4E7LA

Pfv integrase strand transfer complex (stc-mn*) following reaction in crystallo, at 3.0 a resolution.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7lA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7lA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7lA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7lA03
2P0KA 4CF8A 3DM2A 3HXMA 3QLHA 3RMBA 4OVAA 1B9DA 3DOKA 2F8TA 2X74A 3MEWA 3U3YA 1HNVA 3QEWA 2YNFA 5FRNA 4CHNA 2JTFA 1C1AA 4B9TA 4A4EA 4IUTA 3DI6A 4CJFA 2VWJA 3THVA 1L3UA 4LD0A 2RHUA 3MO8A 4EDUA 4CGHA 2KZZA 4DQRA 1TL1A 5CYQA 4HUFA 3CFOA 4KI6A 3P5JA 2NLUA 3OYNA 1RNHA 4FJ9A 2AJQA 2RJCA 2JZ2A 3OJSA 2IC3A 4Z4GA 4Y1DA 3V9ZA 4OLBA 2IAJA 1F21A 1HRHA 2FBTA 4DG1A 3WNEA 4C8OA 4RW4A 2HW3A 4RW7A 4HTUA 1WSGA 2GV9A 3AA4A 3LDSA 2YKNA 3O3FA 3LLRA 3OMGA 1TK0A 5HRNA 2GF7A 4CEFA 1KCFA 5KRTA 4OGEA 3KLHA 3AA2A 4OKJA 1EP4A 1UA1A 5J26A 1FXXA 1EETA 3ZSVA 4F8RA 2HNYA 4CHOA 1ASUA 4FU6A 4C5GA 5D3GA 1KLMA 3F9KA 1XHXA 4I2QA 4M3UA 1D9DA 4LH5A 3MP6A 3UWNA 4W5NA 4NYNA 1NK9A 5C42A 3AA5X 4DU4A 3SUOA 3ITHA 1C0MA 1WSIA 3OYGA 3MEAA 4B9WA 1YVUA 2VWKA 4G1QA 4DSJA 4GW6A 4KV8A 4N5SA 3SV4A 1U49A 3NGIA 1KLNA 2OPSA 4E1MA 2IOCA 1JXEA 4CK1A 2DIGA 4NCGA 4QQDA 4FW2A 3D0PA 4IDKA 4GVMA 4CEEA 2BGGA 2D5RA 2MWOA 2P51A 3SQ0A 2IG0A 4X34A 3SQ2A 4CRIA 3PNWC 1L3SA 4OPJA 2OPQA 5FROA 4QAGA 5T7BA 4M3YA 3CYMA 1BL3A 3JSMA 3PX6A 4N76A 3P83D 2RKIA 2Y1JA 4RW8A 3LWMA 1WJQA 2QXFA 3AO1A 4ZTFA 5J2NA 2XDPA 3QNNA 3ULDA 1DLOA 1VK0A 3LX7A 2W42A 2YHBA 1XI1A 1KVAA 4FLXA 3OYLA 4N4GA 3SUNA 3TAPA 3LP1A 4Z0UA 4A4HA 4BACA 1K6YA 4QVZA 2R5MA 3TAGA 3WNGA 5IAYA 4FW1A 1GOBA 3ZT2A 4UC4A 3IAYA 3L2QA 4E0DA 3SUPA 3AVFA 2OA8A 4JS5A 3OYKA 3NF8A 3DB3A 2DFEA 4C8MA 4FJGA 3DOLA 2RHIA 4B9LA 4DQIA 2EQMA 4KTQA 1VSIA 2IGIA 4EP4A 4C8LA 4NZGA 3L3VA 3HP9A 3NH2A 3NH1A 4JS4A 1WAFA 2EQUA 3PX4A 3KD1E 3AVJA 3E9GA 1L3TA 1HNIA 1WAJA 3NHGA 1J5OA 3L2RA 1NK6A 2RI3A 3ZSZA 1W0HA 3KJVA 1RBUA 1X1PA 1WSFA 4OGCA 3NDKA 4O5BA 3HSTB 4PLIA 1U47A 4AHSA 4JLHA 4DLGA 4Z02A 3IS9A 3L2VA 2DTUA 1HMVA 4IUPA 4CF9A 2GFAA 3RTVA 2RHZA 1LWFA 5KE3A 3VQDA 3K5NA 1RBSA 2X4YA 1LV5A 4C5EA 5SWMA 4KHUA 2YNHA 1VSKA 3RMAA 4DTMA 4ZHRA 4O0JA 3I0RA 4RG8A 2HHWA 4HVJA 3AVIA 3DLEA 1BGXT 3U3GA 3DB4A 4F4KA 3ZSRA 4CEBA 2ZQBA 3NGYA 1NK8A 1S1UA 4FVMA 3LP2A 3AA3A 4CK3A 3HVTA 3HPOA 3KK3A 4QOZB 4KHQA 3BGRA 3QBYA 3OYFA 2KQ2A 1R0AA 4CE9A 3G10A 3K58A 4ELUA 3L42A 4BDZA 4PUOA 4EZ9A 3HO1A 3OYCA 1VSHA 3OYBA 2G8FA 1BHLA 4CEDA 3ZSYA 4IUVA 3SZ2A 2IDOA 4H4OA 5C0MA 3BDPA 3OB9A 4OKKA 3S3MA 1D8YA 4KO0A 1RCHA 1L5UA 3HPHA 4Z4HA 1EXQA 2LDMA 1TKXA 1HQEA 3AVHA 1I3AA 1SKRA 1S1VA 2YRVA 1KSPA 5C6SA 3V1RA 1WSEA 2KFNA 4J2EA 1RTJA 3HT3A 4BWJA 1SKSA 4FZZA 1RTIA 2K3XA 1CXUA 1JLFA 4DF4A 1JLBA 3VQAA 3V4IA 2E5QA 3QEPA 1JXBA 4Q5VA 3KK1A 1BIUA 1RBTA 4FJ5A 3CM6A 3P1GA 3TAFA 2X78A 3KD5E 1Z25A 4FM0A 4FJNA 4BE1A 4CGIA 1UAXA 3OS0A 4DTOA 3HJFA 2BIVA 4KB0A 3HP6A 4B9XA 3DLRA 4CHYA 3AO3A 3KK2A 4DQSA 2RPIA 3AVLA 2G8UA 3RWUA 4JRQA 4ID1A 4IG3A 4DFKA 1QSYA 2HMIA 3LANA 3KLEA 3FLGA 2QQRA 3ZT3A 2ATQA 4L59A 2O4XA 3SQ4A 3U6FA 4M3TA 1FK9A 4PWDA 5CZ1A 4F2SA 1SL0A 4KB1A 4I2PA 2PYJA 2BDPA 1XNIA 1NKBA 2X6SA 2R5AA 1OZ3A 4KHNA 1KVCA 4KAZA 1DTTA 1C0UA 2VG6A 2G8WA 4N4HA 2F8SA 2RI2A 5CZ2A 3NF9A 3QIPA 3PX0A 4B9SA 1HPZA 4CEAA 3VQ6A 2DAQA 4Y1CA 1VSFA 1D9FA 4UQGA 5D6WA 3ASMA 3V9XA 5J2MA 1S9GA 2RO0A 3HL8A 4M41A 1ASWA 1FKOA 4BE2A 4C8KA 1H3ZA 2DY4A 1RTHA 3OA6A 3OYAA 5M9OA 2B6AA 2Z1IA 1ASVA 3AVKA 1G5VA 3CFPA 3TARA 1YTUA 3NCIA 4J2AA 1D5AA 3QEIA 4DSKA 4DTXA 2YKMA 4ELTA 3ISNC 5DMRA 3L2WA 1C6VA 1TKZA 3QEVA 1U4BA 3O4NA 3TABA 2XY5A 4B08A 3FEOA 4CJSA 2G8IA 4M3WA 4FLTA 4DTSA 3H08A 4Q0BA 3MP8A 3NBPA 3I8DA 1REVA 2DFFA 3EY1A 2R7YA 1QS4A 1QQCA 5D6XA 1VRTA 2D0CA 3O4QA 3NNQA 3SPYA 2HVIA 1RT3A 4TSXA 3QJ6A 2FBXA 1T8EA 1S6PA 1TL3A 3OYMA 4XIUA 3KKSA 4LH4A 4F3OA 3RRGA 2QKBA 4CF1A 2E6MA 1QSLA 3PMTA 5HRRA 2BKDN 1BQNA 1BI4A 1KTQA 4W5TA 4M3ZA 4AILC 4RW9A 2BUDA 1CXQA 4FJMA 3CFRA 4C5HA 3DLKA 3S6WA 1RDBA 2RHXA 4CJTA 1XHZA 3VQEA 2D9TA 3K5LA 3K57A 3PY8A 1NJZA 3DLBA 3PMIA 3LPTA 4I9LA 2YNIA 3LALA 1LW2A 2WONA 2E6NA 1T03A 5IN1A 3DYAA 2DIQA 1T7PA 1TKDA 1NKCA 3SNNA 3HM9A 4FZYA 4DSLA 1ZBFA 4PLLA 4NS5A 3K5MA 4C5IA 1DTQA 2GUIA 4DSFA 4ZTJA 1HYVA 1BQMA 4OPKA 3MAQA 5C25A 4HUEA 4KTWA 4BD3A 4CJEA 1KHCA 1ZBUA 4GY5A 3ZSQA 5FRMA 1O1WA 3CM5A 4HCZA 1HYZA 3IRXA 3VQQA 2HQXA 2VG7A 3ASKA 4CFCA 1CZBA 4W5QA 2GFUA 3NAEA 2EQJA 1OI1A 4Z4EA 4HUGA 4FJ8A 1RT6A 2EX3A 2RJFA 4MFBA 4CHPA 3PFSA 3CQ8A 3ZSXA 4Z4FA 2BANA 2G3RA 1GOCA 2RI5A 4FL6A 2D0AA 4FJJA 2HVHA 1U48A 4IG0A 4B9UA 2IS3A 1VSMA 4CERA 2M0OA 2HHVA 4FJ7A 5E41A 4KKOA 4KHSA 1RDDA 2PYLA 4IBNA 3M8RA 1SUQA 3MECA 4FLYA 4LSLA 3HPGA 5J1EA 2XO7A 4DTPA 2KTQA 2HHSA 4H4MA 3V1QA 1UWBA 4CFDA 3O3GA 4PL6A 5J2PA 1Q9YA 3FDRA 3RMDA 5CY4A 3OJUA 3RMCA 4YFUA 4DTJA 1A5VA 5KGXA 4CCHA 1Y97A 3DRSA 2Z1GA 5D6YA 4QQGA 1LAWA 3C95A 1HQUA 1JL2A 3SV3A 1NJWA 4KTZA 4CJQA 3LP0A 3S3OA 3DLGA 3VQ5A 5CIUA 4IUQA 1TVRA 4AH9A 3H8ZA 3V1OA 3F70A 4EZ6A 3OYIA 2LVMA 1IKYA 4IKFA 4FLUA 1VSDA 1G15A 4O55A 3KLGA 2O4IA 2E6LA 4CJ4A 2HNZA 1HYSA 4DS4A 