4E7LA

Pfv integrase strand transfer complex (stc-mn*) following reaction in crystallo, at 3.0 a resolution.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7lA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7lA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7lA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7lA03
3ZSZA 2R57A 1F21A 1ZBHA 3OYIA 3SQ2A 2DIGA 1RT2A 5FROA 3S3MA 3V9WA 5J2PA 4NS5A 1FXXA 2FBVA 5KCOA 2R5AA 3I0RA 2RJCA 4FLYA 5CZ1A 4CHZA 1TGOA 4IG3A 4DFPA 3O4NA 3Q1JA 3LX7A 4Z0UA 2JGUA 5C6SA 3KLEA 3VA0A 1QE1A 3P1GA 3AVIA 3KLIA 1VSDA 3AA4A 3OYMA 4C5IA 5CYQA 2F5KA 3KJVA 3FC3A 4FVMA 2OYQA 4CECA 4OPJA 3PX0A 1SKSA 4QAGA 1H3ZA 2YNIA 2EQMA 4A4FA 1IKVA 1S9EA 4CK2A 1U47A 4B08A 1WSIA 1VSMA 2LTOA 4DFJA 1BI4B 4KI4A 3HVRA 3SI6A 1JLGA 1HYZA 2YV0X 3DYAA 2G8HA 2P5OA 4DSFA 2Y1JA 1Q8IA 4I7FA 3META 3B6PA 1X9SA 1NJZA 4F2RA 1LWCA 1QHTA 2XHBA 3PFSA 4HVJA 5KE2A 3ZSQA 4YFUA 4A4HA 1U49A 4B8CA 1DTTA 3M8RA 4OKKA 2DFEA 1SKWA 3GOXA 3WNFA 3QIPA 3CYMA 4CEQA 3H6ZA 3AO5A 2HQEA 4B9UA 3A2FA 1ASVA 3QERA 2D0BA 4M45A 4KB0A 3ZSWA 2XK0A 2EQJA 1CXQA 3OJUA 3OYKA 2LSNA 3AO1A 2IG0A 3OMGA 3OQ5A 1T7PA 5HP1A 3HT3A 1I3AA 4PL6A 3V1RA 5CYMA 1ZBLA 1BQMA 3QEVA 3VQEA 2KFZA 4QQ6A 4LSLA 3OYEA 3ISNC 4M41A 3AVGA 5D6XA 4CJUA 2HHWA 3MEWA 3OYAA 4W5OA 2HVIA 4DTXA 3V4IA 4ZHRA 5KRTA 4NCBA 1L3VA 1X9WA 3L2WA 2X35A 2R5MA 4DFMA 3RR7A 3SV3A 3AVBA 4I2PA 1FKPA 4CJQA 1S5JA 4HCZA 4CJFA 1L3TA 3M8SA 4DTRA 4B9NA 4BE2A 3KKRA 3DRPA 3TAEA 4BACA 4Q5WA 1X9MA 2YHBA 1MHNA 4DQIA 4O4GA 4CF1A 3DLBA 4BWMA 4IG0A 3U6FA 4R5PA 3VQAA 1LW2A 4AHVA 3SCXA 1LAVA 2EQKA 1QSLA 1WSJA 4DSJA 2Z1GA 1VK0A 4ZTJA 3AVNA 1BISA 3T3FA 4ID1A 2O4GA 2HHSA 3K5MA 1KFDA 4G1QA 2FBYA 4CHOA 5KGXA 2E5QA 3S3NA 2F8SA 3VQ5A 3EYZA 4FJ7A 3SJJA 4CFAA 3VQ6A 4B9LA 3AA2A 1LAWA 1BL3A 4DU3A 1NK9A 4KAZA 3CFRA 4YNQA 4DFKA 4C8MA 3OS2A 2LCCA 2HW3A 3ZT4A 3LPUA 2D0CA 4DMNA 4LY7A 1NKCA 2F96A 3RMCA 3OS0A 2A1RA 3RMBA 2DFFA 3PX6A 3LLRA 3K58A 1JLEA 1C0TA 3FDRA 4M3TA 3HK2A 4FU6A 1BIUA 2ATQA 2EFIA 3DLRA 3OY9A 1BCMA 4ID5A 3TAFA 3C94A 3SUQA 4Z4EA 1OYXA 4AILC 3O3HA 4M42A 1RBRA 3NGZA 2BKDN 3QESA 1W9HA 4E1NA 4AHTA 1VSIA 2LRQA 3LGFA 3B6OA 4O55A 4M3RA 3QEXA 4CE9A 1XC9A 4B9SA 3AVMA 1L3SA 4F4KA 4OJRA 1L5UA 2OPQA 2VG7A 4AHUA 4DU4A 4KHWA 4CEDA 2HVHA 2QQRA 2KTQA 3AVAA 5HRSA 1S6PA 3MAQA 2IAJA 2MWPA 3EZ5A 1SKRA 3L42A 3DOKA 3O4QA 3AVFA 3OVNA 5KGWA 3SUNA 3PMTA 4DQSA 3KIOA 2IS3A 3ULDA 4C8LA 4HUGA 1CXUA 3M8QA 4O0JA 2XRIA 1LWFA 3ZSOA 4BDZA 3CM6A 3UT1A 4CF9A 5I42A 3QIOA 4B9WA 1RT4A 4GY5A 3HPOA 4B8AB 4H4OA 1VSHA 3HSTB 3V9UA 4KHUA 4E89A 3OYGA 2HQXA 1VSFA 1I39A 1UAXA 3VQ7A 3LYIA 1KVCA 1D9FA 3O3FA 3VQ8A 3QLHA 1XHZA 2O4XB 2IC3A 4C8KA 5JS2A 2L3RA 3KK2A 1VSJA 4QQDA 3L8BA 3NTKA 2PYJA 3L3UA 5HLFA 3AVJA 4E19A 2DTUA 1HNVA 4M3ZA 3VQDA 4FLWA 3FFIA 3HPHA 2O4XA 1IG9A 2QK9A 2MWOA 4LH4A 4EP5A 4DWIA 1B9DA 2P51A 3QINA 1QSSA 4OPKA 4Q0BA 1TAUA 2DIQA 3OYDA 2CKKA 4IUUA 1RI0A 3ZT2A 1EX4A 3FEOA 1HYVA 4Z02A 4A4GA 4ELTA 1QSYA 4CHQA 2RJFA 1RTDA 3P8HA 4CEEA 2YKMA 3QBYA 2RJEA 1RDBA 2VWJA 4DSLA 4NCGA 4F2SA 1WSHA 4CJ5A 1YVUA 1HQUA 1A5VA 2RF2A 1RT1A 4Z4GA 4AH9A 2HB5A 4B9MA 4MFBA 2HHVA 3ALYA 1BIZA 3QO9A 2WACA 4RG2A 1JLAA 5HROA 3CM5A 4M3WA 3C4SA 3C6UA 1QS4A 2M1HA 2P1JA 2HHTA 3JYTA 4CEOA 3F9KA 4DF8A 3VQQA 3OB9A 3CG7A 3LP3A 3C6TA 3E9GA 4OLBA 4FXDA 2VYTA 1HQEA 4Y1DA 3QIIA 2KZZA 3LZJA 3PY8A 4HCCA 3L2UA 4FW2A 4M3YA 4UC4A 4MQ3A 3VQBA 2EX3A 3DRRA 2AJQA 4W5NA 3DLEA 2EHGA 2E6MA 4LD6A 4J2DA 1YT3A 3LPTA 5D3GA 4FLVA 1N6QA 2HNYA 2ZQBA 4DSEA 1RDDA 3M9QA 3H8ZA 2VG6A 2FBTA 1A5XA 4DTMA 2I5JA 1WGSA 4NZGA 1WJSA 3NF7A 4FJHA 1HJRA 1C1AA 1WSFA 2VG5A 4J2BA 2GF7A 3LP2A 3MEDA 4M3UA 3QJ6A 3E01A 1RT6A 4BWJA 3WNEA 2XY5A 4I9QA 4KREA 3MEAA 1IKXA 3MEGA 3SYZA 5D6YA 3U3YA 4CCHA 3AVLA 1NOZA 1WLJA 3D0PA 3SQ4A 2X6NA 1D5AA 1C1CA 5HRRA 3CFOA 1S1VA 2R7YA 2LDMA 4CJLA 1D9DA 1RDCA 1RDAA 3KLHA 2YNGA 4KTWA 4CFCA 3E9FA 4FK4A 1GOCA 2FHDA 1IO2A 1NKEA 1T8EA 4CGJA 5J39A 1K6YA 5CIUA 4OGCA 2YRVA 3G0ZA 5FRMA 4CJTA 3NAEA 5HRPA 3MP8A 4DLEA 3LALA 4EZ9A 3AA5X 3C95A 3MXJA 4C8NA 1G5VA 4DTSA 5KTQA 3OYCA 4FZZA 4RW4A 4N4HA 1Q9YA 2G8UA 1Q9XA 1HMVA 1U48A 4NYFA 3RMAA 1VSLA 3RR8A 3LZIA 2RHYA 3L2VA 4HUEA 3TAGA 5J1EA 3QNNA 4FCYA 2GBZA 3RRGA 3KD1E 2RI2A 1CZBA 3DB4A 4CJWA 1JKHA 4TSXA 4FJNA 4CERA 1ZYQA 4W5TA 2G8FA 2BE2A 4WE1A 4DSIA 1TKZA 2EKOA 3HP6A 3MP1A 1BHLA 3ZCMA 3NTHA 1S1XA 1LW0A 2ITGA 3ZSYA 3EAEA 4Y1CA 3AO2A 3KK1A 1JL1A 3OYHA 1A5WA 3HVTA 1NJWA 2KW4A 1KVAA 2PY5A 1NKBA 2JTFA 2QKBA 1J53A 4FZYA 3WNHA 1CZ9A 3LH0A 2RI3A 1Y97A 2FC0A 4E7IA 1NOYA 1WAFA 3NH2A 3F70A 4O44A 4KHSA 4CJEA 4DTPA 4EZ6A 1XWLA 4FJJA 3MP6A 1J9AA 3DOLA 4EP4A 5CZ2A 3OS1A 4W5RA 1VRTA 3G10A 2M16A 4N47A 1R0AA 2RPIA 3T1AA 2RHXA 3SZ2A 1C6VA 1W0HA 4RW8A 4RW9A 2OPSA 2GFAA 3MXIA 1TK0A 1KHCA 4IKFA 2ZD1A 3VN5A 2E6LA 3OYFA 4FJ9A 1RNHA 4O5BA 3LDSA 1NJXA 4Z4CA 2XY7A 4DSKA 4C5EA 2IDOA 4AHCA 1S9GA 2RO0A 1C0UA 1JLFA 3ZT1A 3NE6A 3HL8A 4N76A 3TAQA 4CGIA 1J5OA 2G8KA 1RT3A 2XO7A 2OPPA 4CJVA 1O1WA 2DAQA 5M9OA 4K8ZA 3HYFA 1LWEA 2Z1JA 4N4GA 2K3YA 3SUOA 3PX4A 1ZBFA 4DQRA 1ASUA 3QKJA 4C8OA 