4EJYA

Structure of mbogg1 in complex with high affinity dna ligand
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
289
structure length
289
Chain Sequence
MKYNVEEKGTKVIVRGIADFNLKETFESGQCFRWNEEEDGSYTGVAYDRVVNVKLEGDTLIIDNTNLTDFYDIWFDYFDLGRDYGQIKESLSKDPVLKEAIKFGQGIRILRQDTWETLVSFIVSQNNRIPQIKKVIENLATSFGNPIEYKGKIYYTFPKPEELVMYDVETIAKTRCGFRAKYIFDAASKVFSGEINLLKLHEYSTSEIRDILMTINGVGPKVADCVILYSIGRYDTFPTDVWIKRIVEHLYLKREGTPVEIQLFAIDKFGDLSGFAQQYLFYYGREMGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-Methyladenine DNA glycosylase
publication title Crystal structures of MBOgg1 in complex with two abasic DNA ligands
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Hydrolase/dna
total genus 104
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ejyA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4ejyA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4ejyA01
1YQKA 1P7MA 1M3QA 3IH7A 4OFEA 1DIZA 4EW0A 3FSPA 4YPHA 2NOZA 5KN9A 3CW7A 1KG7A 4EJYA 4EA4A 4EA5A 1PU7A 1MUDA 3IHOA 4B24A 1KG4A 4EJZA 4B23A 1WEGA 1KQJA 4DK9A 1P59A 1N3AA 4YPRA 4UOBA 1KG2A 1NKUA 2H56A 1FN7A 4UNFA 5DPKA 1PVSA 1KG6A 5CHZA 1YQLA 2XHIA 2NOIA 1LWVA 3CVSA 4YOQA 3G0QA 2YG8A 3CWSA 2JHJA 2JG6A 3I0XA 1VRLA 1MUYA 4B22A 3F0ZA 1ORPA 3CWTA 2NOFA 1YQMA 3I0WA 3FHFA 3OGDA 3FHGA 4PIIA 4AIAA 1RRSA 4AI4A 2NOHA 2JHNA 1HU0A 4OFHA 1WEIA 4E9FA 4EW4A 1KG5A 3KNTA 3N5NX 2NOBA 2OFIA 3S6IA 1MPGA 3CVTA 5AN4A 4E9EA 1KEAA 3F10A 4HSBA 4OFAA 1YQRA 4E9HA 1ORNA 4AI5A 1MUNA 1KG3A 1M3HA 1LWYA 1EBMA 3KTUA 4B21A 1XQPA 3CWUA 1LWWA 1WEFA 4EVVA 3CWAA 2ABKA 2NOEA 1N3CA 3OH9A 1XQOA 1RRQA 3D4VA 4E9GA 1NGNA 2OFKA 3OH6A 5KN8A 1PU8A 1N39A 1XG7A 1KO9A 1PU6A 2I5WA 3N0UA 2NOLA 2YG9A 1LMZA
chains in the Genus database with same CATH superfamily
