3F0ZA

Crystal structure of clostridium acetobutylicum 8-oxoguanine glycosylase/lyase in its apo-form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
285
structure length
285
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPKVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, lyase
molecule keywords 8-oxoguanine-DNA-glycosylase
publication title Structural characterization of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase in its apo form and in complex with 8-oxodeoxyguanosine.
pubmed doi rcsb
source organism Clostridium acetobutylicum
total genus 99
structure length 285
sequence length 285
ec nomenclature ec 3.2.2.-:
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3f0zA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3f0zA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3f0zA01
1PU7A 3I0WA 3KNTA 2JHJA 2NOLA 5DPKA 2JG6A 3KTUA 4PIIA 1HU0A 4B24A 1N3CA 1WEIA 1KG3A 1YQMA 4B22A 3N0UA 3IHOA 3CVSA 3CWSA 2JHNA 2ABKA 1DIZA 4AI5A 3CVTA 1KEAA 1RRSA 3I0XA 2NOFA 1N3AA 4EA4A 4EVVA 3F0ZA 3D4VA 4DK9A 4OFEA 5CHZA 1NGNA 1KG2A 3S6IA 1XQPA 1KG7A 1MPGA 2I5WA 1M3HA 1EBMA 1WEFA 4E9HA 4EJZA 2XHIA 1ORPA 3CWUA 1MUNA 3OGDA 4EW0A 1PVSA 1LWWA 3IH7A 1LWYA 3CWAA 1KG6A 4E9EA 1PU8A 1KG5A 1P7MA 2NOZA 4EW4A 3CWTA 1PU6A 3FHGA 4E9FA 1YQLA 1LMZA 4OFHA 5KN9A 4YPRA 2YG8A 3OH9A 4OFAA 1WEGA 1XG7A 1MUDA 2NOHA 3G0QA 1FN7A 1VRLA 4B21A 1NKUA 4YPHA 2YG9A 1MUYA 1RRQA 1M3QA 1YQRA 4EA5A 4UNFA 2H56A 4AI4A 4B23A 1YQKA 3FSPA 1KG4A 1N39A 3CW7A 4EJYA 3FHFA 2OFIA 4UOBA 2NOIA 3F10A 3N5NX 3OH6A 1XQOA 4E9GA 1P59A 4AIAA 2NOEA 1KO9A 2NOBA 4YOQA 5KN8A 1KQJA 4HSBA 2OFKA 1LWVA 1ORNA 5AN4A
chains in the Genus database with same CATH superfamily
3OC3C 3D7QA 3OYBA 1NH2A 1YTFA 4EAJA 4B24A 1WEIA 1KG3A 1YQMA 2HL9A 4TPSA 2QRDA 4IL8A 2H4LX 2JHNA 1UT4A 3H1ZA 3CVTA 4BACA 3I0XA 1KFIA 1N3AA 1QN5A 4NZGA 4OFEA 4EAGA 1KG2A 3L2RA 1MPGA 4E9HA 2XHIA 1ORPA 3CWUA 3N89A 3UW2A 2IV9A 4EW0A 3OYNA 1KY7A 1PVSA 4Q11A 2DKDA 1Q9UA 4D7RA 4DULA 3L2VA 5KL0A 3ASMA 1LMZA 5KN9A 2DKCA 1RM1A 1AISA 4OFAA 3RPJA 1WEGA 