4RG8A 4J2AA 3LANA 4CGHA 3L3VA 3CFPA 3PUFA 5FDLA 1RILA 3NF6A 4BE1A 3QEPA 4FYDA 2RHIA 1KFSA 1VRUA 3HO1A 4KTZA 3NGYA 1CLQA 3MEVA 4CEAA 4DTOA 1NK5A 1TL1A 1MU2A 3V9XA 3OYLA 3DLGA 4CRIA 2E4LA 4CFBA 3TANA 3IS9A 1TL3A 2RJDA 4F8RA 3V1OA 3LAMA 3V1QA 5FRNA 3DM2A 3V9SA 5SWMA 4LSNA 1UWBA 1GOAA 4KTQA 3CEYA 3AVHA 3ZSVA 2B6AA 4IUPA 4C5HA 4Q5VA 3SV4A 4E7LA 2XY6A 3K5OA 3EY1A 5CY4A 4PA1A 4FLTA 1UOCA 4FZXC 1L3UA 4H4MA 1RTIA 3KKSA 3QEIA 3JSMA 4IFYA 1QTMA 3LAKA 3IG1A 4JRPA 3DMJA 1IKWA 1N27A 2DY4A 1YTAA 2X6SA 1XNIA 1OI1A 4KHNA 2EQUA 1Z26A 3OYNA 3MXMA 3DLKA 5EU7A 4K8XA 1JXEA 4EDUA 4BDYA 3O3GA 3NNQA 4X34A 1NK4A 2X4WA 1TK8A 4QW2A 3CQ8A 4HTUA 3OA6A 1N5YA 1B92A 1BCOA 5J2QA 1IH7A 4JLHA 4OVAA 1S1WA 3RWUA 2D0AA 4A4EA 1RBVA 5C24A 1NK0A 2A1SA 2P5GA 2RI5A 4W5QA 1JLBA 4RW6A 1RT7A 4IFVA 1TKTA 1HNIA 4E7KA 4DU1A 3TAMA 4NYNA 3P5JA 3L2QA 1KRPA 4DTJA 3AA3A 3LP0A 4FJGA 2OZMA 3L2RA 4IUQA 3NBPA 1TKXA 4CEZA 2K3XA 4PUOA 3TWHA 4JRQA 4AHRA 1RCHA 2G8IA 3LWLA 5J2MA 4J2EA 1TK5A 2RN2A 1C0MA 3LWMA 4FM1A 2B4JA 5C25A 1TVRA 3ZSRA 3VQPA 5SZTA 1FKOA 2KQ2A 2BDPA 3ASKA 2ZE2A 3AO4A 1YTUA 2QKKA 1U4BA 4QOZB 1WAJA 3NF9A 1U04A 2D5RA 3SQ1A 3VQCA 4FK2A 4CIGA 3ASMA 1S1UA 1KLNA 3V9ZA 2PZSA 3LGLA 1X1PA 4CIEA 5IN1A 2X74A 2QQSA 1UA1A 2Z1IA 2BANA 1TV6A 1S1TA 4CIFA 3QEWA 3NGIA 1G15A 1SL2A 3K5NA 4Z4HA 4FJLA 3HM9A 4CHNA 1EXQA 4OLAA 4JS5A 1WJRA 4RW7A 4OGEA 1C1BA 3U3GA 2OA8A 1JLQA 1EETA 3ZT3A 4DQQA 3KLGA 5J26A 3OMCA 2IGIA 5DK5A 3DRSA 3THVA 4FJKA 1RTJA 2YHAA 3T19A 1JXBA 3D45A 3NF8A 4FM2A 1T05A 4FJXA 1IKYA 2JLEA 4CK1A 1BI4A 3SQ0A 3SPYA 5K14A 3BDLA 1REVA 3NTIA 5J2NA 5IAYA 3VQ4A 4BE0A 4BDPA 5KE3A 1SL0A 2G8WA 1JLCA 4NCAA 3ZSXA 3KUFA 2PYLA 4PLIA 3K2PA 4PQUA 3K59A 1HYSA 4Z4FA 1FK9A 3VQ9A 4DS5A 4KKOA 1VSKA 3UIQA 3HPGA 4FK0A 1SSFA 4N4IA 3HXMA 3WNGA 4FLXA 1WN7A 4OVLA 2WOMA 1T03A 3VA3A 4HCBA 4B9TA 5I3UA 1SL1A 3OJSA 4L59A 5E41A 4QVZA 4IBNA 3DI6A 3NDKA 4B9VA 3P83D 4N41A 4AHSA 3F73A 2HNZA 3UWNA 4KHQA 3PMIA 3H08A 4GVMA 4JS4A 2JZ2A 4CHPA 2GUIA 1B9FA 4II1A 4FL6A 1WJQA 4CF2A 1JL2A 3NH0A 3DB3A 3S3OA 2YNHA 3V81A 4IDKA 4F3OA 1KVBA 1TKDA 4QQGA 1RBTA 3TABA 1ZBUA 3NCIA 4B9XA 2X4YA 2B8AA 3SPZA 2M0OA 4B3OA 3TAPA 1DLOA 4PY5A 3BDPA 4FW1A 3I8DA 1UA0A 4E7JA 5KCHA 4CHYA 2BIVA 2DFHA 1HRHA 1KLMA 5KRSA 2X4XA 1KSPA 2BGGA 1XHXA 2OZSA 1J54A 4CGFA 4CGDA 3AO3A 1GOBA 3MECA 1EP4A 1VSEA 4DS4A 4E0DA 4CJ3A 1WNSA 1OZ2A 3AVCA 5JS1A 3OYJA 1TAQA 2RHZA 4DF4A 2L89A 3ME9A 1NJYA 4DTUA 4O0IA 3K5LA 4KHYA 2RHUA 4ZTFA 4CFDA 1KCFA 4ICLA 1OZ3A 3O8VA 4BD3A 4IURA 3TR8A 5KI6A 4CJPA 2G3RA 1RTHA 3RMDA 1BGXT 3PNWC 3SUPA 3AVKA 3DLHA 1WSEA 4FJ5A 4OKEA 2XDPA 4CF0A 3NH1A 3K57A 4CK3A 4I9LA 3OYBA 4L8RB 2HNDA 2WONA 3TI0A 4XIUA 4LD0A 2R58A 4N5SA 2W42A 3AV9A 3IAYA 3NFAA 1RT5A 1RBSA 1S6QA 4ELVA 3RRHA 4IUVA 2GV9A 3S6WA 3KTQA 3M8PA 3KLFA 4M3XA 5HBMA 4KV8A 2LVMA 2FBXA 4H8KA 4QCLA 2D9TA 1SUQA 5T7BA 2IOCA 1RBUA 4CGGA 2P0KA 4LH5A 4KB1A 2VWKA 4FJIA 2KZMA 3ITHA 3ZT0A 2HHUA 2HMIA 1SV5A 3TARA 2XY8A 4CJ4A 3S9HA 4KI6A 4FLZA 4FJMA 4IUTA 4CJRA 2NUBA 4KPYA 3HJFA 1HPZA 1BQNA 4CJSA 4FM0A 4PLLA 4HHTA 3PO4A 2YNFA 3V6DA 3ZEHA 4CJKA 3SD4A 3BGRA 3SNNA 2PQWA 4DG1A 1LV5A 1WSGA 2YKNA 4ELUA 2RKIA 4C5GA 1ZBIA 3QETA 1NK8A 1NK7A 2OPRA 4F3TA 1KTQA 4DLGA 2GFUA 2B5JA 3DLMA 1QQCA 1D8YA 4OKJA 4FLUA 4KO0A 1ITGA 2G8VA 4E3SA 3HP9A 4KFBA 1EKEA 4HUFA 4DQPA 3QNOA 2KFNA 4KRFA 3MEEA 5C0MA 4UQGA 5D6WA 2BUDA 1XI1A 4E7HA 4GMJB 3KK3A 3MEUA 3I0SA 4CEBA 5HRNA 2O4IA 1Z25A 2HHQA 4DTNA 2E6NA 3LP1A 1U45A 1NK6A 3MO8A 4Z4IA 5KH6A 4E1MA 4GW6A 4I2QA 4N56A 3P8DA 5DMRA 2Q3SA 4CESA 2NLUA 3NHGA 2Y1IA 2QXFA 5C42A 4CF8A 1DTQA 2L8DA 3RTVA 2HHXA 3IRXA 1ASWA 4PWDA 3KD5E 2X78A 2F8TA 4FJ8A 3FLGA 2ETJA 4CEFA 3PO5A 3PV8A 2Z1HA
chains in the Genus database with same CATH superfamily
2ZPBB 2PVDB 1RDUA 2MOXA 3ZR8X 1W2BS 3IV5A 3S3MA 2K7AA 1C0FA 3HZ6A 2A3ZA 2V52B 5M1QA 1FXXA 3FJPA 5KCOA 4XM3A 1KYZA 1V76A 2RJCA 2CP6A 1WEIA 4A3JJ 1JO8A 1P7IA 4DFPA 1QVUA 1YRNB 1T98A 2O01E 3LX7A 4IO9L 3L4IA 3KLEA 1H8KA 1YJWT 3JB9D 3HSEA 2OD5A 1WHKA 1VF9A 3O3KA 3CZ6A 4A3DJ 2O3FA 3AA4A 5CYQA 4E7ZA 2JA8J 4KIBA 3CF2A 3G1OA 1MJ9A 3DU5A 4HVWA 4F7UA 4B24A 4EJTA 2Z2SB 2X3WD 3G71Q 3KTUA 2YNIA 4RB2C 5FU6C 2EQMA 1IKVA 2HKOA 3FMRA 2D2WA 4BNCA 4U0WA 3HHHA 5CO7A 4DV2K 3PIOA 1JJ2M 2PG4A 4DFJA 3F6VA 3V8JA 2DKGA 3TO7A 4BR7A 2YV0X 5HOOA 5IT9E 2DMQA 2G8HA 4KUDK 4NLBA 2JHNA 4AC0A 3M4OJ 1Q8IA 4I7FA 2E7XA 5HK0A 5AJ3K 4F2RA 4UNFA 2BY2A 4B3MK 5GADJ 2YHXA 4IHVA 1QHTA 2WAEA 3ENOA 4FWRA 2AT1B 2E70A 2NUZA 1GBRA 1OPKA 1DGWY 7AT1B 4J9GA 3AY9A 4AVPA 2DETA 4A4HA 3A5LC 1U49A 2HF3A 2OTLT 4B8CA 1KG4A 1VQ5I 2GIVA 3PT9A 2XPVA 1O75A 1UECA 3WU0A 1OR7C 3GOXA 2DERA 3WNFA 1HKSA 1PM3A 1NPRA 3RSEB 2K9LA 1UGSB 4Z89A 2RK1A 3H6ZA 3VS6A 5J1RA 2HQEA 3SAFA 4L18B 2O61A 3SWNB 2WBMA 3QERA 2D0BA 5D8LB 2A28A 1JRIA 1JGSA 2EQJA 4EM1A 2QWOA 2LSNA 1ETQA 3A01B 3E6BA 5IPAA 4H0TB 5GANh 5AZJB 3BROA 3OMGA 3OQ5A 1VYTA 4RS8A 2M4KA 4RTYA 1VQPN 5HP1A 4UY8O 3HT3A 5D8KB 3FZKA 5CYMA 5GJWB 3X2QH 3I55Q 4HX4A 2KFZA 3AKZA 3BR3A 3OYEA 3ISNC 4M41A 2N8GA 5D6XA 3MWPA 5DYMA 3V8LA 4IHWA 3A03A 1PUEE 1YS7A 2NUPB 