4E7LA

Pfv integrase strand transfer complex (stc-mn*) following reaction in crystallo, at 3.0 a resolution.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
b'AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7lA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7lA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7lA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7lA03
2HNYA 3VQAA 1Z25A 2HHXA 4CF1A 4OKJA 3AA4A 4B9MA 4M3WA 4FVMA 5D6WA 1RTHA 3CEYA 4M3YA 3H08A 4CECA 1BCMA 4F3TA 4DLGA 1TL1A 1RBTA 4EZ6A 5J2QA 4DQRA 2LCCA 2X4XA 3V9WA 3Q1JA 3NHGA 3KLHA 3OYCA 3KLGA 4FJNA 2FBTA 2RF2A 4CEZA 1ZYQA 2EQKA 2YKNA 4HCBA 3P83D 4FM0A 4DTXA 3LYIA 2P1JA 2F96A 1WSHA 5HRRA 4Z4IA 3MEVA 3CFPA 4B9WA 1NK7A 5K14A 2P5GA 4IDKA 4HVJA 1ZBFA 3AV9A 4Z4FA 2YHBA 4DTJA 2E5QA 4K8XA 1TKDA 3HXMA 4N41A 3LDSA 2G3RA 4CHNA 1GOAA 3VN5A 3AA3A 1H3ZA 4CFCA 4FJ7A 2EX3A 1JL1A 1KFSA 3M8SA 2F5KA 4OPKA 3KD1E 3ASKA 4FK4A 2RHUA 3AVKA 1RNHA 3LWLA 4GY5A 3VQ5A 4FJ8A 4OJRA 4PLLA 3MEGA 3DB3A 4ELTA 4LH5A 3JYTA 4M3UA 1UWBA 3QEXA 1BI4B 2R57A 4H4MA 2P0KA 1SL2A 4CK2A 1NK4A 4OKKA 2KW4A 5E41A 2F8SA 4OLBA 3WNGA 2AJQA 4N4HA 1L5UA 2B6AA 3GOXA 4E7KA 3OYLA 1NJWA 2G8UA 4NCAA 4W5OA 1IKVA 4Q0BA 5CIUA 2HMIA 3MEDA 3KKSA 1NJZA 4NS5A 3U3GA 4Y1CA 1JLEA 4DS5A 5KE2A 3VQBA 3KKRA 3S3OA 3LANA 3ZT3A 4BD3A 3MEWA 4DLEA 3TI0A 4LY7A 4JRQA 4NCGA 4GMJB 4N4GA 3DOLA 1EKEA 3I0RA 2W42A 5KRTA 1KHCA 4HUGA 2BE2A 1C0UA 4C5GA 4CJQA 2BGGA 4QCLA 3OYEA 1QHTA 4C8KA 2RHYA 1WJRA 3NDKA 1REVA 1J5OA 2M0OA 3FC3A 3ZCMA 1VSLA 4NYFA 1MU2A 4DTNA 4I9LA 3V1OA 3HM9A 4CJLA 1U48A 4RW6A 4CGFA 3NNQA 1U4BA 4DS4A 4BWJA 2DIGA 4CJRA 4H8KA 2EHGA 2RJCA 4JLHA 1XNIA 3CG7A 3MP8A 4FLTA 1FKOA 4DFMA 2Z1JA 3OQ5A 1UA1A 1BI4A 1RT7A 3U6FA 3L3UA 2QKKA 1XI1A 1YVUA 3P5JA 3F9KA 4FLVA 3IRXA 1KVBA 4DMNA 5KGWA 3SJJA 1SKSA 4PQUA 4IG3A 1RTIA 3T3FA 5JS2A 4FXDA 1JLGA 1CZBA 1BL3A 2GFUA 1NK6A 4KO0A 4AHUA 5HRPA 1C1AA 4O5BA 3T19A 3OYHA 4AHTA 3MXIA 2HHWA 5J1EA 4C5HA 3L3VA 4KHWA 1HRHA 4B8CA 1QTMA 2R58A 4PA1A 3CFRA 2YHAA 3VQCA 1SL0A 1HYZA 1L3SA 3HPHA 4H4OA 3LZIA 1LW2A 3AVGA 2VG6A 4CCHA 1RILA 5J2MA 1NKCA 4E7IA 4AILC 3AVHA 2CKKA 4QW2A 5DMRA 1NK5A 2RHZA 4HHTA 2OZSA 3S9HA 3O8VA 3C94A 4HUFA 1NJXA 2YNFA 1HNIA 4E1MA 1ZBHA 1KLNA 2DFHA 2HB5A 1J53A 3RR8A 4AHVA 3DLGA 4IBNA 4LD0A 3PX6A 3CM6A 4FCYA 1IH7A 2K3XA 3RMCA 1OZ3A 3QJ6A 3LGLA 2PQWA 1S6PA 3VQEA 4FL6A 3AO3A 1IKWA 4J2BA 3OS1A 3MP6A 1G5VA 3VQ8A 1UAXA 4I7FA 4FK0A 3TWHA 4WE1A 2FBVA 3NE6A 4DF8A 4QVZA 3CYMA 2XY8A 2LDMA 2R5MA 3KTQA 2VYTA 4E7LA 4Q5WA 4IFYA 2RKIA 4CK1A 2ZD1A 4CGIA 1HYVA 3QBYA 2XHBA 4M45A 3AVLA 3UWNA 1RBUA 4C8MA 2DFEA 2D9TA 4BDPA 4PUOA 3ZSYA 3IS9A 3P8DA 4ICLA 4BDZA 4C8LA 2EFIA 4QQDA 4M3XA 2OYQA 4M3ZA 2HQXA 3RR7A 4FJXA 3BDLA 1Z26A 4HCZA 4CJFA 1RBSA 1MHNA 1TAQA 4O44A 2IG0A 4B9SA 4IUUA 3CFOA 5CY4A 3ZSZA 3I8DA 1UOCA 1KLMA 2OA8A 1C1CA 1X9MA 3I0SA 3G0ZA 1W9HA 2RHIA 3ZSVA 1S1UA 1ASWA 4DSJA 5FDLA 4KRFA 4FK2A 3AVJA 2RO0A 5IN1A 1HQEA 3VQDA 3HO1A 4QOZB 1NK9A 2OPPA 1KVAA 2ATQA 2G8KA 5SWMA 4DFKA 2RI5A 3NTKA 1K6YA 3VQ7A 4BE0A 1LV5A 1SUQA 3WNEA 1T05A 4Z4EA 1VSIA 3OS0A 4QQGA 2VG5A 4KHUA 3PV8A 2P51A 3ZSQA 4FM2A 3OVNA 4UC4A 4YFUA 3SPZA 1O1WA 2RJFA 4C5IA 1TL3A 2G8IA 2I5JA 3NF7A 1WAFA 4E7JA 1SKRA 4KHYA 1Y97A 1A5XA 3QERA 1X1PA 2LVMA 3MAQA 3DOKA 4KAZA 3L2RA 1L3UA 3FDRA 4KHQA 3OYMA 3PX0A 2WACA 3ZT4A 3AVIA 3NF6A 3CM5A 2X6SA 3K2PA 2G8HA 4DTRA 3E9GA 3HYFA 3SV4A 1F21A 3FEOA 4CE9A 4CHQA 4CFDA 1S9EA 1D5AA 4KHNA 1SL1A 1DLOA 3TAPA 4KI6A 2XO7A 1HYSA 1TGOA 4O4GA 2LTOA 4CEOA 1BHLA 4OPJA 3QETA 5FROA 3ZT0A 2L8DA 1R0AA 5J26A 1WNSA 3OYKA 3H8ZA 4B9TA 1J54A 4KKOA 3K5NA 4KREA 2HNDA 1QS4A 1B9FA 1JLQA 4CEEA 4IUPA 4E3SA 4DFJA 2QXFA 2HNZA 4Z02A 3PY8A 3SNNA 1RI0A 1VSDA 3RMDA 2DAQA 3LPTA 3M8QA 3OB9A 3C95A 2L89A 1VSHA 2Z1GA 2D5RA 3V9ZA 3KK2A 1BGXT 4NCBA 3NAEA 4CHZA 2IDOA 3LX7A 4DTOA 3CQ8A 3ISNC 2BIVA 2KTQA 4IKFA 2Q3SA 3DRPA 1FXXA 3K5LA 3HPOA 2WONA 1NOYA 1VSFA 1WJSA 2ITGA 4II1A 3THVA 1WSGA 3P1GA 1CLQA 2EQMA 4CJSA 4KB1A 4O55A 2XK0A 1RT4A 3SI6A 3MECA 3HVRA 2PYLA 4B9VA 3NH0A 4CHYA 2M1HA 2QQSA 4BACA 3L2UA 3RTVA 2F8TA 1A5WA 1LAVA 3ULDA 3ZSOA 2GFAA 3UIQA 4QAGA 4FJLA 3OA6A 1WAJA 3DLBA 3LZJA 4FZXC 3QINA 1ASVA 1UA0A 4M3TA 2HHSA 1OYXA 5SZTA 5JS1A 3JSMA 4HTUA 4FZZA 3NF8A 1XWLA 3VA0A 4BDYA 4CJEA 4FLZA 3AO4A 3S3NA 4E7HA 3VQ9A 4FJIA 3OS2A 5C42A 3OYFA 1VSEA 4CGHA 3TAGA 5HBMA 3DYAA 1U45A 2OPQA 4DTPA 3KJVA 1D9DA 3S3MA 4OLAA 4OGCA 4AH9A 1KCFA 3TARA 1BIUA 4JS4A 4AHRA 1S5JA 3B6OA 1IKYA 1NKEA 4FJHA 2B8AA 3SUQA 1N5YA 3QLHA 1KSPA 1SKWA 3ZT1A 3LP0A 3E01A 3HL8A 2ZE2A 4B9UA 4B9LA 2VG7A 4B08A 3AA2A 2ZQBA 3KD5E 4BWMA 1ITGA 4A4EA 3PMTA 3TABA 3OYDA 3ALYA 1XHZA 1CXUA 4X34A 2KZZA 3DLRA 3O3FA 1TKZA 2YV0X 3QESA 4A4GA 3TAEA 3LWMA 4CK3A 1RT6A 1I3AA 3EAEA 5KRSA 2A1RA 4E1NA 3V9SA 2Z1HA 3BDPA 1JLCA 2HHTA 2IAJA 4OGEA 3L2WA 3M8PA 4G1QA 2VWJA 4N4IA 1JXBA 4R5PA 1WSJA 1OI1A 4CGGA 1J9AA 2KQ2A 2XY6A 5M9OA 4DQIA 1YTAA 2GUIA 1LWEA 1NJYA 4FJ5A 1YT3A 3NFAA 3SUNA 3META 1RDCA 4CFAA 4KV8A 4DU1A 4PWDA 3OYBA 2B4JA 1QE1A 4W5TA 3M9QA 2G8FA 2DTUA 3AVFA 3LP2A 1NK8A 3K58A 3U3YA 1N27A 