3F0ZA

Crystal structure of clostridium acetobutylicum 8-oxoguanine glycosylase/lyase in its apo-form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
285
structure length
285
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPKVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8-oxoguanine-DNA-glycosylase
publication title Structural characterization of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase in its apo form and in complex with 8-oxodeoxyguanosine.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase, lyase
total genus 99
structure length 285
sequence length 285
ec nomenclature ec 3.2.2.-:
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3f0zA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3f0zA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3f0zA01
3CWAA 3IHOA 1EBMA 2NOBA 5AN4A 4DK9A 1XQPA 2YG9A 1NGNA 4HSBA 1YQLA 3F10A 3CWSA 1NKUA 3S6IA 1ORNA 1ORPA 1RRQA 3CW7A 4UOBA 1PVSA 4E9GA 1KG2A 1YQRA 3FHGA 2I5WA 4UNFA 1XG7A 4EVVA 1M3HA 1FN7A 3OH6A 5KN8A 1XQOA 1KQJA 4AI4A 4AI5A 4OFHA 4B23A 1MUYA 2NOEA 3D4VA 3F0ZA 3CVSA 4YOQA 5CHZA 1KG7A 3CWUA 1PU7A 4PIIA 1LWWA 1WEIA 1P7MA 2JHNA 4YPRA 4B24A 1YQKA 1KG6A 3OGDA 1YQMA 5DPKA 1WEFA 1N3AA 1MUDA 1N3CA 4B22A 5KN9A 4OFEA 1PU8A 1KG4A 2ABKA 1LWYA 1KG3A 4EW0A 3I0WA 1RRSA 1M3QA 2H56A 1KEAA 4B21A 3G0QA 2OFKA 4EA5A 3CWTA 1KO9A 3N5NX 4EJZA 2NOFA 3OH9A 3FSPA 1N39A 4EJYA 2XHIA 2JG6A 2NOHA 3I0XA 4E9HA 3IH7A 2YG8A 4EW4A 1MUNA 1PU6A 3KTUA 4E9FA 2NOZA 2OFIA 1HU0A 1VRLA 3CVTA 1WEGA 4OFAA 1MPGA 1DIZA 2NOIA 4EA4A 1LMZA 3KNTA 1LWVA 2NOLA 4AIAA 1KG5A 4E9EA 2JHJA 3FHFA 4YPHA 3N0UA 1P59A
chains in the Genus database with same CATH superfamily
3IHOA 3D7QA 1EBMA 4PY5A 1CDWA 4DK9A 2V92A 2YG9A 4BDZA 3EIKA 1QN6A 1AISA 2NVMA 4ROEB 3OYKA 1RRQA 1VKLA 1PVSA 2I5WA 1P5GX 1KFIA 5JN5A 1FN7A 3OH6A 5BMPA 5KN8A 3OYMA 4OFHA 5CHZA 3L2VA 4PIIA 2IV8A 1P7MA 1KG6A 1QN9A 1B9KA 3OSEA 1N3AA 1N3CA 3KRMA 2G30A 2QLVA 2ABKA 1LWYA 1RRSA 2V8QA 3S3NA 1KEAA 1C47A 4WXAA 4EJZA 2JOIA 5IYDP 1QTPA 2JG6A 2YG8A 4BE0A 3H1ZA 1PU6A 4E7KA 