4E7LA

Pfv integrase strand transfer complex (stc-mn*) following reaction in crystallo, at 3.0 a resolution.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7lA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7lA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7lA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7lA03
1JLGA 2RPIA 2XY7A 4NCGA 4J2AA 3L2UA 4Z02A 3PV8A 4CIGA 3NBPA 1OI1A 2YV0X 4QCLA 1KLNA 3MXMA 4FZZA 3T3FA 1LWFA 2WONA 3LP2A 2GFUA 3NE6A 2I5JA 3SYZA 2HHUA 4RW6A 1QQCA 3MO8A 4EP4A 4O4GA 4CIFA 3SUPA 4DTSA 3L8BA 4H4MA 3K5OA 4J2DA 1U49A 4IFYA 3DM2A 3FLGA 2O4XA 5CZ2A 2X4XA 2XY8A 2MWOA 5D6XA 3SUQA 3OVNA 3OMCA 4DF8A 3AA4A 1RTDA 3SQ0A 3AV9A 2PQWA 2RHXA 3VQ9A 1HQUA 3DLMA 4CJTA 3TAGA 5FDLA 4HCBA 3EY1A 4FLZA 4I7FA 2BUDA 4Q5VA 1S6PA 2HHXA 3DOLA 1O1WA 2NUBA 4B3OA 2FBVA 3ISNC 2W42A 2EHGA 3LLRA 1VSJA 1BCMA 2D0CA 4RW4A 4BE1A 1RDCA 1BISA 3PMIA 1I39A 1YVUA 4PLLA 1C0UA 3C6TA 1RTJA 3RWUA 1IKYA 3NF8A 4II1A 2RKIA 1TKDA 4F3OA 2KFZA 1KCFA 4A4FA 1NJYA 3PX6A 4FM1A 4E3SA 1B92A 4C8NA 3L2WA 3KLEA 4FW1A 1FKPA 3QETA 1YTAA 4N41A 3NTKA 3QNOA 3O4QA 1BHLA 1G15A 3FEOA 3S3OA 1RBSA 4Z4HA 1WSHA 3K5MA 1SKRA 3SI6A 2ITGA 2F5KA 4J2EA 1SV5A 5T7BA 5KRSA 1QSYA 2HNYA 4CJRA 3MP1A 3VQ8A 4CGIA 2OZSA 3DLHA 5J2PA 3LP1A 4M42A 2FBXA 4C5EA 4CHQA 4CJEA 3SUNA 1SSFA 2YHAA 3PO5A 1KTQA 4DSKA 4IUPA 1UOCA 3P5JA 5HRPA 3CEYA 5DK5A 4DTJA 1C1BA 3WNFA 5JS1A 4Z4IA 4FU6A 1Z25A 1J9AA 1ITGA 3MAQA 4N4IA 4CJ3A 1IG9A 1JL1A 3OYGA 1EP4A 3SJJA 4PA1A 4IURA 4FJLA 2R5AA 1IKVA 3O4NA 1JL2A 3OB9A 2G8WA 1JLQA 1EX4A 1RT1A 4FLTA 3V9UA 1W0HA 1UWBA 2G3RA 4Z4GA 1B9FA 3LGFA 3L2VA 2RF2A 3HPGA 4I2PA 2LVMA 4HUFA 4M3WA 1BI4A 3M8PA 1ZBHA 3HK2A 3TAEA 4DTPA 2D0AA 4NS5A 3ZT4A 1T03A 1R0AA 5CYQA 1WSIA 4M3XA 2OZMA 1RBRA 4OPKA 1WJSA 3META 3QO9A 4DS5A 4IBNA 3QNNA 4DQPA 3OYLA 2XRIA 1X9MA 2GBZA 1NKBA 2PZSA 2HVHA 3DI6A 1BIUA 3ZT1A 4JRPA 4PL6A 4BDYA 1MHNA 2EKOA 1TKXA 3LANA 5CY4A 3O3FA 4FJNA 5K14A 2G8IA 1QSLA 3JYTA 5J2NA 2GUIA 5SWMA 4FJJA 2ZE2A 4Z4EA 1VSFA 2OPRA 2XHBA 2OYQA 5C42A 1VSEA 1ZBUA 1N27A 4YNQA 1JXBA 4B9MA 1XWLA 4M3RA 4AHVA 3OS0A 1UA0A 4OVAA 3OJUA 1TK0A 3RMBA 5C24A 3ULDA 4BD3A 4C8OA 5KGXA 2EQKA 2P5OA 4DSJA 2RHYA 2K3YA 3K2PA 3VQDA 1YT3A 2P5GA 3KLFA 3QIOA 1S1XA 4BWJA 4CHPA 3NDKA 5KH6A 4FYDA 1RT5A 3CG7A 3NHGA 4A4HA 1N6QA 4DSLA 1JLBA 4CF8A 1RT6A 1TAUA 2EQJA 4E7JA 3H8ZA 1HJRA 3M8QA 1S5JA 3O3GA 3U3YA 4MQ3A 3ME9A 5FRNA 2R5MA 4N76A 2VG6A 3VQBA 4CEEA 2VG5A 3PO4A 4KHNA 2LSNA 3KJVA 2HQXA 3CFOA 3MECA 3DLEA 1NJWA 3TR8A 1L3UA 3I8DA 5KCOA 4OGCA 1JLAA 4B9LA 4B9SA 4DU4A 5I3UA 1VRUA 4CGHA 1NK9A 4Z4CA 4PWDA 3CYMA 3HT3A 3V9SA 1HYSA 5HLFA 1SKWA 2QKBA 3UT1A 3GOXA 4B9VA 3DYAA 1VSKA 5KRTA 4QOZB 4PY5A 3L2RA 2DFFA 4CK1A 2E6MA 5J39A 2F8SA 3HVRA 4B8CA 1NK6A 4IFVA 4O55A 3OYNA 3FFIA 2BE2A 3OYKA 3PUFA 4FM2A 2HHQA 3TWHA 2HMIA 1LAVA 4DWIA 2YHBA 3IS9A 3MEDA 5E41A 4DLGA 4M45A 4N56A 3RTVA 3TAPA 5J2MA 1NK7A 1D9DA 3KLGA 2DTUA 4JS5A 4DMNA 1FK9A 4HTUA 4M3YA 4ELUA 4CFCA 2FHDA 4FL6A 4CF9A 4DSIA 4X34A 1J5OA 2KFNA 2M0OA 4TSXA 4DTXA 5HROA 1T8EA 1BGXT 4FLXA 4CJWA 3G0ZA 3MEUA 3QLHA 4E19A 3VQEA 4YFUA 3K5NA 4LSNA 1SUQA 3CQ8A 2IGIA 2RJFA 2LRQA 1CZ9A 2B8AA 1DTQA 1RT3A 2HNDA 2XO7A 4I9QA 3LGLA 4IUTA 2X6SA 4QAGA 4ZHRA 2X6NA 2VWKA 4GY5A 2WOMA 3QINA 4DTUA 3C95A 4AILC 1KVAA 4CESA 4FK4A 2HHTA 4QQDA 1QHTA 3D45A 4CF1A 3QEVA 2O4IA 4LSLA 3HPHA 4RG8A 2JTFA 2F96A 3K58A 1Z26A 2HQEA 2IC3A 3QEWA 1NKCA 1TV6A 4CGFA 4DFJA 5D6YA 4C5GA 2RHUA 3M8RA 5I42A 2BIVA 1LW0A 3T1AA 4HCZA 4QQGA 1GOAA 3P8HA 1WN7A 4I2QA 4WE1A 3KLHA 1XHXA 3UWNA 1A5WA 4OJRA 4HUGA 3SZ2A 5C0MA 1KFSA 3LALA 4QVZA 4E1NA 3HM9A 4NCAA 4I9LA 3QBYA 2FBTA 2IS3A 4W5TA 3QEPA 3MEGA 4DTMA 2NLUA 1D8YA 2K3XA 2RI5A 3AO4A 1ASWA 3F9KA 4AHUA 4UC4A 3NH2A 3RMAA 1NK8A 1L5UA 1LWCA 4GMJB 3HJFA 2F8TA 4CEZA 2DY4A 4JLHA 3TAQA 3MEAA 4BACA 4B8AB 3RR7A 3AA2A 1L3VA 3M9QA 1A5VA 1S1VA 1HQEA 4F2SA 4OLAA 4N4HA 3LYIA 1IKXA 4KTZA 3EYZA 5D6WA 1S9EA 4DG1A 1EETA 3QESA 4M3ZA 4LD6A 1WJQA 3QKJA 4RG2A 2M16A 4N47A 4CE9A 5DMRA 1KLMA 1EXQA 1S9GA 3K5LA 4FLWA 4F4KA 2Q3SA 4FJMA 3CFPA 3S3NA 4CEAA 2RI2A 1VSIA 4E7KA 3CM6A 3DLGA 3ZSXA 2D0BA 4N5SA 3OYMA 4B9WA 2PY5A 1X9WA 4PQUA 3KTQA 3ALYA 4CGGA 4KRFA 3WNHA 3IAYA 4A4EA 3OYEA 4E7LA 5HRRA 1S1WA 3HO1A 3LWLA 3NCIA 2VG7A 3NGYA 3WNEA 4FLUA 3QEXA 1BQNA 1ZBLA 2P51A 2G8KA 4ICLA 3THVA 3TI0A 4KHQA 4CJUA 3OMGA 1WSFA 3WNGA 4FLYA 3LP0A 4KAZA 2D9TA 4FZYA 4FJ5A 5HBMA 4E0DA 2RI3A 3E9FA 4OKKA 1JXEA 1BI4B 3LPTA 2Z1JA 3HP6A 4KFBA 3LZIA 3U6FA 2B6AA 2X35A 3SQ4A 4BDPA 4Z0UA 3OYDA 3TABA 1LV5A 2B5JA 1RI0A 1J54A 1MU2A 1SKSA 1TGOA 5KGWA 3KK2A 4E7HA 1L3SA 4L8RB 4KI6A 3LWMA 4O44A 4OKJA 3VQ7A 4CECA 1QTMA 4KI4A 1Q8IA 1WJRA 3HYFA 5J1EA 2QQRA 4FK0A 1TVRA 3PFSA 4CRIA 4CJFA 1TK5A 2MWPA 1JLEA 2G8VA 3KD1E 4CGJA 1J53A 3C4SA 1H3ZA 4OGEA 5M9OA 4ZTJA 3MEEA 3MP6A 1TL3A 2E6NA 3VQ4A 4CEFA 3VA3A 4LD0A 1NOYA 3SUOA 2Y1JA 1WAJA 1TKZA 1REVA 3IRXA 3TAMA 3AVFA 3AVIA 3U3GA 3V1OA 3B6OA 3QIIA 4L59A 2KQ2A 1RNHA 2RJDA 2G8HA 2YNGA 2RN2A 4FW2A 3VQPA 3VQCA 1RTIA 4CHOA 3VN5A 3V6DA 4KPYA 4RW8A 4IG0A 4NYNA 3AVJA 5SZTA 4DU1A 1CXUA 2QKKA 