2V1DA 2MW8A 2BHZA 4ZHRA 4WWCA 1JTXA 3M8JA 1SVMA 3VJPA 4CZHA 3L2WA 2P9SA 1VQ6I 3DF8A 4C2TA 1X3NA 4H5NA 1K73R 4XONA 1S5JA 3M8SA 2GGRA 4BRCA 3FHZA 2V4JC 3CC4A 4A61A 4DTRA 4BE2A 3TAEA 4BACA 3DEUA 1X9MA 2Y4XA 3VESA 5LHGA 2K9QA 3I53A 1PD1A 5GANj 1X6BA 1NBEB 4O4GA 2HOSA 2ASPA 3LSGA 1MNDA 5JHFA 4BWMA 2ZSHB 2GQIA 2D45A 1PNJA 3U6FA 2AXTC 1STZA 2Q1NA 4AHVA 1LAVA 4M77B 2FBIA 2ZJRL 1IREB 1RPWA 5CR2A 1ODDA 3G6EI 1YHQA 4LLGF 1VHXA 4LFUA 4C3JJ 1S7OA 1BISA 1VNDA 1E0EA 1TZLA 1K79A 3CMEA 4C92A 1LUJB 2UXBK 1QU3A 2FBYA 3CJTB 1TOVA 5F0XA 2V1RA 3EYZA 1OMIA 2D1KA 4Y7NJ 1O4XA 4L9JA 2EIJH 3V7CA 1W36D 3B6CA 1VQPT 3MCZA 4KAZA 4F52A 4YNQA 4DFKA 4A3IJ 2X9DA 5K5OA 1MGQA 4NQWA 2D0CA 2VQFK 1VQOA 4JP0A 4FYWB 3I0TA 2KQWA 3VKIA 2ECBA 4BQOA 4MDXA 2QEXI 4E9HA 1C0TA 2A3SA 4FU6A 2EFQA 2UZKA 2WUSA 2E2HJ 3C94A 1Q82U 3SUQA 1FN7A 4CC2A 2IGOA 1D3BB 1OYXA 1YITI 4RM3A 2FX0A 4M42A 2O6GE 1A04A 3CC7N 2KIUA 1BDGA 1W9HA 3HKZN 2EGAA 1VSIA 2LRQA 2VUBA 2KAFA 4P9UA 1AVZC 1XDUA 1XTDA 3HB9A 2H94A 2LNHB 4M3RA 4XKVA 2SRCA 3PIPA 3BZ6A 1E4FT 2YJEA 1TU0B 1PUFB 1L3SA 1FBSA 2HBLA 3FWEA 4DJAA 2CDTA 4AU7A 2OPQA 5GAN3 4KHWA 4HBLA 4QSHA 4CEDA 2HVHA 1QCFA 3JRCA 3H0DA 2XF5A 3JREA 2MWPA 3O6BB 3K7AJ 2YX4A 5E3OA 1SKRA 2ZXWH 3DOKA 5AYFA 3K9TA 3O4QA 3AVFA 1XGOA 3KIOA 2A37A 3MJXA 3MK6A 4CI0C 3CCRA 4O0JA 4HV5A 3SFZA 3ZEUB 2IEKA 4WQ4A 3WVEB 3CM6A 1SFOJ 3UT1A 3O1WA 4CF9A 1MIJA 1GLAG 3QIOA 4B9WA 4DZPA 2MPXC 5TKYA 2X6XA 3TSUA 5B5EC 3HSTB 3MWMA 3V9UA 2QQBA 3FISA 4E89A 3NEUA 1DT9A 1YJNI 1VSFA 2P5VA 1VQ8I 3WVDB 4F93B 2PI0A 4JI3K 3QLHA 4YIRX 2XD0A 3FZFA 3HTVA 4X9CA 3N4PA 2O4XB 1H92A 2CG4A 2HOAA 4M7AD 3NTKA 5HLFA 4ZGDB 4HVVA 2V79A 4B3RK 4RLQA 3CC7T 2PMUA 4Y28E 5TRDA 4M3ZA 1KYWA 3VQDA 1FYMA 1BYMA 2XRNA 5D6FA 3HPHA 4MQVA 3PSFA 3I5SA 2Z16A 4A59A 4KIGA 4LH4A 1UTIA 2L9NA 2YHTA 3LSIA 1D5YA 5BN8A 4LE9A 2XSDC 4JN4A 1A35A 4OPKA 5FLXZ 4Q0BA 2HZDA 1U06A 2DIQA 1H9GA 2R4GA 3LSRA 1HYVA 1QSYA 2RJFA 1HKQA 4GLKA 1RZ4A 1X75C 1GLLO 3BG3A 4CEEA 5LJ5d 3KP6A 4FOIA 3M4YA 2JM8A 1K6OA 3QBYA 4DR2K 4F2SA 4UHTA 3N4QA 1VQLN 1HQUA 3F8CA 3W3DA 2A5WA 1RT1A 4XN0A 3WE3A 4DBHA 3DXKA 3ASOH 2HHVA 2QF7A 2DA6A 4K43A 4A5AA 2WACA 1RADB 1PG5B 4F17A 2QYZA 3TL4X 1JLAA 2W85A 4M75C 2HKNA 3C6UA 1S9HA 4K41A 2FE3A 2RAEA 1QCNA 2CU7A 1VQ7A 2LVSA 1EO1A 4RAGA 4WFBL 4UY8I 2LDUA 3E9GA 2HU9A 2W0ZA 3HRSA 2HF4A 3CO7C 1VTNC 5IT9O 4F7UB 5GAEJ 4CSWA 4M75F 2A6TA 3QIIA 4KH1B 4HCCA 4FW2A 4BEHA 4IJNA 2DZCA 1MMGA 4FO0A 1E3HA 3DRRA 4W5NA 2DT7B 1E17A 2E6MA 3TTDA 1SEMA 1YCYA 4XLAA 1IRGA 2VC0A 4A2BA 3ZMDA 4FLVA 3CJ7A 1KD1O 2CFOA 3H1VX 4TVRA 4DSEA 2K40A 1RLQC 3WHBA 3H8ZA 2FBTA 4Y0WA 2W4SA 1KQ1A 2HOTA 2LTPA 5H6QA 4GYGA 1H1VA 4IRIA 4NZGA 5IT9K 1NG7A 4M71A 3MZ8A 2XRLA 1BKBA 3A8OB 4XLPF 4J2BA 2OF7A 3QOEA 3LP2A 3QJ6A 3TSZA 4IIMA 1RT6A 5AN4A 1W7PD 3WTXC 4JLIA 3SMPA 3E1SA 3LL3A 5J47A 3MEGA 2E2PA 3X26B 3U3YA 2O9VA 1VQLQ 1JBMA 3FZLA 4CCHA 3DKMA 3AVLA 2V9VA 3SQ4A 4M73A 4LFCK 1M1EB 1S1VA 3BUZB 3F2KA 1JEGA 2LDMA 4CJLA 1D9DA 1BOTO 3GFLA 2X1EA 2R7DA 1ZRFA 4KTWA 2FOWA 1LWVA 2JNGA 1YW8A 2CQ7A 1GOCA 2FHDA 5L3GA 1M2OA 2LP5A 2IW5A 4S04A 4CGJA 1FW6A 4M3BA 3I0XA 2FYKA 3MKYB 1K6YA 2I7PA 1VYUA 5HY6A 2RN8A 3GPLA 4XLNF 4YOYA 1FIAA 4CJTA 3BCAA 4CHUA 2J6KA 1ZHFA 4B1RA 1Y8RB 2VLAA 1Q81C 3ABKH 3FXJA 1SPKA 2IIMA 2BZYA 3MXJA 3SDZA 1G5VA 4DTSA 2K5CA 2DMNA 4Y15A 4FZZA 1I1SA 4N4HA 2DBBA 2YT6A 1JCEA 4PJOD 4I6MB 3WODF 2K7LA 2HVQA 5GAOn 4BXFA 2EFPA 1HJOA 2KMUA 2JZYA 2RHYA 2JJ7A 4B1WB 3BE3A 5J1EA 2ACJA 4FCYA 2LG4A 2FQ3A 2RI2A 3OHRA 1JKHA 3V7RA 4ZNXA 4GV3A 4KH4A 4DOWA 2XPUA 2Z33A 4EIKA 1ZYQA 4LG0A 4G7HF 2HZTA 3FXMA 2CO5A 2HMPA 3UKRA 1BHLA 3CCVN 2ITGA 3EAEA 4YPRA 2NUTA 5KNLA 3S1NJ 4HG2A 4DK9A 1A5WA 4DBFA 3KLNA 1VQMA 5KAFC 3M0SA 4AIDA 2ROTA 5F0CA 2KSSA 2ZPIB 4K25A 2CH6A 2JTFA 1MBFA 2QKBA 2BYVE 1KGSA 4OO1J 1Q1VA 4OPAA 2EYQA 5GAOr 4UNOA 4KT5C 4OMZA 5EZGA 4E7IA 1NGNA 2FC0A 4M3FA 1WAFA 2JMCA 2LCSA 3I71A 4H0PA 2M1BA 2QBYB 1XWLA 1JJ8C 1KQJA 3HTUA 4B22A 3MP6A 1U2VB 4A4KA 1R0BG 5CZ2A 1GCPA 4C0FA 1MWMA 3JAME 1ATSA 3FMSA 1R0AA 4Y91A 2RPIA 3CC4I 4A69C 2GFAA 2E6LA 2H3JA 4F14A 3ULRB 2VBWA 4UUVA 5ILSA 1RNHA 4O5BA 1KC8C 3CMYA 3LDSA 2NRVA 1NJXA 3RDIA 1VQ9N 4I76A 3VYUB 4HYEA 2XY7A 1H641 3SEZA 2QAZA 2OTJN 4DEXA 1XSDA 3QFUA 2R7ZJ 1EWRA 1TWBA 2XI9A 3ENBA 1YHQI 4WCGA 3JSCA 3M9AA 4K8ZA 3CP8A 5FU7C 3HYFA 3T7ZA 4N4GA 4RTUA 1IDZA 1B6AA 4XQFA 5HODA 2DMOA 2GOXB 3CMEI 1VA7A 1ASUA 3RMSA 4MHGA 1MA9B 3CCVQ 4R8HA 3MMVA 4BY7J 2XIDA 2X6OA 3CCVT 1YITN 2RH2A 5EGOA 1LVAA 4XK8E 2L4AA 4EW4A 3E5UA 4BE1A 3QEPA 1YJ9A 5CK9A 1N8RC 5H20A 1VRUA 3CESA 4XTXA 1N3AA 4IHTA 4M7DD 2VASA 2RQWA 1VQNN 1CLQA 4MMKA 1VQOI 2ZGWA 3UA6A 1QZ5A 3FLCO 1N25A 1LFBA 2DODA 5DLQE 1YG2A 3J81E 2E5ZA 3M0PA 4E1JA 3NVKA 3ZMTA 1IV0A 4PFZA 3CCJA 2Z3YA 4DV0K 4WTOB 3P38A 5C0YA 4CCJA 3AAFA 1U8RA 1LEBA 1WJAA 2MMPA 3A8YA 3V1QA 2W82A 3CCSN 1LFPA 3V9SA 2XPWA 3WEEA 1E7OA 1JUMA 1R59O 4LSNA 1M8MA 1GOAA 2ED1A 4MDWA 4GYIA 2WSFE 1VQ9Q 4KTQA 3GL1A 3CEYA 3ZSVA 2OTJQ 1S7EA 1VQ9T 1KG2A 2R7WA 4IUPA 3JW4A 1XMAA 2OTJT 2M45A 4G9ZA 2E20A 5GAHJ 4PA1A 4FLTA 1YJNN 2CUFA 4CZGA 1VQ8N 