3CVTA

Crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cvtA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cvtA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cvtA01
3FHGA 4AI4A 1PVSA 3FSPA 4OFEA 4YPHA 4OFHA 4B23A 1ORNA 1ORPA 3OH6A 3F10A 1LWWA 1KO9A 4HSBA 1MUNA 1VRLA 1XQOA 4EJYA 1WEIA 1KG2A 2ABKA 3FHFA 3CVSA 4AI5A 3N5NX 3KTUA 1P7MA 1HU0A 2NOHA 3I0WA 4EJZA 2H56A 1XQPA 4UNFA 4B24A 1KG5A 5CHZA 4EA4A 3N0UA 1PU8A 4E9EA 3OGDA 4E9HA 1LMZA 1FN7A 2YG8A 3CWUA 1KG7A 4E9FA 1M3QA 2NOLA 1N3AA 3I0XA 3CWAA 1WEFA 1MPGA 2YG9A 3S6IA 2I5WA 3CWTA 3CW7A 4PIIA 1KG3A 1NGNA 3IH7A 2OFIA 3G0QA 2NOZA 1PU6A 4B22A 1LWVA 3OH9A 1MUDA 5KN8A 4AIAA 3CWSA 4B21A 1YQLA 1KG4A 4YPRA 1YQMA 3IHOA 4EW4A 1YQKA 2JHJA 3KNTA 1YQRA 4EVVA 5AN4A 1KQJA 4OFAA 3CVTA 1KEAA 1N3CA 4UOBA 1N39A 1XG7A 5KN9A 4EW0A 1PU7A 1RRQA 1NKUA 2NOFA 2NOEA 1MUYA 2OFKA 1EBMA 4YOQA 1KG6A 3D4VA 4EA5A 2NOIA 4DK9A 2XHIA 1RRSA 2JG6A 1LWYA 2NOBA 3F0ZA 1M3HA 4E9GA 1DIZA 2JHNA 5DPKA 1P59A 1WEGA
chains in the Genus database with same CATH superfamily
4AI4A 1P5DX 3FSPA 3RSMA 2HL9A 5IYBP 4OFHA 4B0AA 1ORNA 3OH6A 4E7JA 1LWWA 5F9CA 1PCMX 1WEIA 2V75A 1TBAB 1KY6A 1LXTA 4BDYA 2QLVA 1JDYA 2QR1A 4UNFA 3I3WA 2D0BA 3D7QA 4EA4A 4E7KA 3OLPA 4E7HA 1RM1A 1D3UA 1C9BB 3RPJA 3BKQX 4E9EA 3OGDA 4E9HA 1FN7A 3CWUA 2W03A 4EAIA 2DKCA 1M3QA 3VN5A 1MPGA 1QNCA 2I5WA 3CWTA 3OYHA 4PIIA 1KG3A 1NGNA 1VOKA 2OFIA 2V8QA 1E42A 4IKFA 2Z0FA 1AISA 1C4GA 4QG5A 4WXAA 4B21A 4YPRA 1YQMA 4EW4A 1KYUA 2V92A 5HSHA 1KQJA 3CVTA 1NGMA 1VTLE 2YH5A 3L2QA 1N3CA 4UOBA 3NA5A 3HS8A 1XG7A 1VKLA 4EW0A 1NKUA 2NOFA 4BE2A 2G30A 3S3OA 3D4VA 2YA3A 4DK9A 1RRSA 4ZTJA 2NOBA 3UW2A 5DPKA 1KY7A 2H4LX 3FHGA 1KYFA 3OYEA 4B23A 1WJWA 2ZFDB 1ORPA 3SNSA 3F10A 1TUOA 1VRLA 1XQOA 2ABKA 3KTUA 3PDKA 2HL8A 4Q11A 4TPSA 1PZDA 3OCIA 3KRMA 1R4XA 1XQPA 1KG5A 3TDHA 3OYIA 1QNAA 1LMZA 3OYLA 4E9FA 4D7QA 4ROCB 2NOLA 3OYCA 3OYMA 2EHBD 4I8OA 2HKPA 3S3NA 3C04A 1M5Q1 3ENCA 1QNBA 3H1ZA 1QN9A 3N89A 5KN8A 5KL0A 5FRMA 4AIAA 5FRNA 3ASMA 3OS2A 2NWVA 1YQRA 5AN4A 4OFAA 1YTFA 2HZMA 2QRDA 1QN6A 2MJ7A 4BACA 