3LX7A 4K8ZA 2LTOA 2Y1IA 1X9SA 4PUOA 3AVNA 3PMTA 1NOZA 1IKWA 3IG1A 1A5XA 2R58A 3F70A 2X78A 1QSSA 2HHSA 4CFBA 3O3HA 2RJCA 2JLEA 4ELVA 4JRQA 4BE0A 3DB4A 1D5AA 1WAFA 2P1JA 3AVGA 4F2RA 1KVBA 1VSLA 2IOCA 3K59A 4Y1DA 3SPYA 4DQIA 4W5QA 4CEQA 1U48A 4CJQA 4H8KA 1CZBA 4CF0A 4DSEA 1WNSA 2RO0A 3AO5A 3KK3A 2G8UA 3SNNA 4B9TA 3F73A 3RMCA 4HHTA 4Q0BA 4BE2A 3NTHA 4CJ5A 3OYJA 3MXJA 1WLJA 4FJHA 4AHTA 4F3TA 2BKDN 1KHCA 1WSGA 3VQ6A 3HP9A 3KKRA 3G10A 4DS4A 4AHCA 3ZSWA 5KI6A 1S1TA 4CFDA 4E89A 2KZZA 4E7IA 3OQ5A 3DLKA 2RHIA 5J2QA 4HCCA 2LDMA 3KD5E 3NNQA 1TAQA 1LW2A 1U04A 3VQQA 3PX4A 4QW2A 3AVMA 4IG3A 1JKHA 1HNVA 2R57A 1QS4A 3E01A 4KB0A 1NJZA 3ITHA 4Z4FA 3BDLA 4A4GA 3M8SA 4DFPA 2EQMA 3MEVA 5KE2A 2HVIA 3DRSA 1SL0A 3JSMA 4M3TA 2VYTA 1UAXA 3DMJA 3I0SA 3PY8A 3ASKA 1OYXA 2QQSA 4FK2A 1ZBFA 3S9HA 2WACA 2OPQA 1ZBIA 1OZ2A 4XIUA 3L3UA 2L3RA 1C6VA 1Y97A 4ID5A 1RBUA 4CEBA 2EQUA 3V9XA 3V1RA 1TK8A 3BDPA 1F21A 3NH1A 3EAEA 5FROA 4AHRA 2D5RA 5HRSA 1G5VA 1SL1A 3DRPA 1ASUA 1RBTA 3DOKA 4FVMA 5HRNA 3VA0A 1KRPA 5CYMA 4KHWA 1HYZA 3VQ5A 2DIGA 4MFBA 5FRMA 1RT2A 1VSDA 3KK1A 4CJKA 3AVLA 4KKOA 4CEOA 4DQSA 3K57A 3TAFA 4B9UA 4OLBA 4NZGA 3QJ6A 2KTQA 4EZ9A 4O0JA 2GFAA 2YRVA 4FJ8A 4NYFA 4ELTA 4DQRA 4AH9A 1XHZA 4O5BA 3OA6A 1RDBA 4HUEA 3RRHA 3P8DA 1B9DA 3V9ZA 3V81A 4GVMA 4B9NA 4CJLA 2M1HA 4FZXC 1I3AA 2Z1GA 3AO2A 1RT7A 4IUUA 1BCOA 1FXXA 2BANA 4W5RA 3S3MA 1EKEA 4CJVA 1CLQA 3L2QA 2GF7A 1VRTA 3HL8A 1W9HA 1C0MA 1RILA 4DFKA 1RBVA 2HHVA 2JGUA 3OS2A 3MP8A 2ZD1A 3OJSA 4LH4A 4BWMA 3HXMA 4CHZA 3H6ZA 1UA1A 1T05A 1Q9XA 2HW3A 4QQ6A 3D0PA 3OYCA 4B08A 2BGGA 3L3VA 1WGSA 2QXFA 4CK3A 1RCHA 4FJKA 1X1PA 1XC9A 3KKSA 4W5OA 2YKNA 3I0RA 2DFHA 3NF9A 2IG0A 4E1MA 4CF2A 3AVHA 3PNWC 3C94A 3QERA 1GOBA 3NF6A 4C8LA 2O4GA 3P1GA 3UIQA 5IN1A 3DRRA 3H08A 5EU7A 3V1QA 4JS4A 2BDPA 5KE3A 2XY5A 4DF4A 4FJ9A 3LAMA 3LAKA 4FLVA 3OYHA 4KHSA 4KHYA 2PYLA 2IDOA 3SQ2A 3SQ1A 1DLOA 3QIPA 4EDUA 4CERA 3FDRA 4CHNA 1XNIA 4DU3A 3AO1A 3E9GA 2B4JA 2G8FA 2AJQA 2LCCA 1KSPA 1KVCA 3ZSQA 3KIOA 3AO3A 4LH5A 4UQGA 1TL1A 3DLBA 5D3GA 3T19A 4CFAA 1LWEA 3ZSVA 3ZT2A 4CEDA 1HNIA 3NGZA 1RDDA 4DTNA 1SL2A 4EP5A 4KREA 1C1CA 1QE1A 1CXQA 4FJIA 3ZSOA 4KO0A 3AVCA 3VQAA 4DQQA 3NFAA 1RTHA 4C5HA 1IH7A 3LH0A 2OPSA 3LP3A 4NCBA 3NF7A 1U47A 4FJGA 3P83D 4K8XA 3KLIA 4RW9A 4IUVA 3V9WA 4Q5WA 2FBYA 2XK0A 4G1QA 4FM0A 4J2BA 1HYVA 3AVAA 4DTOA 5CIUA 1NK4A 3LDSA 3C6UA 4CIEA 4FCYA 1RT4A 1U45A 3L42A 1ASVA 1S6QA 4ID1A 4N4GA 2O4XB 4DTRA 1L3TA 1T7PA 1JLFA 4M41A 3ASMA 2EX3A 3HVTA 4CCHA 3FC3A 2YNIA 3ZEHA 4H4OA 4OKEA 4IDKA 3OYBA 2JZ2A 2XY6A 2EFIA 2FC0A 3TANA 3A2FA 2CKKA 4O0IA 1K6YA 3ZSZA 3LZJA 3AVKA 2DFEA 4CJ4A 4M3UA 3SPZA 5C25A 1HPZA 1WSEA 3NAEA 3RMDA 1NKEA 1VK0A 1YTUA 2A1SA 4DFMA 4C8KA 3NTIA 5KTQA 3B6PA 4BDZA 4IUQA 1HRHA 1JLCA 2PYJA 2YKMA 4KHUA 3MEWA 1BIZA 1C1AA 4Y1CA 3DLRA 2ATQA 4EZ6A 4F8RA 2L8DA 2E4LA 4CK2A 3NH0A 4FJ7A 2ZQBA 3BGRA 1S1UA 3S6WA 2RJEA 1WSJA 3SV3A 3HPOA 3DB3A 2ETJA 3NGIA 3RRGA 4FJXA 2RHZA 2YNHA 3HSTB 4HVJA 3OS1A 1IO2A 1GOCA 3V4IA 1ZYQA 1U4BA 5J26A 3SV4A 1NK5A 3SD4A 1LAWA 4KB1A 1C0TA 3QEIA 1FKOA 4B9XA 3TARA 1N5YA 2HHWA 4OVLA 2A1RA 2X4WA 1KFDA 4AHSA 3MXIA 2VWJA 3ZCMA 2L89A 1NK0A 1TKTA 3EZ5A 3SCXA 4W5NA 4GW6A 1BQMA 2IAJA 3OYIA 4C8MA 1BL3A 3AA3A 5JS2A 2HNZA 1Q9YA 5IAYA 3OYAA 2E6LA 4KTWA 3CM5A 4ZTFA 2X4YA 4PLIA 4CGDA 4OPJA 2QK9A 1DTTA 2DIQA 4RW7A 4CJPA 2R7YA 2Z1HA 3ZSYA 4R5PA 1RDAA 2P0KA 4FXDA 2OPPA 1D9FA 5KCHA 1HMVA 1VSMA 3RR8A 4IKFA 3AA5X 2DAQA 2KW4A 3PX0A 4DSFA 2KZMA 5C6SA 2OA8A 3AVBA 2Z1IA 5CZ1A 2X74A 2XDPA 1VSHA 4CHYA 3O8VA 2GV9A 3OYFA 2E5QA 3KUFA 3ZT3A 1XI1A 5HP1A 1OZ3A 4C5IA 4KV8A 3ZSRA 4KTQA 3OY9A 4CJSA 1NJXA 2YNFA 3ZT0A 3CFRA 4DLEA 4LY7A 3Q1JA 3LPUA 2HB5A
chains in the Genus database with same CATH superfamily
2VKNA 2PJPA 4O3MA 1H1VA 4B3SK 3NBPA 4FYWB 3LDNA 3GTMJ 2LBFB 1LWFA 2P9UA 2I5JA 3OSFA 4BJTA 1U49A 4G9YA 2CZ1B 4C2UA 4B22A 2QBYB 2N8GA 4I7FA 4Q5VA 1JBMA 3F6OA 2RQRA 1VNDA 3HOWJ 3TTFA 2ZJPL 5FPEA 2LF7A 1C0UA 3IH4A 1ABOA 2P84A 4NC8A 1KCFA 4A4FA 1VQ7I 1XNRK 2IA0A 4XKBA 3PIPA 1G15A 3SI6A 2Q0OA 3SQNA 3MPUB 4CHQA 2DZCA 1N32K 1VQOQ 1F4KA 4N4IA 1IV6A 1VRLA 1GLJO 2JS0A 3OB9A 2EFQA 4MMKA 3MKLA 2A61A 3DBLB 4XQ3A 2M0MA 4UUTA 4U67L 1RBRA 1WJSA 1RKWA 2GBZA 2PZSA 1Q86C 1X3UA 3ZT1A 1U5TC 2QYOA 1G3WA 4IEEA 4HRIA 1AWCA 1UEBA 1VSFA 1JTXA 4B9MA 5GANf 1VOMA 5EZHA 3OS5A 2NUZA 4PKIA 1EH7A 1GCQA 4EHTA 4J9HA 5KH6A 3N4MA 3DXMB 1ETWA 3I55I 2BY1A 3KJVA 3GZ5A 1F5TA 3CJAA 3M56A 4C0GA 3R6SA 3CYMA 3EE8A 4GDFA 3ZLJA 3L2RA 5J39A 1WXTA 4O55A 2MW8A 2XAGA 3TWHA 2YHBA 1X43A 3RTVA 2L4AA 5KPTA 1Z9ZA 1VQ8I 2JPBA 5GAN7 4OIQF 2M0OA 3RSEB 5GANg 2JMCA 3DV8A 1K8AU 1CZ9A 4M63C 4K2EA 4MHGA 3OSGA 2ZF5O 3P31A 4FK4A 4FWKA 3KBGA 2F6CA 4DFJA 3RMSA 4OOIA 3J7AP 3JV3A 2E10A 4DQ8A 3U2RA 3L4QA 4WCEL 5CVUA 3E6MA 4D1QA 3MEGA 2R7DA 2VKEA 2WADA 3ID6A 4LITA 4JLHA 4ZJZA 5KYXB 4RTFD 1VQMI 3VETA 3S1QJ 3QYBA 3FMSA 2WUSA 2XROA 4CZLA 4HCKA 2RI2A 4E7SA 2DFIA 2DL5A 2HBJA 3A0IX 1CZAN 1E4GT 3A01A 3CW7A 3GBGA 3LWLA 5KNLA 2Z2SB 4KIFA 4IRHA 1IRZA 4BJ5C 1WSFA 1ZREA 4KH1B 4FZYA 5F6FA 3GZ6A 5FB2A 5E26A 2Q1NA 