4E7LA

Pfv integrase strand transfer complex (stc-mn*) following reaction in crystallo, at 3.0 a resolution.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7lA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7lA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7lA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7lA03
3PFSA 1ZBUA 1N5YA 1X9SA 3KIOA 1JL2A 2RF2A 4JLHA 4M41A 4CF1A 3MXIA 1U49A 1FXXA 3QKJA 4I7FA 1NK7A 3WNEA 5I42A 2D9TA 2GFUA 1A5WA 4DTUA 4ID1A 2B6AA 3IG1A 3QLHA 3PMTA 4G1QA 3U3YA 2E6NA 3VQCA 5CZ2A 1YTAA 2FBVA 4B8AB 1XHXA 3ZCMA 4IKFA 3SJJA 4Z4CA 3TAPA 3HK2A 4M3WA 4FJ7A 4CHPA 1J54A 3TARA 3K2PA 3P8HA 1RT2A 2D5RA 3ALYA 3IRXA 4CF0A 4CHYA 4RW8A 1JKHA 2Y1IA 4W5TA 2XY7A 1JLCA 1NOYA 1WSEA 1C1AA 3ZSYA 2X6SA 4B9VA 3PX4A 2RHXA 1KFSA 1BIUA 1EETA 4CJPA 3SI6A 1NJXA 4FJIA 4M3XA 4IURA 1S1WA 3VQBA 4NS5A 1TGOA 3AVLA 4CFCA 4KHWA 2GV9A 3SQ4A 4ELTA 3AVGA 1NK4A 5JS2A 5KE2A 2QXFA 4H4MA 4KKOA 3OYAA 4DMNA 1EKEA 3O4NA 2O4IA 3LAMA 1YT3A 3HPHA 4OGCA 3FDRA 3V9XA 1NK8A 3TAFA 4O44A 5HBMA 4EP5A 3S9HA 3LDSA 4PLLA 3HP6A 1HJRA 3UT1A 3DRPA 5SWMA 3QNOA 1A5VA 1U4BA 3HVRA 4CEZA 1F21A 1DTTA 1NJWA 2XY5A 2CKKA 1DTQA 5HRSA 1RTDA 1VSLA 1GOCA 1HPZA 2BGGA 2YHAA 3O3HA 1ZYQA 4EZ6A 3E9FA 3MXMA 4PUOA 4E7LA 5D6WA 4IUUA 3VQEA 4EZ9A 3ITHA 1WJQA 4FXDA 4C5HA 2X4WA 2OPQA 1HYZA 3L8BA 1RTJA 4CGIA 4HCCA 2VWJA 2YNIA 4CJ3A 1J5OA 2PYLA 3AVMA 4FJJA 1RILA 4FLVA 2VG6A 3M8PA 3D45A 3WNHA 4E3SA 2BANA 1IKYA 4L59A 3T1AA 4CFBA 3PX6A 3NF6A 5C6SA 1QE1A 1KSPA 2LCCA 4FM1A 1KVCA 3EYZA 1BL3A 4CEQA 4PWDA 2HQEA 3LYIA 2YNHA 3CM5A 4DTNA 1L5UA 3MEUA 2EQUA 4PLIA 1Z25A 2HQXA 3ME9A 4BWMA 4CERA 4NCAA 3OA6A 1RTIA 3SCXA 1BCOA 3L42A 1GOAA 3SD4A 3OYCA 1W0HA 3DLEA 1KVAA 3QIPA 3U3GA 4Z4HA 4CF2A 4OPJA 3SV4A 1S1VA 3KD5E 4QOZB 3P1GA 4CGDA 2PYJA 2XO7A 4KRFA 2HHVA 2G8VA 2HHQA 1C0TA 1C0UA 1ZBHA 2WONA 1C0MA 3E01A 3I8DA 3VQPA 5KE3A 3L2WA 1BI4A 1ITGA 3LPTA 3LGLA 5T7BA 3SUQA 1Q9YA 4CFAA 3ASKA 4M3YA 4O5BA 1OI1A 3OB9A 2KZMA 1LWEA 2Z1HA 1QSLA 1NK5A 3PMIA 4CRIA 3OYLA 1NK9A 3AVJA 1QSSA 2BDPA 3LZIA 5KGWA 4OJRA 3RMBA 3DOLA 4N4GA 3K57A 3S3NA 1HQEA 3KUFA 4N41A 3QBYA 2JGUA 4HCZA 3NGYA 4CJSA 2ZQBA 4QVZA 4RW9A 4E19A 3RRHA 4FW2A 1JXBA 3HM9A 3LP1A 3V9UA 1NKEA 4FYDA 5CYQA 1B9DA 2A1RA 3V4IA 2QQSA 2EQKA 3CEYA 1B92A 3P83D 4CJUA 1REVA 3DMJA 4O55A 4C8NA 2KZZA 3VQ7A 3LAKA 2E5QA 3K59A 1TKZA 1BHLA 3EZ5A 3V81A 4CHQA 2X6NA 1SL1A 2G8KA 3DLHA 1BCMA 1O1WA 3UIQA 4B8CA 4ZTJA 4N4IA 4Z02A 3LP2A 3T3FA 4RG2A 1TKXA 1NK0A 1HYSA 4XIUA 4DU4A 1XI1A 3BGRA 4FJXA 3FC3A 5FRNA 3THVA 1JLAA 1XHZA 4CIFA 3TAEA 3TR8A 4DTJA 3S3MA 2FC0A 1LAWA 2YKMA 3C6TA 1L3TA 4CEDA 2PQWA 2HB5A 1KLMA 3ZSXA 3QEXA 1SSFA 1NOZA 4ZTFA 2YNGA 3AO1A 4I9LA 4DTSA 4KI4A 5J2PA 2HNYA 3H8ZA 4KHQA 2X4YA 4W5OA 3TANA 2P1JA 1RT3A 5J2NA 3HJFA 1OZ2A 4FL6A 4FM0A 4DTXA 2YRVA 4ID5A 4RW4A 3I0RA 3LX7A 3CFRA 4F3OA 3RTVA 3ULDA 2RPIA 1HYVA 3V1RA 2P51A 3OS2A 1KVBA 3LWLA 1NJYA 3WNFA 4E7IA 1CXUA 3OS0A 3AVBA 4HUEA 4Z4IA 4J2DA 2DFFA 3OY9A 1NJZA 3NGIA 3AA2A 1OYXA 4X34A 2LDMA 2LRQA 1WSHA 4O0JA 3BDPA 2G8FA 3ZSOA 4GY5A 3DYAA 5CZ1A 2HMIA 3BDLA 5FRMA 1ZBFA 4AH9A 2X74A 2L3RA 3DOKA 1T05A 1S9GA 4HTUA 3KD1E 3HO1A 1RBSA 4LSNA 3M8RA 3PUFA 2F8TA 1X1PA 2RHYA 3RMDA 2X78A 3B6PA 2EQMA 3QEPA 4CEBA 3H6ZA 2EQJA 1CZBA 3DLKA 3QESA 3QNNA 3LANA 3ISNC 1LW2A 4YNQA 3M8QA 1Y97A 4IUVA 4CHNA 1WAFA 1LWFA 1TV6A 4AHSA 4CK2A 4FZYA 3IS9A 2DY4A 2EKOA 3NFAA 3L2UA 4KHNA 4FZZA 4BE0A 5C24A 3LGFA 3K58A 4FK2A 2FBXA 4CGFA 1X9MA 2GF7A 4AHUA 1N27A 4CF9A 4CJKA 4FK0A 2RJDA 4FW1A 2PY5A 3RR7A 3OYFA 1YVUA 2YKNA 3B6OA 3L3VA 3OVNA 2ITGA 4LY7A 1RT5A 2MWPA 4OPKA 4HUFA 1FKOA 3MXJA 2E6LA 3NBPA 3LLRA 4M3TA 4MFBA 2KFZA 2LVMA 1S1XA 2QKBA 5KRSA 1U48A 1ZBIA 3T19A 4OVLA 4M3ZA 1RT4A 4DFPA 1LV5A 4N76A 3K5MA 3MP1A 1RT1A 1S1TA 4DSKA 4PQUA 4B9UA 1N6QA 4BE1A 4C5GA 1MU2A 2I5JA 4Y1DA 1T8EA 4HVJA 3FLGA 3MEVA 1T7PA 1G15A 2GBZA 3OQ5A 4C5EA 4IFYA 3EAEA 1SL2A 1RT6A 3G10A 2AJQA 3AV9A 3SQ2A 4E7HA 4LSLA 3AVFA 2RHZA 1BI4B 2FBYA 3KK3A 4CJEA 3TABA 3AVCA 4DFKA 3C6UA 3V1OA 2A1SA 4HCBA 3K5LA 1XWLA 3L2RA 1VSDA 1S6PA 2F96A 4AILC 1Q8IA 1QSYA 3AVKA 1UWBA 4KB1A 1OZ3A 2PZSA 3META 5KCOA 3KLFA 4KO0A 3A2FA 2OA8A 2RI3A 2D0CA 3DRSA 4FLUA 3VA0A 4E0DA 4IDKA 1C1BA 4DTRA 3NTKA 3HL8A 5C25A 4CECA 4DSEA 4BWJA 1WNSA 1A5XA 4DS4A 1GOBA 2Z1IA 3FFIA 3NH1A 1NKBA 1KRPA 4FJ9A 4CJ4A 1WSFA 3OMGA 2OYQA 4EP4A 4DSIA 1JLFA 4LD0A 1UAXA 4DTPA 3MO8A 2DIGA 3QEIA 3M9QA 3OYNA 3P5JA 3SUNA 4CJWA 1CLQA 3SPYA 2B8AA 4TSXA 3ZT4A 1TL3A 3KJVA 3KK2A 5CIUA 4DQSA 1WSIA 1WN7A 3VQDA 2HHSA 1IH7A 4DSFA 1BQNA 2Q3SA 4E1NA 1SL0A 4I2QA 3NNQA 1HQUA 1I39A 4KTZA 4KFBA 3ZSRA 4K8XA 3OMCA 3DB4A 1J9AA 4OGEA 4B9WA 3SUPA 2F8SA 1S1UA 1VRTA 4QW2A 2ETJA 1NKCA 4J2EA 2LSNA 3G0ZA 1RDDA 1VSKA 3KTQA 3VQQA 3VQAA 5HLFA 3PY8A 1ZBLA 3V1QA 3TAQA 2O4GA 2B4JA 2VG5A 3NDKA 3RMCA 2EFIA 4II1A 2HHUA 3OYIA 4ELUA 4DU1A 1BGXT 