4EJYA

Structure of mbogg1 in complex with high affinity dna ligand
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
289
structure length
289
Chain Sequence
MKYNVEEKGTKVIVRGIADFNLKETFESGQCFRWNEEEDGSYTGVAYDRVVNVKLEGDTLIIDNTNLTDFYDIWFDYFDLGRDYGQIKESLSKDPVLKEAIKFGQGIRILRQDTWETLVSFIVSQNNRIPQIKKVIENLATSFGNPIEYKGKIYYTFPKPEELVMYDVETIAKTRCGFRAKYIFDAASKVFSGEINLLKLHEYSTSEIRDILMTINGVGPKVADCVILYSIGRYDTFPTDVWIKRIVEHLYLKREGTPVEIQLFAIDKFGDLSGFAQQYLFYYGREMGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords 3-Methyladenine DNA glycosylase
publication title Crystal structures of MBOgg1 in complex with two abasic DNA ligands
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
total genus 104
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ejyA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4ejyA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4ejyA01
1KEAA 2H56A 1KG4A 1MUDA 3IHOA 1M3HA 3OH6A 1EBMA 4E9HA 3FHGA 4YOQA 2XHIA 2YG9A 2YG8A 1M3QA 4B22A 1ORPA 3D4VA 4UNFA 3IH7A 4EW4A 3CW7A 4B21A 2NOFA 4EA5A 3CWUA 5DPKA 3CWAA 3F10A 1WEGA 4OFEA 1N3CA 3FHFA 1XQPA 4EVVA 3CWTA 4B23A 2JHJA 1LWVA 1ORNA 1PU7A 1KO9A 1N3AA 1DIZA 3KTUA 3I0WA 1KG6A 1KG3A 1LMZA 1YQMA 1VRLA 3CWSA 4AI4A 2NOHA 5AN4A 3OH9A 2JHNA 4PIIA 1PU6A 5KN8A 1KQJA 1HU0A 4OFAA 1YQLA 2OFIA 1WEIA 4EJZA 4EA4A 1RRQA 1PU8A 4YPHA 2NOIA 1WEFA 3CVSA 1MPGA 4E9GA 2NOLA 3FSPA 5KN9A 1MUYA 1XG7A 1KG2A 4OFHA 2NOBA 2NOEA 4E9FA 4AI5A 1NGNA 2I5WA 1N39A 3OGDA 1YQRA 1RRSA 3G0QA 1FN7A 2JG6A 2ABKA 1P59A 4UOBA 1KG5A 1LWWA 5CHZA 3I0XA 3N0UA 4EJYA 4DK9A 3CVTA 4E9EA 1LWYA 4YPRA 1MUNA 1YQKA 1KG7A 3F0ZA 3N5NX 1XQOA 4B24A 1PVSA 4HSBA 4EW0A 1P7MA 4AIAA 2OFKA 2NOZA 3S6IA 3KNTA 1NKUA
chains in the Genus database with same CATH superfamily
2H56A 1MUDA 2Y8LA 1TGHA 2MJ7A 3FHGA 1TBAB 2JPSA 1WJWA 1U84A 1KY6A 3VW4A 1PZDA 3C04A 1CDWA 1AISA 3D4VA 2DKAA 2MZ8A 4EW4A 4D7RA 2NOFA 4OFEA 3OLPA 1N3CA 1QNCA 3DPUA 2FGTA 1N3AA 1C47A 4WX8A 1KG3A 3OYGA 3N89A 3CWSA 2HZSA 1VOKA 4CFFA 1KFQA 1PU6A 1KQJA 2DKCA 3LCNA 1WEIA 1KFIA 3S3MA 3L2QA 2JPIA 3OS0A 1UL7A 