5B8HA 3OYDA 4L8RB 3CDIA 1NK3P 4LB5A 3BZCA 3HYFA 2NNWA 4CRIA 5A2QK 4CJFA 1K6OA 2A07F 3ML6A 3RI4A 3ISPA 2ZB9A 2G8HA 2CUDA 4G94A 4EAHD 2ZSIB 2QWOA 3M0TA 1U78A 5E84A 2LP5A 1Q18A 3EL2A 2E7WA 4O6JA 1SFEA 2WV1A 3DPTA 3ZQLA 2GBQA 4H8KA 4ABZA 4E6RA 4Q0BA 2BTFA 1MBEA 1XD7A 4Z89A 5ICEA 1FWZA 1ZHIA 4PJOG 1VQNQ 3GEZA 1PUFB 3E5UA 2O3FA 2LNVA 4JRIA 4M75D 3TGNA 3DQVC 3KEYA 3V7RA 3MX5A 3E1SA 3MCAB 5FFXA 3ZMVA 1W2BS 3DOKA 4FVMA 1W70A 3VQ5A 2MABA 3CMAI 2L7KA 3CCUT 2R7QA 3VGLA 5IPAA 4BHPA 3FBNB 3VYRB 4A3LJ 1K0XA 1IZ1A 5KYXA 1OU9A 4B3AA 1B9DA 4YY3K 2LOOA 1HOMA 4B6MA 4GLKA 2FSWA 4OMQA 1RBVA 3HM8A 2DD4A 1QCNA 2HW3A 4CHZA 2DTOA 3P9IA 4CBWA 4JUVA 3CCQN 5BS6A 1FOKA 3WEEA 1KU2A 1WHKA 2PBIA 2DFHA 2W4SA 1XGNA 4MLHA 4XTXA 2KDZA 4PKHA 1X1AA 1RPWA 3F2KA 1Y39A 1QZYA 3FJPA 4EDUA 4CERA 4DBQA 4R79A 5D3GA 3BPVA 4KT6A 1J9IA 4A6DA 4AI5A 4B1VA 3NFAA 3FZFA 4X6AJ 2NXNB 3BDUA 3K9TA 4II2A 4K8XA 1KQ9A 4KIGA 4FM0A 2L0KA 1ASVA 3FGUA 1RLPC 1P4XA 1UGPB 1U2VB 1QQJA 3ZEHA 3FBIB 4IDKA 1QW1A 4L9JA 1ORKA 5KAIC 4PJOD 2LY1A 2CT4A 4BC3A 4IIOA 3R4KA 3G0QA 3M57A 4E1JA 4FWQA 4NO7A 3B8AX 2CMPA 2EA4A 4D8KA 1XOVA 5LGUA 3ZX3A 2RHZA 4Z4FA 2NOJB 4CUGA 1TP4A 3BDDA 3MXIA 2W6KA 3MMVA 2VWJA 3WHCA 1KXPA 3AA3A 3Q0UA 2VUBA 3CUOA 1ARKA 3NVKA 1K0SA 3EDPA 3M1EA 5ADXH 1OR7C 2VOPA 4CZMA 2O9VA 2DCEA 4QIWN 4HTLA 2E5QA 1NJXA 2YS9A 1VZ0A 3ZMDA 1OI1A 2V1NA 1YIJA 2XAHA 2YWWA 4EP4A 3SUPA 4MZMA 3DM2A 2OTJN 4NBQA 5BPIA 2QBYA 1VQ4Q 4HLXA 2LNHB 1IG7A 3AGRA 4CJTA 1J2XA 4C23A 2L2PA 1FJGK 2BUDA 5CQYA 2M3AA 1LFBA 1VQ9N 5E1ZB 5LJ3h 2DLPA 1T08B 3LL3A 2EZKA 3ISNC 1P59A 2D0CA 5J3BA 1AWOA 4FM1A 3E6CC 2Q36A 4IJAA 2LH9A 4L6V5 3Q9VA 4C3HJ 3LP1A 4DR5K 4YFXF 4A3CJ 5FD5A 5DK5A 3H1CA 4FASD 2V4JC 3CUQA 4A0YA 2XKOA 2E1CA 3I56Q 1V5EA 2ZPHB 1EP4A 4RAZA 5AFUA 4GGGA 4PA1A 4IURA 2Z16A 5IYDJ 4DBFA 2V79A 2YUNA 1YHQT 4C8QA 1TBXA 1UWBA 4C0DC 2E2QA 1I1JA 2LVMA 4M77F 4RCHA 5CYQA 1SKUB 1R0AA 3D6RA 3CQTA 3KLNA 2CV2A 5BN8A 3OOPA 4MEXF 2L0AA 3QNNA 4DQPA 2E35A 1HKQA 3O5ZA 2ECZA 3TW6A 4FJJA 3SAFA 5ILVA 4B23A 1VSEA 1VQ9T 4BGBA 4A6EA 2PMZA 2RNJA 3QIOA 1WA7A 2LCLA 4BXUA 1HJRA 5GINA 3VRYA 2GXGA 2RDPA 5I3UA 1QVGM 1QNTA 1HBXG 1SKWA 1WZOA 3GOXA 4WXDA 5KRTA 2EBIA 1X3NA 3OYNA 2FVUA 2XRLA 2DYRH 2HTJA 1SAUA 3WGHA 2IA1A 4RGSA 3IH2A 4DZJA 4KUDK 4DEYA 2WAFA 2BZYA 3RDIA 3T1YK 2XO7A 2OJED 4Q5SF 3MKWB 3SK3A 1UB9A 3S1RJ 5EYRA 4DTUA 2HHTA 1SF9A 1KVAA 4CESA 4LSLA 2F96A 2CUEA 1NKCA 3PVQA 1SL1A 3ASOH 2PYJA 1Z9QA 5JHFA 5C0MA 4CYCA 1VQNT 2MC3A 4M78E 4IO9L 3JB9G 3QPTA 1FBUA 3X20B 3CCSN 4CE9A 1T0FC 1Q86U 4EJWA 3UPUA 3CFPA 1DU0A 2HTSA 5GAEJ 1DUXC 3AGKA 3KTQA 4KITB 2J4RA 3IAYA 1YF5L 2AHJB 4J6YA 1BQNA 4NL3A 3ENBA 2OTLN 3MK6A 3BF1A 3MN7A 1BIBA 1HNZK 2IIMA 1HJOA 2JHJA 3AAPA 4BRPA 1WDXA 4JI4K 3U6FA 4JJCA 1L5UA 1FOWA 3C18A 2E88A 2B5JA 1VQ8A 1Y0MA 4KI6A 4CECA 5J1EA 2Q2EB 4BRDA 1KG3A 3C4SA 4BY7J 5BR8K 3T9NA 3OTOK 1Y96B 2R0QC 5DV5A 4M77G 5CKDA 2HYFA 2CW7A 2YRCA 1O3QA 3H1VX 4GV3A 4X65K 3H35A 4WYBA 1LFPA 2VWFA 1WCMJ 3AVGA 2Y0MA 2PUKB 2DMTA 4DQIA 3SWNB 4DSEA 1B7TA 1D4XA 2O7OA 1JXMA 1Q82R 3VQ6A 3D5SC 3RR6A 4CFDA 3CJ1A 2D1HA 4M6YA 4IG3A 2BXYA 4DFPA 3C7JA 4XRSG 1WHHA 1IAWA 4F91B 2V7FA 2QASA 3WODF 5D5XB 4A3JJ 4M7AB 3EG2A 1C6VA 4CD1A 3ABKH 1LEBA 5J1RA 5F04A 1D3BB 3VB2A 1K8AO 1MBJA 3DRPA 2YT6A 2HAXA 3EFOB 2LG4A 3VYGA 1X58A 4LC9B 4AFZC 3MCPA 4YORA 1KQ8A 4YOQA 1X6BA 5E3NA 1N9SA 2LQKA 1VUBA 5B5EC 3I56I 1ETXA 4LFBK 4OIOF 2V8JA 2KPMA 4CJVA 4EEFG 3S16J 1UG1A 5CPRB 3IAM2 3J7AY 5A2QZ 2VE9A 2QXFA 4FJKA 2Z5UA 1X4PA 3KKSA 2YKNA 3NF9A 2ZMEC 4IXAA 1JU5C 3M0RA 3H08A 3LW5E 1TW2A 2V1DA 4XH1A 1K61A 2IDOA 3FDRA 4N4OB 3RQ4A 1IRXA 1OULA 1E7OA 5E3MA 3DLBA 2ZPIB 2P9SB 5FO5A 2QW9A 4EP5A 2XGEA 2CSOA 4M3DA 1A0NB 2DVEA 1CXQA 1V4RA 1KK7A 3WXMB 4LUEA 3CCQT 2DZ9A 2MBFA 2HMPA 3LP3A 5DEQA 5LJ5h 4IUVA 2L02A 5DM7R 3AVAA 3CLQA 3R8EA 1MH4A 3CCJI 2BVLA 1T6DA 1SC7A 1W0UA 2D5VA 1C6VX 4DA4A 4EW0A 1JJ2A 1M1KU 1KD1U 2QM3A 2YLBA 1M1EB 1WNLA 2FBIA 1HU0A 4P9UA 3JCMc 4BDZA 4LNPA 1XQPA 3HJEA 2E1MB 2CT3A 3LSGA 2DE0X 2HYGD 2ATQA 3NH0A 2WBMA 3FKIJ 2CV1A 1W6XA 2ETJA 3NGIA 2K57A 1U4BA 2LZ6B 4DUZK 1KFDA 2Q2RA 5KN9A 5A0LA 3ZN0A 1Q9YA 3X25B 3KEOA 4ISGA 2O8XA 4LJZF 2FBHA 1HMVA 4A62A 4ZYDA 4XLEA 2QEXA 5CZ1A 1VSHA 5GANh 3O8VA 3H5NA 2EZLA 2GWRA 2VBWA 1VYTA 4CI0C 4R55A 4XAXB 1YHQQ 1JJ2M 1HDPA 5D7UA 2L01A 1S72Q 4AIDA 4J2AA 5TKWA 2LJ3A 3AFHA 1VQON 3MXMA 5KN8A 3FM5A 3UA7A 2KQRA 3IWFA 2DPUA 4KMFA 3JSPA 4O4GA 3L8BA 5IT9O 4ITVA 3H9QA 2V1UA 5CZ2A 4FPAA 2ROLA 2XASA 1LWVA 2IVMA 3OMCA 4DF8A 1UGRB 1N8RU 3DLMA 4CXFA 3A02A 4D5CA 1TUDA 2BZTA 3TBIA 2CFXA 1WFWA 1BISA 1ZG1A 1W1WE 3SDZA 1Z05A 5KYWA 5DY9A 1B92A 4ZGDB 3L1PA 1VQ4T 4GKJK 1RUWA 2EH3A 1HK9A 2D0NA 2YHAA 4A3DJ 1HCRA 1FSEA 3REAB 4L5EA 2Q0RA 1CKAA 3FXOA 3VTIA 3RCOA 5AQRA 5M1QA 4IFEA 4LFAK 2L2OA 1JL2A 1M1KR 2ADUA 1HPMA 4DK9A 3VEXA 4FYXB 1JKRC 1ZBHA 1TXQA 1OYYA 3ZT4A 4EM2A 2EFPA 4CYCB 1VQ7N 1LVAA 2OA4A 4FJNA 1MHNA 1ZSZB 3CD6N 3MAJA 2OPRA 2XHBA 5C42A 3LCNA 3J80K 3CVSA 4C8OA 2RHYA 2K3YA 2XI9A 3M1FA 1VQNI 1Q1VA 1Z7UA 4CHPA 3ZYYX 1JCFA 1S3JA 3VQBA 4MO7A 3P8BB 3TR8A 4ENMA 3QPHA 