3OYAA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and raltegravir at 2.65 resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyaA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyaA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyaA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyaA03
3RRHA 2IGIA 1U4BA 4CFBA 1U45A 1TKXA 4C8OA 1NK6A 4B9XA 4YNQA 4DSEA 2Z1GA 5HRPA 3NH2A 3L3VA 4DS4A 3HJFA 2OA8A 3VQDA 3C6UA 1WSJA 2VG6A 1TGOA 2QK9A 4CIEA 2HHXA 5KCOA 3OYDA 3OYGA 3GOXA 1UOCA 1A5VA 4A4EA 4JS5A 2GFUA 2R58A 1SL2A 1RTHA 4CHYA 2DFEA 4JRQA 4E1NA 3BDPA 4KO0A 3V9WA 4KTQA 1EP4A 3EAEA 2BE2A 2F5KA 2R5MA 3P83D 4B9TA 3CQ8A 2LCCA 4E7HA 1HPZA 1DTTA 4Z0UA 2PQWA 4I2QA 5FRNA 3LX7A 3IG1A 4LD0A 4L8RB 3VQ9A 4B08A 3V1QA 3VQAA 3H08A 2W42A 1BQMA 2D5RA 3ZSXA 3WNHA 2D0CA 3EY1A 3LAMA 4KRFA 4CEOA 4G1QA 1QSLA 2ZQBA 5J1EA 1HYVA 2G8UA 5K14A 1XNIA 3VQ6A 1I3AA 2EX3A 3G10A 4FW1A 3Q1JA 1Q9YA 3QEIA 4CJ5A 2YNHA 4EP4A 4B9SA 4FJKA 3OYMA 3MEEA 1U48A 5D6YA 2YNGA 1NJYA 4RG2A 3AVGA 1RBTA 4FXDA 3HPGA 3VA3A 3AVBA 3THVA 2EQMA 2OZMA 4DTSA 4CGDA 1A5WA 3OVNA 2RPIA 2IC3A 3LH0A 3SD4A 4FJJA 3AV9A 1RT3A 3NFAA 4Z4CA 4W5NA 3SJJA 3MP1A 3QNNA 3NTKA 4CJRA 4ELVA 2HHTA 4FZXC 4CK1A 4CHOA 1X1PA 3NH1A 3ZCMA 3KKRA 1RDBA 2IDOA 3ALYA 3AVAA 3DOLA 4CGHA 1S1UA 2HHSA 4E7KA 3C6TA 2XHBA 1WSGA 1VSEA 3HP6A 3KTQA 1D8YA 4HCZA 3E9FA 2F96A 1RTDA 1D9FA 3KKSA 3TWHA 3VQCA 1XC9A 3M8PA 2KTQA 2HHUA 2R5AA 3G0ZA 2KFNA 3QEXA 4IKFA 1CLQA 4F3OA 4NYFA 3PO4A 4Y1DA 4FK0A 4CIGA 2X35A 1NK5A 1RILA 3PX4A 4O55A 4A4FA 3M9QA 1QSSA 4CHPA 1NK9A 4KKOA 4QQ6A 1W9HA 4OVAA 3F9KA 1TVRA 1ZBUA 3ISNC 3CM6A 3D45A 1RBVA 1X9SA 3O3GA 2ATQA 4FJHA 3KD5E 4CRIA 5HROA 1ITGA 4CJVA 4CEQA 4BE1A 3OB9A 3ZSVA 5KGWA 4XIUA 4KHYA 3LP2A 2XY8A 1NOYA 4B9MA 4PLLA 4KI4A 3OYLA 1WSIA 4FJMA 1RDCA 4OJRA 2LRQA 3SUNA 3M8SA 1NOZA 4LH4A 3UWNA 3LP1A 4OGCA 3DRPA 3AO1A 5JS1A 2HHQA 1NKCA 5KCHA 4FLZA 4OVLA 3C95A 2G8IA 3LAKA 2DY4A 4AHUA 2GF7A 3P8HA 4F2SA 4W5RA 1ASWA 1RTIA 4AILC 3ZSRA 3KLEA 3DLMA 4ID5A 2FC0A 3O3FA 3JYTA 3QETA 1JLAA 1WSHA 1ZBFA 3WNFA 1C0UA 4A4HA 5CZ1A 2EFIA 3MEAA 2OPSA 1HQUA 3O8VA 4OLBA 2P51A 3OS0A 1WNSA 2VWJA 4CE9A 5SZTA 1S9GA 4GMJB 5CYMA 2HNDA 5I42A 1NK0A 1RBRA 4JLHA 1JLCA 3FEOA 4Z4GA 4LD6A 4A4GA 1B9FA 2FBTA 4DSLA 4DU3A 3DLBA 3SNNA 1TKDA 1BL3A 4Z02A 5KRSA 2P5OA 2OYQA 4BDYA 3U3GA 3DOKA 1JKHA 4CJ4A 3RTVA 4JS4A 5HRRA 4DG1A 1HYSA 3QEPA 4BACA 3QEWA 1VSLA 5CY4A 3OYIA 3LGFA 5KH6A 2O4IA 3KUFA 3K2PA 4W5TA 2Z1HA 4F4KA 1TAUA 3TR8A 4J2BA 3SQ4A 4II1A 2YRVA 5C24A 2LVMA 2D9TA 3F70A 3OMGA 1J54A 4FJNA 2M1HA 1I39A 3CFRA 1IKVA 2WOMA 2BUDA 2D0AA 3V1OA 3V9SA 2IG0A 4KHNA 3F73A 1SL1A 4E0DA 4DFPA 4C5EA 3NAEA 1JLFA 2JZ2A 2K3XA 4Q5VA 1H3ZA 4B9NA 4E7LA 4CJTA 4BWMA 4M3WA 2JLEA 4DTJA 1WJRA 3OY9A 4CJWA 4RW6A 2L89A 1YVUA 3OYHA 1C1CA 3DLRA 1WJSA 4FCYA 4R5PA 3KD1E 3AVCA 1NK4A 5JS2A 4OKJA 1NJXA 3NF7A 4E1MA 2G3RA 1WN7A 1L3UA 4L59A 3AO2A 4IG0A 3CYMA 5FDLA 5T7BA 4H4OA 3MXMA 5HRSA 4KREA 4FJ8A 4DSKA 2KFZA 4W5OA 3QIOA 3DI6A 1LV5A 3E9GA 4X34A 4KHUA 1B92A 2BKDN 5CIUA 4CEBA 4CHZA 2RF2A 3ULDA 3ZT4A 1N27A 4CJ3A 2OPPA 4C5GA 4FJ7A 1HNVA 1HYZA 3E01A 3BDLA 1WAJA 4CF1A 4BDZA 3MEWA 4DQRA 3PUFA 4FLWA 4C5HA 3LALA 4HUEA 4OLAA 4QQDA 2E4LA 5J2NA 4M3RA 5C25A 3QKJA 3MAQA 1BI4B 2XY5A 3VQQA 4FLYA 2MWPA 3OYEA 2O4XA 2HNZA 2CKKA 3CG7A 5SWMA 1UA0A 3RRGA 4CJLA 4QVZA 1S5JA 4WE1A 3MO8A 2P5GA 4M3XA 3L2RA 2JTFA 4IUQA 3V9ZA 2GFAA 1UA1A 2FBYA 3SYZA 5J2PA 2B8AA 1BIUA 1NJZA 1KHCA 4CJKA 1LWFA 1SL0A 4E89A 3OA6A 4CGGA 1KCFA 4RW8A 3KJVA 4I2PA 4CJEA 1T8EA 1KFSA 4C5IA 1JLEA 2Z1JA 4UQGA 1QSYA 4E7IA 2BGGA 1KLMA 4FL6A 1SSFA 1Y97A 2XY6A 1FK9A 1U49A 3MEGA 1JXBA 1T7PA 4FU6A 2PYLA 3NF6A 2ZD1A 5HRNA 3TAEA 2HQEA 2HNYA 5FROA 3VQ5A 4Q5WA 4N41A 2MWOA 4DS5A 3OYFA 2NLUA 1ZBHA 1IO2A 3TAFA 2RI5A 2EQUA 3TAGA 1T03A 3FDRA 3P5JA 1WLJA 4IFYA 1S1VA 3L8BA 1X9MA 3QINA 3HYFA 3B6PA 3K5OA 2R7YA 4PUOA 4FK4A 4EDUA 3CEYA 4DQSA 1L5UA 4DLEA 1C6VA 4HHTA 4PQUA 1WSFA 4FLXA 4H8KA 4C8KA 1KTQA 1VSMA 2X78A 3NE6A 4KB1A 3NF8A 2DFHA 1WSEA 4DFJA 4DSIA 4B8CA 3QO9A 1FXXA 3META 1QHTA 4Z4HA 3HPHA 4NYNA 3NH0A 2EQKA 2HMIA 1A5XA 1L3VA 3HL8A 3SPZA 3ZEHA 3QIPA 2I5JA 1XWLA 1D5AA 1OZ3A 4FM0A 4CGFA 3BGRA 3VQBA 1DLOA 3FFIA 4EP5A 4FVMA 4FW2A 2X6SA 3AA2A 2HQXA 3MXIA 3HSTB 4OGEA 1SKRA 1VSKA 4Y1CA 1MU2A 4DQIA 3FLGA 1VSDA 2BDPA 2PYJA 1RBSA 1GOCA 1KVCA 2RN2A 1G15A 2XDPA 3L3UA 4NS5A 3SCXA 3ITHA 3NNQA 3VQPA 4CFDA 3RMBA 2QQRA 3MP6A 5KE3A 2YHAA 1EX4A 4N56A 1NKEA 2B5JA 4KPYA 2WACA 4MFBA 3ASKA 1JXEA 4DTMA 3P8DA 3LWMA 4CF8A 2R57A 4KTWA 1G5VA 1NJWA 4KHWA 3K57A 3ZSZA 3K59A 1C0MA 1RT5A 5CYQA 4ZHRA 4CJFA 2E6NA 2HVIA 5IN1A 4CGJA 4ZTFA 4GY5A 3LZJA 3U6FA 2EHGA 5KRTA 1QS4A 2NUBA 4E3SA 3UIQA 3IRXA 1KVBA 3VQ8A 1Z26A 3O4NA 3DLEA 1S6PA 4Z4EA 3LYIA 1KRPA 4FJ5A 3H6ZA 4FJXA 2Y1IA 3SUOA 4E7JA 4C8LA 1LW2A 4QOZB 4ZTJA 3PMIA 4RW9A 3DB4A 4HVJA 3PX6A 4DQQA 1ASVA 1VSFA 4CK3A 1HRHA 3KK2A 4CJQA 1TV6A 3OQ5A 1Q8IA 3H8ZA 3PFSA 3VQ4A 1YTUA 1S6QA 4DTPA 1TK5A 1RT6A 1BISA 3A2FA 4DF8A 3D0PA 1L3TA 4CECA 4HCCA 2RI2A 3L2WA 4I7FA 2VG7A 3V4IA 2RJFA 3V9UA 1ASUA 1OZ2A 3MEVA 4YFUA 