4DFMA 1U45A 4FXDA 3B6OA 1TGOA 2B4JA 2P5OA 1JLAA 3T1AA 3LGFA 1CLQA 3OYDA 4KFBA 1IKXA 1Z26A 4CGGA 3OYHA 3NGZA 4DF8A 2A1RA 3CG7A 4FLWA 1IKVA 1N6QA 4CIFA 4DQPA 2I5JA 1QE1A 3V9WA 2OYQA 3VQ4A 4R5PA 1X9MA 2K3YA 3SI6A 1A5WA 3SJJA 3Q1JA 1ZBIA 2G8VA 3GOXA 2F96A 3TAMA 4K8ZA 1SL2A 4NYFA 4AHUA 2FBYA 2O4GA 3TR8A 3RR8A 2M16A 4CIEA 1YTAA 3SPZA 1KFDA 3IG1A 3LP3A 1OZ2A 5KCOA 4DFJA 3LZIA 1NOYA 4O0IA 2RJDA 1ZYQA 4E7IA 1LWCA 3AVBA 4M3RA 2X6NA 4CF0A 4B8CA 5DK5A 3AVGA 4I7FA 1NK4A 5KE2A 4FJXA 2PQWA 2M1HA 1RT7A 4CJVA 1C1BA 3MXMA 4B3OA 1TV6A 4YNQA 4ELVA 4E89A 1QHTA 1LW0A 4DU1A 2RHYA 2X4WA 4CJUA 4OVLA 4FK2A 1WJSA 4F3TA 3EYZA 1ITGA 4N4IA 1TAQA 2EFIA 3QIOA 3VQCA 3LAMA 4QQ6A 2OPPA 1J53A 3V81A 3VQ9A 3TANA 4GMJB 3NF6A 3C4SA 4K8XA 4FK0A 4M3XA 2LCCA 1JLQA 1JLGA 3OYEA 2HQEA 1EKEA 1WLJA 2FC0A 3ZT4A 1RT5A 3QERA 4DTNA 4E1NA 3LH0A 1WGSA 4KHWA 1IKWA 3G0ZA 4C8NA 2L89A 2Q3SA 3DLMA 2ZE2A 1MU2A 4WE1A 2HB5A 2ITGA 2LRQA 4AHRA 4N41A 4BDYA 3KKRA 1WNSA 2OZMA 4PY5A 3PO5A 1LWEA 3AO2A 4Z4CA 3SQ1A 2JLEA 1S9EA 3HYFA 2F5KA 1LAVA 1U04A 3K2PA 3AVCA 2QKKA 2P5GA 1IH7A 3LAKA 4N47A 4AHVA 3OS2A 2CKKA 3UT1A 3AVNA 4CFBA 3LGLA 3F73A 1ZBHA 4CFAA 1WJRA 3KTQA 2D0BA 4Q5WA 2YHAA 4E7KA 4FLVA 2FHDA 1BIZA 4CJLA 3AVMA 3RR7A 1C0TA 3OQ5A 3SD4A 1NOZA 1B92A 1UA0A 4CIGA 3LPUA 1L3VA 3TI0A 5JS1A 2WOMA 1SSFA 2B5JA 2L3RA 4M45A 4BDPA 4CHQA 3KUFA 3K59A 4E7LA 4ID5A 5I42A 1RT4A 4HCCA 1OYXA 4HCBA 4A4GA 3VQBA 3PV8A 4CJPA 3MEEA 3P8HA 1RT1A 3TAEA 2B8AA 4FYDA 1T05A 4BE0A 1S1XA 3WNHA 2OPRA 4DSEA 4BWMA 4CHZA 1KVBA 4DQQA 4E19A 1B9FA 2R58A 3NFAA 3PO4A 1QSSA 4FCYA 4AHTA 3M9QA 3C6UA 1X9WA 1JL1A 2HHUA 4B9VA 4DWIA 3RRHA 4DU3A 1NJYA 5K14A 2GBZA 2X35A 3WNFA 3NH0A 1NK0A 4F2RA 4CK2A 4KRFA 3I0SA 4O44A 2XY8A 3VQ8A 1C1CA 2XHBA 3QEXA 4DLEA 4HHTA 2HHQA 4FJIA 3QINA 4CEZA 3QO9A 2WACA 4QW2A 4PQUA 4Z4IA 2P1JA 3L8BA 1N5YA 3QIIA 4DFPA 1NK5A 3AV9A 4CJKA 1UOCA 1A5XA 2PY5A 1XC9A 3MEVA 4J2DA 2QK9A 3NTIA 4IURA 3TAQA 1JKHA 3K5OA 4DS5A 2KW4A 1JLEA 3L2UA 3M8SA 3ALYA 1YT3A 5HROA 3MXIA 4OJRA 3S3NA 4NCBA 4QCLA 4A4FA 4IFVA 4FZXC 4IUUA 1NKEA 3CEYA 3S9HA 3B6PA 1WSHA 5HP1A 2LSNA 1BCMA 3PUFA 2QQSA 4LSNA 4CJWA 3ME9A 3OY9A 2HHXA 4CGJA 4ICLA 1S5JA 1WN7A 3FFIA 3MEUA 3SUQA 3L3UA 4FJLA 4KREA 5KCHA 2ETJA 3NTHA 5HLFA 1HJRA 1ZBLA 3VA3A 2KZMA 1NJXA 4B8AB 3M8QA 2NUBA 4CJ3A 1TAUA 3O8VA 3QKJA 5SZTA 5KTQA 1Q8IA 5FDLA 3V9SA 4JRPA 4B9NA 3JYTA 4B9MA 3QETA 4AHCA 4DSIA 3ZT0A 2XRIA 4KPYA 5KGWA 3VQ7A 2A1SA 3SCXA 1S1WA 3MP1A 5KH6A 4DTUA 2KFZA 1JLCA 3OYJA 3DMJA 3LZJA 4LD6A 3NTKA 2E4LA 4NCAA 3KLIA 1VSEA 5KI6A 2FBVA 4RW6A 4CGDA 1KRPA 3OVNA 5CYMA 1WSJA 3C94A 3META 2XK0A 1SV5A 4FM2A 5JS2A 3SYZA 1CZ9A 4I9QA 1N27A 5HBMA 1RI0A 3VQPA 1VSJA 4CJ5A 1I39A 1TK8A 1X9SA 3OMCA 1MHNA 2VG5A 2Z1HA 3E9FA 4FJHA 2ZD1A 4OLAA 4E3SA 2HHTA 3OS1A 1J9AA 2O4XB 1BISA 3C6TA 4KI4A 1SL1A 1RBRA 1XWLA 4CJRA 4OKEA 3LYIA 3D45A 3O3HA 1BCOA 2DFHA 3H6ZA 4EP5A 2YNGA 1S1TA 1IO2A 3A2FA 1J54A 2OZSA 4FM1A 4E7JA 3VN5A 3ZSOA 2EHGA 2G8HA 1QTMA 4CECA 2XY6A 3AO5A 4DTRA 2X4XA 2RJEA 2Y1IA 4M42A 4W5OA 5C24A 5HRPA 5HRSA 3MEDA 2HNDA 1GOAA 3BDLA 2LTOA 1EX4A 3LWLA 4H8KA 2Z1JA 3DLHA 4KHYA 1S6QA 4N56A 3HK2A 3DRRA 3EZ5A 4LY7A 5J39A 2EKOA 4FLZA 4W5RA 1VSLA 3T19A 3E01A 4E7HA 4O4GA 3DRPA 4CESA 2RN2A 3QNOA 3V6DA 4L8RB 1NK7A 2R57A 1RDCA 4PA1A 3ZSWA 2EQKA 3AVAA 4CEOA 4MQ3A 4DMNA 1VRUA 3ZCMA 4CGFA 3ZEHA 1RDAA 3UIQA 4IFYA 4J2BA 1TKTA 3P8DA 1FKPA 2VYTA 5EU7A 3ZT1A 1Q9XA 1IG9A 3TWHA 2BE2A 3KIOA 4FK4A 1TK5A 3NE6A 3HVRA 3MEGA 4FJKA 1BI4B 4CEQA 1RILA 1SKWA 2YV0X 4CF2A 3EAEA 2PZSA 4RG2A 3M8PA 1RT2A 3QESA 1KFSA 3V9UA 3VA0A 5J2QA 1RTDA 3FC3A 3MXJA 2G8KA 2XY7A 5KRSA 3KLFA 2RF2A 3T3FA 4II1A 3AO4A 5I3UA 1W9HA 2JGUA 1RBVA 3NF7A 2MWPA 2L8DA
chains in the Genus database with same CATH superfamily
3MN9A 2P0KA 1YI2Q 1R5ID 3IH3A 2DDAA 4YOVA 3HUGB 3I4NJ 3HXMA 1ONVA 4MHGA 3QFPA 5EGOB 3O9QA 3HG9A 3EE9A 2X74A 2KYBA 1HNVA 4YFNF 3H6EA 2V52B 2YNFA 2LOOA 3OOUA 2VBYA 3NMUA 2JTFA 5LRRA 2TCTA 1WZOA 3DI6A 1KAZA 3CC7N 2H3GX 3BFMA 3VEVA 3BG6A 2B63J 4BR2A 3L1AA 3GW2A 1L3UA 2RHUA 2XDVA 5HDKA 3FZKA 2A08A 5FD6A 2EFPA 3SJMA 3MO8A 2L5QA 4KIBA 3F23A 4QIWN 4OINF 4MTEA 4AMCA 1ZRDA 1TL1A 5EOYA 3MN6A 1VQLN 4HUFA 3C65A 3V8JA 5L8RE 2FF4A 1MBKA 3OYNA 4L3QA 4DZPA 3CD6I 2DTRA 4JN4A 3O9UA 4DYCA 2JZ2A 1K9MO 2XV4S 3KETA 2ZO4A 4IXCA 1BDGA 4Z4GA 4F7UA 2FD5A 4P5OA 4KGVB 1RRQA 1HRHA 5IYDJ 4M77E 2FBTA 3SBGA 2JT1A 1YF5L 1Y07A 6PAXA 2DZCA 2UXNA 4C92G 3FBIB 2EW3A 4I2OA 4BRCA 1IC8A 1YI2I 4ESJA 3AA4A 1K79A 4XICA 3QYHB 1YW9A 2KDSA 2HBWA 3LLRA 3G4SA 4XLCA 1TK0A 4IRHA 1SMTA 2XB5A 2TRTA 3LSRA 2KRSA 4BQLA 3K6GA 2ZMEA 2P5KA 1B1BA 5FO5A 2EKHA 4AFZC 2MG4A 4OKJA 5GANg 2X6OA 3QP5A 1EP4A 3V7SA 2R7XA 4DJAA 1NEGA 1M1FA 5J26A 1EETA 3ZSVA 4FQGA 1TT0A 1IDZA 1YUWA 4BVPA 1KLMA 2KZGA 2RD1A 2VWBA 1QA6A 4I2QA 5M1NA 4M3UA 1W7PD 1N3CA 1YOVB 1NK9A 2HBKA 2M4GA 3R4KA 4BRDA 1MUZA 3CO6C 2E8AA 4G1QA 2VPLA 1IREB 1G2BA 4DSJA 3QAHA 2HQ5A 1U49A 4PJJA 4XSZF 4JLGA 3ONQA 2JM9A 4CK1A 1JXEA 2W4SA 1YJNQ 3WXIA 3D0PA 5IXBA 3J80K 2V26A 4GVMA 2D5RA 3KYLA 1OU9A 1WCMJ 4UHTA 2IG0A 4X34A 4JEPA 3M0PA 3LDNA 1HPMA 