4IJNA 4BRCA 2QCOA 2NNNA 4AYBN 1S8NA 3K70D 1VRUA 4HV5A 2DO3A 4V19K 4ETSA 3V7SA 5AQJA 2E64A 1K73C 3KZZA 1IXCA 2EIMH 3QBXA 5EGOB 4PDKA 3VU3C 4DLGA 4DHYA 2EFNA 1R00A 4DTXA 2YLCA 3HFOA 1W0TA 3K5NA 3CC4A 1KYZA 4N9IA 2ZGYA 1UHFA 2LQNA 1Q7YC 3O8GA 2DXBA 4DR1K 4XTVA 4HF0A 1TV6A 4A3IJ 4Y33A 3MN9A 3EKSA 2Z3YA 3GOIA 2WFBA 4I9LA 4RGUA 2YHWA 2GWJA 1LWCA 2A3ZA 1MA9B 3DP7A 2RAEA 3M6GA 2F2EA 1KU7A 3THKA 3NMZC 4ZYEA 3VWBA 4EMKB 4N47A 2O2OA 3CBOA 3G25A 1JHHA 3S17J 3G6ET 3FZHA 2D0BA 4LD5A 4KGXB 2YX4A 4A69C 2H27A 4M7YA 2VG7A 3OH9A 3RKWA 5FLXO 2ZJRF 2W7NA 4FLYA 2HOTA 4E0DA 2UXNA 3LPTA 3JB9J 3SQ4A 5IT9Z 1YITA 5M1PA 4L9VA 5K5QA 4OIRF 1PSEA 2RN7A 3PJRA 1QP2A 2FF6A 4M6VA 2KNBB 4KHPK 3WXKA 1JLEA 3R1XA 2MH9A 2O01E 3CWSA 1Q81O 2MD0A 3W6VA 2E6NA 2L9SA 1G3SA 3DKWA 1YTYA 2NVXJ 4XKVA 2M1BA 5HODA 1IREB 5IH2A 2LP0A 3AVJA 2QKKA 2KSSA 2QAZA 1VQ8Q 2V9VA 2PVGB 4GYGA 4CC2A 4KIBA 1SD5A 4BE0A 4BB7A 3CD6A 2HVSA 3BEXA 1XN7A 1CZBA 3DTIA 2KEAA 5E20A 3NMUA 4IWVA 1BR4A 2FB7A 4NLCA 4FJHA 3R60A 2OTLQ 4AHCA 4XLPF 1ATSA 3J8AA 4XN0A 3EH2A 3NNQA 5I2MA 1TT5B 2YX7A 2CGJA 3LMMA 1UHSA 2LKXA 3LSJA 2CW8A 3KXTA 4FWPA 4LGWA 3SFZA 2VN2A 4XLCA 3WVDB 5GMKm 2WACA 5C3EJ 3B73A 2BV6A 3CJQB 3RJPA 3EN9A 5CVVA 5B3SH 2DIGA 1TWHJ 1VSDA 3KK1A 4CJKA 3CCLN 3TAFA 5EG2A 3REOA 4OLBA 4BUGA 2R7XA 4NYFA 1ENHA 4AH9A 1E6HA 4FZXC 1I3AA 4K0KK 4OIPF 3IL2A 4IUUA 2DETA 5AQUA 3OHRA 1Y0NA 3OR1C 4EMSA 3MP8A 4YOTA 1EA3A 4JKHA 1RESA 2M02A 4PJ0C 2V6EA 4CF2A 1RI7A 3NF6A 1LWWA 1HKGA 1ZG3A 4YFNF 3CJBA 1FZPB 5F0HA 2WTEA 3I5SA 2VBXA 3BOQA 3LAKA 3KWGA 2J6FA 2IA2A 3CCSI 3FWEA 2LREA 4PFOA 4CFAA 4CEDA 1RDDA 4F92B 4CBUA 1M3QA 4HVUA 1M2OA 2DTZA 5EX5A 4CCMA 4HPQA 4JJDA 4JNEA 3J7AF 1AOJA 4HOBA 1R58A 2MSYA 4OMLA 3SMPA 1ZUYA 2NUPB 3AKZA 1LDKB 3F5TA 2TDXA 4EFHA 2FYKA 3UKUA 2XY6A 3C7NA 4RMOA 2Y4XA 4L18B 3M0UA 3RMDA 4DEXA 4L3QA 1D09B 3S2DJ 4UB8C 4IUQA 4AIJA 4QS7A 4CCJA 2P0PA 2HEOA 5L3GA 2QWPA 1KHIA 4DR3K 2HU9A 1O13A 3NEUA 2IIRA 2O61A 3M54A 2COWA 2BW3A 4K42A 1LJ9A 3OBYA 2Z99A 9ANTA 3ZRGA 2HNZA 2XD0A 4RM2A 4XR6A 3T0YA 2KMUA 2X4YA 4LFUA 3IMXA 1DTTA 1X3ZB 2DL4A 5LHIA 3QFUA 5KCHA 1GXQA 2DAQA 2KW4A 1FC3A 2Z1IA 1H9TA 1ON2A 3R61A 5HP1A 3IFRA 3ZN1A 3QO3A 1UHMA 1YVUA 3M8JA 1OV3A 1B8IA 3LAJA 4B1ZA 3AY9A 1HR0K 4JX4A 2H8WA 2XB5A 3MHXA 3LA2A 2K02A 1X01A 3ZP5A 2DOAA 1GCPA 1OQKA 1X2KA 1VQLT 2FO0A 3AV9A 2RHXA 2DTRA 4I6ZA 3DOLA 5HLTA 2NRXA 4JP0A 3H3UA 2BE7D 4EPCA 4M7AF 2JQ7A 3L1AA 3G6EA 1MMGA 4ILHA 1RGIA 3L2WA 5M5WJ 4FQGA 5TGTA 5H2FC 1KAZA 3S3OA 1NM1A 3A5LC 5T7BA 2HNYA 2RQUA 2DPPB 2V51B 1JKQC 4IUPA 1L3LA 3WNFA 5JS1A 4IOAF 3HFNA 3VOEA 3N5NX 2W04A 1WBBA 3H9GA 3VS3A 5ICGA 5GMKj 2R7FA 4C8QF 3ZQ7A 3SHWA 1R5HA 3D7SB 3HK2A 1HLVA 3TO9A 2GX9A 1V55H 4IBNA 2LQ8A 1DU6A 3JYTA 5J2NA 1BI0A 4IF4A 3U1DA 4RGXA 1XWLA 2NRWA 4RAGA 3MQ0A 4XSXF 3ASNH 2P5GA 3NHGA 1PC0A 2I10A 2YHYA 1RKTA 1QKWA 5CHIA 1L3UA 1UHCA 1J5YA 5HDGA 2DMOA 1S29A 2NOZA 1HYSA 4CGHA 2L9RA 3UT1A 2OPTA 1IN8A 3HVRA 3AHUA 1ZYRF 4M45A 1V5GA 4JS5A 4DMNA 1QA6A 2WSFE 1W4SA 3K0SA 3LDQA 1RT3A 2DN0A 4PNOA 4EVIA 2JJ7A 2RMOA 1BJZA 3LGLA 1MH3A 4P5OA 1KQJA 2K3FA 4U0YA 4M75C 1QGPA 3JRHA 3OOUA 1Z26A 3UNGC 2IC3A 4IHSA 1K83J 2VONA 4WE1A 2V7ZA 1KFSA 4ANJA 3A03A 1KAXA 5LJ5f 1YO5C 4J6XA 4RA2A 3F22A 4H0VB 1UJYA 2CP3A 2Y31A 3QB0A 2GWKA 1BJAA 1VQ7A 1QVFA 4RUGA 4FJMA 3CC2N 4M7DC 3OYMA 1KD1R 4M78B 1SEMA 3WNHA 1KQSP 4A4EA 3WU0A 4FLUA 3QEXA 3SEZA 4ZYGA 3TI0A 2DRMA 3HRSA 4DYCA 5AQWA 1XPXA 3IH7A 2P9LA 2Z1JA 3JCMW 1IN4A 4UHTA 1R71A 2V26A 1SKSA 1TGOA 2W0ZA 3JCMe 5EF6A 1R5ID 2K9SA 2K5IA 5C0YA 4XEIA 4W97A 1WJRA 5GAOn 3E0JB 1QCOA 3KD1E 3KTUA 4JJNK 3UE5A 1RNLA 2A7YA 2PJRA 1PG5B 4PFZA 3GFMA 3BR1A 4Y28E 1BW5A 2X9DA 4BHBA 2FZCB 1XMKA 2ASOA 4LN2A 4EIAA 2CUBA 1E4FT 5L3EA 3DB4A 2A05A 4EMHA 4J9GA 4CF0A 1OH5A 1SHFA 4XTZA 4XONA 3H0DA 3LM2A 1G2HA 2KHMA 3OYJA 1WLJA 4IO9F 1NJIO 2J5OA 1YJNA 1M27C 3H0HA 4JAXA 1NGEA 3QICA 1WJDA 1NWKA 1P6RA 1EFNA 5K7HA 3CD6Q 4YOYA 3JS6A 4HDVA 2VGNA 3H5RA 3PY8A 3I59A 2KIUA 1ZBIA 3J7AO 3E1YA 2P9KB 1HX1A 2LX9A 5FROA 1G5VA 3FDYA 3EGXA 4HEA2 4WF9L 3AVLA 3KP2A 2GFAA 4DQRA 1XSVA 2M0YA 1P8ZA 2KDOA 3B6AA 4A12A 3AO2A 1RUNA 2GIZA 3I64A 4BKXA 1HW2A 4UVAA 2OF7A 2V1QA 5GAN6 4DV5K 1UA1A 1A5JA 3GTKJ 2FSKA 3WHBA 3DEUA 4LFCK 3I0RA 4P1WA 3CCJT 1SVOA 1H641 2H3JA 4FLVA 1OOTA 3O8MA 5AQYA 2HYJA 1M8MA 4DU3A 3VS4A 3ZSQA 4DYQA 1JTYA 3W3CA 2PI0A 4A53A 2L3QA 4CCLA 4IQ4A 3R0JA 4H0YB 2DRKA 1ZGAA 4XRFA 4J2BA 2HBMA 3QJYA 2EWSA 3S15J 4CIEA 2KIQA 1A6IA 2JA7J 2AZVA 1WEFA 4BQOA 1WBDA 3I9QA 5F27A 5AT1B 3ZSZA 4CJ4A 4M3UA 2LCSA 5C2DA 2A1SA 2M5WA 4DFMA 3A8HB 3WXLA 2E1OA 4DB3A 2E4LA 1FOYA 2DMUA 4JI1K 4WFNL 3HPOA 3E9PA 1WQ2A 1M30A 1ZYQA 3D4VA 3NRVA 1FKOA 2M4KA 2X4WA 3EG9A 4ILJA 2IAJA 1Q81C 1BL3A 2LD5A 5AQLA 2NS7A 1HNXK 2CV0A 3CXCP 4A5MA 3V8LA 2R7SA 3IAS2 3GFJA 1VQOA 3KP4A 4IKFA 5JLXA 4CSWA 3CJ9A 5C6SA 4E9HA 4BH9A 1WHGA 2SEMA 1AKHA 1FPQA 2BBYA 1O3SA 4OB2B 3CJ7A 1VA7A 1NLPC 4YIIA 2DI3A 1YRNB 2EZIA 2QKMB 4NB5A 4EJZA 3TAGA 4ESFA 1GVDA 2NUBA 2FBVA 1VQ5N 2VXEA 3QXEB 3ZFJA 1NEGA 5LLQA 4Y13A 3H9NA 3QG1A 5LY3A 4EMKC 1RLQC 2HZYA 4AYBA 3T1BA 