2D0CA 3BKQX 2OFIA 3N89A 1KY7A 4B0AA 4ZTFA 1QTSA 2MJ7A 1UL7A 1MPGA 1J3MA 4EA4A 3LCNA 4NZGA 3L2WA 3OS1A 4MRQA 4ROCB 2ZFDB 5IYCP 4RODB 3OYLA 1R4XA 3CWAA 3SNSA 4EAGA 1VTLE 3OYNA 1PCZA 2W03A 1UT4A 2DKCA 4IL8A 3EAYA 1YQLA 3F10A 4WX8A 1QNAA 1KYFA 1ORNA 1QN8A 2NLVA 4E9GA 3HS8A 1XG7A 1VOLB 2H5AX 2YA3A 1JDYA 4BE1A 2R5XA 1PZDA 4AI5A 3UW2A 3I3WA 2QRDA 2NOEA 3TE5A 4BDYA 4EAKA 2FUVA 3RSMA 1W80A 1QN4A 4B24A 2DKAA 3OGDA 5DPKA 1WEFA 1MP9A 3TDHA 5FRMA 5KN9A 4OFEA 2JPIA 1PU8A 4D7RA 3OCIA 2Y8QA 3I0WA 1M3QA 2Z0FA 4B21A 2FKFA 2OFKA 4ZTJA 1KO9A 3N5NX 4BJUA 1N39A 3NA5A 4E7JA 3ASMA 4E9HA 3IH7A 3RPJA 4EW4A 1MUNA 3KTUA 2NOZA 1VRLA 3CVTA 2FGTA 4OFAA 3OC3C 1NGMA 1U84A 3OYIA 2YH5A 3ENCA 1LMZA 1LWVA 2H4LX 3OLPA 3OYDA 2FKMX 1UT7A 1KG5A 4DULA 4E7HA 2JHJA 1XSZA 4D7QA 1LXTA 3N0UA 1P59A 2NOBA 2LAEA 5F9CA 1NGNA 1V5SA 4HSBA 2IV9A 4BE2A 4C7PA 2OOYA 3S6IA 3R2XC 1ORPA 3CW7A 1EUVA 1KG2A 3FHGA 4EVVA 2HKPA 1XQOA 1KQJA 4EAJA 1MUYA 5FRNA 4E7IA 3S3OA 3OSTA 1QN7A 1KG7A 2Y8LA 1LWWA 1WEIA 1WJWA 4YPRA 1PCMX 1YQMA 1MUDA 3S3MA 4IKFA 3OYEA 4WZSD 1P5DX 1KG4A 4CFFA 4Q11A 4TPSA 2W04A 3OYFA 2H56A 1WQAA 3OS2A 5KL0A 3DPTA 4EA5A 2HL8A 3OYGA 3OH9A 4BACA 3VN5A 1TBPA 3HS9A 4EJYA 2XHIA 2NOHA 3I0XA 1C9BB 1YTFA 2OOXA 4E9FA 2HZSA 1HU0A 1WEGA 1DIZA 5FROA 2NOIA 3VW4A 1YTBA 1NVPA 1PCJX 2MZ8A 2QREA 3L2QA 3T4NA 3KNTA 1TGHA 2D0AA 3L2RA 4E9EA 2QR1A 1T6AA 1TUOA 4YPHA 2HL9A 2DKDA 4I8OA 1M5Q1 5AN4A 1XQPA 1K2YX 5EPCA 1C4GA 4E7LA 2V9JA 1KYDA 3PMGA 1QNCA 1RM1A 3CWSA 1NKUA 3C04A 3OYBA 4QG5A 5IYBP 4UOBA 2HZMA 3OYCA 1YQRA 3OYHA 4UNFA 1M3HA 2D0BA 5BMNA 4AI4A 1QNEA 4B23A 1QN5A 3D4VA 3F0ZA 3OYJA 3ULXA 3CVSA 3NNQA 4EALA 4YOQA 3CWUA 1PU7A 1Q9UA 1NH2A 1E42A 3OY9A 2JHNA 5JMVD 1YQKA 4HJHA 2VJ0A 4B22A 2PWWA 2Z8UA 1KG3A 1KY6A 1JFIC 4EW0A 2JPSA 2V75A 2NWVA 3G0QA 3CWTA 2NOFA 1QN3A 3FSPA 3ENOC 2F7LA 3OS0A 2EHBD 3OYAA 2QRCA 2O3OA 5HSHA 3OSMA 1TBAB 3L2UA 1KFQA 1VOKA 1VTOA 1D3UA 1KYUA 4EAIA 1K35A 3DPUA 1QNBA 2NOLA 4AIAA 3PDKA 3FHFA
chains in the Genus database with same CATH topology