2RJEA 4QCLA 1VK0A 4AHRA 4PY5A 2VYTA 2RJDA 5J2MA 3LP3A 4M42A 4CJSA 3T3FA 2QXFA 3MEDA 1W0HA 5HLFA 5C6SA 1R0AA 3LPUA 3IAYA 1UWBA 3C4SA 1OYXA 3I8DA 4OKKA 1IKXA 2QKBA 1GOAA 2Z1IA 2BANA 2B4JA 1RBUA 4F3TA 5KI6A 1L3SA 2BIVA 3PV8A 4N4GA 4FM2A 3OYKA 3AVMA 4KB0A 1GOBA 2RJCA 1RI0A 4CJUA 3FC3A 3MP8A 4IFVA 1NK7A 4IG3A 4CCHA 2YKNA 4NZGA 2E6LA 4FYDA 3AA4A 1S1WA 3OYAA 3ZT1A 2GUIA 4OPJA 1U47A 3AVKA 3KIOA 1LAWA 3ZSOA 1BCOA 2IS3A 1RCHA 2D0BA 5KE2A 4DSJA 4LY7A 4DTNA 2HW3A 2HHVA 4LSLA 1ZBLA 4FJ9A 1IH7A 3PX0A 3RMAA 4ELTA 3ZSWA 3EZ5A 4PA1A 4AHVA 3K5LA 5I3UA 3DLGA 2ETJA 4DMNA 4O44A 2B6AA 1S1TA 3HPOA 2RI3A 3NHGA 3OYJA 3HM9A 2XY7A 4FLVA 4CFAA 4OPKA 2X4WA 4FLTA 1VSHA 2EKOA 1C1BA 3TAMA 4DTXA 1TK8A 1VSJA 2A1SA 3AVFA 1O1WA 3PY8A 3OYNA 2K3YA 2F8TA 2FBVA 1YTAA 3HVTA 2ZE2A 4JRPA 3T1AA 5IAYA 4W5QA 3DYAA 2X4XA 3TABA 4N4HA 5DMRA 3M8QA 4CGIA 2HHWA 1UAXA 4B9VA 5KTQA 4FJIA 3OS1A 3TI0A 1DTQA 3S9HA 1TK0A 4FM1A 1QQCA 2HB5A 1J5OA 2RKIA 2E5QA 3SQ0A 4HUFA 4J2AA 2XO7A 3WNGA 2ITGA 4KI6A 3SZ2A 4DTOA 4KHQA 2DAQA 3SPYA 3AVHA 4F8RA 3PMTA 2G8WA 4BWJA 1IKYA 2O4XB 1RDAA 3TAPA 3QNOA 3KLIA 3CFOA 4DSFA 4N4IA 1RTJA 3HK2A 2YV0X 2PY5A 3UT1A 5HBMA 4LSNA 2GBZA 2VG5A 4RW4A 3NCIA 4AHSA 2AJQA 4DF4A 2L8DA 3ZSYA 4ELUA 3VN5A 3S3NA 1CXUA 1SV5A 3O4QA 3QJ6A 3LP0A 4M45A 3QEVA 4CK2A 3OYBA 3C94A 1LW0A 1TL3A 3NF9A 4KV8A 3LGLA 1BCMA 4BE2A 1WAFA 2KZMA 1NKBA 1OI1A 4UC4A 5D3GA 3MEUA 4CF2A 1S9EA 2Q3SA 3PO5A 2G8KA 3T19A 3K5NA 3OS2A 1KFDA 1SKSA 2F8SA 3AVIA 2G8FA 3NBPA 3QLHA 3VA0A 2X4YA 1B9DA 4CIFA 2M16A 4FZZA 3DLKA 1QE1A 3NGIA 1KLNA 1RT7A 5CZ2A 3QERA 2YNFA 4KFBA 4M3TA 3AVNA 1NK8A 1FKPA 4CEEA 4RW7A 1WJQA 5E41A 2KW4A 2OPQA 4M41A 4IURA 4IBNA 4CERA 3ME9A 1Z25A 4C8NA 4KAZA 1N5YA 5D6XA 4IDKA 1SUQA 1T05A 1TL1A 2YHBA 3SUQA 1KSPA 3ZT2A 4O4GA 2M0OA 1JL1A 1JLBA 1ZYQA 1RT4A 4MQ3A 3CFPA 2KQ2A 3I0RA 1CXQA 3V9XA 1IG9A 3LWLA 4NCAA 2PZSA 3KK1A 2Y1JA 2LDMA 3TARA 4B9UA 4J2DA 3M8RA 1C0TA 3RR7A 4K8XA 3S6WA 4HTUA 2P1JA 1Q9XA 4IUTA 2YKMA 3SUPA 3LPTA 4DLGA 2YNIA 4F2RA 3CM5A 4O0JA 3NGZA 4NCGA 2G8HA 4K8ZA 3AO4A 1MHNA 4TSXA 1RT1A 2RHIA 4Q0BA 4C8MA 3K5MA 2DFFA 3L2QA 4CEDA 1RDDA 2X6NA 2X74A 4N47A 2EQJA 4NCBA 3L2UA 3TANA 4N76A 3NDKA 1SKWA 2RHYA 5KGXA 1HJRA 1WGSA 4EZ9A 1QTMA 4DU4A 2DTUA 1REVA 5D6WA 1TKTA 2O4GA 4FLUA 4CF0A 3ZT3A 4CHNA 4GW6A 3ASMA 4N5SA 1N6QA 2DIGA 4DTRA 3KK3A 4FK2A 4PWDA 4H4MA 3SI6A 4CESA 4AH9A 4KTZA 4E19A 3LANA 4Z4FA 4DFKA 3AO5A 4I9LA 3LZIA 1HNIA 3V81A 4O0IA 4AHTA 4Z4IA 3AVJA 3QIIA 2G8VA 3OJUA 1YT3A 3IS9A 4RG8A 1D9DA 4QW2A 4CEAA 1JLQA 2RHXA 3KLHA 2XK0A 1BIZA 1BGXT 2IAJA 1CZ9A 3HO1A 4CEZA 1BHLA 2GV9A 3K58A 1EXQA 2XRIA 3OJSA 4B3OA 2RO0A 1RT2A 5DK5A 5J39A 3DRSA 4KHSA 1EKEA 3RR8A 3DB3A 2IOCA 3EYZA 4HCBA 3PNWC 3SQ2A 5HP1A 3I0SA 3OYCA 4M3UA 2KZZA 3DRRA 3SV3A 4IUVA 1F21A 1X9WA 3QESA 4I9QA 3SQ1A 5M9OA 5C0MA 2L3RA 5EU7A 1JLGA 3B6OA 4BD3A 1J53A 3AA3A 4QQGA 4M3ZA 4ICLA 3WNEA 2DIQA 1LWEA 1CZBA 3AVLA 4QAGA 3MECA 3QBYA 4CFCA 1ZBIA 1XHZA 4DWIA 3O3HA 1C1AA 4CJPA 3MXJA 3HT3A 4ID1A 3RMCA 3VQ7A 3LDSA 2JGUA 2A1RA 2RHUA 1LAVA 4J2EA 4BE0A 1XI1A 3ZSQA 4HUGA 3JSMA 3P1GA 4FJLA 3AO3A 1HMVA 3RMDA 4CF9A 2QKKA 1FKOA 1KVAA 1TKZA 4BDPA 3U3YA 1S1XA 5J26A 4OKEA 4CEFA 4FJGA 4AHCA 3OMCA 4B9WA 3TAQA 2OZSA 2HVHA 3KLGA 2VWKA 3KLFA 4DU1A 2OPRA 1IKWA 1TAQA 1VRUA 4IUUA 4LH5A 3V1RA 4IUPA 1K6YA 3L2VA 1BI4A 2LSNA 3RWUA 1EETA 4B8AB 2E6MA 1BQNA 2FBXA 3L42A 2RHZA 1JL2A 4PLIA 5C42A 4CHQA 4DTUA 2P0KA 3DMJA 4M3YA 2FHDA 3VQEA 1RNHA 3LLRA 3SV4A 3V6DA 3HP9A 3AA5X 1VRTA 2QQSA 1VSIA 4O5BA 1LWCA 3HVRA 2LTOA 5FRMA 4FZYA 5J2QA 3DLHA 3NTHA 1U04A 1XHXA 3S3OA 4GVMA 3DM2A 3HXMA 3S3MA 4EZ6A 4DFMA 4DQPA 3NGYA 3ZT0A 1HQEA 1J9AA 4PL6A 2WONA 3NTIA 4B9LA
chains in the Genus database with same CATH superfamily
2JVHA 4AUXA 5GAOl 3H3OB 2L7KA 3ECOA 2GTOA 3RRHA 3FGUA 1DGWY 2WADA 1U4BA 4CFBA 3I5RA 2RKHA 5E3NA 2R7DA 5CYVA 4PZJA 4C8OA 3M54A 5CHZA 3CVSA 3M8JA 4YNQA 1LNXA 1TQPA 1N77A 2E3HA 3NH2A 1GL5A 2K2MA 2L2OA 4DS4A 5GADJ 4V19S 3FJPA 5B1AH 4Q5SF 4WFNL 2OA8A 3VQDA 1TGOA 2QK9A 3JXUA 3OYDA 5AQYA 3HRTA 2GIZA 5AIQA 3R4KA 3CC7N 3TU4K 3O08A 4L3QA 5AZJA 1GLFO 4WK8F 3H9JA 4ZH4F 2KY9A 3BDPA 2PMZN 5LD2C 2MGQA 1PUEE 4LK0F 1UB9A 3PIPF 4M75E 3PIPL 4RAFA 2BE2A 3CCQT 1YJNN 2DO3A 2JN0A 4H0VB 4MDBA 2X9HA 1FMWA 2M8GX 1ZG1A 4FPAA 3GXOA 2BVLA 4CYCB 1ATSA 1Y39A 4BI3A 3P39A 4LD0A 3PFYA 4L8RB 3UDCA 3DLLA 3VQAA 4LIVA 2WB1A 3H08A 2FEZA 3TQ7P 1OH7A 4XORA 1NGEA 5B3SH 4JK9A 2VODA 2MFZA 1FJGK 3LAMA 2WAEA 4PNOA 4ILJA 4OIPF 3BTCA 1HSTA 3A5OC 1QSLA 1V4RA 4DBHA 5GAOr 3HRMA 3VS6A 5E1ZB 2IW5A 1HA8A 2DERA 2ID6A 1T39A 3G10A 3S41A 1RI9A 5LGUA 2ACJA 1D4XA 3UR3C 5DM6F 3Q1JA 5KVRA 4JKCA 5DM6L 4EMHA 4FO0A 3H0FA 2EINH 1Q9YA 3M5AA 3CCLT 1X9JA 4JI2K 4EP4A 1U3OA 4A3MJ 3PE0A 2YNGA 1NWKA 1T6SA 2LT1A 4RG2A 3JAME 1UELB 1R0CB 2L0AA 5EEGA 1RBTA 4FXDA 2AP1A 5GAMg 3N5BB 3HPGA 1ZA1B 4U0YA 2JA5J 1MA9B 4KN4X 4CCNA 3CTAA 2GXAA 1Z3YA 3LH0A 1ILYA 2DXUA 5EG2A 4KT0E 5HK0A 4BC4A 4DBQA 4W5NA 4XTWA 2YHTA 2FU4A 3QNNA 2GM4A 2DQRA 2FMLA 5H2FC 3GFIA 1U9OA 4ELVA 2E8AA 1YW9A 4QTRA 4C8QB 2OQGA 3KXTA 4YG2F 2ZPIB 1WRJA 5GP9A 