3DM2A 2YNIA 3SD4A 2JLEA 2OZMA 1KRPA 3SQ1A 1HQUA 1S1XA 3D45A 3M8RA 2LRQA 3LALA 5EU7A 2PYJA 4CRIA 4N56A 2NLUA 3TR8A 4CERA 1C0MA 4M3RA 4DTMA 2KFNA 4CJTA 2YNGA 1C1BA 2HHVA 1U47A 3QNOA 1RT1A 3V9UA 4Z4GA 1RT3A 3OJSA 4CEAA 3NTIA 4MQ3A 3EZ5A 1BQNA 1IKXA 4O0IA 3PO4A 4DFPA 3MXJA 5KH6A 4YNQA 1TV6A 3AVCA 2X4WA 4PL6A 3HSTB 4RW8A 4FLYA 3O4NA 1KTQA 3IAYA 4EDUA 2FHDA 3V4IA 3C6UA 4CJWA 4AHSA 4JS5A 4F2RA 3KLEA 2RHXA 2O4XB 1DTTA 4J2AA 3ASMA 4MFBA 4CIEA 3SQ4A 2E4LA 1T7PA 3SQ0A 5C25A 3T1AA 5C24A 3V9XA 4OKEA 1IO2A 1RCHA 1S1VA 2OPRA 2MWPA 5KGXA 1HPZA 2A1SA 3NGZA 4CGJA 5HP1A 2PZSA 4FYDA 4UQGA 4CF0A 4DU3A 4RW9A 5HRNA 4KTZA 4B9XA 4FZYA 3HJFA 2GF7A 3OYGA 4J2EA 1WSIA 2RN2A 1BIZA 3TAMA 4B3OA 4N47A 4ZTJA 1ASUA 2DY4A 2FBXA 4ELVA 1T03A 2IS3A 3AO5A 3FLGA 3D0PA 2D0CA 1BCOA 2RJDA 1EXQA 4KTWA 2HQEA 4CESA 1A5VA 3LGFA 3RWUA 3ME9A 2X6NA 3E9FA 1GOBA 4Z4CA 3TAFA 2K3YA 3AO2A 3OYJA 4FJMA 4ELUA 4KPYA 3QIPA 3O4QA 5KI6A 2KZMA 2RI3A 3NGYA 2Y1JA 1IG9A 3OYIA 4BE1A 3K59A 1JLAA 4LSLA 4E0DA 5CYQA 1HNVA 2L3RA 1TK5A 4I9QA 2Z1IA 2JTFA 4RW4A 1NKBA 1T8EA 1TVRA 2O4IA 1BQMA 2O4XA 3BGRA 3DLHA 3OJUA 4ZTFA 4IURA 2QK9A 4Q5VA 4GW6A 5CZ1A 1S9GA 3PFSA 1RT5A 3C4SA 4Y1DA 4W5RA 1JXEA 3C6TA 4NZGA 3KK1A 4DQSA 3DRSA 1G15A 3DB4A 3SUPA 1XC9A 4AHCA 4FJGA 1LWCA 1DTQA 2HHUA 4DSEA 4CEDA 1ZBIA 1ZBLA 3QNNA 1LAWA 2HHQA 2X74A 1WLJA 1RDDA 3AVAA 3KIOA 3ITHA 3VQ6A 3ZSXA 4CJVA 2R7YA 4K8ZA 1EETA 3IG1A 2WOMA 2LSNA 4B8AB 4DWIA 3OY9A 5IAYA 1S6QA 2BANA 4W5QA 2BDPA 3V1QA 4HCCA 3DLEA 3OMCA 4LD6A 4DQPA 2B5JA 4O0JA 3SPYA 3K57A 1GOCA 4KI4A 2GBZA 3AVMA 1JLBA 3VA3A 3SQ2A 3KK3A 1RDBA 4CJPA 1QSSA 3SYZA 4W5NA 1RBVA 3LAMA 4C5EA 2HVIA 4RG2A 4CGDA 5D6XA 1Q9YA 5C6SA 1VSJA 4Z4HA 1TKTA 1VRUA 3HP6A 1YTUA 2R5AA 3K5OA 3PX4A 2EKOA 1L3VA 2G8VA 1S1TA 2M16A 4DQQA 4PY5A 3V81A 3NBPA 4LSNA 1L3TA 2PY5A 4L59A 3SUOA 5J2PA 4IUTA 4KB0A 2BKDN 3HVTA 4JRPA 4LH4A 4TSXA 5KCHA 4XIUA 2HVHA 3ZT2A 4FJ9A 3QIIA 4FW2A 4DSLA 4CIGA 4CEQA 2BUDA 1RBRA 5J2NA 4HUEA 1JKHA 3L2VA 4DF4A 1VSMA 2EQJA 4ID5A 3KLIA 3QEPA 1RTDA 4CHOA 1WSFA 3S6WA 3AVBA 2IOCA 4M42A 2RPIA 2VWKA 3A2FA 1C6VA 3TAQA 3L8BA 1Q8IA 4EP4A 3FFIA 4KTQA 1BISA 1RT2A 1WGSA 3PNWC 4IFVA 1JLFA 2EQUA 4CF2A 3LH0A 3AO1A 3QEIA 1FKPA 1WJQA 3QO9A 5DK5A 2IGIA 3AA5X 4CF8A 5C0MA 1D9FA 4FJJA 3V6DA 1WSEA 4CJ5A 5HLFA 4PLIA 4ID1A 5T7BA 1QSYA 3EYZA 4DSIA 3NF9A 4DTUA 2P5OA 4N5SA 1HMVA 3K5MA 2O4GA 3QEVA 1RDAA 1SSFA 3MEUA 1NOZA 4CJ4A 4L8RB 4KFBA 4IG0A 2ETJA 2Y1IA 4CF9A 1S1WA 3EY1A 1KFDA 1NK0A 3MEEA 3RMBA 3G10A 1RTJA 2XY7A 4RW7A 4FM1A 4Z0UA 1KVCA 3ZSRA 4E19A 2YNHA 3UT1A 3DMJA 2XRIA 1U49A 1FK9A 4FW1A 3DRRA 5D6YA 1HJRA 5CZ2A 3OYNA 4F8RA 2D0BA 2OPSA 4BE2A 3HPGA 2GV9A 5D3GA 4CJ3A 1CZ9A 4M41A 3LPUA 1X9SA 2XDPA 4DU4A 4DSKA 2DFFA 3HP9A 4C8OA 3NH1A 3HK2A 1LWFA 5KE3A 3KUFA 3DI6A 4QQ6A 2X78A 3AVNA 3WNFA 4DSFA 3RRHA 3MP1A 3OMGA 3VQPA 5KTQA 1Q9XA 1N6QA 4GVMA 3KLFA 3P8HA 1VSKA 3OYAA 4CJUA 1TK0A 5I3UA 3LP1A 1OZ2A 1B92A 2QKBA 2YKMA 4RG8A 4FLXA 4CHPA 4FLWA 5HROA 3PUFA 3B6PA 3LLRA 1C0TA 3RMAA 4CJKA 4EP5A 4FJKA 4KHSA 3LP3A 1ZBUA 2HW3A 4CFBA 3MEAA 1XHXA 2NUBA 3QKJA 2FC0A 1CXQA 1X9WA 3HT3A 3DLKA 4CEFA 1EP4A 1U04A 4IUVA 3NH2A 2XY5A 4B9NA 3WNHA 1W0HA 4FU6A 3TANA 4OVLA 4ZHRA 1B9DA 3MO8A 3NCIA 4C8NA 1QQCA 4F3OA 4CEBA 2MWOA 4N76A 5FRMA 5KCOA 3MXMA 3NGIA 2E6NA 2RJEA 2QQRA 4F2SA 3NTHA 1JL2A 3PO5A 2X35A 4OVAA 3VQ4A 2JGUA 2KFZA 2X4YA 3L42A 1WN7A 1LW0A 3RRGA 1QSLA 3H6ZA 2G8WA 1TKXA 3SCXA 3L2QA 3DLMA 4E89A 4I2PA 1TK8A 1SV5A 5FRNA 4NYNA 1I39A 4J2DA 3QIOA 1VRTA 3O3GA 2DIQA 4FLUA 5J39A 3LAKA 1TAUA 3F70A 4DTSA 4CIFA 4F4KA 3SV3A 3V1RA 3ZEHA 4A4FA 4A4HA 5HRSA 2YRVA 4IUQA 2E6LA 5I42A 2E6MA 5CYMA 3SZ2A 3QEWA 1D8YA 3PMIA 3VQQA 1EX4A 1VK0A 4EZ9A 3O3HA 2RI2A 4DG1A 2IC3A 3ZSWA 2D0AA 3F73A 4I2QA 2JZ2A 2FBYA
chains in the Genus database with same CATH superfamily
1W36D 3EEQA 4ENMA 1YCSB 2H3JA 4B9MA 4I02A 4M3WA 3EN9A 1K78A 1RTHA 2DW4A 3H08A 4U0YA 3C6HA 2FXAA 2CUZA 1B72A 4F3TA 4RTVA 2Y4XA 2K5CA 5B1AH 2DM1A 3HPWA 2KGTA 4FWOA 4V19S 4DQRA 3VV0A 2E2HJ 1VQ5Q 1QKXA 3Q1JA 1YVNA 1XG7A 3P7NA 4ZH4F 3ZPLA 3OYCA 1N78A 3HM5A 2QQ9A 4YOYA 4FJNA 2FBTA 1LFBA 2RF2A 7AT1B 4CEZA 3KXTA 1JCEA 3AARA 2VQHA 1RRQA 2HMAA 4RUGA 2O7OA 2YKNA 3WEEA 3CCQQ 3G6EI 4XRMA 4LLLA 3N4PA 3GFJA 2XC7A 4YIRX 1WSHA 4CH7A 4QKUA 3OL3A 1SS6A 3MN5A 4A59A 1SD4A 4B9WA 3LSPA 3LCNA 5J1UA 3LWIA 4HVJA 5M1KA 1MDMA 1O7LA 1BM9A 2YHBA 1PRLC 4DTJA 4M77C 1RAFB 3VRYA 1D0ZA 2J4RA 2QWNA 3BG9A 4Z89A 2DAOA 3TREA 4I6MA 3LDSA 4YEJA 3I56A 4JLIA 2G3RA 2QA4I 1ZG1A 3VN5A 1FJLA 1H3ZA 4WX9A 1WEFA 1HW5A 4KT6A 1Q81R 2COMA 3VF4A 1HQCA 1E0EA 3CCRI 3CO7C 2PBIA 3R6SA 3O5ZA 3KD1E 3ZQLA 1F4KA 1S72I 2JS2A 1ZKGA 3AVKA 4R56A 1RNHA 3LWLA 1K0XA 1UB9A 2IVNA 1J0RA 1G3YA 3ZQ7A 3CBPA 3MEGA 3NWTA 3JYTA 1UWBA 2YG9A 2VJIA 4JDSA 4H4MA 3SDBA 2M30A 3HFNA 2LMJA 1NK4A 2QASA 3JRGA 3CD6N 3FDYA 2AJQA 4IZ9A 4CZHA 3WG9A 3J8AA 3H3VK 1FIPA 5IWAK 2QG9B 4E7KA 3OYLA 4M7DF 1NJWA 1WUAA 2LKPA 2ZFUA 2VOPA 2Y75A 1ZYRF 4BR7A 1FOYA 2XF5A 4MGRA 2OCEA 4I0AA 3KKSA 1F5TA 3OSGA 2LMDA 5B8HA 5C2DA 4B3TK 4C3HJ 4Y1CA 3I56T 1JLEA 5L3CA 2P0QA 1MBFA 4UOBA 1IO6A 3KKRA 