5FWBA 4MFEA 4Y3OA 5CAIA 1UTIA 1BIAA 4BRNA 1U2VA 2ZXHA 2DA7A 1KO9A 4QVCA 2NVYJ 1J59A 2RF2A 4BBRJ 2V7YA 2JT4A 4KH6A 2HSTA 3DXKB 5B66C 2GELA 3HRGA 2JWLA 4CD3A 1YITT 3ZQFA 2F5CA 3M7GA 3CWTA 3C6AA 4PL6A 2K9NA 3FXQA 2L7MP 4M3BA 3EKUA 1X3WB 5GAHP 1T6CA 1ZBUA 3VEZA 1O7FA 1EWQA 3OJUA 3VESA 1SRMA 4C8QD 4QLCU 4A4HA 2QGFB 5IYCJ 4PL8A 4C2TA 2P4WA 4N76A 4KHNA 5FLVA 2LSNA 1NJWA 3CC2Q 1NK9A 2ZJ2A 4K43A 4PCQA 3TQ7P 2XDVA 2DT7B 4CK1A 2FRWA 4AU7A 4LF5K 1MNEA 2A40A 2K9QA 1VQOI 3IS9A 4N56A 3TAPA 4M4ZA 2CRGA 3DKYA 1AHDP 1J5OA 3HTUA 3I5RA 4LF4K 4TSXA 2EYZA 2RC4A 3JRBA 5D8LB 1OQYA 3HOSA 4EJVA 3FZLA 1IO6A 4ZHRA 1P9QC 4GY5A 4R56A 3MKYB 2D2WA 3H41A 1VHXA 2DQLA 4B1UB 3M8RA 5I42A 2BIVA 1XHXA 1A5WA 3K4KA 2FBTA 4BQNA 3L09A 3H46O 1NK8A 2WY7Q 2F8TA 2I0NA 1QZ5A 1VQ6Q 5AQFA 5EJCA 1ORNA 2Q31A 2OQRA 3CCMA 4GV9A 2ZXJA 3K5LA 4F4KA 2BYVE 3S3NA 2OFIA 3DLGA 3EEQA 2IS4A 2F4OB 3WXJA 4C92D 1NGCA 1XQHA 3OYEA 2WB1N 1GFCA 1OKJA 2FQ3A 1TT0A 1ZBLA 3WE2A 2XAFA 2HXOA 3WNGA 1JEGA 4RB1A 2LMDA 5HBMA 1TNSA 1G83A 4KFBA 2HQRA 2ZXWH 1J54A 1Z0XA 3N97A 3LSTA 4BQAA 2ASPA 2VPRA 3VQ7A 2CW0F 2DK5A 4KISA 4XU1A 4OGEA 5JLHA 1TWAJ 4XRSA 3HC7A 3SWNC 2RE2A 2K79A 1REVA 3IRXA 3B6OA 3CCEN 1RC9A 4P96A 5GAN2 3I56A 4PJOF 2Y1IA 1NOZA 3Q9SA 4LLGF 4G12A 1G59A 3O3HA 4DYRA 2R5YB 4HNVA 2ZSHB 3SPYA 1TNTA 2HBPA 1VQ7T 5JMVA 2KKOA 2W10A 3L9FA 4MEYF 2BKDN 1WPKA 2BY3A 2BY0A 3KKRA 5FU7B 4IRIA 2FXAA 3F3XA 3VS5A 2M2EA 1AEYA 4F7UG 5CQGA 4AUXA 4C1NI 3DRSA 3HPWA 3BT9A 2V8KA 2W82A 1IHWA 2FQ4A 1BOAA 3S41A 4M3GA 2NRHA 3I0WA 3BY5A 5JLWA 1HYZA 4NB4A 3SLCA 3HEFA 4ZGEB 4H5NA 4ELTA 3U21A 3HHGA 3OSSC 5BPNA 3HSFA 2Z1GA 1R23A 5BPMA 3S2WA 2BANA 5JR3A 1EZZB 1YYVA 3KLOA 5AIPA 4PKCC 4RAYA 2F2XA 2ZCWA 1VQ5Q 3L3VA 1FP1D 5E3OA 4B3MK 3PNWC 3GNGA 3DRRA 5HCKA 3CDHA 2K4YA 4YIFA 4RCBA 3ELKA 1KVCA 3A2KA 1W1FA 4WXCA 2GA1A 3KZBA 3T19A 4BQQA 1HNIA 1P7IA 3B02A 3IKTA 1JCEA 1NYGA 1RTHA 1K4US 4BRGA 4C92C 3IQLA 4IPAA 5GPCA 2VQCA 1OCZH 4FJGA 3P83D 1G3YA 4FSXA 3ZCOA 5TJJA 3HGYA 1EO1A 4CCKA 2WC2A 3PQKA 3CMAA 1NH3A 3SJHA 1T6SA 3A2FA 5E17F 5TISC 2DBKA 4XOPA 5C25A 1I1GA 1UG0A 2KHOA 2ZFWA 1VIEA 1WHMA 1WI9A 1JLCA 1PUEE 3MEWA 1VQMQ 2WWYA 4BRLA 3GTLJ 3CCLI 2UV1A 3GO5A 4XN3A 2P9IB 1X6GA 2RJEA 1YLFA 3IUOA 1TTYA 2OX7A 1V4TA 4M77B 3RRGA 1TWGJ 3A4CA 2GNCA 2PJRB 4HXJA 2D0OA 5IAYA 1WGXA 3E6DA 3JRZA 5DPKA 4JEPA 1X2MA 1LNWA 2R7YA 1IV8A 3O9SA 1OCRH 1W7PA 1RDAA 3CWUA 5CCAA 2O0YA 3EGXB 4CBXA 2CUZA 2E19A 3AVBA 1YI2A 1OZ3A 5LJVA 4X9DA 3ABMH 4LK0F 3C0CA 2DJZA 2AQEA 1GLNA 3SBTA 4E70A 1VQKN 4BC5A 1XTDA 3JB9H 4DJAA 3BR5A 1DPUA 1N34K 2QWNA 1TQPA 1YX5A 4PSXA 2H56A 1GT0C 4F3OA 2ECCA 2STTA 2VJ4A 5M1KA 5CKTA 5KQDA 1B9NA 2E12A 2VXDA 1RBSA 4JHDA 4M42A 3BJAA 3DLLL 4C30A 1M1FA 5HRPA 1XC3A 1FYKA 1X6OA 4KH0B 4FU6A 4RB0A 1MWMA 1Y71A 1AZGB 4I99C 1IJJA 4NDLA 4GKKK 1BO5O 1RDWX 1H0MA 1WSUA 3I55T 4A54A 3LL7A 3KYDB 2VT2A 1IF1A 4LIUA 3QO9A 3D7EO 1X9MA 3N05A 4BDYA 3LANA 1ZHFA 4HSTA 5LHHA 3VS7A 4J7IA 4F3QA 1Z91A 3CCJN 3ULDA 2DYIA 2BVMA 2VXZA 3RMQA 1S1XA 1OISA 1N6QA 3H8ZA 3VERA 1S5JA 5BRDA 4CEEA 2VG5A 3JCMd 4C92B 2HHWA 3CC7T 4GFBA 3CCSQ 1QZ6A 5LJ5e 1B6AA 3F8BA 1LE8A 3AL0B 2VI6A 1F36A 1KQ2A 3IKMA 4B8CA 4IFVA 1B07A 2BE2A 3MEDA 2EA2A 1V76A 1N77A 3X28B 4Y4RA 1AT1B 5AQHA 4X34A 2VKDA 3EG0A 1D1AA 3I55N 2E65A 3MEUA 2O8DA 4A0ZA 3G1JA 1BA0A 2KZGA 2X6SA 2DPNA 5ELZA 2CGHA 3I58A 3C95A 1HLUA 3M53A 2FBKA 1JJ8C 1B59A 2HQEA 3F8CA 2DFUA 5D6YA 1IUFA 3P8HA 1FIPA 3SZ2A 1BG3A 3UWNA 1DIZA 5H1SQ 4JKFA 3R9PA 4EM0B 4W5TA 1ZUKA 3U9ZA 3SEMA 5BQTA 5GAOm 4JI6K 2Y75A 2DDAA 2C06A 1A5VA 2P9PB 4OLAA 1Y8RB 5HK3A 2LSOA 2LJ0A 4RG2A 3LWFA 1YWPA 2M16A 2W57A 4RAFA 1EXQA 4FLWA 3V8JA 2E8AA 5LRRA 2G0EA 2LYCA 8ATCB 2F2VA 1A04A 2DPDA 3ALYA 3V42A 4Z94A 3HO1A 1N3AA 2P51A 3THVA 2CP0A 1TWBA 4ESJA 2RH2A 5C4JJ 1PP8F 5IT3A 4M7AC 2IVOA 1KG1A 2RPNA 1NJIU 4B09A 4CCNA 4GV6A 5KGWA 2E5LK 3ATUA 5FW9A 2HOSA 1Q8IA 1TK5A 2FD5A 2DDBA 1TUUA 1YAGA 3BLYA 2K5CA 1A6QA 1HXDA 1XCVA 3VGMA 3QIIA 4CHOA 1MW7A 1YXQA 4LXCA 3ZX0A 2XHCA 2HSEB 4PUOA 3AVNA 2HQHA 2YXYA 1IKWA 3CXCM 1LDJA 3FXRA 2JLEA 2JPCA 5I9EB 5EY4A 1D5AA 1YE9A 2ZNZA 1K8AR 4XK4A 4CEQA 3O5BA 1IGQA 2RN8A 3VEPA 4XTWA 2KRSA 4LMYA 1U1SA 1Z9CA 2KZZA 1J75A 4JKCA 1U04A 3PX4A 1LCUA 4J9EA 1VQ9A 1JKHA 3NQOA 3CF5L 2LVSA 1SL0A 4M3TA 3QQAA 1KC8R 3TPQA 3CERA 5AZIA 4PGGA 3O4WA 2JMAA 1J6ZA 3PNTA 4AFQC 2KVQG 1LJOA 3BDPA 3NH1A 1ZR2A 4CW7B 5HRNA 5D6FA 1M3HA 2WB1A 2GEMA 1MPGA 1QVTA 4Z88A 1HW1A 3VPZA 4RTWA 4HUEA 2MC4A 2I5WA 3LDPA 1FXXA 3SMSA 1RILA 4X1EA 2EFWA 2HHVA 2LTPA 1HDDC 3H6ZA 1S6LA 1U2WA 5TRDA 4B08A 1YJ9N 3QYHB 4J5YA 1RCHA 3BROA 1DQUA 3P1GA 3FK7A 3CCEA 4JS4A 1YFNA 5KE3A 1SQKA 2JS2A 5E1XA 3OYHA 3J80O 5LJ3g 2HR3A 2PN6A 3SQ2A 1SZ2A 1OKRA 4B9QA 3WE3A 3D1NI 3ZT2A 1FJLA 4DTNA 4KREA 1QE1A 4IHYA 3ZSOA 2XKOC 4YELA 2EAYA 2LRDA 2D6FA 3U4LA 2O8CA 2W00A 2J5PA 3G1MA 1TYQB 1BR1A 5AQZA 2G6FX 3HOYJ 4RM3A 3FIWA 2KBTA 4DTRA 4KN7X 2O4XB 4M41A 2QQBA 2BXZA 1SAZA 1BL0A 3O9UA 2F5VA 3HL2A 2DFEA 5J6XA 3PM1A 3CCMT 4MLOA 5KTQA 1M4ZA 2QDYB 4FJ7A 4EQQA 4D9JA 5DCFA 3G6EI 3MMYB 1Z3XA 3JB9F 3C2GA 2WY8Q 4EVVA 2HOEA 3SV4A 4L5IA 