1M3QA 1LXTA 4EW0A 3OSTA 3EIKA 5JMVD 2PWWA 1KG7A 1R4XA 2DKCA 4TPSA 5FROA 3L2WA 2OOXA 1WQAA 4EA4A 1VKLA 3LCNA 4ZTJA 1KYUA 1K35A 1WEGA 3ULXA 4ZTFA 3C04A 4ROCB 1QNAA 1KG2A 3NA5A 4E7HA 4RODB 1KG6A 4E7KA 2XHIA 3NNQA 1QN4A 4YOQA 3PMGA 2MZ8A 3I0XA 1VRLA 3RSMA 3VN5A 1QN8A 4B22A 1PCMX 3S3MA 3DPUA 5BMPA 3BKQX 1QNBA 1TBAB 4Q11A 3FHFA 4AIAA 3OY9A 4AI4A 1VTLE 1YTFA 3ENCA 1HU0A 1PCJX 1KG5A 3KNTA 3OYAA 4PY5A 3CVTA 2Y8QA 4DULA 1XSZA 3T4NA 4HSBA 4OFAA 1YQRA 1ORNA 2QLVA 2FKMX 2NVMA 1M3HA 1LWYA 3UW2A 3KTUA 4D7RA 1XQPA 3PDKA 1LWWA 1EUVA 2NLVA 4EVVA 2ABKA 2YH5A 3OH9A 2Y8LA 3D4VA 3DPTA 4E9GA 4BJUA 1KFIA 1NGNA 3OH6A 1WJWA 1PU8A 3OYEA 1QNCA 4WXAA 1C4GA 3OYDA 2VJ0A 1PU6A 2H5AX 3N0UA 2NOLA 1P7MA 1QTSA 3N89A 2JOIA 1CDWA 4HJHA 2QRCA 2V92A 3CW7A 3L2QA 2W03A 1TGHA 1QN9A 4I8OA 4CFFA 3TE5A 1Q9UA 3OSMA 1MUDA 4EALA 4B0AA 1KG4A 3S3OA 1VOKA 4EJZA 4B23A 2D0BA 1V5SA 4DK9A 1P59A 1QN7A 1N3AA 4YPRA 2HZMA 3OYFA 1UT7A 3D7QA 4D7QA 4EAKA 3CWSA 2JHJA 3OC3C 1U84A 3HS9A 3FHGA 1T6AA 1W80A 3R2XC 2NOHA 4EAGA 4OFHA 4EAIA 1JFIC 4EW4A 2NOBA 3S6IA 1UT4A 3H1ZA 2V75A 3OS0A 4BACA 1NVPA 4B21A 1P5GX 1VTOA 3OYIA 3CWUA 1KY6A 1WEFA 3CWAA 1P5DX 3OYLA 2NOEA 2IV8A 2MJ7A 1XQOA 1RRQA 1QN5A 5KN8A 2HKPA 2O3OA 2I5WA 2YG9A 2D0CA 4E7IA 1LMZA 2EHBD 2NWVA 1YQKA 3IH7A 1DIZA 4QG5A 5JN5A 1C47A 4BE2A 1K2YX 1TBPA 4EA5A 1PU7A 1AISA 2G30A 4B24A 3OYJA 1KQJA 4BE0A 1TUOA 4UOBA 2Z8UA 1FN7A 4UNFA 5DPKA 1PVSA 2HL8A 1RM1A 3OSEA 2NOIA 1LWVA 5FRMA 1QN3A 3CVSA 3KRMA 3HS8A 3F0ZA 3CWTA 1YQMA 3EAYA 2Z0FA 3OYMA 1D3UA 1RRSA 2JHNA 2ZFDB 2F7LA 3OLPA 4E9FA 2FGTA 3N5NX 2OOYA 1J3MA 4E9HA 2DKDA 2R5XA 4AI5A 3OS2A 1NH2A 1QN6A 4ROEB 2FKFA 5HSHA 4IKFA 1N3CA 1B9KA 3TDHA 2YA3A 1YTBA 1N39A 2V9JA 1M5Q1 3OYKA 3I3WA 4OFEA 3S3NA 3FSPA 4YPHA 1NGMA 1PCZA 2NOZA 5KN9A 2DKAA 1E42A 4BDZA 3OYHA 5EPCA 4EJYA 2FUVA 5IYBP 5IYCP 2JPSA 5F9CA 4NZGA 3IHOA 3ENOC 2QR1A 1C9BB 5KL0A 3L2RA 3OYCA 2JPIA 4WZSD 4EAJA 1NKUA 2H56A 3OCIA 3L2UA 2LAEA 5CHZA 5IYDP 1YQLA 2QRDA 1PZDA 3G0QA 2YG8A 2JG6A 1QTPA 1MUYA 2W04A 3VW4A 1ORPA 2NOFA 1UL7A 3I0WA 4E7LA 3OS1A 3OGDA 4IL8A 3L2VA 4PIIA 1KYFA 5BMNA 3OYNA 1WEIA 2QREA 2OFIA 1MPGA 3ASMA 1KY7A 2HL9A 5AN4A 1QNEA 4E7JA 4E9EA 1KEAA 1KYDA 3F10A 2H4LX 1MUNA 1KG3A 1EBMA 3OYGA 5FRNA 1MP9A 2IV9A 4C7PA 3SNSA 4WX8A 3RPJA 1VOLB 1KFQA 2V8QA 4MRQA 2OFKA 4BDYA 2HZSA 2D0AA 1XG7A 1KO9A 3OYBA 1JDYA 4BE1A
chains in the Genus database with same CATH topology