5L3EA 5KYXB 2Y69H 4FX4A 2G0EA 2CH5A 1FBSA 3KEOA 3U1KA 3KWGA 4JRQA 4HPQA 4RTXA 4N4GA 3PVQA 3TVTA 4XTZA 2VC8A 1SVMA 4CJQA 2MA3A 1SFUA 2BGGA 5KCMA 3PM1A 4WXDA 1JTXA 1XDUA 5AQNA 2M0OA 3H5RA 2L9NA 2X51A 2ASPA 3HTSB 1R1TA 3NEUA 2XSDC 3A1PA 3VKIA 3QWXX 1JHFA 2W57A 2LCLA 4PJ0C 1YW7A 3DEEA 3M8FA 1YJNA 3CO6C 5GANe 1XTAA 4DR5K 1OVQA 1HKGA 5ECAA 5FD6A 2HTJA 4H8KA 4JLHA 3DXKB 1XNIA 3CG7A 4FLTA 1WHHA 1R58A 3DLAA 4CHUA 1FKOA 3LSGA 2Z1JA 2GAUA 2VBWA 1LDDA 3EGXA 3ZQHA 3Q9SA 3EKSA 2CQQA 2EJFA 3U6FA 2LQNA 4AD9A 2ZCFB 3P5JA 2IW5A 3F9KA 3A5OC 1RETA 3DFGA 4M77A 1KVBA 3A5LC 1H9GA 1GDTA 1BIBA 4YPRA 2JZYA 3I5UA 3CC7A 4E7SA 2DU9A 1O4XA 1EH6A 2LLKA 3F9MA 4NXNK 5HLTA 2D5VA 2E35A 4KH0B 2ED1A 4AG2C 2B7EA 5J1EA 1UJ0A 1VQKQ 4B8CA 1R71A 2R58A 1IRFA 3G0QA 2YHAA 4R79A 3CCJQ 3VQCA 1M1KU 1SL0A 3RI4A 3JB9G 1TXQA 4J00A 3BDDA 1FTTA 2MGQA 4KJZA 5FU6C 3WTVC 1YJNT 3D5RC 2W0ZA 1ZARA 3ZR8X 1NKCA 3JRHA 1WEGA 1CZAN 3AVHA 4QW2A 3CCYA 5DMRA 1T56A 1NK5A 3J80Z 2PZ1A 4WCGA 4HHTA 2ELHA 2J6FA 1YS7A 3KEYA 2C6YA 4IXCA 1HSQA 1HNIA 4GKKK 2JUGA 4GNIA 3EH2A 4F92B 4FWQA 3IH4A 1V5EA 4WWCA 1J53A 3RR8A 4AHVA 2NRAC 1W2BP 1WJ5A 4BY6B 3CP8A 3EFOA 4F52A 2K7AA 3JRCA 4M3DA 4KISA 4LD0A 5HDKA 2AQFA 4DEXA 3ZQIA 1U78A 2I0NA 1DGWY 3QJ6A 5AQXA 3FISA 3GTJJ 5JR3A 2KSSA 4W1UA 4FL6A 3I0WA 2O8DA 3CJNA 3OS1A 1J7KA 4YDUC 4ZYHA 2W24A 3D2FA 3I9V2 5B5EC 1X3WB 1ZR2A 2FBVA 3NE6A 3BOQA 1ZG5A 2E10A 5DLOA 2EJ9A 2XGCA 4A57A 5M1QA 4B1UB 2EQRA 2HEOA 5LLQA 5GAN8 4X0GA 4JKGA 2HVQA 4IFYA 5FWBA 2E5LK 2JA7J 3H0GJ 4CGIA 1OYYA 2E12A 3UWNA 1MGQA 5CHIA 2LJ1A 2RMOA 1Q86C 3IHUA 3BE3A 3FKIJ 2FEZA 1PWTA 3P8DA 2EIMH 4ICLA 4BDZA 4A3FJ 3RKQA 2EFIA 1XGMA 1K76A 4M3XA 2OYQA 3QPHA 1RUWA 1WQ7A 1MHNA 1U6ZA 4A0YA 2YHWA 3I55A 1V5FA 1U9OA 1J75A 2K9SA 1ZBXA 5CO7A 2OBPA 2IG0A 4A5AA 3CD6A 1IRZA 1UDLA 3CQXA 3ZSZA 2JXBA 3JCMh 3T1HK 4M75E 2GXGA 3VF6A 1C1CA 5A2QK 1X9MA 1AWCA 5K7ZA 4GV9A 1GLAG 4ILGB 2R5YA 2OJ2A 3F72A 3PO2J 4KT0E 1ASWA 1SSHA 3REOA 3R4KA 3AVJA 2F2XA 2RO0A 2ACJA 1X9JA 4FYXB 1OFCX 5IN1A 3A2KA 3JCMd 1HQEA 3HO1A 5F0FA 1IAWA 1NK9A 2DRMA 4E2FB 2QEXN 5SWMA 2GCXA 5CVUA 4BR4A 1K6YA 1OULA 3QBXA 1KQSA 4A63B 1Q7YR 2EGCA 4JI0K 4KGZB 5GAMf 2HSTA 1KQSS 2E5ZA 3PSFA 1T05A 4Z4EA 3OS0A 3AAQA 4QQGA 1OYWA 3I53A 3PV8A 4BY1J 3Q7CA 4C92C 1GXQA 1EF4A 3ZSQA 4FM2A 3OVNA 1WZ2A 3CD6T 3ZETB 2RJFA 3VS2A 4XH4A 3G1MA 3NF7A 5M1OA 4IOAL 4E7JA 1BU6O 1R5HA 4IOCL 1J09A 4MQ9F 1U8RA 1QVUA 1X1PA 3WODF 4DQ8A 1Z91A 4XTVA 1RKTA 1KFZA 5CHZA 1AZGB 4Y15A 3HOTA 2QKLB 8AT1B 2IA0A 3FZKA 3MMVA 4OPAA 1D3BB 3VFZA 4YDUA 2CGJA 1UHFA 3RBBB 5HNHA 3KFWX 2P4RA 2QSFX 3I58A 4RLQA 1I6HJ 3CPWM 2ZPEB 4CE9A 1XJWB 4CFDA 4EMKA 2OC6A 2VLAA 3G2BA 4X1VA 1YF5L 5A0DA 2GTOA 4EVIA 1SL1A 3TAPA 4OMMA 2RNJA 5FO5A 3WTZA 1ZRDA 4IIOA 1MPGA 3FZFA 4CEOA 2AXLA 5HCKA 5GADJ 2XD0A 1BHLA 3TP3A 4BR2A 3A98A 2E64A 4M75D 1HU0A 4UXNA 3DP7A 1RAIB 5GAN6 3WE2A 1YIJQ 5J26A 1WNSA 4HX7A 2E7XA 4II2A 2H6BA 5IYBJ 1P9QC 1J54A 4KKOA 3PIOL 5IT9Z 3WTTC 1B9FA 4EFHA 1JLQA 1KK7A 3E9OA 4CBXA 4E3SA 3K4MA 2EIKH 2LX7A 4JI4K 4I01A 1YBYA 4B24A 1DKGD 4LLGF 5ILUA 5LJ5h 1IJWC 1MMNA 2K3BA 1VQNQ 4AWXB 2KYBA 3M8QA 2LQKA 2P9KA 3OB9A 3C95A 2L89A 2XHIA 3HTUA 4I2OA 1YQRA 3LX7A 4LITA 1HC8A 5LJ3j 3CQ8A 2DLPA 1OCRH 5LJ5d 3RR6A 4JJBA 4J8FA 2BIVA 2L7FP 3CMEN 3MAJA 1YFNA 3PSIA 2PU9B 5DY9A 2I10A 3H41A 3HPOA 4J7FA 2WONA 4OWRB 3BR1A 3D6RA 3THVA 2WWYA 2BBYA 2DVJA 1WSGA 1CLQA 2DI3A 5E79C 1YITN 4O55A 1RUOA 1WXBA 4BGAA 1U6GA 3CCMN 1SRMA 3SI6A 4C92A 4YOVA 2PYLA 1FSEA 3X28B 4UUSA 3O08A 4IIMA 3T8RA 1IZ6A 4IXAA 2DO3A 4IVNA 2M1HA 1TNTA 5CQYA 2F8TA 5B3SH 3K70C 1U8BA 4A69C 4HTLA 3ULDA 4OX9K 3UIQA 4QAGA 3HSRA 4HF0A 1M90U 2DYSH 2Q31A 4L9JA 2CRGA 4F7UA 2P84A 3GOIA 3QINA 1DU6A 2QWWA 1UA0A 4M3TA 2R7TA 1OYXA 4F7ZA 2E1NA 5J1RA 1VQ6Q 5SZTA 1BDGA 3THXA 1X43A 2RA2A 4YIIA 4HTUA 1ZTRA 4FZZA 3BG5A 4ZYEA 3VA0A 2KPMA 2LKXA 5CE3A 2P6TA 2DT5A 3GDQA 2IBDA 3VQ9A 2M2EA 1WI9A 4MDAA 3S17J 4FJIA 5AQQA 3HM8A 1W97L 2HVSA 1VSEA 3TAGA 1R0BG 2OPQA 4KDPA 1HW2A 2OF7A 4J6WA 1TYQA 2XPWA 2ADUA 5LL6S 1D9DA 1NHAA 1GFCA 3FXRA 4AH9A 1H89C 3JCMJ 3TARA 1GLCG 4AHRA 1S5JA 2ISYA 5DM6L 5EZHA 3PE0A 4ORZA 1HX1A 5IT9E 5K7FA 1NM7A 2HYGD 2B8AA 3ZL7C 1G83A 4BGBA 1K9MR 2QEXA 2KHOA 1R59O 5BPIA 4AYBN 3I3LA 4CDGA 4LDUA 2DODA 3HL8A 1A6IA 4B9LA 4ISFA 1ATSA 2K40A 4KGXB 3AA2A 3R0JA 4DR2K 3PMTA 3EFRA 1N8RU 3O1BA 3ALYA 2L7MP 3E6BA 1CXUA 2LY2A 4HX4A 1I4K1 3I4NJ 4WQ4C 4DA4A 3O3FA 3VS4A 1TKZA 2F5VA 1A6QA 1RT6A 1I3AA 2KT8A 1IN5A 2J5OA 5AJ3K 3AHUA 2JHNA 1TWBA 3CJ9A 3CW7A 3KLNA 1JLCA 1LJOA 3KBGA 3L2WA 4HXJA 1WI3A 3GTKJ 3I0TA 1GV5A 1WGXA 2OAZA 1XSXA 5L3FA 5EG2A 1WSJA 3M1FA 1Q82R 2A0FB 2CUJA 2JNGA 1GLEG 2CH6A 5ICGA 3UKRB 3CCUA 1LWEA 4E9FA 2HKXA 2HU9A 1YT3A 3NFAA 4FYWB 1AWJA 1KAXA 2DL8A 4BC3A 2VL8A 1PKTA 1ETKA 2QEXT 5GAN4 5GPAA 1D8KA 2L7ZA 1QE1A 2P9PA 2G8FA 3P4IA 2E70A 4EGZA 1ZA2B 3QFPA 3MHXA 2LK2A 3U3YA 2LBFA 1MH3A 1I81A 1KRPA 2PX9A 1M1KR 1LQ1A 4NC6A 2LRQA 1HF0A 2HSEB 4P1WA 2HD0A 4DTMA 1OKRA 1VUBA 3CCEN 2R7RA 4M7DB 2VQGA 1R0CB 4IO9F 4CJTA 5IHNA 3ZYYX 2YNGA 4JP0A 4NQWB 4BBRJ 2HHVA 1DP3A 5BQTA 3VEYA 1AZEA 2QDLA 3NTIA 