1XG7A 2Z8UA 1U84A 2NOHA 3OS2A 1FN7A 1VRLA 4UNFA 3ENCA 2YA3A 2QLVA 3CW7A 4EJYA 3FHFA 1KY6A 1QTPA 1C47A 4E9GA 3OYGA 2YH5A 1KO9A 3OSTA 2QRCA 5IYCP 3L2WA 2JPIA 5KN8A 1KQJA 1QN9A 1LWVA 4EAKA 3EIKA 3HS8A 2W04A 1PU7A 3I0WA 2JPSA 1TBPA 2Z0FA 2JHJA 2NOLA 3PDKA 2JG6A 1HU0A 4EAIA 1QNCA 4HJHA 3S3OA 1VOLB 1KFQA 3OYMA 3EAYA 2ABKA 2HZSA 5F9CA 4ROCB 4BJUA 2NOFA 1CDWA 5BMNA 4DK9A 3OYLA 3OCIA 2W03A 1NGNA 5CHZA 1QNAA 2OOYA 2D0AA 1KG7A 1EBMA 3OYIA 2MJ7A 3S3MA 4EJZA 1M5Q1 1VKLA 1QN6A 2FGTA 2FKMX 3IH7A 4QG5A 1KG6A 1C4GA 3NA5A 4E9EA 1QTSA 2D0CA 5IYBP 5FRNA 3FHGA 4OFHA 4C7PA 3OS1A 4YPRA 1B9KA 1K2YX 4BE0A 3OYCA 3OH9A 3BKQX 3L2QA 1YTBA 1VTLE 3SNSA 4WX8A 3DPUA 5IYDP 2YG9A 1MUYA 1RRQA 3PMGA 1PCJX 1QNBA 1YQKA 3FSPA 1KG4A 4PY5A 1N39A 2MZ8A 1QNEA 2OFIA 2VJ0A 3N5NX 3OH6A 1TUOA 1KYUA 3C04A 2V8QA 2HL8A 4YOQA 3L2UA 1ORNA 5FRMA 5AN4A 1C9BB 1R4XA 2H5AX 3KTUA 1N3CA 1TGHA 3N0UA 2EHBD 3OYEA 3IHOA 3CWSA 1DIZA 5JN5A 3OS0A 3OYFA 1KEAA 4B0AA 4ZTJA 1MP9A 4EA4A 4EVVA 3F0ZA 3D4VA 5FROA 1UL7A 1XQPA 4WXAA 2O3OA 3OYKA 1XSZA 1NGMA 2FUVA 1MUNA 3OGDA 2V92A 2D0BA 4E7IA 1NVPA 2Y8LA 3S3NA 2NWVA 2HKPA 2ZFDB 1P7MA 2NOZA 3R2XC 1PCMX 2FKFA 4E7KA 4BE2A 2R5XA 1PCZA 4RODB 3OYAA 1VTOA 1UT7A 2V75A 4IKFA 4BE1A 4ZTFA 1QN4A 3OSMA 4E7JA 1K35A 4YPHA 1T6AA 1M3QA 1YQRA 4EA5A 2H56A 3KRMA 3LCNA 2PWWA 1EUVA 1P59A 3VW4A 3T4NA 2OOXA 4AIAA 3OYJA 2NOBA 2NLVA 3VN5A 1PZDA 4HSBA 3OLPA 4D7QA 2V9JA 3DPTA 5EPCA 1JFIC 1QN8A 1W80A 3KNTA 3TDHA 5DPKA 4PIIA 4BDZA 1LXTA 4ROEB 4B22A 3I3WA 2DKAA 3OYDA 3CVSA 5HSHA 4AI5A 3OYHA 2QR1A 1RRSA 5BMPA 2G30A 4EALA 4BDYA 3RSMA 2QREA 3S6IA 2I5WA 1P5GX 3OSEA 1M3HA 1WEFA 3HS9A 1V5SA 1QN7A 4MRQA 1LWWA 1LWYA 3CWAA 4I8OA 1J3MA 1VOKA 1PU8A 5JMVD 1KG5A 1D3UA 4EW4A 3CWTA 2Y8QA 1PU6A 4E9FA 1KYDA 1YQLA 2YG8A 4E7LA 1MUDA 2F7LA 3G0QA 1P5DX 1WQAA 4B21A 1NKUA 1JDYA 1TBAB 2IV8A 3ULXA 1KYFA 4CFFA 4AI4A 3NNQA 4B23A 2HZMA 1QN3A 3ENOC 4UOBA 2NOIA 3F10A 2JOIA 1WJWA 1XQOA 4WZSD 1E42A 2LAEA 4E7HA 2NOEA 2NVMA 3TE5A 2OFKA 3OY9A
chains in the Genus database with same CATH topology
