 5FKNA 2VWFA 4DQSA 3D45A 2RF0A 3AY9A 5JICA 3NGPA 2DTIA 5CPRB 3P8HA 5HS7A 1VQNT 1E17A 4DA4A 3O8HA 4PFPA 3WTUC 4B3SK 3LYIA 2L9SA 3V42A 3O9TA 2CP3A 4FCYA 4BR2A 1SKSA 1WX6A 4AHTA 1VUBA 3T7ZA 3RQ4A 4OAZA 3RWUA 3A8HB 1NGHA 4CZEA 4AD9A 3VQ7A 1UGQB 2VG6A 5AZJB 1DDNA 1NHAA 4I99C 4IJNA 5F04A 2KRNA 1QBJA 2XPUA 5J8FA 2Q97A 2NVUB 4CYDA 2V6EA 6AT1B 2IGNA 1VQLI 3W6KB 3AKZA 1TUDA 3HPGA 2VKEA 5ED4A 3S1MJ 1I1SA 3HUGA 1IXDA 1MWMA 2DPPB 4KT5C 4N9IA 3V8JA 3GWZA 3I56N 3WTZA 2XAFA 4C23A 1JJ2A 3SJMA 3ISPA 5F08A 2QSGX 1YVUA 3R0AA 2XGEA 5FRNA 4BKXA 1NE8A 1OFCX 3H41A 4A53A 3EE8A 5AZIA 1FBUA 4FX0A 2X78A 2K9QA 4IRIA 2X6WA 2WSFE 3K4LA 4LITA 3CPWM 3GFMA 1VRLA 3J81O 3D2FA 4IKFA 1R71A 3SBGA 4JDSA 4O6JA 2IGOA 5KH6A 2DL8A 3H46O 1R77A 1M2OA 2UYTA 2RREA 1VFCA 3AHUA 3O5ZA 1K73U 5E3LA 3K0SA 2YPRA 1DTTA 1CZBA 4CBWA 3RMSA 3WTWC 3HXLA 1CGPA 4CD3A 4C3IJ 2V1XA 1X6OA 3CC4T 1JLAA 1UJYA 1WXBA 4B3MK 4IWVA 3SDGA 3OL4A 3QPTA 3GYHX 4FWSA 3WE3A 5KN9A 2DLLA 3P38A 1H8AC 2DFHA 2RDPA 3TANA 1KFSA 2KK4A 2QEXA 2A1RA 2CP6A 1IRXA 4GVEA 2R92J 1JL1A 2K4BA 3VYHB 4DTJA 2BY0A 3UF4A 4OOIA 4KRFA 3FHFA 1NM7A 3CCRA 1X1PA 1X1BA 2A07F 5DCMA 1ZBIA 1IO6A 1WRJA 2L7FP 3AG4H 1P7IA 5LJ3d 1ZYRF 2ME0A 1JXBA 5FO5A 3F8NA 1BA1A 1XG1A 2L8DA 3M53A 3CCMI 2CG4A 3MP6A 1UG2A 1I3AA 1QVGP 1XC5A 2BXZA 2ZZDA 5CK9A 2VXFA 1V4SA 3K70C 5J1EA 2Q2EB 5DMRA 2PJRA 4J2EA 2DOAA 1ARKA 1YCSB 2VG7A 1M1KR 5CR4A 5DCFA 2W6KA 2CJJA 2VGMA 2RHZA 1EETA 1W7PD 4MEXF 1YAGA 3NDKA 4XSXF 1N3AA 3V8KA 4BRFA 2EFOA 3R60A 1XGNA 4ISGA 4CGIA 3JCMb 4IDKA 4C8QG 5E18F 4FOEA 4HSRA 3I59B 3MK6A 1ZRDA 2F8TA 2E19A 1YX5A 3W2VA 1N77A 1QVUA 1F4KA 4JJBA 3VB2A 1Q82O 4HHTA 4LG3A 2E7XA 2LMDA 3RERA 4L5GA 4FZXC 2K27A 3E9PA 1R7JA 3K6GA 3AL0B 4C0GA 5CAIA 2V8JA 1J0RA 2Q1ZB 5LRSA 2QA4I 2ZPEB 3I3LA 5E17F 2DD5A 1KG7A 2F2EA 3OSFA 5BR8K 3QWXX 5L3BA 1YJNN 3E0JB 2OTLN 3UKRB 3GZNB 4M3TA 3CD6A 2JA2A 2GGRA 3CMAT 2Q36A 1MMSA 1VQ5A 1WJDA 4RTZA 3EKSA 2NOLA 3CUOA 4FETA 1O7LA 1N78A 3LDQA 1U5TA 4BVPA 5EC7A 2FSNA 1ZUKA 2LY1A 2H6BA 1W7PB 3HTVA 4Y0WA 1P2FA 1A04A 2Q3SA 1VQ7A 2NAZA 2Y48A 4DQ8A 2QGFB 1SPKA 1HKGA 3IG1A 1Z67A 1MMNA 4UC4A 3JAME 4RUGA 3JCMe 1V29B 3X26B 1UCRA 4CE9A 1WSEA 2JWLA 1QLYA 4A3FJ 2DT5A 5AQUA 4BGAA 4E7LA 1VQKQ 2BGGA 3D1NI 1Z21A 1Z9CA 2K6DA 2M0YA 2YI1A 3JCMf 1S9HA 2KJCA 3HPOA 3LDSA 3EG2A 1X9WA 1SEUA 1FYKA 4B9MA 1E3PA 1KEAA 2L7KA 2DILA 4HSBA 2O2OA 3A8YA 5ICFA 1FBQA 5M1NA 1S7OA 2MGQA 1PDNC 2VQEK 1YJ9N 3VPZA 2QDLA 4AMCA 4W1UA 4CCNA 3SV4A 4IIOA 4QLCU 3QJYA 1JJ2P 5FWBA 3MJXA 1W5CC 2A36A 2KDSA 2KGTA 1L0OC 1OISA 3V1RA 4XTZA 4A54A 2Y4YA 1XMAA 2NUPB 2O8EB 4IO9L 2W04A 1BIUA 4O55A 4NL2A 1WSFA 2K85A 3AGRA 3G71Q 2ZQBA 2X85A 4GKJK 1XDSA 1CQTA 3V9SA 4E19A 1R5GA 2BZXA 3UKUB 2DA7A 1G3WA 3EG0A 3RNJA 3HTRA 4CHNA 3TOBA 3CF5L 4WCEL 3KYCB 4F7UA 2X4WA 2VT2A 3A02A 1BOBA 1WNSA 5A0LA 2X1CA 4EJWA 1AOYA 2HZYA 1NOYA 4NQWB 2KYBA 1E3OC 1YQAA 1DIZA 3SUPA 3MCZA 4DV1K 5LGUA 1BI2A 3CP2A 3PNWC 5BR9A 3MAQA 3FMRA 3AVJA 1UJ8A 1OI1A 5FB2A 1RBTA 1QTMA 1Z7UA 5EEHA 1MSEC 3M3YJ 3CCUA 3M07A 3CQ8A 2Y69H 4OIPF 1R1VA 2DW4A 1M1KC 1RTHA 3ZT2A 2O8BB 1J54A 1S3JA 3SCXA 1FSHA 3FBIB 2M0MA 4A2BA 2ASOA 2BW3B 3QMLA 5B1BH 3KP2A 1O1WA 1HPZA 1LWYA 2XY7A 4A4EA 3WGIA 3ZEHA 2Y0SN 1Z9QA 2J6FA 3B73A 4NB5A 4CJ4A 1HYOA 4FW1A 1ZGAA 1B92A 1YVNA 3X20B 1OOTA 4PY5A 1ETQA 1C0GA 4OIQF 3GTMJ 4KUMA 1VQOT 3M1CA 3MMYB 3AG2H 3WU0A 1D3BB 1IG7A 5FLVA 4LIUA 2X4YA 4NCAA 2K5FA 3BY6A 1ZR2A 1M8MA 5H6RA 4MMLA 2JTFA 2LQKA 1IV8A 1Q7YR 5AQRA 3VF2A 4B3AA 3VETA 3F6OA 1WHGA 4CC2A 2OTJQ 4PJOD 1QSSA 3BTJA 5GAMh 4XTUA 2J05A 4KNYA 2V8KA 1K8KA 3R0JA 3EG1A 5EJCA 4JLIA 2VWKA 2UZKA 4M7DC 4AH9A 3HP9A 1MSFC 4ESRA 4Y15A 3HTUA 3CCYA 4XBFA 1D4XA 1T6DA 1GLBG 3ZQQA 4E47A 2MYSA 1TYQA 1QPIA 3R3LA 5HRNA 3MEUA 4IRGA 3FHGA 3VEWA 2RK2A 2EV0A 3ZSXA 2HQHA 3VERA 5C15A 2HHHK 3WXMB 