2DBKA 3EZ5A 4MIMA 4O0IA 3URGA 4YNQA 4IJNA 2ROTA 2KVQG 2ZXJA 1YIJI 4C23A 1KZHA 2KRSA 1ZAOA 1JUPA 2F1LA 1QWFA 1NBEB 2P9UB 5IP7J 1X27A 3SFIA 2EWNA 4X9DA 1JI8A 4HW0A 4JS5A 2CYYA 3SFMA 5I9EB 1VAZA 4F2RA 3KLEA 3TDUC 2DFUA 2K57A 1ZUUA 3EG9A 5AT1B 2HPIA 2GX9A 4RCCA 1VQNI 1JUSA 2RQVA 3CDIA 4B1XB 4MFBA 2JPBA 3IAS2 4JK9A 5C25A 3CMEA 2P9NB 3V9XA 1IO2A 4OB1B 1J6ZA 4FQGA 4EJTA 2M9HA 3BCBA 2MWPA 1YG2A 1HPZA 3CXCM 1RLQC 5F1RA 3M4OJ 4I0BA 3CCMA 5FFXA 2XAFA 4K25A 1QQNA 4WQ4A 4A61A 4B44A 5GINA 4DU3A 1BI2A 1DJ7B 3DPTA 2CW0F 2IP2A 2EAYA 3IWFA 2Q2EA 2DL3A 4RB2C 2YT6A 2RH2A 3M0RA 1SAUA 4JPBW 3HJFA 4P96A 4KIGA 4JJNK 1MA9B 2A41A 3TAMA 3DBHB 1Z21A 2ZNYA 5GAN7 2FBXA 3KTUA 2QQBA 5C3EJ 2FPFA 4XH1A 4DYQA 4HQMA 3SZPA 3LDQA 1MBEA 2D0CA 1OCTC 1IGUA 3HHHA 2COWA 5FB2A 3G25A 4ZYDA 2C0IA 4BRGA 3EE9A 2OTLI 3ME9A 2X6NA 1IN6A 1GOBA 4DV2K 3JSCA 3CMET 1YJNQ 2K3YA 5HLIA 4KPYA 1MUZA 3QIPA 5GTHC 5C0YA 2P8TA 3FB9A 1M8MA 4O8KA 3K59A 1YITT 3CCMT 2OAWA 1TK5A 4OO1J 2HQHA 2OCCH 1KG6A 4RW4A 1T8EA 1D09B 5LEJA 1TVRA 1A5JA 2O4XA 3ZN1A 2V1RA 1GBQA 3J7ZO 5DD4A 2ZBKA 3WU1B 4IURA 2QK9A 4OFAA 4Q5VA 1S9GA 3F3XA 3M54A 3C4SA 4HV5A 4Y1DA 4CZMA 4PJOF 4W5RA 2MC3A 3C6TA 4U7DA 3FWEA 4NZGA 3KK1A 1YIOA 1NNEA 3CMAN 3M0QA 2K2VA 1G15A 3QP5A 3HOYJ 2HDWA 1MNMC 2GA1A 3DWLE 3CP2A 3DXJF 5F04A 3RIRA 1DTQA 2FMYA 2YS9A 2HBPA 4KH4A 4ISEA 4DR3K 2JG6A 3AG4H 3CWSA 4A3MJ 3GF2A 4PNOA 2IIMA 3LFUA 4M7AE 3VS6A 2F4IA 4FT4A 3LH5A 3VQ6A 1PU8A 4DHYA 1P90A 1W7PD 1WFWA 1FLIA 2I5UA 2R7YA 4V2GA 5J3LA 1UJYA 4K8ZA 1EETA 5GANh 1WJFA 3ZMZA 3CC4Q 2WOMA 3SEQA 3MKYB 2NUPA 3TSUA 2XPUA 5M1PA 4DWIA 3OY9A 1S6QA 1XDSA 3HRMA 4BS9A 1TQMA 2O88A 1SHFA 2BDPA 1BR2A 1RKWA 4DGWB 4CC4B 3V1QA 4KNYA 4HCCA 3L1AA 3VEXA 4CD1A 4QVDA 1VQLA 4DQPA 4O0JA 2COBA 5GANd 3K2ZA 3K57A 2FU4A 2GBZA 5L3DA 1VZ0A 1IV8A 1E6HA 5GAHJ 1JLBA 5LJ3e 3VA3A 2HZTA 3CCEA 2JMWA 3KK3A 4XICA 4CJPA 4Q5SF 3RERA 4EJUA 1NWKA 3LAMA 4RG2A 1BWFO 5EGOB 1H88C 1W36C 4M3BA 2M45A 1OEBA 3TKYA 4OAZA 5GJVB 1VSJA 4Z4HA 4ZDLA 1TKTA 2HTSA 4FPAA 1VRUA 4D5FA 2GBYA 2DQRA 1X58A 2P9SA 4FYVB 3I56I 3V81A 4M7DG 1GCQA 1YRNB 3MZ8A 3FZLA 4YFNF 3J7YJ 4KB0A 2V79A 3IAM2 3P39A 4ZGEB 2NUTB 4W97A 3QZ5B 5KCHA 2CP7A 5L3BA 4IEJA 2HOTA 1BA0A 3QIIA 4FW2A 3I8BA 3U4LA 4CIGA 2R92J 1XN7A 2DQLA 4DOWA 1NGDA 3GXOA 3E19A 2BW3B 1PG5B 5FU7B 5LGTA 1NZ9A 3VOVA 3RYPA 4B3MK 3QFUA 1KQ8A 2HBJA 3CCET 2O8BB 5LJWA 1Y0UA 2IOCA 3DJCA 1SPKA 3QB0A 4N9IA 3BJ6A 3TAQA 1H8AC 2R4GA 2KP6A 1QA6A 3UATA 1M90R 3GLXA 5FKOA 1QZYA 1YE9A 3M1CA 1VQMN 3L8BA 3FFKB 2XSJC 1BBZA 5FLXO 3LQRA 2Z99A 1RT2A 2QGUA 2EQUA 1E4FT 4CF2A 2GELA 3LH0A 1W7PB 2HQ5A 3VUZA 1ULYA 4AVPA 3AA5X 4AC0A 2DT7B 3SEMA 1G3TA 1D5VA 5JVGF 3HJEA 4Y91A 4C2UA 2ZSIB 5HLFA 4C2MJ 1V1CA 4YG2F 4ZC3A 3NF9A 4RAFA 1W1WE 5GTIC 2PG4A 4N5SA 3VDXA 1MV0B 2O4GA 5JHFA 3QEVA 1RDAA 3B73A 3DTIA 2JA8J 2CMPA 4JKDA 4V2FA 4RAGA 4KFBA 2ETJA 3LL3A 1DEJA 1S1WA 1S5LC 1VYUA 2FZKB 5F64A 3MEEA 3RMBA 2GZWA 3G10A 2XY7A 2D1XA 4CGZA 3M55A 2JMAA 1VQ4N 3O9UA 3JCMb 1YJNI 3F22A 3CCRN 2M8EA 2ESWA 1X3MA 1R49A 1FK9A 2QWPA 1N8RR 2KKOA 2NRXA 3IKTA 4KIFA 4FT8A 5D6YA 2ID3A 4XRSA 3GTOJ 2V1QA 3IFRA 4IJAA 3LDLA 4OB3B 3QSUA 4UV8A 2BHZA 2QI2A 2XAJA 1S7EA 2KRCA 4M41A 2XDPA 4DU4A 2DL4A 3MD2A 3K7AJ 3VTIA 2DEUA 3NH1A 2JN6A 1LWFA 2NXNB 5AQVA 3F8BA 4TV7A 1T8IA 4QQ6A 3G71Q 1KQSP 1KXPA 2XU8A 3CC7I 2VIXA 3PLAA 3LM2A 4BXFA 3RRHA 1OLTA 3F6OA 1V4SA 3VQPA 3JAMZ 1Q9XA 1FC3A 1N6QA 2OTJN 3FXJA 4XLNF 4M77E 5AQOA 1JGGA 3P8HA 3OYAA 3A8YA 3GLLA 2YX4A 3B8AX 1NEBA 3FGUA 4IHSA 4JKHA 2Z2SB 1ETOA 1D1AA 1WHGA 3I4MJ 3E6MA 1OZ2A 4CYCB 2RHKA 3D0SA 3ZLJA 2EQIA 4BU2A 4RG8A 2L9SA 1K73O 3IH7A 4DR7K 2E2IJ 3PUFA 1YXQA 3SMPA 3ERMA 3CQZJ 3LLRA 1C0TA 1IN4A 2QGGA 1V4TA 4FJKA 2P5KA 3R0AA 1Z1DA 4B1RA 1G3WA 1ZBUA 4VUBA 5D5XB 2ISZA 2EBPA 1KG3A 3CMAT 2LVSA 1QHHD 1GCPA 3KZZA 2G6FX 1CXQA 2CS3A 4FT2A 4CI0C 3HT3A 2QSGX 4CEFA 3NH2A 3F23A 1XMKA 2F4OB 3ZEUA 3S8PA 1OX9A 4ZHRA 5F1XA 1K78B 2EKHA 1S1NA 3NCIA 4B23A 2HVRA 1B72B 5C4JJ 4F16A 2D2WA 2BV6A 4CEBA 1I5LA 4LF5K 2L3SA 5KYWA 4KH1B 2CZ6B 2IVMA 3KP5A 2ZPGB 3ELKA 4M71A 4X1EA 1VQ7Q 1M3HA 4KHPK 3PQKA 3NGIA 2RJEA 4KUIA 1W2BM 3O8MA 2FZCB 5CQGA 1AKHA 2DJZA 2LG4A 2E20A 2LCSA 1N9SA 4MO7A 3PO5A 1S7AA 4I98B 1K73U 4FIBA 4IRHA 4ESFA 5I22A 2YU3A 2MC4A 2KZGA 3CXCA 5FWCA 1YYVA 5DCFA 5BRDA 2Q0RA 3H6ZA 2HOAA 3I55I 3JB9H 4I2PA 1SV5A 5FRNA 1JT0A 1U0JA 3CD6I 5CR2A 4IOXA 3THWA 1LOTB 3I4PA 3KP4A 3TP0A 2XF6A 3UR3C 4I6MB 1ATRA 2B86A 1RLPC 4A6DA 3K4BA 1QCOA 4M77D 1TAUA 4ZYGA 1VQMA 2QWOA 3AY9A 1OH5A 4CIFA 4F4KA 3K6GA 3V1RA 5GIPA 1XOVA 3H3NO 1QQJA 1LDJA 5TJJA 1RUNA 4RCHA 3CCSQ 2BOLA 5DPKA 4A4HA 4QVCA 3KP7A 2VASA 2D8HA 4G12A 2VQCA 5KYYB 1TG0A 1SQKA 4IUQA 5D4SA 4HVWA 4C2TA 3TDZC 3TCJA 4AM7A 3G3ZA 3SZ2A 2QQAA 4M78E 3THYA 3CI5A 3GPLA 1NJIU 2RI2A 5GIOA 2UXDK 1NKUA 1NK2P 2IC3A 2Y48A 1HLVA 2D0AA 3H3ZA 4PJNA 2JZ2A 1PSEA 1KQ1A 3SHFA 4WYBA 2EA4A 3VQAA 1W5CC 1ZA1B 3EG1A 4OKJA 4D1QA 5GMKj 1VRLA 2DBBA 4PKIA 3S1NJ 3ABKH 4FVMA 5JLFA 2HXOA 3RMSA 5I2MA 2PFBA 4HF1A 3CEYA 3SB2A 3I71A 1P7JA 3O5BA 1FP1D 1GXIE 3KHYA 1BCMA 2TCTA 3WXLA 3DKMA 4DLGA 1FJGK 3KCCA 3MMYB 