1YQKA 1P7MA 1M3QA 1QTSA 3IH7A 4OFEA 1DIZA 3N89A 2JOIA 1CDWA 4EW0A 3FSPA 4YPHA 1NGMA 1PCZA 2NOZA 5KN9A 3OSTA 3EIKA 3CW7A 1E42A 1KG7A 1R4XA 4TPSA 4EJYA 5IYBP 5IYCP 1TGHA 1QN9A 4EA4A 1TBPA 4I8OA 4EA5A 1PU7A 3OSMA 1MUDA 2G30A 1AISA 3IHOA 4B24A 4B0AA 1KG4A 1VOKA 4EJZA 1C9BB 4B23A 1KYUA 2D0BA 1WEGA 1KQJA 3ULXA 4DK9A 1P59A 1QN7A 1N3AA 4YPRA 4UOBA 2HZMA 4ROCB 1KG2A 4WZSD 2Z8UA 1NKUA 2H56A 1FN7A 3OCIA 1QNAA 2LAEA 4UNFA 5DPKA 1UT7A 1PVSA 4RODB 1KG6A 5CHZA 5IYDP 1YQLA 2XHIA 1RM1A 2NOIA 1QN4A 1LWVA 1QN3A 3CVSA 1PZDA 3KRMA 4YOQA 3G0QA 2YG8A 3CWSA 2MZ8A 2JHJA 2JG6A 3I0XA 1VRLA 1QTPA 3VN5A 1QN8A 1MUYA 3HS8A 4B22A 3F0ZA 1ORPA 3CWTA 2NOFA 3DPUA 1YQMA 3OC3C 1QNBA 1TBAB 3I0WA 4Q11A 3FHFA 3HS9A 1D3UA 3OGDA 3FHGA 4PIIA 4AIAA 1RRSA 1W80A 4AI4A 1KYFA 2NOHA 1VTLE 2JHNA 1YTFA 1HU0A 4OFHA 1JFIC 1WEIA 4E9FA 4EW4A 1KG5A 3KNTA 3N5NX 2FGTA 2NOBA 2OFIA 3S6IA 1MPGA 3ASMA 4PY5A 1KY7A 3CVTA 5AN4A 1QNEA 1UT4A 3H1ZA 4E9EA 1KEAA 1KYDA 4DULA 3F10A 4HSBA 4OFAA 1YQRA 4E9HA 1ORNA 4AI5A 1MUNA 1KG3A 1M3HA 1LWYA 1EBMA 3KTUA 1NVPA 4B21A 1XQPA 1VTOA 3CWUA 1KY6A 1MP9A 1NH2A 2IV9A 1QN6A 1LWWA 4ROEB 3SNSA 1WEFA 4EVVA 3CWAA 2ABKA 2YH5A 2NOEA 1N3CA 2IV8A 2MJ7A 3OH9A 3RPJA 1XQOA 1RRQA 1B9KA 3D4VA 1QN5A 3DPTA 4E9GA 1VOLB 1NGNA 2OFKA 3OH6A 2HZSA 2D0AA 5KN8A 1PU8A 1YTBA 1N39A 1QNCA 2O3OA 1XG7A 1KO9A 2VJ0A 1PU6A 2I5WA 3N0UA 2NOLA 2YG9A 2D0CA 1LMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQK A;  1P7M A;  1M3Q A;  3IH7 A;  4OFE A;  1DIZ A;  4EW0 A;  3FSP A;  4YPH A;  2NOZ A;  5KN9 A;  3CW7 A;  1KG7 A;  4EJY A;  4EA4 A;  4EA5 A;  1PU7 A;  1MUD A;  3IHO A;  4B24 A;  1KG4 A;  4EJZ A;  4B23 A;  1WEG A;  1KQJ A;  4DK9 A;  1P59 A;  1N3A A;  4YPR A;  4UOB A;  1KG2 A;  1NKU A;  2H56 A;  1FN7 A;  4UNF A;  5DPK A;  1PVS A;  1KG6 A;  5CHZ A;  1YQL A;  2XHI A;  2NOI A;  1LWV A;  3CVS A;  4YOQ A;  3G0Q A;  2YG8 A;  3CWS A;  2JHJ A;  2JG6 A;  3I0X A;  1VRL A;  1MUY A;  4B22 A;  3F0Z A;  1ORP A;  3CWT A;  2NOF A;  1YQM A;  3I0W A;  3FHF A;  3OGD A;  3FHG A;  4PII A;  4AIA A;  1RRS A;  4AI4 A;  2NOH A;  2JHN A;  1HU0 A;  4OFH A;  