3REBB 3JCMb 1QQOA 4GY2B 2QEXT 3QEIA 3VOEA 5KYXB 3NRVA 2DAOA 5L3FA 1QTMA 3G4SN 1PRMC 4JRPA 3DMJA 1Z91A 3DEWA 2CUJA 2X6SA 1Q82R 1LOTB 1WQ2A 1XNIA 3HSBA 3OGDA 3DLKA 1KQSS 5EU7A 2FMYA 5TGTA 2DZ9A 3WXJA 4LJZF 5EEGA 3CCRI 1R7JA 4IXAA 1YITT 4HSRA 3CQ8A 4JHDA 2O8BA 4YG2F 1N5YA 3E9PA 2Q2EA 1VQNQ 5LEJA 5J2QA 3FMQA 3ZQLA 1S1WA 3HGYA 2PLYA 1LPQA 1B72A 3C7NB 5C24A 2VKEA 1TWFJ 3J7AP 3QJYA 2RI5A 1FYLA 1XMOK 5J8FA 1RGIA 1ZC6A 4LG3A 3MN2A 3GF2A 3BR2A 2DOAA 5KN8A 3JCMg 3SJHA 1BM9A 1FTZA 1TH7A 3W3CA 3H3OB 1RC9A 1HDPA 1TKTA 3KXTA 3NWTA 2RM4A 1NGIA 2EBIA 2F6CA 1I5OB 3I9QA 3W6VA 1Z6RA 2LQNA 1SC7A 2WBNA 4CZLA 2COBA 1PKTA 4A0XA 3AA3A 3CCSQ 3HSRA 5HDKA 1SFXA 1NJIU 1V4TA 3CCST 2VKDA 1I6XA 3FXKA 4IUQA 3ASNH 2OZMA 4FQGA 5GANf 2K3XA 4CEZA 2H6BA 3TWHA 3PO2J 3J7AO 1U78A 3O2PE 4OFEA 3VMFB 4XICA 3UE5A 4RLFA 1TK5A 3TKYA 2X48A 1QVGS 5CKFA 5IXBA 3RJPA 1C0MA 2E1MC 1ATRA 4FM1A 2GBQA 1RDWX 1VQKN 1DUXC 1YJNT 2ZWHA 5C25A 2O8XA 2DA5A 3KNTA 2FRHA 1VQ8T 2NS8A 4B1VA 3G4SQ 3VQPA 5E3LA 4HLYA 4RKUE 3QU6A 4IQJA 1M1GA 3G4ST 2BDPA 4GVEA 2NOIA 5JVHL 2ZE2A 3VS5A 3C18A 3BJAA 3AO4A 2QDLA 2QKKA 1U4BA 4Y4RA 5FJ8J 4QKUA 3VQCA 2JWKA 5E1WA 5CVUA 5CE3A 3CJNA 2F5TX 3EG9B 1WHUA 2PZSA 4B44A 2HS5A 4DA4A 4A12A 4YOXA 2IPOB 3L1PA 4LN2A 1SD6A 2OAUA 4OIOF 3PGGA 2DILA 2G0EA 2Z1IA 2BANA 1YYVA 5C4XJ 2LY2A 3HFOA 3I4MJ 4KH5A 2DK8A 1BC8C 3K5NA 4DR6K 4CD3A 4WXDA 1GLDG 4OLAA 1QVTA 1HA8A 1HW2A 3LFKA 1N32K 1OQKA 1C1BA 1OCRH 5DLOA 4ILJA 3JCMW 1SRMA 2B0LA 1VQ7I 1JHHA 1UDLA 4H0YB 1DPRA 4J8FA 2V8JA 4OFHA 5AQPA 1K4US 5J1YA 1I1JA 2P9IA 3HOVJ 4BRQA 4EW0A 4JZ3A 3OW2A 5FU6B 3Q7BA 1LDKB 3TOBA 5KYWA 3ZX0A 3THVA 1G3YA 3S1QJ 1TUDA 2YU9J 2YHAA 3QG1A 1T05A 2IA1A 1F1ZA 1MMNA 1BI4A 1MH4A 3U9ZA 3SQ0A 4XKCA 2NRZA 1YIOA 1W4SA 3BCBA 1VQKQ 1REVA 3VQ4A 3CQTA 1VQKT 3GXOA 2G7UA 2NLXA 1HCRA 5HCKA 4I6ZA 4BUGA 2LP0A 1FYKA 4JKAA 3ZSXA 4OFAA 4LUEA 2VL8A 1HYSA 2DEUA 2DYRH 1Q7YU 1QQIA 1IXSB 5GAOm 2P9PA 1FK9A 3VQ9A 2VJIA 1TYQA 4XLFA 2Q97A 2YRDA 1WNLA 4DS5A 3F21A 1LJOA 1RRJA 3EH1A 4H5TA 4A0YA 4DR7K 3CCQQ 1ORKA 3EN9A 1SSFA 3WNGA 4FLXA 1R6RA 1WN7A 4OVLA 1WZ2A 1NLVA 4HCBA 4B9TA 4L59A 4GKJK 3R6SA 4IBNA 2M3AA 2VT3A 3DI6A 3T8RA 1ZYRF 2DLLA 2QDYB 3FXLA 1QWEA 4B9VA 2YR2A 1AOJA 3QDKA 4IEIA 2FOKA 2BY1A 4M6VA 5AQRA 3PMIA 4AM3A 2ZZDA 3H08A 4GVMA 4BRNA 4CHPA 3I56A 1I27A 4II1A 4FL6A 5K5RA 3JAMO 4IOXA 1QP2A 2F9TA 2LOOA 2TDXA 4S0HB 3S3OA 2YNHA 3B8AX 3QP5A 4J6YA 3BP8A 1MGTA 1ESVA 3LM9A 1KVBA 2V7YA 4DB3A 3IKTA 2YUNA 2QK0A 3M5AA 5DM6L 1PVEA 1SEUA 4B9XA 3HOSA 2JUFA 2B8AA 3H0FA 2YCHA 2VB6A 2M0OA 4B3OA 1HD3A 5EY4A 2DJZA 3OW2P 1WDXA 2Q8KA 4EVVA 1TNTA 2BHYA 4O3MA 4ZN3A 2E34A 3EDPA 1JJ2S 3JAMK 1DDNA 2FO0A 2DTHA 2HVRA 5EX5A 4E7SA 5KCHA 3CC4N 2BY3A 1TUYA 4RTVA 2GZWA 3W6KB 1KLMA 2BGGA 3JB9H 1R5ID 3OIQA 4JQFA 2J6FA 4U7BA 4I98B 1XHXA 4G7ZF 1J54A 1VQMI 2P81A 1UGRB 5HNFA 2A08A 3AO3A 1W5CC 3OR1C 1YO5C 1GOBA 3MECA 4DS4A 4CJ3A 4D5CA 4J9DA 1YE9A 2ID6A 3AVCA 2M7BA 4JX4A 3OYJA 3WXLA 1Y96B 2BZ8A 1APLC 4ZDPA 3A02A 4O0IA 3K5LA 3H3ZA 5CQYA 5EGOB 2GLOA 4ZTFA 4CFDA 4BVPA 3THYA 3J81O 2ZM6K 5C10A 1KCFA 3MZHA 2PUOB 3CMEN 2XAJA 3INZA 1S72Q 3CCUQ 4OU0A 1O3TA 1RTHA 1T08B 3KP7A 2Y0SA 3SUPA 3AVKA 3R0JA 4FJ5A 4KHPK 4OKEA 4BY9C 5CPRB 1R36A 4CF0A 3NH1A 3UR3C 2VGNA 3K57A 2CH4W 2J6OA 3JRBA 4AFQC 4F92B 1B07A 2HWVA 2LBFB 1NPPA 4XQ3A 3IQLA 4LD0A 1OH5A 2CUBA 2W42A 2DD4A 3C2GA 3J81K 2RQPA 5AQZA 3DJCA 3IAYA 3H3UA 1RT5A 4EAHD 2ZJPL 1S5LC 1XMXA 1XNQK 1S6QA 4KBMB 4NXMK 4BHBA 3UATA 5GMKl 3S6WA 3SFIA 4M3XA 5HBMA 5MLCQ 2CV2A 3EUAA 2FBXA 3CC4T 2D9TA 2E2IJ 2OU2A 5M1NA 5T7BA 2IIRA 2LNBA 1RBUA 2P0KA 4JI1K 3AL0C 3CXCA 4YOVA 3ITHA 4Q47A 1YJ9I 2ZNYA 1LNXA 3MVPA 3THXA 3VSLA 2E36A 4KI6A 3FFKB 1Z6TA 5GPCA 4FLZA 4FJMA 2MC4A 2Z9OA 3HJFA 1C0WA 3DBLB 1JKOC 1HPZA 4DW6A 4ENMA 4XH1A 4ESBA 4KN7X 2YNFA 3JRHA 4CJKA 2DJNA 2E1HA 1FBUA 3BR6A 2RQQA 1YHQT 1NMDA 2EFNA 1WJCA 1Y1VJ 1SSHA 3LDOA 2V26A 1GFCA 1ZBIA 1HF0A 2RMOA 3DKYA 3CCJI 5BN9A 3CMET 3M8EA 2HYJA 4B3AA 2IS6A 2W48A 2MAMA 1QQCA 2OX7A 2VBXA 1U3OA 4FLUA 1ITGA 2YHYA 3M58A 2M02A 1OCOH 4YFNF 2HVSA 2FEZA 3QBWA 2QM3A 2YLBA 4PL7A 2VXEA 2YSRA 2DFUA 5CKEA 3A8GB 1IRZA 4BQQA 4KRFA 3MEEA 3I35A 1VQOT 2QVOA 4ZYDA 4GMJB 3F72A 4BRGA 1M27C 4CZZA 4D9JA 3BJOA 2Q31A 2RQUA 1Z25A 1XCVA 2E60A 3LWFA 2HYGD 4D8KA 2NRAC 2JUCA 2P0PA 1NK6A 1QZ6A 3MO8A 4CCOA 3QPLA 1QQMA 2P0WA 4DCHA 3PL8A 3KHYA 2O8KA 2A6HF 1X1AA 3D2EB 3K0SA 2FZGB 1DTQA 5DM7L 4N0BA 2RQVA 2L8DA 2V1XA 1XG1A 2ZPGB 5BPNA 4PWDA 2QYOA 2M87A 2VQHA 2ESNA 3I8BA 2RK2A 2X78A 3P8BB 3ZQCA 4FASD 4AIJA 2CUEA 4KULA 3FLGA 4RAZA 3ESWB 4GKKK 1YW7A 1WHLA 3CXCP 4Z8AA 1WXTA 5CKHA 2R57A 1ZBHA 1UHFA 2Q0OA 3HOTA 1K8AO 2RA2A 3CJRB 4M78D 3V9WA 2CP0A 4M3GA 3VB2A 2NRWA 1TXQA 2QWMA 1P6RA 2OAWA 4J83A 4XOPA 2FBVA 3WTVC 2LSOA 5GAN4 2R5AA 4M75B 2F2EA 3I0RA 1TSFA 1QVPA 2XMFA 3QYGB 3O9UA 1NM7A 1TGOA 3M5RA 3O4NA 2E3IA 4K0KK 5C6SA 4FIBA 1NM1A 4N9HA 5L8RE 4GGGA 2GQVA 5GAN8 3VA0A 1TP4A 2UV1A 2WFBA 3D5LA 5HNHA 1VSDA 2P9IB 1HKTA 3OYMA 2F5KA 4IF4A 3K4MA 1QVFS 4FVMA 3GOIA 2JS2A 2QQ9A 2F5EA 1AZEA 5KYWB 3VGMA 3J8AA 3PX0A 1IJJA 4QAGA 5GAMd 3SFMA 