4KHPK 3C6UA 3LMMA 3EEQA 1HQEA 4XIUA 2M87A 1HD3A 2PBDA 3SI6A 1LFBA 2YNIA 5AQPA 3LFUA 3OW2M 2NZTA 1S29A 1OU8A 3S8PA 4AT1B 5CY4A 3CC4A 4BEHA 1P4AA 1YI2N 2DZCA 4GBQA 2EYWA 4ZGEB 5AQXA 2KMUA 3R6OA 4YOYA 3BDPA 4PSXA 4KIGA 2D1VA 3ID6A 5F64A 3SMPA 4XK4A 1K9MR 5D8KB 3E1YA 2VXDA 2HHXA 4KHSA 1KYZA 1M8VA 5K5QA 3JRZA 4LFBK 3H08A 1LDDA 4PJOB 2EPDA 1TUCA 2GIVA 2RQUA 5EEGA 1YO5C 3LSJA 4BGBA 1P4WA 2E1CA 2EQUA 1HJOA 5GANh 2VJJA 3KVGA 3MEWA 3FEOA 3WGGA 1RAGB 3SMSA 1OX9A 4BS9A 3F8CA 1KQSM 5GTIC 4XOPA 4A5AA 5J1UA 4WXCA 1FZPB 4M75B 5LL6S 4DF8A 3OS5A 3V81A 1EWRA 3G4SA 5DTDA 2G7HA 1JLBA 3ZETB 1C0FA 5CKHA 4WCIA 4JKFA 1T7PA 2EV5A 2ISZA 2RA2A 1GLJO 4EHUA 1U8BA 2P9KA 3VS5A 1YQKA 3PNYA 3HB9A 3F3XA 4FJMA 1SS6A 3RKYA 2F69A 1ON2A 1REPC 3TP3A 2OBPA 3BF1A 1R5HA 5BS6A 3IV5A 2Z2SB 3C2GA 2KXCA 4B8AB 3DRRA 3BF3A 3PX6A 5M1PA 4A3MJ 2QWNA 2EHGA 4KH5A 3BCBA 1VQ6T 1TTHB 4B9NA 5J47A 2ZPBB 2VQFK 2GXBA 2GF7A 3FJ5A 2R93J 2JHJA 3HL2A 3IL2A 1NNEA 1IN4A 2ENMA 4ZYDA 3CC2I 1J53A 1ZG3A 4ILJA 4FWKA 4CGHA 1LCUA 3M3ZA 3S16J 4LUEA 3CFRA 3ML6A 4ZYEA 4A5MA 1QQJA 5HY6A 3GVAA 2KIUA 8ATCB 3ZSRA 2MW8A 4PK4A 5HDNA 3FKJA 3PE0A 3MKWB 2JW4A 1NGEA 3RRHA 1LFPA 4PZJA 1T0FA 1OCOH 3JSMA 2NRTA 3KLHA 3TAFA 1UEBA 4PJOF 3WQUA 3FXQA 1CKBA 4F3QA 2CZ1B 2A3SA 2HVQA 2AKKA 3E66A 2QWMA 2JS2A 4HVJA 4RB3C 1OYYA 1Q18A 4E89A 1Q7YC 4I0BA 2LX7A 4L0YB 1KC8R 2X3WD 2KZZA 4RCBA 4OIOF 4M75F 2QENA 3E9GA 4XH4A 1MZBA 3FXKA 1BKBA 4BY6C 2QWOA 1X4OA 1DP7P 4IURA 3GTOJ 5GTHC 2J5OA 4A69C 1S1NA 1PC0A 2DL3A 4M3BA 2ESHA 1K6OA 2VXZA 3CCET 2EQIA 5JVGL 3MEAA 2QSHX 4F7UG 1PSFA 3P9KA 1NJYA 3KETA 3H0DA 3CXCS 1ACIA 2KIMA 3CHWA 1NGIA 2EVRA 2F5DA 1BHLA 4PJJA 4KO0A 4BRAA 2BHZA 3THYA 1S1UA 4B44A 3VGKA 2BE9B 1VQ9Q 3T0YA 4AFSC 2A6TA 2RK1A 1VTNC 1S1WA 4XKCA 1N5YA 3OL3A 5CKDA 4DTNA 5GAMe 1N33K 2LRQA 1BCMA 4RTYA 3ULEB 1AT1B 2EJRA 1H9TA 2F4IA 3CTAA 4OFHA 1Y07A 2M8EA 3RZDJ 3EUKL 1KQ9A 1BG3A 2L9RA 2W24A 4QW2A 4LD0A 2QAZA 4CESA 1S8NA 4GV3A 4X0GA 3T19A 5GAMf 4PJNA 4ESBA 1BR1A 1K9MC 2DI3A 1U2VA 2NOZA 3IRXA 4DBRA 3WNEA 1FYMA 3PLAA 1RBRA 1GCQA 5LMNK 1IUYA 4HF2A 5GJWB 4D9JA 1PP7U 3PNTA 5KN8A 2NOHA 2RQRA 3DLRA 1VQNQ 4U0VA 3F23A 2M0OA 4I9QA 2KQ2A 1UE9A 3ZP5A 3Q5FA 2XV4S 3THWA 1PHTA 2ZXIA 4M77C 4DYRA 4A63B 3LP3A 2STTA 3ALYA 2R7DA 3A4CA 1AHDP 4E7SA 1GHCA 2WB1N 2OPRA 3OYLA 4UOBA 2YU3A 3KFVA 1QVGM 4IEIA 2O8CA 2EZKA 2DMNA 3PNVA 3VEYA 1RBUA 1YI2I 2HNDA 7AT1B 3C6AA 3ZQ7A 1ZYQA 2AKLA 2DL7A 2IG0A 1IZ1A 2JZYA 2CQQA 1BO5O 5KYXA 5C3EJ 3QYBA 3CCLQ 2DXCA 1OH5A 3L2QA 4Q48A 1KG3A 4I02A 1JCGA 1IO2A 4X66K 4JKAA 4AG2C 1LV5A 5GANe 2X9HA 4XN0A 5J3BA 5GAMj 5M1FA 4CZGA 2HHVA 1Q8IA 3PM1A 5KE2A 4LFCK 1YJWA 3M0TA 2KRHA 1SF9A 3KBGA 4DZPA 3PIOL 2A7YA 5GANf 1W36D 4CI6A 4CRIA 1YWOA 3BDLA 1LEBA 5FRMA 4M78C 2CH6A 5HOOA 2HVRA 3ZT0A 1AU7A 4B09A 2G8VA 1GXQA 1U9OA 1TTYA 3PQKA 3U1DA 4DW6A 4M7DA 4OVAA 4NHJA 5EDNA 2E6NA 3TW7A 3T1AA 3H6EA 1Y57A 4JI1K 3MKYB 2KYMA 2ZJ2A 2JOYA 2VB6A 5AONA 1SVMA 3MVPA 2E41A 5B66C 5E1XA 3GG4A 4AUXA 2RNAA 3VRYA 2V52B 3CUQA 3CCSI 3CF2A 2Z1GA 3SK3A 2H56A 4CECA 4QPOA 1XMKA 4RB2C 4FJ5A 4DLEA 1RL2A 2CUZA 2R58A 3SDBA 1JUMA 5JMVA 2Z1DA 4G7HF 3P8DA 1JKPC 2A6EF 2P4RA 1GDTA 2FOKA 3C6TA 3EAEA 1JXSA 4KH4A 4CEOA 3OS0A 3ZX2A 3C12A 4FYXB 1HJDA 3FZKA 5GP9A 1OPCA 4ZNXA 3OSVA 2X4XA 5GANj 1N32K 2R5YA 3L2WA 1KC8C 2XK0A 3REBB 1ZGJA 2PX9A 4QT7A 2YNGA 4KFBA 4FW2A 3KWIA 3LPTA 1R1TA 3NNQA 2VJ5A 1N3CA 2FMLA 2M9UA 4P5NA 3D2EA 2HMIA 1I07A 1G99A 4FM2A 2CQXA 2M4KA 1Z7LA 2HMPA 4L5EA 1RT6A 3CEYA 3THXA 4FVMA 5FDLA 1FJLA 4LG0B 4Q5WA 4BRQA 3ZMVA 4CGJA 4MLHA 2XRIA 1M90U 3K9JA 2OFKA 1IXRC 3PIPL 4FJ8A 5J1RA 4UUSA 4FX4A 2FE3A 4RW6A 1ZARA 1U4BA 1V4RA 1F21A 1VQ8T 3CD6N 2I7NA 3RTRA 4BAYA 5FLMJ 3CJTB 4AQYK 1U45A 4LMYA 3S1RJ 1VQ5N 1RIOH 2M1BA 5DM6F 5E8GA 1Q1HA 3CJRB 4J9EA 3J80E 1YYVA 3CLQA 1TKZA 1NK0A 