3OYDA 2NOLA 4BDZA 2NOBA 1KG2A 2V8QA 3ASMA 3G0QA 3PMGA 1QNEA 1TBPA 4RODB 2ABKA 4UOBA 1KG5A 1T6AA 2OOXA 3I0XA 3UW2A 2HKPA 4DK9A 4E9EA 4WZSD 4HSBA 1K35A 5FRNA 2OFKA 2NOZA 2PWWA 1NGMA 3NA5A 3OYHA 5BMNA 1RM1A 1KG4A 3IHOA 1M3HA 3OSEA 3OH6A 1EBMA 1TUOA 4NZGA 4DULA 1P5DX 4TPSA 2QRCA 2HZMA 4B22A 1ORPA 3CW7A 1VKLA 3T4NA 4C7PA 4ROCB 3HS9A 3OY9A 2V75A 3CWAA 1KY7A 5FRMA 1M5Q1 3OYAA 4B23A 2JHJA 4E7KA 1LWVA 3NNQA 1KO9A 3OYCA 1K2YX 1D3UA 5JMVD 4ZTJA 2NOHA 2FKFA 4EAKA 5AN4A 2R5XA 5KN8A 1QN9A 4PY5A 3OYBA 4EJZA 2QRDA 1P5GX 1PU8A 3ENCA 1WEFA 1QN7A 2QR1A 1QN5A 1MPGA 4E9GA 2HL8A 5HSHA 1UT4A 4ZTFA 4OFHA 1YTBA 4MRQA 1NGNA 4BACA 5IYDP 1N39A 1QN8A 2H5AX 1FN7A 1JDYA 1QN6A 1P59A 4QG5A 3EIKA 1QTPA 3H1ZA 3N0UA 3L2VA 1MP9A 2D0AA 4EAJA 1LWYA 2W03A 4BE0A 3N5NX 1YQKA 1XQOA 4B24A 3RSMA 3OCIA 3TDHA 3SNSA 4AIAA 3OSMA 2G30A 4BE2A 1KEAA 3OYLA 3OYFA 2NVMA 2LAEA 3HS8A 4E9HA 4YOQA 2XHIA 2OOYA 4ROEB 3L2RA 2QREA 3OYMA 4E7LA 4B0AA 2YG8A 2VJ0A 1M3QA 1KYFA 2JOIA 3OS2A 4EAGA 3IH7A 1C9BB 4B21A 1V5SA 3OYEA 3D7QA 3F10A 2NLVA 3FHFA 1XQPA 4EVVA 3CWTA 1XSZA 4D7QA 2HL9A 3BKQX 3L2UA 1ORNA 2Z0FA 3KTUA 2FKMX 5IYCP 1YQMA 1UT7A 2W04A 3OYNA 4AI4A 3KRMA 5IYBP 1NH2A 2QLVA 2IV9A 2D0BA 2Z8UA 3OH9A 2JHNA 4PIIA 2DKDA 3OYIA 1HU0A 1PCMX 4BE1A 4OFAA 4EA4A 1E42A 3FSPA 2V9JA 2NOEA 2F7LA 1KYUA 4AI5A 2NWVA 3OYKA 4E7IA 3PDKA 3OGDA 2V92A 4HJHA 2JG6A 3OYJA 4E7JA 3OSTA 3S3NA 1LWWA 3RPJA 4EJYA 1J3MA 3OS1A 5FROA 5KL0A 1PCZA 4YPRA 3F0ZA 1PVSA 2ZFDB 4EAIA 3S6IA 1C4GA 1NKUA 3TE5A 3R2XC 1VTOA 2YG9A 4E7HA 4I8OA 1NVPA 3VN5A 1QN3A 5BMPA 4UNFA 1QNBA 5EPCA 4EA5A 2YH5A 3CWUA 3ULXA 1Q9UA 5DPKA 1QN4A 3L2WA 1R4XA 4IKFA 2O3OA 1WEGA 1PU7A 2EHBD 1DIZA 3I0WA 1W80A 5F9CA 2Y8QA 4IL8A 1KG6A 1LMZA 2YA3A 1VRLA 1KYDA 2IV8A 3S3OA 4BDYA 1LXTA 5JN5A 1YQLA 2OFIA 3DPTA 3I3WA 1RRQA 4YPHA 1PCJX 2NOIA 3CVSA 1QTSA 5KN9A 1MUYA 1XG7A 4BJUA 1YTFA 4E9FA 2H4LX 3ENOC 2I5WA 1VTLE 3OC3C 1YQRA 1RRSA 2D0CA 4EALA 1VOLB 5CHZA 1JFIC 1QNAA 3CVTA 1B9KA 1MUNA 1EUVA 1KG7A 4WXAA 4EW0A 1P7MA 3EAYA 4Q11A 2FUVA 3KNTA 1WQAA
chains in the Genus database with same CATH topology
