3OH6A

Alka undamaged dna complex: interrogation of a c:g base pair
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
288
structure length
288
Chain Sequence
MADIGSEFYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDCLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of Escherichia coli AlkA in Complex with Undamaged DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 87
structure length 288
sequence length 288
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3oh6A02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3oh6A03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3oh6A01
1KG4A 4OFHA 3N5NX 4YPRA 4OFEA 1ORNA 2NOIA 4B21A 1KG2A 1EBMA 4AI5A 4UOBA 4OFAA 1WEFA 4E9GA 3KTUA 3IH7A 1PVSA 5AN4A 1LWVA 3FSPA 2NOLA 1PU6A 5KN9A 4HSBA 1LWWA 3CWAA 2I5WA 1XQPA 3D4VA 2JHJA 1MPGA 2YG8A 2YG9A 2H56A 1M3HA 1FN7A 3FHGA 5DPKA 4PIIA 3CWTA 1KG3A 3I0XA 4EW4A 1N3AA 1DIZA 3I0WA 2JHNA 3OGDA 1PU7A 1MUDA 1KG7A 4EA5A 1ORPA 3F0ZA 3FHFA 1WEIA 1NKUA 2NOZA 2NOFA 3IHOA 1N3CA 4AIAA 5KN8A 1KG6A 2NOBA 2OFIA 1VRLA 1YQLA 2NOHA 3OH9A 4B23A 1WEGA 3CW7A 2OFKA 4EW0A 3G0QA 1M3QA 4YPHA 1KEAA 4AI4A 4UNFA 1RRSA 5CHZA 1XG7A 3KNTA 3S6IA 2NOEA 4B22A 3N0UA 1NGNA 3CWUA 1LWYA 1KQJA 2XHIA 3F10A 1YQKA 2ABKA 4DK9A 4EJZA 1P59A 1N39A 1MUYA 4YOQA 1KG5A 4EA4A 1HU0A 1LMZA 4B24A 3CVTA 4EJYA 4E9FA 4EVVA 1RRQA 1XQOA 1KO9A 1P7MA 3CVSA 4E9EA 3OH6A 1YQRA 2JG6A 4E9HA 3CWSA 1MUNA 1PU8A 1YQMA
chains in the Genus database with same CATH superfamily
2HZSA 1QN4A 5EPCA 1NVPA 3N5NX 3D7QA 2QR1A 1VTLE 1KY6A 4AI5A 3OYAA 4BACA 4TPSA 3OYIA 1LWVA 1QN5A 1QNAA 3FSPA 1NH2A 1PU6A 4E7LA 1KY7A 3OYEA 1MP9A 2V8QA 4CFFA 3OS0A 1C47A 2JHJA 2HL8A 3OSMA 3DPUA 1MPGA 2YG8A 1M3HA 3FHGA 5DPKA 3CWTA 3OYDA 2D0BA 3ULXA 3I0XA 1VOKA 1DIZA 1AISA 2JHNA 1KYUA 1Q9UA 1PCZA 3BKQX 4EAIA 4ROEB 1MUDA 1KG7A 1ORPA 4ZTFA 1QN7A 1WQAA 4MRQA 1N3CA 4ZTJA 3OSEA 1VRLA 2NOHA 3I3WA 3L2WA 2Y8LA 4B23A 3R2XC 3CW7A 2OOYA 2R5XA 3G0QA 1M3QA 4WXAA 3HS8A 3KNTA 3S6IA 1D3UA 3CWUA 1J3MA 1PCMX 1QNBA 1KQJA 4BDZA 4E7HA 2DKCA 2ABKA 1JDYA 4EJZA 1P59A 2H5AX 1MUYA 2VJ0A 3OCIA 3OSTA 1HU0A 3RSMA 4DULA 4E7IA 1XQOA 1P7MA 5BMNA 5FRNA 2OOXA 