3I8BA 3PX0A 4CZFA 3AGKA 2AXLA 1XSDA 1ZAOA 1GL5A 2V26A 3ABKH 1Z6RA 1KQ1A 2XO7A 2UXCK 3I58A 2V1UA 2JHNA 1VQ7N 3G0QA 1UWBA 4ZN1A 3JCMX 2QKLB 2RHXA 5J6XA 1VSDA 1EZZB 1E4GT 5EYRA 1P8ZA 2F5VA 1KD1R 3EL2A 1TW2A 3BP8A 1K9MO 4HF0A 1DPRA 3CCVQ 3MCPA 3CVTA 2DTUA 2FVUA 3AVGA 4HT8A 4L18B 4KIFA 2VKHA 3DXKA 5AQQA 2WBMA 1QVPA 3JRHA 3RR8A 1IKYA 4JJNK 3CMAQ 2L9NA 2OV7A 4C8QB 3U1KA 3HHHA 4WXHA 2ZPHB 5JS2A 2FG0A 4BRDA 4ZDPA 4DFJA 5GMKl 1PUEE 3QU3A 1E6HA 2W0ZA 1YIJI 3M6GA 2NRVA 4GFBA 3ZPLA 5KGWA 4B9TA 3GLXA 4I6MA 1M1EB 2Z0WA 1QZEA 4XLCA 3VS0A 1U78A 2E10A 5C42A 1YQRA 1BCOA 1NG9A 3CWUA 1VQLT 2AZSA 3RBBB 1NGJA 4QQ6A 1G59A 2DZ9A 1O9SA 3CJNA 3QLHA 5AT1B 1WBBA 3WTTC 4OMMA 1NJZA 4B9SA 3FR0A 2DK5A 4C30A 4B9LA 4CFAA 3CESA 5CYQA 4LLGF 4D0PA 3ZMZA 5ECAA 5SWMA 2CQKA 3QFPA 3IH3A 4EJVA 5BOXA 1ZA2B 4OLBA 3CC7I 1WJEA 5BN9A 2AO9A 3TAGA 1KG5A 1F1ZA 1RT7A 1I27A 1SSHA 2DAOA 3CCJI 2DPNA 3ECHA 4F2SA 2D0OA 4I7HA 5FFZA 3OYDA 2YUPA 5I21A 1E2XA 2FX0A 2PFUA 4KT0E 1OZ2A 1QVTA 1EJ9A 3M7GA 2H27A 3T1YK 5EG0B 3DP7A 3CCEA 5HROA 1KRPA 2JMCA 4DSJA 2PLYA 3S32A 4A62A 4DEYA 1T33A 1X1AA 2A37A 3VDXA 3FLGA 1W70A 3CCUN 1Y6IA 4EVVA 3ABTA 2IRFG 3MEEA 2IVMA 3KPHA 1TUUA 3MN2A 3TSUA 1RC9A 1CF7B 4FIBA 3M9AA 2A61A 1UHMA 4ID1A 2QEXI 3I55A 4ZGDB 2ELJA 4A3CJ 1FKOA 3IHUA 3OMCA 2PQWA 3G6EQ 3CMET 1QHTA 1ENHA 2MABA 4C8QF 3CCRI 2R7ZJ 3VQ4A 3DPUA 2ELKA 3ATUA 1V76A 1R5ID 3CDLA 1RTIA 3K59A 2O3FA 2ABKA 5ILSA 1U47A 4DS4A 3CM6A 3O08A 3BZ6A 3CCMT 3LDPA 4CUGA 3META 4J9DA 2JVHA 2F6CA 2GAUA 1CSKA 1S9EA 4Z6YA 3CCQA 4BACA 2F5KA 3WTVC 3GBQA 4PLLA 1PD0A 3H9NA 3BR2A 2E4LA 4ELUA 5GAOm 2FRHA 4N0BA 1LPQA 4EFHA 2E6ZA 1RAHB 1AA7A 1LAVA 2V6CA 3O80A 1GRIA 4CO8A 3LQQA 1G6NA 4GDFA 3X28B 3QUIA 4M7DG 1BGXT 5D6EA 4I98B 3OYJA 1HKTA 2LX9A 4GYIA 3JCMg 2J06A 3C7NA 2NOBA 1TG0A 5KYWA 1VQOQ 2KI7A 2LDUA 2L4MA 1KG2A 2J5PA 1ODDA 4U0YA 1Q95G 5EG2A 1D9FA 4E9GA 5FKOA 3QEWA 3HUGB 1IDYA 1X2NA 1Z0XA 1KD1C 1RUOA 2LTPA 2QA4T 3M4GA 2QSFX 3ITHA 1LNXA 3PFYA 1YFHA 4JBAA 3LSIA 3QBWA 4C1NK 3CC4N 3DLLF 1JUPA 4MQVA 1PRMC 1GV5A 5AZIB 4YEJA 4ETSA 3CD6I 1NK2P 2YDLA 1BBYA 1XUPO 2D2WA 3D2FB 4W5QA 4IOCL 4RLFA 2NOEA 2EFIA 2HS5A 3BE3A 1OQKA 4J5YA 1PRLC 1ATRA 1XPXA 1VQMA 3IH2A 2O8KA 2NYSA 3FXUA 2V9PA 1MA9B 3TR8A 4JI2K 2V51B 4KTWA 5AQZA 4JZ3A 1QZYA 3J81Z 2VUBA 5TGTA 1J5YA 1VQPQ 3F6VA 1MD0A 3FZVA 3KZYA 4HT9A 4JAXA 1WJSA 4AVZA 3ZMSA 1TV6A 2CH0A 1NK8A 3BTIA 2IGMA 1KVAA 3CQYA 5EGOA 4AI4A 4DTSA 2AXTC 3UWNA 4DFKA 3LCNA 5IT3A 4QS7A 2EBIA 3IAS2 2FPEA 3G4SN 2EPFA 1QCOA 3A8LB 2D8HA 2DFIA 5H6QA 1ORPA 5DCMB 1GFCA 2Q1NA 4Y17A 3AO3A 3GEZA 2JTVA 3LZJA 1RDBA 2P9PA 2R7VA 3JSPA 5AQVA 4EMKC 2I8DA 1ZA1B 1NEGA 3L8BA 2DMOA 3Q9SA 5EF6A 4Q5SF 4IIMA 4JYKA 4IF4A 1EFNA 2DRKA 1FLIA 2PJRB 4AHRA 3HHTB 2HPIA 3DFGA 4BC2A 4FLYA 1ULYA 3EKUA 1XG7A 3CBMA 2WACA 3QOEA 1F43A 2VOPA 4O4GA 2QI2A 4CJTA 2KY9A 5FKLA 2WAEA 3E9LA 1S72A 2HDWA 2L0KA 5HK0A 1RDAA 5KAIC 1BN5A 3TDZC 3CMAN 4X34A 2OZ6A 1LMZA 2DJQA 3KP5A 5CHIA 3JSOA 1TK0A 4QWQA 2LBFA 2JVGA 3HSBA 1NK6A 1SD5A 4G9YA 4OP0A 3CJ7A 3QQAA 1D5YA 3VW4A 2Y9ZA 2CGHA 2NYXA 4Z4FA 2EWNA 1FPQA 5E3OA 1NGBA 5C4XJ 3LNQA 4DV0K 4N4OB 3FWEA 3JCMP 4NC8A 5DK5A 4A6DA 1JXEA 3H0FA 2DDAA 1VQ6Q 1KQJA 1O3SA 3QPLA 3KK1A 4OMNA 2FF3B 4FE7A 1UAXA 1S3XA 4S05A 3JRAA 3K7AJ 2FZKB 3RESA 1YS7A 2DM1A 1EO1A 5BPMA 3JS6A 3KEOA 4DR2K 1V3FA 1U5TB 4R5PA 2A40A 4X1EA 3VA3A 3LOCA 2E2OA 4HDVA 2CUBA 5TISC 4EV0A 4M3GA 3PY8A 3VEVA 4W97A 5GAEP 4HVVA 5EY4A 4JN4A 4RCCA 3DOKA 3JSCA 4PWDA 2XSJC 3Q7CA 2C0IA 4XLHA 5HRSA 4BRGA 5IT9E 3R9PA 2K9NA 4LH4A 5D7UA 1XD7A 3UDCA 4N5SA 5GAOr 2K57A 2AHJB 3C2HA 4M3YA 2RGVA 4FYWB 1S5JA 2D1KA 4FZZA 4PJMA 3TGNA 1B6AA 2VI6A 5TKWA 2FF6A 2DFUA 3HC7A 2ZJQF 4NOYA 3H92A 1YCYA 1R1UA 1I8FA 3JCMc 3L2UA 3CFOA 3ZCMA 3IKMA 1LWVA 1GXPA 3VOVA 3DEUA 4BG9A 4E9FA 5BPLA 1KGSA 1QQIA 5LJ5h 