1PU7A 3I0WA 3DPTA 1JFIC 1QN8A 1TBPA 3OC3C 1W80A 3KNTA 2JHJA 1NH2A 2NOLA 1R4XA 1C9BB 1YTFA 5DPKA 2JG6A 3KTUA 4PIIA 1HU0A 4B24A 1N3CA 1QNCA 1WEIA 1KG3A 1YQMA 4B22A 4ROEB 3N0UA 1TGHA 4TPSA 1VOLB 3IHOA 3CVSA 3CWSA 2JHNA 2ABKA 1UT4A 1DIZA 3H1ZA 4AI5A 3CVTA 2HZSA 1KEAA 1RRSA 4B0AA 3I0XA 4ROCB 1MP9A 2NOFA 1N3AA 1CDWA 4EA4A 4EVVA 2G30A 3F0ZA 3D4VA 4DK9A 1QN5A 4OFEA 3OCIA 5CHZA 1NGNA 1KG2A 3S6IA 1QNAA 1XQPA 2D0AA 1KG7A 1MPGA 2I5WA 2O3OA 1M3HA 1EBMA 2MJ7A 1WEFA 3HS9A 4E9HA 4EJZA 1QN7A 1NGMA 2XHIA 1ORPA 3CWUA 3N89A 1QN6A 1MUNA 3OGDA 2IV9A 4EW0A 2D0BA 2FGTA 1KY7A 1PVSA 1LWWA 3IH7A 1LWYA 1NVPA 4Q11A 3CWAA 4I8OA 1KG6A 1VOKA 4E9EA 1QTSA 2D0CA 1PU8A 1KG5A 1P7MA 2NOZA 4DULA 4EW4A 1D3UA 3CWTA 5IYBP 1PU6A 3FHGA 4E9FA 1KYDA 1YQLA 1LMZA 4OFHA 3ASMA 5KN9A 1RM1A 4YPRA 1B9KA 2YG8A 3OH9A 1AISA 4OFAA 1PCZA 3RPJA 1WEGA 1XG7A 1MUDA 2Z8UA 4RODB 1YTBA 1VTOA 2NOHA 1UT7A 3G0QA 1VTLE 1FN7A 1VRLA 1QN4A 3OSMA 4B21A 1NKUA 3SNSA 1TBAB 3DPUA 4YPHA 2YG9A 2IV8A 5IYDP 3ULXA 1MUYA 1RRQA 1KYFA 1M3QA 1YQRA 4EA5A 4UNFA 1QNBA 2H56A 4AI4A 4B23A 1YQKA 3FSPA 1KG4A 4PY5A 2HZMA 1N39A 2MZ8A 3CW7A 4EJYA 3FHFA 1QNEA 1QN3A 2OFIA 2VJ0A 4UOBA 2NOIA 3F10A 3N5NX 1KY6A 3OH6A 1QTPA 2JOIA 3KRMA 1XQOA 4WZSD 4E9GA 1P59A 1KYUA 1E42A 4AIAA 2LAEA 2NOEA 2YH5A 1KO9A 2NOBA 3OSTA 5IYCP 4YOQA 3VN5A 1PZDA 5KN8A 1KQJA 4HSBA 1QN9A 2OFKA 1LWVA 1ORNA 3EIKA 3HS8A 5AN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PU7 A;  3I0W A;  3KNT A;  2JHJ A;  2NOL A;  5DPK A;  2JG6 A;  3KTU A;  4PII A;  1HU0 A;  4B24 A;  1N3C A;  1WEI A;  1KG3 A;  1YQM A;  4B22 A;  3N0U A;  3IHO A;  3CVS A;  3CWS A;  2JHN A;  2ABK A;  1DIZ A;  4AI5 A;  3CVT A;  1KEA A;  1RRS A;  3I0X A;  2NOF A;  1N3A A;  4EA4 A;  4EVV A;  3F0Z A;  3D4V A;  4DK9 A;  4OFE A;  5CHZ A;  1NGN A;  1KG2 A;  3S6I A;  1XQP A;  1KG7 A;  1MPG A;  2I5W A;  1M3H A;  1EBM A;  1WEF A;  4E9H A;  4EJZ A;  2XHI A;  1ORP A;  3CWU A;  1MUN A;  3OGD A;  4EW0 A;  1PVS A;  1LWW A;  3IH7 A;  1LWY A;  3CWA A;  1KG6 A;  4E9E A;  1PU8 A;  1KG5 A;  1P7M A;  2NOZ A;  4EW4 A;  3CWT A;  1PU6 A;  3FHG A;  4E9F A;  1YQL A;  1LMZ A;  4OFH