4TVRA 2HCKA 3ML6A 2QSGX 1U9NA 4X1EA 1RLPC 2O8EA 1G3SA 3VU3C 1IG8A 1K9MC 3M1CA 2LBFB 2KROA 3CYMA 5C44J 3QP6A 3E1SA 3JCMd 1X69A 1VQPA 3JRCA 3EYYA 2RE2A 3AO1A 1OULA 1LCKA 2E5ZA 4ZTFA 2J6KA 1NKUA 4XU2A 1P8ZA 2M0YA 4PK4A 2K9LA 4A54A 3J80E 4FLXA 3UA6A 1XG7A 3GVAA 3QICA 2HS5A 3HI0A 3BDDA 3L9FA 5C12A 3QB0A 2KSSA 2ETHA 5DUIA 4A4HA 3LWFA 2KE9A 3GNGA 2FXAA 1O7FA 5CHZA 4CZHA 2W0ZA 2LK2A 1X6BA 5HS9A 3CESA 4CI0C 1NU0A 3CC7T 5IAYA 3ZX0A 2DL3A 3JCMc 3C7NB 3BPVA 3B02A 1R23A 1YJNI 2H6CA 3L2QA 1T39A 1MNDA 1N34K 4H5VA 3SUPA 4KH1B 1K8AU 3PIOF 1WQWA 1ZR2A 4JLIA 4UNOA 1YS6A 1LWWA 5GAEP 2HQHA 5AQQA 2GLOA 3DOLA 4B9LA 4DR1K 5TRDA 4DQIA 5HL7L 1WQ2A 1W4MA 2IGIA 4EP4A 5JICA 3K2ZA 1SVOA 3HP9A 5JMVA 5BOXA 1GCQC 5GANj 1CF7B 3NH2A 4JK1X 3JRZA 2JPBA 2EQUA 2DPNA 3GTJJ 3EEQA 1JTXA 2H8WA 1L3TA 1VQMA 1HNIA 4IJAA 3NHGA 4PJ0C 4B3AA 1J5OA 2A5YB 2E64A 3SLCA 2DFUA 2VQGA 2CZ7B 1VA7A 3MN5A 3C7JA 4IPAA 3WEEB 1P4AA 2QBYA 2GCXA 1WSFA 1VQ6Q 4UOBA 3R8EA 1JO8A 1DGKN 3W6KB 4AHSA 1T95A 1WJFA 4OFHA 3VPRA 4O5VA 3WTXC 2HQRA 1NE8A 3H0IA 3E9LA 2F4MB 3DXMB 3GX4X 4KT0E 4YPRA 3WXJA 4B1UB 2RHZA 3LSGA 2PI0A 5KYXA 2CRGA 1HC8A 4OB0B 1GLBG 2VXDA 1FSHA 1RBSA 5K5RA 5SWMA 4KHUA 4OU0A 2BEOA 1PNJA 1RAAB 4EW4A 4DTMA 2XG8D 1PHTA 4IOAF 4RG8A 3OV8A 1BI0A 4HVJA 4KITB 3DLEA 1I0CA 5AQFA 3DB4A 1B72A 1TWCJ 2UUBK 3LA2A 1Y8QB 4BXXJ 2JXBA 5LD2C 4BH9A 3Q9SA 4RAFA 1IUYA 1P7JA 1VIEA 4JYKA 4PJOF 3X25B 1W7PA 3AL0C 1QHAA 4HF2A 4OFAA 3R0JA 1QHGA 4X6AJ 5DY9A 3HPOA 3M56A 1QW1A 1VQ6I 5LMUK 1EH7A 2KQ2A 4HNUA 1ZBJA 3PE0A 3K58A 3TVTA 4H0PA 4BDZA 2HSTA 5GAOp 2RQTA 3HO1A 4CD3A 1VAZA 3REOA 2RV8A 3KEQA 2R0QC 1F4KA 4IUVA 1LOTB 4JI5K 3CMEA 4H03B 2CFOA 3CWUA 3CHWA 4BBSJ 3JTGA 3E6MA 3MWTA 4OKKA 1AT1B 4FL9A 2KIFA 2L3DA 1FYNA 3CPFA 3I59B 1BC8C 2FL7A 1RCHA 2ROLA 3QHSA 2RQPA 1L5UA 3HPHA 4RCHA 2P9UB 4IEIA 2E5LK 3RTRA 4FE7A 3DEWA 5BR8K 2K9GA 2EBPA 2AXTC 3BF3A 2M0CA 4V2SA 1S1VA 2F5VA 1DU6A 5CE3A 4F55A 4KBMB 3QDRB 1RTJA 4KGXB 1PUFB 2NNNA 2W6KA 3I56A 5D4RA 5KYYB 4OO1J 2ME6A 5CKBA 2KL4A 4S0HB 2ZB9A 3DLLF 3IUCA 2M3AA 1KEAA 3UPUA 4DF4A 2A6AA 2IEKA 3V4IA 3F8MA 2QSHX 1MUDA 1JXBA 3KK1A 1BIUA 2OANA 2P7VB 3I58A 3BG3A 5J3LA 2L54A 1CQTA 4CO8A 2ZGYA 2D6FA 2YJEA 1RESA 4I0AA 4FM0A 4FJNA 3WGGA 5GMKj 1NGBA 1PD0A 4CGIA 1UAXA 3LFKA 2KLAA 1SANA 2KQWA 2LKPA 3HJFA 3IWZA 3FXRA 1MWMA 3PSFA 3I55I 2F1LA 4JQFA 5AQWA 2RPIA 2Q2EA 4KUIA 1C0FA 1WWXA 4IG3A 4GFBA 2D45A 1QSYA 2HMIA 3URGA 2JZYA 3KLEA 3HSRA 4GLMA 3DCFA 1FEXA 2H3EB 3SQ4A 3U6FA 2LTPA 1KG2A 1O3TA 3TW7A 5EG0B 2KJCA 2HVRA 5EG2A 4E9FA 3H5RA 2YUPA 4KB1A 4I2PA 1JKOC 2VGMA 3T5XA 1XNIA 1NKBA 4RS8A 3UF4A 2DTOA 4LN2A 1KVCA 4KAZA 1DTTA 1VQKN 3EGDB 4BRIA 2DBMA 2PMUA 4LB5A 4C92A 3V7RA 4CEAA 2XGDA 3G6EN 2KGTA 1FMWA 2DAQA 3QJYA 4IO8A 4FWQA 4IL6C 1D9FA 2VJJA 5GTHC 1FTZA 2MOXA 4CZGA 4ZYGA 4II2A 2R7SA 1XB4A 1IN4A 2XGCA 4M7DF 4JKFA 3F8NA 4JKEA 4IWVA 1JKQC 3HGGA 4M41A 3EGXB 1ASWA 2VQFK 3RNJA 2XAQA 1TUDA 4KBOA 3NWSA 3OYAA 4EW0A 4Q48A 4Y7NJ 3L7WA 2B6AA 3CJRB 2Z1IA 4ESBA 5FFZA 4Y15A 5EC7A 2E7WA 4JI2K 5B5EC 1YX5A 2X9HA 2YKMA 4DBQA 3CW7A 5F6FA 3CWTA 1QZ5A 2XUBA 4C3HJ 1TKZA 2VXZA 3TABA 4FT8A 1YJ9A 2MBFA 4IRIA 4JKAA 2HYJA 2DL8A 4M3WA 5GANd 1TQPA 1S72A 2LP0A 3I8DA 2IRFG 2DFFA 2EGCA 4I02A 4ETSA 3CCSA 1I94K 3A5LC 3KEOA 2C6YA 2P9NA 1AHJB 4HXJA 2ZFWA 1RT3A 1OFCX 2UXXA 3VV0A 2H6BA 1U8RA 1ON1A 5E3OA 4DOZA 2A61A 4O5FA 1T8EA 2GTDA 1TL3A 2VE9A 1FBUA 1KIKA 1SC7A 5F64A 3I9V2 2R7FA 4CF1A 1PJRA 3G25A 1QSLA 2WC2A 3SMSA 2BKDN 1J59A 1KAXA 1ZYRF 4NQWB 2K9MA 2A36A 1BI4A 4AU7A 4WF2A 3CC4N 4M3ZA 4AILC 4NL2A 3HTRA 1CXQA 3RERA 2YSQA 4LG3A 4UUVA 1QCOA 2I0NA 5IOYA 4C5HA 1MIJA 4C0GA 4Z6YA 3FZMA 4I98B 4J9BA 3DKXA 3HOXJ 3SQNA 3ASOH 3WGIA 2DRKA 1KU9A 1WI9A 1YIJA 4A0YA 2IGKA 2PU9B 4JKGA 3Q7CA 2MAMA 3GXOA 3PMIA 3QO3A 3S6IA 3K10A 1LWVA 3FM5A 1JBMA 3HUGA 3ZN0A 1ORPA 5EGOA 5HDNA 4XK8E 2E6NA 1T03A 3WE3A 1T7PA 4B4CA 3RMSA 1XPXA 3OS5A 4A5NA 5LJ5g 4CZKA 4CCKA 4CD1A 3E9PA 2VQEK 4U67L 4PLLA 1NMNA 2DNUA 2RHKA 3HIFA 1X4PA 2GUIA 3FHNA 5CVRA 4DSFA 1BIBA 2O9SA 4HLYA 4NHJA 2P8TA 3O08A 1VQOA 2VKHA 5DD4A 1C0WA 4ENJA 1BQMA 1IN8A 1VTNC 2FEZA 4BD3A 2CZ0B 4CJEA 2XAHA 2P0QA 2I2LA 2M87A 1O1WA 1X1AA 2EQIA 4DBFA 4HCZA 3Q3SA 1XS9A 2HQXA 3NHNA 4UVBA 3ASKA 2HZDA 1U1SA 1RAFB 2A37A 4UVCA 2VOOA 5GJVB 1OI1A 1VQKT 3PO2J 2EPDA 5DUKA 3GFMA 4L9JA 2A3ZA 2QWWA 3B6CA 3PFSA 1VYTA 4MIMA 2BANA 3VGKA 2CT4A 2FQ3A 4FL6A 3G6ET 4F7UF 4FJJA 4KMUX 4M9ZA 3CCJA 4IG0A 2BYVE 2V1XA 1Q7YO 2DA2A 2LT4A 5D5XB 2W57A 1PVSA 3CUOA 4AIKA 3GTLJ 4KKOA 1WHHA 4KHSA 5E20A 2PYLA 4IO9F 3QPTA 2YHYA 3FMRA 2MH9A 1SUQA 4P55A 5FPNA 3MECA 2NVYJ 4M9XA 2UUZA 2KTQA 2L2PA 2XI9A 7AT1B 3CCQQ 4BY6C 1N77A 4XRMA 1R77A 1PD1A 3TL4X 1YRNA 3TO9A 1OV3A 4PL6A 4ZDLA 4LF6K 4LD9K 1ZN2A 3ZXSA 1D0ZA 2UXDK 1UECA 5CY4A 3THYB 1UGPB 1YJ9T 3RMCA 1KQ8A 4YFUA 2QYZA 4DTJA 1ETKA 5GAN2 4A3KJ 3EUAA 1LAWA 1FNNA 4YEJA 4WXDA 3BQYA 2O03A 3WT0A 2ESHA 3VQ5A 1KG7A 2DK3A 2JRMA 2H56A 5CIUA 3O3KA 2ABKA 3ESWB 3H8ZA 2K5IA 2ZC2A 1XQPA 1TQMA 3ZX3A 2XASA 1VQNQ 1Y7XA 5HDGA 2L3PA 2EYQA 4XLNF 4O55A 5D6EA 1ZUUA 2EFWA 3K1PA 3TSQA 2ICWG 4DS4A 3EG3A 