3F0ZA

Crystal structure of clostridium acetobutylicum 8-oxoguanine glycosylase/lyase in its apo-form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
285
structure length
285
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPKVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8-oxoguanine-DNA-glycosylase
publication title Structural characterization of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase in its apo form and in complex with 8-oxodeoxyguanosine.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase, lyase
total genus 99
structure length 285
sequence length 285
ec nomenclature ec 3.2.2.-:
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3f0zA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3f0zA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3f0zA01
1MUYA 4UNFA 5KN8A 1HU0A 4EJYA 5CHZA 1NGNA 3FHFA 4EVVA 1PU7A 1N3CA 1MPGA 1P7MA 1VRLA 4E9EA 3CWUA 1MUNA 2NOBA 3OH6A 3N5NX 1PVSA 4B24A 1KG3A 2ABKA 1LWVA 1LWWA 1XQOA 4EA5A 3CWSA 3N0UA 1KG6A 3OH9A 1WEIA 4E9FA 1LWYA 3F0ZA 1MUDA 1PU8A 1KG4A 1PU6A 3OGDA 4HSBA 4UOBA 1N39A 4YPHA 1M3QA 3CVSA 2OFIA 1YQRA 1ORNA 3D4VA 4OFAA 2I5WA 3FSPA 4E9HA 5AN4A 1P59A 4EW4A 3S6IA 2XHIA 4YPRA 4B21A 3F10A 2NOEA 1WEGA 3CVTA 1N3AA 4B22A 2JHJA 2YG8A 2JHNA 3KNTA 4EJZA 3CWTA 1WEFA 1YQLA 5DPKA 2NOHA 1EBMA 1KQJA 1LMZA 3FHGA 3G0QA 3I0WA 1YQMA 1KEAA 4AI4A 2NOLA 2H56A 1FN7A 1ORPA 1YQKA 3KTUA 2JG6A 3CW7A 2NOZA 1XG7A 2YG9A 4B23A 4E9GA 1DIZA 4DK9A 5KN9A 4OFEA 3CWAA 4YOQA 4AI5A 1KG2A 3I0XA 4EW0A 1KO9A 4PIIA 2NOFA 2NOIA 1XQPA 4OFHA 1NKUA 1M3HA 1RRQA 1KG5A 3IHOA 4AIAA 1KG7A 3IH7A 2OFKA 4EA4A 1RRSA
chains in the Genus database with same CATH superfamily
3OYKA 1NGNA 3FHFA 4WX8A 2V9JA 1VRLA 4E7HA 4E9EA 4NZGA 4C7PA 1MUNA 1PCZA 2NOBA 1TBAB 1WQAA 1KG3A 2ABKA 3OS1A 2Z0FA 5F9CA 1QN7A 1QN8A 4BACA 1WEIA 1LWYA 3OSTA 1MUDA 3OYHA 4HSBA 1YTBA 4E7KA 3L2WA 3NNQA 4YPHA 1M3QA 2HZMA 2W04A 3EIKA 2EHBD 4E9HA 5AN4A 4EW4A 3OS0A 2DKAA 2G30A 2QR1A 3S3NA 4ROEB 2NWVA 1NH2A 2FKMX 4B22A 2Z8UA 1AISA 1YQLA 1KYFA 5DPKA 1EBMA 1U84A 1VKLA 