1YTBA 3KRMA 4EALA 3CWSA 4D7RA 3OLPA 4OFHA 2YH5A 4OFEA 1ORNA 4HJHA 4B21A 3OYFA 4OFAA 1C4GA 2IV8A 4E9GA 3C04A 5HSHA 5AN4A 1UL7A 2NOLA 5KN9A 1KYFA 4HSBA 1XQPA 3D4VA 2NWVA 5FROA 1QN8A 2V9JA 1TBAB 2QLVA 4IKFA 2H56A 3L2RA 3TE5A 1JFIC 1LXTA 1PU7A 1UT4A 3ENCA 3FHFA 1WJWA 4WX8A 2QRDA 2NOZA 3IHOA 4AIAA 5KN8A 2NOBA 1TBPA 1YQLA 4EAJA 4IL8A 2QRCA 2OFKA 1VTOA 4YPHA 4AI4A 4UNFA 2JOIA 3N0UA 1NGNA 3OYKA 3OS2A 4E7JA 1LWYA 5FRMA 2XHIA 3S3OA 4C7PA 2FUVA 1P5GX 4WZSD 4YOQA 1QN9A 1E42A 1RRQA 3PMGA 2JG6A 4E9HA 4QG5A 1PU8A 3DPTA 1KG4A 4E7KA 4ROCB 1EBMA 1EUVA 1R4XA 5BMPA 4UOBA 1WEFA 3KTUA 1PVSA 1QTSA 1QN6A 1LWWA 3OYJA 1QNCA 3CWAA 2MJ7A 2JPIA 2IV9A 2LAEA 3OYGA 3LCNA 3NA5A 1VOLB 3L2QA 2Z0FA 1FN7A 2MZ8A 2W04A 1PCJX 4BE0A 5IYDP 4D7QA 5F9CA 1NKUA 2Y8QA 2NOFA 1RM1A 2ZFDB 1PZDA 1KFIA 2YA3A 1K2YX 3H1ZA 4EAGA 2NVMA 4EW0A 3VW4A 2O3OA 2QREA 1U84A 2W03A 1XG7A 5CHZA 1T6AA 4B22A 3UW2A 3NNQA 3OYCA 3F10A 3L2UA 1YQKA 3OC3C 2NLVA 1N39A 4BE2A 4RODB 1KG5A 4EA4A 2D0CA 1LMZA 4B24A 4E9FA 4BJUA 1KO9A 1TUOA 1TGHA 4E9EA 1YQRA 3VN5A 5IYBP 4PY5A 2Z8UA 1MUNA 3T4NA 1YQMA 3OY9A 4B0AA 4YPRA 1QNEA 2NOIA 2FGTA 1KG2A 2EHBD 4Q11A 3OS1A 2HZMA 2JPSA 3IH7A 5JMVD 4NZGA 3EIKA 1KFQA 2I5WA 5KL0A 3OYLA 3SNSA 1YTFA 1VKLA 3S3MA 2YG9A 5JN5A 1W80A 4PIIA 1KG3A 4EW4A 3PDKA 1N3AA 3I0WA 2HKPA 1CDWA 3OGDA 2PWWA 4EA5A 3ASMA 3F0ZA 1WEIA 3OYHA 2FKFA 1NGMA 1KYDA 1KG6A 1UT7A 2OFIA 3OYMA 1M5Q1 3RPJA 2FKMX 5IYCP 3OH9A 2HL9A 1XSZA 1WEGA 4BDYA 3EAYA 1KEAA 3ENOC 1RRSA 1B9KA 2NOEA 2DKAA 1C9BB 4I8OA 1QTPA 2V92A 4EAKA 1K35A 3HS9A 2H4LX 3L2VA 4DK9A 2G30A 3CVTA 4EJYA 3S3NA 4BE1A 4EVVA 3TDHA 2D0AA 3OYNA 3CVSA 3OH6A 3OYBA 1QN3A 2DKDA 1P5DX 1V5SA 3N89A 2F7LA 2V75A
chains in the Genus database with same CATH topology
1KG4A 4OFHA 3N5NX 4YPRA 4OFEA 1ORNA 2NOIA 4B21A 1KG2A 1EBMA 4AI5A 4UOBA 4OFAA 1WEFA 4E9GA 3KTUA 3IH7A 1PVSA 5AN4A 1LWVA 3FSPA 2NOLA 1PU6A 5KN9A 4HSBA 1LWWA 3CWAA 2I5WA 1XQPA 3D4VA 2JHJA 1MPGA 2YG8A 2YG9A 2H56A 1M3HA 1FN7A 3FHGA 5DPKA 4PIIA 3CWTA 1KG3A 3I0XA 4EW4A 1N3AA 1DIZA 3I0WA 2JHNA 3OGDA 1PU7A 1MUDA 1KG7A 4EA5A 1ORPA 3F0ZA 3FHFA 1WEIA 1NKUA 2NOZA 2NOFA 3IHOA 1N3CA 4AIAA 5KN8A 1KG6A 2NOBA 2OFIA 1VRLA 1YQLA 