3CVTA

Crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cvtA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cvtA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cvtA01
1ORPA 4YPRA 4E9FA 2XHIA 1N3CA 1M3QA 3D4VA 2YG8A 2NOZA 2OFIA 4EW0A 1N3AA 3CVTA 2JHJA 1RRQA 2OFKA 1YQRA 2NOBA 1NKUA 1P59A 5AN4A 4B23A 3CWUA 1XQOA 4EA4A 4EA5A 5KN8A 3CWSA 1YQLA 4UOBA 2NOLA 3KTUA 1M3HA 4EJYA 5DPKA 1VRLA 1KG6A 1PU8A 3IHOA 4B21A 1EBMA 1WEIA 1P7MA 2NOFA 4OFHA 3G0QA 4OFAA 4B24A 2ABKA 1N39A 2JHNA 1XQPA 4AIAA 2NOEA 4AI5A 3OH9A 4YOQA 1KG5A 2NOHA 5CHZA 1PU6A 3F10A 1ORNA 2YG9A 3CWTA 4B22A 3CVSA 4E9EA 1RRSA 1WEGA 2JG6A 1PU7A 3I0XA 3CW7A 3FHFA 4UNFA 1MPGA 1YQKA 5KN9A 3IH7A 3FSPA 3KNTA 3F0ZA 1KO9A 4DK9A 1LWYA 1MUNA 1FN7A 1KEAA 1KG7A 3N5NX 1NGNA 1XG7A 3OGDA 3I0WA 4E9GA 1PVSA 3CWAA 2NOIA 3OH6A 1YQMA 1LWWA 4EJZA 4EVVA 1LWVA 1HU0A 1MUDA 1MUYA 1KG3A 1WEFA 1KQJA 1LMZA 1DIZA 1KG2A 1KG4A 3FHGA 4PIIA 2H56A 4YPHA 4E9HA 4HSBA 4EW4A 3S6IA 3N0UA 4OFEA 2I5WA 4AI4A
chains in the Genus database with same CATH superfamily
2OOYA 2MJ7A 3OSMA 4WXAA 2ZFDB 4BE1A 1M3QA 2YG8A 3OYIA 2QRDA 3CVTA 3OYDA 4BACA 3L2UA 1P5GX 3DPUA 1RRQA 4WX8A 2NOBA 1R4XA 2QREA 4B23A 3CWUA 3PDKA 1YQLA 3OYHA 2HZSA 4ZTFA 1JDYA 1WQAA 5F9CA 2NOLA 2VJ0A 4B21A 1EBMA 5IYBP 1D3UA 1QN3A 4OFHA 4OFAA 3OS0A 2JOIA 1PZDA 4DULA 4AIAA 2NVMA 4B0AA 4AI5A 2R5XA 1KG5A 4ZTJA 4IL8A 2V8QA 1P5DX 3LCNA 2D0BA 5FRMA 3I0XA 3CW7A 3OYGA 3EAYA 1KFIA 1YTFA 1QNBA 2V75A 3IH7A 3FSPA 2Y8QA 1VTOA 4DK9A 3N89A 1KEAA 3N5NX 2JPIA 1XG7A 3OGDA 2QLVA 3BKQX 2F7LA 2NOIA 1QN6A 3OH6A 1YQMA 1KFQA 4BDYA 5EPCA 1VOKA 1NH2A 1TGHA 2IV8A 1C4GA 1QN4A 1MUYA 3OYBA 3C04A 4EALA 1KQJA 1DIZA 4E7KA 1LXTA 1C47A 1KG2A 4PIIA 4YPHA 1TUOA 4EW4A 1XSZA 3N0UA 3HS9A 3KRMA 3OS1A 2XHIA 1QTSA 1JFIC 5JMVD 2NOZA 2OFIA 1EUVA 3ULXA 5IYCP 2W03A 3OSEA 3OY9A 3S3NA 1NKUA 1QN9A 5AN4A 4EA4A 1KY6A 1AISA 3H1ZA 3OS2A 3SNSA 4E7JA 3OYCA 2H5AX 2EHBD 4HJHA 2D0AA 2V9JA 3KTUA 4EJYA 3L2VA 1B9KA 3R2XC 3G0QA 4MRQA 2ABKA 1RM1A 5FRNA 1QNCA 2Z0FA 1UL7A 4D7QA 2NOHA 3F10A 1ORNA 5FROA 4NZGA 1YTBA 1RRSA 1WEGA 