4N4IA 1G5VA 2A5WA 2VIXA 1VQ4Q 3F8MA 2RE2A 5M5XJ 2GWRA 1I1GA 1T3SA 2YRCA 3GBGA 3T3FA 3VS6A 3Q9VA 3RVCA 4B1YB 2W4SA 3C6HA 1ZKGA 3NFCA 3LGFA 3QSUA 4LF5K 2MD5A 3U21A 2KSSA 1BU1A 3CBPA 1QZ6A 4FISA 4CICA 1U6GA 4ZZDA 2F5EA 1VA7A 4MDWA 4MFBA 2LCSA 1KVCA 4HPQA 1XTDA 1PU6A 3AO1A 2EV6A 4OFEA 1JKRC 2OTLT 3QEPA 2QQAA 2VBYA 3B6CA 1YITA 1HPMA 2GFUA 3K4JA 4IFVA 2P5KA 1ETVA 5CQEA 4C92C 1K83J 3V4IA 4DU1A 1EXQA 4F7UB 3H3OB 3EDPA 4ZN3A 5A2QE 1ON1A 2DETA 2GV9A 1X9SA 1W97L 1G4DA 3NTKA 2M51A 3TSWA 3KYLA 4DYCA 4CJRA 5KAFC 1LUJB 3UNGC 3JRBA 2D0QB 3IC7A 4KRTA 2PTKA 1MMDA 1OH8A 3A0HC 3IHOA 2X0LA 1H92A 1YJWN 1RFQA 3WEEB 2RJFA 1QQOA 2LP5A 3CCMA 4QKUA 2MF2A 4ORZA 2QXLA 1XHXA 2L7MP 1U2WA 2YS9A 3SJJA 4IOAF 1NJIU 3PJRA 4O5VA 2M02A 2E6MA 3TO7A 2P1JA 5I2SA 1T8IA 2XRLA 4WQ5C 2LCLA 1JRIA 2QTVA 2VXEA 2MWOA 4H5WA 4DUZK 2KZMA 2LVSA 2E3HA 4NB4A 2VCPA 1JKHA 1Q81U 4CCHA 2H8RA 3FJPA 2FLOA 5GPCA 3MPUB 2UUCK 2Z33A 4Z0UA 2XDVA 2HKXA 4DF4A 3N5BB 3CPWA 3K4CA 4QPQA 1YJ9T 2RV8A 4HZFA 4G9ZA 3ZR8X 4EJUA 4MNUA 2BANA 1U6ZA 3OA9A 4BHCA 3P83D 4B1ZA 1P90A 2OZUA 3LSPA 4YY3K 2QYOA 5FPMA 1NJXA 1ZXOA 3HYFA 4X65K 3SHWA 3ATVA 4MDAA 3TDUC 5EEAA 2QF7A 3HM5A 2M1HA 4CJSA 2RJEA 3QEXA 1T03A 4WQ4A 3WU1B 2GTJA 4H5RA 3K70D 4JNEA 3TQ7P 1K8KB 4ZYGA 1HKCA 2GNCA 5C2DA 1KAYA 2EIFA 1NGDA 1FSEA 3CC2T 1WUAA 3DPTA 4RTFD 5ICCA 2XHKA 1HCRA 4CJ3A 3KLEA 5H2FC 4F04B 4F7UF 5B3SH 1TYQB 2FA5A 4UV8A 2RQVA 4HKEA 3MO8A 3J7AO 2R5ZA 4FJLA 3EPZA 1QP2A 5AQNA 5AFUA 3PMTA 3LGLA 3VF6A 1F5TA 1OVQA 2PMZN 3I0WA 4YPRA 3UA7A 4YIFA 2EGAA 5GAMg 4FLTA 1U8RA 2HL5C 2P9UA 2HVIA 4CK2A 1J59A 2QGGA 4R79A 4DEXA 4JK8A 3ZOBA 4L8RB 1WI7A 1BW5A 2QKKA 2RAEA 4BEHB 2E6LA 4UVCA 3EFSA 1WBDA 3ZSVA 4JJDA 3ABMH 3N97A 3HJEA 5D3GA 3GNFB 1LW2A 1LQ1A 1SG5A 4ATOA 4JI8K 3CVSA 3RJPA 3L2ZA 3HRSA 3FDRA 3UR3C 3PV8A 4E7ZA 1QO0D 1SKRA 1KONA 3A0BC 3S14J 3NGZA 4HCCA 2R7SA 3JCMJ 4KUDK 1QGPA 5GAN7 3IMXA 3TSPA 1N9RA 1U1TA 2PU9B 1BISA 4Z4CA 2KXDA 2Q0OA 3D7EO 2RJDA 1VQ8Q 3KFWX 3RKWA 3PUFA 4OB0B 3R4KA 3CPFA 2AHQA 1WHHA 1P7JA 2O61A 2DT6A 1U49A 2P4WA 1TOVA 1VQ6N 2EKHA 1NKUA 3SEMA 1VSHA 5LJ5e 4QSHA 2I2LA 5HK3A 4HCBA 5GANg 5GAEJ 1YS6A 1B8IA 1NK7A 3G0ZA 1N8RU 1BI3A 4XOTA 3HOTA 3MXIA 2DK8A 3VQPA 2HTJA 2QWLA 2P9KB 5LJ5f 3C95A 4HA8A 4DJAA 1W2BS 2VYPA 2ID3A 2V4JC 4CCJA 2A41A 1SKWA 1WJFA 2UU9K 3F10A 2M45A 4MIMA 1GXIE 2JA6J 3EY1A 1VRUA 4CF0A 5C0YA 2O0YA 3M0RA 4DV6K 4CC4B 3E2UA 1XC9A 1YI2T 3JREA 2QUFA 2DBMA 2R5MA 3LWHA 2BTTA 1ATNA 2X35A 4UV9A 4DQ2A 1DQUA 2CGPA 3JTHA 2K5CA 1QW1A 2V9KA 2F4VK 2B86A 2FPDA 4C0ZA 1M9SA 1A6IA 3IH4A 5IP6A 1VQLQ 1K7AA 2M16A 4O44A 1Y39A 4E4HA 3MWPA 4FE4A 3OYHA 1Q9XA 3CCEN 4IXCA 2HL3A 3SEQA 3OH9A 1K61A 1WKMA 8AT1B 5LJ5j 1CXUA 2DA4A 1UB4A 3TTFA 4Y52J 2JRMA 2AIRB 1ZLMA 2D0PA 2IIRA 2B8AA 3I55N 3CPWP 1OPKA 1ZBJA 2V1NA 5LEKA 2DL5A 4GGGA 2MBFA 4JRPA 4CJPA 3RMBA 3DM2A 3HOYJ 5ICGA 1ABOA 2RM4A 2HHSA 1MJBA 1QPMA 1WJQA 1T95A 4DV3K 4M3DA 4BH9A 1K9AA 4CBXA 4B9UA 1NU0A 4F3TA 3KLNA 5HLGA 4CJFA 2K40A 4M7DE 1WFWA 1N5ZA 2LKPA 2E5LK 1U0JA 4D5CA 1GLLO 5IWAK 2ZD1A 1ZQ1A 1TWGJ 4B47A 1QKWA 4EZ9A 1RKWA 3LWMA 4BC5A 3AA5X 2W57A 2W00A 3THYB 4FXDA 3KIOA 2P0PA 4FPBA 5H20A 1L3LA 3DLMA 4CZIA 3TAPA 5LGNA 1LWEA 4B3TK 3N5NX 3MEDA 1H1VA 3W3CA 5GIPA 5J2PA 1RT5A 3BJOA 2UV1A 2AQEA 1MMGA 1J9AA 3CMEQ 3KZBA 2UXBK 1ZRCA 3TO9A 4CCKA 4NLBA 2DQLA 1UA1A 3K1NA 3ZQFA 3S2HJ 4JD2B 2JMWA 1U1SA 3G71I 3AV9A 3HZJA 2D0AA 5CE3A 1U2VB 3L3VA 4FM4B 5EVZA 1U9NA 3GIBA 4A3GJ 1J5OA 3REOA 4OB2B 3NBPA 4XLPF 1AOJA 4F7ZA 5AQHA 4M7DD 3T8TA 4AC0A 3C0CA 4PL7A 2IC3A 1B9NA 3UIQA 4Z4EA 1BOTO 4WF2A 3G2BA 4GYGA 2AS5F 1ZBHA 3FKIJ 4CF9A 4UHTA 4CHQA 2O8CB 1HLVA 1QS4A 1X3ZB 2GCXA 5JLHA 1IXSB 2FU4A 3ULDA 2I10A 5F27A 2EX3A 3MX5A 1NK9A 4F92B 1IBKK 3J7ZI 5KYXB 3H35A 5L3GA 3E5QA 1IRFA 4AHVA 1VQMN 3VYGA 2R3SA 2RO0A 3LPUA 1Z91A 5BRHA 