1WEI A;  4E9F A;  4EW4 A;  1KG5 A;  3KNT A;  3N5N X;  2NOB A;  2OFI A;  3S6I A;  1MPG A;  3CVT A;  5AN4 A;  4E9E A;  1KEA A;  3F10 A;  4HSB A;  4OFA A;  1YQR A;  4E9H A;  1ORN A;  4AI5 A;  1MUN A;  1KG3 A;  1M3H A;  1LWY A;  1EBM A;  3KTU A;  4B21 A;  1XQP A;  3CWU A;  1LWW A;  1WEF A;  4EVV A;  3CWA A;  2ABK A;  2NOE A;  1N3C A;  3OH9 A;  1XQO A;  1RRQ A;  3D4V A;  4E9G A;  1NGN A;  2OFK A;  3OH6 A;  5KN8 A;  1PU8 A;  1N39 A;  1XG7 A;  1KO9 A;  1PU6 A;  2I5W A;  3N0U A;  2NOL A;  2YG9 A;  1LMZ A; 
#chains in the Genus database with same CATH topology
 1M3Q A;  1LXT A;  4EW0 A;  3OST A;  3EIK A;  5JMV D;  2PWW A;  1KG7 A;  1R4X A;  2DKC A;  4TPS A;  5FRO A;  3L2W A;  2OOX A;  1WQA A;  4EA4 A;  1VKL A;  3LCN A;  4ZTJ A;  1KYU A;  1K35 A;  1WEG A;  3ULX A;  4ZTF A;  3C04 A;  4ROC B;  1QNA A;  1KG2 A;  3NA5 A;  4E7H A;  4ROD B;  1KG6 A;  4E7K A;  2XHI A;  3NNQ A;  1QN4 A;  4YOQ A;  3PMG A;  2MZ8 A;  3I0X A;  1VRL A;  3RSM A;  3VN5 A;  1QN8 A;  4B22 A;  1PCM X;  3S3M A;  3DPU A;  5BMP A;  3BKQ X;  1QNB A;  1TBA B;  4Q11 A;  3FHF A;  4AIA A;  3OY9 A;  4AI4 A;  1VTL E;  1YTF A;  3ENC A;  1HU0 A;  1PCJ X;  1KG5 A;  3KNT A;  3OYA A;  4PY5 A;  3CVT A;  2Y8Q A;  4DUL A;  1XSZ A;  3T4N A;  4HSB A;  4OFA A;  1YQR A;  1ORN A;  2QLV A;  2FKM X;  2NVM A;  1M3H A;  1LWY A;  3UW2 A;  3KTU A;  4D7R A;  1XQP A;  3PDK A;  1LWW A;  1EUV A;  2NLV A;  4EVV A;  2ABK A;  2YH5 A;  3OH9 A;  2Y8L A;  3D4V A;  3DPT A;  4E9G A;  4BJU A;  1KFI A;  1NGN A;  3OH6 A;  1WJW A;  1PU8 A;  3OYE A;  1QNC A;  4WXA A;  1C4G A;  3OYD A;  2VJ0 A;  1PU6 A;  2H5A X;  3N0U A;  2NOL A;  1P7M A;  1QTS A;  3N89 A;  2JOI A;  1CDW A;  4HJH A;  2QRC A;  2V92 A;  3CW7 A;  3L2Q A;  2W03 A;  1TGH A;  1QN9 A;  4I8O A;  4CFF A;  3TE5 A;  1Q9U A;  3OSM A;  1MUD A;  4EAL A;  4B0A A;  1KG4 A;  3S3O A;  1VOK A;  4EJZ A;  4B23 A;  2D0B A;  1V5S A;  4DK9 A;  1P59 A;  1QN7 A;  1N3A A;  4YPR A;  2HZM A;  3OYF A;  1UT7 A;  3D7Q A;  4D7Q A;  4EAK A;  3CWS A;  2JHJ A;  3OC3 C;  1U84 A;  3HS9 A;  3FHG A;  1T6A A;  1W80 A;  