4B9TA 1LAVA 4KV8A 1MHNA 4HHTA 3RR8A 3AO4A 1UA0A 2DFEA 1I3AA 4Z4FA 1G5VA 4CESA 5J1EA 5J2MA 5FDLA 1ASWA 5SZTA 4PL6A 1KCFA 1RT7A 4FLWA 4DFMA 3Q1JA 4N4HA 1KFDA 2R5MA 4KHSA 2IDOA 3CG7A 2X35A 3AVHA 2XY8A 5KRTA 4KAZA 1TVRA 5HP1A 4IG3A 1JLGA 4B9XA 1JXEA 5C42A 2YV0X 4DQPA 2GUIA 4FJLA 2EHGA 4BACA 2RKIA 3HSTB 4M3RA 2RJFA 4CEEA 1W9HA 4YFUA 3CM6A 3RRGA 4ICLA 4LH5A 5D3GA 2IC3A 2VWKA 3CFPA 2E6MA 4FJKA 4IUTA 4OKJA 4CGHA 3HPOA 3NF7A 3HPGA 5HRRA 4B08A 2RO0A 3DLBA 3QIIA 2YNFA 3MECA 4B9SA 3L2VA 2DIQA 1SV5A 2VG7A 4DSJA 2KFNA 4K8ZA 5C0MA 1JLQA 3H08A 4KTQA 4OVAA 1XNIA 2K3XA 4PA1A 3V9WA 3FEOA 4OLBA 2P0KA 4CJQA 3LP3A 2F5KA 1RI0A 2G8WA 4C8LA 1JLEA 2G8HA 3HVTA 1VSIA 4C5IA 2WOMA 3F9KA 1DLOA 2OPRA 4E7KA 3C94A 2IAJA 1VSMA 4CE9A 4ZHRA 3ZT0A 3V9SA 3OYEA 2RN2A 4DU3A 3QERA 2XK0A 3MEGA 5EU7A 4Z4EA 4B9MA 3MEEA 4R5PA 3OYGA 1WJSA 2R5AA 5HROA 1JLBA 4IUPA 3ZEHA 4QQDA 1FK9A 2RHIA 3K5OA 1B9FA 4Z4GA 4AHCA 3DM2A 4HUGA 2HHTA 2ZE2A 3F70A 5JS1A 2B5JA 3KLGA 3SPZA 2GFAA 2QKKA 4NYNA 2HNDA 4J2BA 2L8DA 4FJ5A 2HW3A 3NAEA 4FK4A 2NUBA 4OLAA 3OYDA 3U6FA 1SKWA 3IAYA 1HRHA 2L89A 3AVNA 4CIEA 3KK1A 5KGXA 4DLEA 3DLMA 3SNNA 1L3VA 4FJ8A 3OYMA 4PY5A 1BISA 4CHZA 4CEOA 2HVIA 3MEDA 1WJRA 4F3TA 4FM2A 4CFDA 4DQIA 4UC4A 4Q0BA 3SV3A 1WSJA 4IBNA 1TAQA 1VSHA 3PO4A 3MP6A 4CIGA 1VSJA 4KTWA 4IG0A 1IKVA 4F2SA 3ZT3A 2BE2A 5D6YA 4IFVA 4AHVA 3SQ1A 1D5AA 4CJTA 2G8UA 2M16A 4GMJB 2HHXA 4FJGA 4NCGA 3ZSZA 1WAJA 3AVAA 2MWOA 3DLRA 3VQ9A 4CK3A 5HRPA 3LWMA 1TK0A 2XDPA 1KLNA 2OZSA 1J53A 1VK0A 3AVIA 3ASMA 3L3UA 3MP8A 1FKPA 3QETA 4ELVA 4C8OA 4M3UA 4DFJA 3OJSA 4DSLA 4F8RA 1IKWA 2R58A 1L3UA 3RMAA 4E1MA 3NH2A 2Z1JA 5CYMA 3JSMA 2G8IA 3DB3A 2P5GA 1WGSA 1SUQA 1RBVA 3OYKA 1TKTA 2OPSA 4CF8A 4FLXA 1TK5A 1D8YA 1S9EA 4CJVA 3NF8A 4A4EA 3OYJA 2R7YA 3V9ZA 2DTUA 2HHWA 4DTOA 1BIZA 2BKDN 1VSFA 1L3SA 3PNWC 2XY6A 1K6YA 3DRRA 3M8SA 5KCHA 4OKKA 4CJLA 4UQGA 1TL1A 4DQRA 4EDUA 2D0BA 4E89A 3ZSQA 3CFOA 2VYTA 2HNZA 4QAGA 1RBRA 3VQ8A 4N56A 3LZJA 2KW4A 2IS3A 4FCYA 4CJRA 4CHOA 1RBTA 1SKSA 3ZSWA 4BDPA 2RJCA 4N47A 4W5QA 4FJHA 3QEVA 4J2AA 2YHBA 1WSGA 3AA4A 2X4XA 3ZSVA 4CGGA 2RHUA 1RDAA 4H8KA 2XHBA 3TAGA 2D0AA 1VSEA 2HVHA 3E9GA 1VRUA 3O8VA 3SUOA 1YTUA 4NCBA 3NE6A 3KLEA 2P5OA 1LWCA 4FVMA 3AA3A 3AO3A 4MQ3A 2O4XB 5IN1A 4DWIA 4KB0A 4OKEA 5D6XA 5J26A 1TK8A 2BUDA 2RI5A 3HP9A 4DQQA 3QJ6A 1QQCA 1ASVA 3O4QA 4C8MA 4DG1A 4KPYA 3NHGA 2RI2A 4IUQA 4FU6A 3EY1A 4GVMA 3QINA 3OYHA 3K5NA 4FJNA 3I0SA 1CZ9A 4A4GA 3CYMA 1EP4A 1JL1A 4LD6A 3KLIA 4RW7A 3OYBA 1QS4A 3SZ2A 2OZMA 3NCIA 1U45A 1RCHA 3NH0A 3KKSA 2KTQA 4BDYA 1U04A 1RDBA 4RW6A 3RWUA 1IO2A 3S6WA 4WE1A 1RTHA 1NK6A 4F2RA 1EXQA 2ZD1A 4CGJA 3F73A 3NTIA 4BDZA 2K3YA 5KI6A 1QTMA 2Z1GA 3DLGA 3SQ0A 2OPPA 1C1CA 1WLJA 2IGIA 2KQ2A 4DF4A 3HYFA 4KHYA 3SYZA 3QIOA 4F4KA 5HRNA 4QQ6A 1Z26A 5K14A 1ASUA 2LTOA 5E41A 2M0OA 4A4HA 3O3GA 1RNHA 3UWNA 2BIVA 4Z0UA 4Q5WA 1BQMA 2IOCA 4I2PA 4DS5A 2DAQA 3LALA 1D9FA 1UOCA 2FHDA 4KREA 4BD3A 3P8DA 2M1HA 4NYFA 1CXQA 4CEAA 3OJUA 5FROA 4JS5A 5I3UA 1U47A 4KHUA 1IKXA 3V6DA 4QQGA 4CJFA 4C8KA 4Q5VA 1C6VA 3KLHA 4JRPA 4FLYA 3TAMA 3MEAA 3WNGA 1HNVA 2EX3A 3LPUA 4W5RA 3CQ8A 1X9WA 4FLZA 5M9OA 5CY4A 3L2QA 3O3FA 4JRQA 3VA3A 1D9DA 4AHRA 3HT3A 4M45A 2JTFA 3VN5A 4CK1A 4QCLA 3NF9A 4GW6A 2NLUA 3AO5A 1LW0A 5KTQA 1TKDA 2XRIA 1EX4A 1SKRA 3C95A 2WACA 5DMRA 2QK9A 4RG8A 1XC9A 3TI0A 2DFHA 3TWHA 4JS4A 3AO2A 4Y1CA 4DTMA 5KH6A 2G3RA 4O4GA 2O4XA 2E4LA 2Y1JA 1H3ZA 4KI6A 1TAUA 3KKRA 3LH0A 2RJEA 3MEWA 2IG0A 4LH4A 4AHTA 3C4SA 3QEWA 3NTHA 1UA1A 1QHTA 4B9NA 3VQ5A 3PO5A 1IG9A 4FJMA 3D0PA 4E7JA 4H4OA 4FLTA 3OS1A 3ZT1A 4DLGA 5J2QA 1S5JA 2W42A 4A4FA 3JYTA 1KHCA 3HXMA 4B9LA 2FBTA 3DI6A 1RBUA 4NZGA 1T03A 5J39A 2JZ2A 2R57A 4CJ5A 4I9QA 3LP0A 2ATQA 1RDCA 4DF8A 5DK5A 4CEFA 2QQRA 4L8RB 4B3OA 3GOXA 3PX0A 1KTQA 4O0IA 4N5SA 1HNIA 3NGZA 1Q9XA 4FZXC 1HMVA 4W5NA 3PV8A 1R0AA 2JLEA 3VQ4A 3QO9A 4M42A 3MAQA 4BE2A 3ZT2A 1S6QA 4CCHA 3AA5X 3S3OA 3VQ6A 5IAYA
chains in the Genus database with same CATH superfamily
3L7WA 3KIOA 4JLHA 2XU8A 5HS7A 1HU0A 1KC8R 2E6NA 5DCMB 4RMNA 3S17J 3WODF 2K4YA 3SI6A 4OB2B 1TGOA 4C1NK 2KE9A 3O9SA 1XB4A 3JAME 5BPMA 1TL8A 4CHUA 3GP8A 2DJNA 4H5TA 3HBLA 3G4SQ 4EW4A 5AQIA 5HRSA 1FTTA 3CC2N 2P9IA 3MXMA 4DBHA 4UNOA 2HDDA 2VT3A 2UUAK 3H3NO 1ETYA 4HAMA 2YRCA 3FXLA 3LNQA 1N9SA 1ETXA 2DD5A 2ESHA 1APLC 3A8GB 4L0ZB 1BL3A 3LW5E 4BWMA 4PCQA 3SV4A 3CMEQ 3UDCA 4XMYA 2YLBA 1PYVA 3HZJA 1WOQA 3GCMA 2E3HA 4AYBN 2YUOA 1NZ9A 3GFMA 3CC2T 3AVJA 2BDPA 1OR7C 1G4DA 2OX7A 2COWA 1NKEA 2ETHA 2JUGA 4C8NA 2UV1A 4J7IA 2WTEA 1KQ8A 4LDYA 3OS5A 1Z6TA 3R0AA 2GA2A 4HSRA 1CF7A 5FRNA 3QHSA 2A0FB 2AP1A 4XU3A 1YJNQ 3OV8A 2Y69H 1O7FA 3S2HJ 5HKCA 1R9TJ 4EQQA 1ACIA 4E7IA 4HF0A 1SKUB 3SLCA 3OY9A 4X34A 4HPQA 2G8FA 3AL0C 5FRMA 2QZ8A 4AD9A 1YI2Q 2ZMEC 4LSNA 4LF4K 5FKOA 3GW2A 4EPCA 1YJ9T 3TEDA 3K0SA 2FSWA 5KK1A 4FZZA 3GYHX 3WE3A 1OVYA 2FBXA 