1KEAA 2H56A 1KG4A 1MUDA 1TGHA 3IHOA 1M3HA 2LAEA 3OH6A 3HS8A 1EBMA 1VTOA 4DULA 4E9HA 2MJ7A 3FHGA 4YOQA 1TBAB 2XHIA 2YG9A 4TPSA 2HZMA 4I8OA 4ROEB 1NVPA 1KY6A 4B0AA 2YG8A 3VN5A 2VJ0A 1QN3A 1M3QA 4B22A 1KYFA 1ORPA 1PZDA 2JOIA 1CDWA 1AISA 3D4VA 2MZ8A 4UNFA 3IH7A 1C9BB 1RM1A 4EW4A 3CW7A 1QNBA 4B21A 2NOFA 4EA5A 2YH5A 3CWUA 3ULXA 5DPKA 4ROCB 3HS9A 1QN4A 1KY7A 3CWAA 1R4XA 2O3OA 3F10A 1WEGA 4OFEA 1N3CA 3FHFA 1XQPA 4EVVA 3CWTA 1QNCA 4B23A 2JHJA 1LWVA 3DPUA 2FGTA 1ORNA 1PU7A 1KO9A 1N3AA 1DIZA 3KTUA 3I0WA 1W80A 1D3UA 5IYCP 1KG6A 1KG3A 1LMZA 1YQMA 1UT7A 3N89A 1VRLA 3CWSA 2HZSA 3KRMA 5IYBP 4AI4A 1NH2A 2NOHA 1KYDA 1VOKA 2IV9A 2D0BA 2Z8UA 2IV8A 5AN4A 3OH9A 2JHNA 4PIIA 1PU6A 5KN8A 1QN9A 1KQJA 1HU0A 4PY5A 4OFAA 1YQLA 2OFIA 1WEIA 4EJZA 3DPTA 4EA4A 1RRQA 1PU8A 4YPHA 2NOIA 1WEFA 1QN7A 3CVSA 1QTSA 1QN5A 1MPGA 4E9GA 1E42A 2NOLA 1UT4A 3FSPA 5KN9A 1MUYA 1XG7A 1KG2A 4OFHA 2NOBA 1YTFA 1YTBA 2NOEA 4E9FA 1KYUA 4AI5A 1NGNA 2I5WA 1VTLE 5IYDP 1N39A 1QN8A 3OGDA 3OC3C 3ASMA 1YQRA 1RRSA 3G0QA 1QNEA 1FN7A 1TBPA 2D0CA 4RODB 2JG6A 2ABKA 1QN6A 1P59A 3OSTA 4UOBA 1KG5A 3EIKA 1LWWA 1VOLB 3RPJA 5CHZA 3I0XA 1QTPA 3H1ZA 1JFIC 1QNAA 3N0UA 4EJYA 4DK9A 3CVTA 1B9KA 1MP9A 4E9EA 2D0AA 1PCZA 1LWYA 4YPRA 1MUNA 1YQKA 1KG7A 3F0ZA 3N5NX 1XQOA 4B24A 3OCIA 4WZSD 1PVSA 4HSBA 4EW0A 1P7MA 4Q11A 3SNSA 4AIAA 3OSMA 2OFKA 2NOZA 2G30A 1NGMA 3S6IA 3KNTA 1NKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KEA A;  2H56 A;  1KG4 A;  1MUD A;  3IHO A;  1M3H A;  3OH6 A;  1EBM A;  4E9H A;  3FHG A;  4YOQ A;  2XHI A;  2YG9 A;  2YG8 A;  1M3Q A;  4B22 A;  1ORP A;  3D4V A;  4UNF A;  3IH7 A;  4EW4 A;  3CW7 A;  4B21 A;  2NOF A;  4EA5 A;  3CWU A;  5DPK A;  3CWA A;  3F10 A;  1WEG A;  4OFE A;  1N3C A;  3FHF A;  1XQP A;  4EVV A;  3CWT A;  4B23 A;  2JHJ A;  1LWV A;  1ORN A;  1PU7 A;  1KO9 A;  1N3A A;  1DIZ A;  3KTU A;  3I0W A;  1KG6 A;  1KG3 A;  1LMZ A;  1YQM A;  1VRL A;  3CWS A;  4AI4 A;  2NOH A;  5AN4 A;  3OH9 A;  2JHN A;  4PII A;  1PU6 A;  5KN8 A;  1KQJ A;  1HU0 A;  4OFA A;  1YQL A;  2OFI A;  1WEI A;  4EJZ A;  4EA4 A;  1RRQ A;  1PU8 A;  4YPH A;  