3OH6A

Alka undamaged dna complex: interrogation of a c:g base pair
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
288
structure length
288
Chain Sequence
MADIGSEFYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDCLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of Escherichia coli AlkA in Complex with Undamaged DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 87
structure length 288
sequence length 288
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3oh6A02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3oh6A03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3oh6A01
2NOEA 3FHFA 1HU0A 3CVSA 5DPKA 1RRQA 1N3AA 1N3CA 1KG4A 3CWAA 3N0UA 1NKUA 1ORPA 4PIIA 4EA5A 2JG6A 2JHNA 2XHIA 2H56A 1MUYA 2ABKA 4YOQA 1KQJA 1FN7A 2NOFA 1WEIA 1KG6A 4OFAA 1LWYA 1LWWA 1PVSA 4UNFA 4EW4A 1YQRA 3I0WA 2I5WA 1KEAA 3CVTA 3CW7A 1M3HA 3CWSA 3I0XA 1MUNA 3F10A 4AI5A 3FSPA 5CHZA 4DK9A 2OFKA 4EJYA 1LWVA 1RRSA 4AIAA 2NOZA 1N39A 1KG3A 2NOIA 3IHOA 4E9GA 1KO9A 4E9FA 4EW0A 3S6IA 2JHJA 1EBMA 2NOBA 5KN9A 2OFIA 2YG9A 4EJZA 1PU8A 1ORNA 4YPHA 1VRLA 1M3QA 1XQPA 3N5NX 3CWTA 3F0ZA 4UOBA 1WEFA 4E9EA 5KN8A 4OFHA 3OH6A 2NOHA 4E9HA 2NOLA 1PU7A 1KG7A 1MUDA 4YPRA 1KG5A 3KNTA 4EVVA 3G0QA 3OGDA 4B21A 1LMZA 1MPGA 3KTUA 4B23A 2YG8A 1YQKA 3IH7A 1P59A 4B22A 5AN4A 1YQLA 3D4VA 4EA4A 4AI4A 4HSBA 1PU6A 4B24A 1XG7A 1NGNA 1YQMA 1DIZA 3FHGA 1WEGA 1XQOA 3CWUA 4OFEA 3OH9A 1P7MA 1KG2A
chains in the Genus database with same CATH superfamily
1QN7A 2V92A 3RSMA 3FHFA 4D7RA 1TGHA 1NVPA 1KG4A 3CWAA 1NKUA 2QRCA 1ORPA 5EPCA 2XHIA 4ROCB 2H56A 1PZDA 1FN7A 2NOFA 5FROA 1Q9UA 2NLVA 2FGTA 2IV8A 4D7QA 1MP9A 4UNFA 3PDKA 2JPIA 4HJHA 1RM1A 2JOIA 1E42A 3CWSA 4AI5A 4QG5A 2HKPA 1EUVA 4BDYA 2NOZA 3NA5A 1D3UA 1B9KA 4PY5A 3UW2A 4MRQA 2ZFDB 4E9FA 2VJ0A 3OYEA 1CDWA 1QNBA 3OYDA 3DPTA 3H1ZA 1PU8A 1VRLA 4BE1A 1JFIC 1R4XA 1WEFA 2Y8QA 2NOHA 2NOLA 4IKFA 4EAIA 1MUDA 5KL0A 4YPRA 1KG5A 2W03A 3G0QA 4B22A 2DKAA 3OYGA 3ASMA 3OSMA 2HL9A 4HSBA 4B24A 1XG7A 3OYCA 1DIZA 2H4LX 1QN3A 4E7JA 3OS2A 4C7PA 1QNAA 2IV9A 1N3CA 4EALA 1UT4A 3S3OA 3PMGA 3OS1A 2EHBD 2QRDA 4E7KA 5IYBP 5BMPA 2JG6A 1MUYA 3BKQX 1KQJA 