3EGDB 2MK5A 1I07A 2OU2A 3CXCA 2KROA 2OZUA 2A41A 1W5CC 3OYAA 3HG9A 1RR8C 4C0DB 3I5UA 4LG0B 3H5AA 2R4GA 5EEHA 1NM7A 5GANd 3P39A 1VQKI 1O9SA 2OA8A 2Q97A 2YHXA 4M7DB 1XI1A 3ZSRA 1N8RR 2AZSA 4CJSA 3O9QA 3ZT0A 4LY7A 1R7JA 2OTLA 1OYWA 3BZKA 4Z02A 3CJNA 4WFBL 2GFUA 4BR0A 2UXBK 5EEAA 1YJ9T 4H4MA 2E2JJ 2JM8A 2X4XA 4JD2A 4A2UA 2QA4N 2EYYA 5GADJ 2A68F 2R92J 3QZ9B 1O1WA 1WYXA 5BNGA 2ME0A 1JXOA 2LK2A 5ICCA 3ULEA 1UMQA 3RESA 3G73A 4CZKA 3LAPA 2GBYA 3ABTA 4C0ZA 3FEOA 1WH5A 3PFYA 3HKSA 3F21A 2OZSA 5FPDA 1MMNA 5DM6L 1USSA 2HWVA 4JI7K 2TRTA 3OYGA 4M7AE 1MDMB 4OU0A 2QLZA 3ZQQA 2HZDA 2RVCA 4GXOA 1W0HA 1CF7B 1Y0UA 3CC4Q 1G2BA 3D0SA 3M8PA 5EGOA 5EVZA 2VT3A 1VYVA 2AHQA 4M77A 2J7IA 4YEJA 4OPKA 1N5ZA 1NYFA 1QLYA 2PVOB 3JRFA 3IKVA 5FGMA 3HDDA 2K4JA 3BTIA 1NBWA 2OYQA 4QS8A 1H8KA 5A0GA 1TK0A 4J9CA 4ELZC 4OAYA 3CCLA 4H5TA 3K2PA 1F1BB 3RYRA 2Y0SN 3VQDA 5AQIA 1SMTA 3K1NA 2DM1A 1YW9A 2WA0A 2IP2A 3CC2I 4KMUX 2XIDA 3U3YA 2E41A 1J09A 2FF3B 4AF1A 4FETA 1ITYA 3I8DA 4PWDA 3CJTB 1VSKA 4BYYA 3N5BB 3QYGB 3FFIA 3PUFA 5FLXK 4DWIA 2ZPFB 2VKVA 3VS2A 3KLGA 1FK9A 1SFKA 4M3YA 1AU7A 4CF9A 2QTVA 3A5NC 4IOCF 2FOWA 4LD9K 1IDZA 4FLXA 4MDWA 2HPIA 4I9QA 2X6WA 2OTLI 1U6ZA 2A6TA 4QAGA 2X6OA 2X6NA 1Y07A 2LC4A 1OR7A 2KJBA 3GTQJ 2JTFA 3K58A 4M78A 4XTYA 1J7KA 4C5GA 2RHUA 4BRAA 1TOVA 2G7UA 2X51A 5M5XJ 4A3KJ 3THXA 1NPRA 3NAUA 4QVZA 4DTMA 3CCRA 4H0OA 1EH8A 5E1WA 1W2BP 2OAUA 3JCMb 3UB5A 1ZC6A 5IHIA 4R8HA 2CDTA 3I9V2 3MEAA 4B8AB 3BG5A 3QESA 1DEJA 3JB9I 4BY1J 2QF7A 3PSFA 5CQEA 1A35A 1YNZA 3ZXSA 2O8CB 2PY5A 4O8KA 1N75A 1KC8U 2COYA 5HRRA 5D4SA 1YCYA 2FNAA 1S1WA 5GAOp 1OMIA 4MTDA 1K4SA 2AKKA 2XF7A 2D9TA 1JXEA 3NARA 1BI4B 4IHXA 1B4AA 2DVJA 2XSDC 5B1BH 4OB3B 3CJRB 1R5GA 1L3SA 1S7OA 4OKJA 4KGZB 2F69A 3T8RA 1J53A 2UUZA 1TZLA 5E3LA 4CEFA 1BB9A 3V1OA 3ECOA 1YI2Q 1RTIA 4Q4ZF 2HBLA 3JAMK 1PRLC 3CCET 2IPOB 1E3HA 4RTVA 2E36A 3NFCA 1V29B 1WJCA 4ILGB 2E1HA 1QWEA 1T39A 5J2QA 3KD5E 3JAMO 4PKGA 3ITHA 4A4GA 3BCAA 3Q0WA 5KE2A 2HI3A 1ZSZC 3MFKA 4KN4X 1U0JA 3ASKA 3ZMSA 2R5ZA 2BUPA 2MOXA 3SBGA 3L3UA 1R1VA 3V1RA 3JW4A 3BTJA 1DGWY 2D5RA 5KHDA 1RBTA 1SPKA 5CYMA 3CCJA 4P9FA 4MFBA 2KP6A 4IHVA 1SVLA 5F2RA 2JRMA 1M8VA 4MDBA 1X4OA 3HI0A 3ZETB 5AZJB 2HHHK 5FKMA 1DJ7B 3DWLE 2QSHX 1JQQA 4OX9K 3EZWA 2CH6A 3BG3A 2CFOA 2CQ7A 4I76A 3HOXJ 2HMAA 2GF7A 4ZGJB 1R49A 1W9HA 4M6XA 3ABUA 2QSFX 2H1KA 3RZOJ 4ON0A 2EW3A 4QQ6A 2DA5A 4FWNA 2ITMA 3OYCA 1W2BM 1TUGB 1WGSA 4JKDA 1YCSB 1JUPA 4E4HA 4E1MA 4IVNA 5I21A 4XM3A 3UKGA 4EATA 2OFKA 2LJ1A 2HGCA 1LCKA 4DF4A 5J4YA 3FFKB 2DA3A 3SQ1A 3IDHA 3HOTA 2CGKA 1VQ7Q 5J40A 3BC8A 2F4IA 1FMWA 2X85A 4Y17A 1LWEA 3ZSVA 2JUCA 1PU6A 5A2QE 3LQRA 1GUUA 1C1CA 4FJIA 1VQPQ 2ZXIA 1Q82C 2OPSA 5CVIA 4RLQA 1P2FA 3H92A 2XK0A 5CQXA 3DPLC 1R22A 4B21A 4A3BJ 1T7PA 1QBJA 4KUIA 3ASMA 2EJGA 4M78G 4H5RA 2RQPA 1JJ2P 2EFOA 5C44J 1X2QA 4VUBA 3ATVA 4AVPA 1XX5A 4QVDA 1NJIR 3DEWA 3O3KA 5FKNA 5CLSA 4KHUA 1VIFA 5DYMA 4J9DA 1HC8A 1VF9A 4F7UA 3FJ5A 2QXLA 3O80A 1WSJA 3HUGB 2DTIA 2YNHA 3HSTB 4P55A 1S72I 3SD4A 4HVWA 2OANA 3FXMA 3K4MA 2EKHA 3C3WA 2A1RA 2F5DA 1D5YA 2DOEA 4ZTFA 1RAIB 4WFAL 5GTHC 2KE9A 5LMUK 2O31A 4R5PA 1YQAA 3WT0A 3G4SA 2UXCK 2QG9B 4U7DA 1MJAA 2KZMA 1LEAA 1GBQA 4UNFA 2O5RA 3W2AA 4JRKA 3OYFA 3TU5A 1OX8A 4HF1A 4O5BA 1YJNQ 2A28A 3LWHA 4JKGA 4JZ3A 1MBGA 1GDTA 4CIGA 3VEOA 5D5WB 5K1YA 2FL7A 1X2NA 4BQZA 1V3FA 1KSWA 5GIPA 2FJ1A 1AD5A 4IFYA 1MUDA 4I6MB 5D6XA 2E2OA 2HXIA 2JOYA 4LG3A 2DT6A 4HCBA 1MSEC 2BHYA 1LB2A 3SWNA 3MN2A 2XPUA 1BCMA 1ABQA 3MVPA 1HNWK 2VBYA 5GAMd 3C6TA 1RTJA 1IKYA 3NF8A 1NJYA 2QWQA 4FW1A 4PJOA 1FKPA 2ITGA 2F5KA 4J2EA 3OIQA 4ESRA 2ZJQF 2CSIA 2QTXA 4IQJA 4BI4A 3EUKL 1Z25A 3SDBA 1JL1A 2F9TA 3KFWX 1I94K 4FWRA 2XHIA 1VQ4N 4FLTA 1NG7A 2IXSA 2COZA 1YJ9Q 4EM1A 1Q81U 1BI4A 2LR8A 2OZMA 3GIBA 5CO7A 3VS6A 2ZE2A 2JT1A 2ETHA 1K78A 3OS0A 3TP3A 1Y57A 2EQKA 5KGXA 4YRVA 4BR9A 3MX2A 2L7ZA 3CCVA 2QA4I 2EK5A 2L9VA 1JLBA 2XF5A 4E7JA 5GAMj 2E5ZA 2VG6A 3CESA 4X9CA 1T56A 4OGCA 1UCRA 5HLFA 4XNFA 5EXWA 2QKBA 3K1MA 3QU3A 1L0OC 3JREA 1D9DA 2ZJQL 1VQKA 1DGRM 3JCMP 2PNIA 1BM9A 4ELUA 4CFCA 1SHGA 1F1ZA 4YPHA 1ACMB 1O4XA 2LBFA 1SUQA 1W36C 2KT0A 2O8EB 1W5SA 3G2BA 1J3TA 1FN7A 2X3XD 2XSJC 3HKZN 1GLEG 1R1UA 5GP9A 4CF1A 4NUBA 3HPHA 2DILA 1NLOC 1R6RA 4HT9A 4OPAA 2OTJT 5AQPA 4S0HB 2DBMA 1B34A 4BG9A 4B3RK 4UC4A 1NLVA 3P9KA 5J8CA 1KG6A 1S1VA 2DA4A 3ROUA 4N4HA 3FE1A 4H5VA 3CPWS 5DMRA 4IEJA 3JAMZ 3M4YA 5LGNA 5GTIC 4PQUA 2HDAA 3HSBA 4FIBA 4CGGA 4B47A 2HL3A 3ZBDA 2LC2A 2HBKA 1Z77A 1NGJA 3A1YA 4ZDOA 4KAZA 1TWFJ 3LP0A 4FJ5A 2QSGX 5MLCQ 4BRIA 1E3MA 3LWMA 3U1KA 5LJWA 3O9TA 2QQRA 4NXNK 2PQ8A 3SDGA 1KFZA 3MP6A 1TL3A 3VQ4A 2RQTA 4IOCL 1YITN 3VOVA 5L3BA 3F9MA 1KG2A 4ZDLA 4RW8A 2ME6A 1TC3C 1CXUA 3LA3A 4K8ZA 1SD4A 2XVCA 4LF9K 1PRMC 3FMRA 2R58A 3F70A 1QSSA 2P1JA 4FL9A 3VEWA 3WTXC 1XSDA 1T33A 4B4CA 4H0EA 1UG2A 3S8PA 3F73A 5FWCA 3O2PE 3CCMI 3NTHA 3MXJA 3JAME 5H6RA 3WG9A 1WJAA 3ZMZA 5KI6A 4D0PA 2OTLT 3DLKA 2RHIA 1T3SA 3J81O 4W1UA 2VE8A 3VSKA 4ENJA 3M07A 1VTNC 2GXBA 1VQOT 3LDOA 2EV0A 1HKSA 2QQSA 5HS7A 1N9RA 4C1NK 4Z8AA 4XIUA 3MKZA 4HSBA 1IBMK 