2LKSA 2Q1ZB 4BRQA 4CBUA 2LNBA 2PMUA 2X4XA 1AOJA 2V6EA 3KLHA 1VQ4A 5M1NA 4HDUA 4OAYA 2F5CA 3JCMc 4CJ7A 1WJEA 1VQMT 2PJRA 1YJ9Q 4PKGA 4AT1B 1H641 2FVUA 2EQKA 1OQYA 4G8XA 4HCBA 4DBQA 3P83D 2NS0A 3LYIA 3VMFB 3TMOA 4ZGDB 2F96A 3H3OB 3CF5F 3H6EA 3VSKA 3M53A 5FLXK 4MFDA 2L4AA 3JSPA 2RNAA 4AI4A 4Z4FA 1LE8A 5LFAA 5J40A 3HXMA 2X0LA 5I11A 3EL2A 3RZDJ 2FE3A 2YI1A 2M7AA 2KJCA 5DUIA 3ECOA 4Z6YA 3I64A 4OPKA 2OTJA 4M7XA 3R2XC 1K8AO 1LKXA 2GOMA 2RHUA 3CBMA 3ATVA 1LCKA 2VWBA 5AQKA 4FE7A 1UECA 3T1YK 1UG0A 3FMRA 4ELTA 1XB4A 3EGXB 1RR7A 1VQ4T 1LPQA 2P0KA 1SL2A 2L3DA 4CK2A 2V4JC 3CCRT 1PUFA 4IX7A 2V52B 2KW4A 3LQQA 4Y4RA 4H03B 1WVRA 2NYXA 5LL6Z 3S6IA 4UUVA 2A6EF 4LOCA 4OLBA 4A3CJ 3CJBA 1T6SA 2CS7A 4M78D 2ZWHA 4IEIA 1IGNA 1BC8C 1QZZA 4G7OF 4ATOA 2P0WA 1UMQA 2XUBA 5ILVA 3LSRA 5F27A 5CQXA 4W5OA 3CWAA 4CZJA 3CMEQ 1E3HA 3OBYA 2HMIA 4M3FA 3OV8A 3JV3A 1LUJB 3U3GA 1WSUA 2ZJRF 1YITQ 1S8NA 2CZ0B 4DS5A 5KE2A 2HAXA 5KYNA 1LCUA 3LANA 3ZT3A 3JW4A 1X01A 3F8CA 2MD0A 4FM4B 4HRIA 2OTJT 1OQKA 4LY7A 2B0LA 3VS0A 2GGRA 1EKEA 1XGSA 2D45A 1T08B 3PJRA 4C5GA 3TQNA 3ZRGA 2BE9B 1K8AU 4C8QF 3EETA 2RK1A 3Q9VA 1FBQA 3TU5A 2DA4A 3N5NX 1J5OA 1S3XA 2CUFA 5H20A 4XKVA 2IGOA 5E8IA 3EFOB 5DTDA 1BI1A 5C2FA 4EJVA 3R8EA 2GXBA 4JOMA 3NNQA 1U4BA 1KONA 3BTCA 1SEUA 2ZGZA 4CJRA 4HSTA 4XK8E 1DIZA 3MJXA 3J7AP 1TWAJ 4HQEA 3RVCA 1U5TC 1R9TJ 2HQRA 3D2FB 1OH7A 3M0TA 1P2FA 4MO4A 2V1NA 1FX7A 1YVUA 3MKLA 3WGIA 3VESA 4PL7A 1J2XA 1U2WA 2DJIA 2DTIA 2P4WA 1QVFP 5KGWA 3DXMB 1ZQ1A 4PQUA 3QYHB 4BC4A 4RB3C 1RTIA 3T3FA 4OMZA 1B9NA 4LD5A 2CREA 1EZZB 1S6LA 1BJAA 1CZBA 4HOBA 1NK6A 4AHUA 3PT9A 1C1AA 2CSQA 4XKCA 4AHTA 5HKCA 4RTUA 4DV7K 3L3VA 2J5PA 2QEXI 4CZCA 1HRHA 1E3OC 3BF3A 4C1NI 4DUYK 4PA1A 5E3MA 4KGVB 1I1GA 1H3HA 1REPC 3A5NC 1HYZA 1M2VA 1BBYA 5AQMA 3HPHA 5KVRA 3TO9A 1PHTA 3LZIA 1LW2A 1AWWA 2JJ7A 4GLMA 1HK9A 1RILA 3H35A 3T8TA 4E7IA 4AILC 1FTZA 1B1BA 1O9SA 3NWSA 4YOWA 4G7HF 1HCRA 1FYLA 2DL5A 2NVQJ 2DCEA 2XDVA 1NJXA 3CVTA 5E3LA 1JEGA 1KLNA 4FHTA 1IBMK 3J81Z 4Y33A 4ELYC 1RFQA 2CQNA 1FMWA 2R3SA 3P8BB 4Z8AA 1G2HA 2UXBK 3PL8A 4BYYA 1YN8A 1QLYA 3PX6A 2QAZA 4GRIA 1ZR4A 1E7OA 2K3XA 2CGKA 1OZ3A 1JBMA 2G9WA 1S6PA 3OA9A 3CCUI 3GMEA 4H5NA 3E0JB 2KKZA 1I5OB 3OGDA 2NOEA 3UKGA 3TU4K 3S32A 4Z88A 2ED0A 2H27A 4PUSA 3HHTB 4PSXA 3KPHA 2DERA 4I7FA 2R7FA 4MZTA 4FK0A 2R7DA 2O8KA 4LFUA 1IUFA 3EO3A 3W2VA 3ER0A 4PDKA 2XDBA 3KVGA 2XRNA 5J8FA 3C0BA 4QVZA 2A5XA 3CCEQ 4C92D 2XY8A 8ATCB 2EV0A 4BRNA 3GTPJ 2QTXA 2VYTA 4Q5WA 4DIQA 2DYRH 4ILJA 2RKIA 2OUMA 5F0HA 2EVRA 4CK1A 4LGWA 4D9JA 1S7OA 3QBYA 3BR5A 2XHBA 3AVLA 4FISA 2RAEA 3AGKA 1T3LA 1RBUA 4EA5A 4B3XA 3H46O 5C44J 1R1VA 1T0HA 4C8MA 2DFEA 4PUOA 2HXIA 3IS9A 1SD7A 2MBFA 4C8LA 1UJ8A 4WXCA 1HKTA 4QQDA 4M3ZA 3RR7A 2V51B 3BDLA 1Z26A 2HBMA 3F0ZA 1XQSC 3U23A 1TAQA 1U5TA 3PO3J 2A28A 2A08A 4B9SA 1R36A 3H45C 2L4MA 4FSSA 2MW8A 3CFOA 3VEPA 1U3OA 2KE9A 3VUBA 2M5WA 1BA5A 3R6OA 4EMKB 4ASNA 5EYRA 2AO9A 2DMPA 1U3EM 1LOJA 1NYFA 1W70A 3CVSA 4BEHB 5FDLA 5B66C 1JCGA 2IT0A 4E70A 5HS7A 2K5IA 2ATQA 2VBYA 1A36A 4Y28E 2QDYB 3FIFA 4FSVA 2ZZDA 1Y0NA 3CMEI 2DXUA 5LJ3h 4H5TA 3CPFA 1YLFA 3LDOA 4LG0A 5HLHA 1KEAA 4AIDA 4JJDA 3LSKA 1LV5A 3RKXA 1VSIA 3J80O 1WYXA 3B02A 3CJAA 1EV7A 4L5IA 4AG1C 3CCMI 5E3NA 2F5TX 4HX8A 1PKSA 2W48A 1WQWA 2VT3A 4NC7A 3OSSC 3F8MA 2LDUA 2F6CA 1W2BA 2X9HA 1STZA 4RTFD 2P9KB 2ZJPF 5LJ3d 1Q81O 3QPLA 2OX7A 1YJWA 1C0GA 4YFUA 1NG2A 4C5IA 1TL3A 5DUKA 2K3FA 4CW7B 1WAFA 2R7VA 1TOVA 1F36A 3GG4A 1WEIA 2BE7D 3DOKA 3HUGB 3L2RA 5KQ8A 2DILA 4KHQA 2IA1A 5HY6A 1OCPA 2KMTA 3OOUA 2QBYB 5L8RE 3LNQA 2IS6A 2O9LA 1UG1A 5GMKe 4PJOG 1I3QJ 2E4HA 2UUCK 3K2PA 2KR3A 2A7YA 4C92B 2DXCA 4DTRA 3VPRA 4UUSB 2HKQB 3HYFA 1I07A 4RTTA 5A2QE 2EIJH 2QUFA 2HYJA 2YX7A 3FEOA 5IP9J 4CHQA 1NH3A 3WG7H 5DCMA 1D5AA 4A3LJ 1IUYA 4J9FA 5IPAA 2WA0A 4PGHA 1NJIR 3ZN0A 2EFNA 3PIOA 2JT4A 1MBGA 1XMQK 2CH4W 1UFMA 3HZJA 4F7UB 4PSWA 4CZIA 2NOZA 1HD3A 1X2KA 1DLOA 1M9SA 2KY9A 4KI6A 2Y30A 3M58A 3THXB 3CUQC 4JYKA 2J06A 3CMAQ 4BR9A 2E5NA 4CD3A 2LRDA 1CF7B 4Z94A 3HC7A 4DCHA 2D8JA 1Q81U 4AUXA 2O8FA 1QHAA 3OYKA 4H0PA 4B9TA 1KSWA 4CC3A 4NLBA 4C0FA 1NPRA 2DYBA 2AZSA 3IQLA 3BW1A 2NNYA 3X2QH 1U1SA 4RWTA 3DEWA 1QMCA 4DFJA 4XLPF 1XQHA 2JPCA 2HKNA 3RMDA 3SYTA 3WHCA 1GLJO 2QGFB 4ZGJB 3HEFA 2DKGA 1VSHA 2Z1GA 2VVKA 2BY0A 3KK2A 1GV2A 2JW4A 1BGXT 2NRTA 4XN3A 2PVDB 4DTOA 4HYEA 2JHJA 2XKOC 5ADXA 3ISNC 4J83A 1Y96B 1WI7A 2CSIA 2RREA 3A0BC 1ZRCA 3HKZN 1YP5A 2FSWA 5JLHA 1VSFA 4U88A 2LSOA 2ITGA 3HG9A 2HDDA 1RAEB 1M3QA 4K2EA 1T6CA 4BY7J 2QK0A 3QHSA 4CJSA 5GANg 4NUBA 4BG8A 3BZCA 1WHMA 1RT4A 4P5NA 4XLAA 1VQLI 5KK1A 3NH0A 3VEOA 4FVUA 2OTLN 2QQSA 4H0XB 4BACA 3RTVA 3BROA 1XPXA 2JVGA 1QWEA 1SEMA 3ZX2A 5CKFA 1LAVA 1C0WA 3ZSOA 2GFAA 2SRCA 1OCCH 1T3VA 3OA6A 1WAJA 4RGUA 1VQON 3DLBA 3CCEI 3ZGKA 3K4LA 2HHSA 1OMIA 4E9HA 3ZX3A 4DR4K 1Q1HA 2W6KA 4IO9L 4XTYA 1PP7U 3RQIA 3CMMA 4BDYA 4JV5K 4E7HA 4CZKA 3D7EO 1ETVA 3GUDA 3G1OA 5HBMA 5EOYA 1WKMA 2LBFB 4DTPA 2NVUB 3K10A 4BVOA 5DDGA 2CP0A 2IGMA 4QIWN 4PK4A 2E60A 2K9MA 4AVZA 4OGCA 3FXMA 5LMUK 4A3DJ 2HOEA 2A3ZA 4JLGA 2UV1A 2L2PA 4K0KK 