A;  5KN9 A;  4YPR A;  2YG8 A;  3OH9 A;  4OFA A;  1WEG A;  1XG7 A;  1MUD A;  2NOH A;  3G0Q A;  1FN7 A;  1VRL A;  4B21 A;  1NKU A;  4YPH A;  2YG9 A;  1MUY A;  1RRQ A;  1M3Q A;  1YQR A;  4EA5 A;  4UNF A;  2H56 A;  4AI4 A;  4B23 A;  1YQK A;  3FSP A;  1KG4 A;  1N39 A;  3CW7 A;  4EJY A;  3FHF A;  2OFI A;  4UOB A;  2NOI A;  3F10 A;  3N5N X;  3OH6 A;  1XQO A;  4E9G A;  1P59 A;  4AIA A;  2NOE A;  1KO9 A;  2NOB A;  4YOQ A;  5KN8 A;  1KQJ A;  4HSB A;  2OFK A;  1LWV A;  1ORN A;  5AN4 A; 
#chains in the Genus database with same CATH topology
 3OC3 C;  3D7Q A;  3OYB A;  1NH2 A;  1YTF A;  4EAJ A;  4B24 A;  1WEI A;  1KG3 A;  1YQM A;  2HL9 A;  4TPS A;  2QRD A;  4IL8 A;  2H4L X;  2JHN A;  1UT4 A;  3H1Z A;  3CVT A;  4BAC A;  3I0X A;  1KFI A;  1N3A A;  1QN5 A;  4NZG A;  4OFE A;  4EAG A;  1KG2 A;  3L2R A;  1MPG A;  4E9H A;  2XHI A;  1ORP A;  3CWU A;  3N89 A;  3UW2 A;  2IV9 A;  4EW0 A;  3OYN A;  1KY7 A;  1PVS A;  4Q11 A;  2DKD A;  1Q9U A;  4D7R A;  4DUL A;  3L2V A;  5KL0 A;  3ASM A;  1LMZ A;  5KN9 A;  2DKC A;  1RM1 A;  1AIS A;  4OFA A;  3RPJ A;  1WEG A;  1XG7 A;  2Z8U A;  1U84 A;  2NOH A;  3OS2 A;  1FN7 A;  1VRL A;  4UNF A;  3ENC A;  2YA3 A;  2QLV A;  3CW7 A;  4EJY A;  3FHF A;  1KY6 A;  1QTP A;  1C47 A;  4E9G A;  3OYG A;  2YH5 A;  1KO9 A;  3OST A;  2QRC A;  5IYC P;  3L2W A;  2JPI A;  5KN8 A;  1KQJ A;  1QN9 A;  1LWV A;  4EAK A;  3EIK A;  3HS8 A;  2W04 A;  1PU7 A;  3I0W A;  2JPS A;  1TBP A;  2Z0F A;  2JHJ A;  2NOL A;  3PDK A;  2JG6 A;  1HU0 A;  4EAI A;  1QNC A;  4HJH A;  3S3O A;  1VOL B;  1KFQ A;  3OYM A;  3EAY A;  2ABK A;  2HZS A;  5F9C A;  4ROC B;  4BJU A;  2NOF A;  1CDW A;  5BMN A;  4DK9 A;  3OYL A;  3OCI A;  2W03 A;  1NGN A;  5CHZ A;  1QNA A;  2OOY A;  2D0A A;  1KG7 A;  1EBM A;  3OYI A;  2MJ7 A;  3S3M A;  4EJZ A;  1M5Q 1;  1VKL A;  1QN6 A;  2FGT A;  2FKM X;  3IH7 A;  4QG5 A;  1KG6 A;  1C4G A;  3NA5 A;  4E9E A;  1QTS A;  2D0C A;  5IYB P;  5FRN A;  3FHG A;  4OFH A;  4C7P A;  3OS1 A;  4YPR A;  1B9K A;  1K2Y X;  4BE0 A;  3OYC A;  3OH9 A;  3BKQ X;  3L2Q A;  1YTB A;  1VTL E;  