4MQ3A 1MV3A 3LA2A 2OAUA 2HOTA 1D8YA 3H45C 4B48A 3P39A 4XNFA 1EV7A 3TREA 3VF4A 1HSJA 3F9KA 2GBZA 1KCFA 5AFUH 4JHDA 2QA4Q 1R23A 5DDGA 5F0HA 4DQRA 4OPJA 1M3QA 5J2NA 3COAC 1YFNA 1R36A 3ROUA 2EKOA 1TGOA 2WOMA 3A8GB 1NMDA 3H5AA 1K78A 2A3ZA 2JQ7A 4J9IA 1BQNA 1FC3A 3VS1A 3OW2A 1LNWA 2XIGA 3AL0C 4JKCA 3QO9A 1JCEA 3MQ0A 3WGHA 1I5ZA 3L6QA 5M9OA 2KPMA 5ILUA 5A0DA 2YHTA 1YIJT 2HQ5A 3ABUA 1E0EA 2OTJI 2KEAA 1D09B 4LGWA 4QQDA 4BHBA 2L02A 3CUQB 3CC2A 2NS7A 4EJZA 1LCKA 2DXBA 3J7AP 4W5NA 2E2IJ 1UB9A 3OTOK 4MTDA 5J4VA 1HUXA 3M55A 4J6XA 1TVRA 4JK1X 5CLSA 1TT0A 4M41A 1IRGA 4HWIA 3M4OJ 4F2RA 4RM3A 5IHKA 1KG1A 3AFHA 3E3VA 1BQMA 1J5EK 4RGSA 4CERA 5LJ3h 1I4K1 2VQGA 1KQSA 2VT3A 1FP1D 4F14A 4WK8F 4B3RK 1S72N 2R5YB 4BC4A 3CC7T 4RM2A 3OYNA 1A6QA 5LY3A 3JCUC 4XU2A 2LKSA 3EFOB 2Z1HA 2HHUA 4JP0A 3D2EB 4A4KA 5LFAA 3L2VA 1V1CA 3J80K 1O3TA 4M7AB 2WV1A 4MHGA 4ZDOA 3THXB 2VC8A 3SFIA 4FASD 2LNBA 2VBXA 4D7NA 3A5NC 2LP0A 3ENBA 2C6YA 1Y96A 2FQ3A 4MMKA 4CCMA 4RTUA 2RMOA 4UUSB 3HFNA 4Q0BA 1D1CA 4PFOA 3FE1A 3S2WA 4QVCA 3BT9A 3OMYA 2DO7A 1FW6A 3K57A 4RTXA 2ZFWA 3VQCA 2QEXT 2KL4A 4J9CA 3VGLA 2NNWA 3KEQA 1MBKA 3VJPA 1ESVA 2H3GX 1BW6A 2KFZA 4PSWA 3SYTA 2KLOA 3CCRT 4M7DF 2LZ6B 2LLKA 1NGFA 2Y1JA 2CMPA 4Z8AA 3PGGA 1U06A 3CWSA 1SD4A 4IUQA 1BIAA 2OYQA 4JV5K 1WZOA 2DTOA 1ZK8A 1S6PA 4E6KG 4FT8A 1WXUA 2PFBA 1JT6A 1YE9A 4YNQA 1X9JA 2QM1A 3N0UA 2P5OA 2LQNA 3ENOA 4I2OA 1WQWA 3DXKB 1EH6A 3CCQI 2FC0A 2DA6A 3LAKA 2G6FX 4HDUA 5AYFA 4M77E 5IPAA 4HW0A 4FTHA 1SVOA 4CJKA 4IHTA 2FHDA 2K7LA 2WC9A 1WEIA 1ETKA 5K14A 2RQTA 5JVHL 1QHHD 1ZN2A 2W03A 3JV3A 4AYBA 3BR5A 3R2XC 4I09A 4IZZA 1FEXA 4II1A 4LDWA 2HBWA 3J8AA 5ADXH 3SZPA 3HJFA 1YW7A 4XK8E 3TVTA 3ASKA 1WNLA 4DLGA 1FYLA 1BR2A 4BROA 5AZJA 2XB5A 2DN0A 1K8AR 4KV8A 1V5FA 3LDOA 2NS8A 5KYUA 4J19A 4YFNF 4JPBW 3HSTB 1O57A 1WN7A 5KI6A 4PLIA 3HIFA 3J80O 5L3EA 2OF7A 4KT6A 3LW5E 2ITGA 1QWFA 4ISFA 1BL0A 4C2MJ 4DNCA 5IY5H 3GTJJ 2FRWA 2COMA 2Q31A 3NF9A 2G8IA 4IZ9A 4M78E 3MP1A 4L5IA 1OMIA 1YITN 4RGXA 3CD6T 4M77D 1GOCA 1UDLA 2CZ7B 2RPNA 1VQ5T 3P31A 4A3BJ 2EA2A 2L4AA 1UECA 2BY1A 1KLNA 3NWTA 2HQEA 2V79A 2EQJA 2QQBA 1TKDA 1NJIO 4H0EA 3B02A 4DOZA 2YHAA 1VQMI 4CYCA 2XF5A 3W2AA 1I3QJ 2CS7A 1X2QA 4BR4A 2MMPA 3M0PA 2GQIA 1MH4A 2E2HJ 3L3UA 3HK2A 1SSFA 2HXOA 2DT7B 1UOCA 1VQ7T 5F1XA 3RTVA 2IW5A 3C4SA 1OEBA 5E26A 3VQ8A 4HV6A 3O3HA 2XDPA 5E41A 3CCSA 2DYIA 3OW2P 3CCMN 4DR5K 4IRHA 1FX7A 3HSCA 1JE8A 4CF8A 3SPZA 2ZJRF 1Y8RB 2XF6A 1ZX6A 1YJNQ 1PVEA 2OTLQ 5E1WA 3UT1A 4HOBA 2HNYA 2V7FA 2WY7Q 4FL6A 4P96A 1S6QA 2KTQA 3O1WA 3RKXA 4LUDA 3SV3A 3LQRA 4FSSA 4OF1A 3OBYA 5HKCA 4M78D 5IAYA 4YOUA 2EBPA 1TQPA 1NLPC 2R7XA 3UB5A 1DT9A 1W0UA 4YFXF 4AM7A 3H3NO 4CH7A 4FLZA 4P9UA 3FIFA 3V9XA 3DBHB 4NC6A 1R4MB 3AARA 2UUAK 3LZIA 3JXUA 4E1JA 4FOIA 5GIOA 2E4HA 2E60A 3KYDB 4E70A 1PSEA 1KQSP 2CREA 3ZFJA 1J9IA 2ZCWA 4LF7K 4FLWA 2HTSA 1IW7F 4LXCA 4E7JA 2ABLA 2R7WA 5LJ3e 3AO5A 3KD5E 3HTSB 5E84A 1FOXA 1S7AA 3V4GA 4HX8A 2NRAC 2GELA 3QEIA 2E20A 4OMLA 3NHGA 1O13A 1K4TA 3L2RA 5GMKh 2VKNA 1M1KU 1MJAA 5FKKA 3K1MA 5LJ3f 1Y8QB 2K3XA 1S72I 2LVMA 1ORNA 3CWTA 5IYDJ 5D4SA 4HNUA 1GLAG 2RQQA 3QNNA 3SLCA 3F8BA 1JI8A 1YJ9Q 4DFMA 1Q86R 4DB3A 4M75C 1JJ2S 2QWQA 3C7NB 5KYWB 2DA2A 4GO1A 1YT3A 3ULQB 1FTTA 2P9LA 1RT2A 4H8KA 4N0AC 1FIPA 3CCLI 2ZPGB 1IN5A 1SKUB 2HZTA 2XDBA 4AG1C 5KYYA 3SXYA 1VSIA 3OYIA 1HSQA 2L3DA 5HNHA 4JLHA 3CCUT 5M3MJ 3V6DA 2QBYA 3OHRA 2KBTA 3O4QA 3JCMh 4RMOA 4J83A 1B4AA 4ICLA 1LOJA 1W0HA 4LSLA 4XTYA 1HNVA 4FWPA 1B59A 5D8LB 3BDUA 5AQLA 2VGNA 2W25A 4UB8C 3E6DA 3FBNB 1TBXA 1XCBA 3BWGA 1G15A 1XQHA 1YIJA 4FSXA 3G73A 2DFFA 5LJ3j 4RAFA 2EWSA 1IXCA 4A57A 3CPEA 1W5SA 1VIEA 4BI3A 4NXMK 1WQ2A 2M30A 1YQLA 1K8AC 4ZTJA 3LSHA 1IZ6A 3HRGA 4B8CA 2BEOA 3KJVA 5K5OA 1BB9A 1N8RO 1RNHA 3ENHA 3NVKA 4H0VB 4Z89A 1BJZA 2XVCA 3QU6A 