1PU7A 3VW4A 3FHFA 1YQKA 3KNTA 2PWWA 3F0ZA 3OSTA 1LWYA 1MUNA 1FN7A 5KL0A 5IYDP 3OYAA 3ENOC 3I0WA 1W80A 1PVSA 3OLPA 2Y8LA 1HU0A 4Q11A 2IV9A 5BMNA 1VOLB 2G30A 1KG3A 3NNQA 2H4LX 1UT4A 1U84A 1KYUA 1KG4A 3FHGA 1V5SA 2DKDA 4HSBA 4BDZA 3OYLA 4AI4A 4YPRA 4E9FA 3TDHA 3S3MA 1N3CA 3D4VA 4EW0A 2DKCA 4E7IA 1CDWA 3RSMA 2JHJA 2OFKA 1QTPA 3T4NA 1PCZA 2QRCA 2YH5A 1KYFA 2OOXA 2HZMA 1XQOA 4EA5A 1VKLA 2D0CA 5KN8A 2HKPA 4WZSD 4UOBA 3VN5A 3OYKA 3OYMA 3IHOA 1PU8A 3OYEA 1P7MA 3PMGA 4B24A 5HSHA 1NGMA 1QN7A 2YA3A 2DKAA 4D7RA 3NA5A 1E42A 4E7HA 4YOQA 1M5Q1 3TE5A 5BMPA 5CHZA 1PU6A 3OYNA 3L2WA 2YG9A 3CWTA 4B22A 3CVSA 4E9EA 2JG6A 1C9BB 4UNFA 3L2QA 1MPGA 4RODB 5KN9A 3ASMA 1K35A 1K2YX 1NGNA 2Z8UA 4TPSA 2HL9A 5JN5A 3CWAA 2FGTA 4EJZA 1TBPA 2QR1A 4EVVA 4EAJA 4EAKA 1LWVA 2FUVA 2V92A 1MUDA 1QNEA 1LMZA 1TBAB 4QG5A 3HS8A 4ROEB 2H56A 3S3OA 4E9HA 3S6IA 4OFEA 1ORPA 1WJWA 2FKMX 4BE2A 1QNAA 2HL8A 3OC3C 1KY7A 1N3AA 3OYFA 1UT7A 1YQRA 3D7QA 3UW2A 1P59A 3CWSA 3OCIA 3L2RA 1PCJX 2FKFA 1M3HA 5DPKA 1VRLA 1KG6A 1VTLE 1WEIA 2NOFA 4BE0A 4C7PA 3ENCA 1MP9A 1N39A 4EAGA 4CFFA 2JHNA 1XQPA 2NOEA 2NLVA 1Q9UA 3OH9A 3OYJA 1PCMX 2JPSA 1QN8A 1T6AA 3I3WA 3EIKA 1KO9A 1KG7A 1QN5A 4E9GA 3DPTA 1KYDA 1LWWA 2NWVA 3RPJA 1NVPA 2W04A 4PY5A 4EAIA 1J3MA 2LAEA 4IKFA 1WEFA 2MZ8A 4ROCB 2O3OA 4I8OA 4BJUA 4E7LA 2I5WA
chains in the Genus database with same CATH topology
1ORPA 4YPRA 4E9FA 2XHIA 1N3CA 1M3QA 3D4VA 2YG8A 2NOZA 2OFIA 4EW0A 1N3AA 3CVTA 2JHJA 1RRQA 2OFKA 1YQRA 2NOBA 1NKUA 1P59A 5AN4A 4B23A 3CWUA 1XQOA 4EA4A 4EA5A 5KN8A 3CWSA 1YQLA 4UOBA 2NOLA 3KTUA 1M3HA 4EJYA 5DPKA 1VRLA 1KG6A 1PU8A 3IHOA 4B21A 1EBMA 1WEIA 1P7MA 2NOFA 4OFHA 3G0QA 4OFAA 4B24A 2ABKA 1N39A 2JHNA 1XQPA 4AIAA 2NOEA 4AI5A 3OH9A 4YOQA 1KG5A 2NOHA 5CHZA 1PU6A 3F10A 1ORNA 2YG9A 3CWTA 4B22A 3CVSA 4E9EA 1RRSA 1WEGA 2JG6A 1PU7A 3I0XA 3CW7A 3FHFA 4UNFA 1MPGA 1YQKA 5KN9A 3IH7A 3FSPA 3KNTA 3F0ZA 1KO9A 4DK9A 1LWYA 1MUNA 1FN7A 1KEAA 1KG7A 3N5NX 1NGNA 1XG7A 3OGDA 3I0WA 4E9GA 1PVSA 3CWAA 2NOIA 3OH6A 1YQMA 1LWWA 4EJZA 4EVVA 1LWVA 1HU0A 1MUDA 1MUYA 1KG3A 1WEFA 1KQJA 1LMZA 