3OYIA 4E7IA 3EIKA 3HS9A 2HZSA 3OYNA 1KG6A 4OFAA 1NH2A 2FKMX 1P5GX 3I0WA 2YH5A 3CW7A 2JPSA 2NWVA 1QN4A 2LAEA 2FKFA 3OYLA 1N39A 1KG3A 2NOIA 1KO9A 4CFFA 2JHJA 3L2UA 2NOBA 2OFIA 5JN5A 3L2RA 1KYFA 2O3OA 2PWWA 4YPHA 1KYDA 1M3QA 1M5Q1 4B0AA 1XQPA 3N5NX 1KYUA 3L2VA 2FUVA 4E9EA 1PU7A 3OCIA 2V75A 3T4NA 4B21A 1TBAB 3L2QA 1MPGA 3KTUA 4B23A 2V9JA 1YQKA 2OOYA 4I8OA 3NNQA 3IH7A 2DKCA 2MZ8A 1UT7A 2DKDA 3S3NA 3LCNA 2Y8LA 4AI4A 5BMNA 2F7LA 1QN9A 4BJUA 1QN8A 1NGNA 1YQMA 4EAGA 1P7MA 2MJ7A 1XSZA 5IYCP 3HS8A 1KY6A 1QN6A 1RRQA 1N3AA 1KFIA 4WXAA 4EAJA 4EA5A 2ABKA 4YOQA 3ENCA 1WEIA 1VTOA 3OSEA 2W04A 1LWYA 1LWWA 2OOXA 1PVSA 3OS0A 4EW4A 1YQRA 3OYMA 4BE0A 1KFQA 4BE2A 1PCJX 3C04A 3F10A 3FSPA 1QTPA 5CHZA 2QR1A 1LWVA 1RRSA 1LXTA 2V8QA 4AIAA 5JMVD 4E9GA 1W80A 3ULXA 1C47A 1EBMA 1C4GA 2YG9A 1ORNA 3OYAA 1T6AA 3OY9A 3OYFA 3OYBA 1J3MA 3CWTA 3I3WA 2R5XA 3TDHA 4OFHA 3OH6A 2HL8A 2Z0FA 3ENOC 1KG7A 5HSHA 3KNTA 4EVVA 1LMZA 2YG8A 3S3MA 4ZTFA 1P59A 1K35A 1YTFA 4TPSA 5AN4A 4EA4A 1PU6A 4E7HA 4BDZA 3DPUA 3FHGA 1XQOA 3OYKA 3OH9A 1VTLE 3OLPA 1NGMA 1U84A 2NOEA 4E7LA 1TUOA 1HU0A 2D0BA 3CVSA 5DPKA 3N0UA 3TE5A 3R2XC 1QN5A 4PIIA 2G30A 2Z8UA 1JDYA 2JHNA 2D0CA 1VKLA 1WQAA 2I5WA 2NVMA 1V5SA 5F9CA 1KEAA 4BACA 2QREA 3CVTA 1UL7A 1M3HA 3I0XA 1QNEA 1MUNA 4ZTJA 3RPJA 4DK9A 2D0AA 2OFKA 4EJYA 3N89A 4RODB 1PCMX 5IYDP 3IHOA 3KRMA 4EW0A 3S6IA 1TBPA 4WZSD 5KN9A 2H5AX 4WX8A 1QNCA 4EJZA 1VOLB 4EAKA 3OSTA 3L2WA 1K2YX 3F0ZA 4UOBA 2HZMA 3VN5A 1C9BB 5KN8A 4NZGA 1P5DX 4E9HA 1VOKA 2QLVA 1AISA 5FRNA 5FRMA 3OGDA 1QTSA 3OC3C 1WJWA 3SNSA 4ROEB 3VW4A 1YQLA 3D4VA 2YA3A 1KY7A 3D7QA 4DULA 1YTBA 1PCZA 1WEGA 3CWUA 4OFEA 3OYJA 3EAYA 3OYHA 4IL8A 4Q11A 1KG2A
chains in the Genus database with same CATH topology
2NOEA 3FHFA 1HU0A 3CVSA 5DPKA 1RRQA 1N3AA 1N3CA 1KG4A 3CWAA 3N0UA 1NKUA 1ORPA 4PIIA 4EA5A 2JG6A 2JHNA 2XHIA 2H56A 1MUYA 2ABKA 4YOQA 1KQJA 1FN7A 2NOFA 1WEIA 1KG6A 4OFAA 1LWYA 1LWWA 1PVSA 4UNFA 4EW4A 1YQRA 3I0WA 2I5WA 1KEAA 3CVTA 3CW7A 1M3HA 3CWSA 3I0XA 1MUNA 3F10A 4AI5A 3FSPA 5CHZA 4DK9A 2OFKA 4EJYA 1LWVA 1RRSA 4AIAA 2NOZA 1N39A 1KG3A 2NOIA 3IHOA 4E9GA 1KO9A 4E9FA 4EW0A 3S6IA 2JHJA 1EBMA 2NOBA 5KN9A 2OFIA 2YG9A 