3Q1JA 3F5TA 3MKZA 1DGKN 1UHWA 1K1ZA 5EGOB 1R0CB 2K3FA 2YU9J 3VN5A 5FD6A 3M8EA 4DHYA 1QZ5A 1O75A 2Z16A 3BG7A 3EGUA 3D0SA 3CC7A 3AVKA 3O3KA 2P9PB 3QICA 3FRNA 5L23A 4V2GA 1HW2A 2CV2A 2CQ7A 1D5VA 3DRSA 3O9UA 4A5NA 1D0YA 1E3MA 1IN8A 3KP4A 3CCJA 4C1NI 2KT1A 3BTCA 1A36A 5IXFA 1ZBUA 4NLCA 1SFXA 1C0MA 1OV3A 2Q0UA 4H4OA 4OINF 1OCCH 3S1QJ 3IRRA 1XMXA 3A5OC 4A4FA 5E8IA 4F91B 3DB4A 4IL6C 2LREA 4ILHA 3C94A 1Z3XA 1J2XA 3BZKA 1RI0A 3BGRA 4WXDA 2EYXA 3HRMA 3VGMA 2B7EA 1LWCA 2HR3A 2DODA 1YITI 1TKTA 1LB2A 4UXNA 5F0CA 4CFBA 3W6VA 2IIMA 3D5LA 2BOLA 2H6CA 3UKUA 1ZBLA 1OKJA 5HS9A 2LBFB 4BR9A 3D7SB 1L5UA 3IWFA 3E9OA 3GCMA 4EP4A 2E3IA 3VQBA 3CJQB 4A2UA 5HRPA 3OYAA 2K9LA 1D9DA 4A3DJ 1XN7A 2HYJA 4NQWA 3C7JA 1VI0A 1BI0A 4WFAL 1BIBA 1X19A 4V2FA 2F2XA 3EO3A 5IT9K 5IXBA 3HGYA 2DTHA 3MN6A 4N76A 3NGYA 3FMSA 4A4GA 1YHQA 4BE2A 3Q0UA 2LY9A 3GPLA 1YI2Q 4J7IA 4M71A 2JWKA 4F17A 2RPIA 2NOFA 2TRTA 3D0PA 4FLXA 3UKGA 1IBMK 2ZB9A 3HYIA 4ELTA 1BI4A 1ETYA 2FQ4A 2DK3A 4WCGA 3CCVI 4F9OA 3SAHA 3VYRB 1PU8A 3VSKA 3G4ST 4XTWA 1D1BA 1HC8A 2FEZA 3K69A 4FYDA 4H5NA 5KQ8A 1E4FT 5C0MA 1WA7A 1W1WE 2K5IA 4PCQA 2HF3A 3EYIA 2DBBA 1Z1DA 2H1LA 2IS6A 2JMAA 1Q86C 3RR7A 2ETJA 4IO9F 4KGVB 3G1JA 4DBFA 2D0BA 5FPDA 4CJUA 4HCKA 4CEDA 3LFKA 5H1SQ 4LE9A 2ITMA 3F9MA 3IAM2 3DU5A 2A28A 3SZTA 2DA5A 4EDUA 4Z2YA 4J9GA 2DAQA 1WCMJ 3DAWA 1YW9A 2WTEA 4GCVA 4HQEA 1D3BA 3H0HA 2Y0MA 2M3AA 3ZN1A 4HUEA 4PUOA 5GMKe 2V7ZA 4PKGA 2BBYA 2L01A 4CCLA 2FB7A 1WH5A 3FDYA 3WG7H 1Q7YU 1XI1A 3VQDA 4RKUE 2LG4A 3CXCM 3FGUA 5LRRA 1UG1A 1X9MA 3OR1C 3TL4X 2NRHA 1WPKA 2KHMA 2ZO4A 2NVTJ 3K1PA 3S6IA 2D5VA 4RTVA 5AQWA 1U3EM 3QOPA 5A2QK 2P9IA 4JI7K 5LJWA 2EIMH 4G7ZF 1IKXA 4XORA 5DEQA 1U3OA 3P4IA 3DLAA 2M7AA 5LLQA 2B5JA 2QVOA 2DBKA 3ZBDA 2M5WA 2MA3A 1LJOA 3V7RA 1FNNA 4BRLA 2M2EA 4NNJA 3M8QA 4C8MA 3TTDA 4ZH4F 1NGAA 5LJ5g 3M5AA 1KHCA 3M1EA 4E9EA 2R7QA 1CZAN 3EG3A 3I56A 3RMQA 3ZSYA 5IT9O 3TPQA 3DKMA 1NPPA 4LIVA 1B7TA 1XJWB 1BOAA 2AK5A 4HAMA 1H3HA 2BUPA 3BPXA 1SL1A 1R00A 1VZ0A 1RI7A 2H1KA 2OPPA 2FNAA 3AVCA 3A8MB 1BYMA 4HYEA 3BTLA 2D6FA 3K4KA 1YTUA 3HPWA 3G6EI 3E1SA 1K9MU 2CWEA 3JAMZ 2HWVA 5GMKj 4XLNF 1RILA 4GKKK 1ACMB 2I7PA 5CHZA 2NVXJ 3F8FA 4LNPA 4IQ4A 1C1CA 3LSRA 1SFEA 3M0SA 3CJCA 2CZ0B 2F2VA 1DTQA 2PAVA 2OPQA 2JN0A 3O4WA 2X1EA 2E1HA 4N9HA 1W0TA 5BRFA 2HBJA 4RW4A 3GFLA 3TU5A 1B9MA 1WSUA 2CP7A 1TK8A 2J6KA 2BVMA 3HOWJ 5EU7A 3PO5A 2CU7A 2H8WA 2COYA 4N0AA 2L89A 3CC2N 1UGVA 4F4KA 2VQCA 1WH7A 5BN8A 4OMZA 1G83A 4NYFA 1UUEA 3ZETA 3T9NA 2FBTA 5GAHP 2ECZA 3ONQA 4V2SA 5CZ2A 5GAOq 4BXFA 2C06A 4IJAA 4MO5A 3O1BA 4EQQA 2ZC2A 4II3A 3FZHA 5A2QO 3BPVA 5C25A 1ETOA 4C5IA 2K2VA 4DR1K 2YWWA 3KLGA 3QIPA 5CO7A 4EZ6A 1W4SA 2BYVE 1XGMA 1MGTA 2EILH 3SQ2A 5KGXA 1YTYA 2K79A 3VYSB 4CGZA 1W2BA 2HSEB 4GLKA 2DYBA 5FU7B 3W6JB 4B08A 3HEFA 4OFAA 3MXJA 1HYSA 3VRZA 4C0DB 4C8QC 1V5EA 3NTIA 4JOMA 2RHUA 1KHIA 4EHTA 4CHYA 1QWEA 3WODF 3VEPA 4C2UA 2O03A 3X24B 2Z9OA 3EZWA 3WTSC 3RMAA 3MN5A 3KCCA 1YJWT 2P9UB 1MUNA 1ZRFA 2QYZA 3HI0A 5IHNA 1Q86O 3OIQA 1NGNA 1M2VA 4B3XA 2E1MB 2FOWA 2K2MA 1LKXA 1SHGA 1VQPI 3PVLA 2WC2A 4KB1A 4QS9A 1GUUA 1YBYA 4MLOA 1TUYA 4QTRA 3O3FA 1X1DA 2IBDA 2GWKA 1BDGA 1YJNA 1JBMA 2CSQA 4BY7J 3V7CA 4BBRJ 2DEUA 2DXTA 1HNWK 4WWCA 3CMMA 5FW9A 5SZTA 3TP0A 1JKQC 1KC8U 4CK1A 3PO4A 4KH1B 3MEGA 4I76A 5M1KA 4M3EA 1A31A 1DLOA 2D45A 4DG1A 4F55A 1RPWA 3JRCA 3OJSA 3QDFA 1NG2A 2KJBA 4FJIA 2QWWA 2CV0A 3GL1A 1KG6A 4KB0A 2TCTA 3CFPA 4C8NA 2COWA 2QEXQ 2D8JA 3W0LA 4MO4A 3E01A 1BC7C 4ENMA 4NL3A 4CEZA 2FPFA 2ZNYA 4J6YA 3DF8A 2RI2A 4JZ4A 1B8IB 5KK1A 3OSGA 2YLBA 1SANA 1K0XA 3JB9J 4C92E 4EP5A 3TAQA 3BR3A 4WF9L 4OWRB 4IHSA 1I1JA 2Q2RA 1RAFB 4KGZB 4IG0A 2JA5J 5AQJA 2QKMB 2YHBA 3DWLE 2XGXA 4L6V5 4YPHA 1K0SA 2MI6A 1KFZA 4IHVA 5CKEA 4M9ZA 4MFDA 4ENJA 2ZWHA 1M1FA 3SNNA 1LJ9A 4MO7A 4MLEA 