2NOHA 3OH9A 4B23A 1WEGA 3CW7A 2OFKA 4EW0A 3G0QA 1M3QA 4YPHA 1KEAA 4AI4A 4UNFA 1RRSA 5CHZA 1XG7A 3KNTA 3S6IA 2NOEA 4B22A 3N0UA 1NGNA 3CWUA 1LWYA 1KQJA 2XHIA 3F10A 1YQKA 2ABKA 4DK9A 4EJZA 1P59A 1N39A 1MUYA 4YOQA 1KG5A 4EA4A 1HU0A 1LMZA 4B24A 3CVTA 4EJYA 4E9FA 4EVVA 1RRQA 1XQOA 1KO9A 1P7MA 3CVSA 4E9EA 3OH6A 1YQRA 2JG6A 4E9HA 3CWSA 1MUNA 1PU8A 1YQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KG4 A;  4OFH A;  3N5N X;  4YPR A;  4OFE A;  1ORN A;  2NOI A;  4B21 A;  1KG2 A;  1EBM A;  4AI5 A;  4UOB A;  4OFA A;  1WEF A;  4E9G A;  3KTU A;  3IH7 A;  1PVS A;  5AN4 A;  1LWV A;  3FSP A;  2NOL A;  1PU6 A;  5KN9 A;  4HSB A;  1LWW A;  3CWA A;  2I5W A;  1XQP A;  3D4V A;  2JHJ A;  1MPG A;  2YG8 A;  2YG9 A;  2H56 A;  1M3H A;  1FN7 A;  3FHG A;  5DPK A;  4PII A;  3CWT A;  1KG3 A;  3I0X A;  4EW4 A;  1N3A A;  1DIZ A;  3I0W A;  2JHN A;  3OGD A;  1PU7 A;  1MUD A;  1KG7 A;  4EA5 A;  1ORP A;  3F0Z A;  3FHF A;  1WEI A;  1NKU A;  2NOZ A;  2NOF A;  3IHO A;  1N3C A;  4AIA A;  5KN8 A;  1KG6 A;  2NOB A;  2OFI A;  1VRL A;  1YQL A;  2NOH A;  3OH9 A;  4B23 A;  1WEG A;  3CW7 A;  2OFK A;  4EW0 A;  3G0Q A;  1M3Q A;  4YPH A;  1KEA A;  4AI4 A;  4UNF A;  1RRS A;  5CHZ A;  1XG7 A;  3KNT A;  3S6I A;  2NOE A;  4B22 A;  3N0U A;  1NGN A;  3CWU A;  1LWY A;  1KQJ A;  2XHI A;  3F10 A;  1YQK A;  2ABK A;  4DK9 A;  4EJZ A;  1P59 A;  1N39 A;  1MUY A;  4YOQ A;  1KG5 A;  4EA4 A;  1HU0 A;  1LMZ A;  4B24 A;  3CVT A;  4EJY A;  4E9F A;  4EVV A;  1RRQ A;  1XQO A;  1KO9 A;  1P7M A;  3CVS A;  4E9E A;  3OH6 A;  1YQR A;  2JG6 A;  4E9H A;  3CWS A;  1MUN A;  1PU8 A;  1YQM A; 
#chains in the Genus database with same CATH topology
 2HZS A;  1QN4 A;  5EPC A;  1NVP A;  3N5N X;  3D7Q A;  2QR1 A;  1VTL E;  1KY6 A;  4AI5 A;  3OYA A;  4BAC A;  4TPS A;  3OYI A;  1LWV A;  1QN5 A;  1QNA A;  3FSP A;  1NH2 A;  1PU6 A;  4E7L A;  1KY7 A;  3OYE A;  1MP9 A;  2V8Q A;  4CFF A;  3OS0 A;  1C47 A;  2JHJ A;  2HL8 A;  3OSM A;  3DPU A;  1MPG A;  2YG8 A;  1M3H A;  3FHG A;  5DPK A;  3CWT A;  3OYD A;  2D0B A;  3ULX A;  3I0X A;  1VOK A;  1DIZ A;  1AIS A;  2JHN A;  1KYU A;  1Q9U A;  1PCZ A;  3BKQ X;  4EAI A;  4ROE