4OFEA 3DOLA 1GDTA 1HC8A 4CGHA 2EGAA 2L2PA 4E7KA 4UNOA 3EYIA 3S93A 4R55A 4RLQA 2HSTA 1GCQA 3LSRA 3KTQA 3CPWP 2DMUA 2UXNA 3I54A 3CCEQ 1RTDA 2QAZA 3F6VA 2CUBA 4FSVA 4OB3B 2H8RA 2V8JA 1IHWA 3G0ZA 2JW4A 1CLQA 1HU0A 3JRIA 3WXMB 1P59A 4Y1DA 3I8BA 3PX4A 4O55A 3I56T 4A4FA 1H88C 3CF5F 3CF5L 4DV6K 3C0CA 1UHCA 1J6ZA 4E7ZA 4XAXB 4QQ6A 2PMZA 2HEQA 2BXYA 1M3HA 1ZBUA 3CM6A 1RBVA 1KQSA 3CD6T 4JLIA 1YJNA 4LC9B 3OW2P 1K8KA 4IO9F 2QWNA 4IO9L 1G3YA 3SEZA 5KGWA 1XMXA 3CC4Q 3H41A 5GJWB 2O9SA 5CVIA 3BR0A 5L3GA 3VYUB 1RDCA 4BQQA 3F6OA 4BY6B 3SUNA 1UMQA 2COZA 1NOZA 4P5NA 3UWNA 1BKBA 1JO8A 4F7UG 4KT5C 4E9HA 1QMCA 1OKRA 3X24B 2X0LA 3HSFA 1B07A 3A8LB 3IRRA 4OVLA 3VESA 3F8CA 3KNTA 3C95A 2G8IA 2DA6A 2MSYA 2DY4A 2NOBA 1W2BP 5FD6A 3TSWA 2OZ6A 4G94A 1TC3C 3CMAN 1I5OB 3KLEA 1UAAA 2DA4A 3DLMA 1JJ8C 3FMRA 2JS0A 5BNGA 3PNYA 1JLAA 2K3FA 2CGPA 1WSHA 3RKWA 1YIJT 2CZ0B 3HEFA 3W2AA 1XDUA 4M78B 2OPSA 2DMQA 1U2VA 2HOAA 3O8VA 1BI2A 3V7CA 2OTJI 1YNZA 4ESRA 4RTXA 2CO5A 3AT1B 2VWJA 1Z9QA 5CQGA 2VQGA 1WA7A 4D5FA 3QYBA 3ZQIA 1RNLA 2M0CA 2RQUA 1I6HJ 1WH5A 2LOOA 1NK0A 1RBRA 1K83J 1JLCA 2WY7Q 3LQRA 4Q47A 2JXBA 4QPOA 4A4GA 4F04B 1MUZA 3EO3A 1B9FA 2FBTA 4OMFB 3M4YA 3G1JA 2KMTA 4BDYA 4BVOA 1YOVB 5LBQA 4ETSA 4LFAK 2K86A 1BIBA 2JTEA 4CJ4A 2K9SA 2BGCA 1R49A 4AG1C 3MMVA 4LLLA 4BY7J 2R7XA 4MO5A 5HRRA 1FWZA 1HYSA 3LA7A 2J5OA 1QPIA 2V1QA 2EB7A 2VB6A 2LG4A 3L2ZA 4D7NA 3M59A 4OMZA 3CXCA 3TMOA 3CD6N 4BNCA 4BACA 1X2QA 3CCQA 5ICFA 1RAAB 5DEQA 5CY4A 5KH6A 5HLTA 3WXJA 2F4IA 4IDHA 3KUFA 2HNIA 2E1HA 2P6TA 5IT9K 3G4SQ 4O3MA 3QWYA 1TAUA 1ULYA 3TR8A 1ZUYA 1JE8A 2D9TA 3F70A 2CW0F 2DJNA 2M1HA 4XK4A 1IKVA 4J9EA 1K78B 5J3BA 3T7ZA 2OC6A 3ER0A 3MN5A 1SL1A 4E0DA 3O1WA 3KWGA 3WTWC 1S22A 5J1YA 2F4MB 1KG7A 3AL0C 3D2EA 4B9NA 2W6LA 3TTFA 3K10A 3IKVA 4CJTA 5FB2A 2KZVA 3CETA 2X1CA 1XGOA 3ULRB 4M77D 4X66K 3RVCA 3EHQA 2NAZA 1UG0A 4EATA 5HY6A 1AEYA 1YVUA 4GV3A 2O8DA 4LE9A 1C1CA 1WJBA 3GTLJ 3CCLA 3DLRA 2CWEA 3E6CC 3TSUA 3CCRN 1WJSA 2QWLA 1IBKK 1PD0A 2QEXT 3BY6A 2ZPFB 4E1MA 1HKQA 2G3RA 3J7ZO 1L3UA 1BW5A 4L59A 3HI0A 1WEGA 3AO2A 3CCEI 2VWBA 1LFBA 3M3ZA 1Z9ZA 4FSXA 1N75A 3QP5A 5HRSA 5C4JJ 4FJ8A 3MCPA 3CMAA 1VA7A 3MKZA 1FOYA 2K3PA 4W5OA 1D1BA 2XB5A 4HAMA 3RQ4A 1EIFA 3QFPA 5E8IA 1LV5A 4X34A 1UTIA 1IRZA 4OAYA 2KE9A 5GIPA 2DPUA 4WQ5A 2RF2A 3JCMf 1FT9A 1KJWA 4C92D 4CJ3A 5ECAA 5CVVA 4JJCA 5KYWB 2UZKA 1HNVA 3RZOJ 1TBXA 4JD2A 2LLKA 3BCBA 3MEWA 3M56A 3CJTB 5KYYA 1IV0A 4HUEA 3O9TA 1DJ7B 3BJAA 4FQGA 3QBXA 5BMZA 3CC4I 5C25A 3VETA 4PGGA 1XTAA 1PHTA 1V4SA 1XSXA 4FLYA 1M27C 5EYRA 3OYEA 4KH5A 2YWWA 3SDZA 2BV6A 4I99C 3IFRA 1FJLA 2K5CA 3VYSB 5SWMA 4CJLA 5CKFA 4WE1A 3I56A 1IXCA 3ZMTA 5ICGA 4Y17A 2DETA 3V9ZA 1E2XA 1ZELA 2GFAA 5F1XA 4XLFA 3HPWA 4O5VA 3URGA 4NXMK 2NLXA 3D1NI 2FBYA 2DYBA 5J2PA 2JT4A 1X3NA 3N4MA 3CD6A 3E6MA 3CCMQ 1NJZA 5JMVA 2DO7A 1LWFA 4YFXF 4CCJA 4C8QE 4JJBA 3PL8A 3PVQA 4CJEA 1MMNA 3LDQA 1VRLA 1KFSA 4C5IA 4PKIA 4RB1A 1JLEA 2Z1JA 4UQGA 4LN2A 1J59A 3FDYA 3K4MA 3IL2A 4LD9K 1RPWA 4KH6A 4AYBA 1R5ID 1E3MA 1RAGB 5CQXA 1FK9A 1U49A 3LM9A 2EPDA 4ESFA 1KA8A 4ESJA 5H20A 3QXEB 2HNYA 1W7PA 5FROA 1HCRA 4N41A 2P9LA 3EEQA 3C3WA 2GGRA 1M1KR 1T6CA 3OYFA 2CS7A 1UFMA 1E3HA 1X01A 3TAFA 3BF1A 2RI5A 3CQZJ 4YFKF 1X75C 4M9ZA 2Y0SA 4BC3A 3SK3A 4F7UB 2P9IB 2NUZA 1UG2A 4IFYA 3T9NA 3EGXB 3JB9F 4PFPA 4XM3A 4WQ5C 1ZRDA 4PUOA 5I21A 3TTDA 2W0ZA 3BG5A 1QVFS 2IVPA 1C6VA 1YIJA 4PQUA 4H0YB 3I3LA 4UV9A 2HSEB 3O9RA 4EMGA 3JSCA 3A5LC 4H8KA 1TXQA 5EF6A 1T3VA 3Q3SA 3NE6A 4KB1A 1VQNN 3DKWA 2K5IA 5EXWA 4XH4A 2DFHA 4I0AA 2W10A 2XPWA 1BO5O 1WSEA 2UU9K 5AQVA 2A36A 3ML6A 4H0XB 5JFRA 3META 3KP5A 1ETYA 4DKWA 4BRMA 3NH0A 2EQKA 3G4SI 2QK0A 2HMIA 2QA4T 1O13A 2NVXJ 4TV7A 3FMSA 3RKYA 4WWCA 3A8YA 2PAVA 2CH4W 5DY9A 3CCUT 2WAFA 3W3CA 1OZ3A 3M6GA 5DYMA 1AZGB 1Y8RB 4A6DA 4FM0A 4L5EA 2LKSA 2DT7B 1IO6A 3FZFA 2HDCA 3H3UA 3JCUC 3K4JA 3KZYA 3ECHA 3FFIA 4BU2A 1ZGAA 4II2A 4KN7X 4J6YA 3OL4A 3S1RJ 3LWHA 1WXTA 2EV5A 1QVPA 1DKGD 2YU9J 2KJBA 4OGEA 3P9CA 2FO0A 1SKRA 4F55A 2CW7A 1X2KA 1MU2A 4DQIA 2V7YA 3JB9I 4N9IA 1MIJA 1M3QA 3H3VK 2BDPA 2PYJA 3S1NJ 2E4HA 4NL3A 3EG1A 1O4XA 3OBWA 4RB2C 4JK1X 3ID6A 1WHLA 1W36C 2W1OA 4VUBA 3L3UA 2R7WA 1J5EK 3ITHA 4CFDA 4ZJZA 3RMBA 3QOPA 5LJWA 5LL6Z 1YJ9T 5FKLA 1PKSA 2UXXA 2B5JA 5HDGA 2P0QA 5M1QA 1KC8O 2QSHX 5FFZA 4R56A 1WGXA 2P9PA 4MFBA 1MBHA 3ASKA 2OI3A 4B6MA 4RTZA 3O6WA 3FHFA 2ZPBB 1MNMC 2ATCB 2WSEE 2HEOA 2RQTA 3QPHA 2VV5A 1G5VA 4KTWA 4HT8A 1EQYA 3VS2A 2YJEA 4OB1B 3JV3A 5IHNA 5AN4A 4C9YA 4EPCA 2QEXA 3ZSZA 1VQKT 4V2FA 2JJ7A 2FZCB 1B34B 1U5TA 1IRGA 2E2PA 2XAJA 2PN6A 4CJFA 2BUPA 1YO5C 4EAHD 2Z3YA 4EEFG 2RK1A 2VGMA 3AG2H 4GY5A 1OCCH 2VKDA 3LZJA 4CBXA 4G12A 3U6FA 4DR1K 5GANe 1SEMA 1QZYA 3UIQA 4B47A 2DTZA 1KFZA 1B6AA 1OYYA 4B09A 4J9DA 2OX7A 1IAWA 2O03A 1NK3P 2CH5A 2JT1A 2Y1IA 1LJ9A 4C8LA 1VQ7I 4ZNXA 5F1JA 1VFCA 2EV0A 2CS3A 4AI4A 4HV6A 5K5RA 3PMIA 2CSIA 1X1AA 1RRSA 2JNGA 1Q86O 3NGPA 1SRMA 3HHGA 2GOXB 3LW5E 1HKCA 4RM2A 3KK2A 2F5CA 3NFCA 4ISGA 2FXUA 1YBYA 2E35A 1TV6A 1R0BG 1Q8IA 1S72N 1YTUA 5AQLA 4DTPA 1BISA 1QQIA 8ATCB 1WWXA 4BY6C 3D0PA 