4JKGA 2K4YA 3GW2A 3TPQA 1WJ5A 4M74A 1Z3XA 1U47A 4OWRB 3CUQA 3EL2A 2H1KA 2R5YA 5C15A 1BI4B 3HVRA 3D7EO 5LMNK 1JLGA 2UXCK 1NJIR 1NK3P 3X20B 4ASNA 1BJAA 3DYAA 2JN0A 2KJCA 2GQQA 3CCEQ 5BRHA 1FX7A 2CT3A 1BI0A 3ZRGA 3PFIA 1X9SA 3MQ0A 4FWKA 5GAN7 1NJZA 3K70D 1YQLA 3PFSA 4HVJA 5JVGL 2HBPA 3RPUD 2NOHA 2LREA 4DYQA 5AQKA 2P9PB 5EVZA 3CF5F 1B9MA 4YFUA 4IOAF 1WKMA 1PD0A 3HHGA 1TYQB 4FE4A 3I4NJ 5J4VA 2OFKA 2NNNA 1KZHA 2CP3A 3AO5A 2JA6J 4B9UA 2YUOA 3FBIB 3HOYJ 3WXKA 1MZBA 2FPDA 3JB9J 2BVLA 2XK0A 1TWCJ 3OJUA 5BREA 3OYKA 3SAGA 2L3DA 3AO1A 4H0XB 4AM6A 3PQKA 1OCPA 1ZUKA 2IG0A 2ESHA 3RYRA 4QLCU 2JA2A 1U5TC 4QVCA 1A6IA 1KO9A 3FKIJ 1I3AA 4MFEA 2XDBA 2JK3A 1ZBLA 3QEVA 3VQEA 3CCLA 3JB9G 3AVGA 3G1LA 3OYAA 4PIIA 3U2RA 5LRRA 5CVVA 3GTOJ 1YI2N 4X0GA 3O8MA 2UUZA 1KG5A 3JCMJ 1VQ7T 3VV0A 2M8EA 4AF1A 2X35A 1I8FA 4ENNA 1H88C 4MQ9F 2CSOA 4I2PA 4CJQA 1JJ6C 4HCZA 4RUGA 4KA4A 5FKOA 3IFRA 4CJFA 1FMWA 3VTHA 1LNWA 5GAOp 1L3TA 1Z9CA 2H8WA 1NHAA 1OPCA 3QWYA 1M3CA 4WK8F 3DRPA 3F3XA 2GAUA 3EFSA 4DQIA 4YELA 4X64K 4CF1A 3LMMA 5IOYA 1O3RA 5HDNA 5HLHA 4R5PA 3ULEA 2JT4A 2RNJA 3EGUA 1AZGB 1WI9A 1MMDA 1SAXA 4JBAA 1WSJA 3WQUA 2O8DB 3JXUA 3F5TA 3DPTA 2O8CA 4RGSA 2Z1GA 4XMYA 3I56I 2RC4A 3OL3A 2PVOB 1VK0A 5JI6A 2CP5A 1S3JA 1Q7YR 4A6DA 4ZTJA 2IGNA 1MSFC 1T56A 5DPKA 2LKSA 2F48A 4JRKA 3AVNA 1ZBJA 3F22A 5CAIA 3B02A 1P4WA 4XH5A 4YFKF 4OINF 1B34A 1SAZA 2BZXA 1KFDA 2AXLA 4G1QA 2CT4A 5KGXA 1MBHA 1O9SA 1UEBA 3AG3H 2E5QA 2KDOA 2LMDA 4M6XA 4KICA 4RB1A 2LF7A 4CFAA 2VKNA 3VQ6A 1W7AA 5EEHA 1W2BA 2NNWA 3SBGA 1UFMA 1LAWA 2DA3A 3VYHB 1BL3A 2EYXA 3CC2I 1TNSA 4FT8A 2V9KA 1RAFB 1ZLMA 1BR1A 5BS6A 3WQTA 4BROA 3CP2A 4C8MA 2QM1A 2HW3A 3ZT4A 4PHTX 1F43A 3EO3A 3ZX2A 1YI2Q 1K73O 4PJLA 1RAAB 5HKCA 4DMNA 2HEQA 1WBBA 1NKCA 2VXFA 4XSXF 3GLXA 3Q5FA 2K2MA 1YI2T 1A36A 3RMBA 3EG2A 4JI7K 2W84A 3PX6A 5GTIC 2FXUA 3K58A 1AOYA 1JLEA 2GWRA 1S29A 2G7HA 3O8HA 4M3TA 3D2FB 5IYBJ 1SG5A 4LMYA 1BK2A 5GAMe 4ID5A 4LK1F 4WYBA 2V1NA 1GLNA 4AILC 2V9PA 3O3HA 3SZTA 1G4DA 3NGZA 2BKDN 3QESA 4XORA 4LF4K 1LE8A 4AHTA 2ASOA 4ZZDA 3B6OA 2P4RA 4JI5K 2O8FB 4XTWA 3QEXA 4CE9A 4D0PA 1XC9A 5AZIA 2CWEA 3JV3A 3OYYA 4B9SA 3AVMA 2OQRA 2WSEE 1L5UA 1X1DA 3BQYA 2CP7A 1PYVA 2DA1A 4X1VA 2VG7A 1P92A 2EQRA 4PFOA 5IYCJ 1K76A 1S6PA 3DWLE 2E7WA 4BG8A 1VQMT 1YJ9N 3OVNA 4HLXA 1ZG5A 4DQSA 1EH7A 2IS3A 2VJ5A 3HXLA 3QO3A 3T5XA 2GUPA 1GFDA 4JI2K 3M8QA 3ZX3A 1QPMA 1C6VX 2A40A 2B7EA 3TREA 2RHKA 4RAFA 3QFPA 5J4YA 4WFAL 4P55A 5I42A 3WTSC 4A3BJ 2R3SA 5BNGA 4GY5A 3H0IA 1IXDA 3NFCA 1QNTA 2L02A 3OYGA 1ULYA 2CV1A 3F0CA 4CICA 2HQXA 3CCJN 2C6YA 1I39A 2KQRA 1Q18A 2MH9A 3GEZA 5EJCA 2ROLA 3VQ7A 1W2BP 2CUZA 3VQ8A 1OX8A 2A41A 1U2WA 1XHZA 2IC3A 1J6ZA 3J7YP 2F4MB 4M9SA 1T95A 1XOVA 5DTDA 1T39A 1CQTA 4QQDA 2FZKB 4E19A 1YN8A 1QZZA 2DTUA 4LF9K 3O9TA 2PMZA 4J9BA 5J6XA 2WSCE 3SB2A 4IHSA 1ZA1B 3FFIA 3MCAB 4IL6C 2QK9A 1HKGA 1FMKA 3RYPA 3LA3A 4M7AC 2WB1A 2MWOA 4PL8A 4EP5A 2O2OA 1XQHA 3QINA 1GLFO 2F2WA 3IAS2 1GDTA 5A0GA 3OYDA 4IUUA 2JTMA 3JSOA 2LKPA 3FEOA 3KETA 4PKCC 2YJFA 4ELTA 2A6EF 4B9QA 1GVJA 3FXQA 4M7AF 1D09B 1YJ9T 2AHQA 1SFKA 3FSPA 2NXNB 1OYIA 3KP2A 3QMLA 4RAYA 1YVUA 1FSHA 5FPEA 3I5RA 3VU3C 1KONA 2WA0A 1ZELA 2W41A 3LA2A 4YFXF 2LQKA 4LNPA 4Z4GA 1MBKA 3BG5A 2C06A 2L4MA 2DE0X 1W1WE 2Y48A 2OZ6A 3QO9A 3CQXA 3JCMd 3JRAA 3M1CA 3C4SA 3EHRA 5HLGA 3PO3J 1QS4A 5J1UA 1DP3A 2PNIA 4MO4A 2HHTA 4G8XA 3CCJT 2W57A 2EYYA 2P8TA 3F9KA 2CYZB 4M3DA 2NVUB 2VT2A 2E1MB 3OB9A 1W97L 3VF6A 3LCNA 3SXYA 1YF5L 5KPRA 3ZQHA 4L5GA 3LSPA 2CZ6B 5ICEA 1NU0A 4OLBA 3K4LA 4NOYA 1HQEA 2F5FA 5AQMA 1AU7A 4Y1DA 2KZZA 3RVCA 2JJ9A 2NOJB 3GTKJ 2MLGA 3JRDA 3QYFA 4M7AG 2K9SA 4CYDA 2AJQA 3DLEA 3K0LA 4LD6A 5GANg 2KEAA 5BQTA 4J2DA 1WFWA 2L2OA 3U9DA 3U1KA 2JSPA 2HXIA 5CHIA 4OMNA 4PCQA 2HNYA 2ZQBA 3PIOF 2JUGA 2I5JA 4HT9A 3IH2A 3NF7A 2VG5A 2GF7A 4MO5A 4ESRA 2HQ5A 2H8RA 2P5KA 2V7FA 3CVTA 4KREA 4HDVA 2TRTA 3KWGA 2VPRA 1M3AA 1V55H 4OB0B 3QWXX 2BXYA 2HQAA 3DU6A 5GAN2 3UKUB 1NOZA 4MLOA 3MN7A 3GBGA 3W0LA 3D0PA 1D5AA 1C1CA 1X3MA 5HRRA 5AIQA 3HBLA 3GTMJ 3N05A 2MF2A 1RDCA 5IWAK 2YNGA 2JPSA 4GV9A 3LQQA 3DWLA 3Q0UA 4GDFA 1XQPA 5BRDA 2DBKA 2XAGA 1IO2A 4CO8A 2H8HA 5AQTA 1NKEA 2BXZA 1T8EA 3L2CA 2KXDA 1TLHB 3HIFA 4BU2A 2RDPA 3Q9SA 4EMHA 2NRRA 1UE9A 4OGCA 1T3VA 5CVJA 4D5FA 1U8BA 3CD6N 4MNUA 5AR0A 3NAEA 3Q9VA 1A6QA 2EINH 4DLEA 1EJ9A 1O3SA 5A0LA 1X3WB 1K9AA 3FF5A 1WEFA 4LOCA 5M5WJ 3C95A 1EV7A 1D3YA 2H56A 2RF0A 4WQ5A 3IUCA 1VIEA 1HLUA 5EG0B 1X2KA 2HTJA 3HM8A 3X24B 2G8UA 1HMVA 4B3XA 3ZN1A 3CMAN 4NYFA 1Z9QA 3VYGA 3RMAA 3RR8A 1ERDA 5GAGP 3LZIA 1NGBA 3BY6A 1BJZA 4HUEA 1BBZA 2CW7A 2P6SA 3QNNA 1N34K 5GAMj 4CJWA 3E6MA 1G59A 4CERA 1GV5A 4EJYA 1TWHJ 2DOEA 4DSIA 4JKFA 1TKZA 1X58A 1N3CA 4LD9K 4ISGA 3HP6A 4HRIA 3MP1A 3NTHA 2OJED 3ZSYA 3PNTA 4BRIA 5I11A 4Y1CA 2D0NA 3M0TA 1JL1A 1KFZA 3OYHA 3HVTA 1U5TA 2KW4A 1ZBSA 2QCOA 1DEJA 4LC9B 3AG1H 2CV0A 3HRTA 3CCLI 1P8ZA 5B1BH 1FTTA 5KYYB 1IN7A 1PCXA 3L09A 3ZQ7A 2XDDA 2CUDA 3SK3A 3F70A 4HA8A 2R7UA 4O44A 4F04B 4M7AE 1NGEA 3CERA 4CJEA 4DTPA 5L3CA 1ZQ1A 2QUFA 4C92F 1J9AA 4MMLA 3CD6Q 4B8XA 3OS1A 1VQ4A 2E71A 