B;  1MUD A;  1KG7 A;  1ORP A;  4ZTF A;  1QN7 A;  1WQA A;  4MRQ A;  1N3C A;  4ZTJ A;  3OSE A;  1VRL A;  2NOH A;  3I3W A;  3L2W A;  2Y8L A;  4B23 A;  3R2X C;  3CW7 A;  2OOY A;  2R5X A;  3G0Q A;  1M3Q A;  4WXA A;  3HS8 A;  3KNT A;  3S6I A;  1D3U A;  3CWU A;  1J3M A;  1PCM X;  1QNB A;  1KQJ A;  4BDZ A;  4E7H A;  2DKC A;  2ABK A;  1JDY A;  4EJZ A;  1P59 A;  2H5A X;  1MUY A;  2VJ0 A;  3OCI A;  3OST A;  1HU0 A;  3RSM A;  4DUL A;  4E7I A;  1XQO A;  1P7M A;  5BMN A;  5FRN A;  2OOX A;  1YTB A;  3KRM A;  4EAL A;  3CWS A;  4D7R A;  3OLP A;  4OFH A;  2YH5 A;  4OFE A;  1ORN A;  4HJH A;  4B21 A;  3OYF A;  4OFA A;  1C4G A;  2IV8 A;  4E9G A;  3C04 A;  5HSH A;  5AN4 A;  1UL7 A;  2NOL A;  5KN9 A;  1KYF A;  4HSB A;  1XQP A;  3D4V A;  2NWV A;  5FRO A;  1QN8 A;  2V9J A;  1TBA B;  2QLV A;  4IKF A;  2H56 A;  3L2R A;  3TE5 A;  1JFI C;  1LXT A;  1PU7 A;  1UT4 A;  3ENC A;  3FHF A;  1WJW A;  4WX8 A;  2QRD A;  2NOZ A;  3IHO A;  4AIA A;  5KN8 A;  2NOB A;  1TBP A;  1YQL A;  4EAJ A;  4IL8 A;  2QRC A;  2OFK A;  1VTO A;  4YPH A;  4AI4 A;  4UNF A;  2JOI A;  3N0U A;  1NGN A;  3OYK A;  3OS2 A;  4E7J A;  1LWY A;  5FRM A;  2XHI A;  3S3O A;  4C7P A;  2FUV A;  1P5G X;  4WZS D;  4YOQ A;  1QN9 A;  1E42 A;  1RRQ A;  3PMG A;  2JG6 A;  4E9H A;  4QG5 A;  1PU8 A;  3DPT A;  1KG4 A;  4E7K A;  4ROC B;  1EBM A;  1EUV A;  1R4X A;  5BMP A;  4UOB A;  1WEF A;  3KTU A;  1PVS A;  1QTS A;  1QN6 A;  1LWW A;  3OYJ A;  1QNC A;  3CWA A;  2MJ7 A;  2JPI A;  2IV9 A;  2LAE A;  3OYG A;  3LCN A;  3NA5 A;  1VOL B;  3L2Q A;  2Z0F A;  1FN7 A;  2MZ8 A;  2W04 A;  1PCJ X;  4BE0 A;  5IYD P;  4D7Q A;  5F9C A;  1NKU A;  2Y8Q A;  2NOF A;  1RM1 A;  2ZFD B;  1PZD A;  1KFI A;  2YA3 A;  1K2Y X;  3H1Z A;  4EAG A;  2NVM A;  4EW0 A;  3VW4 A;  2O3O A;  2QRE A;  1U84 A;  2W03 A;  1XG7 A;  5CHZ A;  1T6A A;  4B22 A;  3UW2 A;  3NNQ A;  3OYC A;  3F10 A;  3L2U A;  1YQK A;  3OC3 C;  2NLV A;  1N39 A;  4BE2 A;  4ROD B;  1KG5 A;  4EA4 A;  2D0C A;  1LMZ A;  4B24 A;  4E9F A;  4BJU A;  1KO9 A;  1TUO A;  1TGH A;  4E9E A;  1YQR A;  3VN5 A;  5IYB P;  4PY5 A;  2Z8U A;  1MUN A;  3T4N A;  1YQM A;  3OY9 A;  4B0A A;  4YPR A;  1QNE