1DIZA 1KG2A 1KG4A 3FHGA 4PIIA 2H56A 4YPHA 4E9HA 4HSBA 4EW4A 3S6IA 3N0UA 4OFEA 2I5WA 4AI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORP A;  4YPR A;  4E9F A;  2XHI A;  1N3C A;  1M3Q A;  3D4V A;  2YG8 A;  2NOZ A;  2OFI A;  4EW0 A;  1N3A A;  3CVT A;  2JHJ A;  1RRQ A;  2OFK A;  1YQR A;  2NOB A;  1NKU A;  1P59 A;  5AN4 A;  4B23 A;  3CWU A;  1XQO A;  4EA4 A;  4EA5 A;  5KN8 A;  3CWS A;  1YQL A;  4UOB A;  2NOL A;  3KTU A;  1M3H A;  4EJY A;  5DPK A;  1VRL A;  1KG6 A;  1PU8 A;  3IHO A;  4B21 A;  1EBM A;  1WEI A;  1P7M A;  2NOF A;  4OFH A;  3G0Q A;  4OFA A;  4B24 A;  2ABK A;  1N39 A;  2JHN A;  1XQP A;  4AIA A;  2NOE A;  4AI5 A;  3OH9 A;  4YOQ A;  1KG5 A;  2NOH A;  5CHZ A;  1PU6 A;  3F10 A;  1ORN A;  2YG9 A;  3CWT A;  4B22 A;  3CVS A;  4E9E A;  1RRS A;  1WEG A;  2JG6 A;  1PU7 A;  3I0X A;  3CW7 A;  3FHF A;  4UNF A;  1MPG A;  1YQK A;  5KN9 A;  3IH7 A;  3FSP A;  3KNT A;  3F0Z A;  1KO9 A;  4DK9 A;  1LWY A;  1MUN A;  1FN7 A;  1KEA A;  1KG7 A;  3N5N X;  1NGN A;  1XG7 A;  3OGD A;  3I0W A;  4E9G A;  1PVS A;  3CWA A;  2NOI A;  3OH6 A;  1YQM A;  1LWW A;  4EJZ A;  4EVV A;  1LWV A;  1HU0 A;  1MUD A;  1MUY A;  1KG3 A;  1WEF A;  1KQJ A;  1LMZ A;  1DIZ A;  1KG2 A;  1KG4 A;  3FHG A;  4PII A;  2H56 A;  4YPH A;  4E9H A;  4HSB A;  4EW4 A;  3S6I A;  3N0U A;  4OFE A;  2I5W A;  4AI4 A; 
#chains in the Genus database with same CATH topology
 2OOY A;  2MJ7 A;  3OSM A;  4WXA A;  2ZFD B;  4BE1 A;  1M3Q A;  2YG8 A;  3OYI A;  2QRD A;  3CVT A;  3OYD A;  4BAC A;  3L2U A;  1P5G X;  3DPU A;  1RRQ A;  4WX8 A;  2NOB A;  1R4X A;  2QRE A;  4B23 A;  3CWU A;  3PDK A;  1YQL A;  3OYH A;  2HZS A;  4ZTF A;  1JDY A;  1WQA A;  5F9C A;  2NOL A;  2VJ0 A;  4B21 A;  1EBM A;  5IYB P;  1D3U A;  1QN3 A;  4OFH A;  4OFA A;  3OS0 A;  2JOI A;  1PZD A;  4DUL A;  4AIA A;  2NVM A;  4B0A A;  4AI5 A;  2R5X A;  1KG5 A;  4ZTJ A;  4IL8 A;  2V8Q A;  1P5D X;  3LCN A;  2D0B A;  5FRM A;  3I0X A;  3CW7 A;  3OYG A;  3EAY A;  1KFI A;  1YTF A;  1QNB A;  2V75 A;  3IH7 A;  3FSP A;  2Y8Q A;  1VTO A;  4DK9 A;  3N89 