2F4VK 3G10A 1RAEB 2M16A 4N47A 3BPXA 3KLOA 3H0HA 3T1AA 2RHXA 1C6VA 2EZHA 5D5XB 4RW9A 3MXIA 1U0JA 4IKFA 2ZD1A 3VN5A 1GLEG 3G3ZA 3BY5A 3AGRA 3HBTA 4OB2B 3QDRB 1KQSM 2IT0A 3CMAQ 3CC2N 2BE5F 3WTYC 3FIWA 4PJOG 3OV8A 1C0UA 3LAJA 1WHHA 3NE6A 3ERED 3QUIA 1X9JA 4N76A 3TAQA 5FKKA 1J5OA 1ZLKA 3WG7H 3LDPA 4BREA 2VODA 1RT3A 3DKWA 4M6YA 5C3EJ 2XO7A 2OPPA 1YNZA 3PJRA 3HPWA 4CJVA 3BG9A 3JCMV 5M9OA 1SMTA 1LWEA 2F2VA 5I2MA 2K3YA 3PX4A 1ZBFA 4DQRA 3TGNA 3GWZA 3QKJA 2FA5A 1ACMB 1J3TA 2O8EA 3WU2C 2XAQA 2QA4N 2ZXIA 1KQ2A 3PUFA 3VS3A 3PUBA 1TL8A 4XLEA 3NF6A 1K78B 1VI0A 3PIPF 4QS7A 2UUAK 2VV5A 3JCMQ 1FLIA 2DMPA 1Z9ZA 5FPNA 4BRFA 3GO5A 4JEPA 4DYCA 4A5BA 1UJ0A 4KTZA 2QGGA 1KD1C 2GOMA 1PDNC 4PFPA 5F04A 3J80Z 4S05A 2X3XD 2QWPA 3CCMA 4B4CA 4M7DC 2XIGA 2FRYA 1MU2A 2NVYJ 4JYAK 1JE8A 1IN4A 3BWGA 3V9XA 1YWPA 1RACB 2ME0A 1E3OC 3DLGA 1WHMA 1SD4A 2E4LA 5F2RA 2ZFWA 1H89C 1IGUA 1TL3A 1QZYA 4F8RA 2M2EA 1TQIA 3V1OA 3UA7A 1E6GA 1R49A 5FRNA 1TT5B 3CLOA 3WTUC 2K86A 1B8IB 5SWMA 2DYSH 4GCVA 1E6HA 3IMXA 4QWQA 2JVHA 5AIPA 1BWFO 4RMOA 2ZJ2A 2YLCA 3AVHA 1ZSZA 3SHWA 5FLVA 3CC2T 2B6AA 4C5HA 1MUZA 3HKSA 1R4MB 2XY6A 2GWJA 2MA3A 2K9MA 3R61A 3DFGA 4FZXC 1LDDA 4F91B 2KK4A 2R5ZA 3RIRA 2OZUA 3JSMA 4IFYA 4A3EJ 3G71A 3IG1A 3FM5A 3LAKA 4BYYA 3X28B 5AQYA 1B1BA 3ZQFA 2V6EA 3OYNA 1I3QJ 3A0BC 3A8MB 2QA4Q 1JXEA 1J9IA 2CW0F 1NK4A 5LGNA 1TK8A 4HTUA 4ZYEA 3I4PA 4EJOA 3DPUA 3PVLA 1BCOA 4AFSC 1NG2A 4BI3A 3DBHB 2D0AA 1LDJA 3VEPA 1NK0A 5DM7R 4JJCA 1YJWN 2P5GA 4M7DG 3VW4A 1OQYA 1JT0A 1PHTA 3VFZA 1YOVB 1Q86C 4II3A 5GPAA 4W5QA 1JLBA 2DJIA 1AHJB 2J5PA 4XTYA 5E26A 4IFVA 2AHJB 1HNIA 3FXOA 2QWWA 1ETVA 1R8OB 4FISA 2JTEA 2VXDA 3EFRA 1QQNA 2EYZA 2BE9B 3L2QA 2JWLA 2KP6A 2YHWA 2ZPHB 3CDLA 2JQ7A 4HCKA 4OAYA 2OI3A 4AIKA 1UGQB 1JQQA 3PVQA 3L2RA 1O57A 4FL9A 1AKHA 4RM2A 2ZJQF 3HGGA 4M75D 2XAHA 2HL5C 1GXIE 4JRQA 1X19A 2TCTA 4GXOA 2STTA 2I5WA 4BRLA 3CDHA 4M7AA 1FT9A 4AHRA 2JS0A 2G8IA 5J2MA 2GCXA 4DV1K 2RN2A 3HFNA 5F64A 4P96A 2COMA 4K2EA 2KHMA 1UB4A 4IQ4A 1JCGA 3I55A 4JNEA 1Q82O 1V3FA 1FJGK 4FWSA 2KKOA 2KQ2A 2QTVA 3ASKA 2A61A 4A62A 1KSWA 4O8KA 3O9SA 2HYFA 2EV6A 4KBOA 1S1UA 2VBZA 1X1PA 3LGLA 3RKXA 2EZLA 2QKMB 2X74A 5AQJA 1WZOA 1TUGB 1YJWQ 2DMTA 3HRUA 3JTHA 3QEWA 1UZCA 3NGIA 4IEJA 1G15A 3MAJA 4YY3K 2ZCWA 4PDKA 3HM9A 4HV6A 4JS5A 1FC3A 1ZR4A 3MPUB 4OGEA 3NPFA 4LLNA 3EGXA 4KFCA 3U3GA 1T6SA 3SHFA 1EETA 3ZT3A 1XN7A 4YDUA 1D5VA 1LWYA 3KEYA 3KLGA 5AQFA 2O0YA 1SFUA 3ABLH 5DK5A 3DRSA 1U9OA 4XL9A 4FJKA 2V8IA 2XHIA 3ATVA 1RTJA 1FSEA 3T19A 1JXBA 3O9QA 1HNZK 2J4RA 1I4K1 2B63J 4CK1A 4F16A 3ID8A 3SWNC 1I1GA 1KHIA 4LXCA 4MDAA 5K14A 2OTLQ 1L3LA 3VUBA 1Y1WJ 4BDPA 5KE3A 2VOOA 2EJRA 3LSJA 1SL0A 4FX0A 3IL2A 1DU0A 1JLCA 1R0CB 2LT4A 2CQXA 1YS6A 1U6GA 5K7FA 3AAQA 4M7DE 2WAFA 1QA6A 3K2PA 2XUBA 4PQUA 3K59A 5EZHA 4EFHA 4C8QD 1N78A 3E19A 4DV4K 2VONA 4RWTA 3PSIA 2QWQA 4KKOA 1Z3YA 4KT0E 2P9NB 3RKYA 4N4IA 3GDQA 1W7PA 2Y2ZA 3WT0A 2XB5A 1AA7A 4FYXB 3C7JA 1ZG3A 4UUSB 4ISFA 4PGHA 5K1YA 2KZGA 4LFBK 3JB9I 2FF4A 2PFBA 2LNVA 1Q81U 4LUDA 2CGLA 1KQSA 2GELA 3F73A 2HNZA 1NMNA 3GTGJ 2E6ZA 1OX9A 1U5TB 2ZXHA 5DS9A 3UWNA 4KHQA 4DV3K 4JS4A 1D4XA 1I5LA 2JZ2A 1JCFA 4DR1K 3N0UA 2HKQB 2DU9A 4RB3C 1EA3A 2HKXA 1P7MA 2Z5UA 1JL2A 2PX9A 4BJTA 5FD5A 2I5UA 2ZNZA 1EF4A 1PU7A 5DD4A 1X01A 3HG9A 4WF9L 1ZUUA 1TKDA 2Y4YA 4JI8K 1FOWA 1X3UA 1ZBUA 2HI3A 5LJ3e 4J00A 1Y8QB 1BI3A 2ELJA 1M1FA 4PJOA 3D6RA 1WHJA 1OISA 3I59B 4LDUA 3FK6A 3SPZA 3CWSA 3BDUA 2D1VA 2P9LA 2DL4A 5H1SQ 4A3KJ 4QPQA 1PWTA 4PY5A 2DPNA 1WQWA 4FWMA 1USTA 3CBMA 3A4CA 1DJ7B 2BZTA 4J9IA 4IO8A 4CHYA 1Q95G 2PJRA 1MJBA 1HRHA 1KSPA 4UV8A 1QVGA 3VS1A 1PU6A 1DKGD 3M59A 2E1NA 2ECZA 2QTDA 1JKRC 3CDIA 3KYCB 3E6CC 2BTFA 2W7NA 4NDLA 1X69A 3DXMA 1WNSA 1WJEA 3HKZA 1JI8A 3M0RA 3OR2C 4M3EA 2A36A 1USSA 1VQPQ 1NTCA 1TAQA 4PKHA 4DF4A 4E9FA 4WF2A 1OLTA 3QP6A 3K4KA 1PSFA 3J7AF 4HDUA 1IGNA 1PC0A 3TU4K 5GMKi 1KC8U 2YPRA 3AFHA 1VQ4I 4U0YA 4JX6A 3I54A 4IURA 4A2AA 1BC7C 2DL5A 2P9UA 2DT6A 1K9MU 3REOA 5KPTA 4CYCA 1IN5A 4NLCA 1O13A 1CF7A 1WPYA 1IHWA 2DXUA 3EG3A 2CZ7B 4P9FA 2D8JA 3WHCA 3OYBA 2HNDA 4BBSJ 1MUNA 1BG3A 4IZZA 4XIUA 2DLPA 1K0XA 2M8GX 1N5ZA 4LDVA 4FETA 2R93J 5IHKA 3F10A 2QZ8A 1T3LA 1JT6A 4ON0A 2MFZA 4O6JA 3RERA 1XSXA 1DPUA 2KHOA 3QYBA 1BOBA 1PSEA 3J7AY 1RBSA 2O9LA 1N8RU 2KJBA 4ZGEB 2DYIA 4IUVA 5M3MJ 3CPWA 4MZPA 2GV9A 1L0OC 3M8PA 3KLFA 2ME6A 1P7JA 3TSPA 1HXDA 4H8KA 4QCLA 1WWXA 2ADUA 1MJAA 4CGGA 2VWKA 4PSWA 1WYXA 3ZT0A 2HMIA 1I6HJ 4XNFA 3TARA 4DBRA 2QG9B 1T38A 4MFDA 2XY8A 4CJ4A 5M1PA 2GXGA 2EFWA 2X0LA 2ZBKA 2NUBA 4DEYA 1BQNA 3HL2A 4FM0A 3PO4A 4HHTA 1QVGP 3CCMI 4R56A 4M7DA 2NNYA 4Q48A 1LJ9A 2LYCA 1MDMB 1LV5A 4E4HA 3LOCA 2ZB9A 2YX6A 2YKNA 4ELUA 2RKIA 2E12A 4C5GA 3LWIA 2JMWA 2FRWA 1WI3A 4VUBA 1QVFM 2XC7A 2EA2A 3S93A 3QZ9B 1NK7A 1NK8A 1Y57A 4ILHA 4CD1A 1W1FA 4RBOA 4FSVA 4DLGA 2KRCA 5F6FA 1WX6A 3DLMA 4FWNA 3DP7A 3PE0A 4EM0B 4OB3B 2G8VA 2DO7A 2RV8A 2JA7J 4RGUA 3CC7Q 1EKEA 3F0ZA 3CW7A 1VQLA 3RCOA 4HUFA 2IS2A 3HZJA 4DQPA 1SF9A 4F9OA 4A54A 4B48A 5IP9J 3JSPA 2GTOA 1VUBA 1Y0MA 2ZFUA 5D6WA 3EKSA 5DUKA 3KK3A 1XGMA 4IDHA 