4ZZLA 2Z99A 2MH9A 1HD3A 2RI2A 1NGFA 3W6JB 2ZB9A 4X0GA 1DGKN 1JI8A 3K69A 3JCMc 3THYA 2A5XA 1NK2P 5E20A 3GTMJ 3RPQA 1PKTA 2RJFA 2H56A 1VQPQ 2OTLN 1FZPB 3ZN1A 5GMKh 1DPRA 2DOEA 1UG1A 2RJEA 2DL7A 1VK0A 3CCMN 1ONVA 3VTIA 2XIGA 3IUCA 3DEWA 2VYTA 2UXDK 2RJDA 1MGQA 1JCEA 3GVAA 5J2MA 5KYXA 3LP3A 3RDVA 4M42A 1T8IA 4H5NA 1M3AA 2D6FA 4H0OA 1U5TC 1V3FA 3DFGA 4O8KA 1UWBA 4ME7A 1RFQA 4FWMA 3L09A 3C4SA 5DLQE 2YLCA 7AT1B 5GIOA 2ETHA 1WYXA 3GBGA 1GBRA 2WSFE 2Z1IA 1FBSA 3IH2A 1RBUA 1XX5A 3FXUA 4ZGEB 3HL2A 3L0QA 4B3MK 3PV8A 4A93J 4HVVA 2ECBA 4XONA 4FM2A 2TDXA 2HYGD 1STZA 3AVMA 4KH4A 1EJ9A 5KAIC 2JPSA 2DF6A 3VF4A 4XKWA 3FXQA 3ATUA 2NUPA 2YJFA 4UXNA 1IG7A 4A5MA 1QVFM 3MP8A 2E19A 1NK7A 3ZETA 5L3CA 5EG0A 3EDPA 1LPLA 4CCHA 3ENBA 4XTZA 2NUTB 4NZGA 1WEIA 3E9LA 1QHHD 3JCMP 2HGCA 2VJ4A 3OYAA 3WVDB 5GAN4 2YT6A 1GV2A 4OPJA 5M5XJ 4ELZC 1U47A 4XRMA 1LAWA 3JAMZ 5AQWA 1RCHA 3QDFA 1IREB 2RQVA 4QIWN 4DTNA 4PFZA 3C2BA 2NRXA 4MFDA 1T0FA 1ZN2A 1YW8A 3PX0A 3RMAA 2GIVA 3ZSWA 2QWPA 1PCXA 2NNYA 2LSOA 1QZ5A 4MTDA 4DMNA 4O44A 3IKTA 2VQCA 2PBDA 3I55Q 4J6WA 1D3BB 3ZMVA 4OMQA 4FLVA 5FLXE 3FZMA 3BF3A 2V52B 5CVRA 4PFOA 3VOVA 2LH9A 2IVNA 1CZAN 1K4SA 3C2GA 1S72A 1FTTA 3CCSQ 4UB8C 3KHYA 2E2JJ 4DTXA 1TK8A 1BR1A 2A1SA 3H36A 5C10A 2E12A 3WGIA 2DYIA 2F8TA 3HSRA 4FM4B 2FQ4A 3ABTA 3T1AA 3GTOJ 2GTJA 5IAYA 4W5QA 2CQXA 3DYAA 1P7JA 2WV0A 1KGSA 3VF6A 2YX4A 5KQ8A 4CGIA 9ATCB 3VKIA 3BROA 1UAXA 4KIBA 3VERA 1MMAA 1BBYA 2VASA 1FSEA 1RIOH 1SFUA 2DN0A 2M4KA 3O8GA 3S17J 3C7NA 4FM1A 2HB5A 1J5OA 1WCMJ 5ERIA 1DU6A 2ZBKA 3DLAA 4HUFA 3TDZC 2KRFA 3SJMA 2ITGA 1ETKA 1QNTA 3HTRA 4MDAA 4I02A 4HX7A 1QLYA 1R59O 1TQMA 5BN9A 2OJED 1VQKA 3CCVN 4DEYA 4F8RA 2D5VA 4HT9A 3GZ6A 4W1UA 4J00A 1ORPA 1YP5A 2XHKA 4NC6A 2XD0A 2W84A 3TTCA 4DSFA 5J8FA 4HVUA 4D7MA 2VBWA 1RTJA 5AJ3K 1E6GA 2YV0X 5LJ5e 4HG2A 3BTIA 5F0XA 2KRCA 3S1QJ 2GBZA 4BQLA 4PJOG 3B73A 2CT3A 2AJQA 2I5UA 4X9CA 2EZLA 4XMYA 4J9IA 3TKYA 3VN5A 1QQMA 4M3GA 1XQSC 1QPMA 1CXUA 2ZJRF 3OOPA 1T0FC 2HFHA 4MLHA 3RYPA 3QJ6A 5K7ZA 1VQPI 2P9SB 2G0EA 3HGYA 1TL3A 1KC8C 3C6AA 1J09A 4KV8A 3BEXA 1WAFA 2KZMA 4M75A 3G71N 1HKSA 3VRZA 3I0XA 1N6AA 4M7AC 1NM7A 5LMNK 2RF0A 4CF2A 5E84A 3B6CA 2NRRA 2P9UB 3OS2A 2FRHA 2HZTA 3M57A 2X4YA 3THXB 5LJ3d 1N8RR 4A3CJ 2E1NA 1K61A 2M16A 5KPTA 2Q2EA 4ZN3A 1QE1A 1MV3A 4FWLA 3NGIA 2Q36A 2R93J 3E7LA 2H3JA 5GANj 3E5XA 1RT7A 2L3DA 3ZCOA 4DV5K 1NEGA 1YJWN 1K73O 2XUBA 3MZ8A 5DCMB 4XQFA 5AQFA 4YOWA 2PU9B 1ORNA 1HYOA 2FSKA 4DR3K 3KTUA 1OKJA 3AVNA 4H5VA 1NK8A 4Z6YA 2KW4A 4M41A 4CERA 2OFKA 3SHFA 1SF9A 4BRLA 3MPUB 1YIOA 1N9SA 3K4BA 4H0PA 4OO1J 3OIQA 1SUQA 3TGNA 2LJ1A 2KDZA 2YHBA 4CSWA 3TBIA 2MF2A 2KT0A 2MYSA 3L7WA 2VWFA 3CFPA 2ZSIB 2KQ2A 1SMTA 1CXQA 4CXFA 1IG9A 3LWLA 2VC1A 3G0QA 4XH5A 4CZMA 2PZSA 3GZNB 1JBMA 1J3TA 4MZTA 3SEQA 3SXYA 1H1VA 4B9UA 4CW7B 2QXLA 1C0TA 4HNTA 1V4TA 3S6WA 3GDQA 4HTUA 5D8KB 2QWOA 3S8PA 1D3YA 2A6TA 4ISFA 1QQJA 3LPTA 1TUCA 4AFSC 3IMXA 3FKJA 1Z6RA 3FK6A 2JK3A 2ESWA 3JCMJ 4O0JA 2E2HJ 3AO4A 1MHNA 3VV0A 3O9UA 2FZGB 1QWFA 1T08B 3L2QA 2OTJT 4CEDA 1TW2A 3EG3A 1I1GA 2DVJA 1GUUA 5LRSA 3MKWB 3O8MA 4NCBA 3I55I 3LSIA 3JTGA 4JAXA 4M75C 4DYCA 5DM7R 2CFXA 4X9DA 3GF5A 4EZ9A 4DU4A 1VQ8N 3CCSI 3DTIA 3JRGA 1AHJB 2ZXWH 3BDDA 1TYQA 4M77F 4MMKA 3DLLF 4FLUA 3A1YA 4CHNA 3ASMA 5D4SA 4FWRA 1D5YA 1N6QA 1AA7A 4CHUA 5FU7B 2OAZA 1KXPA 4BR5A 5J3LA 3SI6A 2MC3A 1KC8U 2CUFA 4KTZA 2BOLA 2VXDA 2Y9YA 4DFKA 3J7YJ 1KD1O 4JV5K 1Z77A 3AO5A 2O8CA 2JSPA 1HNIA 3G71A 4AHTA 2I5WA 4I6MB 2BH1A 3A98A 1KK7A 5GAOn 4DYQA 5GAN6 4JKDA 4RDUA 5GAN5 4RAYA 3IS9A 3DBHB 4CEAA 4J5YA 1JLQA 3KLHA 2XK0A 4B3AA 1BGXT 2A5YB 4C92F 4EM1A 3FZHA 3HO1A 3F72A 3JCMX 1WHJA 2NOLA 1RRQA 4RGRA 4E1JA 3MD2A 4C0DC 5CHIA 3GBTA 3OJSA 4B3OA 1R1TA 5DK5A 2Q0UA 3OR2C 1WFXA 5J39A 2DOFA 3DRSA 3J8AA 3CQXA 4LDUA 2IOCA 3CC2Q 3SQ2A 2X1DA 2D0PA 5HP1A 3I0SA 3LDNA 4XSXF 2GA2A 3O1BA 2KZZA 1HW1A 1RETA 1TOVA 1F21A 2ZGWA 1D8JA 1JCFA 5AQSA 2ZXJA 1YI2N 3T8TA 1NZ9A 3ROUA 1QVFA 1U6ZA 3GTKJ 2COBA 2MD5A 4XBFA 2L3RA 4AIAA 5EU7A 3GTPJ 3B6OA 5JVHL 4HQEA 4HPQA 4M3ZA 3A01A 1LEBA 4E9EA 2RC4A 4ICLA 4A0ZA 2M0MA 2D8JA 2YRDA 1ZUUA 3CCET 2RQWA 5I2SA 5EZHA 4KMUX 3QBYA 3FHGA 3VEXA 3EH1A 4EMSA 1PU8A 2VE8A 3IH7A 2BZTA 1R00A 3MXJA 3HT3A 1RDWX 3PIPA 1U3EM 3UKUA 4B24A 2BW3A 2OCCH 3VQ7A 1H92A 2PVOB 2A1RA 4M7DD 2M7AA 2DMPA 4L6V5 2VCPA 2ZJ2A 2MAMA 4N0AC 4JJNK 1FBUA 1GVJA 2I10A 2KNBB 2Z9OA 4FJLA 2EWNA 4LNPA 2KRMA 2EBPA 2OAWA 1D1AA 4A61A 1X2MA 3GOIA 1VQ4Q 4LFBK 5CKDA 1WHUA 4HF1A 1KVAA 3M7GA 4HVWA 2EIJH 4GYGA 4RUGA 1KAXA 4PJOB 1AKHB 3A8OB 3HOTA 4BDPA 2KT8A 2W85A 1KG4A 2HU9A 1GLJO 1S1XA 4LF8K 3KFWX 3SFZA 3F8BA 2ROLA 2YSQA 2C0TA 4AHCA 3G1LA 4MFEA 4L9NA 2TRTA 3KLFA 3VYGA 5JHFA 2W4SA 1YHQQ 1TAQA 2DXIA 1AOYA 3N4PA 4CD3A 1NJIR 1Q81R 4A2UA 2PFBA 1FYLA 3L2VA 1BI4A 1EETA 3FX3A 1WEFA 4B8AB 2E6MA 1JL2A 4CHQA 4BAYA 3HC7A 1M5Q1 1FLIA 5LJ5j 4ENMA 4P1WA 4FWPA 2P0KA 4ABZA 3VQEA 1XUPO 3EL2A 1I5LA 5C4XJ 1SQKA 2I2LA 1LWCA 2XASA 2YX7A 2J6FA 4PKHA 1KSWA 1R5GA 1OPKA 2SRCA 2N8GA 3MQ0A 3DLHA 3NTHA 2LFBA 2EV6A 5BS6A 3E2UA 2QYOA 3HXMA 3S3MA 1UZCA 1AWWA 3LAPA 