3JSOA 3R1XA 3B6OA 1IKYA 3RSNA 1KQ2A 2O31A 1XX5A 4A93J 4FJHA 4BXXJ 3SUQA 2BY3A 1GL5A 2K79A 3CUQA 2CH0A 3O6BB 1JUMA 4U67L 2GWRA 1KSPA 4L0YB 1SKWA 1RGIA 5AN4A 1JE8A 2H1LA 3ZT1A 3LP0A 3E01A 4QT7A 1VQMQ 2CZ1B 3QMLA 1ATNA 2VG7A 4EAHD 1SKUB 4JKCA 4D5CA 3KD5E 4BWMA 2VQEK 4A4EA 5E1WA 3OYDA 3UDCA 3HGGA 4YPHA 4XTWA 2FB7A 2RB6A 2VONA 5GAOr 1IXSB 4JKFA 3RPQA 2YV0X 5JVTA 1O3TA 3VPZA 2HWVA 3TAEA 3RDIA 2HMPA 3JREA 5KRSA 3BC8A 3A01B 2WSCE 4RS8A 4B8XA 4E1NA 4JEPA 1ZXOA 5HNFA 5AQLA 1AOYA 2GBQA 1SF9A 3T69A 3V9SA 5H6RA 2RK2A 2Z1HA 3EG9B 1JB0E 1ABOA 3BDPA 4DV6K 2ZFWA 2IAJA 2IS2A 4L5JA 3UA6A 3M8PA 2A5WA 4A0XA 2A61A 2XKOA 2VB6A 3EGDA 3MKWB 2OA4A 2XIGA 5JLWA 1OI1A 3RKWA 3HB9A 4CGGA 3H9NA 1ESVA 4DQIA 3DBRB 5AQJA 4MEXF 3META 1RDCA 4J6YA 1WXUA 5J1YA 1PM3A 4DU1A 3F21A 1VQ4Q 3L9FA 4HT8A 2PBDA 1GUUA 3KYDB 5JLXA 4H0OA 1WPYA 3CCRQ 1NGAA 3AVFA 3A4CA 1T6DA 2Q2EB 4M7AC 4TVRA 3DM2A 1R7JA 2QQ8A 1V4RA 4YTLA 2YNIA 3PIPA 3SD4A 2JLEA 5EF6A 4BRPA 1HQUA 1FYMA 3D45A 4UNOA 3M8RA 1N3CA 2QSHX 2DDBA 3DF8A 3PUBA 5JICA 1WHKA 1SFOJ 3ZQFA 1X6BA 4C92G 4CRIA 3ID6A 3V8LA 1PC0A 3J80K 1WRJA 2GQVA 1Q7YO 4XSZF 2VPLA 5E3OA 1GLDG 3JCMf 3S2DJ 1U47A 3BWGA 3QNOA 4Y0WA 5FKNA 2WC2A 4M9ZA 4CEAA 2L2OA 3PO4A 3GBGA 2OTJQ 3MXJA 3SJHA 5LRSA 2KJBA 3CHWA 1QRYA 4EJYA 4MDBA 5AQYA 1M3AA 3IL2A 4YRVA 3HSTB 4RW8A 4X66K 2K27A 3QZ9B 2VN2A 1ABQA 3O4NA 1KTQA 3RSEA 2FHDA 3CCVN 4B09A 4ZNXA 4AHSA 1JU5C 2EILH 2CV2A 4C8QB 4KIBA 1X1CA 2O4XB 4EHUA 4K41A 3OR1C 5DV5A 2RVCA 4CIEA 3SQ4A 2E4LA 1DPRA 1T7PA 3CDHA 3P9KA 4PJOE 5C24A 3HKZA 4I99C 1JQQA 2EZLA 2W04A 4KULA 1TW3A 2A1SA 3FLCO 3NGZA 1ZLMA 3C7JA 2KDZA 1Y6IA 4FYDA 2HQNA 1KQSM 3TPQA 2ELJA 1Q7YU 2GEMA 5EY4A 2RQRA 4IRIA 3ZP5A 4J2EA 1KYZA 2XB0X 2RN2A 1VQOA 4NHJA 4MTEA 4BJ5C 3HZ6A 2DK3A 1X4PA 1TUCA 4ELVA 2Y2ZA 4G6DA 3AO5A 3C18A 5GMKl 1W1FA 3FLGA 4CO8A 1QZEA 1MD0A 1DDNA 2NUPB 3GW2A 1WOQA 5ELZA 1ZSZC 4DZJA 1BCOA 3LDNA 3BT9A 3DLLL 3DWLA 4JI7K 2CGHA 2RJDA 2HQEA 2DPUA 1EIFA 4CESA 3O8GA 4A12A 2F5FA 2EFPA 2XG8D 1WHJA 3E9FA 2JN0A 4XNFA 2OFIA 2A5YB 4Z4CA 3TAFA 4FJMA 1YOVB 4ELUA 3O4QA 4M7AA 4L6V5 5DD8A 1BI0A 3LA2A 1JJ8C 4G6TB 3EHRA 4BE1A 4RGRA 3T9NA 5KN9A 4YELA 3CC7N 4JZ3A 5CYQA 1N77A 2L3RA 1FOKA 1WZOA 4I9QA 2DA7A 2JTFA 2LY9A 2M34A 2OTLT 2ZPIB 3VGLA 1CGPA 3TO6A 2O4IA 3L0QA 2CW8A 3BGRA 2KXCA 3U1DA 3DLHA 4M9XA 2JA5J 1LPLA 5HDGA 3HGYA 3A8MB 5LJ5f 4D7NA 1VQOT 3PFSA 4XOTA 2YRCA 2FRWA 4J9GA 2DMUA 2P9SB 1JXEA 1TWHJ 2ZO4A 3DCFA 1N39A 1VQPA 3DRSA 1VQMI 3DB4A 5HVQC 2UUBK 1QZ5A 3NFCA 2MOXA 1M1EB 4M75F 3L6QA 2P6SA 2L7KA 1YO5C 2CP2A 3QG1A 2JTMA 2RDPA 4B3SK 2HHUA 5BOXA 1YHQA 3COAC 1MJBA 2NRRA 4GLKA 5TRDA 3KE2A 2ME6A 1B3QA 2LOOA 1RDDA 2FSKA 2PQ8A 2XDDA 3VERA 5BPMA 2HSPA 3ZSXA 5A2QO 1IZ1A 4ZZLA 2J7IA 4FWRA 1IW7F 1RC9A 1JJ6C 3GIBA 2ZJQF 4LLNA 3HKSA 3IG1A 3NAUA 3LA3A 3CPEA 1WH5A 4OOIA 5IAYA 4RTZA 1X2NA 1AEYA 4J9EA 4L3QA 3E5UA 4FYYB 4BJTA 1BIAA 2XGEA 1BA1A 3VEZA 2VQLA 1Y0MA 3FJPA 3OMCA 2EK5A 4LD6A 2B5JA 2M1BA 4LF9K 3AFHA 5GJWB 2P5LC 4KI4A 3UF4A 4EJOA 6PAXA 1XC3A 3ZETA 1VQ4I 1K9MO 1Z6RA 1Q1VA 4GBQA 4ANJA 3BPVA 4FL9A 3SQ2A 3SYZA 4BC2A 2EPDA 3CJ1A 1RBVA 1T33A 2CUDA 2HVIA 1ZSZA 1HSTA 3OW2A 2E1MC 5IYCJ 5D6XA 2PNIA 1HSJA 3NQOA 5BREA 2BY2A 1ETXA 2AIRB 3OW2S 1FEXA 4H5RA 3I55N 1YTUA 3BJAA 2IRFG 1I27A 4DYRA 1QVGA 4AF1A 3PVLA 3MPUB 3K5OA 1L3VA 2G8VA 4PY5A 1QVGS 1WFXA 3MN7A 3K9JA 3S2HJ 1BW6A 1D1BA 2PY5A 4L59A 2XICA 3MQ0A 4IUTA 3CCVA 3KP6A 2OTJI 4JBAA 3ZMUA 3HVTA 1MJ9A 4NDLA 4TSXA 3PFIA 1Q82O 1XNQK 1MGTA 4X64K 2LTPA 4FWLA 4DBHA 3T1BA 1JKHA 1EO1A 2B63J 2FQ4A 3L2VA 4DF4A 3Q0WA 1KYWA 3ULRB 5KN8A 3BUZB 2O8CA 3OSFA 1K9MU 4D8DA 4M42A 4C8QG 3DKXA 2VWKA 1O75A 1C6VA 4NOYA 1UELB 1VA7A 4I76A 2HQAA 4WFBL 3RPUA 3KLOA 4OIQF 2OD5A 1M1KO 4BI4A 1WBDA 5FW9A 4KTQA 1WGSA 1M27C 4G94A 4IFVA 3S93A 4EMGA 4JK7A 2A6AA 1IV0A 1JGSA 4ABZA 1FKPA 1WJQA 4XR6A 5DK5A 4PJMA 3S14J 5C0MA 5IXBA 1D9FA 4BRAA 4MNUA 3V6DA 1FPQA 5BPNA 3U9DA 2VKNA 3CCVT 2Z9OA 4LMYA 1P59A 4DSIA 3M8JA 2YSQA 2P5OA 1VQKN 4M73A 4WCIA 3EDPA 1K8KB 3CCJN 5CVIA 2V7YA 4MZPA 2WV1A 4IFEA 4CVNE 4IG0A 4KITB 5AYFA 1Q82U 3PNTA 4CF9A 2HKOA 3CESA 4M78C 2JPSA 2PEXA 3JRIA 4S05A 3A8HB 4RW7A 2FL7A 2L3QA 4FM1A 4Z0UA 4RCBA 1WB9A 1ZLJA 2YG8A 2K86A 4JZ4A 2MIOA 3ID8A 4ZN3A 2XRIA 1VQ5A 3ZEUB 1KG7A 2FQ3A 3W3CA 3GX4X 4M7DC 2E1YA 3HXLA 4F8RA 3WQUA 3JCUC 2OPSA 1QQOA 1YI2N 2STTA 5F0CA 2E2OA 5D3GA 1CZ9A 4M6YA 1TZLA 1X9SA 3CCQA 2VJJA 1X3UA 2DFFA 1TQPA 5KYWB 3A5MC 1ZRFA 4C8OA 1KG2A 1HNZK 3DI6A 5KE3A 3KUFA 2GLOA 2NS8A 3HFOA 2EINH 2JWKA 2VBZA 3WNFA 5IT3A 4CZFA 4IEEA 2H94A 1QU3A 1AKHB 1ZGJA 1T95A 2P0PA 4YOUA 2WV0A 1KU3A 3U2RA 4BC5A 1OOTA 3O8HA 1Z7UA 4PJJA 4CJUA 1W4SA 3CC7T 3UB5A 2KQWA 3E1YA 3M5AA 4L9VA 3SQNA 2R7SA 3I35A 1JRIA 3LP1A 1R4MB 2LH9A 3MK6A 3RKYA 1KQ0A 2CU7A 1QCFA 5MLCQ 1KG1A 2WAQA 3GZ6A 3V8KA 3FXUA 5C12A 1U2VA 3JRDA 4FLXA 3HBLA 4FLWA 2DN0A 4CXFA 3W2WA 2XHKA 5GMKh 5AQPA 2ZB9A 5D8LB 4NL2A 4EP5A 2HFHA 2XB5A 5DM6F 3LP3A 4F04B 2EIFA 3A8GB 2FPEA 4CFBA 2CFXA 3MEAA 1XHXA 1UGPB 1TUGB 3THYB 1KD1R 4ETSA 4OIRF 4WF2A 1ORPA 2FC0A 2JSPA 1X9WA 1MSFC 1EP4A 4AI5A 2UWMA 1UHCA 2Y0SN 2XY5A 2W25A 