1RRQA 3ENOC 2FUVA 1EBMA 4BE0A 1KG6A 4EA5A 3OYAA 1QN5A 2HZSA 1M3HA 1VOLB 2JHNA 2NVMA 5JN5A 1P59A 2OOXA 4WZSD 1QN3A 4D7RA 1K35A 4OFEA 4YPHA 1TBPA 3T4NA 4EAJA 4HSBA 4AI5A 1MP9A 1P7MA 1HU0A 3I0WA 2DKAA 2H5AX 1PCZA 2LAEA 3S3MA 2H56A 2QREA 3PMGA 1QN8A 3OYKA 3NNQA 1KYDA 1VTOA 1QNEA 1PU8A 5BMPA 3L2UA 2YG8A 1YTBA 3I0XA 4PY5A 1K2YX 4E7LA 4EAKA 4EALA 4BDZA 1V5SA 4WX8A 3OYFA 4ZTFA 3G0QA 1PU6A 2FKFA 1NH2A 4B22A 1LWVA 1B9KA 3OH9A 5BMNA 1EUVA 4MRQA 1KG4A 3IHOA 1YQKA 4BE1A 3DPUA 3VW4A 2PWWA 1KEAA 1N39A 5KN9A 2DKDA 2IV9A 2NOEA 1KFQA 1MUYA 2OFKA 1QN7A 4YOQA 3OYJA 4HJHA 2OOYA 4DULA 2JG6A 3OYNA 1DIZA 1TGHA 5IYDP 4BJUA 1Q9UA 3OSEA 2O3OA 3OSMA 1PVSA 5EPCA 1T6AA 2VJ0A 2W04A 1C47A 1KO9A 1MUNA 4EJYA 1KG2A 3FHFA 3CVSA 5JMVD 3N5NX 1PCJX 4ROEB 2NOHA 3L2VA 1UT4A 2NLVA 1QN4A 3OS0A 4EJZA 1WQAA 2D0AA 4NZGA 4EAGA 3TE5A 1NVPA 4B24A 2D0CA 5CHZA 3N0UA 3OC3C 2IV8A 4E7IA 3R2XC 2V9JA 1U84A 3OY9A 1J3MA 1UT7A 2R5XA 1KG7A 1N3AA 3CWAA 1WEFA 1UL7A 2YG9A 1CDWA 3S6IA 3EIKA 1W80A 3CW7A 3DPTA 3OYDA 4IL8A 1KFIA 3IH7A 2FGTA 2NOZA 3ULXA 3OS1A 1MUDA 4C7PA 2JPIA 2QRCA 3CWSA 3OYGA 1YQLA 4CFFA 2MZ8A 2JHJA 1QTPA 3KNTA 4EVVA 2F7LA 5IYCP 1QTSA 2Y8LA 1PU7A 3LCNA 1JFIC 1XSZA 4RODB 2JPSA 2Y8QA 3HS9A 2NOIA 2XHIA 2FKMX 3OSTA 3OYBA 1LWYA 3F0ZA 4E9GA 1P5GX 5FROA 2JOIA 1WEGA 3L2RA 3L2WA 3EAYA 2Z8UA
chains in the Genus database with same CATH topology
3FHGA 4AI4A 1PVSA 3FSPA 4OFEA 4YPHA 4OFHA 4B23A 1ORNA 1ORPA 3OH6A 3F10A 1LWWA 1KO9A 4HSBA 1MUNA 1VRLA 1XQOA 4EJYA 1WEIA 1KG2A 2ABKA 3FHFA 3CVSA 4AI5A 3N5NX 3KTUA 1P7MA 1HU0A 2NOHA 3I0WA 4EJZA 2H56A 1XQPA 4UNFA 4B24A 1KG5A 5CHZA 4EA4A 3N0UA 1PU8A 4E9EA 3OGDA 4E9HA 1LMZA 1FN7A 2YG8A 3CWUA 1KG7A 4E9FA 1M3QA 2NOLA 1N3AA 3I0XA 3CWAA 1WEFA 1MPGA 2YG9A 3S6IA 2I5WA 3CWTA 3CW7A 4PIIA 1KG3A 1NGNA 3IH7A 2OFIA 3G0QA 2NOZA 1PU6A 4B22A 1LWVA 3OH9A 1MUDA 5KN8A 4AIAA 3CWSA 4B21A 1YQLA 1KG4A 4YPRA 1YQMA 3IHOA 4EW4A 1YQKA 2JHJA 3KNTA 1YQRA 4EVVA 5AN4A 1KQJA 4OFAA 3CVTA 1KEAA 1N3CA 4UOBA 1N39A 1XG7A 5KN9A 4EW0A 1PU7A 1RRQA 1NKUA 2NOFA 2NOEA 1MUYA 2OFKA 1EBMA 4YOQA 1KG6A 3D4VA 4EA5A 