4EJZA 1PU8A 1ORNA 4YPHA 1VRLA 1M3QA 1XQPA 3N5NX 3CWTA 3F0ZA 4UOBA 1WEFA 4E9EA 5KN8A 4OFHA 3OH6A 2NOHA 4E9HA 2NOLA 1PU7A 1KG7A 1MUDA 4YPRA 1KG5A 3KNTA 4EVVA 3G0QA 3OGDA 4B21A 1LMZA 1MPGA 3KTUA 4B23A 2YG8A 1YQKA 3IH7A 1P59A 4B22A 5AN4A 1YQLA 3D4VA 4EA4A 4AI4A 4HSBA 1PU6A 4B24A 1XG7A 1NGNA 1YQMA 1DIZA 3FHGA 1WEGA 1XQOA 3CWUA 4OFEA 3OH9A 1P7MA 1KG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOE A;  3FHF A;  1HU0 A;  3CVS A;  5DPK A;  1RRQ A;  1N3A A;  1N3C A;  1KG4 A;  3CWA A;  3N0U A;  1NKU A;  1ORP A;  4PII A;  4EA5 A;  2JG6 A;  2JHN A;  2XHI A;  2H56 A;  1MUY A;  2ABK A;  4YOQ A;  1KQJ A;  1FN7 A;  2NOF A;  1WEI A;  1KG6 A;  4OFA A;  1LWY A;  1LWW A;  1PVS A;  4UNF A;  4EW4 A;  1YQR A;  3I0W A;  2I5W A;  1KEA A;  3CVT A;  3CW7 A;  1M3H A;  3CWS A;  3I0X A;  1MUN A;  3F10 A;  4AI5 A;  3FSP A;  5CHZ A;  4DK9 A;  2OFK A;  4EJY A;  1LWV A;  1RRS A;  4AIA A;  2NOZ A;  1N39 A;  1KG3 A;  2NOI A;  3IHO A;  4E9G A;  1KO9 A;  4E9F A;  4EW0 A;  3S6I A;  2JHJ A;  1EBM A;  2NOB A;  5KN9 A;  2OFI A;  2YG9 A;  4EJZ A;  1PU8 A;  1ORN A;  4YPH A;  1VRL A;  1M3Q A;  1XQP A;  3N5N X;  3CWT A;  3F0Z A;  4UOB A;  1WEF A;  4E9E A;  5KN8 A;  4OFH A;  3OH6 A;  2NOH A;  4E9H A;  2NOL A;  1PU7 A;  1KG7 A;  1MUD A;  4YPR A;  1KG5 A;  3KNT A;  4EVV A;  3G0Q A;  3OGD A;  4B21 A;  1LMZ A;  1MPG A;  3KTU A;  4B23 A;  2YG8 A;  1YQK A;  3IH7 A;  1P59 A;  4B22 A;  5AN4 A;  1YQL A;  3D4V A;  4EA4 A;  4AI4 A;  4HSB A;  1PU6 A;  4B24 A;  1XG7 A;  1NGN A;  1YQM A;  1DIZ A;  3FHG A;  1WEG A;  1XQO A;  3CWU A;  4OFE A;  3OH9 A;  1P7M A;  1KG2 A; 
#chains in the Genus database with same CATH topology
 1QN7 A;  2V92 A;  3RSM A;  3FHF A;  4D7R A;  1TGH A;  1NVP A;  1KG4 A;  3CWA A;  1NKU A;  2QRC A;  1ORP A;  5EPC A;  2XHI A;  4ROC B;  2H56 A;  1PZD A;  1FN7 A;  2NOF A;  5FRO A;  1Q9U A;  2NLV A;  2FGT A;  2IV8 A;  4D7Q A;  1MP9 A;  4UNF A;  3PDK A;  2JPI A;  4HJH A;  1RM1 A;  2JOI A;  1E42 A;  3CWS A;  4AI5 A;  4QG5 A;  2HKP A;  1EUV A;  4BDY A;  2NOZ A;  3NA5 A;  1D3U A;  1B9K A;  4PY5 A;  3UW2 A;  4MRQ A;  2ZFD B;  4E9F A;  2VJ0 A;  3OYE A;  1CDW A;  1QNB