5EEHA 3ZT0A 3QG1A 1HQEA 2KT1A 1E17A 2Y4XA 3JRCA 1KG6A 4AIDA 3PJRA 3CVTA 2VKHA 4XLNF 3OA9A 1TKXA 2D8HA 4GRIA 1VQ9T 5LJ3h 4NL2A 1NK6A 4OPHA 2Z1GA 2LC4A 2XHIA 1XMQK 2DTOA 4BY9C 4U0WA 2V26A 4W97A 1SVLA 4DJAA 1SS6A 4Y0WA 2Y48A 3E6DA 4A69C 3EG9A 3GOXA 1A5VA 3EG2A 4BRIA 3K4LA 1SL2A 4DNCA 1XQOA 2OTJA 1K73C 4GLKA 4DR7K 1IC8A 2NS8A 4DQ2A 2V4JC 4BJ6C 4PJMA 2QSGX 1EP4A 1F43A 4IHSA 1YFHA 3NQOA 3G4ST 1OCZH 1JCGA 4HLXA 2KR3A 4B9TA 3CQ8A 2YUOA 4JQFA 3A5ZB 1KU9A 1R22A 4I2QA 1B9MA 3TSZA 4EMKB 3CJ1A 4C92E 4H03B 4AIJA 1F36A 2B86A 2W00A 3LX7A 1MUNA 2BTTA 4WF9L 2LJ3A 2L5QA 4YFNF 2MIOA 2D5RA 2G9WA 1T6DA 2FF3B 1JHFA 2AIRB 4YEJA 2P5VA 3WNHA 2MA3A 2OUMA 3I59B 3L4QA 4JRKA 1LOTB 4XSZF 5AQQA 2E6ZA 2DBBA 1FMVA 5AQNA 1HYVA 3AKZA 1XTDA 1XNIA 4KICA 3VQ6A 1I3AA 3I9V2 5CKBA 2JJ9A 4FW1A 1IN7A 3W2WA 1YITI 3C12A 3HTUA 5BR8K 3RMQA 1HUXA 3LQQA 1K8AR 3OL3A 2IS6A 4OFAA 3BE3A 3QEIA 5FLVA 2YNHA 4L5GA 2BBYA 4B9SA 3MEEA 5JHUA 2X48A 1WDXA 2YLBA 2G6FX 4E2FB 5H6QA 3AVGA 3OSGA 2JM9A 3THVA 2EQMA 2IIRA 3R3LA 4LF4K 4DTSA 1A5WA 4B1WB 2IC3A 2CUDA 1RAFB 2FXAA 2VI6A 3IP4B 4CZEA 4FJJA 1VQ9N 4L9TA 3SZTA 1RT3A 3RCOA 4Z4CA 4CZCA 1OULA 1G83A 1VQ5Q 3CC2N 3CO6C 1Q7YO 2FBIA 2EYWA 3JB9H 4QS7A 1IN5A 4JI1K 3OOUA 3ATVA 2IVOA 1WJCA 3G6EN 5E1XA 1VQ4I 3RMSA 4AQYK 1X1PA 1X43A 1Y64A 1YFNA 1XNQK 3R1XA 1RDBA 2GQVA 1P4XA 1R71A 2IDOA 4M7YA 3ALYA 3TW7A 3AVAA 2KMUA 5IPAA 2JA2A 3M1FA 4YOQA 4OMLA 3SB2A 3DU6A 4HNUA 4KUMA 3F8NA 1WSGA 1VSEA 2EW3A 1KG2A 3UKRB 4AM7A 5A2QE 2L7ZA 4HCZA 3CBOA 1YHQI 1D9FA 3X2QH 3CMEN 4LDWA 3TWHA 4C30A 3H1VX 1BW6A 1T0HA 2DXCA 1XC9A 1IBLK 3IC7A 1OR7A 2KTQA 1OCTC 4XK8E 4IJAA 2BY2A 1TLHB 3PO4A 4FK0A 2X35A 1NK5A 2Y4YA 1JXOA 1K73U 3E1SA 4JHDA 1VQ7T 1QSSA 1ZHFA 1BJZA 1NK9A 2E65A 1TH7A 1W9HA 1X58A 3JCMe 1J75A 3ISNC 1TWHJ 1VQ6N 4QLCU 1XN7A 1YAGA 3O3GA 2ATQA 2LCLA 4FJHA 1ZBXA 5IOZA 2DA1A 1ITGA 3MWTA 4CJVA 4BHPA 4JPBW 1OVQA 4JK7A 4XIUA 4KHYA 1NOYA 3KETA 4PLLA 2O01E 1WSIA 2LJ0A 1APLC 4DV3K 4EJYA 1QZEA 2LRQA 2A3LA 3M8SA 4GO1A 4LH4A 3SEMA 3NMZC 1NG7A 3AO1A 1ZH5A 2HHQA 3SYTA 3PSFA 2A3ZA 2I8DA 2YR2A 2IS1A 4DK9A 3MN9A 2M0YA 2NXNB 2IGOA 3JW4A 4M3BA 4RS8A 1FYNA 2PLYA 3DXJF 3ZGKA 2ZF5O 2NRZA 4PJ0C 2IS4A 4B9QA 2DXTA 3FJ5A 4W5RA 4NB4A 1ASWA 3JRBA 3TU5A 2XRNA 5D5VB 2LD5A 4LXCA 3SFMA 2FC0A 4ID5A 4BEHB 3QETA 4BL0B 4PJOE 2AT1B 4I98B 5LGTA 1NJIC 4A4KA 3EN9A 4C3JJ 1VTNC 2HQNA 3A8HB 3S15J 1C6VX 2ZGZA 2JTMA 3DKYA 3HKSA 2K3BA 5FLXZ 4OLBA 2XU8A 3JSPA 2PUOB 3JAMK 3TEEA 5CE3A 3O4WA 1VQ9A 4JI6K 4G7HF 3PQJA 2COMA 5LJ5g 5CYMA 3CBMA 1OR7C 1HDDC 5I42A 3KK7A 3TSPA 4EQQA 2HOSA 2BZ8A 4Z4GA 3H35A 4LD6A 1V1CA 4XLHA 2RN8A 2GXGA 1ZARA 3LSHA 4DU3A 1TKDA 1YRNB 1GHCA 2L54A 5KRSA 4X65K 4BRGA 2M45A 2OYQA 4JKBA 5GINA 1X3MA 3VDXA 1ATRA 3U3GA 1SMYF 1WXUA 1LCUA 2CP6A 4MLEA 5HCKA 3RTVA 1Z21A 3RTRA 1IN4A 3HDDA 4JS4A 4DG1A 3H3NO 2ICWG 2R7RA 3COAC 2V1NA 3E97A 1HKBA 3G4SA 4MLOA 4AM6A 2AKLA 1MNEA 2MD0A 3LSGA 3OYIA 4LUDA 2Z16A 3K9JA 2O4IA 3CF2A 3K2PA 5GPAA 3GFMA 2UV1A 2ECZA 4F4KA 4NQWB 4J2BA 1H9TA 1J54A 3CFRA 3QOEA 4LLGF 1U1SA 3V1OA 4FISA 3AAFA 4OF1A 4G6QA 4KHNA 4DFPA 4C5EA 5DS9A 3O6BB 3H9GA 3REAB 3WODF 1VQ5I 2JZ2A 3K1NA 1YX3A 3K6GA 2GWRA 1ON1A 2R5ZB 1H3ZA 4E7LA 1TQIA 2JLEA 2F6CA 2O8EA 5AFUH 3OY9A 2DRKA 1RGIA 2E64A 2L89A 1SSHA 3QPTA 4F52A 2WFBA 1UGQB 3AG3H 3VODA 1QKWA 3OMYA 5IXFA 5JS2A 2PX9A 2KBTA 2R7ZJ 4FASD 3KYLA 3R6OA 3UNGC 3AG1H 2EFWA 3JSOA 4H0TB 3LOCA 4RAGA 2LMDA 3CYMA 3QHSA 4H4OA 3MEXA 4C8QD 3Q9VA 3GUDA 2A6HF 3MK6A 5LJVA 1VQOI 3D4VA 3J80E 1K9MR 1MJ9A 3S2DJ 3H9NA 3REBB 1NJIU 2K9MA 1B92A 2BKDN 5CIUA 5C3EJ 4CHZA 3R60A 4M73A 2HVRA 5DUIA 3SBTA 5HS9A 4C0GA 3ZT4A 2DBMA 1HYZA 3O5ZA 5AZIA 2H27A 3E01A 1WAJA 2B0LA 4HV5A 4CF1A 1W4SA 4DQRA 4FLWA 3ZRGA 4C5HA 3FM3A 1RADB 3W6KB 1WIEA 4IJNA 3F23A 4CZFA 1Z67A 2LVSA 1R1UA 3M0RA 3HYIA 5HS7A 2O4XA 1U5SA 2EYZA 3IQLA 1LWVA 3CG7A 1UA0A 1NLVA 1UJYA 5IT9O 3RRGA 2KDOA 3OH6A 4AG2C 1VYVA 4BBSJ 3CUOA 4XN3A 1EH7A 1VQ7A 4CZHA 3HSEA 1RUNA 2QYZA 2HOTA 4Y3OA 2VQEK 2FNPA 1UA1A 2DTHA 3OBYA 2ENMA 5CAIA 1HLVA 5GANf 1AHDP 2XKOA 3OIPA 2B8AA 4ZDPA 1KHCA 4CJKA 3AAQA 5CQYA 3K70C 1SL0A 4P55A 2JUGA 2VJ5A 4E89A 4CGGA 3QBWA 1Q7YC 3DCFA 2XGCA 1O7LA 4DOZA 2K9LA 1T33A 2JM8A 2GOMA 2LBFA 2XDVA 1QSYA 4IRHA 2HHHK 1MSEC 2K5FA 1KLMA 2EFOA 2ZCFB 2DLPA 4KUDK 5TJJA 1ETOA 2FD5A 5CVUA 1MMDA 4BY1J 2EGEA 2BZXA 3GBQA 2PBIA 4YIFA 2MWOA 3QAHA 5CO7A 2EJRA 4B3RK 2QQ9A 1IO2A 4CD1A 5LJ3f 1P90A 2EQUA 2HTSA 3AY9A 2GZWA 2FEIA 2DXBA 4M78D 1IRFA 3FDRA 4JKGA 1WLJA 1I4K1 5BRFA 2GCXA 1U6GA 4JX5A 4UVAA 1QVGA 3P31A 5AZJB 1H641 2BVMA 2HZDA 3CEYA 4DQSA 1QVUA 4HHTA 6PAXA 4Y4RA 4UOBA 1WSFA 4FLXA 1KAYA 3PIOF 3QYHB 3PIOL 2AZVA 2WBMA 2KKOA 3VEYA 1GXPA 4XLEA 2CV2A 3JCMQ 1PD1A 1TZLA 4BS9A 4DSIA 3SDGA 4B8CA 1YS7A 1QHTA 2NOEA 3X25B 4NBQA 1K0XA 4Z4HA 2LQNA 4NYNA 3JRAA 2CYZB 1K8AU 3VJPA 4M3DA 1UCRA 5AQHA 3HL8A 4Q4ZF 2I5JA 1XWLA 3OW2S 1D5AA 1ZRFA 1YN8A 3EGDA 3I55T 5TISC 2XKOC 3SDBA 5LY3A 5M3MJ 2XI9A 4PUSA 2DQLA 2IGMA 1OYIA 3DWLE 2J7IA 3CCST 3FSPA 2KRHA 1H8AC 2EWSA 4FW2A 2GNCA 2IVMA 2WAQA 2Q0RA 2KROA 2JHNA 2HQXA 2ZNYA 3HSTB 2ZNZA 3J81E 3KP3A 