3FHGA 4EAJA 3G0QA 2QLVA 3LCNA 1YQKA 1UT7A 2JG6A 2YH5A 4B23A 4DK9A 3DPUA 4BJUA 3CWAA 5FROA 1RM1A 1V5SA 3OYCA 1R4XA 1KYUA 2NOFA 2NLVA 3RPJA 2HL9A 1KG5A 3IH7A 2Y8LA 2JHJA 3SNSA 5IYDP 3HS9A 1MUYA 5KN8A 3VW4A 4EJYA 1VOLB 3T4NA 1N3CA 3ULXA 1QN9A 1MPGA 1CDWA 1PCJX 3C04A 4ZTFA 4D7RA 4EA5A 1XSZA 4BE0A 5BMNA 3CWSA 1KG6A 2YA3A 3F0ZA 1WJWA 1PCMX 1JFIC 2IV8A 1EUVA 1QN6A 3OGDA 2F7LA 3BKQX 3OY9A 2OFIA 3ENOC 1YQRA 1E42A 3I3WA 1QNEA 4E7LA 1C4GA 5EPCA 2H4LX 4YPRA 2D0BA 1LXTA 2W03A 3F10A 4TPSA 2HZSA 1WEGA 1K35A 2FGTA 3UW2A 3CWTA 1WEFA 1VOKA 2O3OA 5IYCP 2HL8A 4I8OA 3I0WA 1KEAA 1KFIA 2QRDA 3PMGA 4Q11A 3KTUA 2D0CA 4BDYA 2PWWA 2OOXA 4E9GA 3D7QA 3OYLA 2OOYA 3OYBA 1KG2A 4EW0A 5JN5A 1TGHA 1D3UA 3OCIA 4BE1A 2DKCA 1XQPA 2DKDA 1TUOA 4AIAA 3L2UA 2R5XA 1C47A 3OYFA 5CHZA 4EVVA 1PU7A 1W80A 3KRMA 2IV9A 1UL7A 4WXAA 2MZ8A 1PZDA 1P7MA 1QNCA 1NGMA 2VJ0A 1KFQA 3N5NX 1PVSA 4B24A 1LWVA 3OYIA 3TDHA 3OYNA 3N0UA 2HKPA 5HSHA 4E9FA 4E7IA 1PU8A 1PU6A 5KL0A 4EALA 1C9BB 2JPSA 4B0AA 1QN4A 3ENCA 1VTLE 3D4VA 4OFAA 4ZTJA 2I5WA 3FSPA 4D7QA 3RSMA 3S6IA 2XHIA 4B21A 2JOIA 4EAIA 4ROCB 1NVPA 2NOEA 3R2XC 3CVTA 2V8QA 2QREA 1MP9A 3KNTA 4EJZA 4RODB 3OYGA 2ZFDB 1KQJA 1YQMA 4AI4A 2NOLA 2JPIA 3CW7A 4IKFA 2NOZA 3EAYA 2YG9A 5FRMA 3OS2A 5IYBP 4E7JA 4OFEA 4YOQA 5BMPA 4AI5A 3I0XA 1QN5A 4BE2A 4PIIA 3L2VA 3OYEA 4EAGA 3OYAA 4OFHA 1K2YX 1RRQA 1M5Q1 3S3MA 2FKFA 2OFKA 1RRSA 4UNFA 4DULA 1KYDA 1HU0A 1J3MA 2LAEA 3CWUA 3HS8A 2Y8QA 2V75A 1B9KA 3OH6A 3L2RA 1LWWA 1XQOA 3S3OA 1JDYA 3OH9A 4BDZA 4CFFA 1QNBA 2H5AX 1KG4A 2QRCA 3OYMA 4UOBA 3PDKA 1N39A 1KY6A 3CVSA 1P5DX 1T6AA 1ORNA 3H1ZA 2V92A 1VTOA 1P59A 2MJ7A 3ASMA 1QTPA 3NA5A 4HJHA 1N3AA 3OLPA 2YG8A 2JHNA 4IL8A 2NVMA 4PY5A 2FUVA 2NOHA 1Q9UA 5FRNA 1P5GX 3OSEA 1LMZA 1QTSA 1TBPA 2H56A 1FN7A 3DPTA 1ORPA 1QNAA 3OYJA 3TE5A 1XG7A 2D0AA 4MRQA 4EAKA 1DIZA 1UT4A 5KN9A 1QN3A 4QG5A 3OYDA 5JMVD 1YTFA 1KO9A 3N89A 2NOIA 4WZSD 3L2QA 3OC3C 3VN5A 1NKUA 1M3HA 1KY7A 3IHOA 1KG7A 4EA4A 3OSMA
chains in the Genus database with same CATH topology