2NOI A;  1WEF A;  3CVS A;  1MPG A;  4E9G A;  2NOL A;  3FSP A;  5KN9 A;  1MUY A;  1XG7 A;  1KG2 A;  4OFH A;  2NOB A;  2NOE A;  4E9F A;  4AI5 A;  1NGN A;  2I5W A;  1N39 A;  3OGD A;  1YQR A;  1RRS A;  3G0Q A;  1FN7 A;  2JG6 A;  2ABK A;  1P59 A;  4UOB A;  1KG5 A;  1LWW A;  5CHZ A;  3I0X A;  3N0U A;  4EJY A;  4DK9 A;  3CVT A;  4E9E A;  1LWY A;  4YPR A;  1MUN A;  1YQK A;  1KG7 A;  3F0Z A;  3N5N X;  1XQO A;  4B24 A;  1PVS A;  4HSB A;  4EW0 A;  1P7M A;  4AIA A;  2OFK A;  2NOZ A;  3S6I A;  3KNT A;  1NKU A; 
#chains in the Genus database with same CATH topology
 2H56 A;  1MUD A;  2Y8L A;  1TGH A;  2MJ7 A;  3FHG A;  1TBA B;  2JPS A;  1WJW A;  1U84 A;  1KY6 A;  3VW4 A;  1PZD A;  3C04 A;  1CDW A;  1AIS A;  3D4V A;  2DKA A;  2MZ8 A;  4EW4 A;  4D7R A;  2NOF A;  4OFE A;  3OLP A;  1N3C A;  1QNC A;  3DPU A;  2FGT A;  1N3A A;  1C47 A;  4WX8 A;  1KG3 A;  3OYG A;  3N89 A;  3CWS A;  2HZS A;  1VOK A;  4CFF A;  1KFQ A;  1PU6 A;  1KQJ A;  2DKC A;  3LCN A;  1WEI A;  1KFI A;  3S3M A;  3L2Q A;  2JPI A;  3OS0 A;  1UL7 A;  3OYD A;  2NOL A;  4BDZ A;  2NOB A;  1KG2 A;  2V8Q A;  3ASM A;  3G0Q A;  3PMG A;  1QNE A;  1TBP A;  4ROD B;  2ABK A;  4UOB A;  1KG5 A;  1T6A A;  2OOX A;  3I0X A;  3UW2 A;  2HKP A;  4DK9 A;  4E9E A;  4WZS D;  4HSB A;  1K35 A;  5FRN A;  2OFK A;  2NOZ A;  2PWW A;  1NGM A;  3NA5 A;  3OYH A;  5BMN A;  1RM1 A;  1KG4 A;  3IHO A;  1M3H A;  3OSE A;  3OH6 A;  1EBM A;  1TUO A;  4NZG A;  4DUL A;  1P5D X;  4TPS A;  2QRC A;  2HZM A;  4B22 A;  1ORP A;  3CW7 A;  1VKL A;  3T4N A;  4C7P A;  4ROC B;  3HS9 A;  3OY9 A;  2V75 A;  3CWA A;  1KY7 A;  5FRM A;  1M5Q 1;  3OYA A;  4B23 A;  2JHJ A;  4E7K A;  1LWV A;  3NNQ A;  1KO9 A;  3OYC A;  1K2Y X;  1D3U A;  5JMV D;  4ZTJ A;  2NOH A;  2FKF A;  4EAK A;  5AN4 A;  2R5X A;  5KN8 A;  1QN9 A;  4PY5 A;  3OYB A;  4EJZ A;  2QRD A;  1P5G X;  1PU8 A;  3ENC A;  1WEF A;  1QN7 A;  2QR1 A;  1QN5 A;  1MPG A;  4E9G A;  2HL8 A;  5HSH A;  1UT4 A;  4ZTF A;  4OFH A;  1YTB A;  4MRQ A;  1NGN A;  4BAC A;  5IYD P;  1N39 A;  1QN8 A;  2H5A X;  1FN7 A;  1JDY A;  1QN6 A;  