2NOIA 4DK9A 2XHIA 1RRSA 2JG6A 1LWYA 2NOBA 3F0ZA 1M3HA 4E9GA 1DIZA 2JHNA 5DPKA 1P59A 1WEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHG A;  4AI4 A;  1PVS A;  3FSP A;  4OFE A;  4YPH A;  4OFH A;  4B23 A;  1ORN A;  1ORP A;  3OH6 A;  3F10 A;  1LWW A;  1KO9 A;  4HSB A;  1MUN A;  1VRL A;  1XQO A;  4EJY A;  1WEI A;  1KG2 A;  2ABK A;  3FHF A;  3CVS A;  4AI5 A;  3N5N X;  3KTU A;  1P7M A;  1HU0 A;  2NOH A;  3I0W A;  4EJZ A;  2H56 A;  1XQP A;  4UNF A;  4B24 A;  1KG5 A;  5CHZ A;  4EA4 A;  3N0U A;  1PU8 A;  4E9E A;  3OGD A;  4E9H A;  1LMZ A;  1FN7 A;  2YG8 A;  3CWU A;  1KG7 A;  4E9F A;  1M3Q A;  2NOL A;  1N3A A;  3I0X A;  3CWA A;  1WEF A;  1MPG A;  2YG9 A;  3S6I A;  2I5W A;  3CWT A;  3CW7 A;  4PII A;  1KG3 A;  1NGN A;  3IH7 A;  2OFI A;  3G0Q A;  2NOZ A;  1PU6 A;  4B22 A;  1LWV A;  3OH9 A;  1MUD A;  5KN8 A;  4AIA A;  3CWS A;  4B21 A;  1YQL A;  1KG4 A;  4YPR A;  1YQM A;  3IHO A;  4EW4 A;  1YQK A;  2JHJ A;  3KNT A;  1YQR A;  4EVV A;  5AN4 A;  1KQJ A;  4OFA A;  3CVT A;  1KEA A;  1N3C A;  4UOB A;  1N39 A;  1XG7 A;  5KN9 A;  4EW0 A;  1PU7 A;  1RRQ A;  1NKU A;  2NOF A;  2NOE A;  1MUY A;  2OFK A;  1EBM A;  4YOQ A;  1KG6 A;  3D4V A;  4EA5 A;  2NOI A;  4DK9 A;  2XHI A;  1RRS A;  2JG6 A;  1LWY A;  2NOB A;  3F0Z A;  1M3H A;  4E9G A;  1DIZ A;  2JHN A;  5DPK A;  1P59 A;  1WEG A; 
#chains in the Genus database with same CATH topology
 4AI4 A;  1P5D X;  3FSP A;  3RSM A;  2HL9 A;  5IYB P;  4OFH A;  4B0A A;  1ORN A;  3OH6 A;  4E7J A;  1LWW A;  5F9C A;  1PCM X;  1WEI A;  2V75 A;  1TBA B;  1KY6 A;  1LXT A;  4BDY A;  2QLV A;  1JDY A;  2QR1 A;  4UNF A;  3I3W A;  2D0B A;  3D7Q A;  4EA4 A;  4E7K A;  3OLP A;  4E7H A;  1RM1 A;  1D3U A;  1C9B B;  3RPJ A;  3BKQ X;  4E9E A;  3OGD A;  4E9H A;  1FN7 A;  3CWU A;  2W03 A;  4EAI A;  2DKC A;  1M3Q A;  3VN5 A;  1MPG A;  1QNC A;  2I5W A;  3CWT A;  3OYH A;  4PII A;  1KG3 A;  1NGN A;  1VOK A;  2OFI A;  2V8Q A;  1E42 A;  4IKF A;  2Z0F A;  1AIS A;  1C4G A;  4QG5 A;  4WXA A;  4B21 A;  4YPR A;  1YQM A;  4EW4 A;  1KYU A;  2V92 A;  5HSH