2Q2EA 1E3HA 1TOVA 1DGKN 4AHUA 1I94K 2ITGA 3ZCOA 2RQVA 3JB9G 2E1HA 4EATA 1S1TA 5CJ9A 3RCOA 2NUTB 2BHZA 3F0ZA 4RTXA 1W4MA 3G10A 1LNXA 4CBWA 2QDYB 4HNUA 2B9SA 1UWBA 3VYUB 2ZJ2A 1G99A 2A6AA 2ASOA 1Z7LA 3FF5A 4B23A 1U3EM 2JTEA 1JT6A 5BR9A 3WEEA 3ZMTA 4IX7A 2FX0A 2NRWA 2E5NA 4M77C 3DB4A 2E4HA 4QW2A 4PJMA 3GLXA 2K2VA 3KTQA 1TYQB 1ZBLA 1VQOI 2B4JA 2DQRA 1STZA 3TL4X 1UHSA 4MFDA 2KNBB 3VWBA 1KCFA 3URGA 4FWKA 3QUIA 4DV5K 3GBTA 1JGGA 3SBTA 3BDDA 3NVKA 1QW1A 3CXCS 2LF8A 4KFCA 2IC3A 2XD0A 4AC0A 1WJFA 3DLBA 3CJ1A 5EZHA 3WVDB 1Y7XA 1BOBA 1RI0A 1G2HA 1MMDA 4HLXA 3VUBA 4E7KA 1DPUA 3EG0A 1VYVA 3K5OA 4N9IA 4I98B 2A07F 2DEUA 1R1VA 2QKKA 2VKEA 1QRYA 2EW3A 5DM7R 2HS5A 3OYDA 3IAYA 5KPZA 5H6RA 3J80K 2DCEA 1VRLA 4FM2A 1XC3A 3ZR8X 1BW5A 4L9VA 2JWKA 1Q86U 2VXDA 2G8UA 3HOZJ 5HRPA 2MLKA 1ARKA 3L0QA 2A37A 4ELVA 4A3JJ 4JKCA 2L3DA 4C8OA 5HNFA 3CCUA 1RAFB 1MGQA 1Y0NA 3NF8A 2R7YA 2BKDN 3ID6A 3JCMh 2YX4A 1VQ9A 1NLVA 3VEOA 1NGHA 1WI9A 2QBYB 3CFOA 2Y48A 2O8CB 1RBRA 2V26A 4AIAA 5AQVA 4EMSA 2IS3A 1RRSA 4HX4A 1SKSA 2RJCA 5F27A 2FPFA 5I3UA 1G3TA 3SMPA 2RHUA 1MSEC 5GMKe 1ZBJA 2DOAA 2JJ9A 2DNUA 1J6ZA 4FVMA 3CVTA 4ZZLA 2DYIA 3QJ6A 1IN6A 4C8MA 4IUQA 3QINA 3K5NA 3OBYA 1CZ9A 2NYSA 4J9FA 3KLIA 2JSCA 3OYBA 4IIOA 2KYBA 1HW2A 3KWGA 1IXDA 2KBTA 2XSDC 1WJAA 4LLLA 3HYFA 2VBWA 4MO5A 3F6OA 1ZSZB 3CCSN 1SVLA 4JI8K 4CEAA 3H0FA 3T0YA 2NNWA 1PHTA 2X6OA 4JRPA 3UB5A 3CCLQ 1BA5A 1YIOA 1QPIA 3OGDA 3AO5A 3I59A 2UUCK 1QQIA 4WCIA 4IWVA 1K4TA 3SEZA 3LH0A 2JRTA 2XF7A 4ZYHA 2EFOA 2DK8A 3SDBA 4OMMA 1ZYRF 3CCST 4XQFA 3HXMA 3JB9I 5KN9A 1K73U 1WCMJ 2MD5A 2WA0A 1BJZA 5DM6L 4FL9A 3PX0A 3CMEN 3NGZA 3VOVA 2G6FX 2FL7A 3VQ4A 1D5VA 1N3CA 2E35A 5GAMh 5IAYA 4A3KJ 1A5WA 2K9SA 4C92B 1WX6A 3G4SA 1YTYA 2CUFA 5KYWA 4OMLA 3CCMN 4CF0A 5I11A 2LQNA 4QPQA 2L0KA 1C1AA 3A8MB 2WAQA 1R4NB 1S1WA 3RI4A 2RQRA 4CCNA 5LJ3e 4J9DA 5GMKm 2LMDA 5LJWA 1FOYA 2VWBA 1YHQA 1YT3A 3G6EQ 3WE2A 1N8RR 2FQ4A 4ISGA 5GAN2 3ABUA 3I56I 3H3OB 1UCRA 3ZMDA 1S72A 5BN8A 3ITHA 1M4ZA 2X4WA 2L4AA 1K73C 1FTZA 1M90O 3ENBA 1K4SA 1J5OA 4I2OA 1M90U 4PJOE 2O88A 1IDYA 4CFBA 4L59A 4BQNA 4FSXA 4JYAK 1FJGK 3CM5A 4Z6YA 1ILYA 1E7OA 2R3SA 4CF2A 2MI6A 3CCSA 2NVTJ 2MC3A 5MLCQ 3UKUB 4HG2A 1UGVA 1LCKA 2P7VB 3G2BA 4BR2A 2NOZA 3AFHA 1KXPA 2ROLA 3QWYA 4C0DC 2CW8A 4J00A 4E47A 5KGWA 2DMNA 3DBLB 1W2BP 3CETA 1ZG3A 3Q7CA 4M78B 1IJWC 4DZJA 2ZQBA 1EWQA 1B9DA 1IN4A 3P83D 2BGCA 4M75F 1I6XA 3VQ7A 3K59A 1I6HJ 2DJQA 2V79A 3KP2A 2V52B 1S72Q 4XKCA 4R8HA 4N4IA 3LP2A 1TKXA 1A31A 4EFHA 4WX9A 1WXTA 1IF1A 3FC3A 4RLFA 1K9MR 4DTJA 2FB7A 3VW4A 3W2WA 4ZTFA 2HEQA 3HTSB 3A5OC 3WHCA 4IXAA 3ZMZA 4FPAA 3CCQT 1C0WA 3D7SB 3HHTB 1ETVA 1U6ZA 1QZYA 4CUGA 3CCUI 3C7NA 1VQ5N 4ENNA 3VSKA 4BQZA 2BOLA 4ZZDA 3IWFA 2X78A 2EQMA 1Q82U 3J81K 3RJPA 1WAFA 3IC7A 4QS8A 4FZYA 4G7ZF 2JT1A 4PDKA 3CCLT 2HGCA 5DPKA 2RQWA 3CCQA 1A04A 4ISFA 5LJ5g 1IAWA 3NBPA 3ASOH 4JK1X 5KRSA 3CMAA 1GHCA 2CQXA 3S2DJ 4PQUA 4B9UA 1UHCA 2DRKA 3WXJA 1WJBA 5TGTA 3GBQA 3OQ5A 3TBIA 3K6GA 1OEBA 5CVVA 3V42A 1H89C 2BW3A 2I2LA 4KB1A 3A2FA 1RNLA 2EYZA 4IJNA 4XH1A 3VA0A 5C25A 3LWIA 2RNAA 5FWBA 4DYCA 4EP4A 3GTLJ 2V4JC 1SFKA 4LJZF 1TL3A 4OIRF 1YIJA 3WHBA 3QPSA 4F7UG 1SL0A 3NNQA 3F10A 4OGEA 3HXLA 5AQRA 5H6QA 1UG2A 3AG2H 4IHSA 2J6FA 4AM6A 2VXZA 3DAWA 3EDPA 1BIBA 1GDTA 3EFSA 5SZTA 4JYKA 4WCGA 4K2EA 4KA4A 3AVHA 3KVGA 2CW0F 3MN5A 5B8HA 5FW9A 1LOTB 1HX1A 1PRMC 3K1MA 2XGDA 4CCOA 4S05A 1YHQT 2HZYA 2EQRA 2O5RA 3M53A 3FMRA 5AJ3K 3CC7I 4O3MA 3R8EA 1JLEA 2KMTA 1UEBA 4JKGB 4M7DC 2HEOA 5EU7A 4BRKA 3MEEA 1QU3A 2W1OA 4IUPA 3L6QA 1LE8B 3WU1B 1OULA 1RR7A 4JI3K 3ENOA 1MA9B 1T98A 2HW3A 4HF1A 3QU6A 3ABMH 2ELJA 1BBZA 2LNBA 1HDPA 4YIIA 1OISA 5FLXK 3NGPA 2KZGA 5GAGJ 4WWCA 9ATCB 1UB4A 4H5WA 4M3BA 4HKEA 4IFVA 3ERED 4AIHA 1H0MA 1U78A 5TKYA 4JJDA 2QEXT 4JJBA 1QVFP 1VQNT 2OAUA 3JSMA 2PJPA 2Y9ZA 2AZSA 4FLXA 1B4AA 2QA4A 1UG0A 1RKWA 4Y4RA 2OV7A 1IRZA 3VUZA 2A28A 5D6FA 1SAZA 4DUZK 1MBHA 4H0VB 1UGSB 4BDPA 4W5QA 4CGGA 2XHBA 2D0AA 2VBYA 4YOTA 4NCBA 2QQAA 2LYCA 3LDLA 1OCPA 3WU2C 2DJIA 3PO2J 3O4QA 3CD6A 3MCZA 3HOVJ 3VOEA 3L1PA 1Q81C 1RESA 1ZH5A 3INZA 4A4GA 2OZMA 2M02A 4HOBA 4AFQC 3NCIA 2E36A 3B6AA 3CC4I 3JRAA 1AWXA 1FSEA 5GPAA 2ZD1A 3F73A 1KQ9A 2DL5A 3ZOBA 5KI6A 1HYOA 3DLGA 3QRFF 4DF4A 3QIOA 5C15A 5HRNA 3HFNA 2XVCA 1JEGA 4NC7A 2R93J 4DS5A 2HF4A 3FZKA 3IKVA 3FXRA 2M1HA 3V8JA 3LSMA 4KHUA 2P84A 3DPUA 1P4AA 3TAMA 1HNVA 4W5RA 4XLPF 2YPRA 3HRMA 2GQQA 3O3FA 4RDUA 1SEMA 3D6RA 3HT3A 4HW0A 2EQIA 3VN5A 4QCLA 2K5CA 3C7NB 3G6EA 5DMRA 3PL8A 3CLQA 1X6BA 2Y1JA 2HL3A 3C65A 4NXMK 2LNVA 3CWTA 1R1TA 5J40A 1HD3A 1KC8C 3CCMQ 2YSRA 2DTHA 4CZJA 4HT8A 2CU7A 3U9ZA 2OTJN 2X48A 1XDSA 2QKLB 3EUAA 1DJ7B 3GIBA 2AO9A 1ZLJA 2E6ZA 1P4XA 4BH9A 1MDUB 4V2SA 1H92A 3U9GA 3KTUA 5KPTA 5KYXA 5DD8A 2DKGA 3FHNA 1ZA2B 3EL2A 3EZWA 4AF1A 1QNTA 4B8AB 3ZCMA 3TAPA 2LJ1A 5L8RE 3IRXA 2E2OA 3H46O 3H0IA 