A;  2NOI A;  2FGT A;  1KG2 A;  2EHB D;  4Q11 A;  3OS1 A;  2HZM A;  2JPS A;  3IH7 A;  5JMV D;  4NZG A;  3EIK A;  1KFQ A;  2I5W A;  5KL0 A;  3OYL A;  3SNS A;  1YTF A;  1VKL A;  3S3M A;  2YG9 A;  5JN5 A;  1W80 A;  4PII A;  1KG3 A;  4EW4 A;  3PDK A;  1N3A A;  3I0W A;  2HKP A;  1CDW A;  3OGD A;  2PWW A;  4EA5 A;  3ASM A;  3F0Z A;  1WEI A;  3OYH A;  2FKF A;  1NGM A;  1KYD A;  1KG6 A;  1UT7 A;  2OFI A;  3OYM A;  1M5Q 1;  3RPJ A;  2FKM X;  5IYC P;  3OH9 A;  2HL9 A;  1XSZ A;  1WEG A;  4BDY A;  3EAY A;  1KEA A;  3ENO C;  1RRS A;  1B9K A;  2NOE A;  2DKA A;  1C9B B;  4I8O A;  1QTP A;  2V92 A;  4EAK A;  1K35 A;  3HS9 A;  2H4L X;  3L2V A;  4DK9 A;  2G30 A;  3CVT A;  4EJY A;  3S3N A;  4BE1 A;  4EVV A;  3TDH A;  2D0A A;  3OYN A;  3CVS A;  3OH6 A;  3OYB A;  1QN3 A;  2DKD A;  1P5D X;  1V5S A;  3N89 A;  2F7L A;  2V75 A; 
#chains in the Genus database with same CATH homology
 1KG4 A;  4OFH A;  3N5N X;  4YPR A;  4OFE A;  1ORN A;  2NOI A;  4B21 A;  1KG2 A;  1EBM A;  4AI5 A;  4UOB A;  4OFA A;  1WEF A;  4E9G A;  3KTU A;  3IH7 A;  1PVS A;  5AN4 A;  1LWV A;  3FSP A;  2NOL A;  1PU6 A;  5KN9 A;  4HSB A;  1LWW A;  3CWA A;  2I5W A;  1XQP A;  3D4V A;  2JHJ A;  1MPG A;  2YG8 A;  2YG9 A;  2H56 A;  1M3H A;  1FN7 A;  3FHG A;  5DPK A;  4PII A;  3CWT A;  1KG3 A;  3I0X A;  4EW4 A;  1N3A A;  1DIZ A;  3I0W A;  2JHN A;  3OGD A;  1PU7 A;  1MUD A;  1KG7 A;  4EA5 A;  1ORP A;  3F0Z A;  3FHF A;  1WEI A;  1NKU A;  2NOZ A;  2NOF A;  3IHO A;  1N3C A;  4AIA A;  5KN8 A;  1KG6 A;  2NOB A;  2OFI A;  1VRL A;  1YQL A;  2NOH A;  3OH9 A;  4B23 A;  1WEG A;  3CW7 A;  2OFK A;  4EW0 A;  3G0Q A;  1M3Q A;  4YPH A;  1KEA A;  4AI4 A;  4UNF A;  1RRS A;  5CHZ A;  1XG7 A;  3KNT A;  3S6I A;  2NOE A;  4B22 A;  3N0U A;  1NGN A;  3CWU A;  1LWY A;  1KQJ A;  2XHI A;  3F10 A;  1YQK A;  2ABK A;  4DK9 A;  4EJZ A;  1P59 A;  1N39 A;  1MUY A;  4YOQ A;  1KG5 A;  4EA4 A;  1HU0 A;  1LMZ A;  4B24 A;  3CVT A;  4EJY A;  4E9F A;  4EVV A;  1RRQ A;  1XQO A;  1KO9 A;  1P7M A;  3CVS A;  4E9E A;  3OH6 A;  1YQR A;  2JG6 A;  4E9H A;  3CWS A;  1MUN A;  1PU8 A;  1YQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...