A;  1KQJ A;  3CVT A;  1NGM A;  1VTL E;  2YH5 A;  3L2Q A;  1N3C A;  4UOB A;  3NA5 A;  3HS8 A;  1XG7 A;  1VKL A;  4EW0 A;  1NKU A;  2NOF A;  4BE2 A;  2G30 A;  3S3O A;  3D4V A;  2YA3 A;  4DK9 A;  1RRS A;  4ZTJ A;  2NOB A;  3UW2 A;  5DPK A;  1KY7 A;  2H4L X;  3FHG A;  1KYF A;  3OYE A;  4B23 A;  1WJW A;  2ZFD B;  1ORP A;  3SNS A;  3F10 A;  1TUO A;  1VRL A;  1XQO A;  2ABK A;  3KTU A;  3PDK A;  2HL8 A;  4Q11 A;  4TPS A;  1PZD A;  3OCI A;  3KRM A;  1R4X A;  1XQP A;  1KG5 A;  3TDH A;  3OYI A;  1QNA A;  1LMZ A;  3OYL A;  4E9F A;  4D7Q A;  4ROC B;  2NOL A;  3OYC A;  3OYM A;  2EHB D;  4I8O A;  2HKP A;  3S3N A;  3C04 A;  1M5Q 1;  3ENC A;  1QNB A;  3H1Z A;  1QN9 A;  3N89 A;  5KN8 A;  5KL0 A;  5FRM A;  4AIA A;  5FRN A;  3ASM A;  3OS2 A;  2NWV A;  1YQR A;  5AN4 A;  4OFA A;  1YTF A;  2HZM A;  2QRD A;  1QN6 A;  2MJ7 A;  4BAC A;  1RRQ A;  3ENO C;  2FUV A;  1EBM A;  4BE0 A;  1KG6 A;  4EA5 A;  3OYA A;  1QN5 A;  2HZS A;  1M3H A;  1VOL B;  2JHN A;  2NVM A;  5JN5 A;  1P59 A;  2OOX A;  4WZS D;  1QN3 A;  4D7R A;  1K35 A;  4OFE A;  4YPH A;  1TBP A;  3T4N A;  4EAJ A;  4HSB A;  4AI5 A;  1MP9 A;  1P7M A;  1HU0 A;  3I0W A;  2DKA A;  2H5A X;  1PCZ A;  2LAE A;  3S3M A;  2H56 A;  2QRE A;  3PMG A;  1QN8 A;  3OYK A;  3NNQ A;  1KYD A;  1VTO A;  1QNE A;  1PU8 A;  5BMP A;  3L2U A;  2YG8 A;  1YTB A;  3I0X A;  4PY5 A;  1K2Y X;  4E7L A;  4EAK A;  4EAL A;  4BDZ A;  1V5S A;  4WX8 A;  3OYF A;  4ZTF A;  3G0Q A;  1PU6 A;  2FKF A;  1NH2 A;  4B22 A;  1LWV A;  1B9K A;  3OH9 A;  5BMN A;  1EUV A;  4MRQ A;  1KG4 A;  3IHO A;  1YQK A;  4BE1 A;  3DPU A;  3VW4 A;  2PWW A;  1KEA A;  1N39 A;  5KN9 A;  2DKD A;  2IV9 A;  2NOE A;  1KFQ A;  1MUY A;  2OFK A;  1QN7 A;  4YOQ A;  3OYJ A;  4HJH A;  2OOY A;  4DUL A;  2JG6 A;  3OYN A;  1DIZ A;  1TGH A;  5IYD P;  4BJU A;  1Q9U A;  3OSE A;  2O3O A;  3OSM A;  1PVS A;  5EPC A;  1T6A A;  2VJ0 A;  2W04 A;  1C47 A;  1KO9 A;  1MUN A;  4EJY A;  1KG2 A;  3FHF A;  3CVS A;  5JMV D;  3N5N X;  1PCJ X;  4ROE B;  2NOH A;  3L2V A;  1UT4 A;  2NLV A;  1QN4 A;  3OS0 A;  4EJZ A;  