1EETA 2M30A 4J9IA 1QVFM 4RBOA 3G71T 3IMXA 3E6CC 4OGCA 4NNJA 5BNGA 1NNEA 3S9HA 2FZCB 2E7WA 5HCKA 1HPZA 4V2FA 3IRQA 2NUPA 1O7LA 1Q7YU 2HVQA 1YI2I 4LF7K 2UYTA 2K85A 1RILA 2K40A 3Q3SA 1RADB 1U3OA 4MQ9F 1WRJA 1AKHB 3A5LC 3EYZA 3DEEA 2HQEA 4UHTA 2CH0A 4A57A 3TREA 4K43A 5LJ3d 4DZPA 4AMCA 4ENMA 1J5EK 3S1RJ 1ITYA 1TBXA 3CCJA 2JJ7A 4LF6K 4QT7A 3E2UA 1HC8A 4DOWA 5KE3A 3LPTA 4YELA 1CQTA 5E8IA 3G73A 1ZG1A 2CP2A 3TP3A 3NWTA 3KPHA 1LWEA 2EZHA 4E9EA 3S3NA 5L3DA 3U9DA 3K70D 3R6MA 5GADJ 3HM9A 1S72T 3RMQA 1SD4A 4JK9A 1PSFA 3FDYA 3OIPA 3T3FA 4ENJA 3UATA 5GMKl 3DKXA 2SRCA 5KAFC 1JLAA 3BROA 4A4KA 2NRVA 3GTKJ 1NOZA 4KI4A 2AT1B 4W5OA 4B3MK 1OZ2A 3QZ5B 4RTFD 4GLMA 2YRVA 1QVFA 3TTFA 2CUDA 1HCRA 4XKBA 5FPDA 1HR0K 2F2EA 2FVUA 3BDLA 1ZBFA 3KD1E 4AYBA 2ZMEB 2F5DA 1S9GA 2HI3A 2K02A 1I81A 4YNQA 3FXQA 1LW2A 5AQMA 3R4KA 2DA4A 3NFAA 2YHXA 2XAUA 5DLQE 3WU0A 2EFPA 1VYUA 1N5ZA 3BTJA 2HSPA 2RJDA 3O6WA 3W2AA 3OYFA 1D3BB 2YKNA 1FPQA 1PSEA 5EOYA 2JSPA 1S1XA 2P9NA 4EJYA 1XN7A 3ENHA 2DT6A 2YHWA 2OQRA 1T7PA 3F72A 2GBZA 3CPWM 5CQYA 4AU7A 2RHZA 4CJEA 3AVCA 3LAJA 4HCBA 1XWLA 3L2RA 3AVKA 2RI3A 2F7TA 4XRMA 2JA7J 3PSIA 4BR9A 3JCMe 2Q2RA 2XPVA 3OMGA 3CDIA 1JLFA 3QEIA 1WN7A 4DSFA 4LD5A 3RKXA 5GAMg 5J6XA 3VS7A 3ZSRA 4PKHA 2F8SA 2QM1A 4IOAF 3RUXA 2RNJA 5AQUA 2HQNA 4A6EA 2XI9A 2VG5A 1Q82C 2MFZA 4A63B 1D0ZA 1WPYA 4X65K 5FDLA 1KFDA 3CJCA 1VQNN 1KD1R 4HTLA 2AHQA 1YIJN 1W9HA 4ICLA 1T3SA 1AEYA 4XIDA 2CGKA 4DUYK 1NK3P 1VZ0A 3L2VA 5DDGA 2LBFB 2EIJH 4RTZA 2LJ0A 3W2VA 5I21A 1SQKA 1U6GA 4C5IA 1VTNC 4CYCB 4I09A 1VAZA 1P7IA 1TUGB 3QERA 3UPUA 4C0FA 5FU7B 3FE1A 1FK9A 2RHIA 4Z4GA 4BR5A 5JS1A 2CGHA 1ON1A 2J7IA 1X6GA 1V4TA 3GPLA 3ZEUA 2K7LA 1E6HA 3DLMA 1BISA 4NL3A 1K0SA 4NUBA 3OSFA 1SVMA 4XQ3A 3F22A 4RGXA 1I1GA 4J19A 3ZSZA 4JN4A 2HBJA 1YIJQ 1FKPA 2LX9A 2XDVA 5CK9A 3PSFA 1DQUA 4U67L 4UOBA 3CF5L 2DA9A 2DA3A 1G83A 2KIFA 4D7MA 2PJRB 2A5XA 3U1KA 2DO3A 1G3YA 4HV6A 2DXUA 4FJHA 1DKGD 4H0YB 3SAFA 4FOIA 4BY1J 4IO8A 4DR4K 5L3GA 2O4XB 2F5EA 4DQQA 1ASVA 2PVOB 1F9NA 2VASA 1VF9A 2KR3A 1W7PD 3QICA 5B1AH 3CCQI 2J6OA 2E1ZA 1B6AA 4KT0E 4XLEA 3MKYB 5LHGA 4A3BJ 3TVTA 2ZPHB 4RGSA 3LSJA 3G7ZA 2KQ2A 5B5EC 2ECBA 3F2KA 2Y4XA 2R7OA 3E6MA 3DLLA 2BIVA 2CFXA 2VYPA 1QWEA 4C92C 2HSEB 3VF4A 4FLYA 4UV8A 3WNGA 4OMZA 3DXKA 3JCMX 2FBKA 5GAOn 2WADA 3DPLC 2QK9A 4YEJA 3CDHA 2CV0A 3TWHA 4WF2A 2O4XA 1VQMQ 2BY2A 3IKTA 3JCMV 2EYXA 3C4SA 2ROTA 4EHUA 3PE0A 2GX9A 4FLTA 4PKCC 1B72B 2FYKA 1I5LA 1RUOA 2CP3A 1T03A 5JHFA 4GLKA 1ZG5A 2XIDA 4K42A 1Q9XA 1BB9A 1J75A 4YPRA 5FD6A 5FPMA 1DP3A 3U8XA 1FXXA 5H1SQ 6PAXA 2O8BA 4CICA 3FHGA 2JTMA 2KKZA 2V1UA 1WIEA 4IKFA 4C8QA 3LCNA 2Y0MA 2VKNA 3ZSYA 4B1YB 2HBWA 4A3DJ 1VQ6A 1F5TA 1WJCA 4C0DB 3THYA 5F6FA 2V75A 3EG2A 4KKOA 2K9NA 4DOZA 3TAFA 2LMJA 4EM0B 3VS5A 5BRHA 4MGRA 5F2RA 3UT1A 2HPMA 5DV5A 3ATVA 4PFPA 4UUSA 4M77D 1ZYQA 2STTA 1UB9A 3WTSC 3G1JA 5CPRB 3VQEA 1IREB 1WJQA 2E20A 3OW2S 4C2UA 5C0YA 4LFBK 3D45A 1VQ7Q 2QYZA 2DA6A 4AFSC 1QE1A 1KSPA 1B07A 2CQKA 3WTZA 1M2VB 4W97A 1OFCX 1PM3A 2L5QA 1Y6IA 1I8FA 1J7KA 1NGGA 2ABKA 3MAJA 5FB2A 2DXBA 4JKHA 2OCEA 1YFNA 3P38A 2XG8D 2HTJA 3DTKA 3THYB 3LGLA 3G71I 2M0CA 1V4SA 1JJ2M 4P5NA 1ORPA 3NHNA 4OMPA 4RTYA 1K7AA 4WTOB 3LZIA 4JZ3A 1LFPA 4QVZA 1O13A 3MKWB 2DPPB 1B92A 4B1XB 4RGUA 1O75A 3ZPLA 3I56A 2F6CA 3V81A 3DBRB 4IOXA 1O1WA 4MMLA 4P55A 4G9YA 2JUCA 1FMWA 3GTGJ 2CP6A 4JHDB 1YW7A 1XI1A 2QWQA 4ZYEA 5ED4A 3O1WA 4IEIA 2RQUA 3KP7A 1RT3A 1NG9A 4FM0A 4RW4A 4F3OA 2JHNA 2YSQA 3ULDA 2R7TA 3OS2A 3LWLA 1KEAA 4Z4IA 2LC4A 3GTQJ 1NJZA 3PNTA 2XB0X 1OQKA 5ICCA 2KY9A 2AXLA 3HO1A 1HKCA 3GTJJ 3EO3A 4XTWA 1X1PA 2H6BA 3ZQHA 4GDFA 4A5AA 1DU0A 2WC2A 1YCYA 3S15J 2VWFA 4CGFA 4RA2A 3JAMO 4CZMA 2OTLA 4OPKA 4YFKF 1M90C 5FKMA 4EJWA 3T19A 1IXCA 3HOSA 2P0QA 1X4PA 3MP1A 2HKXA 3K5MA 4HVJA 1VQ4I 1SL2A 3C0CA 2IPOB 4YY3K 4DFKA 2O7OA 2DL7A 1JUPA 3I33A 2PG4A 5DM6F 1IW7F 2WBMA 3MZ8A 3BC8A 4GYIA 4LK0F 1WNSA 2VE9A 2FF3B 2KRCA 1EIFA 3GOIA 3QJYA 3I55I 3HFOA 3CCLI 4CC2A 2EJRA 4KRTA 1G3SA 2HHSA 4Y33A 1P9QC 3EE8A 4KFBA 1W36D 3MVPA 2PTKA 1VRTA 4BL0B 1B72A 1T38A 4ON0A 4XK8E 5KYYB 2L9RA 3RMCA 3CQYA 2DMOA 3G4SI 1JJ2P 4DK9A 1VQLN 5TISC 3N4PA 4CESA 4FLWA 2HQHA 1W7AA 1IBKK 2P7CB 2X35A 2CQNA 1ZLKA 4H03B 5KRTA 4CDGA 4LIUA 2HOAA 2DK5A 1UJ8A 4Z8AA 3HPGA 2KPMA 1K8KB 1XMQK 4AG2C 3H08A 1TWHJ 5AQXA 1EQYA 1P4WA 2P0KA 3HVTA 4C92A 2A69F 2X6XA 4V19K 1Y96A 2PEXA 1V5GA 1NBWA 5ADXH 2KDZA 3BR3A 4PZJA 4HUGA 4FSSA 4A3GJ 4QTRA 4FK4A 5KGXA 5EVZA 2Q97A 3C6HA 3G71N 3DLLF 3QYGB 3TSZA 3T8TA 1NGDA 4CHZA 2HVIA 3O8GA 4DQIA 3N05A 3SEQA 1YWOA 2DTZA 3SV3A 2MPXC 2BVLA 3EGXA 2KIUA 4IG0A 4V19S 1M1KC 2QK0A 5JLHA 5GAEJ 3LWMA 3DLRA 3I55A 2ADUA 3X25B 4MLEA 2MAMA 2F4VK 3JB9H 5LJ5d 5HLTA 2P5GA 1WGSA 1RBVA 3OH6A 2PJRA 2E1NA 2QA4Q 3TKYA 3M8SA 1XS9A 2MBFA 3X2QH 1ON2A 3FJ5A 1ODDA 2HNZA 2EYQA 4M77F 2L9NA 4N47A 4Z94A 2GOMA 2ZWHA 4FYXB 