A;  3OYD A;  3DPT A;  3H1Z A;  1PU8 A;  1VRL A;  4BE1 A;  1JFI C;  1R4X A;  1WEF A;  2Y8Q A;  2NOH A;  2NOL A;  4IKF A;  4EAI A;  1MUD A;  5KL0 A;  4YPR A;  1KG5 A;  2W03 A;  3G0Q A;  4B22 A;  2DKA A;  3OYG A;  3ASM A;  3OSM A;  2HL9 A;  4HSB A;  4B24 A;  1XG7 A;  3OYC A;  1DIZ A;  2H4L X;  1QN3 A;  4E7J A;  3OS2 A;  4C7P A;  1QNA A;  2IV9 A;  1N3C A;  4EAL A;  1UT4 A;  3S3O A;  3PMG A;  3OS1 A;  2EHB D;  2QRD A;  4E7K A;  5IYB P;  5BMP A;  2JG6 A;  1MUY A;  3BKQ X;  1KQJ A;  3OYI A;  4E7I A;  3EIK A;  3HS9 A;  2HZS A;  3OYN A;  1KG6 A;  4OFA A;  1NH2 A;  2FKM X;  1P5G X;  3I0W A;  2YH5 A;  3CW7 A;  2JPS A;  2NWV A;  1QN4 A;  2LAE A;  2FKF A;  3OYL A;  1N39 A;  1KG3 A;  2NOI A;  1KO9 A;  4CFF A;  2JHJ A;  3L2U A;  2NOB A;  2OFI A;  5JN5 A;  3L2R A;  1KYF A;  2O3O A;  2PWW A;  4YPH A;  1KYD A;  1M3Q A;  1M5Q 1;  4B0A A;  1XQP A;  3N5N X;  1KYU A;  3L2V A;  2FUV A;  4E9E A;  1PU7 A;  3OCI A;  2V75 A;  3T4N A;  4B21 A;  1TBA B;  3L2Q A;  1MPG A;  3KTU A;  4B23 A;  2V9J A;  1YQK A;  2OOY A;  4I8O A;  3NNQ A;  3IH7 A;  2DKC A;  2MZ8 A;  1UT7 A;  2DKD A;  3S3N A;  3LCN A;  2Y8L A;  4AI4 A;  5BMN A;  2F7L A;  1QN9 A;  4BJU A;  1QN8 A;  1NGN A;  1YQM A;  4EAG A;  1P7M A;  2MJ7 A;  1XSZ A;  5IYC P;  3HS8 A;  1KY6 A;  1QN6 A;  1RRQ A;  1N3A A;  1KFI A;  4WXA A;  4EAJ A;  4EA5 A;  2ABK A;  4YOQ A;  3ENC A;  1WEI A;  1VTO A;  3OSE A;  2W04 A;  1LWY A;  1LWW A;  2OOX A;  1PVS A;  3OS0 A;  4EW4 A;  1YQR A;  3OYM A;  4BE0 A;  1KFQ A;  4BE2 A;  1PCJ X;  3C04 A;  3F10 A;  3FSP A;  1QTP A;  5CHZ A;  2QR1 A;  1LWV A;  1RRS A;  1LXT A;  2V8Q A;  4AIA A;  5JMV D;  4E9G A;  1W80 A;  3ULX A;  1C47 A;  1EBM A;  1C4G A;  2YG9 A;  1ORN A;  3OYA A;  1T6A A;  3OY9 A;  3OYF A;  3OYB A;  1J3M A;  3CWT A;  3I3W A;  2R5X A;  3TDH A;  4OFH A;  3OH6 A;  2HL8 A;  2Z0F A;  3ENO C;  1KG7 A;  5HSH A;  3KNT A;  4EVV A;  1LMZ A;  2YG8 A;  3S3M A;  4ZTF A;  1P59 A;  1K35 A;  1YTF A;  4TPS A;  5AN4 A;  4EA4 A;  1PU6 A;  4E7H A;  4BDZ A;  3DPU A;  3FHG A;  1XQO A;  3OYK A;  3OH9 A;  1VTL E;  3OLP A;  1NGM A;  1U84 A;  2NOE A;  4E7L A;  1TUO A;  1HU0 A;  2D0B A;  3CVS