1F21A 4JQFA 2DAOA 1KRPA 2NVQJ 4Y7NJ 1RT2A 4CEOA 1XDSA 3K57A 4NZGA 3A5ZB 3J81E 1DDNA 3FKJA 2VQHA 2QWWA 4IRGA 4RTUA 3P8DA 1G3TA 5KYWB 3LWIA 2DLLA 4L5GA 4LIVA 2I7NA 5DUIA 2K5LA 1BCOA 1EKEA 2D45A 5HY6A 3HXMA 3FXJA 3KYCB 5C10A 5AONA 1HUXA 1UE9A 3KETA 2CQKA 2XGXA 2IG0A 3QERA 1NJIC 1X3MA 5LL6Z 3O08A 3OL3A 3CCLQ 5EU7A 3I56T 3OA9A 4FOEA 2HF3A 4UUVA 1N25A 3QIPA 1KC8O 4S04A 1XNIA 2B4JA 2AXTC 3KIOA 2A3LA 1R59O 2F4MB 4CZGA 4M9XA 3FHNA 1Z3YA 4N0AA 1YWOA 2F7TA 3LSMA 1D0YA 1EIFA 4ID1A 4N4GA 4NQWB 1L3TA 4QWQA 3HVTA 1FT9A 2CP2A 2FC0A 4O0IA 4M74A 1I50J 2H8RA 2PLYA 5GAHJ 1NKEA 2JUGA 5DUKA 5M5YJ 4YOUA 2K85A 1VQKT 1JKOC 4KBOA 2OCCH 3SV3A 2QA4A 3E6BA 4LDVA 3K7AJ 1S7AA 2W03A 4HVJA 4G7OF 3GTJJ 3QEIA 2YG9A 2K27A 3A98A 3C7NB 2R7WA 1Y1WJ 4GW6A 1BQMA 1MJBA 3SAHA 3BR3A 4D7NA 4N4NB 4YIRX 5A0DA 4PFPA 3ZSYA 3D2FB 4FXDA 2NAZA 1NG2A 2JPSA 3JCMf 3WU1B 1ZLJA 2XDPA 2LX7A 5F08A 3I56N 4C5IA 1YJNT 2E71A 2P9SA 5JHUA 1IUYA 4UY8I 3GPLA 1UZCA 4GY2B 4JKBA 3CPFA 1NGHA 3VFZA 3EG9B 1UHWA 4ZN1A 4M9ZA 1VQLN 2WONA 4OB1B 3HUGA 1IB8A 5LJ5j 2ZCFB 4J2DA 3HOUJ 1VYUA 3QOPA 3FHZA 4JYKA 1MGTA 5IP7J 2X9HA 2E4HA 2NRAC 2OZ6A 2HZTA 4F55A 4CJ7A 1K73U 2AXLA 3HGGA 1UJ0A 4X66K 4II1A 1Y96A 1STZA 4A2AA 2CUFA 3NTKA 3QNOA 3O4QA 1WSHA 2XAUA 1SV5A 5TKYA 1QSYA 4CGIA 3M4OJ 2X6XA 3DLHA 3RPUA 3LH5A 2L5QA 2XUBA 4PIIA 1JKPC 3CEYA 1QVGP 3GTGJ 3G6EN 2M34A 1J9AA 1WQ7A 1UDLA 1KA8A 4CJ3A 5CE3A 1KZHA 2FX0A 4LDXA 1PJRA 4GBQA 3Q7CA 4J8OA 4ZZDA 2R5AA 1IC8A 1EX4A 4O8UA 4ENNA 2RD1A 5BOXA 4HX4A 4HUFA 4M3WA 2CYZB 1K4TA 4NC7A 1ULYA 3H0GJ 2NRVA 2A6AA 3UF4A 1WSIA 2KGTA 4M7AG 2Z9OA 2HCKA 2ZBKA 1WHJA 1QP3A 5M3FJ 2K7LA 2RF0A 1VQ8T 2GUIA 1QVGA 2JWKA 3I4MJ 4YNQA 4Q47A 2IGNA 3S1MJ 4KNYA 2GOXB 2I2LA 1VQ6A 1QMCA 2A0FB 2XGDA 3M8QA 2R5MA 2CJJA 3FX3A 3TW7A 3CMAQ 2EPDA 4M78D 1WI3A 4FM4B 2LY2A 3VKIA 5KCOA 1MDMA 2XPVA 2EJFA 4Z4CA 5GMKl 2ZM6K 3B6CA 3TO7A 2MLGA 4B9VA 3CD6T 2JSCA 1SANA 2XHKA 3OYKA 2ENMA 4C92E 2AO9A 2MIOA 3DLLA 3PIOF 2FSNA 1WHUA 1DKGD 2FHDA 4FOIA 2KFNA 5AQSA 4I2OA 3G7ZA 2ZMEB 3F10A 4CJWA 3OW2S 3CQ8A 1GFDA 1AHJB 2YUQA 4IOAL 4B1WB 3M0PA 1W4MA 2YU9J 4IHTA 4N0AC 4QQDA 3QEWA 4CZCA 3ABLH 1FMVA 1GCQC 1GOAA 3X24B 3LALA 4IOXA 4E1NA 1IXDA 3F9KA 3CCLT 3CCQQ 1XQSC 5HLGA 2DY4A 3H3VK 3M9QA 3JXUA 2X6YA 3IH3A 4CI6A 5D6WA 4X1VA 1EETA 4EGYA 3F8FA 2ED0A 3CLOA 3K0LA 1KJWA 4DIQA 3ENOA 4UV9A 3P7NA 5FKKA 1FMKA 3WNEA 4BREA 1BWFO 4KHQA 2O8BB 2PFUA 2M8EA 1LNXA 4LLNA 1BN5A 3LZIA 1MU2A 4KI4A 4RCCA 2YX6A 4PHTX 5E79C 4QT7A 4IZ9A 1RRJA 4M73A 1QU3A 3G4SQ 5JFRA 3OV8A 1QHAA 2R3SA 2K7AA 3ZGKA 4Z6YA 3MCZA 3AVFA 1TQIA 3VQCA 2VYPA 5EEGA 4QS9A 3LX7A 5HNFA 4KA4A 3EO3A 2X78A 4M77D 3ZPLA 1KQ1A 3RKXA 5D5VB 1KVBA 3K59A 4F04B 2LLKA 1YIJN 1WI7A 5AQGA 2DA9A 3RMCA 4CJ5A 2COBA 4AHTA 1YS7A 3HP9A 1S1TA 3IRQA 3K70C 1P7MA 4HCCA 3X2QH 2EINH 3VQQA 3VSLA 5BR9A 2M9UA 3WUHA 4ZNXA 3UATA 2ZNYA 2L54A 3M8SA 4BI3A 2EQMA 5KCMA 2PFBA 3JSMA 5GANe 1N3CA 3I0SA 2VIXA 4C8QB 1ZBFA 3S9HA 2W1OA 4A3EJ 2YUPA 2EB7A 4A5NA 2M51A 1IRGA 3V9XA 2DKGA 2EQUA 4BG8A 1IN7A 5HRSA 3ZX2A 5AR0A 1YN8A 4KHWA 4DQSA 2V1XA 2C0IA 4UVCA 2AQFA 2YRVA 4FJ8A 2P4TA 3DTEA 1XHZA 1YJ9A 1BYMA 2DJQA 3RRHA 1XQOA 3HB9A 1B72A 2YPRA 1ZBJA 2DW4A 1CLQA 2DJIA 4D8DA 2QUFA 2RNGA 5FKLA 3BG7A 2Y90A 1QQMA 1Q9XA 2BZ8A 2QYZA 4JKEA 2KYMA 1KIKA 3CMET 2BGGA 3BR2A 5C4XJ 3J81K 3TVTA 2XAQA 2DMNA 4PGHA 2RHKA 5FU6C 2O4GA 1GHCA 2E70A 3MZYA 2DXCA 3IWZA 1C0GA 5IP9J 3CC7A 2G8FA 4J8FA 5GAN8 3AO3A 1TL1A 5LBQA 3SB2A 5IY5H 2LF8A 1QVUA 1FBSA 3THWB 3ZOBA 2NRZA 1ETQA 2Y48A 2K6DA 2G7HA 3KCCA 4AIKA 1U84A 5FLMJ 2HKXA 1GV5A 1AZEA 1NK4A 2E5NA 2V52B 4XKCA 2ABLA 2XMFA 2WC9A 2IVNA 4B8XA 3TQNA 2ZJPF 2NZTA 3NAEA 3HOVJ 1NZ9A 4OMZA 2DMQA 4WQ5C 2KK4A 1RR7A 1NK2P 3M0QA 2VBZA 3K4BA 2KXDA 2A42A 2UU9K 1IO2A 1RL2A 1N5YA 4OP0A 1TQMA 3MJXA 4I7HA 2VXFA 1NK0A 4C8MA 3DPUA 2E20A 2KISA 4HBLA 1NPPA 2GOMA 4V2GA 4LDWA 2PMHA 3RR8A 1KQ0A 3DTKA 5H6QA 3AA5X 4I98B 1Z67A 1XUPO 1VQ9Q 3K9JA 3KUFA 4B1XB 2JNGA 2ZZDA 1WUAA 1TSFA 3C6HA 4FSVA 3N4QA 3NE6A 3SYZA 3G71I 1ETKA 3O1WA 2XY8A 2AA4A 2GTDA 3WEEB 4DV4K 4UVBA 5AQNA 1KONA 2PUOB 2CUJA 4BC4A 3M3YJ 2EVRA 4ENKA 1K8KA 3RWUA 4IIMA 5DD4A 4DOVA 4JKGB 2ZPBB 2OTJA 3OW2M 1TKDA 2JXBA 3IHOA 3PO3J 1UECA 4E3SA 1YOVB 4AVZA 1I81A 3AG3H 4HYEA 1YTAA 2PYLA 3K5MA 4UUSA 2E6ZA 3CC7I 4CJRA 1KD1C 1WHLA 1KTQA 1UOCA 1VQ8N 1ZELA 2V9PA 3URGA 3CF5F 3SJJA 2H3EB 3CCUA 2H6CA 4DV7K 4FE7A 3V9UA 4G6DA 3VF4A 2NOFA 4I2PA 3RZDJ 4CZZA 1UGQB 2D4WA 2FZGB 5EDNA 1OVQA 1MIJA 3OYLA 1OPKA 4F7UB 3CMAT 2F2WA 5SWMA 2R7OA 3BP8A 2DTHA 5KYYA 2FG0A 1UA0A 1DPRA 1O3TA 4MO4A 3KNTA 4PJOC 2MYSA 4FYDA 3CG7A 1TAUA 1M1KC 4K25A 4BVPA 2FMLA 1MD0A 3O3GA 4MQ3A 2B0LA 3ME9A 4DV2K 3FIFA 5DLQE 1KU3A 9ATCB 1VQLA 3CFOA 4PZJA 2IBDA 4JPBW 1ZSGA 2V75A 1S3XA 2F8SA 2VJJA 1K8AC 1Y8QB 2FA5A 1KG4A 1ZGJA 5L3FA 1PM3A 5J2MA 2DTUA 1FLIA 4BROA 4DSIA 3D2EB 2COMA 3CP8A 1T8EA 2BW3B 3EUHA 3VQEA 1QQNA 3RR7A 2IGIA 3OBWA 1HSJA 4OWRB 1S22A 6AT1B 1MWKA 2FNPA 2O4IA 4I01A 2EGAA 3CBMA 1S9HA 4HCZA 2NUTB 1X75C 3SZPA 3FK6A 2MMPA 2NS8A 1K9AA 1YW7A 2KZVA 2Z0WA 4LF6K 3THYB 3HJFA 1X9JA 5DD8A 4C3IJ 3FHFA 4NOYA 