3SNS A;  4WX8 A;  3DPU A;  5IYD P;  2YG9 A;  1MUY A;  1RRQ A;  3PMG A;  1PCJ X;  1QNB A;  1YQK A;  3FSP A;  1KG4 A;  4PY5 A;  1N39 A;  2MZ8 A;  1QNE A;  2OFI A;  2VJ0 A;  3N5N X;  3OH6 A;  1TUO A;  1KYU A;  3C04 A;  2V8Q A;  2HL8 A;  4YOQ A;  3L2U A;  1ORN A;  5FRM A;  5AN4 A;  1C9B B;  1R4X A;  2H5A X;  3KTU A;  1N3C A;  1TGH A;  3N0U A;  2EHB D;  3OYE A;  3IHO A;  3CWS A;  1DIZ A;  5JN5 A;  3OS0 A;  3OYF A;  1KEA A;  4B0A A;  4ZTJ A;  1MP9 A;  4EA4 A;  4EVV A;  3F0Z A;  3D4V A;  5FRO A;  1UL7 A;  1XQP A;  4WXA A;  2O3O A;  3OYK A;  1XSZ A;  1NGM A;  2FUV A;  1MUN A;  3OGD A;  2V92 A;  2D0B A;  4E7I A;  1NVP A;  2Y8L A;  3S3N A;  2NWV A;  2HKP A;  2ZFD B;  1P7M A;  2NOZ A;  3R2X C;  1PCM X;  2FKF A;  4E7K A;  4BE2 A;  2R5X A;  1PCZ A;  4ROD B;  3OYA A;  1VTO A;  1UT7 A;  2V75 A;  4IKF A;  4BE1 A;  4ZTF A;  1QN4 A;  3OSM A;  4E7J A;  1K35 A;  4YPH A;  1T6A A;  1M3Q A;  1YQR A;  4EA5 A;  2H56 A;  3KRM A;  3LCN A;  2PWW A;  1EUV A;  1P59 A;  3VW4 A;  3T4N A;  2OOX A;  4AIA A;  3OYJ A;  2NOB A;  2NLV A;  3VN5 A;  1PZD A;  4HSB A;  3OLP A;  4D7Q A;  2V9J A;  3DPT A;  5EPC A;  1JFI C;  1QN8 A;  1W80 A;  3KNT A;  3TDH A;  5DPK A;  4PII A;  4BDZ A;  1LXT A;  4ROE B;  4B22 A;  3I3W A;  2DKA A;  3OYD A;  3CVS A;  5HSH A;  4AI5 A;  3OYH A;  2QR1 A;  1RRS A;  5BMP A;  2G30 A;  4EAL A;  4BDY A;  3RSM A;  2QRE A;  3S6I A;  2I5W A;  1P5G X;  3OSE A;  1M3H A;  1WEF A;  3HS9 A;  1V5S A;  1QN7 A;  4MRQ A;  1LWW A;  1LWY A;  3CWA A;  4I8O A;  1J3M A;  1VOK A;  1PU8 A;  5JMV D;  1KG5 A;  1D3U A;  4EW4 A;  3CWT A;  2Y8Q A;  1PU6 A;  4E9F A;  1KYD A;  1YQL A;  2YG8 A;  4E7L A;  1MUD A;  2F7L A;  3G0Q A;  1P5D X;  1WQA A;  4B21 A;  1NKU A;  1JDY A;  1TBA B;  2IV8 A;  3ULX A;  1KYF A;  4CFF A;  4AI4 A;  3NNQ A;  4B23 A;  2HZM A;  1QN3 A;  3ENO C;  4UOB A;  2NOI A;  3F10 A;  2JOI A;  1WJW A;  1XQO A;  4WZS D;  1E42 A;  2LAE A;  4E7H A;  2NOE A;  2NVM A;  3TE5 A;  2OFK A;  3OY9 A; 
#chains in the Genus database with same CATH homology