4GXOA 3DTEA 1M1KO 4XOPA 3S2DJ 3QRFF 1VIFA 3MK6A 3CC4T 4RM3A 4KDPA 5IOZA 1AWXA 5LJ5j 2RNAA 4JJBA 3CQXA 3R0AA 1AKHB 3R6OA 2LBFA 1OKRA 2DRMA 1RAEB 5F0FA 4J9FA 4FLWA 1IKVA 3CCQI 2ABLA 4H0XB 2DBBA 2QUFA 1KZHA 1WKMA 2LCSA 2WBNA 5IYCJ 4DQPA 5C15A 1QVTA 1J3TA 3V9WA 1I07A 3KFVA 4R5PA 1X9MA 2E88A 2IGNA 3M53A 4JRIA 3VEYA 1Q7YC 1KO9A 2JT4A 1BN5A 1BW6A 3RPQA 1UZCA 1B8IB 2NOGA 3HKSA 4AVZA 2DD5A 1ZBIA 2G8VA 1Z7LA 3GOXA 2DK8A 2X1EA 4KGZB 1CGPA 2YXYA 2JA2A 2MPXC 2V7YA 4OOIA 3BF1A 2FBYA 3EZWA 3P9CA 2WB1A 3SPZA 2COWA 4M77F 2VCPA 1Z67A 3WTTC 4L5GA 2OFKA 4HZFA 5BPIA 1VQNI 1SD5A 3LP3A 4A0XA 3C7NA 1OZ2A 2DL4A 1BBYA 1HW2A 4DFJA 2WY8Q 4O0IA 3AAQA 1FT9A 2LH9A 1TWHJ 2RJDA 2E3HA 3S41A 3V7CA 5CR2A 3CD6A 4LK1F 1ZTRA 2P6TA 1LB2A 3AVGA 3VF2A 3BPXA 2F5TX 4KYWA 3G71Q 4X64K 4DW6A 4XH1A 1H92A 3CLQA 2HL3A 3FSPA 4FJXA 2M1HA 2PUKB 1LOJA 4KIFA 2CW7A 1TV6A 3D4VA 5FPMA 4CUGA 1CF7A 2BGCA 3H9JA 5DM6F 1PRMC 2JPSA 1YI2A 4E89A 3DWLE 2E5KA 3FJ5A 1QHTA 1HD3A 2RHYA 2G9WA 2DPUA 5GAMh 1QP2A 2LJ3A 5KN8A 2EFIA 3QIOA 3GDQA 2GIVA 5KQDA 1NM7A 1XCBA 3AL0B 3LAMA 4M75C 4H5NA 3MKWB 3WEEA 2EZHA 2R7RA 5A2QO 1XMAA 1M1KC 4BRQA 1Z21A 2RPNA 4YOTA 2K85A 4OB1B 5FU7C 1XN7A 2OQRA 3C4SA 2XDDA 2ID6A 1YITN 2L9RA 1JLQA 3OYEA 2L3SA 2HQEA 2FC0A 3TEDA 2O7OA 1Q86U 1Q81O 2VPRA 2VBWA 3OMYA 1TU0B 3H0FA 1D3BB 3CMAN 3DXMA 3GNFB 2A69F 1RFQA 5CQGA 4A61A 4GYIA 4W97A 2NVUB 2L89A 3HYIA 3DLMA 2O8DA 4ZDOA 4OMNA 2HB5A 4GYGA 2MH2A 3R1XA 3RQ4A 3G71I 3SFIA 2ZKZA 1IGUA 1SVLA 1FP2A 3ULQB 4M63C 3ZX2A 2F5KA 4JI4K 2Y4XA 1IUFA 2A3LA 2JMAA 3OTOK 5BPMA 2CH4W 2KLOA 3IKVA 4A3EJ 3NPFA 3MJXA 4NC6A 3LAKA 1PU8A 2YWWA 2JOYA 2HDAA 4AHVA 2CKKA 1RI9A 2K79A 3A5MC 4CFBA 3H1VX 3F73A 5BNGA 1ZBHA 3SAGA 2PJRB 3H0HA 4I01A 4UUTA 1W36D 1GDTA 1YW7A 2ZAEA 1KQJA 1NLPC 2V75A 2CT3A 4LNPA 4Z88A 1SD7A 3J7AF 1KJWA 2L7MP 3BEXA 2ZXWH 5DM7F 1NOZA 2PG4A 1WJEA 1UA0A 5DLQE 2E3IA 2KRMA 3IAS2 3UKGA 4CIGA 4HSBA 3TI0A 1I1GA 2VKVA 1MDMB 1SSFA 4AIHA 4CHQA 4ZZDA 4MZTA 2YLCA 3I59A 4ID5A 3KTUA 2P9UA 1EZZB 2DTZA 4OPHA 5IT9K 1NG2A 1SPKA 4RTFD 1S1XA 3D1NI 3WNHA 1YJNA 1Y96B 2OPRA 4DSEA 3R2XC 2E2HJ 3WG9A 3FXLA 4A3JJ 1Q81C 1PUFA 1ZELA 2E19A 5CQYA 5KYYA 1IV8A 5C2DA 1QSSA 4AHTA 2OTJN 2CV2A 5IHIA 3U2RA 1QCNA 2DDBA 2K4JA 4A59A 2VL8A 4B9VA 5KPRA 2JSCA 4DWIA 2FPEA 1WEGA 4XU3A 4LUDA 4G6DA 5K5QA 3CO7C 4CZFA 4PL7A 2FF3B 5M1QA 4DU3A 4HQEA 5K14A 4X62K 5IT9E 1HK9A 2IPOB 1YQKA 1NK0A 4XLPF 3VS0A 2CW8A 3RZDJ 4IDHA 1ZARA 3WHCA 2HXOA 1GBRA 3A4CA 3L09A 5AYFA 3M0UA 1NGHA 3MKYB 2HHQA 2QSFX 3RKWA 2D8HA 3EHQA 1K4SA 3QO9A 1VHXA 1RI7A 1W6XA 4LB6B 5FKOA 3T8RA 4KFCA 3L8BA 4RAYA 2W40A 4P96A 4E70A 3GF2A 2E2IJ 1YITT 2PY5A 2WV0A 5LJ5d 4Y33A 4RA2A 1NGNA 4F93B 1XC3A 1G3YA 1WI3A 5EG0A 2H09A 4G9ZA 3CMAT 1JKHA 2F69A 2WAEA 4DS5A 1FJGK 4XBFA 2VQCA 4R55A 5F27A 3ALYA 1Q7YR 3EGDA 4O8UA 1YT3A 4NCBA 3ZOBA 4A4FA 3JCMh 2AIRB 1NKEA 2K57A 2M34A 3F8BA 2PZ1A 1RR7A 1BCMA 3VWBA 4JK8A 2FSWA 5KK1A 3U9DA 2CH6A 1IN7A 4ICLA 2YU3A 3B73A 3C3WA 4ON0A 2P9KB 2BE5F 3QDKA 3A01B 3SUQA 4FJLA 4KREA 2LKSA 2NUPB 3H5NA 1SG5A 5KCHA 5A2QZ 2ETJA 1E3PA 3ZQFA 3EGXA 4FIBA 2YI1A 1TT5B 2W25A 3VA3A 2KZMA 1VQ6A 3TREA 1ZQ1A 3D2EB 3HBTA 4CXFA 4CJ3A 1MBEA 3NVMA 4YG2F 3IRRA 2DXBA 3QQAA 2VVKA 4DOWA 4L9TA 2GEMA 2DW4A 5IH2A 2KIMA 5AFUA 2K40A 3CCVN 5DD8A 5DEQA 4LGWA 3GTQJ 4B9NA 2C0IA 3CBPA 4BRPA 3V8LA 2NRZA 2E1HA 2GM4A 2XRIA 2VN2A 1ZGJA 1MV0B 3SCXA 2EYYA 4XRFA 3RBBB 5KH6A 3OYJA 3DMJA 4BC3A 3NTKA 4NCAA 5CVVA 4FM4B 4IHYA 3E3VA 3K70C 1RACB 1GLFO 5GAOm 5AT1B 1MJAA 4RW6A 4IHSA 1WRJA 4UY8O 4ZC3A 2BUPA 4CGDA 1Y1WJ 4M7AF 3META 4NQWA 4FM2A 2M51A 4L0YB 1QP3A 5EYRA 4RGRA 3OW2M 1YP5A 1RI0A 2OTJT 4XLFA 1I39A 4LIVA 3KXTA 1TK8A 3HRGA 5B8HA 5JFRA 4YOWA 1MHNA 4Q47A 1DGWY 1KC8U 2Z1HA 2XVCA 2X4HA 4FJHA 4CYDA 2BV6A 4UB8C 4IOAL 4WQ5A 4OLAA 3EYIA 1ZGWA 2V9KA 3OS1A 3W3DA 1HX1A 4A3MJ 5M1OA 5GAN7 5C3EJ 3B6AA 1XSDA 4BRLA 1M90U 4CZLA 4BBRJ 2VV5A 4CJRA 3DTKA 4OKEA 3FXUA 3O3HA 1BCOA 5D7UA 3SJHA 4BQOA 5IP6A 2YNGA 2DA4A 5BN8A 3TCJA 1TW2A 2RK1A 2OZSA 1RR8C 3S1RJ 4YIIA 4PKCC 2EGEA 5AQTA 1VYVA 2G8HA 1QTMA 3AO5A 4DTRA 4BY6B 3P38A 2NRAC 4RMNA 3FMQA 5JLHA 2Y1IA 4RCBA 2F5FA 5M3MJ 4KT5C 1ON2A 3WHBA 3PO3J 1NGJA 3CPWM 5C24A 3I71A 2GNCA 2FOWA 3MEDA 2HU9A 1BU1A 3LWLA 2WSEE 1H8KA 2E12A 1ACMB 4EJVA 1BA0A 4N56A 3HK2A 3CUQC 2BY2A 5J39A 1WBDA 3E01A 2ZM6K 2BY3A 1WHLA 4B09A 5J8FA 1PG5B 2NAZA 3JRGA 4CESA 2EWNA 1WPYA 1OQKA 3SMPA 3ZSWA 3NWTA 3C2HA 1VRUA 1TXQA 4YIFA 3AGRA 3DLLL 3UIQA 1ZREA 3ATVA 1I4K1 3P8DA 4BUGA 2PFUA 1LFPA 3VDXA 4ORZA 3T7ZA 4GV3A 1ETWA 8AT1B 3ZBDA 3JTHA 1D8KA 1Q9XA 1M1GA 4PCQA 3DKMA 1NGEA 2GGRA 5LJ3e 3KIOA 3CCVT 3S1NJ 3THYA 2CUDA 3TSWA 4PL8A 3BY5A 1X75C 2L9VA 3AAPA 2XHKA 3NVKA 1SKWA 2Q0RA 2QTDA 4AUXA 3BT9A 3N05A 1SEMA 3VA0A 1ZBXA 3ER0A 4KH6A 3FGUA 3FC3A 2JWLA 1JQQA 4II1A 3VS2A 3SK3A 1K1ZA 3PJRA 2DF6A 2XRNA 3OBWA 2XU8A 5ED4A 2L8DA 3VS1A 3EG9B 3QBXA 2JS2A 3K4CA 4J8FA 3QLHA 4UXNA 3RMBA 4DR6K 3OW2S 2FSNA 3BZ6A 3DOKA 5BN9A 4G6TB 1KGSA 3BJ6A 3QYGB 4AG2C 5AQRA 4DV0K 4LFBK 1M8MA 2JJ9A 3JCMW 3A0IX 3GP8A 4G7ZF 1U1TA 5FRNA 1RLQC 2J6OA 5FKLA 4A4EA 4O6JA 3VYTB 1AKHA 