5AFUA 1VSKA 4Y1CA 2DJIA 1YUWA 2NZTA 3HOYJ 3L00A 2GWJA 2QASA 3FLGA 3JRDA 3WTZA 2R5YA 3W2VA 1Q82O 1BN5A 2HNHA 4JOMA 1WH7A 1A5JA 4C1NI 2A61A 2NOIA 2NVUB 3ONQA 2DA2A 4NB5A 3BWGA 2ZMEC 3ZEUA 3UF4A 3IDHA 5D6EA 2LP5A 1Q7YU 1F1BB 4NOYA 2F5EA 2FSWA 1I8FA 3KYCB 4GXOA 1QCOA 1KQ8A 2V9VA 2JVGA 5J47A 3MP6A 2D2WA 3CQTA 4LG3A 1XMOK 4M7DF 2QGGA 3CC7Q 2ASOA 1BI3A 4KPYA 2HQ5A 2WACA 4GVEA 2OCEA 5H6RA 4DTMA 2LNBA 1HPMA 3P8DA 1ETVA 1VQMT 4DV7K 3E19A 2BXZA 4RKUE 3TREA 3A0IX 4QT7A 4X1VA 1B3QA 3HOUJ 3O3KA 3ZMDA 1YJNQ 5HNHA 1LE8B 2KK4A 4O8UA 4FOEA 3K59A 5GADP 4BRAA 3CCJN 1C0MA 3KVGA 3ZQHA 2CG4A 4ZHRA 1RESA 3VEOA 5AQIA 4XLCA 1WB9A 1KO9A 2E6NA 5IN1A 4CGJA 1NMDA 4ZTFA 3K9KA 4IRIA 3CJBA 2V7FA 3E6BA 2EHGA 5HNFA 3NVKA 3ZXSA 4E3SA 2PQ8A 1FOWA 1AD5A 2DU9A 2H1KA 2IA2A 1NGJA 3IRXA 2M30A 4CUGA 3DLEA 3QZ5B 4A3JJ 3RBBB 4A3EJ 2ASPA 4F7ZA 2MC4A 3M55A 4BR9A 1K8KB 3H6ZA 1WZOA 5FW9A 3FBNB 1KQJA 2KDSA 1LW2A 2PMUA 2CUJA 1Z6TA 1Z91A 1DQUA 1NEBA 1DP3A 4QVDA 2F7TA 4UVCA 2M9HA 4RTTA 4HVJA 2K02A 5FKOA 1VAZA 4UY8O 4JNEA 5CR4A 1A35A 1VSFA 3BC8A 2QLZA 3FLCO 1K9MC 5L3DA 5BPNA 3H8ZA 3PFSA 4OU0A 4PGHA 1NGDA 1QA6A 5E17F 1PSEA 2NVTJ 4G8XA 1L3TA 2E1OA 2AXTC 2W40A 1MV0B 3L2WA 3AL0B 2VG7A 3S32A 3I5SA 2XIDA 3I33A 1WHMA 5IYCJ 1D8KA 1P92A 5AQUA 2CYYA 4LIUA 2YUNA 2DK3A 3H9QA 2HYFA 5I22A 4BRKA 2R7TA 1L3LA 4KJZA 1SD5A 5LJ5d 1VQMN 5C2FA 2EFQA 2FJ1A 2KSSA 5HLFA 5C6SA 3FM5A 3CCQQ 1R0AA 4ITVA 3RKQA 2JZYA 3LPUA 1G6NA 1ABOA 1W70A 5KYUA 2P81A 4LLNA 3DPTA 5FLMJ 3ZQFA 2P9NA 4K43A 3NEUA 1KYWA 3CJCA 4RMOA 1IXRC 2P8TA 5M5WJ 1IKXA 2DBKA 5IXBA 2DYRH 4ZYGA 1ZHIA 1A36A 2B4JA 1U8BA 5EX5A 4NXNK 1UHSA 3DTKA 4XKCA 3E0JB 4Z88A 4B43A 1OU8A 3TPQA 2VN2A 5JI6A 2WB1N 3N97A 1T2KA 1DUXC 3OYKA 2ZXHA 2RJCA 1RI0A 1GLBG 3GL1A 4CC2A 5F08A 1FPQA 3CPWM 2HI3A 3GLXA 2CZ7B 4V2SA 3IH3A 1ZYRF 5GJVB 4LMYA 2E6LA 4FYDA 2FF4A 4KIFA 2JPCA 3ZT1A 1GLLO 1NYFA 3AVKA 4AC0A 2ED0A 2HDDA 3ZSOA 2YHXA 2V1RA 2EAYA 2D0BA 3HGGA 3WHBA 2PJRA 5KE2A 2WC2A 4Y7NJ 4JYAK 3AFHA 1KQ2A 3CJNA 4LSLA 4DW6A 2QF7A 1R9TJ 3CMAQ 3I55A 2GAUA 3FMQA 3MN6A 1SG5A 3WXLA 3D2EB 2JWTA 3JCMg 1AT1B 1BR2A 2MMPA 4ELTA 2E2IJ 1MDUB 3EZ5A 1JJ2A 3K5LA 3OW2M 4KYWA 3DLGA 3CCSA 3CC7I 1AWXA 4BR2A 4M7DE 3SQNA 3A0HC 4R1HA 2NRWA 5D6FA 4BBRJ 1K9MU 2AQEA 5KNLA 2O8DB 5FJ8J 5ICEA 2BHYA 3F5TA 4OPKA 1XGSA 2CREA 2BY1A 2X4WA 2KQRA 4FLTA 1YJNI 1BB9A 2EKOA 1VSJA 1BOBA 2RN7A 1FC3A 5A2QZ 1O1WA 3OYNA 4ENKA 2FBVA 3HUGA 1XB4A 3T1BA 1W97L 4DR2K 3TABA 5DMRA 3FIWA 1W2BM 3M8QA 3CWUA 1OYWA 4M63C 2M02A 4PK4A 4PJJA 4FJIA 2YI1A 1YITT 1UFFA 1WBDA 3OS1A 2ZAEA 3TI0A 1DTQA 3S9HA 2V9PA 1TK0A 1QQCA 3DXMA 2KGTA 2H6CA 4OMOA 2E5QA 3SQ0A 1IGQA 4P5OA 2MLKA 2JN6A 1VQMA 1X1CA 5KYYB 3WNGA 3ZYYX 1V55H 2A69F 3C65A 3CD6Q 4BH9A 4KHQA 3BUZB 4DQ8A 3SPYA 1HLUA 1BU6O 3WGHA 3PMTA 2FOKA 2PMHA 5IY5H 2BE9B 1NPPA 1OCOH 3FBIB 1RDAA 4L0ZB 3EQLF 2A42A 4K42A 3CFOA 1K76A 4KITB 2IPOB 3RNJA 4FL9A 5HBMA 2CP3A 4M77A 4FWKA 4RW4A 1FP2A 1Q82C 1VQ4T 2KHOA 3NCIA 4HF0A 3E5UA 1M8MA 4ELUA 5FD5A 1QGPA 1RKWA 3S3NA 5HK3A 3D5RC 3CP2A 5FPDA 2QTVA 3O4QA 1JJ6C 1X6OA 2E36A 4M45A 1YHQT 4CK2A 3FKIJ 3NF9A 4HSBA 5BRDA 5LMUK 3CCRQ 4BE2A 5K1YA 1HW2A 2JWKA 1MDMA 3GO5A 4BUGA 1ZLMA 1W7PB 3U21A 2DLLA 4X6AJ 3T19A 1KFDA 2F8SA 2P9LB 3QLHA 3VA0A 2EZIA 4C92A 3WXIA 3HFNA 4DGWB 3I4MJ 4BRHA 1M3CA 4YOTA 4IHTA 4Z94A 2LDUA 1PU6A 5IYDJ 2PJPA 3JRZA 4RTFD 4XIDA 5AQPA 3ZOBA 3CBPA 3P4IA 2V6EA 3TOBA 2F2EA 2F5DA 2YNFA 3VSLA 3PSIA 4RBOA 2VKVA 1BR4A 2E1CA 3CW7A 5DM7F 1PUFA 1OVYA 5DM7L 4RW7A 3QDRB 4C8NA 5FLXK 3SJHA 1N5YA 5GMKe 3DBRB 2LY9A 3OHRA 1TL1A 3QPSA 3CIPA 3RERA 4J6XA 2EYYA 1RLQC 4DBFA 1ZYQA 1RT4A 4MQ3A 1UHFA 2ZKZA 3DF8A 3REOA 4UNFA 4NCAA 3VGKA 1MD0A 4EHTA 2AHJB 2DTIA 4EVVA 1JTXA 3KLOA 2DOAA 4HNVA 2LDMA 5LRRA 3TARA 3BDUA 2G7HA 1S7EA 2CP2A 4AFZC 3RPUA 1S7OA 3I58A 5B8HA 3CCQN 4K8XA 3JCMV 4FTHA 1FW6A 2LREA 4M77C 4IUTA 2YKMA 1WHHA 4M7AG 2E34A 1S7AA 2L3SA 2AA4A 4F2RA 2D1XA 3CMAI 3NGZA 4PJLA 5LL6S 2G8HA 5J1UA 4TSXA 4C8MA 3EG0A 1CSKA 3D7SB 1RDDA 3BPVA 5F0FA 3AG4H 5HL7L 3S14J 1HNWK 4FX4A 3TANA 4JI4K 4A3DJ 3NDKA 5D7UA 1Q82U 2FQ3A 2RHYA 1MPGA 3E66A 5LJ5h 1JEGA 2FA5A 1WGSA 3EUAA 1UGRB 3M5RA 1QTMA 2DTUA 5LEKA 1P7MA 3NAUA 1CGPA 3MJXA 5D6WA 2QEXQ 5E3LA 4JI3K 4C92C 2O4GA 4R79A 3VS0A 3CCLN 2DIGA 4FWNA 2E7XA 2J6OA 4XTUA 3KK3A 4FK2A 4PWDA 1G3SA 4GKKK 5A0DA 3KP7A 4H4MA 3HBLA 3KEOA 1KZHA 3BTLA 1IBMK 4AH9A 1SAZA 3J80Z 3CMYA 3PM1A 2Z0WA 3ENOA 3GTQJ 2RREA 2P9PB 5H1SQ 4C8QF 5GAGJ 1IB8A 5AQKA 1BI0A 3QIIA 2AS5F 3OJUA 4BI8B 4NDLA 2VVKA 2HBMA 3SLCA 4RG8A 1VQNQ 3CD6I 1U0JA 4G9YA 3MDQA 1U5TB 1BIZA 4MZMA 3VUZA 4NC7A 1CZ9A 4WX9A 3I4NJ 2DTRA 2VJIA 1GCQC 5LHGA 4OOIA 2XRIA 2RO0A 1Y96A 3PQKA 3DU5A 2CUZA 1VQ5T 1S9HA 2FYKA 2L9NA 5D5UB 2R7FA 5ILVA 1NYGA 2ZFWA 5IHKA 4JRIA 3DRRA 4OFHA 1YITA 4IUVA 4M75G 3EUKL 2BY3A 4CDGA 2RQQA 5K7FA 2HBJA 3CPWA 3OS5A 2LNHB 3PNTA 3I56N 4Y15A 3WNEA 2DIQA 2DILA 2Y75A 3THWA 2ABLA 2KVQG 1LWEA 1CZBA 2DMNA 4QAGA 1MGTA 3O9SA 1XHZA 3ZPLA 3CCRI 3WHCA 1VQOT 1SHGA 1C1AA 1BU1A 4BUPA 2E88A 4A63B 3IRQA 4Q48A 2D0QB 3CZ6A 4JKHA 2A68F 4WCEL 3LDSA 2B9SA 1EWQA 4XH1A 2P4WA 