3GTJJ 1IAWA 4M72A 2O4IA 3G71I 2Z0WA 2GIZA 1JGGA 2HHQA 3T0YA 2CGPA 4M7AB 1WCMJ 1YIJN 2ELHA 1I81A 3FJ5A 4N56A 2YU3A 5JFRA 3MKWB 1H9TA 2Y1IA 5C42A 1VYVA 1ETKA 1ZKGA 2JW4A 3IP4B 1JJ2A 3RTVA 2WB1N 2HHXA 2VCPA 3RI4A 3IHUA 4EQQA 3IRXA 1ASWA 3CPWP 2UUCK 3AHUA 1BU6O 2DCEA 3A0IX 2LZ6B 2K79A 3VEZA 3ECHA 4XU2A 3ATUA 3TP0A 4LB5A 3PO5A 2ECCA 4LITA 5AQXA 3PV8A 4JOMA 2Z1HA 2DBMA 1F21A 1M2VA 2XKPA 3CWTA 2NAZA 4LIUA 3M3ZA 4MEYF 1XSVA 3KFVA 3HJEA 1NE8A 1ON1A 2L7FP 3N4MA 1HKCA 5LJ3h 1V4SA 1BI1A 1RI7A 1YXQA 5HVQC 4UVCA 1QKWA 3ZYYX 2VE9A 2DXIA 3G7ZA 5E8GA 4OB1B 4M78C 4CHZA 4IG3A 2DPPB 2NOGA 1IGQA 4E2FB 3Q1JA 5IP6A 4RTZA 1RLPC 3VEWA 2FSNA 2OV7A 5FWBA 4FX4A 3P1GA 3NWSA 3AVIA 2CQQA 3H9NA 4PKGA 2RPNA 1TQMA 4CZEA 3I55I 4C5IA 5HLTA 1YRNA 4XU1A 3F9MA 2OYQA 4CECA 1QGPA 2XSJC 4M78F 3MX2A 4BKXA 4OPJA 3JCUC 1H3ZA 2Y9YA 5C4JJ 2X4JA 3UPUA 1YIJQ 2G9WA 3EGDA 1S9EA 2F5DA 1JUPA 4EA4A 4B08A 1YIJT 3CMMA 4YOUA 3G73A 5J3BA 4J8OA 3K2ZA 3BG6A 2ZCFB 5LJ3j 3UB5A 1IB8A 2Z99A 1M1KC 1YAGA 3DAWA 1KXPA 3CJBA 5JR3A 4DSFA 2Y1JA 4XH4A 3META 2CZ0B 3OBWA 1ACIA 4DZJA 5GANd 1LWCA 2LRDA 1ILYA 2XHBA 3C0BA 3VOVA 1T0FC 4C2MJ 2EJ9A 3ZSQA 5LFAA 5IT9Z 5AFUH 3KFWX 3H5RA 4BRDA 2PBIA 1VQ5N 2VIXA 1DTTA 5CHZA 2L2PA 5GMKm 2W10A 3M8RA 4OKKA 2DFEA 2KRSA 5IHNA 1AWXA 3NVMA 5D5UB 3AAPA 3H46O 3QIPA 4XBFA 1GL5A 1JJ2P 5EOYA 4CEQA 2BOLA 1WJFA 2YUQA 2HQRA 4JJBA 1MBGA 2ED0A 3C2HA 3A2FA 2W24A 1X2QA 4M78G 3S32A 2BBYA 3ROUA 2GX9A 2K57A 5BR8K 3ZSWA 3LFUA 3CJCA 3KWIA 3M7GA 3NMUA 1CXQA 3CCVA 2H1LA 3CLQA 3KE2A 2YXYA 1EIFA 3SWNA 2HAXA 4EIAA 1T7PA 3CJ1A 2OUMA 4A5NA 4OP0A 2JVGA 1M90C 2P9SB 2QGUA 4YIIA 1U9NA 2Q1ZB 4QQ6A 1FOKA 2FF6A 1XGSA 2V1QA 4XU3A 2LCLA 4CJUA 2H3GX 5AZJA 2NOZA 4CUGA 4W5OA 1F5TA 1IV6A 1R9TJ 4DTXA 3V4IA 3NMZC 5KRTA 4NCBA 5C12A 1Q86O 3H41A 3MDQA 1X9WA 3BTJA 2R5MA 3RR7A 1VQ6N 5BMZA 2F7TA 1FKPA 4BR5A 3RNJA 2NUPA 4NXNK 2M7AA 2K5LA 3K4JA 4P1WA 3KKRA 2DTZA 4O5FA 4A53A 2DX1A 1MHNA 3D5SC 2DA9A 4CXFA 2IP2A 1VQ9A 5LJ5e 4IG0A 2OTJA 2WAQN 3FHFA 4KN4X 5GADP 1VQ5Q 4N0AC 2EQKA 1QSLA 4BRMA 2UYTA 2DTIA 4C92B 1VQ5T 4DSJA 4BR2A 3C3WA 2MLKA 2K5FA 4RA2A 3G6EN 5FKMA 2EJFA 5M5YJ 3EKUA 3MN6A 2ZKZA 3QXEB 1FBQA 1WEGA 4CCNA 5TKWA 4KITB 1G3WA 2UXDK 4JJDA 3BTLA 1J5EK 1UGPB 2HHSA 1SZ2A 3CF5L 4CHOA 4IOAL 3MN9A 3S3NA 5E8IA 2HQHA 4EMSA 3VQ5A 4HQMA 4NQWB 4II2A 4FJ7A 1QRYA 3IC7A 3TBIA 1GV2A 1IRFA 4B9LA 3AA2A 2HPMA 1WB9A 4EGZA 1Q81R 2DI3A 4R1HA 4DU3A 4MGRA 2A5XA 1NK9A 4N4NB 2R7OA 1VQNA 3CFRA 1MMAA 2DVJA 3ZCOA 2M0CA 3EEQA 5KHDA 3ZQGA 2LJ0A 5GP9A 3R1XA 2LCCA 3LPUA 3EFOA 1K8AC 1VQ4N 1XMKA 5CLSA 2F96A 3RMCA 4JK7A 2A1RA 1GRIA 2WY7Q 4EA5A 3R2XC 2QEXN 1VQ6Q 3LLRA 2ID3A 1NYGA 2M0MA 1HSQA 3FDRA 1BIUA 3K1MA 2ATQA 1VQ6T 1TT0A 3EG0A 4IVNA 1U84A 2RNAA 3OY9A 4BXUA 1GLJO 3TAFA 4JAXA 4OIRF 4BC5A 4NUBA 4Z4EA 1R4NB 1KG1A 4BRHA 4M7YA 2C0TA 3QSUA 2LT1A 3V4GA 3CCSA 1XQSC 3VS4A 4E1NA 4YPHA 4M78E 3JTGA 1ONVA 3TSQA 3LGFA 4BQLA 1LB2A 4O55A 5BPLA 1RKTA 1D3BA 1XTAA 2HDWA 5ADXH 1NG6A 1Q7YO 2R7RA 2DRKA 3FZMA 4IX7A 4OJRA 5F1JA 2CYYA 4LK0F 3G6EQ 2HSPA 4XTUA 1VQ8A 4DU4A 1ABQA 3R3LA 3G6ET 1U5SA 3LWHA 1M9SA 2KTQA 3F8MA 5D7UA 3CHWA 3G4SA 1KAXA 5AT1B 2IAJA 3EZ5A 3EUKL 3EE9A 3L42A 1PUFA 3M0UA 2W25A 5KGWA 1M4ZA 5IXFA 5FB2A 3PMTA 4IOCF 4D6WA 4HUGA 2EFOA 2IXSA 1X6OA 1MV3A 2VUMJ 1BA0A 2QXLA 2XRIA 3M6GA 2XG8D 2FZCB 1NG9A 3QQAA 2KY9A 1QMCA 5CJ9A 1UG0A 5L23A 2NZTA 1RT4A 2LC2A 1ETWA 3HPOA 4B8AB 3DXJF 4H4OA 4IPAA 4HT8A 1SANA 4KHUA 1KC8R 1LCUA 3O5ZA 3ZEUA 4X66K 3U23A 1VQ4T 2QEXQ 2E2OA 2HZYA 2EILH 1K9MR 1N39A 2EJGA 1D9FA 2OFIA 3FB9A 1KG6A 4D7MA 3S6IA 2ZAEA 4RTWA 3H6EA 5JS2A 3KK2A 4Y3OA 2W03A 3K1PA 1VSJA 1YITQ 5CQXA 2PYJA 3L3UA 1TQPA 2ESWA 3FX3A 4IHYA 2CZ1B 2RN7A 2OQGA 1TUCA 1HNVA 5FLXE 2E2QA 3VEVA 4JDSA 3IWZA 4FLWA 3TVTA 3FM3A 1YUWA 2O4XA 1RRQA 5JVTA 1EH8A 3TO6A 4QPOA 3PM1A 3ZQQA 1E3MA 1N8RR 3G71N 1NWKA 2P51A 1P9QC 1WXUA 1RESA 5J40A 1VQKA 1FY7A 2M4GA 2BGCA 2CKKA 1RI0A 3ZT2A 1EX4A 4BY6C 1F1BB 2EBPA 4A4GA 2W1OA 5B1AH 4ZZLA 2OANA 3DXKB 2HDDA 2CH5A 2IVPA 1RDBA 2PZ1A 4DSLA 2FU4A 4F7ZA 4M63C 2KDZA 4V19K 1MNMC 1WSHA 4CJ5A 3RR6A 2Y69H 1VQLI 1FPQA 3EYIA 2HGCA 3HOWJ 3CCQA 4DV6K 4Z94A 1UJYA 4UVBA 4QS8A 4AH9A 2OA4A 4MFBA 3GCMA 3CCMT 1U1TA 2E3HA 1BIZA 4J7FA 3VS2A 3ABUA 4RG2A 3BPVA 3CM5A 5LGTA 4XRSG 1YJNQ 4AYBN 1VQ8Q 1OYWA 5JLXA 5GAN5 2L5QA 4ZYHA 4CEOA 2ZGYA 1HX1A 4DF8A 4F55A 3E9OA 3HOXJ 4BEHB 4WFNL 4A0ZA 3TDZC 4IZ9A 4O8UA 1R22A 5LJ5h 3C6TA 3WGHA 3I64A 2XGCA 4AUXA 3NHNA 1ZLJA 3CUQC 1GT0C 4X9DA 1SVOA 2COZA 3LZJA 1KQ9A 2E65A 4UC4A 5FFZA 1WIEA 2BV6A 4L6V5 2K6DA 3EGDB 2EHGA 1EH6A 4AI4A 2EWSA 2KVQG 1S8NA 3I55N 1YT3A 3LPTA 3HRMA 1UB9A 1BBYA 1N6QA 3E5XA 1K73C 4IFEA 1RRSA 3M9QA 3G71T 4JI0K 1LVKA 2CJJA 1YCSB 1R5GA 1XUPO 4GRIA 5CQGA 2E10A 3ZMVA 3MFKA 4FHTA 5ECAA 4CBWA 1KAYA 1G8XA 3CWUA 1WJSA 2A05A 1C1AA 1WSFA 3L1AA 4M3UA 2H09A 2X85A 4M78A 4KT6A 4Y92A 3E01A 4BWJA 5FFXA 5F08A 5LJ5j 1QHAA 3MEAA 4KH6A 1IKXA 3O5BA 5BPMA 1G6NA 2EYWA 5D6YA 2DA7A 1HUXA 3M1EA 4D7NA 1OKJA 1A31A 1WLJA 1D8JA 4I2OA 2MG4A 3AGKA 4CZCA 1SD7A 3CFOA 1X4PA 1ENHA 2R7YA 3M55A 5KVRA 3OA9A 6PAXA 3ID6A 5DCFA 