3R2X C;  2NOH A;  4EAG A;  4OFH A;  4EAI A;  1JFI C;  4EW4 A;  2NOB A;  3S6I A;  1UT4 A;  3H1Z A;  2V75 A;  3OS0 A;  4BAC A;  1NVP A;  4B21 A;  1P5G X;  1VTO A;  3OYI A;  3CWU A;  1KY6 A;  1WEF A;  3CWA A;  1P5D X;  3OYL A;  2NOE A;  2IV8 A;  2MJ7 A;  1XQO A;  1RRQ A;  1QN5 A;  5KN8 A;  2HKP A;  2O3O A;  2I5W A;  2YG9 A;  2D0C A;  4E7I A;  1LMZ A;  2EHB D;  2NWV A;  1YQK A;  3IH7 A;  1DIZ A;  4QG5 A;  5JN5 A;  1C47 A;  4BE2 A;  1K2Y X;  1TBP A;  4EA5 A;  1PU7 A;  1AIS A;  2G30 A;  4B24 A;  3OYJ A;  1KQJ A;  4BE0 A;  1TUO A;  4UOB A;  2Z8U A;  1FN7 A;  4UNF A;  5DPK A;  1PVS A;  2HL8 A;  1RM1 A;  3OSE A;  2NOI A;  1LWV A;  5FRM A;  1QN3 A;  3CVS A;  3KRM A;  3HS8 A;  3F0Z A;  3CWT A;  1YQM A;  3EAY A;  2Z0F A;  3OYM A;  1D3U A;  1RRS A;  2JHN A;  2ZFD B;  2F7L A;  3OLP A;  4E9F A;  2FGT A;  3N5N X;  2OOY A;  1J3M A;  4E9H A;  2DKD A;  2R5X A;  4AI5 A;  3OS2 A;  1NH2 A;  1QN6 A;  4ROE B;  2FKF A;  5HSH A;  4IKF A;  1N3C A;  1B9K A;  3TDH A;  2YA3 A;  1YTB A;  1N39 A;  2V9J A;  1M5Q 1;  3OYK A;  3I3W A;  4OFE A;  3S3N A;  3FSP A;  4YPH A;  1NGM A;  1PCZ A;  2NOZ A;  5KN9 A;  2DKA A;  1E42 A;  4BDZ A;  3OYH A;  5EPC A;  4EJY A;  2FUV A;  5IYB P;  5IYC P;  2JPS A;  5F9C A;  4NZG A;  3IHO A;  3ENO C;  2QR1 A;  1C9B B;  5KL0 A;  3L2R A;  3OYC A;  2JPI A;  4WZS D;  4EAJ A;  1NKU A;  2H56 A;  3OCI A;  3L2U A;  2LAE A;  5CHZ A;  5IYD P;  1YQL A;  2QRD A;  1PZD A;  3G0Q A;  2YG8 A;  2JG6 A;  1QTP A;  1MUY A;  2W04 A;  3VW4 A;  1ORP A;  2NOF A;  1UL7 A;  3I0W A;  4E7L A;  3OS1 A;  3OGD A;  4IL8 A;  3L2V A;  4PII A;  1KYF A;  5BMN A;  3OYN A;  1WEI A;  2QRE A;  2OFI A;  1MPG A;  3ASM A;  1KY7 A;  2HL9 A;  5AN4 A;  1QNE A;  4E7J A;  4E9E A;  1KEA A;  1KYD A;  3F10 A;  2H4L X;  1MUN A;  1KG3 A;  1EBM A;  3OYG A;  5FRN A;  1MP9 A;  2IV9 A;  4C7P A;  3SNS A;  4WX8 A;  3RPJ A;  1VOL B;  1KFQ A;  2V8Q A;  4MRQ A;  2OFK A;  4BDY A;  2HZS A;  2D0A A;  1XG7 A;  1KO9 A;  3OYB A;  1JDY A;  4BE1 A; 
#chains in the Genus database with same CATH homology