3CWAA 3IHOA 4I8OA 1EBMA 2NOBA 3SNSA 2LAEA 4PY5A 1CDWA 5AN4A 1VTLE 4DK9A 1XQPA 2YG9A 1PCZA 1UT4A 1NGNA 2IV9A 4HSBA 1KYDA 1QNCA 1YQLA 3F10A 3EIKA 1RM1A 1QNAA 3CWSA 1KYFA 1NKUA 1QN6A 1AISA 3S6IA 1ORNA 4ROEB 1ORPA 1QN8A 5IYBP 1RRQA 3CW7A 4UOBA 1PVSA 4E9GA 2HZMA 1KG2A 1YQRA 3FHGA 2I5WA 4UNFA 3HS8A 1XG7A 1VOLB 4EVVA 1M3HA 1FN7A 3OH6A 5KN8A 1XQOA 2D0BA 1KQJA 4AI4A 1PZDA 4AI5A 1QNEA 4OFHA 4B23A 1QN5A 1MUYA 2NOEA 3D4VA 3F0ZA 3ULXA 3CVSA 4YOQA 3OSTA 1QN7A 5CHZA 1KG7A 3CWUA 1PU7A 1NH2A 4PIIA 1LWWA 1WEIA 1E42A 1P7MA 2JHNA 4YPRA 1W80A 2IV8A 1QN4A 4B24A 1YQKA 1KG6A 1QN9A 3OGDA 1YQMA 5DPKA 1WEFA 1B9KA 1N3AA 1MP9A 1MUDA 1N3CA 2VJ0A 4B22A 5KN9A 4OFEA 2Z8UA 3KRMA 4WZSD 1PU8A 2G30A 1KG4A 2ABKA 1LWYA 1KG3A 1KY6A 4Q11A 3OCIA 4TPSA 1JFIC 4EW0A 3I0WA 1RRSA 1M3QA 2H56A 3DPTA 1KEAA 4B21A 3G0QA 2OFKA 4EA5A 3CWTA 1KO9A 3N5NX 4EJZA 2NOFA 3OH9A 3VN5A 2JOIA 1TBPA 3FSPA 1QN3A 5IYDP 3HS9A 1N39A 4EJYA 2XHIA 1QTPA 2JG6A 2NOHA 3I0XA 4E9HA 3IH7A 2YG8A 4EW4A 3ASMA 3RPJA 1C9BB 1YTFA 1MUNA 2O3OA 3H1ZA 1PU6A 3KTUA 4E9FA 2D0CA 2NOZA 3OSMA 2OFIA 3N89A 1KY7A 2HZSA 1HU0A 4B0AA 1VRLA 3CVTA 1TBAB 1WEGA 1QTSA 2MJ7A 2FGTA 4OFAA 1MPGA 1DIZA 2NOIA 1YTBA 3OC3C 1NGMA 4EA4A 1VOKA 1VTOA 1NVPA 1D3UA 2YH5A 2MZ8A 1KYUA 1LMZA 3KNTA 3DPUA 1TGHA 1LWVA 2D0AA 2NOLA 4ROCB 1QNBA 4AIAA 1UT7A 5IYCP 1KG5A 4DULA 4RODB 4E9EA 2JHJA 3FHFA 1R4XA 4YPHA 3N0UA 1P59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWA A;  3IHO A;  1EBM A;  2NOB A;  5AN4 A;  4DK9 A;  1XQP A;  2YG9 A;  1NGN A;  4HSB A;  1YQL A;  3F10 A;  3CWS A;  1NKU A;  3S6I A;  1ORN A;  1ORP A;  1RRQ A;  3CW7 A;  4UOB A;  1PVS A;  4E9G A;  1KG2 A;  1YQR A;  3FHG A;  2I5W A;  4UNF A;  1XG7 A;  4EVV A;  1M3H A;  1FN7 A;  3OH6 A;  5KN8 A;  1XQO A;  1KQJ A;  4AI4 A;  4AI5 A;  4OFH A;  4B23 A;  1MUY A;  2NOE A;  3D4V A;  3F0Z A;  3CVS A;  4YOQ A;  5CHZ A;  1KG7 A;  3CWU A;  1PU7 A;  4PII A;  1LWW A;  1WEI A;  1P7M A;  2JHN A;  4YPR A;  4B24 A;  1YQK A;  1KG6 A;  3OGD A;  1YQM A;  5DPK A;  1WEF A;  1N3A A;  1MUD A;  1N3C A;  4B22 A;  5KN9 A;  4OFE A;  1PU8 A;  1KG4 A;  2ABK A;  1LWY A;  1KG3 A;  4EW0 A;  3I0W A;  