4W5RA 4XLEA 1KO9A 4IUVA 3PVQA 1OCPA 1FP2A 3O9RA 3RSEB 1U5SA 2KFNA 3I53A 4UUTA 4XICA 1IN7A 2M9HA 1Y1WJ 2RD1A 2HXIA 5JVGF 3NAUA 3NF8A 2MH9A 4OX9K 4LLLA 3RQIA 1FY7A 5FJ8J 3QETA 1HQUA 1IV0A 3V9UA 4EW0A 2BHYA 1QKXA 3L42A 1T3LA 2F4MB 2MOXA 3R6NA 2OUMA 4C92D 1HMVA 2OA8A 1WVRA 2PMHA 3BUZB 3D6RA 2YHYA 1R0AA 1H641 1TL3A 3CCSN 1WSGA 1SFUA 1WAFA 2LT4A 3QKJA 2AP1A 1SV5A 2VOOA 3I4PA 4LDYA 1GBRA 3RR6A 4XTXA 3M4YA 1E7OA 1VSMA 2MAMA 2HDCA 1DP3A 4JEPA 3CD6Q 4KULA 3OA6A 2UXNA 5C12A 2ZAEA 5D5XB 3LAPA 3AT1B 1VQ5Q 5GPAA 2E5NA 3M54A 4OAYA 4IUPA 2PQ8A 3QG1A 2DJZA 3VMFB 4FM0A 2DMUA 2XKOC 4FJ7A 1JXOA 2CP5A 4RG8A 1MNMC 2DA9A 1OPLA 1X6GA 1SAZA 4UNFA 1VQ7Q 4EJTA 4LY7A 5CIUA 3OSSC 9ATCB 1EX4A 1M1KO 2E1ZA 2YX4A 1XSVA 3LWLA 3EG9A 2XKPA 1RABB 2Y0SA 4P55A 4JS5A 1JLCA 4D1QA 1VQ4I 4HF1A 3JW4A 5ICEA 4EEFG 3H0IA 4JI3K 4N47A 5KVRA 3WQTA 1J7KA 2B4JA 3A01B 2ZSHB 4CD1A 3TAMA 2E7WA 1W2BP 3K9TA 1MUDA 4LFUA 3U9DA 2LR8A 5DD4A 2RHIA 2K3BA 2GXAA 2X6YA 3V1OA 2KFDA 2FBXA 3J7AF 4J2DA 1Z6TA 3FZLA 2GIZA 5CQGA 2LCCA 4YFUA 3VA0A 3ZQLA 2MH2A 2ROTA 4CJVA 5GAHJ 4U67L 5KTQA 1MWKA 2EJ9A 1T39A 5JS1A 1XMQK 2B6AA 2ZXJA 2HHTA 4C3JJ 1FBSA 4UVBA 2BY2A 3OS1A 1WXTA 4AU7A 3QJ6A 1JB0E 3A5ZB 1AZEA 3J7YJ 1JQQA 2HDDA 5CQXA 4EMHA 1HSTA 4FYYB 1HLUA 1Y7XA 1SAXA 3ERMA 4O5BA 2LNVA 1SL2A 3O8VA 1K76A 1W4MA 1PUFA 4H03B 2A69F 5KNLA 2WA0A 4KN4X 2LJ1A 4S04A 2XSDC 3TEEA 2XI9A 3QXEB 2YUOA 4AFUC 4IUUA 4BJ6C 2EYZA 3I55T 3U8XA 3QPHA 2L9VA 5BPDA 2XHIA 4A3IJ 4BQZA 5FPNA 4A3KJ 3SD4A 4TVRA 2F5CA 4C8KA 4XH1A 1HNIA 1TZLA 4Y92A 4H0YB 2IS3A 4I2QA 3BJAA 2WSEE 1YIJN 3C0BA 3WE2A 1D3YA 5K7FA 4CZKA 1J6ZA 2CKKA 2HYGD 4YDUC 1KXPA 2Y30A 1X4PA 3VTHA 4KREA 3BR0A 1HOMA 1TSFA 2RB6A 4H0XB 4WFBL 3SUQA 2NRRA 1IGQA 1MGQA 4UNOA 1Y64A 3QESA 3CCUQ 3QDRB 3ZMDA 1HKSA 2FBKA 3LWFA 4BR5A 1K78B 2RJCA 3CCQT 2KRMA 1BUPA 1ASWA 1KD1U 2VLAA 2EB7A 1PD1A 3HBTA 3OYMA 4IG3A 3UPUA 4MDXA 3AVNA 2GZWA 3U3GA 2B9SA 5FU6B 3JCMV 3LANA 3CC7N 2KKZA 5FLXE 4DWIA 2G8KA 4WX9A 1WLJA 4RWTA 2EIKH 3JRGA 4OMYA 4AIDA 4J6WA 4DS5A 2R7OA 4JJCA 2VKVA 3CCJN 2J4RA 2HHWA 2DA3A 2B0LA 3INZA 2I5UA 3EQLF 2V75A 3IKTA 1U5TC 2W85A 3K10A 1NJWA 3VYTB 3QODA 3L00A 1BM9A 3MFKA 3MEXA 4FJKA 3AA3A 3WXIA 3ZXSA 1M27C 4AVPA 1VYTA 2MLKA 3QBYA 4GVMA 3U9ZA 4H0OA 1IC8A 4HUGA 3J7ZO 4IFYA 1WYXA 4GNIA 3LDNA 4B6MA 3CDHA 3LSTA 3HOSA 4XRFA 2QEXN 2F96A 2WFBA 3NAEA 3K4NA 1H88C 4OLAA 1ATSA 4AIJA 2FJ1A 4DTXA 2ZE2A 4KI4A 2ESNA 1VQMT 1USSA 3CCRN 1VQKA 2XG8D 5L3CA 4U7BA 4JLGA 5KCHA 2JT1A 2WAQA 4NC7A 1WHKA 2BUDA 1ZBXA 5CYMA 1RBSA 3MECA 1D0ZA 1TUGB 1QZZA 4E1MA 5LJ3g 2ATQA 1T3VA 3KKSA 1NBWA 4BGDA 2P0QA 4G12A 2FBYA 1Y96B 3MHXA 3KX2A 1NM1A 3HKZA 1B72A 1LPLA 4Z4IA 2KDZA 3HPHA 4HVWA 3CC4Q 1RDUA 3QZ5B 2X48A 2E70A 4BYYA 4FJ9A 1OKRA 5GAN8 5JVTA 2NOGA 3VS4A 2HBLA 4B22A 2PI0A 4PNOA 2JJ9A 1WB9A 3M8SA 4J9FA 3TU4K 2QZ8A 3DLGA 3J81K 2CV1A 3I35A 3EHQA 1VQ8I 4N4GA 4EIAA 4B1WB 3P1GA 2VE8A 1JEGA 1U84A 1Q82C 2GQVA 1MBFA 3BQZA 4YOVA 2WONA 3TARA 4M3FA 2P9SB 2M8GX 3GNGA 3G71A 1NMNA 2VPLA 3T5XA 1UFFA 2L7ZA 5B8HA 4CC7A 4QVZA 2A5YB 1WJAA 3QZ9B 2K9MA 4C5EA 3RCOA 4ASNA 1Q7YO 2HFHA 4XTVA 1W7AA 2RVCA 5J39A 2JSCA 1A0NB 3CWAA 1P59A 4CBUA 1JCFA 1BK2A 1MNDA 1C0TA 3CMYA 1QVFS 1AKHA 2EA4A 3O8GA 5LD2C 3OYCA 1VSEA 4JQFA 3JB9I 4BJ5C 1S6LA 5DM7L 1ZLJA 3BOQA 3G4SQ 3BG3A 4P9FA 3CJ9A 4AILC 1MDMA 1QRYA 4RMNA 1Y0MA 1S72T 5J4YA 2EQKA 2ZJRL 1XGOA 3TEDA 1AWCA 4M4ZA 3OYFA 2W42A 3CW7A 4PA1A 1V5GA 3MXMA 3I0XA 3SWNB 4CW7B 2GTOA 4B43A 1UFMA 4PKCC 3A2FA 2EFPA 4FJGA 5KYUB 2W1OA 4MQ9F 5GAN2 1KQ8A 2C0TA 3KLOA 1FOKA 3CCLT 2Z5UA 1HA8A 2HAXA 5C6SA 3FXOA 2F4OB 1NBEB 1VAZA 3ECOA 3PO2J 3ID8A 2H3JA 2MCNA 3IS9A 3M8PA 2NVQJ 2YV0X 4ZDLA 4JK9A 3WUHA 2O4XA 2HQXA 3I9V2 1HYZA 1OCTC 1RTJA 2XKOA 2XAUA 3CIPA 4Y13A 2WB1A 3J80Z 3A1YA 3B6OA 3A98A 1RCHA 4Q47A 2P81A 1DUXC 4CYCB 1QNTA 