1WQA A;  2D0A A;  4NZG A;  4EAG A;  3TE5 A;  1NVP A;  4B24 A;  2D0C A;  5CHZ A;  3N0U A;  3OC3 C;  2IV8 A;  4E7I A;  3R2X C;  2V9J A;  1U84 A;  3OY9 A;  1J3M A;  1UT7 A;  2R5X A;  1KG7 A;  1N3A A;  3CWA A;  1WEF A;  1UL7 A;  2YG9 A;  1CDW A;  3S6I A;  3EIK A;  1W80 A;  3CW7 A;  3DPT A;  3OYD A;  4IL8 A;  1KFI A;  3IH7 A;  2FGT A;  2NOZ A;  3ULX A;  3OS1 A;  1MUD A;  4C7P A;  2JPI A;  2QRC A;  3CWS A;  3OYG A;  1YQL A;  4CFF A;  2MZ8 A;  2JHJ A;  1QTP A;  3KNT A;  4EVV A;  2F7L A;  5IYC P;  1QTS A;  2Y8L A;  1PU7 A;  3LCN A;  1JFI C;  1XSZ A;  4ROD B;  2JPS A;  2Y8Q A;  3HS9 A;  2NOI A;  2XHI A;  2FKM X;  3OST A;  3OYB A;  1LWY A;  3F0Z A;  4E9G A;  1P5G X;  5FRO A;  2JOI A;  1WEG A;  3L2R A;  3L2W A;  3EAY A;  2Z8U A; 
#chains in the Genus database with same CATH homology
 3FHG A;  4AI4 A;  1PVS A;  3FSP A;  4OFE A;  4YPH A;  4OFH A;  4B23 A;  1ORN A;  1ORP A;  3OH6 A;  3F10 A;  1LWW A;  1KO9 A;  4HSB A;  1MUN A;  1VRL A;  1XQO A;  4EJY A;  1WEI A;  1KG2 A;  2ABK A;  3FHF A;  3CVS A;  4AI5 A;  3N5N X;  3KTU A;  1P7M A;  1HU0 A;  2NOH A;  3I0W A;  4EJZ A;  2H56 A;  1XQP A;  4UNF A;  4B24 A;  1KG5 A;  5CHZ A;  4EA4 A;  3N0U A;  1PU8 A;  4E9E A;  3OGD A;  4E9H A;  1LMZ A;  1FN7 A;  2YG8 A;  3CWU A;  1KG7 A;  4E9F A;  1M3Q A;  2NOL A;  1N3A A;  3I0X A;  3CWA A;  1WEF A;  1MPG A;  2YG9 A;  3S6I A;  2I5W A;  3CWT A;  3CW7 A;  4PII A;  1KG3 A;  1NGN A;  3IH7 A;  2OFI A;  3G0Q A;  2NOZ A;  1PU6 A;  4B22 A;  1LWV A;  3OH9 A;  1MUD A;  5KN8 A;  4AIA A;  3CWS A;  4B21 A;  1YQL A;  1KG4 A;  4YPR A;  1YQM A;  3IHO A;  4EW4 A;  1YQK A;  2JHJ A;  3KNT A;  1YQR A;  4EVV A;  5AN4 A;  1KQJ A;  4OFA A;  3CVT A;  1KEA A;  1N3C A;  4UOB A;  1N39 A;  1XG7 A;  5KN9 A;  4EW0 A;  1PU7 A;  1RRQ A;  1NKU A;  2NOF A;  2NOE A;  1MUY A;  2OFK A;  1EBM A;  4YOQ A;  1KG6 A;  3D4V A;  4EA5 A;  2NOI A;  4DK9 A;  2XHI A;  1RRS A;  2JG6 A;  1LWY A;  2NOB A;  3F0Z A;  1M3H A;  4E9G A;  1DIZ A;  2JHN A;  5DPK A;  1P59 A;  1WEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...