A;  1KEA A;  3N5N X;  2JPI A;  1XG7 A;  3OGD A;  2QLV A;  3BKQ X;  2F7L A;  2NOI A;  1QN6 A;  3OH6 A;  1YQM A;  1KFQ A;  4BDY A;  5EPC A;  1VOK A;  1NH2 A;  1TGH A;  2IV8 A;  1C4G A;  1QN4 A;  1MUY A;  3OYB A;  3C04 A;  4EAL A;  1KQJ A;  1DIZ A;  4E7K A;  1LXT A;  1C47 A;  1KG2 A;  4PII A;  4YPH A;  1TUO A;  4EW4 A;  1XSZ A;  3N0U A;  3HS9 A;  3KRM A;  3OS1 A;  2XHI A;  1QTS A;  1JFI C;  5JMV D;  2NOZ A;  2OFI A;  1EUV A;  3ULX A;  5IYC P;  2W03 A;  3OSE A;  3OY9 A;  3S3N A;  1NKU A;  1QN9 A;  5AN4 A;  4EA4 A;  1KY6 A;  1AIS A;  3H1Z A;  3OS2 A;  3SNS A;  4E7J A;  3OYC A;  2H5A X;  2EHB D;  4HJH A;  2D0A A;  2V9J A;  3KTU A;  4EJY A;  3L2V A;  1B9K A;  3R2X C;  3G0Q A;  4MRQ A;  2ABK A;  1RM1 A;  5FRN A;  1QNC A;  2Z0F A;  1UL7 A;  4D7Q A;  2NOH A;  3F10 A;  1ORN A;  5FRO A;  4NZG A;  1YTB A;  1RRS A;  1WEG A;  1PU7 A;  3VW4 A;  3FHF A;  1YQK A;  3KNT A;  2PWW A;  3F0Z A;  3OST A;  1LWY A;  1MUN A;  1FN7 A;  5KL0 A;  5IYD P;  3OYA A;  3ENO C;  3I0W A;  1W80 A;  1PVS A;  3OLP A;  2Y8L A;  1HU0 A;  4Q11 A;  2IV9 A;  5BMN A;  1VOL B;  2G30 A;  1KG3 A;  3NNQ A;  2H4L X;  1UT4 A;  1U84 A;  1KYU A;  1KG4 A;  3FHG A;  1V5S A;  2DKD A;  4HSB A;  4BDZ A;  3OYL A;  4AI4 A;  4YPR A;  4E9F A;  3TDH A;  3S3M A;  1N3C A;  3D4V A;  4EW0 A;  2DKC A;  4E7I A;  1CDW A;  3RSM A;  2JHJ A;  2OFK A;  1QTP A;  3T4N A;  1PCZ A;  2QRC A;  2YH5 A;  1KYF A;  2OOX A;  2HZM A;  1XQO A;  4EA5 A;  1VKL A;  2D0C A;  5KN8 A;  2HKP A;  4WZS D;  4UOB A;  3VN5 A;  3OYK A;  3OYM A;  3IHO A;  1PU8 A;  3OYE A;  1P7M A;  3PMG A;  4B24 A;  5HSH A;  1NGM A;  1QN7 A;  2YA3 A;  2DKA A;  4D7R A;  3NA5 A;  1E42 A;  4E7H A;  4YOQ A;  1M5Q 1;  3TE5 A;  5BMP A;  5CHZ A;  1PU6 A;  3OYN A;  3L2W A;  2YG9 A;  3CWT A;  4B22 A;  3CVS A;  4E9E A;  2JG6 A;  1C9B B;  4UNF A;  3L2Q A;  1MPG A;  4ROD B;  5KN9 A;  3ASM A;  1K35 A;  1K2Y X;  1NGN A;  2Z8U A;  4TPS A;  2HL9 A;  5JN5 A;  3CWA A;  2FGT A;  4EJZ A;  1TBP A;  2QR1 A;  4EVV A;  4EAJ A;  4EAK A;  1LWV A;  2FUV A;  2V92 A;  1MUD A;  1QNE A;  