4CJFA 3GF5A 4DCHA 1XSVA 4F04B 2FUG2 3GTMJ 4YOQA 4IHXA 3M55A 3CZ6A 1GCQA 1Z6RA 3M1FA 2I10A 4O8KA 2KZZA 2BZTA 1NK3P 4DQRA 3X24B 5J3BA 2PEXA 4FYXB 1T6SA 3LQRA 3JAMZ 2P9IB 2A41A 5LJWA 2WBMA 2LSOA 4KI6A 1RKTA 4K2EA 3P5JA 2NLUA 3I55T 1B8IA 3G1JA 4M75B 3U9GA 2NS7A 3F8FA 4HW0A 3OJSA 4DV1K 1FY7A 2DA1A 1WI7A 2EYWA 3TOAA 1TW3A 2Q1NA 5FU7B 2IAJA 2ECCA 1FSEA 2MLGA 4JD2B 3WNEA 1VQ9N 4RW4A 3VEPA 3MKDA 2OTLN 1UGVA 4FOEA 2GIZA 1IRGA 1VUBA 3VOEA 4E9HA 1M3CA 2JVHA 2KT0A 2HBLA 2P6SA 5HNFA 3IQLA 4WK8F 2YKNA 3O3FA 1M3HA 2MI6A 3OIPA 2ED0A 2LYCA 3GEZA 1HKCA 3CC7Q 2DMTA 4NXNK 3CCSN 2BH1A 3O9TA 2Y9YA 3LAJA 4CEFA 2P81A 4K41A 4Y28E 2A28A 4LOCA 3LSTA 3KLHA 3QUIA 2FNAA 5L3FA 4J7FA 1V55H 2AHJB 4QKUA 2HNYA 1A6QA 2PVDB 4FU6A 5GANh 4BKXA 3KZBA 1LEBA 3VGMA 4CCOA 3ASNH 1NM1A 2GOMA 2LMDA 3DPLC 1D9DA 3CWSA 2F5CA 3UWNA 3DF8A 3QPHA 1B07A 5C42A 1MKMA 2HL5C 2QQAA 3OYGA 1WSIA 4EQQA 4J9HA 1YVUA 3VFZA 3OR2C 2DILA 2YRCA 3NEUA 4GW6A 4KV8A 3M4GA 4N5SA 4JV5K 3SV4A 2D1XA 3SHFA 1KLNA 1P6RA 3O8HA 2A5WA 4XQFA 4XQ3A 1UDLA 5GAN8 2DIGA 1S29A 4NCGA 3C2BA 4FW2A 2HDWA 2COBA 2O01E 2QKMB 2K3BA 3WU0A 3ABMH 1E7OA 2BGGA 2MWOA 1YCYA 2OBPA 1V5FA 2P7CB 2JMCA 1GLDG 4MZMA 4C8QE 3CC7I 3KEYA 1SKUB 1IZ6A 2DT7B 3LSPA 2K2VA 4EJTA 4QAGA 5GAGJ 2Q97A 3IL2A 4B1XB 4GO1A 3BR2A 4LFAK 2D5VA 1EIFA 4WXCA 4BVOA 1BL3A 2FSJA 3JSMA 2BOLA 3P83D 2DYSH 2Y1JA 4RW8A 3LWMA 3S32A 2QXFA 1LNXA 3VF6A 2XDPA 3ULDA 5E8GA 1VK0A 3JRBA 5FWCA 1KVAA 3C0BA 4XKVA 4M78E 3SUNA 5KAFC 2K86A 3QWXX 2O2OA 4PHTX 4Z0UA 1GXIE 4TV7A 1J6ZA 4LE9A 1KG5A 2CGJA 1VQ8N 3ZQIA 2QDLA 3ZMUA 3CCQA 1RETA 5AFUH 3F0CA 1SRMA 3RKQA 1GOBA 2ED1A 2EBIA 3OH6A 5FWBA 4UC4A 3LQQA 4MO7A 5I22A 4E0DA 1PDNC 2JUCA 1J5YA 2EIJH 1HUXA 3AVFA 1DPUA 1MDMA 2DFEA 1ITYA 4BRAA 1ZLKA 4C8MA 2RHIA 4M75G 4YOUA 1GLAG 2QQBA 2LD5A 2CH5A 5E17F 2V1DA 1ZBSA 1N8RO 1SQKA 3CCMN 4LDVA 2YX6A 1VQNA 4J83A 3NH1A 4Y91A 5EEHA 1WAFA 3PX4A 3A1PA 4QSHA 3BG7A 2OTLT 1WAJA 3OL4A 4BI8B 2E6ZA 1LWYA 1PU6A 3DLAA 2Y9ZA 3DXJF 2DOFA 4F7ZA 2QDYB 3F10A 2COYA 4HNTA 3E2UA 1J75A 3CVTA 1RL2A 2OD5A 4O5BA 3HSTB 4H5TA 3C18A 4DLGA 4YDUC 4Z02A 3IS9A 4Y0WA 2Y69H 5EEGA 4EVIA 1HMVA 4CCLA 2ZNYA 3THWB 2IJLA 1HA8A 4BRMA 1SS6A 3RPUA 2J7IA 2HPMA 2FPFA 3M07A 1EA3A 3M59A 3TTDA 1P4XA 4HTLA 4MDBA 3RSEB 4UY8I 3A8YA 2X4YA 3T1YK 1VQ4N 1G3TA 1VSKA 4BC5A 1E6HA 2Y0MA 4UV8A 1K8KB 4I7HA 2L3QA 1BGXT 1ZLJA 3U3GA 1AOYA 3BY6A 3OIOA 1F43A 4B1WB 3FZVA 4GV6A 2JTVA 2ZQBA 3NGYA 1S1UA 1X1BA 3F6VA 1MH4A 2HI3A 2QAZA 4DHYA 1STZA 4FSSA 2BVLA 1LVKA 3K7AJ 1EWQA 3CXCM 3H41A 2Z1DA 3GCMA 1TUYA 1T8IA 1Z9QA 5AQGA 3G71A 4B1VA 4CK3A 3HVTA 1P4WA 5DCMB 3CC2N 2EQRA 4CW7B 2DXTA 3HOTA 3QBYA 3BLYA 3I4MJ 4HQMA 3CDHA 3C1DA 1N8RC 2XF6A 2FMYA 4A6DA 4FPBA 5DYMA 3M0QA 2BZXA 4EZ9A 5HK3A 3PT9A 3OYCA 1VSHA 2V8JA 2G8FA 2EV0A 4CEDA 1IRXA 2VI6A 3EUKL 3GMEA 2P9KA 2IDOA 4H4OA 3A01A 4PJOC 2NUPA 3H1CA 1USTA 2NYSA 3S3MA 4JKDA 1D8YA 1KU7A 1MUYA 1OCRH 3D2EA 1D1BA 3A8LB 1VYUA 4Z4HA 2DODA 1EXQA 1NGGA 2LDMA 2YUNA 4BI3A 1TKXA 1ZUKA 1VQ8T 4DQ8A 1FX7A 3LNQA 1MDUB 1MA9B 2DA9A 3V1RA 1QKWA 1FN7A 1JI8A 1X3MA 5DM6L 2WSCE 1UGQB 4DGWB 4YIRX 3W6VA 2GELA 2XKPA 1SKSA 4IHTA 5GAMg 1TZLA 1RTIA 2K3XA 3PNYA 1RAHB 3EPZA 1J5EK 1CXUA 4EIAA 2CP7A 1HLUA 1N78A 1ZA2B 2CQNA 2LNHB 3A0HC 1UHSA 3QEPA 4KHPK 2ISYA 4FJ5A 3CM6A 3P1GA 4FE4A 2X78A 1ZA1B 4XRSG 4PFZA 1MWKA 3R6SA 2LRDA 2OZ6A 3OSVA 3CCMT 4GKJK 1PRLC 4BE1A 3HRUA 4HSRA 3MWPA 2X3XD 4CZZA 3E5QA 5L3CA 1FOWA 2YHWA 3FM3A 1EJ9A 3HP6A 3AO3A 4A12A 4M75D 2DQRA 4GVEA 4WFAL 3ABUA 4JRQA 3S14J 2Y30A 4ID1A 2IW5A 4ZGDB 3K4JA 4DFKA 4ZNXA 3DBLB 3IV5A 3L4IA 1QZEA 1OCPA 3H0GJ 3LANA 2RDPA 2CZ1B 3MAJA 4R8HA 4X1VA 4M3TA 2QQ8A 1TOVA 2E7XA 4ITVA 2K7AA 4DA4A 2ME0A 1N36K 1QZYA 5C4JJ 1ABOA 2G8WA 2KY9A 4V19S 1VQ4T 1K8AO 2F8SA 4M6YA 2RI2A 3T9NA 2V7ZA 5CZ2A 3O1BA 2P0PA 1Y71A 3FZLA 4BREA 4B44A 3R9PA 2WWYA 3VQ6A 1YTYA 5AQJA 2W00A 4IQJA 1W2BM 2F2EA 3WODF 4J8OA 2KJBA 3ASMA 1K0SA 3TTCA 3TO6A 1KD1R 3CPWP 5TGTA 2ZWHA 5DM7L 1XSXA 3V9XA 2M5WA 2WA0A 1FZPB 2RO0A 3HL8A 2A6EF 2NOBA 2V9PA 1FKOA 1OH7A 4QTRA 4LF4K 1PU7A 5DCFA 2HD0A 3ID6A 4DV4K 5LRSA 3CC2T 1ASVA 3N97A 2M45A 1YTUA 4WF9L 4J2AA 3BWGA 1WZ2A 4DTXA 1R1UA 3CPWA 1YJNN 4H0TB 2MA3A 3EE8A 3JB9G 1U9OA 2K6DA 5AQZA 3HTVA 1YFNA 5J1UA 3FEOA 1BIAA 1FLIA 4B6MA 1VQKQ 2QTXA 1M27C 1QQJA 3H08A 5GAHJ 3NBPA 2ZPGB 4M7DC 1FOKA 1REVA 5GAMj 3JSOA 4ESRA 1A35A 3D2FB 3DTIA 5D6XA 1UELB 3O4QA 3G6EQ 2YT6A 3CCEN 1ODDA 2UWMA 1HF0A 4PGGA 1H641 3N0UA 2HMPA 4TSXA 4CSWA 1Z3XA 1DT9A 3E9OA 4XIUA 4HV5A 3ABLH 4BRFA 3EKUA 4F3OA 3RRGA 3JCMe 2QKBA 2E6MA 4K0KK 1BQNA 1RAIB 1T38A 3MZ8A 4RW9A 2E71A 5EXWA 3Q0UA 2YUQA 1HJDA 3J81O 1TL8A 4FJMA 2V1RA 3CFRA 1KG4A 3M5AA 3QYFA 2WADA 2PN6A 4B23A 3SYTA 3HRTA 2XSJC 2E34A 1K8AC 5A2QK 2D9TA 3VQEA 3K57A 4EV0A 4A62A 1LFUP 1NJZA 2VGNA 3SFZA 1XMOK 2M4KA 2EH3A 3EG9A 4I9LA 5AQSA 1OCZH 2J5OA 1X2QA 5A0LA 5FLVA 3LALA 1SF9A 2Y31A 4CC7A 1Y57A 1LW2A 2V51B 2IAIA 1VQKI 3O9RA 5FGMA 3DYAA 2DIQA 3KZYA 5M1PA 2PFBA 1D0XA 3SNNA 5FW9A 1MD0A 4QPOA 1QGPA 3G6EI 2W41A 3CCLN 4DSLA 1XTAA 2CMPA 2K9QA 2R5YB 4C5IA 4QVCA 2CH0A 3M1EA 1ZHIA 3UKUB 5FPDA 1OH8A 