1RRS A;  1M3Q A;  2H56 A;  1KEA A;  4B21 A;  3G0Q A;  2OFK A;  4EA5 A;  3CWT A;  1KO9 A;  3N5N X;  4EJZ A;  2NOF A;  3OH9 A;  3FSP A;  1N39 A;  4EJY A;  2XHI A;  2JG6 A;  2NOH A;  3I0X A;  4E9H A;  3IH7 A;  2YG8 A;  4EW4 A;  1MUN A;  1PU6 A;  3KTU A;  4E9F A;  2NOZ A;  2OFI A;  1HU0 A;  1VRL A;  3CVT A;  1WEG A;  4OFA A;  1MPG A;  1DIZ A;  2NOI A;  4EA4 A;  1LMZ A;  3KNT A;  1LWV A;  2NOL A;  4AIA A;  1KG5 A;  4E9E A;  2JHJ A;  3FHF A;  4YPH A;  3N0U A;  1P59 A; 
#chains in the Genus database with same CATH topology
 3IHO A;  3D7Q A;  1EBM A;  4PY5 A;  1CDW A;  4DK9 A;  2V92 A;  2YG9 A;  4BDZ A;  3EIK A;  1QN6 A;  1AIS A;  2NVM A;  4ROE B;  3OYK A;  1RRQ A;  1VKL A;  1PVS A;  2I5W A;  1P5G X;  1KFI A;  5JN5 A;  1FN7 A;  3OH6 A;  5BMP A;  5KN8 A;  3OYM A;  4OFH A;  5CHZ A;  3L2V A;  4PII A;  2IV8 A;  1P7M A;  1KG6 A;  1QN9 A;  1B9K A;  3OSE A;  1N3A A;  1N3C A;  3KRM A;  2G30 A;  2QLV A;  2ABK A;  1LWY A;  1RRS A;  2V8Q A;  3S3N A;  1KEA A;  1C47 A;  4WXA A;  4EJZ A;  2JOI A;  5IYD P;  1QTP A;  2JG6 A;  2YG8 A;  4BE0 A;  3H1Z A;  1PU6 A;  4E7K A;  2D0C A;  3BKQ X;  2OFI A;  3N89 A;  1KY7 A;  4B0A A;  4ZTF A;  1QTS A;  2MJ7 A;  1UL7 A;  1MPG A;  1J3M A;  4EA4 A;  3LCN A;  4NZG A;  3L2W A;  3OS1 A;  4MRQ A;  4ROC B;  2ZFD B;  5IYC P;  4ROD B;  3OYL A;  1R4X A;  3CWA A;  3SNS A;  4EAG A;  1VTL E;  3OYN A;  1PCZ A;  2W03 A;  1UT4 A;  2DKC A;  4IL8 A;  3EAY A;  1YQL A;  3F10 A;  4WX8 A;  1QNA A;  1KYF A;  1ORN A;  1QN8 A;  2NLV A;  4E9G A;  3HS8 A;  1XG7 A;  1VOL B;  2H5A X;  2YA3 A;  1JDY A;  4BE1 A;  2R5X A;  1PZD A;  4AI5 A;  3UW2 A;  3I3W A;  2QRD A;  2NOE A;  3TE5 A;  4BDY A;  4EAK A;  2FUV A;  3RSM A;  1W80 A;  1QN4 A;  4B24 A;  2DKA A;  3OGD A;  5DPK A;  1WEF A;  1MP9 A;  3TDH A;  5FRM A;  5KN9 A;  4OFE A;  2JPI A;  1PU8 A;  4D7R A;  3OCI A;  2Y8Q A;  3I0W A;  1M3Q A;  2Z0F A;  4B21 A;  2FKF A;  2OFK A;  4ZTJ A;  1KO9 A;  3N5N X;  4BJU A;  1N39 A;  3NA5 A;  4E7J A;  3ASM A;  4E9H A;  3IH7 A;  3RPJ A;  4EW4 A;  1MUN A;  3KTU A;  2NOZ A;  1VRL A;  