1LMZ A;  1TBA B;  4QG5 A;  3HS8 A;  4ROE B;  2H56 A;  3S3O A;  4E9H A;  3S6I A;  4OFE A;  1ORP A;  1WJW A;  2FKM X;  4BE2 A;  1QNA A;  2HL8 A;  3OC3 C;  1KY7 A;  1N3A A;  3OYF A;  1UT7 A;  1YQR A;  3D7Q A;  3UW2 A;  1P59 A;  3CWS A;  3OCI A;  3L2R A;  1PCJ X;  2FKF A;  1M3H A;  5DPK A;  1VRL A;  1KG6 A;  1VTL E;  1WEI A;  2NOF A;  4BE0 A;  4C7P A;  3ENC A;  1MP9 A;  1N39 A;  4EAG A;  4CFF A;  2JHN A;  1XQP A;  2NOE A;  2NLV A;  1Q9U A;  3OH9 A;  3OYJ A;  1PCM X;  2JPS A;  1QN8 A;  1T6A A;  3I3W A;  3EIK A;  1KO9 A;  1KG7 A;  1QN5 A;  4E9G A;  3DPT A;  1KYD A;  1LWW A;  2NWV A;  3RPJ A;  1NVP A;  2W04 A;  4PY5 A;  4EAI A;  1J3M A;  2LAE A;  4IKF A;  1WEF A;  2MZ8 A;  4ROC B;  2O3O A;  4I8O A;  4BJU A;  4E7L A;  2I5W A; 
#chains in the Genus database with same CATH homology
 1ORP A;  4YPR A;  4E9F A;  2XHI A;  1N3C A;  1M3Q A;  3D4V A;  2YG8 A;  2NOZ A;  2OFI A;  4EW0 A;  1N3A A;  3CVT A;  2JHJ A;  1RRQ A;  2OFK A;  1YQR A;  2NOB A;  1NKU A;  1P59 A;  5AN4 A;  4B23 A;  3CWU A;  1XQO A;  4EA4 A;  4EA5 A;  5KN8 A;  3CWS A;  1YQL A;  4UOB A;  2NOL A;  3KTU A;  1M3H A;  4EJY A;  5DPK A;  1VRL A;  1KG6 A;  1PU8 A;  3IHO A;  4B21 A;  1EBM A;  1WEI A;  1P7M A;  2NOF A;  4OFH A;  3G0Q A;  4OFA A;  4B24 A;  2ABK A;  1N39 A;  2JHN A;  1XQP A;  4AIA A;  2NOE A;  4AI5 A;  3OH9 A;  4YOQ A;  1KG5 A;  2NOH A;  5CHZ A;  1PU6 A;  3F10 A;  1ORN A;  2YG9 A;  3CWT A;  4B22 A;  3CVS A;  4E9E A;  1RRS A;  1WEG A;  2JG6 A;  1PU7 A;  3I0X A;  3CW7 A;  3FHF A;  4UNF A;  1MPG A;  1YQK A;  5KN9 A;  3IH7 A;  3FSP A;  3KNT A;  3F0Z A;  1KO9 A;  4DK9 A;  1LWY A;  1MUN A;  1FN7 A;  1KEA A;  1KG7 A;  3N5N X;  1NGN A;  1XG7 A;  3OGD A;  3I0W A;  4E9G A;  1PVS A;  3CWA A;  2NOI A;  3OH6 A;  1YQM A;  1LWW A;  4EJZ A;  4EVV A;  1LWV A;  1HU0 A;  1MUD A;  1MUY A;  1KG3 A;  1WEF A;  1KQJ A;  1LMZ A;  1DIZ A;  1KG2 A;  1KG4 A;  3FHG A;  4PII A;  2H56 A;  4YPH A;  4E9H A;  4HSB A;  4EW4 A;  3S6I A;  3N0U A;  4OFE A;  2I5W A;  4AI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...