5HK0A 3CC4Q 2UXBK 1OR7A 1O75A 1HSQA 1ZBUA 5KYNA 4GY5A 4HPQA 2P9IA 1HYZA 5KPTA 1Y0UA 4DR7K 4JUVA 4M75A 3H3VK 4F3QA 3ZEUB 4W5QA 1U6GA 3CDLA 2O8XA 3JS6A 4ZGEB 2EQJA 5C10A 3ISPA 4Z4EA 2KKOA 4RM2A 3TQNA 2ZJRL 1RT6A 4JD2A 3LDPA 4MFBA 4BYYA 5AQXA 3VGLA 3WUHA 4CCMA 3V4GA 4C1NI 3HM5A 2D0AA 2JK3A 2HVHA 4BC2A 1POGA 2HR3A 1ZSGA 2J5PA 1I1SA 1AZEA 4CA0A 1DEJA 4FJ7A 2CS7A 4RGUA 2F4VK 4GRIA 5AQHA 4DUYK 3V8KA 1N39A 2XICA 2LFBA 4FLYA 3KP5A 3HPGA 3BZKA 1S7AA 2WTEA 5FFXA 3GTKJ 3X26B 4IOXA 4H4MA 2LCLA 3O4WA 1M3AA 1UWBA 1XGNA 3CC4I 1MNEA 1TWAJ 1OEBA 3UE5A 4BUPA 1Q9YA 1RUNA 1T3LA 2LDUA 3S8PA 3PVLA 1A5VA 5FLXE 3DRSA 4B47A 4NOYA 1HQUA 1LEAA 4PNOA 4KTZA 3ZP5A 3FHZA 2FYKA 3S3OA 5FU6B 1TVRA 2NOEA 1RDWX 1IBMK 4F91B 4B24A 1KD1U 3WU1B 5C0YA 3V1OA 3F70A 4L0ZB 2VBZA 2VOPA 3OYIA 3TTFA 2KXCA 1NHAA 3K70D 4IKFA 1G15A 2O8CB 2O4IA 2E6LA 2DEUA 1HYSA 2JA8J 2P4TA 2XIGA 1JLAA 3T1AA 3DP7A 4V19K 2EZKA 1CLQA 1F9NA 3OYDA 4BY7J 2MK5A 4KFBA 3CCYA 4XH5A 4IHVA 1Z26A 4NUBA 3UNGC 5J4YA 2PTKA 1OVYA 5JVGF 2CS3A 3T0YA 4BB7A 2A1RA 1BR1A 1H88C 1IJJA 5CQEA 3CF5F 1XMQK 4RCCA 1MSFC 1JTYA 3X2QH 5GMKm 5CCAA 2I5JA 3CF2A 1QE1A 3GZ6A 3S93A 3O5BA 3N4MA 1CKBA 3BTIA 3KHYA 3SI6A 1JUPA 2BY0A 5GPCA 2K02A 4LG0B 2QVOA 2UU9K 3I35A 1SL2A 2WAQN 3KZIC 5BR9A 5DTDA 2O4GA 1D3YA 4AVPA 3CCLT 4N0BA 1R22A 1QO0D 3TU5A 4AYBN 3HRSA 3IG1A 2CUFA 3H3OB 2D1HA 1NOYA 2DYBA 3HKZA 3C0CA 1BI1A 3VW4A 3BG9A 1ZYQA 4E7IA 1ETYA 2TDXA 5BPDA 4JX4A 1GBQA 1TS9A 5CKEA 1B9NA 2PVGB 2BBYA 3LOCA 4A57A 3BE3A 4PZJA 4I7FA 3RQIA 1NK4A 2A05A 3G1MA 1QMCA 1BKBA 2LC4A 4XRSA 1LCUA 1C1BA 2K7LA 2HYFA 4NB4A 2ZPFB 2HTSA 2OU2A 1ZSZC 2F6CA 3ZMDA 2Q0OA 4UNFA 4M77C 2YPRA 5HS7A 4M6VA 3I8BA 2X4WA 2IGMA 4QLCU 2GUPA 4CJUA 4FK2A 2ISZA 4L18B 4BHPA 4N4IA 1Y6IA 3QXEB 3VQCA 1FW6A 3S17J 3VS5A 3BJAA 2J6FA 4LFUA 3KX2A 3CJBA 3IH2A 3L00A 4KN4X 1JXMA 3VQ9A 4J9GA 4H5RA 4K8XA 4M3XA 2NOJB 2HHHK 2JNGA 2D1KA 2WUSA 2XSDC 4ZYEA 4U88A 3F21A 1YJWN 4E4HA 2KRNA 3ZT4A 2E65A 1RT5A 3THWA 3QERA 3WXMB 4DTNA 3RESA 4E1NA 3CJTB 2F4IA 4LC9B 4D7MA 1IKWA 2RGVA 3ENBA 2YX4A 4JKGB 4PJOB 4OX9K 3JSCA 4XTZA 2OCCH 1Z91A 3RSEA 4WE1A 5GAOl 5F04A 4AHRA 4F17A 1D09B 4N41A 4C8QF 1Y1VJ 3KKRA 1TUGB 4HAMA 4PY5A 2EAYA 2E20A 1V5GA 3CI5A 3W3CA 1K8KA 2DOEA 1KG3A 4Z4CA 2JLEA 4GNIA 1UEBA 2VYPA 3HYFA 2OFIA 3DPUA 3AVCA 4FYYB 4ZZLA 2VODA 2EIFA 2QKKA 2P5GA 2Q36A 3CXCP 3CC7A 3P9KA 2WTUA 1IBLK 2LY1A 5GANe 3AVNA 4M78F 4DR5K 1DPRA 1YITQ 5DCMA 5B66C 4RTVA 1K73U 4CFAA 2M9HA 3ZMTA 5EDNA 1H0MA 4E7KA 1MW7A 2FHDA 1B3QA 3CMAQ 2W7NA 4CJLA 1TWFJ 3X20B 1KA8A 1IHWA 2IVNA 3CXCA 5LJ3f 5DLOA 3A5NC 2ZXHA 2P9LB 4YRVA 1SEUA 4XSXF 5JS1A 1X2KA 2JS0A 3KUFA 3D0SA 1U78A 5GPAA 2K5CA 5I42A 4HCCA 1RT4A 4RAGA 1RKWA 3N4QA 1OYXA 3EN9A 1V4RA 5AQYA 1MZBA 4CJPA 3MEEA 2K3PA 3P8HA 2LREA 4FYDA 3K9JA 3FR0A 2O8BA 3I3LA 4BWMA 3A8HB 2DEQA 3FHFA 4LLLA 1GXQA 2DJIA 2L4MA 4CZIA 3NFAA 3I33A 1PKSA 1OH5A 1MMGA 1NGCA 3PO4A 2QTVA 3M9QA 3CCUN 1I5OB 5GAHP 1X9WA 1JL1A 1YRNB 1YITI 2M0MA 1E3MA 4FISA 4KUMA 2EA2A 1YHQN 3PIPF 3CMAI 1YIOA 4U0YA 2DYIA 3KP6A 4ZN1A 3NH0A 1KONA 1FP1D 3LDOA 2O88A 4ISEA 2R7OA 5AZJB 3I64A 2HOAA 3DBRB 2K9NA 1MPGA 4O44A 3VESA 3O80A 3VQ8A 1C1CA 1YCSB 1JXOA 3WQTA 3FXJA 4JI7K 5CK9A 3QINA 2LMJA 1MBFA 2WACA 4EGZA 2JTMA 2DETA 2NOZA 4HDUA 1NNEA 3BC8A 1VQ5N 3EGUA 5BPLA 4AFSC 1Q82U 3OSSC 1N5YA 5M5YJ 5AQNA 4AI5A 1YG2A 3CUQA 1WVRA 1JRIA 5CLSA 1O4XA 2AZVA 3AV9A 4WFNL 1A5XA 1YVNA 2ECBA 2OTJQ 1Q18A 1YJWT 1W70A 2VKEA 3K2AA 4J2DA 1XJWB 3IKMA 3NTIA 4CJ7A 4A2AA 4AI4A 2MSYA 1ZUYA 4XN0A 4NB5A 4M7DB 1JCEA 4PJOG 2ZPHB 2KW4A 3IDHA 3L2UA 5HCKA 4IIMA 2MFZA 3H92A 2FJ1A 2R7DA 3JRIA 3UR3C 3DPTA 3TOBA 4QCLA 4B1RA 4IFVA 4XMYA 3TKYA 4I0BA 1WSHA 1W2BP 2RM4A 5F0HA 1QVFM 4LSNA 3OY9A 2HHXA 4CGJA 2IIMA 2OF7A 2ZJQF 3ENOA 3J80Z 2IA0A 3QPSA 4V2FA 1LDDA 4P1WA 2YU9J 5GP9A 3DEEA 4I6ZA 2VXEA 3RSNA 2CFXA 1ZHFA 2G7HA 5GMKe 2NUBA 1ZH5A 2YS9A 3N5NX 1W2BA 4KMFA 2M2EA 2DJNA 2D8JA 2ECZA 4HF1A 4MNUA 3U4LA 1VQLT 5JHUA 5GIPA 3LCNA 1GFDA 2OTJI 3V9SA 4JRPA 2CV1A 5B1AH 3RJPA 2DVJA 5ECAA 3QETA 4XONA 1Q86O 3LAPA 2Y0SN 2YG9A 1DP3A 3A5ZB 4FETA 3D2FA 3VQ7A 1S1WA 5LGNA 5LL6S 3WVDB 4JYAK 1XMXA 2IA1A 1PSFA 1JLCA 1Z0XA 1K9AA 3JREA 1OOTA 1VSEA 5LGUA 1QVPA 1T33A 5KI6A 2FBVA 4WCGA 2ZJPF 1NEBA 1KRPA 5CYMA 1GCPA 3SZPA 1Z6TA 3T1BA 3C94A 4Z89A 4F14A 5JS2A 1JJ6C 2JM8A 2EFOA 4C92D 4M4ZA 1CZ9A 1N27A 5HBMA 3VQPA 2ELHA 4L5JA 1IRZA 4CJ5A 3CCUT 4OAYA 1X9SA 2R7WA 5H6RA 1KYZA 2E2PA 2VG5A 1KQSM 2H3JA 9ANTA 5EZHA 3CCVQ 1U5SA 4BU2A 4M3GA 3AY9A 2NRTA 1WH7A 4JI0K 3J7AY 4PSWA 1QNTA 2O8DB 5J1YA 2HHTA 2R3SA 1J9AA 2O4XB 1V3FA 3VOVA 3H3ZA 4H0OA 1BISA 3C6TA 4XLAA 3TDUC 4KI4A 1LQ1A 1SL1A 2DTIA 1XWLA 4M7AC 1KQ0A 4PKGA 3LYIA 4WX9A 2QM1A 3RDVA 1SD4A 1I27A 1QVGM 1RAGB 1W1FA 2W84A 3U21A 4MLHA 5M1FA 1J54A 3H3UA 4XTYA 2R5YA 2EA4A 4HDVA 5LBQA 3UKUA 1VQ5T 1AU7A 3E5XA 1Z9ZA 1UFFA 2X4XA 2Y4YA 3CMYA 4AG1C 4M42A 5D8LB 4HVWA 1NJIR 5EJCA 4YTLA 2OUMA 5KN9A 1EX4A 1Q86C 2X1CA 4B43A 5E26A 3S2WA 4C92E 3ZEUA 1NYGA 4M7DG 2Z1JA 2FNPA 4G7OF 5H1SQ 1S6QA 1PKTA 3G3ZA 1T2KA 2YX7A 1RNLA 2OX7A 3CCVI 1E3HA 1UHFA 3TDZC 1BI2A 4FLZA 