2I7NA 2FUG2 3WNHA 2EH3A 3GP8A 4DV0K 1JKPC 1KC8C 1VI0A 4FU6A 2XV4S 2W85A 2ZXIA 1K7AA 4C0DC 3JCMX 3CF5L 1AA7A 4AIJA 3VYGA 1D4XA 4AM6A 4C8NA 3MCZA 2DOAA 4F3OA 1NM1A 3H3UA 1QKWA 2PTKA 3WXJA 4UY8O 5TGTA 4CSWA 4M78A 1TW2A 1EQYA 4LB6B 5KCOA 4FWMA 2HF4A 5LEKA 1XCVA 2HZDA 2X1DA 2NVYJ 4BHPA 2PUKB 2PJRB 4A5NA 4A4KA 3NTHA 2VV5A 2BXZA 2WSFE 3CC2N 3WTSC 2JWLA 1MBJA 4LFBK 4GV6A 5DS9A 4OVAA 3VQ4A 2JGUA 5EC7A 1IBLK 2WB1N 2X4YA 2OZUA 4M7DA 3BR6A 1WN7A 1UUEA 1LW0A 2YHYA 1ETYA 3O9SA 2G8WA 4NQWA 3BZ6A 3IUOA 3SCXA 1D5YA 1WHUA 5CJ9A 3J7ZI 4UNFA 4E89A 4BRKA 1LE8B 3HRSA 4NYNA 2JSCA 2RQQA 3H9GA 3M3YJ 1VRTA 4FLUA 3ROUA 5J39A 5C4XJ 4C3IJ 2Q0OA 1AHDP 3TBIA 4XRSG 1FP2A 2DTHA 4K43A 2VXFA 1P4WA 3G4SN 4N9HA 2TRTA 3JAMO 3I55T 2LC4A 3CQYA 4M7YA 2C0TA 4D8KA 2K02A 4IPAA 4DNCA 2YX6A 5I42A 5CYMA 5GANf 2JMCA 3PMIA 3VQQA 4XH5A 2ZJRL 3VRZA 1ZHIA 3DQVC 4OP0A 2E2JJ 3UPUA 5AFUH 3FJ5A 3ZSWA 3EPZA 4KN7X 3OR2C 3PIPF 3K2AA 1PUFB 2Q0UA 4A5BA 3IP4B 1R4NB 1VQKA 2ZMEB 2PVOB 3CCJA 3GZ5A 5GAOm 3CCUN 5LJ3g 5K1YA 2CSOA 2M3AA 2GWKA 4M3YA 1R5ID 3ULEA 2H8HA 3FXKA 1UG2A 3MKDA 2YSRA 1RBTA 4EZ6A 3CIPA 5J2QA 2LCCA 1YJWI 3V9WA 3E1SA 2YJEA 5ED4A 2ASOA 3GNGA 3EG0A 2X4JA 3NHGA 1U06A 5IOYA 3SWNB 1KIKA 2BHYA 1NG9A 1YAGA 3S2WA 3NARA 3KLGA 2EGAA 4UV9A 3DEUA 3GBQA 4Y92A 3CERA 5AQZA 2ZC2A 2RNGA 1KG4A 2OAUA 3EUHC 2EZHA 1NYGA 2P1JA 2PN6A 4YY3K 4H4KC 1YI2A 2IJLA 4M3EA 2FSNA 3CFPA 4AM3A 5E1XA 1NK7A 5K14A 3NMZC 4DV1K 4IDKA 2KBTA 1M90O 4BVPA 4A2BA 1ZBFA 5EXWA 2ECCA 3UKUA 5A0LA 2F2WA 4K8XA 4EHTA 2H8RA 4N41A 5AQSA 3MWMA 1MMSA 2RF0A 1GOAA 3AA3A 1IF1A 4O5VA 4FJ7A 1VQKT 1JL1A 1KFSA 1TUUA 5CK9A 2F5KA 5KYUA 1ORKA 2W03A 3CCJT 3EZWA 1UCRA 4XKBA 4G6QA 2OQRA 3ASKA 1NE8A 4FK4A 3BR0A 1XUPO 3C0CA 4XU3A 1XQOA 1HDPA 3VS5A 4OJRA 4PLLA 3DB3A 4FETA 4F55A 3AT1B 1TWGJ 4M3UA 2KDOA 4M72A 4IHWA 3SAHA 5FPDA 3QEXA 2R57A 2C06A 1XC5A 1VQ6N 2HS5A 5E41A 2F8SA 1N9RA 2BVMA 5LGUA 1UGQB 3WU2C 1L5UA 2HOSA 1X1BA 2VXDA 1WDXA 5JVHL 2MLGA 1X3NA 4PJLA 3S16J 1YI2T 4NCAA 3VYHB 1BW5A 2KI7A 4BREA 2ZJ2A 2LNHB 2DF6A 3SJMA 5CIUA 5F2RA 3MEXA 1LWVA 2CH4A 3ZX0A 4O3MA 2DOEA 1HKBA 2QWRA 5HODA 2GTJA 1N8RO 2KRNA 5B1BH 1K9AA 3KYCB 1M2VB 4FO0A 2Y0SA 3VQBA 1OVYA 4FE4A 4B3AA 3D7SB 4HA8A 1G3SA 3RNJA 2M51A 2ZXWH 2OTLQ 5EVZA 1I1JA 1OU9A 4LF7K 5FLXE 4NCGA 1RI7A 3PTAA 1LNXA 5GAMj 3SEZA 4MTDA 3I0RA 2W42A 5KRTA 1KHCA 1KO9A 2BE2A 2D1HA 1FNNA 1QHTA 3D2EA 5CPRB 2RHYA 1WJRA 2NOGA 4C8KA 2PVGB 1REVA 2YR2A 4J8OA 3FC3A 2LP0A 1Z3XA 4L9TA 3ZCMA 1VSLA 1MU2A 1J9IA 4RTWA 4I9LA 2Y31A 2RQUA 3HM9A 4LN2A 3CC2A 1U48A 2R7UA 4RW6A 4CGFA 4KH5A 3GWZA 4DS4A 3BY6A 4M75B 2WB1A 3EUHA 2H3EB 2EHGA 2RJCA 3OWTA 4OFHA 4CA0A 2DXBA 2LD5A 1GFDA 3E5XA 1Q86U 1IJJA 3OQ5A 5EGOA 1D0XA 2YUPA 2KMUA 1UA1A 3H0FA 1BI4A 1RT7A 3L3UA 1MSEC 4BRLA 4FLVA 3FE1A 1SKSA 4AFQC 4IG3A 3IC7A 3G4SA 3KEQA 4PFOA 5JS2A 2QM3A 4FXDA 3R60A 2ICWG 2GFUA 1ZREA 1IDZA 4O5BA 1TL8A 3E7LA 3H0IA 2HHWA 1SHGA 1BK2A 4C5HA 2JA2A 3ZMVA 3WGGA 1B8IB 2W00A 1O3QA 1QTMA 3CMYA 2NZTA 2K5LA 4WQ5C 3OBWA 1HOMA 2NS7A 3CFRA 3LMMA 3ESWB 2WAFA 5IH2A 1TT0A 2DA1A 1L3SA 5IHKA 1APLC 3AVGA 4L18B 2VGNA 3CC2T 3BR2A 4X9CA 1P4AA 5J2MA 2ZF5O 3SK3A 1YQMA 1R8OB 3SBTA 5CAIA 4FWSA 1QZ6A 1R1UA 3LFKA 4Y52J 3TEEA 1YNZA 4JK8A 1ZUKA 3S9HA 3O8VA 2L01A 3C94A 1TUDA 4MMLA 4OMOA 2ZJPL 3QQAA 2LQ8A 1NLPC 3JB9D 3SBGA 3ZQGA 1VQLN 4ZZDA 2HB5A 1X2MA 3BDUA 4WXHA 2QLZA 5CKDA 1MBKA 2V1DA 3DLGA 4LIVA 1T44A 2D4WA 2O9VA 3T0YA 3CM6A 3G4ST 5AONA 4R8HA 1RL2A 2CGLA 1TWFJ 3ATUA 1O13A 1K0SA 3NGPA 2X6XA 3LGLA 1K4SA 1NU0A 2PQWA 2QTVA 2DEQA 2NRHA 4C0ZA 3I56Q 1YUWA 4J2BA 4GY2B 2IVWA 1G5VA 3JAMK 3VQ8A 2E3HA 2Z16A 3GTGJ 1EBMA 1RPWA 5EDNA 1ZBJA 4WE1A 2RPNA 2DRKA 2R7QA 4DF8A 3HRTA 1ORNA 3CYMA 4NBQA 4EMHA 2R5MA 2DETA 3UA7A 4E7LA 4ILHA 1IB8A 3CUOA 3CCUT 2ZD1A 4RAZA 1HYVA 2NOFA 3E2UA 5KQDA 4M45A 4RB1A 4AIHA 1W6XA 5LY3A 2D9TA 3H0DA 4BDPA 1HW1A 5CVJA 1BL0A 4CCKA 3TTDA 5D6FA 2HQXA 3IH2A 1JJ2S 4ME7A 1RBSA 3SDGA 2EA2A 3U21A 3C2HA 2GOXB 1QVFA 1N34K 5GAN5 3BP8A 1OKJA 3NVMA 1WJCA 3HHGA 4O44A 4ZN1A 2NVXJ 1VQ6A 1QVFS 5CY4A 5E18F 3I8DA 4B47A 3L4IA 4G7ZF 1HR0K 1DQUA 3HSCA 2JOYA 1X69A 2CO5A 5J4YA 5TKWA 3L00A 2DVEA 4AFZC 4A3EJ 3RUXA 2Q1NA 3G0ZA 5M5YJ 4AQYK 3K4CA 1W9HA 3QAHA 1S1UA 1GLLO 3WE3A 4KA4A 4DSJA 2Q2RA 4FK2A 1M1KC 2FOWA 5D5UB 5CKTA 1E6GA 1H8KA 5AQIA 1BU1A 2EZIA 3MZHA 3BZKA 1MJAA 2DA6A 2EPFA 2G8KA 1D1CA 2QWQA 3TL4X 2R5ZB 4M77F 1MKMA 4ON0A 3U9ZA 2O8FB 2RI5A 3NTKA 2L54A 4B48A 1X75C 4RMNA 4H0YB 4JN4A 3EG2A 1SUQA 1YQKA 4B1ZA 3JS6A 2ABKA 2LNVA 3N4MA 3HTRA 2E65A 2VG5A 3MDQA 1P7MA 2W1OA 2P51A 3ENHA 1ON2A 5I21A 5FGMA 1EH8A 3OW2P 1P7IA 3I59B 3J81O 4M6VA 2EB7A 1VQ6T 5J8CA 4JI8K 1O1WA 3BLYA 1MWKA 1UE9A 2CG4A 3HOZJ 1QVGP 2I5JA 3LAPA 1DUXC 1VQOI 1R22A 3HDDA 4KHYA 3O9QA 4GKJK 2QVOA 1Y97A 1A5XA 3QERA 4P5OA 2LREA 2FXUA 3WXKA 3MAQA 1RABB 3GNFB 2AS5F 5LJVA 2DXTA 2JA6J 4EW4A 1L3UA 3FDRA 4J9IA 1MWMA 1Z05A 4H5WA 2QF7A 2HBWA 3L1PA 1I50J 3OYMA 5EG0A 2FJ1A 3M0UA 5C15A 3UE5A 3JRBA 2E1ZA 3AVIA 2EYYA 3CC7Q 3CM5A 2JVHA 4XL9A 5JI6A 3V4GA 3U8XA 2G8HA 5BNGA 3M59A 3F6VA 2L5QA 1B34B 1KJWA 1Z7LA 4M75G 3CC4N 2W4SA 4DJAA 