A;  5DPK A;  3N0U A;  3TE5 A;  3R2X C;  1QN5 A;  4PII A;  2G30 A;  2Z8U A;  1JDY A;  2JHN A;  2D0C A;  1VKL A;  1WQA A;  2I5W A;  2NVM A;  1V5S A;  5F9C A;  1KEA A;  4BAC A;  2QRE A;  3CVT A;  1UL7 A;  1M3H A;  3I0X A;  1QNE A;  1MUN A;  4ZTJ A;  3RPJ A;  4DK9 A;  2D0A A;  2OFK A;  4EJY A;  3N89 A;  4ROD B;  1PCM X;  5IYD P;  3IHO A;  3KRM A;  4EW0 A;  3S6I A;  1TBP A;  4WZS D;  5KN9 A;  2H5A X;  4WX8 A;  1QNC A;  4EJZ A;  1VOL B;  4EAK A;  3OST A;  3L2W A;  1K2Y X;  3F0Z A;  4UOB A;  2HZM A;  3VN5 A;  1C9B B;  5KN8 A;  4NZG A;  1P5D X;  4E9H A;  1VOK A;  2QLV A;  1AIS A;  5FRN A;  5FRM A;  3OGD A;  1QTS A;  3OC3 C;  1WJW A;  3SNS A;  4ROE B;  3VW4 A;  1YQL A;  3D4V A;  2YA3 A;  1KY7 A;  3D7Q A;  4DUL A;  1YTB A;  1PCZ A;  1WEG A;  3CWU A;  4OFE A;  3OYJ A;  3EAY A;  3OYH A;  4IL8 A;  4Q11 A;  1KG2 A; 
#chains in the Genus database with same CATH homology
 2NOE A;  3FHF A;  1HU0 A;  3CVS A;  5DPK A;  1RRQ A;  1N3A A;  1N3C A;  1KG4 A;  3CWA A;  3N0U A;  1NKU A;  1ORP A;  4PII A;  4EA5 A;  2JG6 A;  2JHN A;  2XHI A;  2H56 A;  1MUY A;  2ABK A;  4YOQ A;  1KQJ A;  1FN7 A;  2NOF A;  1WEI A;  1KG6 A;  4OFA A;  1LWY A;  1LWW A;  1PVS A;  4UNF A;  4EW4 A;  1YQR A;  3I0W A;  2I5W A;  1KEA A;  3CVT A;  3CW7 A;  1M3H A;  3CWS A;  3I0X A;  1MUN A;  3F10 A;  4AI5 A;  3FSP A;  5CHZ A;  4DK9 A;  2OFK A;  4EJY A;  1LWV A;  1RRS A;  4AIA A;  2NOZ A;  1N39 A;  1KG3 A;  2NOI A;  3IHO A;  4E9G A;  1KO9 A;  4E9F A;  4EW0 A;  3S6I A;  2JHJ A;  1EBM A;  2NOB A;  5KN9 A;  2OFI A;  2YG9 A;  4EJZ A;  1PU8 A;  1ORN A;  4YPH A;  1VRL A;  1M3Q A;  1XQP A;  3N5N X;  3CWT A;  3F0Z A;  4UOB A;  1WEF A;  4E9E A;  5KN8 A;  4OFH A;  3OH6 A;  2NOH A;  4E9H A;  2NOL A;  1PU7 A;  1KG7 A;  1MUD A;  4YPR A;  1KG5 A;  3KNT A;  4EVV A;  3G0Q A;  3OGD A;  4B21 A;  1LMZ A;  1MPG A;  3KTU A;  4B23 A;  2YG8 A;  1YQK A;  3IH7 A;  1P59 A;  4B22 A;  5AN4 A;  1YQL A;  3D4V A;  4EA4 A;  4AI4 A;  4HSB A;  1PU6 A;  4B24 A;  1XG7 A;  1NGN A;  1YQM A;  1DIZ A;  3FHG A;  1WEG A;  1XQO A;  3CWU A;  4OFE A;  3OH9 A;  1P7M A;  1KG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...