 1YQK A;  1P7M A;  1M3Q A;  1QTS A;  3IH7 A;  4OFE A;  1DIZ A;  3N89 A;  2JOI A;  1CDW A;  4EW0 A;  3FSP A;  4YPH A;  1NGM A;  1PCZ A;  2NOZ A;  5KN9 A;  3OST A;  3EIK A;  3CW7 A;  1E42 A;  1KG7 A;  1R4X A;  4TPS A;  4EJY A;  5IYB P;  5IYC P;  1TGH A;  1QN9 A;  4EA4 A;  1TBP A;  4I8O A;  4EA5 A;  1PU7 A;  3OSM A;  1MUD A;  2G30 A;  1AIS A;  3IHO A;  4B24 A;  4B0A A;  1KG4 A;  1VOK A;  4EJZ A;  1C9B B;  4B23 A;  1KYU A;  2D0B A;  1WEG A;  1KQJ A;  3ULX A;  4DK9 A;  1P59 A;  1QN7 A;  1N3A A;  4YPR A;  4UOB A;  2HZM A;  4ROC B;  1KG2 A;  4WZS D;  2Z8U A;  1NKU A;  2H56 A;  1FN7 A;  3OCI A;  1QNA A;  2LAE A;  4UNF A;  5DPK A;  1UT7 A;  1PVS A;  4ROD B;  1KG6 A;  5CHZ A;  5IYD P;  1YQL A;  2XHI A;  1RM1 A;  2NOI A;  1QN4 A;  1LWV A;  1QN3 A;  3CVS A;  1PZD A;  3KRM A;  4YOQ A;  3G0Q A;  2YG8 A;  3CWS A;  2MZ8 A;  2JHJ A;  2JG6 A;  3I0X A;  1VRL A;  1QTP A;  3VN5 A;  1QN8 A;  1MUY A;  3HS8 A;  4B22 A;  3F0Z A;  1ORP A;  3CWT A;  2NOF A;  3DPU A;  1YQM A;  3OC3 C;  1QNB A;  1TBA B;  3I0W A;  4Q11 A;  3FHF A;  3HS9 A;  1D3U A;  3OGD A;  3FHG A;  4PII A;  4AIA A;  1RRS A;  1W80 A;  4AI4 A;  1KYF A;  2NOH A;  1VTL E;  2JHN A;  1YTF A;  1HU0 A;  4OFH A;  1JFI C;  1WEI A;  4E9F A;  4EW4 A;  1KG5 A;  3KNT A;  3N5N X;  2FGT A;  2NOB A;  2OFI A;  3S6I A;  1MPG A;  3ASM A;  4PY5 A;  1KY7 A;  3CVT A;  5AN4 A;  1QNE A;  1UT4 A;  3H1Z A;  4E9E A;  1KEA A;  1KYD A;  4DUL A;  3F10 A;  4HSB A;  4OFA A;  1YQR A;  4E9H A;  1ORN A;  4AI5 A;  1MUN A;  1KG3 A;  1M3H A;  1LWY A;  1EBM A;  3KTU A;  1NVP A;  4B21 A;  1XQP A;  1VTO A;  3CWU A;  1KY6 A;  1MP9 A;  1NH2 A;  2IV9 A;  1QN6 A;  1LWW A;  4ROE B;  3SNS A;  1WEF A;  4EVV A;  3CWA A;  2ABK A;  2YH5 A;  2NOE A;  1N3C A;  2IV8 A;  2MJ7 A;  3OH9 A;  3RPJ A;  1XQO A;  1RRQ A;  1B9K A;  3D4V A;  1QN5 A;  3DPT A;  4E9G A;  1VOL B;  1NGN A;  2OFK A;  3OH6 A;  2HZS A;  2D0A A;  5KN8 A;  1PU8 A;  1YTB A;  1N39 A;  1QNC A;  2O3O A;  1XG7 A;  1KO9 A;  2VJ0 A;  1PU6 A;  2I5W A;  3N0U A;  2NOL A;  2YG9 A;  2D0C A;  1LMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...