1P59 A;  4QG5 A;  3EIK A;  1QTP A;  3H1Z A;  3N0U A;  3L2V A;  1MP9 A;  2D0A A;  4EAJ A;  1LWY A;  2W03 A;  4BE0 A;  3N5N X;  1YQK A;  1XQO A;  4B24 A;  3RSM A;  3OCI A;  3TDH A;  3SNS A;  4AIA A;  3OSM A;  2G30 A;  4BE2 A;  1KEA A;  3OYL A;  3OYF A;  2NVM A;  2LAE A;  3HS8 A;  4E9H A;  4YOQ A;  2XHI A;  2OOY A;  4ROE B;  3L2R A;  2QRE A;  3OYM A;  4E7L A;  4B0A A;  2YG8 A;  2VJ0 A;  1M3Q A;  1KYF A;  2JOI A;  3OS2 A;  4EAG A;  3IH7 A;  1C9B B;  4B21 A;  1V5S A;  3OYE A;  3D7Q A;  3F10 A;  2NLV A;  3FHF A;  1XQP A;  4EVV A;  3CWT A;  1XSZ A;  4D7Q A;  2HL9 A;  3BKQ X;  3L2U A;  1ORN A;  2Z0F A;  3KTU A;  2FKM X;  5IYC P;  1YQM A;  1UT7 A;  2W04 A;  3OYN A;  4AI4 A;  3KRM A;  5IYB P;  1NH2 A;  2QLV A;  2IV9 A;  2D0B A;  2Z8U A;  3OH9 A;  2JHN A;  4PII A;  2DKD A;  3OYI A;  1HU0 A;  1PCM X;  4BE1 A;  4OFA A;  4EA4 A;  1E42 A;  3FSP A;  2V9J A;  2NOE A;  2F7L A;  1KYU A;  4AI5 A;  2NWV A;  3OYK A;  4E7I A;  3PDK A;  3OGD A;  2V92 A;  4HJH A;  2JG6 A;  3OYJ A;  4E7J A;  3OST A;  3S3N A;  1LWW A;  3RPJ A;  4EJY A;  1J3M A;  3OS1 A;  5FRO A;  5KL0 A;  1PCZ A;  4YPR A;  3F0Z A;  1PVS A;  2ZFD B;  4EAI A;  3S6I A;  1C4G A;  1NKU A;  3TE5 A;  3R2X C;  1VTO A;  2YG9 A;  4E7H A;  4I8O A;  1NVP A;  3VN5 A;  1QN3 A;  5BMP A;  4UNF A;  1QNB A;  5EPC A;  4EA5 A;  2YH5 A;  3CWU A;  3ULX A;  1Q9U A;  5DPK A;  1QN4 A;  3L2W A;  1R4X A;  4IKF A;  2O3O A;  1WEG A;  1PU7 A;  2EHB D;  1DIZ A;  3I0W A;  1W80 A;  5F9C A;  2Y8Q A;  4IL8 A;  1KG6 A;  1LMZ A;  2YA3 A;  1VRL A;  1KYD A;  2IV8 A;  3S3O A;  4BDY A;  1LXT A;  5JN5 A;  1YQL A;  2OFI A;  3DPT A;  3I3W A;  1RRQ A;  4YPH A;  1PCJ X;  2NOI A;  3CVS A;  1QTS A;  5KN9 A;  1MUY A;  1XG7 A;  4BJU A;  1YTF A;  4E9F A;  2H4L X;  3ENO C;  2I5W A;  1VTL E;  3OC3 C;  1YQR A;  1RRS A;  2D0C A;  4EAL A;  1VOL B;  5CHZ A;  1JFI C;  1QNA A;  3CVT A;  1B9K A;  1MUN A;  1EUV A;  1KG7 A;  4WXA A;  4EW0 A;  1P7M A;  3EAY A;  4Q11 A;  2FUV A;  3KNT A;  1WQA A; 
#chains in the Genus database with same CATH homology