3LYIA 1S9EA 2LNBA 4M3ZA 2VGMA 4V2SA 4EJTA 5IYBJ 2Y9ZA 2Q3SA 1ACIA 3CM6A 2IEKA 4JDSA 1YJWA 2P5VA 1FYNA 3EYYA 2QA4Q 2XIGA 2KR3A 1QHGA 4G8XA 3HIFA 2RM4A 1BKBA 3E9FA 3HP6A 1B1BA 1HF0A 5D6EA 3QWLA 1NNEA 2RB6A 3RYPA 3PNYA 1TH7A 5M9OA 1DP7P 1YQMA 2XDDA 1SAXA 4YOWA 5ERIA 2HNIA 4B1YB 2EYXA 1YJ9I 3P4IA 3L2CA 2O8EA 2MI6A 3V6DA 4RKUE 2LTOA 3KVGA 3BW1A 4J19A 4Y91A 2EGEA 5KVRA 4FT4A 4JI3K 5KYUA 1WAFA 1IW7F 4KT5C 1VSLA 2CP7A 4JJBA 1Y6IA 2VOOA 4RGRA 3KK3A 2G8UA 5CVJA 1XJWB 4NL2A 5J1YA 5GIOA 3CMEI 1Y64A 4C8QE 4E89A 4E7IA 3SJMA 3CCEQ 1TAQA 4BRKA 2XAJA 5HVQC 3AVMA 1HNVA 1QS4A 4A59A 3BDLA 3VYSB 5JVGL 1U9NA 2E3IA 2IGMA 4RS8A 3H1QA 1UAXA 2VODA 1MMSA 4O5VA 1K76A 1JGSA 2GTJA 5LJ3e 3EQLF 1FEXA 4AHRA 5D8KB 5HK0A 1BK2A 5E8IA 2FZKB 4DR7K 3F23A 5F0CA 2X1EA 4JLIA 1YHQA 2NOIA 5FLXE 3GMEA 1YIJI 3CTAA 3W0LA 2YR2A 1S5LC 1EQYA 2NWMA 4CHUA 3S2HJ 2ECBA 1LMZA 3CCST 1WH7A 1YUWA 4CK3A 2NVTJ 2IS1A 1PD0A 1GOBA 3RNJA 1R0CB 1XG1A 3JCMQ 3ENHA 4FJ9A 4M75E 1GXIE 1DLOA 5L3CA 4LUDA 3GBTA 1GVJA 2JG6A 1X1BA 3NGZA 4HKEA 2DMPA 3G71Q 3CMEN 1QO0D 3VQAA 1YS6A 2HQNA 4HNUA 1WQWA 4AM6A 2ZKZA 3NF7A 1HYVA 3WU2C 3A5MC 3L42A 3QAHA 3BPXA 2EX3A 4OKEA 1BR2A 2RQWA 2ICWG 5CKEA 1M3CA 3RPQA 4EV0A 4WTOB 3CMYA 1QPMA 4QSHA 4BEHB 3NTIA 3KP3A 1D8KA 1MGQA 1C1AA 1FP2A 2L8DA 5DLOA 3SFIA 4MMLA 4BRQA 3ULRB 3BGRA 1NEBA 3DU6A 4A5AA 8AT1B 3H45C 2LDUA 4JX5A 3V4IA 1OYIA 4F2SA 3DF8A 3PFIA 3KZIC 1C0TA 1CF7A 2O03A 3VF2A 3TEEA 3RBBB 1PKTA 2E6LA 1FX7A 1OJLA 3SZGA 1VQ6T 1RDUA 2CH5A 1ZBSA 2EIFA 2P0KA 3X26B 3TTDA 1D9FA 1MUNA 1XMXA 5C2FA 1M1KO 2X74A 5BN9A 4L0YB 3BWGA 1RABB 3T7ZA 2HB5A 1YQRA 2VKHA 2M0CA 4M7AD 3WTVC 4PK4A 1SFUA 4QCLA 4KRTA 1KLNA 1A31A 4FZZA 1V4SA 4ASNA 1AWWA 2CQXA 1YQLA 1APLC 3QP5A 3EGUA 4RW6A 2OV7A 1KYWA 5ADXA 1OH8A 4ATOA 3SUQA 2UXXA 1RTDA 1YX3A 1FOXA 4DV3K 3SQ0A 3GNFB 2M7AA 3EY1A 2IS6A 4B3OA 5LJ3f 4CZFA 3LOCA 1F43A 2NVUB 2RKIA 2KFZA 3J80Z 3PX6A 4C8NA 3CC2T 1Y1VJ 3WTWC 1BHLA 2HQ5A 1SKRA 3CDLA 1RZ4A 1YJWI 5KRSA 3H3OB 5J2PA 1NGFA 1CGPA 3L00A 1EWRA 2EQRA 1PYVA 4JYAK 2DERA 2K9GA 3G3ZA 5FLXZ 1SEUA 5LGTA 3I3LA 2K9MA 1YITI 1RACB 2QK0A 2KI7A 1HKCA 3VENA 2MLKA 5LJ5g 3TKYA 1YI2I 3LGFA 3G71N 3EGDA 1YITQ 3BF3A 4A57A 4R1HA 2D0AA 3W3DA 3WTZA 3O6WA 1VQPA 4M3XA 1JCGA 4C9YA 3UR3C 1ZX6A 3GWZA 2D1VA 3KZYA 3LFKA 2FF4A 4JRPA 4JI0K 1UJ8A 5BPDA 1W97L 5CY4A 5K14A 2ISZA 1P4WA 2AP1A 4GCVA 2P5KA 3MWTA 5C24A 4BD3A 3QZ5B 3W2VA 1QZEA 2XDBA 3NDKA 2EQJA 1LKXA 4NXMK 2EV6A 4B9LA 3C1DA 3ZEUB 3I8BA 3DYAA 1P4AA 1LOJA 2CQNA 2FLOA 4OINF 3UKRA 5J47A 2PZ1A 2HMIA 4PJOB 5E41A 1NK7A 1KQSM 1R0BG 1I5LA 2CYYA 3FF5A 4GRIA 1BC7C 3GTPJ 4BR7A 1GV2A 4G7ZF 3QLHA 4E19A 2RJFA 5JVTA 2HNDA 5AJ3K 2M8GX 3AT1B 3M3ZA 3LFUA 3EE9A 1VAZA 3QINA 4M78C 2JW4A 1QHTA 4E9GA 3RDVA 1CSKA 4RG8A 3TSZA 4JOMA 4B3XA 5GAMf 3AG4H 2M45A 1XG7A 3COAC 1U5TA 4MZTA 2JWTA 5AQOA 5BREA 3HM9A 2O8FA 3JB9D 2RI5A 3PGGA 3M1CA 4CEZA 1CQTA 3ZETA 3BQYA 1NG6A 1IKXA 4DG1A 4LD6A 4RTTA 1S9GA 1IG8A 1Z6RA 4CEAA 3D2EA 4N5SA 4KH4A 2X0LA 4MDXA 2VJ5A 2QGUA 2YJEA 3JRDA 4ICLA 5KQ8A 2KLAA 4UNOA 4BRFA 1FIAA 4JBAA 2A37A 4OKKA 2QKLB 3FISA 3M5RA 3KK2A 2EPFA 2E1NA 5HLHA 4FK0A 2HD0A 4WF2A 3CVTA 3TOBA 4JN4A 1TS9A 4M7DD 2Y1JA 3CIPA 4ZYAA 3BG6A 3AVIA 4JK7A 2KQ2A 4OAZA 4R0KA 2RN2A 4UXNA 2QWMA 2JHNA 2VPLA 3PMTA 1GL5A 3WVEB 4BR5A 3PVLA 4PSWA 2P8TA 2WV0A 1LPQA 4HZFA 3I55A 4GNIA 1BA1A 4XL9A 3CMAN 3IRRA 2F4VK 3HSEA 3HTRA 1KHCA 2DD5A 4JHDB 1WRJA 4E47A 4HV6A 1GLDG 2LDMA 2IVWA 2CP5A 1MMDA 3E01A 3CCRN 1ZLMA 4M77C 2OTJQ 1WB9A 1Q1HA 4Y52J 2OBPA 4JI8K 2K4BA 5KAFC 3LSPA 2WSEE 2L3RA 3PSIA 2UZKA 3VV0A 1Q86R 4YHHK 3FXLA 2JMWA 3VA0A 1XCBA 1I6XA 3QJ6A 2C0OA 3GZNB 3CQXA 1WLPB 2EYWA 3SAGA 3CCRI 1VQKQ 1BUPA 4LOCA 4G9ZA 1RT7A 3QWXX 5I11A 2L3PA 4DR4K 1C0MA 4XU2A 4BDPA 2A6EF 4LH4A 3DFGA 3DXJF 3D0PA 1XC9A 3FLCO 3C94A 2DXIA 1ATRA 2HKNA 5IN1A 3V1QA 4M7DG 1MV3A 4II3A 5AQVA 1PHTA 5CKFA 5LFAA 4B1RA 3G6EQ 4A3GJ 4CHNA 4BNCA 3AO1A 1KSPA 3DCFA 3HRMA 3OIPA 2JRTA 1EH6A 3HOZJ 4JD2B 4M7XA 4C5HA 3WTUC 3VF6A 3CUQB 2UUCK 1ZUUA 5LEJA 1D1BA 4KICA 1R8OB 3OH6A 1S72N 2CS3A 4MO5A 3FC3A 4H4OA 2I5UA 3OYBA 3TANA 5FFZA 4EGZA 2AT1B 3AVKA 1SFXA 4H5WA 1B34B 5M1NA 4M7DA 4C92G 2NRRA 3IUCA 4C8KA 2CH0A 2H09A 4HT8A 1V1CA 4LG0A 3CHWA 4X62K 3DLRA 4EZ6A 5LJ3j 3GP8A 1VQNA 5K7ZA 3VRZA 1Q81R 2E34A 1NK5A 5HDKA 1BOBA 1LAWA 4KB1A 4B9XA 3VMFB 4AHSA 1N8RO 2F48A 2GQQA 4BY6B 2EIKH 2WSCE 4BGDA 2V8IA 4K41A 4OPJA 3PLAA 1MJ9A 2DIQA 3A8LB 4N9HA 4BVOA 1VSMA 1VQ6N 5CYVA 5DS9A 2LY9A 4KTQA 1XS9A 2YNFA 4F7ZA 3CFRA 2QA4T 3GF5A 2QM1A 4FTHA 4DCHA 3CPWA 3T3FA 4ESBA 1R9TJ 4KT0E 1P90A 5I22A 2J6KA 5JI6A 1JGGA 1O57A 1EJ9A 5AQXA 4XSZF 1RAEB 1MDUB 1K73R 1I27A 1K9MR 2HHXA 1JI8A 3FSPA 2FRHA 4RW4A 1VSJA 3R2XC 4C0FA 1NG9A 4J9BA 1RDCA 4P5NA 4PLLA 1GBRA 3CXCS 3M55A 1ZRDA 2ID3A 1N33K 3VS1A 2V9KA 2BGCA 3HKZA 3VYTB 2C6YA 5IHKA 4JI2K 3MEXA 1SSHA 4YOXA 4D5FA 5HLIA 4AD9A 3MP1A 3VQ8A 4XK8E 4BEHA 4C5EA 4DSKA 1ETVA 2Y4YA 3M4GA 3K69A 5F1JA 1T0FA 4UOBA 4CDGA 1IG9A 2ELJA 3R3LA 2EIJH 1YJNN 1K1ZA 5GAMe 2E2NA 2G3RA 4G6TB 2VC8A 2JA5J 3RVCA 2BH1A 2JUFA 3TAEA 2X3WD 1T03A 3S32A 1BA5A 3JCMJ 4DS5A 2XRIA