4Z8AA 4BE0A 4OIQF 9ANTA 4ELYC 1VQ4A 1Y8QB 1H3HA 3VGLA 4L9VA 1V54H 4AYBN 4IQ4A 2ZPEB 4HUGA 5IWAK 5TKYA 3HFOA 3OW2A 2RQRA 4K41A 3VFZA 1FP1D 3THYB 4IFEA 3QWXX 5KQDA 5EEAA 4B48A 2J4RA 5KN9A 3RMDA 3ZQ7A 5KK1A 1YHQA 1M1GA 2GBYA 4HF2A 2HXOA 1FY7A 1AU7A 1LWYA 1N36K 1AOJA 5KYXB 2Y0SN 2NYXA 4M78F 4KGZB 3OMCA 3LDPA 5FKNA 2OZSA 3DEUA 1FIAA 2OPRA 1IKWA 4IUUA 5CQEA 4HQMA 4LH5A 3P7NA 4IUPA 1W2BA 3CESA 4G9ZA 4BRQA 1YQAA 1YIJN 4BROA 1KQ0A 4MIMA 4CCOA 3K7AJ 3L42A 2RHZA 2LY2A 1K6OA 3KEQA 4HRIA 4IVNA 5DPKA 1Y71A 4KRTA 1RNHA 3HP9A 3AA5X 5CR2A 2XHCA 3J7ZI 2NNWA 1B59A 4XTYA 5FRMA 4FZYA 2ELHA 3A8MB 1Y1WJ 2NUPB 1U04A 4IO8A 5EOYA 3S3OA 4L18B 2M1BA 4ZGDB 3HHTB 4QKUA 5EG0B 1T95A 3MZHA 2XGDA 1CF7A 3ZETB 3H0DA 4EZ6A 2CH6A 4DFMA 2KZGA 4UUTA 4DQPA 3NGYA 1D0YA 2VL8A 1J9AA 3K4CA 2WONA 4B9LA 3MZYA 2CQKA 4MEYF 4IXAA 3J81Z 2KP6A 3LCNA 3M4GA 3ENHA 1U45A 1S72Q 1LB2A 2Z1DA 1T38A 2COYA 2HDWA 2QEXI 3SAGA 4B9XA 2ZO4A 4DSEA 2F5FA 3JCMd 1Y56A 3L3VA 1YQLA 1EH6A 3WVEB 4DV4K 3HJFA 3MKYB 2DEUA 3BR2A 2ZCWA 1K4US 5HLGA 1Y7XA 2A05A 3OYGA 2SEMA 2OTLQ 1UOCA 4HA8A 3G73A 2LKXA 3GIBA 2GFUA 2R58A 4ILHA 3QICA 1U1TA 2DFEA 4B44A 4JRQA 2EKHA 3WE3A 4E1NA 4M7AB 4JKFA 4KO0A 5JR3A 3V9WA 2RHKA 3IAM2 2ELKA 2F2WA 4KTQA 5GMKj 3RPUD 4U7BA 2RVCA 3K2ZA 2ITMA 3GNFB 1M1KO 2HF4A 1VQNI 4BXXJ 3EAEA 3A03A 2F5KA 2HZYA 2R5MA 2DODA 4A3BJ 4O5FA 3VB2A 4KDPA 4E7HA 1HPZA 2VT2A 1VQKQ 1IF1A 5FRNA 3IG1A 1YE9A 4B08A 3V1QA 3WT0A 2K4JA 3M3YJ 1PSFA 2MOXA 2RQPA 2DMTA 2QEXN 1M9SA 3ZP5A 3BR3A 4F91B 2D0CA 3LMMA 3C7NB 1HBXG 4BGBA 1LJOA 2VJJA 2GQIA 4X64K 3U4LA 4G1QA 5J1EA 2G8UA 5M1KA 4PIIA 5GAN8 4YPHA 3L9FA 5GTIC 1JKQC 3G3ZA 3VEPA 2C0IA 1Z0XA 2IVWA 4FJKA 1ZSZA 2R7UA 1HNXK 5D6YA 3A8GB 4O6JA 1VQ5A 3HOVJ 1I07A 2ID3A 3U1KA 3H5NA 3VA3A 4XRSA 3R6MA 1KU2A 1XDSA 1MBJA 3HM8A 3KCCA 4B1YB 3QU6A 4F9OA 1SC7A 4IOAF 4IOAL 1NGBA 4K0KK 4LF5K 2RPIA 4MGRA 2ADUA 3Q7BA 3LSKA 1WVRA 2JUCA 1YG2A 2K40A 3UA7A 3H1CA 3DKXA 4BQAA 5GMKm 2O8FA 2CQ7A 4LF9K 3NTKA 2LQWA 3CJ7A 2LP0A 4BJ5C 4FZXC 2JMCA 1S3JA 4CK1A 2A07F 4CHOA 1V5FA 3ZCMA 3X28B 3BJOA 3DAWA 2K2VA 4E6KG 3M0PA 1DU0A 2X9DA 4ZGJB 4M75B 2PZ1A 4GV9A 1S1UA 3WEEA 2HHSA 4WFAL 3WU1B 2F1LA 1O3RA 2XHBA 1VQOA 1R4MB 4IWVA 1D8YA 1RR8C 4OMNA 4S04A 4M78E 2DPNA 5E3MA 1EFNA 5GAMd 2F9WA 2F96A 3KKSA 3CP8A 4JKAA 3VQCA 3EETA 1G2BA 5FPEA 3M8PA 4LDYA 2Q2EB 3WG7H 2Q2RA 4BC2A 2HHUA 2R5AA 3VPZA 2KFNA 4PJOD 4IKFA 4NYFA 2NRVA 4Y28E 3ASOH 2HKQB 2F5VA 4BQNA 1RILA 4DUYK 4EM0B 4M9SA 3QYFA 4LG0A 3M9QA 2A3SA 1SPKA 3D5SC 2F69A 4KNYA 3RQIA 4Z89A 1YQKA 4PSXA 4KKOA 3R8EA 3HOZJ 4A57A 4IXCA 2R7OA 1ZRCA 1TVRA 1LKXA 3FWEA 3WU2C 3L2CA 2Q31A 5D8LB 3RI4A 4I7HA 3KD5E 2LYCA 4LITA 3DWLA 2QQBA 5HROA 4F92B 5AQGA 5B5EC 3OB9A 3F8MA 3ZSVA 3CCVQ 4H5WA 4FWQA 1XMAA 2XY8A 3NRVA 2PEXA 4C0DB 4KI4A 1LVAA 3OYLA 1SAUA 3V42A 1Z7LA 2JPBA 2OBPA 1OX9A 2ESNA 5GMKi 3NMUA 1ZSZC 5JLFA 4OGCA 3DRPA 5JS1A 1UJ8A 1NKCA 3M0TA 5KCHA 1MBKA 1S72I 1VQLT 3FZKA 4ZC3A 4WCGA 3LAKA 2X3XD 4AHUA 3M9AA 1LFPA 3P8HA 4AILC 2CGJA 4TVRA 3ZSRA 2E20A 3WXKA 1RZ4A 3N5NX 3JRFA 3O3FA 3U1DA 2QA4N 5CKHA 3JYTA 2OTLI 1VZ0A 3K0SA 3KLNA 4GCVA 1DDNA 2ZM6K 3DPUA 4E6RA 2KHMA 2JWLA 3CCMI 3F2KA 4KISA 3G71Q 3WNFA 1C0UA 4A4HA 2QWMA 3CCUN 1ZREA 5CZ1A 2P9KA 1FBQA 2EFIA 1V5GA 2VUMJ 1IGUA 1WQ2A 1C0GA 4AWXB 3VYHB 1ETQA 3GCMA 4D5CA 4CJ7A 4UV8A 1TYQB 4PKGA 2QM3A 2KIMA 3RSEA 3OS0A 1Y0NA 1M2OA 1B7TA 4CE9A 3WTSC 3S6IA 2FBHA 5SZTA 1S9GA 1Q18A 2CQNA 4GMJB 1BA1A 4ENJA 3VS7A 3J7AF 3T1HK 3PGGA 2HNDA 4JI8K 4ILGB 4JLHA 4K25A 5LJ3e 4RM3A 3FEOA 5FWCA 1ARKA 1RC9A 1YJWQ 2LCSA 1BG3A 2O8CB 1RL2A 1TWBA 4XTVA 2OZUA 3JRHA 1B8IA 3GF2A 1SFKA 1JKHA 4MHGA 1I0CA 3D2FA 2DA3A 1MWMA 2VPLA 1YJ9N 1NMNA 5ILSA 3QEWA 1VSLA 2K79A 1QQNA 5A2QK 3E9PA 3QODA 4EJUA 3BG7A 1BJAA 1S5LC 4E47A 2L9VA 4FYVB 3LGFA 4DCHA 3W6VA 3V8LA 1G3WA 1WUAA 1U78A 4OX9K 3SZGA 3E9OA 1T44A 1WBBA 3SQ4A 2LKPA 4II1A 1IUFA 1VQKN 1WJEA 3OMGA 3JCMh 3OIOA 3Q5FA 3CC7T 2ZPHB 2HQAA 4ON0A 4CICA 2BHZA 1NGNA 4GLMA 1GV5A 2IG0A 3V9SA 3F73A 1VQLN 4LOCA 3NAEA 1OLTA 3I4PA 4DIQA 3A01B 3GTGJ 2K3XA 2NRHA 1YJNT 4M3FA 1JKPC 4UB6C 4BWMA 4M3WA 1TNTA 4DTJA 1WJRA 4M7AE 4CJWA 3JREA 2HBPA 5ED4A 1UDLA 3OYHA 1KG3A 2E3IA 1F9NA 1RRJA 2NOHA 3BY7A 4AIKA 4HOBA 3KD1E 3O9QA 1VQ8Q 3UKUB 3PIOA 2BW3B 4J7IA 4J8FA 4J9BA 4KT6A 1NJXA 3GTJJ 3NF7A 3H0GJ 1M1KC 3JAMO 2C06A 3PO2J 4IG0A 2OPTA 5KAFC 5FDLA 4FE7A 3UATA 3MXMA 2NOZA 1RI7A 5BPIA 4FYXB 2KEAA 4XU3A 3ASNH 4FPBA 2X6OA 2KFZA 5F04A 2QA4A 4FETA 3QIOA 2Y69H 1T3LA 3E9GA 1KG5A 3T0YA 4KHUA 1MBFA 2ZWHA 4CEBA 3ISPA 4DOWA 1YYVA 3CCUA 3V7SA 3ULDA 3BT9A 3SMPA 4ZDLA 4F7UE 2OPPA 4C5GA 4E7SA 1P6RA 2HPMA 3T5XA 3R0JA 4BDZA 5J6XA 2XDDA 1JUMA 3PUFA 3WUHA 3LALA 5FPNA 4B8XA 5E3OA 4OLAA 4QQDA 3CCVI 2QBYA 4EW4A 3MX2A 4M3RA 1MBGA 3WQUA 1BI4B 3BG3A 3VQQA 4M72A 1BIAA 2MWPA 4EJTA 2HNZA 4F93B 4HW0A 4IEJA 3J7YP 5J40A 1O3SA 4NLBA 4QVZA 4GKJK 3KBGA 1ZA2B 2P5GA 4M3XA 3L2RA 4IUQA 4KMFA 1X1DA 3OH9A 5CVJA 2QWWA 1B72A 1YI2Q 5DLOA 5AYFA 2H6BA 3BR6A 3ERED 2H8HA 4XU0A 3GE1A 1YJ9A 1BIUA 2IBDA 2EFNA 3ZBDA 2HBWA 2XICA 3Q0VA 1KCFA 2L0KA 2X4JA 4M7DA 2UUCK 4GBQA 4I2PA 1MNDA 