3CVT A;  2FGT A;  4OFA A;  3OC3 C;  1NGM A;  1U84 A;  3OYI A;  2YH5 A;  3ENC A;  1LMZ A;  1LWV A;  2H4L X;  3OLP A;  3OYD A;  2FKM X;  1UT7 A;  1KG5 A;  4DUL A;  4E7H A;  2JHJ A;  1XSZ A;  4D7Q A;  1LXT A;  3N0U A;  1P59 A;  2NOB A;  2LAE A;  5F9C A;  1NGN A;  1V5S A;  4HSB A;  2IV9 A;  4BE2 A;  4C7P A;  2OOY A;  3S6I A;  3R2X C;  1ORP A;  3CW7 A;  1EUV A;  1KG2 A;  3FHG A;  4EVV A;  2HKP A;  1XQO A;  1KQJ A;  4EAJ A;  1MUY A;  5FRN A;  4E7I A;  3S3O A;  3OST A;  1QN7 A;  1KG7 A;  2Y8L A;  1LWW A;  1WEI A;  1WJW A;  4YPR A;  1PCM X;  1YQM A;  1MUD A;  3S3M A;  4IKF A;  3OYE A;  4WZS D;  1P5D X;  1KG4 A;  4CFF A;  4Q11 A;  4TPS A;  2W04 A;  3OYF A;  2H56 A;  1WQA A;  3OS2 A;  5KL0 A;  3DPT A;  4EA5 A;  2HL8 A;  3OYG A;  3OH9 A;  4BAC A;  3VN5 A;  1TBP A;  3HS9 A;  4EJY A;  2XHI A;  2NOH A;  3I0X A;  1C9B B;  1YTF A;  2OOX A;  4E9F A;  2HZS A;  1HU0 A;  1WEG A;  1DIZ A;  5FRO A;  2NOI A;  3VW4 A;  1YTB A;  1NVP A;  1PCJ X;  2MZ8 A;  2QRE A;  3L2Q A;  3T4N A;  3KNT A;  1TGH A;  2D0A A;  3L2R A;  4E9E A;  2QR1 A;  1T6A A;  1TUO A;  4YPH A;  2HL9 A;  2DKD A;  4I8O A;  1M5Q 1;  5AN4 A;  1XQP A;  1K2Y X;  5EPC A;  1C4G A;  4E7L A;  2V9J A;  1KYD A;  3PMG A;  1QNC A;  1RM1 A;  3CWS A;  1NKU A;  3C04 A;  3OYB A;  4QG5 A;  5IYB P;  4UOB A;  2HZM A;  3OYC A;  1YQR A;  3OYH A;  4UNF A;  1M3H A;  2D0B A;  5BMN A;  4AI4 A;  1QNE A;  4B23 A;  1QN5 A;  3D4V A;  3F0Z A;  3OYJ A;  3ULX A;  3CVS A;  3NNQ A;  4EAL A;  4YOQ A;  3CWU A;  1PU7 A;  1Q9U A;  1NH2 A;  1E42 A;  3OY9 A;  2JHN A;  5JMV D;  1YQK A;  4HJH A;  2VJ0 A;  4B22 A;  2PWW A;  2Z8U A;  1KG3 A;  1KY6 A;  1JFI C;  4EW0 A;  2JPS A;  2V75 A;  2NWV A;  3G0Q A;  3CWT A;  2NOF A;  1QN3 A;  3FSP A;  3ENO C;  2F7L A;  3OS0 A;  2EHB D;  3OYA A;  2QRC A;  2O3O A;  5HSH A;  3OSM A;  1TBA B;  3L2U A;  1KFQ A;  1VOK A;  1VTO A;  1D3U A;  1KYU A;  4EAI A;  1K35 A;  3DPU A;  1QNB A;  2NOL A;  4AIA A;  3PDK A;  3FHF A; 
#chains in the Genus database with same CATH homology