3HS9A 1MUYA 4UNFA 4DULA 1KYDA 5KN8A 1HU0A 4EJYA 5CHZA 1NGNA 3FHFA 4EVVA 1VOLB 1PU7A 1W80A 3KRMA 2IV9A 2MZ8A 2LAEA 1N3CA 3ULXA 1QN9A 1MPGA 1P7MA 1VRLA 1PZDA 1CDWA 1QNCA 4E9EA 3CWUA 3HS8A 1MUNA 1PCZA 2NOBA 1NGMA 1B9KA 1TBAB 3OH6A 2VJ0A 3N5NX 1PVSA 4B24A 1KG3A 2ABKA 1LWVA 1QN7A 1LWWA 1XQOA 4EA5A 3CWSA 3N0UA 1KG6A 1QN8A 3OH9A 1WEIA 4E9FA 1LWYA 3F0ZA 3OSTA 1MUDA 1QNBA 1PU8A 1KG4A 1PU6A 1JFIC 2IV8A 1QN6A 3OGDA 4HSBA 1YTBA 4UOBA 1N39A 1C9BB 1KY6A 4B0AA 4YPHA 1M3QA 1QN4A 3CVSA 2HZMA 2OFIA 1YQRA 1E42A 3EIKA 1VTLE 1ORNA 1QNEA 3D4VA 3H1ZA 4OFAA 2I5WA 3FSPA 4E9HA 5AN4A 3OSMA 1VTOA 1P59A 4EW4A 3S6IA 2XHIA 4YPRA 4B21A 2D0BA 2JOIA 2MJ7A 3ASMA 3F10A 4ROCB 1NVPA 4TPSA 2NOEA 1QTPA 2HZSA 2G30A 1WEGA 3CVTA 2FGTA 4ROEB 1NH2A 1N3AA 4B22A 2JHJA 2YG8A 2JHNA 1MP9A 3KNTA 4EJZA 2Z8UA 3CWTA 1WEFA 4PY5A 1AISA 1YQLA 4RODB 1KYFA 1VOKA 5DPKA 2NOHA 1EBMA 1KQJA 2O3OA 1LMZA 1QTSA 3FHGA 1TBPA 5IYCP 3G0QA 4I8OA 3I0WA 1YQMA 1KEAA 4AI4A 2NOLA 2H56A 1FN7A 3DPTA 1ORPA 1QNAA 1YQKA 4Q11A 3KTUA 1UT7A 2JG6A 2D0CA 3CW7A 2NOZA 1XG7A 2YG9A 2YH5A 4B23A 2D0AA 4E9GA 1DIZA 5IYBP 1UT4A 4DK9A 5KN9A 3DPUA 4OFEA 1QN3A 3CWAA 1RM1A 4YOQA 4AI5A 1KG2A 3I0XA 4EW0A 1TGHA 1R4XA 1YTFA 1D3UA 1QN5A 1KO9A 1KYUA 3OCIA 4PIIA 3N89A 2NOFA 2NOIA 1XQPA 4WZSD 3OC3C 3RPJA 4OFHA 3VN5A 1NKUA 1M3HA 1KY7A 1RRQA 1KG5A 3IHOA 4AIAA 1KG7A 3IH7A 2OFKA 3SNSA 4EA4A 1RRSA 5IYDP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUY A;  4UNF A;  5KN8 A;  1HU0 A;  4EJY A;  5CHZ A;  1NGN A;  3FHF A;  4EVV A;  1PU7 A;  1N3C A;  1MPG A;  1P7M A;  1VRL A;  4E9E A;  3CWU A;  1MUN A;  2NOB A;  3OH6 A;  3N5N X;  1PVS A;  4B24 A;  1KG3 A;  2ABK A;  1LWV A;  1LWW A;  1XQO A;  4EA5 A;  3CWS A;  3N0U A;  1KG6 A;  3OH9 A;  1WEI A;  4E9F A;  1LWY A;  3F0Z A;  1MUD A;  1PU8 A;  1KG4 A;  1PU6 A;  3OGD A;  4HSB A;  4UOB A;  1N39 A;  4YPH A;  1M3Q A;  3CVS A;  2OFI A;  1YQR A;  1ORN A;  3D4V A;  4OFA A;  2I5W A;  3FSP A;  4E9H A;  5AN4 A;  1P59 A;  4EW4 A;  3S6I A;  2XHI A;  4YPR A;  4B21 A;  3F10 A;  2NOE A;  1WEG A;  3CVT A;  1N3A A;  4B22 A;  2JHJ A;  2YG8 A;  2JHN A;  3KNT A;  4EJZ A;  3CWT A;  1WEF A;  