2HVHA 3MEXA 1VQKQ 2QDLA 2OD5A 3NE6A 2H09A 4KHPK 4WXDA 1Z3XA 3CCRN 1D1AA 2P9PB 2HXIA 1TH7A 4OFHA 4M7AA 2QEXI 1RCHA 4LE9A 1SAUA 3S6WA 2P9PA 3ZETA 3SYZA 5FJ8J 3HSFA 3MN2A 1Q82R 5K14A 4FYWB 5FLXZ 2NOHA 1K8AR 4LFUA 3LALA 1UOCA 1D1BA 4OMFB 2D4WA 4EA5A 4QS9A 4C8KA 5GAOm 1OQYA 1KK7A 1ZBXA 1GLBG 1K76A 2JTFA 4CK1A 1G6NA 4RG8A 4BKXA 4JI2K 2FZKB 1WDXA 3KKRA 3CJNA 3CXCA 4AHTA 1NH3A 3KZZA 1LWYA 3RDVA 4L9TA 2ZCWA 1BOTO 4XRFA 5JVTA 2QA4T 4NZGA 2YU9J 1RLPC 4NB5A 5IT9K 4R55A 3GOXA 1KTQA 2KRSA 4PSWA 5GAN8 2ZSHB 2JS0A 4MFEA 1ZUUA 5TJJA 4UUSB 2E5KA 4C0GA 4FWSA 3JRBA 1PUFB 1KQ2A 3U3YA 5ILVA 2FBVA 3RSNA 5KN8A 3E7LA 3M0QA 4L5GA 3CZ6A 3CUOA 1EH8A 2VUMJ 4KGVB 5GANj 1HLVA 2PVDB 1U9OA 1N6AA 3CUQC 1NPPA 2V6EA 3DCFA 3UKGA 5KAIC 3CCQQ 4HRIA 1NK8A 1ZX6A 2YRDA 2MH2A 3I4PA 3TW6A 3UKUA 4XLAA 1U4BA 1M3AA 2K9GA 3CJTB 4E7ZA 5HS8A 2DT7B 3K4BA 2RK1A 3KFVA 4PL8A 1MIJA 4IUUA 3X26B 1FP1D 4E6RA 3AVMA 4FJJA 4NL2A 2PMHA 4DR2K 4C8QE 3JRCA 1W7PB 1XGNA 3T5XA 3SCXA 2HQ5A 1GOAA 3SD4A 1WBDA 1H88C 1N78A 4KRFA 5IXFA 1BBYA 3PT9A 1YIJT 3NARA 1WHJA 2D2WA 2LF7A 4HVWA 3EQLF 2CFOA 4M3YA 3OB9A 1LB2A 1LDDA 3DU6A 3BR2A 3QQAA 1AWOA 4C23A 2RQTA 1YJ9Q 2VPLA 5C12A 3NAUA 1HUXA 5HDNA 5BREA 1HLUA 1NLPC 2IEKA 1NG7A 2P9SB 5CR2A 2NRHA 1KQSP 3DLHA 3UIQA 4A6DA 3TMOA 1U0JA 4G7OF 1MWMA 4X0GA 1QPMA 5FKLA 1WXUA 1LNWA 3C6TA 2DMQA 3QPHA 1FN7A 1ZR4A 1T39A 3DXJF 1EH6A 1B8IB 4E1JA 3CFRA 2UUBK 1HJOA 3AGRA 4UVBA 2DL4A 1BR1A 1WFWA 2DX1A 1OPCA 5AQYA 3ZLJA 1QCFA 1T05A 5D8KB 4JQFA 4L3QA 4LDUA 2EQJA 5HK3A 1KFZA 3M8QA 1Y97A 3BUZB 4FISA 1TP4A 1TWGJ 1A35A 1IO6A 3K58A 1N27A 5IHKA 2PY5A 1Z6RA 4MFBA 2COMA 4DFPA 1KC8U 3S14J 3ID8A 2V7FA 1GLEG 1IGNA 2BV6A 4ANJA 2EZLA 4C5EA 2F2XA 3GDQA 4OB0B 1ZQ1A 3CCUT 3VENA 2A1SA 4M74A 1S6PA 3G1OA 3WGIA 1VOMA 1C1BA 2VQHA 1D3YA 4DS4A 2QA4I 3FK7A 2LCSA 4WQ4A 3MO8A 2DIGA 2XDBA 1X1AA 3UKRA 4LF8K 4BVPA 3RKQA 2OI3A 3G25A 4KTZA 4P96A 4BAYA 2ZSIB 3BZ6A 2R5ZB 4J2EA 4KN4X 4F52A 2RC4A 3CXCP 3VQQA 3I0XA 3JRIA 3EUHA 2HHUA 2DBBA 4OAYA 1UA0A 1U48A 3WTVC 3KLNA 4XICA 1JKOC 3CG7A 2UXCK 4IL6C 4QS7A 2X1EA 3IL2A 2GUIA 4KH5A 3CM6A 2LR8A 2VWKA 3G6ET 4IUTA 2O03A 4CCLA 3HSBA 2VN2A 2NRTA 5C0MA 4PA1A 4MIMA 2JM8A 3V9WA 4A2BA 5KQDA 2HAXA 5FD5A 3T7ZA 3F9KA 1NGBA 2IAJA 3WQTA 2RN2A 5C2DA 4AFUC 2R5AA 4LNPA 1YI2A 4C0ZA 4XTYA 5LGNA 4LIVA 1SKWA 2V9VA 3H5AA 4DBQA 1M2OA 2NUTA 2L0AA 4UC4A 1TAQA 3PO4A 2D0OA 4KTWA 1GV2A 1NK2P 1KLNA 2XDPA 4PHTX 2YT6A 2M2EA 3I5SA 1L3UA 3VGMA 4BXXJ 1RRQA 1SUQA 3MJXA 2Q1ZB 4BY7J 2DTUA 3OA9A 1VI0A 1K6YA 5IY5H 2YHTA 1K9MC 4DV4K 3CCUQ 1H9TA 2BE9B 5GIPA 1U2VB 1YNZA 4FWRA 2DOFA 3I71A 2K3PA 2PU9B 2M34A 1SPKA 1VQLA 2VI6A 2J6KA 3GXOA 4OKEA 5IH2A 1UZCA 4H5VA 1RACB 2OAWA 4KPYA 1NM7A 2EVRA 4GVMA 2OA4A 2ZCFB 1JL1A 2K2MA 4RW7A 1GLLO 5CLSA 2NVQJ 1Y0MA 3QP5A 2ACJA 3L2CA 2FBIA 3H92A 4RTTA 1RTHA 1NK6A 5AYFA 3NTIA 1NG6A 2IGNA 4XLFA 2UZKA 1OYYA 3JCMf 1PG5B 5LRRA 5E41A 4L5JA 1RNHA 1ATRA 4I2PA 2DAQA 1ZSZA 5AQOA 2L9VA 4YORA 2EV5A 1IKXA 1N75A 1YUWA 4MEXF 1K61A 2DZ9A 3GO5A 4S0HB 1WGXA 4DCHA 3CCVN 1T3VA 5F04A 4BRDA 1K73O 3WT0A 3J80O 1UGPB 1RUWA 3GTMJ 1K9MO 4ESRA 1Z9CA 1XG1A 5CQGA 1MBJA 4J5YA 1S22A 3HUGA 5GAEP 2QG9B 3QEWA 2RK2A 3E5XA 1X27A 3JYTA 2XHKA 3SHWA 1IV6A 4BHCA 4OP0A 2FLOA 3EG3A 2QQRA 4B1RA 1N3AA 2BY1A 3D2EB 3AAPA 2YWWA 3FKIJ 4CZLA 1U9NA 2ZPGB 2ME0A 3QLHA 2N8GA 1YTAA 2K27A 5CZ2A 5CYVA 4BBSJ 4RB2C 4KT5C 5GAN6 1OKRA 4II3A 3K2PA 1RT2A 1FEXA 1XQHA 1OYIA 1WQ2A 4MTDA 1UFMA 3UF4A 5IOYA 2MA3A 1W36C 1GLCG 4M4ZA 3ML6A 2PBDA 2W04A 5BPLA 3HPHA 4HNVA 3VB2A 3V9XA 4IHWA 1LDJA 3R61A 1P90A 4EP5A 2LZ6B 5SWMA 2DPNA 3Q0WA 1A0NB 1IUYA 3F8NA 1KD1C 1TSFA 3QDRB 4IOCF 4EZ6A 4PUOA 1V1CA 2YXYA 4C2MJ 1Q82O 1PDNC 2DA2A 3M8PA 5BOXA 2A3LA 4BRHA 2QWOA 1ZAOA 1KVCA 4PWDA 2YUPA 2IT0A 1BU6O 4PLIA 1TLHB 2VXFA 3ME9A 1IZ1A 3OYCA 2B0LA 3WTXC 2D1XA 1S1VA 3SDGA 3CC2Q 3CCMA 1IG8A 4N4NB 2E1YA 2IVOA 4B3SK 3G4SN 4CXFA 3L2WA 3BTIA 4JBAA 1R0BG 4Z2YA 1VQNI 1VQ8N 3O9QA 3D4VA 1X1DA 1GBRA 4D5FA 4DBFA 2I7PA 2KAFA 2JWLA 1B34A 2R7SA 3DOLA 4N4GA 2HWVA 4ETSA 3M0PA 3RRHA 3V9UA 1OKJA 4OIPF 1JO8A 4XRSG 2QQSA 3CEYA 2JVGA 2WAEA 2KZZA 3M0UA 3QBXA 2QKBA 1U1TA 4GBQA 2NNNA 1KU7A 3A1PA 4B43A 3GTPJ 2DVJA 4MDXA 3F3XA 3VS3A 3H8ZA 3CPWS 2NXNB 1QO0D 3T9NA 4MNUA 1XNRK 4D9JA 2DLPA 1KVBA 2ISYA 3SFMA 1CXUA 2Q2EB 2RDPA 1OYXA 3CCVQ 1WSHA 5GADP 2HMIA 1WHLA 2A3ZA 3RMDA 2RB6A 4CEBA 3H6ZA 3QESA 3QNNA 3C3WA 1YX5A 3O3KA 3LL3A 3DXKB 2AKLA 1LWFA 1H1VA 1PJRA 4BHBA 2MCNA 5BN9A 4EM2A 3KCCA 4LG3A 4CF9A 4WFNL 3M6GA 2K3FA 1S9HA 2MWPA 2O0YA 3LLRA 2QQBA 1WQ7A 1RT4A 1PKTA 2IAIA 3GZNB 2XF5A 2F4IA 1MU2A 2P5LC 3VYHB 4YOYA 1S7OA 4IFYA 4H0EA 3AV9A 4LSLA 1Z05A 3AVFA 3KK3A 2K6DA 1KSWA 3WXMB 3M57A 5D5WB 5E1ZB 3QPTA 5L3CA 5GAMe 1J3TA 1LE8A 1LJOA 4DTRA 4DEYA 2Z1IA 1WSFA 4JV5K 1YITT 4WF9L 2F5VA 1GLJO 2VKVA 4A0YA 4LD0A 1FBQA 4GVEA 3TDZC 1JHHA 3SAGA 4IJAA 3O9RA 4MHGA 4B24A 4DQSA 