 3CWA A;  3IHO A;  4I8O A;  1EBM A;  2NOB A;  3SNS A;  2LAE A;  4PY5 A;  1CDW A;  5AN4 A;  1VTL E;  4DK9 A;  1XQP A;  2YG9 A;  1PCZ A;  1UT4 A;  1NGN A;  2IV9 A;  4HSB A;  1KYD A;  1QNC A;  1YQL A;  3F10 A;  3EIK A;  1RM1 A;  1QNA A;  3CWS A;  1KYF A;  1NKU A;  1QN6 A;  1AIS A;  3S6I A;  1ORN A;  4ROE B;  1ORP A;  1QN8 A;  5IYB P;  1RRQ A;  3CW7 A;  4UOB A;  1PVS A;  4E9G A;  2HZM A;  1KG2 A;  1YQR A;  3FHG A;  2I5W A;  4UNF A;  3HS8 A;  1XG7 A;  1VOL B;  4EVV A;  1M3H A;  1FN7 A;  3OH6 A;  5KN8 A;  1XQO A;  2D0B A;  1KQJ A;  4AI4 A;  1PZD A;  4AI5 A;  1QNE A;  4OFH A;  4B23 A;  1QN5 A;  1MUY A;  2NOE A;  3D4V A;  3F0Z A;  3ULX A;  3CVS A;  4YOQ A;  3OST A;  1QN7 A;  5CHZ A;  1KG7 A;  3CWU A;  1PU7 A;  1NH2 A;  4PII A;  1LWW A;  1WEI A;  1E42 A;  1P7M A;  2JHN A;  4YPR A;  1W80 A;  2IV8 A;  1QN4 A;  4B24 A;  1YQK A;  1KG6 A;  1QN9 A;  3OGD A;  1YQM A;  5DPK A;  1WEF A;  1B9K A;  1N3A A;  1MP9 A;  1MUD A;  1N3C A;  2VJ0 A;  4B22 A;  5KN9 A;  4OFE A;  2Z8U A;  3KRM A;  4WZS D;  1PU8 A;  2G30 A;  1KG4 A;  2ABK A;  1LWY A;  1KG3 A;  1KY6 A;  4Q11 A;  3OCI A;  4TPS A;  1JFI C;  4EW0 A;  3I0W A;  1RRS A;  1M3Q A;  2H56 A;  3DPT A;  1KEA A;  4B21 A;  3G0Q A;  2OFK A;  4EA5 A;  3CWT A;  1KO9 A;  3N5N X;  4EJZ A;  2NOF A;  3OH9 A;  3VN5 A;  2JOI A;  1TBP A;  3FSP A;  1QN3 A;  5IYD P;  3HS9 A;  1N39 A;  4EJY A;  2XHI A;  1QTP A;  2JG6 A;  2NOH A;  3I0X A;  4E9H A;  3IH7 A;  2YG8 A;  4EW4 A;  3ASM A;  3RPJ A;  1C9B B;  1YTF A;  1MUN A;  2O3O A;  3H1Z A;  1PU6 A;  3KTU A;  4E9F A;  2D0C A;  2NOZ A;  3OSM A;  2OFI A;  3N89 A;  1KY7 A;  2HZS A;  1HU0 A;  4B0A A;  1VRL A;  3CVT A;  1TBA B;  1WEG A;  1QTS A;  2MJ7 A;  2FGT A;  4OFA A;  1MPG A;  1DIZ A;  2NOI A;  1YTB A;  3OC3 C;  1NGM A;  4EA4 A;  1VOK A;  1VTO A;  1NVP A;  1D3U A;  2YH5 A;  2MZ8 A;  1KYU A;  1LMZ A;  3KNT A;  3DPU A;  1TGH A;  1LWV A;  2D0A A;  2NOL A;  4ROC B;  1QNB A;  4AIA A;  1UT7 A;  5IYC P;  1KG5 A;  4DUL A;  4ROD B;  4E9E A;  2JHJ A;  3FHF A;  1R4X A;  4YPH A;  3N0U A;  1P59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...