3E9FA 4LF5K 1JB0E 3U1DA 2HPIA 3LAPA 3FR0A 5CQEA 2L3SA 1W5SA 4U0VA 1ZBXA 2F1LA 5FGMA 4QTRA 1SRLA 2AP1A 1B9NA 3W2WA 4J01A 3QB0A 5J39A 3VF2A 3BDDA 2YRVA 3G0ZA 3KYDB 4AFZC 2LFBA 1OYYA 1HC8A 2J06A 3O1BA 1JXSA 2CMPA 2KGTA 1S72A 3LALA 2DOFA 3CCUA 4Q5SF 1RKWA 5FW9A 2BVMA 4C8NA 2CRGA 4ATOA 4LDXA 5KTQA 1RIOH 1HLVA 3N5NX 1T0FA 3C0CA 3EPZA 4LDYA 3THWA 3LQRA 5GAEP 4LG0B 1U48A 1Y0NA 3OTOK 1BO5O 4RGXA 1VSLA 3I55T 1M30A 2OCCH 3L2VA 2XVCA 2RE2A 4NL3A 3TAGA 3UKRB 4BJ6C 3RRGA 2NYSA 1CZBA 3RPUA 3Q0WA 1FOYA 2X51A 4TSXA 4I6MA 2LY9A 4U67L 2NUTB 2FPEA 4W5TA 1WVRA 4KUIA 2G8FA 3VDXA 4M77D 3H36A 2OBPA 2EKOA 3D4VA 1H8AC 1JU5C 9ANTA 1RABB 3ZCMA 3CCVI 2HDAA 3X25B 3U9GA 1PP8F 1X6GA 2NVQJ 5AQWA 3KVGA 1XGNA 1NJWA 3DV8A 3PIOL 2PY5A 4PKIA 1NKBA 2KBTA 9ATCB 3H9GA 2QASA 3LH0A 5ILVA 2HEOA 4X6AJ 3TP3A 1NOYA 1V4RA 3NH2A 1DGKN 4KHSA 2IVWA 1AHDP 4EZ6A 2FSKA 4FJJA 1ETOA 2DNUA 2L3PA 2M0YA 4I99C 3VF4A 4W5RA 1VRTA 2WV0A 1TS9A 1FMVA 4BXXJ 5M1FA 5AQQA 3W2AA 5JLHA 2QGFB 3CBPA 2OPSA 2WTEA 2JT1A 2BH1A 1QHHD 2QBYA 1KHCA 3T69A 3EFOB 2BEOA 4YOTA 2JMAA 1U2VA 5ICCA 1SAUA 3OYFA 4FJ9A 3K1NA 4FWOA 1VQ9I 5M1OA 3JAMZ 2AS5F 4P5OA 4X62K 2RD1A 4C5EA 2OTJI 3BTCA 1BOAA 4AHCA 2MD0A 3OIPA 4N0AA 1R1TA 2RO0A 3VODA 3CI5A 4BQNA 4CGIA 2G8KA 2DK3A 1NEGA 2ZSIB 5LBQA 3E66A 1YQMA 2ZPFB 2NOBA 1UMQA 2VJJA 3IKVA 1YHQN 1ZRDA 4I7HA 3M56A 5LMUK 3SUOA 1A5JA 3L0QA 3GZ6A 2VC1A 4PUSA 4C8OA 3AG2H 1IDYA 5J3LA 2Y9ZA 3TTCA 4B6MA 1CZAN 4KGZB 3LANA 1M3BA 3A8LB 1PKSA 1WSUA 1RILA 3OH6A 3OSVA 2L7KA 4BI8B 1RAGB 3BW1A 4D1QA 1M1KO 4M9ZA 4FYDA 3RMQA 4EMKC 3HO1A 4A5MA 3QOPA 1VQNI 2K02A 1RAHB 3QAHA 1QBJA 4WCEL 4CI6A 2JXBA 1KA8A 3MEVA 4B43A 4JI4K 3RQIA 1VQON 4CZJA 4CEAA 2VVKA 1K83J 4OMPA 2PQ8A 1TL1A 1WBDA 2ICWG 4FM4B 5FKNA 4E9GA 5F0HA 4DR3K 3WEEB 4CRIA 3OS5A 4CFBA 2IAIA 3M07A 4JKHA 3IS9A 5LJ3f 2MC3A 1J09A 3U21A 2RJDA 4G6QA 3CC4Q 1TC3C 1PU8A 3LAMA 1NGAA 3CCSI 3LH5A 3HOUJ 3J81Z 3GLLA 4NBQA 2AKLA 1OJLA 1ZGWA 4C0DC 1UHCA 3K4NA 3KEOA 1UWBA 2JOYA 2XICA 5FLXO 3FKJA 5E3NA 1E3PA 1HYOA 1BW5A 3MZYA 4Q5VA 3R4KA 3SV4A 2ABLA 3VS0A 4E7LA 2LF8A 1NK2P 1EWQA 3EY1A 2HSEB 2AQEA 1M90O 4EHTA 2L9SA 1YHQQ 2E1ZA 1L3UA 4H4MA 2E41A 4GLMA 2RB6A 3KKSA 3G4SI 1D8KA 5CYVA 3CMEQ 4JHDB 3QU3A 3P31A 2DY4A 2O8BB 1YTAA 4DBQA 2Q2EB 3S41A 1EFNA 2ZF5O 5C44J 2NWMA 3Q0VA 1AWCA 5KCMA 2EQUA 1Z26A 4KHNA 1B72B 5A2QZ 3HHTB 4HNVA 4LDWA 5FLXK 3P7NA 3O3GA 3NNQA 3CCRN 1SFEA 2YUSA 4MEXF 5KYXA 1NGHA 4X34A 4XEIA 3EG1A 1K4SA 2X4WA 4QW2A 2HCKA 1CGPA 4I0AA 3OA6A 3CCEA 1Z21A 3O8GA 3R9PA 1IH7A 2NRHA 4JLHA 3RWUA 4A4EA 1RBVA 2EPFA 2GXBA 2A1SA 2VQCA 3R6NA 4GO1A 1VQOQ 3KP4A 3IWFA 3ZL7C 5GIPA 1UFFA 4OMFB 2NVXJ 4RW6A 2VN2A 4XRSA 4R79A 3VEOA 4LF8K 3C7NA 4E7KA 2A07F 5GJVB 4J6WA 2OPTA 4DU1A 1OH6A 3PIPL 4NYNA 2WTUA 3P5JA 2W04A 1KRPA 4DTJA 3OIOA 2QKLB 2VXZA 1G3SA 3DTKA 3LP0A 4HNTA 5AFUA 2M34A 4FJGA 4EEFG 4P5NA 4A2UA 1N6AA 4PUOA 5BPIA 3JRFA 2FBHA 1LEAA 1IO6A 1X4OA 1RCHA 1YLFA 1YTYA 4J2EA 2V1UA 2P9KA 5E18F 3IH3A 3PFYA 4B47A 3DKXA 3VERA 5F27A 1VQKI 3EQLF 1TVRA 3QPSA 5GAMg 3ZSRA 4B3SK 3GX4X 4PGGA 5IP7J 1FKOA 1M3QA 5GAHP 2J5OA 4LLLA 1O3QA 2KMTA 1IC8A 4OMMA 4AQYK 3WXIA 4DUZK 1KU2A 5GAN6 1WAJA 4QOZB 3NF9A 4GBQA 2O88A 2D5RA 4W97A 3SQ1A 3CCRQ 3S17J 3ASMA 1O7LA 3T1YK 3V9ZA 1WUAA 3CCRT 3CCQI 1MWKA 2PEXA 2QQSA 1UA1A 4JV5K 4ETSA 2K4BA 1T33A 2O5RA 4CIFA 2IA2A 3QWLA 2LKXA 4M78B 1G83A 5KYNA 3EG9A 4Z4HA 2D5VA 5HLIA 1WJDA 2Y30A 1EXQA 3CJQB 1H0MA 1WJRA 3P9KA 4RW7A 4HNUA 5HL7L 3FGUA 1DP7P 5ELZA 1VQ7N 2EAYA 4PJ0C 1DQUA 4L5EA 1Z77A 4CVNE 1JKPC 3ELKA 4JKEA 4DQQA 2P4TA 2VKVA 2XGEA 1Y64A 1AWWA 2M9UA 4A93J 2X9HA 1VQLT 4J9HA 1HDDC 4L0YB 1NGGA 2XAFA 1LWWA 5D5VB 4RDUA 3JB9F 4M75G 4FM2A 1R58A 4WQ5C 2ABKA 1IKYA 1BUPA 1U6ZA 2D1HA 4LF7K 3SDBA 1K8KA 3DLLF 4H5WA 2R92J 3SPYA 3K10A 3NTIA 3LDLA 3EH2A 4BE0A 3VETA 1VIFA 5KQ8A 3OH9A 1BR4A 1RNLA 2FD5A 2G8WA 1BW6A 3THWB 1YI2A 2ZJQL 3KUFA 3CJ9A 4BQZA 1QLYA 1MUYA 1OH8A 3GE1A 3ZOBA 5J8CA 5GMKe 3HUGA 4IIOA 3GMEA 3UIQA 3HPGA 3AARA 2VQLA 3HXMA 4BY1J 4C8QC 1X27A 2D6FA 2WOMA 1BR2A 2JPCA 1T03A 3C1DA 4Z6YA 1UAAA 1UHWA 2F9WA 2HBWA 2KT1A 5I3UA 1SL1A 5FLMJ 5JICA 3IDHA 2W6KA 4QVZA 4DOZA 3GFIA 2DEQA 1UGVA 1OR7A 3NDKA 2COWA 3RKWA 4X1EA 3CO6C 5ICGA 1KG7A 4U87A 1MD0A 3P83D 1OKRA 4XTZA 1REPC 2FQ4A 4C9YA 2DJQA 4OX9K 3OW2M 2EV5A 3ZXSA 3TEEA 4C8QF 1QPIA 5DCMA 4G6DA 1VQ7Q 5FO5A 1UCRA 1GCQC 4C92D 1Z67A 4EGYA 4JYKA 1S72I 2G6FX 3CCUI 4Y13A 4CF2A 5TJJA 3NH0A 3S1MJ 3V81A 3I58A 3U4LA 5ADXA 3OSFA 3E97A 5FPDA 2PBDA 1S6LA 4QQGA 3H5NA 3NARA 1RBTA 1LCKA 3TABA 3QICA 2DTRA 1J75A 5I22A 3N5BB 5FD6A 2XGXA 2DVEA 2YRCA 1ZARA 4A6EA 1IXRC 4QIWN 4MO7A 2A42A 1Z05A 3TAPA 3IRRA 3CPEA 1NZ9A 4HVUA 3BDPA 2JA5J 1N36K 4FW1A 1HW1A 1IN6A 1UHSA 2CW8A 2K4JA 2EK5A 5L3EA 3FZVA 2K5IA 4E7JA 2QWRA 3LSTA 3O6WA 2BIVA 2DFHA 5LRSA 3WGIA 2X4XA 1SHGA 5DD8A 1IJWC 4C8QG 3S2DJ 4JJNK 4A3FJ 1VQMN 4CGFA 2EGCA 3COAC 2F69A 1J59A 3A5MC 5AQGA 1SD5A 4UXNA 3THYB 2LLKA 4FT4A 1OZ2A 3BT9A 1K9MC 4I09A 4J6XA 4E6RA 4L3QA 2L7ZA 2DMUA 1IUFA 2RHZA 4CA0A 2L89A 4BS9A 4KMFA 1NJYA 2XGDA 2Q0RA 1Q82C 4FE7A 4CZKA 3FK7A 2HBMA 4KHYA 3JCMX 1Y0UA 4M75E