3SJMA 4Z88A 2BTFA 1B59A 1BQNA 3K10A 1I39A 1LVAA 2QENA 3DU5A 4B6MA 2QVOA 3CDLA 5HLFA 2O8DA 1NMNA 3M59A 1FX7A 4F7ZA 1W1FA 3VKIA 4E9FA 4HVUA 3B02A 3H45C 1G5VA 2IS4A 2OTLI 5LJ3h 3F8BA 1B8IA 3I59B 3R9PA 1SHFA 4D5CA 1X43A 2GBQA 3SYTA 2IBDA 1V76A 3I3LA 4UXNA 2F5CA 3P8BB 1QCNA 3IH4A 2CZ0B 1ONVA 3CCEI 2BHYA 2F5KA 2E34A 2KT8A 2OFIA 1M1KR 1IV8A 5LEKA 2V1DA 3BPXA 3DF8A 3JCMW 1E0EA 3JTGA 1VSMA 4ZHRA 5E18F 1V54H 3ZN1A 3T1BA 2K3BA 2QI2A 1O4XA 1Y07A 1MUNA 1B9FA 5K5RA 1NU0A 3FWEA 4OWRB 2HCKA 5F0XA 4F7UE 4FJ5A 4DKWA 3CD6Q 2XIGA 1MDMB 2XAFA 4OFAA 1YQRA 1ZC6A 4DV7K 1USSA 3VFZA 1K78B 2LKXA 3DPTA 4RUGA 3UNGC 1VQKA 2W03A 2QWRA 4CZZA 1PCXA 4XTVA 1DT9A 2BE2A 4LGWA 4L9JA 3CIPA 2JPSA 1J53A 3CMAQ 4M6VA 3C12A 2DDBA 1M9SA 4DYQA 3KP5A 1B7TA 5EEGA 3NH2A 3OYKA 2XC7A 4FSVA 1D8YA 3ZQFA 1ORNA 4CJVA 2LX7A 3OYJA 2FPEA 5M1KA 2VLAA 3KZIC 3CCVT 2D0BA 1NMDA 2VYTA 1I5OB 4I0AA 3P4IA 5M3MJ 2WBNA 1PU6A 2QWLA 1M27C 4GGGA 4IHVA 4P9UA 4JOMA 2QSHX 1WLPB 1TK8A 4BY9C 3H9JA 2F9WA 2PX9A 1R59O 2HBPA 4II2A 5FU6B 2LDUA 1Z21A 1VQ9N 1EA3A 4DIQA 4R0KA 3KKSA 5F1XA 2HF3A 4XL9A 4A12A 5D8LB 1RDBA 3IHUA 4FASD 2K3YA 4KMUX 1C1CA 2IGIA 3EFRA 1NGEA 4RTWA 2V9PA 5A0LA 2RKHA 1RETA 1HQCA 2BE5F 3EHQA 4NYFA 1CXQA 2KMUA 5FROA 2QTVA 1W2BS 2K9LA 3JRFA 3P9IA 4M78A 1C6VA 2DMTA 1ESVA 4AQYK 2RA2A 4JRQA 3FKJA 1R6RA 3GFJA 1TKDA 5C44J 3C95A 3HG9A 3HIFA 5ERIA 1FBSA 1WH5A 3AO2A 3HOUJ 3JTHA 1NM1A 2GXAA 2RJEA 3OL4A 3NTHA 3PUBA 2JZYA 4ATOA 3J81E 3PO5A 1TYQA 4A4FA 4OMYA 3DI6A 4HNTA 3SDZA 4CVNE 5GANe 1SZ2A 2DERA 2R57A 3MWPA 3FISA 1RDCA 2GTJA 1VQ7A 3J7YP 2ZBKA 1HNIA 4FZXC 4XRSA 2C06A 3ZT2A 5BRFA 4NBQA 1UGQB 1YJ9N 5KVRA 1U49A 3AAFA 5I2SA 3WNEA 5I42A 1NK7A 3FIFA 2FRHA 3IG1A 2X3XD 2VJIA 1MD0A 3HK2A 3CCJQ 4CHPA 2XKOA 1LMZA 3PNYA 2LD5A 4E70A 3BZKA 2RHXA 1KFSA 4YFNF 4LF9K 2ESWA 4ENKA 3ZEUB 1V55H 2KFDA 4QPOA 4BS9A 1S5LC 2VIXA 2Y90A 2K57A 4OMOA 2O4IA 1R0CB 2OTLT 2AQEA 1VQ6Q 2MW8A 1KHIA 1HNXK 2G9WA 3W3CA 4IO9F 2CSQA 2HOSA 4FETA 3KNTA 5D6WA 4EZ9A 4EJVA 3PLAA 1RTJA 2YNIA 4CJ3A 3K1NA 4D8KA 3JB9J 2WY7Q 3AAQA 1YXQA 4BQOA 3N5NX 3CCRT 4OFEA 1L5UA 3MEUA 4CERA 3BCAA 1KD1U 1BCOA 4OPJA 1KVAA 3FHZA 3OSVA 2XB5A 2WB1N 2O61A 3HBTA 3V8KA 4CGDA 3SJHA 5FFXA 1J0RA 1C0TA 3I8DA 2B63J 1ITGA 3KP3A 4B3RK 3T69A 3ZQLA 3CMEA 4O5BA 3QO3A 3LM2A 5EZGA 1M30A 3MX2A 3PMIA 4C92F 4EMGA 4IQJA 4OJRA 4F93B 2GA1A 3I4NJ 1HQEA 3QBYA 3NGYA 3CPFA 4E19A 2XROA 3HOTA 3ZQGA 4CJUA 1OH5A 1Y96B 4A93J 2X6NA 3PTAA 4NC8A 5FLXE 1WWXA 3RZOJ 4A61A 2ZJPL 4AWXB 4PJOG 3CF2A 4XIUA 2ZXIA 3EPZA 4CBUA 1X9JA 1T95A 2HNYA 2DT5A 2DBKA 3TANA 2KEAA 2NOIA 1M3QA 1QVGA 4JK7A 5KYNA 2M5WA 3A5ZB 4M7AE 3M8FA 4A3EJ 3AA2A 3W0LA 2LRQA 2NOJB 2VJ5A 4XK4A 3VETA 2F5FA 2GQIA 5EY4A 5GTIC 2GWRA 2VKDA 4M77A 1KQ1A 1VQOQ 2V9KA 3M1EA 3ISNC 4LDVA 4IUVA 1VQPI 4GO1A 2ZMEA 5C24A 4CJKA 2H8RA 1VQ5Q 4HUFA 4M3TA 2A3SA 3QYBA 3CPWP 1QZ5A 5HLIA 1FOKA 4QWQA 4BE1A 4C5GA 3VF6A 3EETA 3FLGA 4Y52J 4BGAA 3DTEA 3ROUA 3W6KB 2FU4A 1ABQA 3LH5A 1D8JA 5GIOA 2F96A 1ETQA 3C7JA 4J8OA 1XUPO 3M54A 5CKDA 3PIPL 5KQ8A 1GOBA 3S2WA 2E60A 1XTAA 2LT1A 1HPMA 2LFBA 4AM7A 4CCMA 4VUBA 4A5NA 3OYNA 1JTXA 1IZ6A 1IH7A 1J9AA 1EJ9A 3HSEA 4PGGA 3HTUA 1QQJA 2C0TA 3FGUA 4RAYA 3PIOA 5K7HA 5EC7A 2G7UA 3MCAB 1QHAA 2QSFX 2OAZA 1HDDC 5J1EA 3WQUA 3PO3J 1RT7A 2CUBA 4FJ9A 4DR6K 2IDOA 5LMUK 3I35A 4YFUA 2ELHA 4M7DE 2A5YB 2XAQA 3O80A 2X3WD 1DP7P 3Q5FA 3NF7A 2IXSA 1UJYA 5BPDA 2YUSA 3TSUA 1XNIA 1EFNA 3CCEQ 5KYWB 1R8OB 1M3BA 4FWLA 4A69C 4HZFA 2D5VA 3E3VA 3K4NA 1IG7A 4R5PA 2BW3B 3CMAN 2GFAA 1S3XA 4J2BA 2L8DA 2P6TA 4BBRJ 3M8JA 2QYOA 3U6FA 1YJWI 4KULA 1WH7A 3AVNA 4ZH4F 3HC7A 1Y0UA 1UAAA 3GMEA 1VQLQ 4Q0BA 3SBGA 3E97A 1K4US 1ZQ3P 5D6YA 2HHXA 2DDAA 4GMJB 3GLLA 3ZYYX 4KJZA 3RDIA 1PRLC 4DSLA 4X9DA 1RAHB 2KRMA 1VQ5A 2DTIA 2NOGA 3VGKA 5HS9A 3A5MC 3KP6A 4CJLA 1HSJA 5LJVA 4M72A 1HSQA 2AKKA 4F04B 4N56A 3CC4Q 3UKRB 1VQ7N 1GXPA 3CHWA 5ILSA 1MPGA 3EHRA 4DR1K 4IHYA 2VKHA 3DBHB 2B86A 3AO3A 4X66K 1PU8A 4F91B 3I8BA 2QWPA 4HWIA 4RB3C 2FRWA 3O4WA 2E2JJ 2K7AA 4WE1A 4BDZA 5DCMA 1QTMA 3K1PA 1Z26A 4C92D 4Q5WA 2IOCA 4KREA 5J47A 2CH5A 1MV3A 2AZVA 3P8DA 1LDKB 2E3IA 3CCVI 3CD6N 2BXYA 4M9SA 4JX4A 4NQWA 3CMYA 1GVDA 3CQ8A 2H8HA 3E6BA 4JNEA 4AHRA 5CCAA 4ZN1A 5KTQA 2NLUA 2XRIA 3OOPA 2CV1A 3S1MJ 3HM8A 2PI0A 4O4GA 4KI6A 1IBLK 2YUNA 2OTLN 3AHUA 2RREA 3RPUD 4M75B 2HPIA 4CZIA 1XSXA 1LEBA 4J9GA 4L0YB 4FJMA 5J2QA 1Y39A 2W42A 5E3MA 4ZGDB 5J39A 2WFBA 2ATQA 4BGBA 3SZTA 4L8RB 3D5SC 5DK5A 3HDDA 5FPNA 4F7UA 2YJFA 3QO9A 1S6QA 2KXCA 1WJ5A 3HI0A 3CPWA 1ZBUA 3LFKA 4CF1A 2RF2A 1X1CA 2L01A 3BE3A 1LFBA 1Q95G 4UB8C 4F92B 5J4VA 3JRHA 4ID1A 4BXUA 4EIKA 1G59A 4C3JJ 1J54A 2D5RA 3QOPA 3AL0B 4OMNA 4FWPA 1W0UA 3PX4A 2KIMA 4BROA 3BFMA 3VQBA 1YQLA 4MMKA 2DN0A 4IDHA 2JMCA 2PBIA 1WI7A 4FOEA 5HBMA 4KH4A 2XPUA 2WAFA 4CEZA 3IFRA 3QPLA 1GOCA 4JLIA 5E3OA 2BGGA 4ISEA 5M1OA 1VQKI 4CW7B 3EYYA 4DBRA 2YG8A 