1YQL A;  5DPK A;  2NOH A;  1EBM A;  1KQJ A;  1LMZ A;  3FHG A;  3G0Q A;  3I0W A;  1YQM A;  1KEA A;  4AI4 A;  2NOL A;  2H56 A;  1FN7 A;  1ORP A;  1YQK A;  3KTU A;  2JG6 A;  3CW7 A;  2NOZ A;  1XG7 A;  2YG9 A;  4B23 A;  4E9G A;  1DIZ A;  4DK9 A;  5KN9 A;  4OFE A;  3CWA A;  4YOQ A;  4AI5 A;  1KG2 A;  3I0X A;  4EW0 A;  1KO9 A;  4PII A;  2NOF A;  2NOI A;  1XQP A;  4OFH A;  1NKU A;  1M3H A;  1RRQ A;  1KG5 A;  3IHO A;  4AIA A;  1KG7 A;  3IH7 A;  2OFK A;  4EA4 A;  1RRS A; 
#chains in the Genus database with same CATH topology
 3OYK A;  1NGN A;  3FHF A;  4WX8 A;  2V9J A;  1VRL A;  4E7H A;  4E9E A;  4NZG A;  4C7P A;  1MUN A;  1PCZ A;  2NOB A;  1TBA B;  1WQA A;  1KG3 A;  2ABK A;  3OS1 A;  2Z0F A;  5F9C A;  1QN7 A;  1QN8 A;  4BAC A;  1WEI A;  1LWY A;  3OST A;  1MUD A;  3OYH A;  4HSB A;  1YTB A;  4E7K A;  3L2W A;  3NNQ A;  4YPH A;  1M3Q A;  2HZM A;  2W04 A;  3EIK A;  2EHB D;  4E9H A;  5AN4 A;  4EW4 A;  3OS0 A;  2DKA A;  2G30 A;  2QR1 A;  3S3N A;  4ROE B;  2NWV A;  1NH2 A;  2FKM X;  4B22 A;  2Z8U A;  1AIS A;  1YQL A;  1KYF A;  5DPK A;  1EBM A;  1U84 A;  1VKL A;  3FHG A;  4EAJ A;  3G0Q A;  2QLV A;  3LCN A;  1YQK A;  1UT7 A;  2JG6 A;  2YH5 A;  4B23 A;  4DK9 A;  3DPU A;  4BJU A;  3CWA A;  5FRO A;  1RM1 A;  1V5S A;  3OYC A;  1R4X A;  1KYU A;  2NOF A;  2NLV A;  3RPJ A;  2HL9 A;  1KG5 A;  3IH7 A;  2Y8L A;  2JHJ A;  3SNS A;  5IYD P;  3HS9 A;  1MUY A;  5KN8 A;  3VW4 A;  4EJY A;  1VOL B;  3T4N A;  1N3C A;  3ULX A;  1QN9 A;  1MPG A;  1CDW A;  1PCJ X;  3C04 A;  4ZTF A;  4D7R A;  4EA5 A;  1XSZ A;  4BE0 A;  5BMN A;  3CWS A;  1KG6 A;  2YA3 A;  3F0Z A;  1WJW A;  1PCM X;  1JFI C;  2IV8 A;  1EUV A;  1QN6 A;  3OGD A;  2F7L A;  3BKQ X;  3OY9 A;  2OFI A;  3ENO C;  1YQR A;  1E42 A;  3I3W A;  1QNE A;  4E7L A;  1C4G A;  5EPC A;  2H4L X;  4YPR A;  2D0B A;  1LXT A;  2W03 A;  3F10 A;  4TPS A;  2HZS A;  1WEG A;  1K35 A;  2FGT A;  3UW2 A;  3CWT A;  1WEF A;  1VOK A;  2O3O A;  5IYC P;  2HL8 A;  4I8O A;  3I0W A;  1KEA A;  1KFI A;  2QRD A;  3PMG A;  4Q11 A;  3KTU A;  2D0C A;  4BDY A;  2PWW A;  