 1KEA A;  2H56 A;  1KG4 A;  1MUD A;  1TGH A;  3IHO A;  1M3H A;  2LAE A;  3OH6 A;  3HS8 A;  1EBM A;  1VTO A;  4DUL A;  4E9H A;  2MJ7 A;  3FHG A;  4YOQ A;  1TBA B;  2XHI A;  2YG9 A;  4TPS A;  2HZM A;  4I8O A;  4ROE B;  1NVP A;  1KY6 A;  4B0A A;  2YG8 A;  3VN5 A;  2VJ0 A;  1QN3 A;  1M3Q A;  4B22 A;  1KYF A;  1ORP A;  1PZD A;  2JOI A;  1CDW A;  1AIS A;  3D4V A;  2MZ8 A;  4UNF A;  3IH7 A;  1C9B B;  1RM1 A;  4EW4 A;  3CW7 A;  1QNB A;  4B21 A;  2NOF A;  4EA5 A;  2YH5 A;  3CWU A;  3ULX A;  5DPK A;  4ROC B;  3HS9 A;  1QN4 A;  1KY7 A;  3CWA A;  1R4X A;  2O3O A;  3F10 A;  1WEG A;  4OFE A;  1N3C A;  3FHF A;  1XQP A;  4EVV A;  3CWT A;  1QNC A;  4B23 A;  2JHJ A;  1LWV A;  3DPU A;  2FGT A;  1ORN A;  1PU7 A;  1KO9 A;  1N3A A;  1DIZ A;  3KTU A;  3I0W A;  1W80 A;  1D3U A;  5IYC P;  1KG6 A;  1KG3 A;  1LMZ A;  1YQM A;  1UT7 A;  3N89 A;  1VRL A;  3CWS A;  2HZS A;  3KRM A;  5IYB P;  4AI4 A;  1NH2 A;  2NOH A;  1KYD A;  1VOK A;  2IV9 A;  2D0B A;  2Z8U A;  2IV8 A;  5AN4 A;  3OH9 A;  2JHN A;  4PII A;  1PU6 A;  5KN8 A;  1QN9 A;  1KQJ A;  1HU0 A;  4PY5 A;  4OFA A;  1YQL A;  2OFI A;  1WEI A;  4EJZ A;  3DPT A;  4EA4 A;  1RRQ A;  1PU8 A;  4YPH A;  2NOI A;  1WEF A;  1QN7 A;  3CVS A;  1QTS A;  1QN5 A;  1MPG A;  4E9G A;  1E42 A;  2NOL A;  1UT4 A;  3FSP A;  5KN9 A;  1MUY A;  1XG7 A;  1KG2 A;  4OFH A;  2NOB A;  1YTF A;  1YTB A;  2NOE A;  4E9F A;  1KYU A;  4AI5 A;  1NGN A;  2I5W A;  1VTL E;  5IYD P;  1N39 A;  1QN8 A;  3OGD A;  3OC3 C;  3ASM A;  1YQR A;  1RRS A;  3G0Q A;  1QNE A;  1FN7 A;  1TBP A;  2D0C A;  4ROD B;  2JG6 A;  2ABK A;  1QN6 A;  1P59 A;  3OST A;  4UOB A;  1KG5 A;  3EIK A;  1LWW A;  1VOL B;  3RPJ A;  5CHZ A;  3I0X A;  1QTP A;  3H1Z A;  1JFI C;  1QNA A;  3N0U A;  4EJY A;  4DK9 A;  3CVT A;  1B9K A;  1MP9 A;  4E9E A;  2D0A A;  1PCZ A;  1LWY A;  4YPR A;  1MUN A;  1YQK A;  1KG7 A;  3F0Z A;  3N5N X;  1XQO A;  4B24 A;  3OCI A;  4WZS D;  1PVS A;  4HSB A;  4EW0 A;  1P7M A;  4Q11 A;  3SNS A;  4AIA A;  3OSM A;  2OFK A;  2NOZ A;  2G30 A;  1NGM A;  3S6I A;  3KNT A;  1NKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...