5DUKA 3P9CA 1QKXA 3D5LA 2OPQA 1YITI 4CD3A 3K7AJ 1NEGA 4E3SA 3S6IA 2FZGB 5GMKi 4CD1A 3BY6A 4CH7A 2IW5A 2LKSA 2L3QA 3QIPA 2LY1A 1NHAA 4MZTA 1T0HA 5GANg 2XO7A 4BRNA 2HHQA 1KQ0A 1SS6A 2P9KB 1V5FA 2COBA 3GX4X 3E01A 4JRKA 3VERA 4HBLA 2P4RA 3VQPA 3SUQA 1T8IA 4R1HA 3DWLA 1OI1A 4X1VA 1VYTA 3A03A 1ZR2A 1Y8RB 8AT1B 3OYLA 1NK9A 4C30A 1XSDA 4M78E 2K9QA 5L3EA 1U5TB 5BR8K 2DETA 3M07A 1PUFA 4A5BA 3V4IA 2A61A 4M78D 4HA8A 1O3TA 4U7DA 1KRPA 4I02A 3E1SA 1F43A 3TP0A 4PJOA 3DKWA 2IS1A 3BEXA 2K5IA 2EFWA 4XEIA 3CCRI 3CP2A 3ZMSA 1M1EB 2HB5A 4O5VA 2F2VA 5J2PA 5JI6A 3CW7A 1BDGA 3R0JA 2ABLA 1YYVA 3LX7A 3OSSC 2KRHA 3V1RA 4ESFA 1NJYA 3AVBA 4JJCA 4ILHA 3K2AA 3ATUA 3BDPA 1E3PA 3SB2A 3C2BA 4F16A 4HT9A 4BB7A 3VEWA 3WVEB 5KYUB 3CJ9A 2VPRA 3DLKA 1QCOA 1TV6A 2JN0A 5D5VB 4GYGA 2BYVE 4YPHA 3N4QA 1M8VA 1BI0A 4KIGA 4M71A 2NS7A 4BYYA 4PFZA 3MXJA 3E1YA 4QLCU 2LVMA 1AOJA 2CMPA 1LPLA 4M3ZA 2CZ6B 4KYWA 4LUEA 1YJWN 3HPWA 1N6QA 4CO8A 2I5JA 1G15A 2DFUA 1M5Q1 2HNHA 2CW7A 2CUJA 3G1MA 1G3WA 4IHTA 2HKNA 4QKUA 2OA8A 1E4FT 3DRSA 3KEYA 4B9QA 5H2FC 1OCRH 1MJAA 4CECA 4IZ9A 2C6YA 5LHHA 4D1QA 3LDNA 1E17A 3SUNA 3EFOA 4AVZA 1YF5L 2ZXWH 2MH9A 3OBWA 4NB4A 1HQUA 2VODA 4B9WA 1GLFO 3M3YJ 5D5UB 3QZ9B 1WFXA 5DEQA 1J9IA 2RPNA 1J5YA 3OL3A 2EFIA 4HVVA 1X3WB 1YX3A 1ZSZC 1MHNA 1U1SA 4B44A 4RLQA 5LMNK 5J2MA 4KHSA 4HDVA 4DFMA 1BA0A 4LN2A 2MG4A 1NE8A 1DEJA 3HGYA 2XY8A 2EHGA 2W4SA 2K4BA 2RJFA 1PNJA 2OTLQ 5HRRA 1CSKA 2HHVA 1I07A 2XV4S 2RMOA 4OLBA 1HA8A 2G8HA 5CKEA 2H1KA 1K83J 3SMSA 2OPRA 4CE9A 4AIDA 3BG5A 1BU1A 1HW1A 3MEGA 4Z4EA 1W2BM 4F7UB 3EGDA 4UUTA 4GKKK 2ZNZA 1FT9A 1IN7A 2KQWA 3O8MA 4DLEA 2VGMA 1QA6A 4A0ZA 3JCMP 2KRFA 1TW2A 1AA7A 1VSHA 4ZDPA 3MP6A 1IKVA 3RKWA 4XOPA 3G6EI 5GAN5 4EM1A 4AHVA 4CJTA 4HX7A 3L3UA 4M3UA 3HTVA 5LBQA 1O3QA 2KROA 2R58A 2D0PA 2GTDA 5FLXO 4J7FA 3TOBA 1J09A 5KPRA 2F8TA 2EK5A 4QVDA 3CD6T 3V9ZA 4E7SA 1VSFA 2XY6A 2DI3A 1ZARA 1Q86R 6AT1B 4EHTA 2A6HF 2FPDA 3ZSWA 4IZZA 2DBMA 3VYRB 3WEEB 3MWMA 1RDAA 3FB9A 1TUYA 1YTUA 1ORKA 1OR7A 2P5OA 1N9RA 2OCCH 1RIOH 4DWIA 4L5IA 1U84A 1P7JA 2RAEA 1XDUA 5AZJA 3FXJA 3SZ2A 1CF7B 1MDMA 3BZCA 3RWUA 2M1BA 1IO2A 2COZA 3VEVA 4F2RA 2EAYA 4M3FA 4DW6A 1WLJA 2V6CA 2ZO4A 1HJDA 4KHYA 4I6MA 3CMEI 3BR5A 3QSUA 3VPZA 3RERA 2PQ8A 4BNCA 3CQTA 3OW2A 1BI3A 4M3GA 4BUGA 3ISPA 3J8AA 3KYDB 1T44A 2XICA 1R71A 3ABKH 3JXUA 4M78F 2WC9A 2CQQA 1G2BA 3K4LA 4ZGEB 1LW0A 2LP0A 2J06A 4M7YA 1XC9A 1Y71A 3H1QA 2JUFA 3HB9A 3DV8A 4ZJZA 1O3RA 2GELA 3CC2A 4DLGA 1H9GA 2O01E 1UHWA 4A62A 3S1NJ 1AWCA 4CJ5A 3D7EO 2H56A 4DF8A 1D0XA 1BA1A 3LSPA 4OPHA 4QSHA 3MAQA 4B3TK 1BC7C 1M1KO 3LSHA 3S3OA 4JPBW 1P8ZA 1N5YA 1UGRB 3QKJA 2VQEK 5F0FA 1BR4A 1JJ6C 5HDGA 1Q86O 1IRXA 4AM3A 3KYCB 3ALYA 1VHXA 3H0HA 3HEFA 3FIWA 3G0QA 2XY7A 4IOAL 4U0YA 4B9VA 4F55A 1BIUA 4CFCA 1YRNA 1SMTA 2GV9A 2EV0A 1EKEA 3O4NA 2A42A 1QKWA 3HYIA 1MBKA 1A5VA 1SAXA 3QNOA 2K5FA 4EV0A 2VC8A 2XY5A 1DTQA 1R23A 5CE3A 3A2KA 1N36K 4LG0A 2EIFA 2ZKZA 4JAXA 1FNNA 3P39A 2BUPA 4FLVA 4FM1A 1MBGA 1WKMA 2VQFK 3MZYA 3CC7A 1RTIA 3VYGA 2LJ3A 1VQ8I 1NGJA 1ZUKA 1MV0B 2G8VA 2B7EA 5F64A 2BEOA 3H9GA 5HL7L 4IFEA 4MTEA 2KT1A 1ZTRA 5GANf 2QWMA 3R2XC 2LT4A 1QSLA 1QSSA 4KH0B 4MEYF 1XJWB 3BR0A 3P9KA 1YCSB 2GWKA 3E9LA 2LTPA 1SRLA 4WQ5C 1TG0A 4MLOA 4KIFA 1ERDA 4EAHD 2ICWG 4CHQA 4YRVA 2JA8J 5L23A 5JICA 4QIWN 2IVNA 2DPUA 1OCOH 3THVA 3GFIA 2W48A 3RSEA 2O8EA 4JKBA 1BIAA 4CZCA 4DTXA 4ID5A 4M77G 2WB1A 3I0RA 3RTVA 1XGMA 5GTHC 2MIOA 5IXBA 3J7AP 1YHQI 4M7DG 1H8KA 3J80E 4EMKA 4FE7A 3HSRA 2XUBA 1Q81R 1JU5C 2R5ZA 1BWFO 3B6PA 3QEPA 5LJ3f 3SZGA 4M77B 1VQ7T 2OQGA 3KE2A 2MF2A 2JQ7A 4YOWA 4M7DB 3CC4A 1X3ZB 4Q4ZF 5J4YA 3GFLA 3KZYA 3IAM2 2HDCA 1FC3A 2QKMB 3HOYJ 1L3SA 1RT5A 1ZXOA 3FXMA 3SWNC 4XN3A 2HNIA 4J01A 2ZPIB 3MEVA 4M7AB 1U5SA 1V4RA 1X3MA 1OU8A 4DR5K 5DS9A 1QSYA 1BKBA 1WJDA 1ZGAA 2RN8A 3MZHA 4FLUA 1WEIA 3OW2P 3Q7BA 3LWFA 1KONA 2FO0A 2OYQA 3HRTA 1LJ9A 4PNOA 3TCJA 2ZFUA 1YO5C 3P5JA 2OC6A 3CXCM 3L09A 4K8XA 4ZC3A 1FIPA 5K7FA 2DJZA 4B47A 4BJ5C 3U23A 2WY8Q 1NGNA 4JDSA 3OYIA 1T6DA 3TU4K 4DU1A 1BGXT 3RR8A 4HHTA 2MD0A 4FJ7A 2Z33A 3F8CA 1HKGA 2FF4A 3BTCA 4KAZA 3JSPA 5HP1A 2QEXQ 4A5MA 1VQMT 2JVHA 1RRJA 1T08B 1WQWA 4IO9L 3RRGA 2E6MA 2R92J 2C0OA 4CGHA 3E9OA 2LVSA 3HPOA 4KBMB 3SFZA 4K8ZA 5JFRA 4OVAA 4PL7A 2K3XA 3LP3A 5EF6A 1DLOA 2R7DA 2HSTA 2OBPA 2V7ZA 3Q0VA 3OYGA 3GZ5A 4KBOA 1VQON 1RAIB 4FX0A 3DM2A 1MMNA 3BOQA 3FR0A 2LOOA 1EF4A 1TUUA 2EGEA 4FT4A 1JTYA 2E2PA 5F1RA 4ILGB 2XSJC 1D5AA 4EMHA 2M16A 2H94A 2CSIA 2Y0SA 3QETA 2R7RA 3LAPA 3L00A 3M1CA 3NRVA 2Z1JA 5CYMA 1X2NA 2J5PA 2HHWA 3I4MJ 3CCRQ 2PLYA 1P6RA 2ZJPF 4UVCA 3ZSQA 5LJ3j 2IA1A 2W10A 1RBTA 4D0PA 3GWZA 4M73A 3IH7A 2X4XA 1R4MB 1X01A 1VRUA 1MMGA 3A0HC 3HP9A 4PK4A 3CVSA 3EY1A 1Y64A 4FJNA 2RN7A 3KX2A 2QF7A 4IOCL 1QS4A 2MLGA 3NH0A 2JA2A 2KTQA 4BDYA 4RW6A 2QTXA 2UXXA 3CJQB 2DW4A 3L4IA 2RGVA 3FXUA 2XAJA 1WJEA 1RAEB 