 1PU7 A;  3I0W A;  3DPT A;  1JFI C;  1QN8 A;  1TBP A;  3OC3 C;  1W80 A;  3KNT A;  2JHJ A;  1NH2 A;  2NOL A;  1R4X A;  1C9B B;  1YTF A;  5DPK A;  2JG6 A;  3KTU A;  4PII A;  1HU0 A;  4B24 A;  1N3C A;  1QNC A;  1WEI A;  1KG3 A;  1YQM A;  4B22 A;  4ROE B;  3N0U A;  1TGH A;  4TPS A;  1VOL B;  3IHO A;  3CVS A;  3CWS A;  2JHN A;  2ABK A;  1UT4 A;  1DIZ A;  3H1Z A;  4AI5 A;  3CVT A;  2HZS A;  1KEA A;  1RRS A;  4B0A A;  3I0X A;  4ROC B;  1MP9 A;  2NOF A;  1N3A A;  1CDW A;  4EA4 A;  4EVV A;  2G30 A;  3F0Z A;  3D4V A;  4DK9 A;  1QN5 A;  4OFE A;  3OCI A;  5CHZ A;  1NGN A;  1KG2 A;  3S6I A;  1QNA A;  1XQP A;  2D0A A;  1KG7 A;  1MPG A;  2I5W A;  2O3O A;  1M3H A;  1EBM A;  2MJ7 A;  1WEF A;  3HS9 A;  4E9H A;  4EJZ A;  1QN7 A;  1NGM A;  2XHI A;  1ORP A;  3CWU A;  3N89 A;  1QN6 A;  1MUN A;  3OGD A;  2IV9 A;  4EW0 A;  2D0B A;  2FGT A;  1KY7 A;  1PVS A;  1LWW A;  3IH7 A;  1LWY A;  1NVP A;  4Q11 A;  3CWA A;  4I8O A;  1KG6 A;  1VOK A;  4E9E A;  1QTS A;  2D0C A;  1PU8 A;  1KG5 A;  1P7M A;  2NOZ A;  4DUL A;  4EW4 A;  1D3U A;  3CWT A;  5IYB P;  1PU6 A;  3FHG A;  4E9F A;  1KYD A;  1YQL A;  1LMZ A;  4OFH A;  3ASM A;  5KN9 A;  1RM1 A;  4YPR A;  1B9K A;  2YG8 A;  3OH9 A;  1AIS A;  4OFA A;  1PCZ A;  3RPJ A;  1WEG A;  1XG7 A;  1MUD A;  2Z8U A;  4ROD B;  1YTB A;  1VTO A;  2NOH A;  1UT7 A;  3G0Q A;  1VTL E;  1FN7 A;  1VRL A;  1QN4 A;  3OSM A;  4B21 A;  1NKU A;  3SNS A;  1TBA B;  3DPU A;  4YPH A;  2YG9 A;  2IV8 A;  5IYD P;  3ULX A;  1MUY A;  1RRQ A;  1KYF A;  1M3Q A;  1YQR A;  4EA5 A;  4UNF A;  1QNB A;  2H56 A;  4AI4 A;  4B23 A;  1YQK A;  3FSP A;  1KG4 A;  4PY5 A;  2HZM A;  1N39 A;  2MZ8 A;  3CW7 A;  4EJY A;  3FHF A;  1QNE A;  1QN3 A;  2OFI A;  2VJ0 A;  4UOB A;  2NOI A;  3F10 A;  3N5N X;  1KY6 A;  3OH6 A;  1QTP A;  2JOI A;  3KRM A;  1XQO A;  4WZS D;  4E9G A;  1P59 A;  1KYU A;  1E42 A;  4AIA A;  2LAE A;  2NOE A;  2YH5 A;  1KO9 A;  2NOB A;  3OST A;  5IYC P;  4YOQ A;  3VN5 A;  1PZD A;  5KN8 A;  1KQJ A;  4HSB A;  1QN9 A;  2OFK A;  1LWV A;  1ORN A;  3EIK A;  3HS8 A;  5AN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...