3JB9D 1GCPA 3IUCA 1TWFJ 2K9SA 1NG6A 4XMYA 3PL8A 2CT3A 2OQRA 2OTJA 3K5NA 3AO4A 2MFZA 3CM5A 5J40A 4XR6A 5HRRA 1N34K 2ZMEC 4YHHK 5EX5A 2DOFA 3EH2A 3HXMA 3JCMW 3MP8A 2XPVA 4EATA 1PYVA 3SEZA 5GAOl 4CK3A 1TW3A 2IA1A 1JLQA 3O6WA 1T8EA 3OWTA 3O9QA 2IA0A 2D1HA 3H8ZA 3DTEA 4JRIA 2DDBA 2LMJA 2BH1A 2ZNZA 3ZMTA 2LKXA 1WHMA 2DYSH 3CO6C 3MCAB 3DBLB 3DB3A 2ZJPL 3NVMA 4OPAA 5DYMA 3NCIA 3BY7A 4IFEA 3FXRA 3CMEI 5EXWA 3QYGB 1AWOA 4BDZA 3ASMA 4M7XA 4H4MA 2OD5A 3A8OB 3QNOA 4KUIA 2XY6A 3OY9A 3FHZA 4BDPA 3MZYA 4CHOA 4J9BA 2R4GA 5AJ3K 3W3DA 1BU6O 2PZSA 1Z9ZA 1LDKB 3DKYA 2HVHA 3AO2A 4FJXA 3NPFA 3I64A 1Y97A 2JN6A 3AG3H 1OH6A 1TXQA 4RCHA 2KRSA 4OB1B 1QHAA 3CYMA 4IOCF 1LVAA 1GVJA 4BR7A 3CQTA 1SRLA 4X64K 4P5OA 3A03A 2CFOA 1HNXK 1YITT 2PZ1A 4JKGA 3L2CA 2ATCB 1VRTA 3NH2A 3KD1E 2E34A 5DUKA 3G1MA 1KAZA 3M8JA 3VOEA 4M6YA 4YDUA 2CZ6B 4LK0F 4IQJA 1VSLA 1HKBA 2H09A 2JM8A 2BE7D 2YRDA 2CYYA 5JFRA 2KVQG 5HDKA 2JM9A 3VUBA 1RRQA 2IVNA 2P9LB 1UHFA 4BRMA 3QB0A 1TS9A 3BR6A 1T08B 3GFIA 3KZZA 1H9GA 3BG5A 4C9YA 4K41A 3P5JA 5E1ZB 3AAQA 2X74A 2YJFA 2GBQA 5KYYB 2WUSA 4FWLA 1OU9A 4M77A 1YHQI 1KC8O 1A5JA 2EW3A 4NCBA 1IKVA 3NMZC 1GLCG 4O0JA 2QBYB 1A35A 4ESFA 2VE9A 3SFMA 2L5QA 1ITGA 4FSVA 1HQCA 4EA5A 4L9JA 4FWRA 1ERDA 3HVRA 3OB9A 3CCVT 3H6ZA 4M6XA 2FBHA 3M59A 3AVAA 4EW4A 4CJEA 3LDLA 5DY9A 1OYIA 3CETA 3G3ZA 4DQIA 4B1RA 1T6CA 1VYVA 1UHCA 1MBHA 2RN2A 1T38A 1USTA 3LSGA 5E79C 2QK9A 2VWJA 1SEMA 2CS3A 2HW3A 4ISEA 4FYVB 2IA2A 3UA6A 4BXUA 3FHNA 1N39A 1YJWQ 1I50J 3N4MA 1WFXA 4GV6A 5J2MA 5CVJA 4L5JA 2F5FA 3DRPA 1TC3C 3KZIC 1X58A 4MTEA 1QA6A 3TAEA 4BRIA 2Z1IA 4M78A 3FLCO 2FMYA 2VL8A 5I9EB 2JUGA 2XPWA 5AQOA 1T0FC 2DQRA 1KSPA 3JB9F 5LHIA 4RDUA 1OR7C 4ZHRA 1VOMA 1GLEG 3ZQCA 5JR3A 4O8UA 4DGWB 3E19A 2F9WA 3VQQA 1X2MA 2F48A 1NKCA 1MV0B 2AT1B 2JUCA 3ERED 2VG5A 3HBLA 5M5YJ 4LSNA 1OULA 2DEQA 1D0XA 4GY5A 3S2DJ 1R6RA 5D6XA 5BPIA 2DMTA 1K73R 3VSLA 1M4ZA 3E6BA 2ED1A 4RGRA 4ZTFA 1SMTA 3LLRA 3KLFA 4M42A 1M3BA 3RDVA 3MN9A 2ID6A 2G7UA 2E5QA 4J00A 4XLFA 2QG9B 2Z1JA 3U2RA 4Q5VA 5AQGA 2P8TA 4CGDA 2O8XA 2V8IA 3FSPA 1IJWC 2XAGA 3I56I 2YX7A 5T7BA 1ASUA 3C2BA 1OJLA 4KHNA 1F9NA 2NOJB 1V55H 3HOZJ 1HBXG 3OYKA 2E1NA 2D0NA 1W2BM 2ZM6K 4OGEA 2IXSA 3SB2A 1XOVA 1VQ9A 1WGSA 3KKRA 5F2RA 2DA1A 3R61A 1NWKA 4A93J 3G6ET 2HCKA 5DM7R 4JKBA 3KP3A 5J2QA 2LJ0A 1LVKA 1WZ2A 1NEBA 1IJJA 1X3UA 3TWHA 2P51A 1UZCA 3CI5A 1KAXA 3OYBA 4KISA 2NLUA 3NH1A 1YF5L 1WI9A 2YG8A 3KE2A 1GCQC 2X51A 1RT3A 4RW7A 3WEEA 5GAOn 2HSTA 2ELHA 2DD4A 2VODA 4ENNA 1BI4B 2LD5A 4LD5A 3QIIA 4PJOE 5FPEA 4G6TB 3M56A 4DR3K 2FUG2 1VQNA 1UA0A 2E36A 2Q0RA 1IREB 3PX4A 5HODA 5IN1A 4DV2K 2EIJH 1IF1A 1AD5A 2P7VB 4CIEA 3KNTA 2E1OA 1NYGA 2WTUA 1RAIB 3TI0A 1IGUA 4M75E 2FSWA 3ER0A 5CKFA 4IHYA 2EJFA 3N4QA 1AWXA 1XHZA 3VENA 1XGSA 4CZZA 2W48A 4HLXA 4BQQA 5CVRA 4B21A 4B1UB 4UB6C 5TKYA 3CCLA 3AA4A 4WE1A 3ZLJA 2DKGA 3DOLA 4B8XA 3PQJA 3LM9A 3GMEA 2GTDA 1WEFA 4BE0A 3ESWB 2E12A 2D4WA 2VPRA 1UGRB 3D5RC 2OQGA 5CVVA 1HW5A 2GFAA 4EGZA 2M7BA 5M1OA 2KAFA 2K7AA 4CSWA 3Q7BA 4HBLA 1JJ8C 2MC3A 2P9IB 3WXLA 4M3WA 5J26A 2ZMEA 5C10A 1X3WB 1DU0A 2R7UA 4BNCA 3GX4X 3HVTA 3CQXA 2XY5A 2XU8A 3JCMd 2HZDA 1QU3A 4M75D 2CT4A 2EH3A 3LA3A 4YG2F 3QHSA 2PYLA 2IAJA 2JVVA 1YOVB 5IYCJ 1SUQA 3CUQC 5E20A 2IVWA 2XDDA 4M3RA 2A42A 4BG8A 2Y2ZA 1FTZA 1SHFA 2CP0A 2P9NA 3U4LA 1VQPT 4CJ7A 1MDUB 2IDOA 4OJRA 3TQNA 5CVUA 4YOXA 1S1VA 5IH2A 2HNHA 1FN7A 4H5TA 1YJNI 4E0DA 4H0TB 2OTLI 2L2PA 3AAFA 2O8DA 3FX3A 2A5XA 2NWMA 2LF7A 3D4VA 2F1LA 5E3NA 2ACJA 1KD1O 2LY2A 2QGUA 5IT9Z 2GM4A 3FIWA 1I5LA 3CCEQ 3ULRB 1NGCA 4M72A 4KITB 3RPUD 3R6MA 5IHIA 2X9DA 3FK7A 3G1OA 4JRQA 1ZSZC 2JT4A 4A0XA 2JA8J 4PL8A 1K73C 1PP8F 5GAN3 2RKHA 2PN6A 5D6YA 4OMQA 1R49A 4RA2A 1ZG5A 4MEYF 5HLIA 3VQ6A 1N27A 2DMPA 4OU0A 4OPKA 1YXQA 4M7AC 3CPWS 1TAUA 4EIKA 2HU9A 3NHNA