1H0MA 4HCKA 3QO3A 2YRCA 4E7IA 4ASNA 2ISZA 3O8HA 2IT0A 4FL6A 2OTJQ 1TUDA 3SBGA 3FHNA 1Y97A 2NOFA 3G71I 1Z7UA 1O75A 3VW4A 3Q0WA 1KONA 3MEGA 1JXBA 1KQSP 2OANA 2KI7A 2O8BA 2PNIA 1T7PA 3K1MA 5HRNA 5GAMh 3K1PA 2ECCA 3TAEA 1YQMA 3ID8A 2WUSA 3O80A 5EZGA 4A3KJ 1VQLA 4HTLA 4CO8A 3Q7CA 2NLUA 2F9TA 1V5EA 3ZQQA 1W7AA 4BRNA 1ZBHA 5E79C 3B8AX 1Y57A 4MO4A 3TAGA 2QSFX 3EG9B 2L4MA 1BM9A 3FXRA 3P5JA 1YJWI 3P38A 4N4OB 3L8BA 4Y52J 1X9MA 3HYFA 3B6PA 3K5OA 2R7YA 1POGA 4CBUA 3HJEA 4FK4A 2AKKA 1RKTA 3K4NA 1N33K 1M1KU 4NNJA 1N8RO 1DGRM 4C8KA 1KTQA 1VSMA 1BC8C 1GRIA 3ABLH 3NF8A 4M6YA 1WI7A 1WX6A 1KIKA 1SFEA 4DFJA 4RAZA 1GLEG 3CMAT 3J80K 3HPHA 3GYHX 1T0JA 3JB9G 4AU7A 3SWNA 3W3DA 3ZX2A 3L1PA 1L3VA 1FNNA 2FMYA 3SPZA 2RM4A 2M9UA 4NC8A 3ZEHA 5D5WB 3HKZN 3HG9A 3ZQCA 4LFUA 3DXKA 5AIPA 3QWLA 4JJDA 5DTDA 4J83A 1LMZA 4EIAA 3BP8A 2DL8A 4A54A 5HOOA 4CGFA 3OSVA 1F4KA 5ADXA 2X51A 2IGNA 4M7DC 1PWTA 2OF7A 4FVMA 2DK8A 5D4RA 2YXYA 1TT0A 4FX0A 4BRCA 2HOEA 2X6SA 4II3A 2WC9A 2D45A 1LE8A 2A28A 1PRMC 3HTVA 3MXIA 2DA9A 2EYQA 1XQHA 5BPDA 3RESA 5EY4A 2KRNA 3M8FA 2D4WA 3QZ9B 3U9GA 1VQ8I 4FSSA 4EA4A 3BW1A 4IX7A 1PVSA 3WG9A 3CXCP 1ZLJA 1JXMA 5L23A 1VF9A 2RK2A 3CC7A 3R6SA 3I64A 5LJ3j 1Q1VA 1GVDA 1ZQ3P 4NS5A 3NNQA 5GAN3 5KE3A 3CDIA 5LHHA 3QYEA 3ULEA 2Q8KA 3CPEA 1IN6A 4D8KA 4N56A 4PL8A 1JXEA 1P2FA 1FMKA 2OFIA 4EJWA 1KG1A 4KHWA 3RZDJ 2L01A 3NWTA 2ZSHB 3K57A 2EJGA 4P96A 5M5YJ 1X3WB 4WQ4A 5E26A 4QVCA 2W6KA 4BQZA 1RT5A 5CYQA 2DD5A 1X6GA 4DR6K 1M90O 2CQQA 2D1KA 2HVIA 2EPFA 1DEJA 5F6FA 3KP4A 3OWTA 1M30A 3X26B 2AXLA 4JHDB 3EFOA 4BVPA 1QS4A 2NUBA 3PLAA 1MBEA 3VENA 1P7IA 3SWNC 1HF0A 2ASMA 2XDBA 3H0IA 4RGSA 1D0XA 4OB2B 1YI2I 2NYSA 1M90R 1BK2A 3CUQA 3CCRT 4IZZA 4CZLA 4FJ5A 1MWKA 1SD7A 4FJXA 3MN2A 3SUOA 1FYMA 4E7JA 2YG9A 2IJLA 5LFAA 2RAEA 3I0TA 2X6WA 2E1ZA 4GV6A 2HCKA 4GFBA 4RW9A 4ZZDA 1EWRA 3DB4A 4YOUA 2MG4A 4JYKA 4DQQA 3AGRA 2EBIA 5JICA 2XPUA 2LR8A 1ASVA 2I0NA 1XCBA 2HKOA 1K0SA 4CJQA 4MDWA 1QZ6A 4YORA 3HKZA 5C12A 1FX7A 2O0YA 4BC5A 2E60A 1IUYA 1S6QA 1TU0B 1RT6A 1VQ9Q 1R77A 3C6HA 3LL7A 4AFQC 3QDKA 3ULQB 4WTOB 4HEA2 4CECA 1D1CA 4PJNA 2VT3A 4HCCA 1PU7A 4I7FA 2H3EB 3TL4X 2DYSH 3WTYC 5IP7J 3G6EQ 1N3AA 2XAHA 2XAUA 4XICA 1OZ2A 2HYJA 2CZ1B 2VC8A 4RGXA 1MMGA 2GA1A 3MEVA 1U9NA 1KEAA 2XMFA 3G25A 4QCLA 5DV5A 4AHRA 2STTA 3FXLA 1ZXOA 3GPLA 5LEJA 1QVGS 1M1EB 2DA7A 1LQ1A 3J81K 2JMWA 2YHWA 4WQ4C 4CJSA 2IA1A 3CMEQ 3MEDA 1W0HA 2ZXIA 2OTJN 1MMSA 2XF6A 4IL6C 4LF6K 5EGOA 1PP8F 1I1SA 2A40A 4EGZA 4KGXB 1N34K 1PVEA 1R6RA 3CQYA 1YX5A 4YY3K 3QFUA 3W0LA 5GMKl 5IOYA 4A12A 2EJFA 4OMMA 3CJRB 2BANA 3F0ZA 2LK2A 4F3TA 4I01A 1LFUP 1VQ6Q 5KI6A 1L3SA 5DD8A 1WHKA 5C0YA 1QW1A 5L3EA 4N4GA 3CUQC 1NJIO 1Z9CA 1Q81O 4HWIA 1TWFJ 3PFIA 2HL5C 3CC4T 4GNIA 4KB0A 4E70A 4CH7A 1M2VA 1GOBA 1ZBSA 2AO9A 2W7NA 3QUIA 1IRXA 4IG3A 3D0SA 2YDLA 1R36A 4BQOA 1SRLA 4XN0A 2CFOA 2FSNA 4KH1B 1WNLA 2KYMA 3MCAB 2YCHA 1SAXA 1O3QA 4J01A 2GUIA 4YPRA 3AARA 1U84A 3HB9A 3KIOA 1KU3A 4DBRA 2V1UA 2IS3A 3KFVA 1UB4A 1N39A 2BE7D 1R58A 1QKXA 2HHVA 4HDUA 5M1OA 2J5PA 3FXOA 1BA0A 3WTTC 4FJ9A 1XSVA 2CP5A 1HJOA 2FF6A 1VQNT 2YPRA 2E1MC 2O8EB 4GDFA 3I9QA 4RB3C 3OV8A 1ZX6A 1XG1A 2B6AA 1QCFA 4IPAA 2RI3A 4J9CA 4S0HB 3OYJA 3HM9A 3R9PA 4CFAA 4BGAA 4I0BA 2P6SA 3RSNA 4PL7A 1WPKA 1C1BA 1N8RC 4U7DA 1UGPB 3L6QA 2GLOA 2ELJA 3CCEN 3PY8A 2K3YA 3WTVC 1YTAA 1ESVA 2ZE2A 1UE9A 1BL0A 5K5QA 2CDTA 3DP7A 3KZZA 4CYCA 5A0GA 3CLOA 4N4HA 1SANA 4BHBA 1HR0K 3F0CA 3IHUA 3KYDB 1SHFA 1ABQA 4EV0A 4A0YA 5LLQA 2A37A 5GANg 4ZN1A 3QB0A 1VQ7Q 5AZIB 2RKIA 2EGCA 4HSRA 2G7UA 4PJOF 4YRVA 5KCMA 4IHYA 4ZYHA 3WQTA 4OIOF 4N0BA 1QU3A 3J7AY 4C1NK 2IRFG 4KI6A 1XD7A 4MTEA 3SZ2A 4C2TA 2VQLA 5C15A 2BE5F 2DAQA 1I5ZA 4LD5A 3EGUA 3AVHA 2KLOA 3N05A 3CC4N 5HKCA 1IKYA 4K2EA 3MFKA 2O4XB 3M07A 2CU7A 3KLIA 4IIMA 2XAGA 3I5UA 3TCJA 3VEZA 1QWEA 4N4IA 1ZR2A 2VBXA 2UXBK 3F21A 4ATOA 2NRTA 1QO0D 2DX1A 2PY5A 3UT1A 3EKUA 2QDLA 2LX9A 5LJ3g 1NLPC 4HX4A 3LAJA 1KHIA 4AHSA 3UE5A 1VQ9I 4HXJA 2L8DA 3ZSYA 3CPFA 1Y0MA 2VUBA 3CC2I 1K8AO 3CCRA 1SV5A 4IHXA 1XPXA 3LSMA 3G6EI 4D9JA 1GFCA 2QGUA 2XGXA 2ZGYA 2LBFB 1UJ0A 1KYZA 4C8QA 3C94A 1LW0A 2E5NA 1OPCA 1OCRH 1IXSB 2K9QA 1PNJA 2Z2SB 2JSCA 1IN8A 1S6LA 2WA0A 2UUAK 1OFCX 3V4GA 5D3GA 3F9MA 1S9EA 2M2EA 2FPEA 3DV8A 2K85A 3K5NA 2ZMEB 1SKSA 2O6GE 3AVIA 1X27A 2CRGA 3CMEI 2K6DA 1IV8A 5GAN7 2ESHA 2F2VA 2CH0A 5F2RA 5GAMf 1L0OC 2M5WA 1HXDA 2WTEA 4KIGA 5JVTA 4LGWA 1M90C 5HLHA 1A6IA 3H5AA 5L3FA 4P9UA 2V8IA 2O61A 4JKGB 5CZ2A 1TT5B 3KX2A 3QERA 4BG8A 3RIRA 3LL3A 2V7ZA 4KFBA 4C0FA 2VKEA 2QWQA 1VQ6I 1N8RU 4CEEA 5E8GA 1WJQA 3M1EA 5KN8A 2K27A 1I27A 4IURA 2OPQA 3U9ZA 1Z25A 4JZ3A 4I2OA 2FE3A 3ELKA 4IDKA 3CCEA 1FSHA 4M3EA 4UUSB 1S72T 3ZT2A 1QVGM 1JL1A 5BREA 3V9XA 3IAS2 3I0RA 5M1NA 2X1EA 3HXLA 2C6YA 4EM2A 4XR6A 3A1PA 4A2AA 4RTUA 3KK1A 2VC0A 2Y1JA 4J2DA 3M8RA 2EA2A 3ABKH 3DEEA 1DPUA 3G4SN 1K7AA 4U88A 4EFHA 2FG0A 2OTLT 2P1JA 2E71A 4M4ZA 3SUPA 4KHPK 1CKAA 3CMMA 1A31A 3EGDB 3JCMb 2VGNA 3CCMT 4DLGA 2UUZA 2YNIA 3CM5A 3FK7A 4KGVB 5J8CA 4K8ZA 2L4AA 4BYYA 4MQ9F 4LDVA 3CC4A 1RT1A 2RHIA 3H0HA 2DFFA 3VTHA 5D5XB