3K4KA 2PMZN 4C1NK 4W5RA 2JHNA 4EGYA 3T19A 5GINA 3I55Q 5DV5A 2QCOA 4O4GA 2OC6A 2R7VA 3REBB 1JT0A 3GFIA 1G6NA 3NAUA 3INZA 2R57A 1RDCA 1LE8B 1HU0A 1OX9A 4MEXF 2QEXN 5DM7R 2FMLA 4PJOD 4ZYAA 1ARKA 1QKXA 4MQ3A 4MLEA 2BE7D 1R0BG 2FRYA 4CGFA 1RDAA 1YX3A 1WYXA 2HMAA 4J2BA 1TKTA 4JI6K 2QGGA 2VYTA 5EU7A 2X4JA 4EVVA 5AQIA 2NNWA 3SAFA 1IG9A 3N5BB 4C2MJ 1H8AC 2LY9A 3VKIA 1CZAN 1REPC 4U7DA 1TK5A 1D5VA 2YUOA 3HVRA 1O3QA 3MEGA 4FJKA 1MH3A 2XAFA 4HX4A 1L0OC 1R71A 3GE1A 3EAEA 2CYYA 2F5EA 4RG2A 3P9IA 3V9UA 4JI3K 4RTTA 1K61A 1WUAA 4IF4A 2PBDA 2XY7A 4GKKK 3T3FA 3GTPJ 3AO4A 5IHKA 2JGUA 5I11A 3NF7A 4FWMA 2RA2A 1HQCA 2SRCA 1PM3A 4I99C 1YQMA 1LDJA 3ELKA 4CF8A 2JSPA 1T08B 2O8CA 2QA4N 3VUBA 1HYOA 3QOPA 4OVAA 4BEHB 1B9DA 3U3YA 3HM8A 4CGZA 3QEWA 4XIDA 1W97L 3ZMSA 5M5WJ 2ZGWA 1XGOA 3CWAA 1F5TA 4CHNA 4B9TA 1USSA 1M2OA 4IUTA 1H1VA 2ESNA 1ZR4A 5D4SA 4LDYA 2E10A 3VERA 2VWJA 3THVA 4LD0A 2CREA 3VUZA 1ZSZB 4EDUA 2VONA 4S05A 3HL2A 4M77B 1VQKA 3PLAA 4ZJZA 3EUHA 1WLPB 5CYQA 5HLHA 1VQ7N 2BHZA 1JU5C 3G6EA 3I9QA 4RTXA 3RCOA 3PIOA 1RNHA 4LG0A 1GHCA 2AJQA 2YUSA 3D7SB 2JVGA 2YSRA 2XMFA 4QVDA 2IC3A 5B1BH 2BW3B 4Y1DA 4OLBA 1J9IA 1F21A 4DG1A 4C8OA 5LJVA 4YDUA 2XKOC 2AXLA 4RW7A 3GBQA 4HTUA 2BE9B 4J6XA 2GV9A 3QU6A 3RUXA 4D8KA 2HKXA 3LDSA 2K9SA 4F7UG 3OMGA 1LPLA 1R5GA 3VEZA 3SEZA 1VF9A 3S16J 1SFOJ 2DXCA 1M8VA 1KCFA 2PMHA 4JDSA 1U6ZA 5F2RA 5KRTA 4EJWA 4I09A 2X6YA 2DMQA 1FXXA 1XGMA 1E17A 1HJOA 5ILUA 4OIRF 1KC8O 4C5GA 2NUTB 2XGXA 1R4MB 3ZQQA 3FHGA 2OAZA 5LJ5e 1I1JA 2RK2A 3NFCA 4CC4B 1QQNA 1ZRFA 4C30A 1XHXA 3ZRGA 4LH5A 3J7ZO 1QHHD 4EJOA 1EH8A 4NYNA 3FF5A 2KZVA 2QEXT 2F4OB 1VQ9Q 4M7DD 4DU4A 1J0RA 3ZFJA 1BI3A 1C0MA 4N9HA 2OTLQ 4KIGA 2L4AA 1M90O 3KBGA 3IC7A 3GWZA 4EFHA 2GQIA 3NGIA 2OPSA 3UB5A 3CC4A 1BM9A 1UE9A 1G83A 1NJIU 2OA4A 4QQDA 4FO0A 1GVJA 4RMOA 4IDKA 4CEEA 2XDBA 3JCMQ 2P51A 2W85A 2L01A 1KHIA 4PJOA 3PGGA 4H0VB 4RLQA 4BRHA 1YLFA 1L3SA 1GLNA 5GJWB 2FZGB 2OPQA 3T1HK 3FLCO 5FROA 1WXBA 3C6HA 3H0DA 3RMQA 1WDXA 4M3YA 2HDCA 4KUDK 3PX6A 4N76A 5BREA 2DL7A 3E5UA 5E3LA 1WJQA 5GADP 4J9DA 1X9JA 2EZLA 3EG0A 1N5ZA 2ACJA 2IVWA 5D8KB 3QNNA 1XG1A 1DLOA 3NQOA 2W42A 4J01A 2YHBA 2MC4A 1W7AA 5KQ8A 1YW8A 3OYLA 5FKNA 3SEQA 2DOAA 4RKUE 4KH4A 3SHWA 4A2BA 2EILH 1WB9A 1UHCA 1VQ9I 2EJFA 2VC8A 4PFPA 1NBWA 2OTLI 4JZ3A 2R5MA 5E1ZB 1Q86R 2CP6A 3I5UA 3TAGA 1JJ2M 4NDLA 4KN7X 5F0XA 3BQZA 1M4ZA 5HNHA 2CGKA 4FW1A 4BRNA 3JCMf 3ZT2A 3F2KA 2AQEA 1TTYA 2P9LA 2D0NA 3IAYA 1TH7A 1KC8C 4ISFA 4M77G 2GWRA 2CW0F 3UA7A 3IMXA 1XNRK 1AWWA 1B59A 3NF8A 1AEYA 1KFZA 4P9FA 4ANJA 1MNMC 3OGDA 4JHDB 1U2VB 3TMOA 2HXIA 2EQMA 4KTQA 1YN8A 5FJ8J 3L3VA 1M90C 3FXQA 2JN6A 5L3BA 3J7YJ 4G6QA 3F72A 5ICEA 3THXB 4WYBA 3G0QA 1NGDA 3KD1E 1C6VX 4H5WA 4V2GA 1ATSA 1DJ7B 3L2RA 2YDLA 5M1KA 1BOAA 1NK6A 5HLGA 2RI3A 1VQ8Q 1MSEC 1W0HA 2GWJA 1RBUA 2CO5A 1X1PA 1BA5A 3LA7A 4OGCA 4PJNA 3WG7H 1IO6A 3NDKA 1SFXA 2L7KA 1KQ1A 1U47A 5I2MA 1NK2P 4I76A 2FOKA 1W5CC 3MN2A 3L2VA 2DTUA 3OIQA 3BTCA 1S5LC 4FT4A 1RIOH 5LEKA 2LT1A 4HT9A 5AZJA 5IHNA 4CF9A 1BU6O 2GFAA 1EBMA 3RTVA 1UHWA 1AOJA 2Z33A 1SFEA 2QWNA 1N32K 2OAUA 3K5NA 5JLXA 3CCMQ 1MV3A 2V6CA 2HGCA 4C5EA 2HFHA 2YNHA 1WJAA 2LR8A 3RMAA 4Y17A 2QM3A 1HBXG 3KZZA 3AVIA 3J81K 1HCRA 2DMOA 1QLYA 2VB6A 5JVGL 1H89C 5KYWB 4F4KA 1IXSB 2Z0WA 3ZSRA 3CF5L 3BCAA 3O2PE 2PAVA 2WSFE 3GIBA 3CCRN 4ENNA 4BNCA 2JWTA 4MMLA 2NLXA 2ZPBB 4OIPF 5K7HA 4BJ6C 2B9SA 2E41A 4DV5K 4E6KG 1VQ8I 5CHIA 4M7DA 4XM3A 2RNGA 4KHQA 2V1UA 4WQ4C 1SFUA 3WTWC 3JR9A 2HOTA 1R0AA 1XDSA 1ZXOA 2EWSA 4Y52J 4ELUA 4CZCA 2FPDA 3L42A 3J81E 2KP6A 4PUOA 1QVFP 2DCEA 3Q9VA 3NGPA 1IN5A 4HA8A 1BHLA 4XK4A 1Z9CA 1OVQA 1VQ4Q 3SZ2A 4JI1K 1I50J 2LP5A 5C0MA 6AT1B 3KYDB 1WJBA 2FX0A 3G2BA 2LJ0A 3CCMI 4C2TA 2A68F 2KHOA 2L7FP 5M5XJ 5HS8A 4L6V5 1QVFA 1TG0A 2RNJA 3TEEA 2O31A 3MMVA 3FRNA 4EATA 3TP0A 3AVHA 3QPLA 4DV2K 3OYYA 2YRVA 2FA5A 5C6SA 1ZK8A 1FYLA 2HF3A 1ORKA 2KFNA 1SAXA 1UTIA 2HNIA 4AM7A 3CC2Q 4XH4A 3HT3A 4EM2A 3OWTA 4BWJA 1WHMA 3ULEB 4M7AB 1DGRM 4ME7A 4AIAA 2MC3A 1SHFA 3VQAA 5AZIB 4A3CJ 3M0TA 4Q5VA 4J5YA 3TAFA 3K69A 1T0FA 4RWTA 1OPCA 3KD5E 4EHUA 2DI3A 2G7UA 1P7IA 2BXYA 4IVNA 2STTA 2K5FA 4CI6A 3OA9A 4AIJA 2IS2A 4MFDA 1VQ4I 3OS0A 2B0LA 4DTOA 2BIVA 2WAFA 4KH5A 1YITA 2FU4A 4N4NB 2ITMA 4KB0A 4B9XA 4ZGJB 3DLRA 2ZGZA 2COMA 1JKRC 4CHYA 4E9EA 3KK2A 1MJ9A 4OB3B 9ATCB 3AVLA 4GLKA 1KQSP 4H0YB 3ZQGA 3CMAA 1P9QC 2ROTA 5ELZA 3RWUA 3HHHA 2XAUA 4FSXA 4HG2A 2HTJA 1BR4A 4I6MB 2BXZA 2ATQA 2O4XA 1W36C 1PP8F 2YLBA 5HKCA 4DIQA 3ROUA 1YQRA 3CC2I 2WFBA 1XTDA 5CZ1A 4F2SA 4PWDA 2VC1A 5D6FA 1SL0A 1ZGAA 1NZ9A 1KQSA 3CQTA 2PYJA 2E1OA 4EM0B 1K4US 1QVGP 2IS1A 1PSEA 2X6SA 3DBHB 3TW6A 4M71A 2D0PA 3JRFA 1W4SA 2OCEA 2K5LA 4IIOA 1C0UA 2JWKA 2V6EA 2VASA 1N9SA 4X9DA 2GWKA 3MWMA 2F7TA 3NF9A 3QIPA 1GV2A 3PX0A 1WHKA 4B9SA 3L2ZA 2OQGA 4Y1CA 2YHTA 3CBOA 5KCMA 4PJMA 5D6WA 1EWRA 1QVGA 3CETA 3FFKB 3JCMJ 4WQ5C 1FC3A 2KIQA 1YE9A 3JCMb 1R6RA 1S9GA 3CCRT 1Y0NA 4CZMA 2XPUA 5TKYA 1KC8R 4IEEA 2DY4A 1RTHA 4OMQA 5GMKl 2CP3A 3OA6A 5F1RA 3MMYB 5LHIA 3UATA 3AVKA 1G5VA 3H9GA 3TARA 2Z99A 2R7QA 4JOMA 1D5AA 1RRJA 3GTOJ 