2OOX A;  4E9G A;  3D7Q A;  3OYL A;  2OOY A;  3OYB A;  1KG2 A;  4EW0 A;  5JN5 A;  1TGH A;  1D3U A;  3OCI A;  4BE1 A;  2DKC A;  1XQP A;  2DKD A;  1TUO A;  4AIA A;  3L2U A;  2R5X A;  1C47 A;  3OYF A;  5CHZ A;  4EVV A;  1PU7 A;  1W80 A;  3KRM A;  2IV9 A;  1UL7 A;  4WXA A;  2MZ8 A;  1PZD A;  1P7M A;  1QNC A;  1NGM A;  2VJ0 A;  1KFQ A;  3N5N X;  1PVS A;  4B24 A;  1LWV A;  3OYI A;  3TDH A;  3OYN A;  3N0U A;  2HKP A;  5HSH A;  4E9F A;  4E7I A;  1PU8 A;  1PU6 A;  5KL0 A;  4EAL A;  1C9B B;  2JPS A;  4B0A A;  1QN4 A;  3ENC A;  1VTL E;  3D4V A;  4OFA A;  4ZTJ A;  2I5W A;  3FSP A;  4D7Q A;  3RSM A;  3S6I A;  2XHI A;  4B21 A;  2JOI A;  4EAI A;  4ROC B;  1NVP A;  2NOE A;  3R2X C;  3CVT A;  2V8Q A;  2QRE A;  1MP9 A;  3KNT A;  4EJZ A;  4ROD B;  3OYG A;  2ZFD B;  1KQJ A;  1YQM A;  4AI4 A;  2NOL A;  2JPI A;  3CW7 A;  4IKF A;  2NOZ A;  3EAY A;  2YG9 A;  5FRM A;  3OS2 A;  5IYB P;  4E7J A;  4OFE A;  4YOQ A;  5BMP A;  4AI5 A;  3I0X A;  1QN5 A;  4BE2 A;  4PII A;  3L2V A;  3OYE A;  4EAG A;  3OYA A;  4OFH A;  1K2Y X;  1RRQ A;  1M5Q 1;  3S3M A;  2FKF A;  2OFK A;  1RRS A;  4UNF A;  4DUL A;  1KYD A;  1HU0 A;  1J3M A;  2LAE A;  3CWU A;  3HS8 A;  2Y8Q A;  2V75 A;  1B9K A;  3OH6 A;  3L2R A;  1LWW A;  1XQO A;  3S3O A;  1JDY A;  3OH9 A;  4BDZ A;  4CFF A;  1QNB A;  2H5A X;  1KG4 A;  2QRC A;  3OYM A;  4UOB A;  3PDK A;  1N39 A;  1KY6 A;  3CVS A;  1P5D X;  1T6A A;  1ORN A;  3H1Z A;  2V92 A;  1VTO A;  1P59 A;  2MJ7 A;  3ASM A;  1QTP A;  3NA5 A;  4HJH A;  1N3A A;  3OLP A;  2YG8 A;  2JHN A;  4IL8 A;  2NVM A;  4PY5 A;  2FUV A;  2NOH A;  1Q9U A;  5FRN A;  1P5G X;  3OSE A;  1LMZ A;  1QTS A;  1TBP A;  2H56 A;  1FN7 A;  3DPT A;  1ORP A;  1QNA A;  3OYJ A;  3TE5 A;  1XG7 A;  2D0A A;  4MRQ A;  4EAK A;  1DIZ A;  1UT4 A;  5KN9 A;  1QN3 A;  4QG5 A;  3OYD A;  5JMV D;  1YTF A;  1KO9 A;  3N89 A;  2NOI A;  4WZS D;  3L2Q A;  3OC3 C;  3VN5 A;  1NKU A;  1M3H A;  1KY7 A;  3IHO A;  1KG7 A;  4EA4 A;  3OSM A; 
#chains in the Genus database with same CATH homology