1VOMA 1LWYA 1S9EA 1OJLA 3QDRB 2JK3A 4JHDA 3WVDB 1ACIA 2QXLA 4BI3A 1PVEA 1E17A 4MQVA 1TGOA 2V8IA 2LTOA 4I7HA 5FROA 2XF7A 1RESA 3H1VX 3H5NA 4XIDA 2I7PA 5E20A 2QW9A 4F93B 5DM7F 1R0AA 1WJBA 4XOPA 2ZM6K 4MDXA 2E34A 2FBHA 1AD5A 2A68F 3K4NA 2HNHA 1SFEA 1VYTA 3TOBA 1M4ZA 1QS4A 1AWXA 2D1KA 5K5QA 4CEEA 1VQPI 4LFCK 1T2KA 3ERED 4Z02A 3SNNA 1RI0A 1FT9A 1XGOA 5DM7R 2ZGWA 4ZDPA 1YHQI 1DPUA 3CBOA 3ENBA 1Q95G 5J3BA 3MCPA 5KYYA 3CUQB 2EFWA 4NCBA 3QOPA 2DNUA 4CCOA 2IDOA 3C12A 4RLFA 4BQNA 4A6EA 1K79A 5LHGA 3MCAB 4M78F 4OB2B 4MLHA 1Y7XA 1L0OC 2DA2A 2KTQA 3DRPA 1FXXA 2FD5A 3K5LA 3V7RA 5DYMA 3FHGA 2FYKA 1XGNA 1NOYA 1ZG3A 3FMQA 2CP3A 2W82A 3G73A 2EQMA 2ID6A 4KB1A 2AA4A 2YUSA 3HL2A 5AFUA 2XK0A 1RDWX 2VOOA 2LJ3A 3MECA 3THKA 1TTHB 3E97A 1YTYA 4BJ6C 1OCZH 4CHYA 4BRDA 1WPKA 3D4VA 3L2UA 2OPTA 1A5WA 1IDYA 4ESRA 1YCYA 4PJOC 3IDHA 1PJRA 2R7ZJ 4FJLA 1ENHA 3EGDB 4MMKA 4FZXC 3ABUA 3I55Q 2O8EA 4GO1A 5IOZA 1Z9CA 3OS5A 2FSJA 4IDHA 3CD6Q 1PSFA 1VQLT 1K1ZA 2QWLA 5FPMA 3JSMA 3NF8A 1HBXG 2GUPA 2EFOA 3E9LA 5GAMe 2QZ8A 4GYIA 5AZIA 5C42A 3OYFA 3VF2A 1OH8A 1WNLA 4CGHA 4C1NK 3DYAA 1U45A 1S22A 1TU0B 1UB4A 4JRIA 1IN7A 3FXOA 3QBWA 4OLAA 3QO3A 4M7AD 3F8FA 3SAFA 1KCFA 1RRSA 3CCVI 4JS4A 3E6DA 2R0QC 1Y07A 1RDUA 1NGFA 5TKYA 3TQ7P 4Z2YA 1NKEA 2DMOA 1N5YA 4KH6A 1S9HA 2Z1DA 2IPQX 1WX6A 3QLHA 3P31A 2E36A 2K9LA 4N4OB 4Q47A 2ZE2A 2ZAEA 4B08A 5LD2C 4QSHA 2ZQBA 4FASD 1ITGA 1Y1VJ 3TABA 3S41A 4EPCA 2KZZA 4EM0B 3DLRA 2WSEE 4F17A 3QESA 4A4GA 3LWMA 4CK3A 4LE9A 3EAEA 3AKZA 4BY9C 3L2CA 5BMZA 3KZYA 2MI6A 3RSEB 2A1RA 2K5FA 3HYIA 3X24B 4JUVA 3K1MA 4IO8A 2X9DA 3PQJA 3G71N 2ZXHA 1JHHA 4XLHA 2ME0A 1J5YA 4G1QA 1Q86R 4PFPA 4CZZA 2F48A 4LJZF 4NLCA 2P9IA 3VS3A 1Y1WJ 1BC7C 1DU0A 1KC8R 4R5PA 5BRHA 3M7GA 3FK6A 3VU3C 1J9AA 2XY6A 5M9OA 2GUIA 2IS1A 2E1HA 3SUNA 1WBBA 1B07A 4CFAA 2Y4YA 2NAZA 4PWDA 3OYBA 3SMSA 3K4KA 3O9RA 4OMFB 2O3FA 2DTUA 3LM9A 1TP4A 1M90C 3CC4A 3EYYA 3GBTA 3K58A 2EBIA 3MVPA 4BNCA 2YWWA 2HYFA 2FOKA 3TW6A 4LK0F 1N27A 3V7CA 2PUOB 2NLXA 1WJDA 3FM5A 3BTLA 4LK1F 1K83J 2OZMA 1V55H 1YI2Q 1S1XA 4PJOA 4ZDOA 3LALA 5EU7A 3O1WA 3TTCA 4C9YA 1VQ5I 2NLUA 4CERA 2VCPA 1YWPA 3BEXA 3MX2A 3OIOA 5IXFA 2FX0A 2AHQA 4C92F 4U87A 3EHQA 4A0ZA 4BROA 1VYVA 1XMXA 2LX9A 1RT1A 3C7NA 3V9UA 4Z4GA 5AIQA 2WFBA 3OJSA 3J81K 4KBOA 3CCQI 3C2GA 1IKXA 1S29A 1AU7A 4M4ZA 1O7FA 2XRLA 1SVOA 4M7AB 2KRFA 3I9QA 4F7UF 4HLYA 5D5VB 1IRGA 2IXSA 4EMKC 3AVCA 2X4WA 3DXMA 2OANA 2JM8A 4PL6A 1HKCA 4AIKA 2P9LA 4GVEA 4CYDA 3PFYA 1IV6A 4EDUA 3C6UA 2E2QA 5LJ3f 4O6JA 2RHXA 1VF9A 2VC0A 3CC4T 3IHOA 1NBWA 4M6XA 4PIIA 3OH6A 2NWMA 4Q48A 2Q36A 3ZOBA 1VQ7N 1N8RC 4N0AC 3A8OB 1I6XA 5F1JA 4OKEA 2ZJQL 4EV0A 2Y9YA 1RCHA 5HDNA 5KGXA 1Y71A 1WH7A 2A36A 3BY5A 4LUEA 2XVCA 4XK4A 4CGJA 1XSVA 5HP1A 2PZSA 4CF0A 3NMUA 2Z3YA 1NJIO 3TTFA 4RW9A 2LQWA 3RPUD 2AK5A 3DLLA 5GAGP 1YX5A 5ILSA 3OYGA 2ZPFB 1KAZA 2EYZA 4DOZA 1WSIA 5D4RA 3TSWA 1ZQ3P 1BIZA 3J80E 4CUGA 4B3OA 4N47A 3EE8A 5JFRA 1ASUA 3L4QA 4GFBA 2DY4A 1T03A 3V42A 3WEEB 3N4QA 3CCSN 2ZCWA 1R00A 3D0PA 5BS6A 4WCEL 3S15J 3QODA 4AU7A 2AHJB 3QOEA 2G7HA 2E19A 2GM4A 1HJOA 3WGHA 3BY7A 2NOIA 1Z3YA 5BPDA 4IQJA 1MDMB 2NOLA 1IHVA 4XMYA 3W6KB 3QYBA 2GWJA 2BZ8A 5HK0A 3CC2Q 2BTFA 2F4MB 1IC8A 3OYJA 5KI6A 2KZMA 2HGCA 3NGYA 2Y1JA 2RN8A 3OYIA 2KIMA 2QEXQ 4ENNA 4F9OA 4BQAA 1JLAA 3QRFF 2A3LA 1FMKA 4UB8C 1M3CA 1M2OA 3HRGA 4E0DA 2YHTA 2GA2A 1NGEA 2Z1IA 3ZMDA 1SANA 3IKMA 2QM1A 5LBQA 2RD1A 4LXCA 5EEHA 1BQMA 1ZSZB 1IXDA 1W5TA 2ZPHB 3M8EA 1UGRB 1N33K 4MFEA 4FOIA 3OJUA 1N5ZA 4ZTFA 3G4SQ 3SXYA 4LDVA 2XASA 1RZ4A 2CQ7A 1EA3A 3EYIA 1YJ9N 1MMGA 1RT5A 2KXDA 1NGNA 3JTGA 3UNGC 2COYA 4DQSA 3GZNB 4R55A 1V76A 1CKBA 4M7DE 5HLGA 1XC9A 4AHCA 3TSPA 3M5RA 4DYCA 1WWXA 4LNPA 1MIJA 4M3GA 5AZJA 4S04A 2CUEA 4BQLA 3QNNA 2VUBA 1SG5A 4BEHA 2LF7A 1LAWA 2DTOA 1FN7A 3IKVA 2HHQA 3G71A 4RDUA 2G7UA 2CW7A 4DEYA 1MNEA 3HI0A 1WLJA 3O6WA 3CTAA 4IF4A 3CCUQ 1H92A 1DGRM 2E1OA 1WJAA 3CCLN 5FLVA 3KIOA 2A37A 4HKEA 4P9FA 4E6RA 2NRZA 4N0AA 1ZELA 4U0WA 1GVJA 2V6CA 2O8CB 1FY7A 1IN8A 1P8ZA 1VQKI 3FK7A 1MV3A 5LHHA 2DFIA 1BKBA 1Z9ZA 1VFCA 4B8AB 3CCJI 3J7AF 3M07A 3WTWC 2JTVA 4LF4K 1SD5A 3DLEA 1JKQC 4Y7NJ 1QCNA 3QU6A 3GFLA 2DPPB 4JAXA 3IWZA 3SPYA 2X6OA 1GLNA 4E6KG 3S1RJ 4LD9K 1MH4A 2KISA 2PAVA 2JTEA 4E9GA 1EFNA 3QYFA 4EM2A 1GHCA 2IEKA 3EUKL 1FYNA 3G1LA 1TWCJ 5EEGA 1O3RA 3ASNH 3W6VA 2V8KA 5EJCA 3HUGA 3IV5A 1RDBA 2YPRA 4A53A 1VQ9N 4R0KA 2X48A 2QBYA 1YI2I 3G71T 2KK4A 3LWFA 3L2ZA 3VSLA 1TQIA 4RGSA 1Q9YA 3CJTB 1OCOH 3KP2A 2DX1A 4L5EA 2UYTA 2FBYA 1A35A 3ML6A 4YOQA 2R5AA 4M77B 3HTVA 2YJFA 4G9ZA 3PX4A 4DV5K 2EKOA 2LP5A 2OQGA 4ENJA 3CJ7A 2HF3A 5GAN2 3NBPA 1KU2A 3GE1A 1T38A 3SUOA 3B6CA 5J2PA 3H36A 3ZFJA 2K2MA 3F5TA 4BQQA 3FIWA 2BKDN 4JRPA 4LH4A 3A5ZB 2PFUA 3Q3SA 5CVVA 4XIUA 3M56A 2HVHA 1VQ7A 2YXYA 4FJ9A 1X6GA 4M7AG 4BUGA 4DSLA 2E1MB 2KFDA 4CEQA 4BB7A 1CF7A 4M7DD 4HUEA 3CCMQ 4IQ4A 3GTQJ 4O8UA 1FW6A 1ZUYA 1VSMA 3AL0C 4ID5A 2ENMA 2ESNA 5H2FC 4YFXF 3QEPA 1RTDA 2WUSA 3E66A 2W84A 3MN9A 4CHOA 3S6WA 3ZBDA 1MW7A 5K5OA 4D6WA 2RPIA 4J7IA 3A2FA 3CWUA 1LVKA 2BXYA 5K5RA 5KNLA 2VKDA 4H5VA 2OI3A 2M9UA 3KX2A