2W6LA 3G4SN 3L2CA 4EPCA 2EJRA 4ELTA 3GL1A 4LFCK 1S22A 5AQPA 5DMRA 1KAYA 1V1CA 1C6VA 3QEVA 1M90R 3CJNA 4CJSA 2DPDA 3O6BB 1LE8A 3MFKA 1PCXA 2KRHA 2HOEA 3MP8A 3S1MJ 3EY1A 4YY3K 2R7YA 2MF2A 1QS4A 2WY7Q 1QQCA 2YCHA 4QWQA 2VE8A 2CGPA 3I4PA 1D4XA 4YELA 1OCTC 1ENHA 3GOIA 1XGSA 2LX7A 2E1ZA 2CH4A 1OYWA 1U3OA 3QJ6A 2NWMA 2OTJA 4Y13A 3A8GB 3M54A 1S6PA 3PIPL 3OYMA 1DP7P 4LH4A 3FDYA 1BBZA 1X01A 5K7ZA 5GANf 5IXFA 1TUCA 4HVUA 3FIWA 1KTQA 4W5TA 1W0UA 1RGIA 1XC5A 2DYRH 4M3EA 3FBNB 4M7AG 2E4HA 1D0YA 1QVUA 1M9SA 4X65K 1IV0A 4AWXB 3DLKA 3TO7A 4LD5A 4CJTA 3J7ZI 1XHZA 3K5LA 3BR1A 2DBKA 1SMYF 3RYPA 1A0NB 3K4LA 5IT9Z 3HTSB 3F8CA 4B9QA 1XQOA 3LPTA 3VYSB 4ILJA 2HEOA 2OAWA 2YNIA 4EJZA 2XRLA 3JRDA 3SEMA 2WONA 1MMDA 2XC7A 4BEHA 3CCEQ 5IN1A 2XAJA 2E2QA 4JPBW 3H9NA 1KQ2A 4G8XA 1HKTA 2PNIA 1TKDA 2QGFB 1VQPN 4FZYA 5K7FA 2CV0A 3HOWJ 2Q2RA 3MDQA 5FB2A 4X0GA 1K0XA 3I53A 4NS5A 3ZYYX 1DTQA 3E7LA 1X2NA 3WQUA 1QZ6A 5GAN4 4ZTJA 1HYVA 3ZGKA 1ZSZA 4HVVA 3WVEB 2RAEA 3MAQA 4M77A 4Z8AA 5C25A 4HUEA 4KTWA 2CUJA 1YQLA 3BR5A 4WTOB 1TUUA 1KHCA 3Q7BA 1T6CA 5FRMA 2W48A 4DK9A 2ZJQL 3CM5A 3IRXA 3LSJA 3JSPA 3VS3A 3MKLA 2GA1A 4PJLA 2GZWA 3OHRA 4B8XA 3M0RA 5AONA 2QWMA 3PFYA 2R5ZB 1EV7A 2ZSHB 4C92F 4CCJA 2BW3A 4FJ8A 3VYGA 2EX3A 4EMSA 1YYVA 4CHPA 3MPUB 2ASPA 1L3LA 3ZQLA 2LX9A 4Z4FA 2E70A 2G3RA 2RI5A 5LFAA 5CO7A 4NC7A 3L0QA 2ZJRF 3GLXA 1X19A 2W1OA 2FVUA 3FXMA 2BZ8A 3CCLQ 2HBPA 3HSCA 4CERA 2M0OA 2HHVA 2VUMJ 4ILHA 3CCEI 2QWLA 2ELJA 3VTIA 4XNFA 3VS4A 3QZ5B 5HOOA 1TYQB 1RDDA 4JP0A 3HHGA 3M8RA 1WIEA 2ESWA 3CCVA 1VQMN 4BQAA 4BG8A 1PUEE 1K6OA 4LSLA 5F1XA 5J1EA 4DTPA 1HSJA 1MMNA 1ETQA 2HHSA 2JG6A 1JJ8C 3JAMO 3G4ST 1FJLA 3V1QA 4JRKA 4J19A 3J7YP 2NUTA 5J2PA 3JCMX 1WXTA 3FDRA 2ZJPL 3OJUA 5E3MA 1IXDA 4JKHA 4CCHA 2HEQA 4D7NA 3SAHA 2ENMA 3C95A 1JL2A 2DVEA 2JRTA 3AFHA 2NNYA 2NOLA 3IRQA 4KISA 3H9QA 4IZZA 4IUQA 2EJGA 3TBIA 4F16A 5EEAA 2HBMA 4XTXA 3GZ5A 1D1CA 2W82A 2KISA 4FLUA 1VSDA 1KU3A 4G94A 2Z9OA 5AN4A 3KLGA 1WA7A 2QF7A 4A5MA 2W03A 3CCLI 4F52A 1U45A 2O8KA 4FXDA 1K76A 3B6OA 4RGXA 3J7AP 3WXLA 1GLCG 2IPQX 4XEIA 3HGYA 1MMAA 3LGFA 1V4SA 1U84A 1IKXA 2F48A 4EMKC 4CGGA 1JHFA 1YWOA 5CAIA 4CC3A 2CQQA 3NGZA 2KBTA 3EQLF 3I55A 5AQKA 4BGDA 1N6QA 3A03A 3CLOA 4CIFA 1WHUA 2Z2SB 3HDDA 4BHCA 2M1BA 1B6AA 3DV8A 1WBBA 1DIZA 3MQ0A 1O57A 2M9UA 3LL3A 4BQZA 3VQ4A 3JCUC 3I54A 1OH6A 4BXFA 4AQYK 1EH6A 1S3JA 2COZA 3CIPA 4HX8A 4K43A 1WJ5A 4DKWA 3I0XA 1A5WA 2UV1A 5K5OA 1V4TA 4M7AD 3Q1JA 1VQPT 1HDDC 2AZSA 3CMEN 4HKEA 4NYFA 1JJ2P 2V1QA 2WC9A 4CIEA 1QRYA 1FYKA 1KFDA 1ZRCA 1ZX6A 4MQVA 4YFXF 3ERMA 4OB2B 3DU5A 1SSHA 1WH5A 5KCOA 4BQQA 4FWRA 3LZIA 1M3BA 4B3MK 3M57A 2CU7A 2XF7A 1LWCA 3AVBA 4M3RA 2X6NA 4CF0A 4H0EA 1BJAA 3QU3A 1JJ2A 3LM2A 2RH2A 5DK5A 4M72A 4JHDA 1U2VA 1R0CB 4Z94A 2LJ1A 5KE2A 1WFXA 2QQ9A 4JK7A 2E1MC 3I56N 4BRKA 2PQWA 1UGSB 2OJ2A 4B3OA 1D5YA 1NG9A 3M4YA 1CKAA 1X6OA 1OISA 2NZTA 3THXA 4DU1A 2EJ9A 3LWHA 2CYZB 3VENA 4F3TA 1ITGA 1R00A 2PLYA 2R7ZJ 3BY7A 1E4GT 2FSKA 1AWCA 4C9YA 1J53A 1RPWA 1TBXA 4M7AE 3HOUJ 1KG6A 1PVEA 3KWIA 3BG5A 2Q8KA 4FK0A 1VQMT 3AG4H 3Q0WA 2LCCA 1JLGA 4FX4A 5KPZA 1WLJA 4S04A 1BUPA 3F3XA 1YQAA 2O0YA 1OKJA 5H6QA 3T8TA 3LH0A 4C0FA 1UJYA 3LA3A 2C0OA 3HOSA 3KWGA 1S7OA 2UZKA 1FOXA 4C8NA 4B21A 1MU2A 2DXUA 2MW8A 3Q0VA 1ESVA 1XOVA 2LRQA 1K9MR 1B34B 3VYUB 4AIDA 1WHGA 1WNSA 4PKHA 4CICA 2H1LA 2KT8A 3M6GA 1U8BA 3FX3A 4OP0A 3ZETB 1LWEA 2E60A 5IP9J 4B22A 3AO2A 3FE1A 3VEXA 2HDDA 2XHCA 5KYWA 2DLLA 5TJJA 5AR0A 1S9EA 1JB0E 1U04A 1X3WB 1F36A 4JZ4A 2F9WA 3U9ZA 1XD7A 5CJ9A 5LJ3h 3D5SC 2GTOA 1XCVA 4N47A 3OS2A 5KVRA 3UT1A 4XKBA 3SDGA 1ZG1A 1HXDA 1YJWQ 1WJRA 4JAXA 3KTQA 2D0BA 2DA7A 2X6XA 4MEYF 4C8QC 2YHAA 4EM1A 2VQLA 1P2FA 3IAM2 4U0WA 1FIAA 2RN8A 3FKIJ 2DE0X 1BIZA 2FBIA 3CQZJ 5J4VA 3BR3A 3RR7A 2RQVA 1C0TA 5ILVA 4DEXA 3OQ5A 2V9VA 4A3IJ 3SD4A 4EA4A 3M4OJ 1B92A 2KXDA 4R56A 3MD2A 3O8MA 4IFEA 3UKRB 2CG4A 3CBMA 1VQ9A 1ETXA 2KRCA 3JCMP 2HZYA 2EZIA 3DEUA 2OTLA 2VKDA 3MN7A 4M78C 1BR2A 3KPHA 3CPWS 3ECHA 3LSMA 1YJ9N 1JUMA 3PV8A 3VQBA 3RPUD 3TP3A 3D7EO 4CC2A 4ZDPA 3C6AA 3TAEA 1S72N 3CMET 4BG9A 1U5TC 3HEFA 4CHZA 3L6QA 3GZNB 1KVBA 4DQQA 4JK9A 4E19A 3Q5FA 1FPQA 2R58A 2Y90A 1X3NA 2NRRA 3VSLA 5E84A 1XQSC 1KD1O 2KMTA 4FYWB 2KHMA 3H5AA 3ULEA 4FCYA 1WNLA 1FBQA 4M7AA 3HTUA 1K7AA 3SZGA 5JI6A 3H35A 1VQLQ 1FTTA 1EFNA 2YHXA 1LMZA 1RUOA 4UB6C 5L3EA 5AZIA 4RB3C 1YJWI 2YRDA 3A02A 1YFHA 2XB0X 4DUZK 4DEYA 3KP3A 3I56T 2XIDA 1NJYA 1G4DA 5AIPA 5KNLA 1R59O 2DQLA 1M2VB 3WNFA 1A36A 2FBKA 4J9IA 3FXOA 4QS9A 4Y3OA 1G8XA 3PUBA 4CK2A 1DKGD 3FK7A 1YIJN 5CKFA 3IP4B 2XY8A 2AT1B 2IIRA 2XHBA 1QQOA 2D1VA 3HOVJ 2NRWA 1HKQA 1WFWA 4GCVA 4II3A 3EH2A 1P92A 3TSZA 2HSEB 1SAZA 4A6EA 5J40A 4MDWA 1DDNA 4I6MA 5AQOA 3R6NA 4CJKA 1X27A 3HZ6A 2O8FB 4R1HA 2NUZA 2LLKA 3ABTA 1GLLO 1FMVA 3CCUQ 5L3DA 2KK4A 4IURA 2OZUA 1LFBA 3A5OC 5EX5A 2ASOA 3IKTA 3K5OA 3KCCA 5HODA 1YHQQ 2XROA 5FLMJ 1IGQA 1VQON 4U87A 1VQLI 3JB9I 1JLEA 3M8SA 2DTHA 4CVNE 1QWEA 4ASNA 5HROA 3MXIA 4OJRA 5GAN6 1UCRA 4RDUA 1RRSA 1ZLMA 4FZXC 5GIOA 1IN6A 3CEYA 4Y4RA 1U3EM 3B6PA 1E6GA 2E1NA 4K42A 5HLIA 5LJ5f 3ZQCA