 3HS9 A;  1MUY A;  4UNF A;  4DUL A;  1KYD A;  5KN8 A;  1HU0 A;  4EJY A;  5CHZ A;  1NGN A;  3FHF A;  4EVV A;  1VOL B;  1PU7 A;  1W80 A;  3KRM A;  2IV9 A;  2MZ8 A;  2LAE A;  1N3C A;  3ULX A;  1QN9 A;  1MPG A;  1P7M A;  1VRL A;  1PZD A;  1CDW A;  1QNC A;  4E9E A;  3CWU A;  3HS8 A;  1MUN A;  1PCZ A;  2NOB A;  1NGM A;  1B9K A;  1TBA B;  3OH6 A;  2VJ0 A;  3N5N X;  1PVS A;  4B24 A;  1KG3 A;  2ABK A;  1LWV A;  1QN7 A;  1LWW A;  1XQO A;  4EA5 A;  3CWS A;  3N0U A;  1KG6 A;  1QN8 A;  3OH9 A;  1WEI A;  4E9F A;  1LWY A;  3F0Z A;  3OST A;  1MUD A;  1QNB A;  1PU8 A;  1KG4 A;  1PU6 A;  1JFI C;  2IV8 A;  1QN6 A;  3OGD A;  4HSB A;  1YTB A;  4UOB A;  1N39 A;  1C9B B;  1KY6 A;  4B0A A;  4YPH A;  1M3Q A;  1QN4 A;  3CVS A;  2HZM A;  2OFI A;  1YQR A;  1E42 A;  3EIK A;  1VTL E;  1ORN A;  1QNE A;  3D4V A;  3H1Z A;  4OFA A;  2I5W A;  3FSP A;  4E9H A;  5AN4 A;  3OSM A;  1VTO A;  1P59 A;  4EW4 A;  3S6I A;  2XHI A;  4YPR A;  4B21 A;  2D0B A;  2JOI A;  2MJ7 A;  3ASM A;  3F10 A;  4ROC B;  1NVP A;  4TPS A;  2NOE A;  1QTP A;  2HZS A;  2G30 A;  1WEG A;  3CVT A;  2FGT A;  4ROE B;  1NH2 A;  1N3A A;  4B22 A;  2JHJ A;  2YG8 A;  2JHN A;  1MP9 A;  3KNT A;  4EJZ A;  2Z8U A;  3CWT A;  1WEF A;  4PY5 A;  1AIS A;  1YQL A;  4ROD B;  1KYF A;  1VOK A;  5DPK A;  2NOH A;  1EBM A;  1KQJ A;  2O3O A;  1LMZ A;  1QTS A;  3FHG A;  1TBP A;  5IYC P;  3G0Q A;  4I8O A;  3I0W A;  1YQM A;  1KEA A;  4AI4 A;  2NOL A;  2H56 A;  1FN7 A;  3DPT A;  1ORP A;  1QNA A;  1YQK A;  4Q11 A;  3KTU A;  1UT7 A;  2JG6 A;  2D0C A;  3CW7 A;  2NOZ A;  1XG7 A;  2YG9 A;  2YH5 A;  4B23 A;  2D0A A;  4E9G A;  1DIZ A;  5IYB P;  1UT4 A;  4DK9 A;  5KN9 A;  3DPU A;  4OFE A;  1QN3 A;  3CWA A;  1RM1 A;  4YOQ A;  4AI5 A;  1KG2 A;  3I0X A;  4EW0 A;  1TGH A;  1R4X A;  1YTF A;  1D3U A;  1QN5 A;  1KO9 A;  1KYU A;  3OCI A;  4PII A;  3N89 A;  2NOF A;  2NOI A;  1XQP A;  4WZS D;  3OC3 C;  3RPJ A;  4OFH A;  3VN5 A;  1NKU A;  1M3H A;  1KY7 A;  1RRQ A;  1KG5 A;  3IHO A;  4AIA A;  1KG7 A;  3IH7 A;  2OFK A;  3SNS A;  4EA4 A;  1RRS A;  5IYD P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...