4QQ6A 1ASUA 4IVNA 3HKSA 3M5RA 1BQMA 2EPFA 1XMOK 2FHDA 1W6XA 1OPKA 5TRDA 3TU5A 3E5QA 1X2QA 3A1YA 5FU7C 2M0MA 5AQKA 4QQGA 1KG7A 5L3BA 3KLHA 3GBGA 3RR6A 3MEAA 4HSBA 1X9WA 4JRIA 2OTJA 3CESA 2O8XA 3QFUA 3ECHA 3VODA 3SK3A 1KU9A 3VS2A 2WSFE 1N8RO 2E88A 4JEPA 2DFHA 4JS4A 3ELKA 1TAUA 4C8QD 2HTSA 3K9KA 1KD1O 3CCYA 2ZFWA 4M3EA 3EEQA 2DAOA 3PIPF 1BI2A 1VQ4Q 2FEZA 2KQRA 3AG4H 5A2QZ 3HJEA 3MWTA 4KMFA 4J9BA 1T3LA 4N5SA 5J1UA 3CQXA 3EH1A 3RQ4A 2E41A 1JKRC 1IXSB 4C8QC 3FZVA 2Z99A 1SD6A 3G71Q 1WNLA 4DTUA 3TO6A 2FQ3A 2IIMA 4K25A 1XHXA 4CHYA 1WI3A 3MN7A 3H9NA 1OOTA 1DDNA 4B1WB 1JCEA 4G6TB 1W97L 4G12A 4U87A 3AVLA 2FF6A 5CVIA 1EZZB 1D5YA 4O44A 1JHFA 2E5ZA 4F3QA 1Y56A 2E2IJ 2STWA 2CZ7B 3BY5A 4MO4A 3O3HA 4BC4A 4BVOA 2X85A 3L8BA 4CGIA 3PFIA 1GFDA 2MGQA 3CCMT 1S1NA 1HF0A 2X1DA 2BANA 4KGZB 1MH3A 5C6SA 2LCCA 3F9MA 4F14A 3MX5A 4CEQA 1NJIC 2Z2SB 1OCTC 2HQXA 5IT9Z 5AQSA 5E17F 4Z4HA 1VQ8Q 4XSZF 4RTUA 1S6LA 5D5XB 2JA6J 2F9TA 3KK7A 2PYJA 5ADXA 4OIQF 2WONA 2YJEA 2LH9A 3D5RC 4KGXB 4NOYA 4PJOB 1FYLA 1A36A 3REBB 3RMBA 2R5YA 3NEUA 1HW5A 3CQZJ 3EG9A 1YS6A 1T6CA 3HZ6A 1QHHD 1TQIA 3MKDA 1OX9A 4C2TA 2BVMA 2EQKA 1OV3A 1VQ5I 2EFQA 2XGEA 1LFUP 3DMJA 1I3QJ 4C3IJ 3LAKA 3I54A 2E5QA 4M6YA 2G8KA 3ZP5A 1YW9A 2M7BA 5GAOr 4ZTJA 1HYSA 2EA2A 1U2WA 2FE3A 2YLCA 3H0GJ 4LD9K 4XLHA 3ZL7C 1Y1WJ 2BZYA 3RNJA 2OZ6A 4CIFA 2W6KA 1XHZA 1LAWA 4HDUA 4CEDA 4MDWA 1KLMA 1KG6A 1IHWA 4I9LA 1FMKA 3TEEA 2BY3A 3M4GA 1MJ9A 4NO7A 2MYSA 4Q5SF 3HRGA 5B1BH 5ICGA 5C4XJ 1JJ2S 5IT9E 4Y13A 1YFHA 5C3EJ 1KU2A 4M75C 3NGIA 3DYAA 3A5NC 5IYBJ 3DOKA 4HTUA 2O9VA 2IS2A 5KHDA 3HKZA 2JW4A 4D8DA 3VRZA 1X1BA 5FKNA 2DY4A 2Y75A 3MDQA 4MO7A 1MNEA 3S1QJ 2DA7A 3VU3C 4YOQA 2F5TX 2GF7A 1A5JA 5IYCJ 2L7KA 1YVUA 2EIMH 3L3VA 2V1NA 3THXA 1YI2N 1X69A 1WZOA 2EWNA 4BI4A 3X20B 5GAOp 1VQMN 4X62K 2CV2A 2P9UB 1UE9A 1H8AC 3SQ2A 3W6JB 4GNIA 3CJ7A 2ZJQL 1NWKA 4YFXF 4X6AJ 3META 3QWXX 3S8PA 4KO0A 4LOCA 5B66C 3GVAA 3NTKA 3HL8A 3T1HK 3QAHA 1A5XA 3R6SA 4JKGA 5E3LA 5C4JJ 2L3SA 3CCLN 3EE9A 1IGQA 5ELZA 3CMMA 2H6CA 4H0PA 4EJTA 3VQDA 4OPAA 2Q3SA 1KYWA 4N9HA 3SXYA 3X24B 4IRIA 4CI0C 3SUPA 3U2RA 4P1WA 2IPQX 4B9TA 3M55A 2ZM6K 1LAVA 3ECOA 3AO4A 2ZNYA 2R5MA 2W57A 2ITMA 1JBMA 1JLGA 4IG3A 1AKHA 1TW3A 4C8QF 1JE8A 3JR9A 1N77A 3GG4A 5LD2C 5DY9A 5EG2A 2LP5A 2YNFA 2KFNA 3I0WA 5BPIA 2CP5A 1EWRA 2G8WA 4XKWA 4JI5K 2EV6A 1N8RC 4CA0A 3N5BB 3CCEA 1IXRC 4UNFA 4QQDA 2E5LK 4IHXA 2HHTA 3D2EA 4NYNA 1X58A 2EYWA 4BJ6C 2LLKA 2L89A 1TT0A 4DHYA 4PY5A 1VQ9I 1UECA 5AQWA 1X6OA 1YHQN 2DLLA 4FJGA 4Z89A 3P31A 4XKVA 2GIZA 1P7MA 4KHQA 3AVIA 3ASMA 3CJRB 4R79A 1XTDA 3H3UA 2GCXA 1NGAA 1I27A 3DB3A 5LJ3g 3J81Z 1YJWQ 2ED0A 2X9HA 4E89A 2EA4A 4BRPA 4LC9B 2AK5A 2JG6A 2KW4A 4CJRA 5HY6A 1YJWT 4N0BA 1K8AO 1VSEA 2HYGD 3AKZA 3TO7A 5GANh 2CWEA 1AVZC 1BM9A 2E1CA 1PUEE 2QLZA 3EGXB 3ZQ7A 3VRYA 3RPQA 3GL1A 2O8EB 5I2MA 2RI2A 5GAN7 3OIQA 3RESA 1EP4A 3A01A 2IGOA 2DL8A 2IVWA 3BJOA 3J7AF 2M3AA 3AY9A 3NPFA 2R0QC 1REPC 4LLNA 2TDXA 2DYSH 2XMFA 3SFIA 3LWHA 4RM3A 5DM7F 4AFZC 3Q9SA 5AQLA 3K4JA 4BRIA 3JAMZ 3BR6A 2WV1A 4J6WA 4DEXA 2W41A 1W5SA 3MPUB 2BZXA 1R5HA 5FO5A 1F36A 4M7AC 1KGSA 3S93A 4XR6A 5EDNA 2EX3A 5BQTA 3N4MA 5CKHA 5M9OA 1IRFA 3VS6A 4H5NA 2QTDA 1XQPA 2WACA 4ESBA 3LSIA 2ZC2A 4Y1CA 3I5RA 5KH6A 4WXCA 2EZIA 5E1XA 2Z16A 3LSGA 3MEWA 2QM3A 2DA5A 3CP8A 2IG0A 4LH4A 1J59A 3O2PE 1R5GA 3VQ5A 2X9DA 4GV6A 4E7JA 3BP8A 3OS1A 1DU6A 4B9LA 2FA5A 1U2VA 2XKOC 1ZRCA 1YVNA 5ECAA 1QZ6A 2KYMA 1MW7A 4LITA 3EGDB 5CHZA 3BG3A 1NLOC 1R0AA 3WXIA 3PIOL 3AA5X 4W1UA 2I5WA 1VQ7I 3WGGA 1JL2A 3CJAA 3X28B 2IVMA 1LWVA 4B4CA 2GFUA 4G1QA 4A53A 3ZMUA 1DGRM 2OUMA 4Z4CA 1TTHB 2XHCA 3TARA 2UXBK 1WSEA 4J83A 1BOAA 3VMFB 1E4GT 2QSGX 3QYFA 2L4MA 4BU2A 5JR3A 2P8TA 3RQIA 5M5XJ 3ZMVA 3AVGA 3OOUA 1NK4A 1C6VX 1VA7A 3OYYA 1O3SA 3WG7H 1JXOA 1GLNA 1PP8F 2OTJQ 3H5RA 3CCUN 3D0SA 4O8UA 2HBKA 3LFUA 4QVCA 2VB6A 2CUEA 2ZF5O 3H41A 5KCMA 5EG0A 2Q0RA 3FMSA 3K9JA 1B1BA 5GAOl 2CGPA 2H1LA 2KJCA 3E0JB 2YNHA 4BEHB 3EKSA 1N34K 5GAHP 3U3GA 3PFYA 3NVMA 2LY9A 3H0DA 2QW9A 3KD5E 3DXMA 3P1GA 4QOZB 3GF2A 3KETA 2F2WA 5T7BA 1Q9YA 1BW6A 2ZJRL 3VS4A 1AWWA 1JJ8C 4FE4A 3KEQA 3RYRA 1GVJA 5LGUA 5DD4A 1SC7A 1L3LA 2GNCA 1XNQK 4G8XA 1NBEB 2A1RA 4BQLA 1I1SA 5KYXB 2NOEA 3D2FA 3ESWB 3BGRA 3BPVA 4NDLA 2R7FA 3SAHA 5AZJB 3S3MA 2RF0A 3QEXA 3K4CA 1SSFA 1WHUA 4G7HF 1WZ2A 2QWNA 2P81A 3ZQCA 4ELYC 4HV5A 4FL6A 1VQ6I 1GCQA 3S16J 1VIEA 2RPIA 1HYVA 4EGZA 4YIRX 3WNFA 2VE8A 2LK2A 4AIJA 1RBSA 3M8RA 1WSUA 1MNDA 5FU6C 2KGTA 1Z1DA 2OZUA 4LFCK 2EKOA 3IUOA 4XN0A 2VOOA 3RR7A 2PZ1A 3SHFA 3D1NI 1U5TA 4OVLA 4H5RA 5LJ5f 2NVXJ 3TSPA 2FXAA 2CP7A 3ZFJA 1Q7YC 3LDOA 3TABA 2NAZA 1BI4B 4F17A 1UHFA 1RAAB 4M63C 3E9PA 2MSYA 3ZX3A 3DXMB 1J2XA 3BCBA 3CC2I 4DA4A 2QQ8A 3Q0UA 4CJ4A 2L9SA 2A6TA 2L7ZA 4EJUA 4DSIA 1TWCJ 2P5VA 2GOXB 9ANTA 1VQ4A 4C8QG 1Y57A 2HZDA 4B8XA 3ZX0A 3TTDA 3UE5A 2LSNA 2I5UA 1VSKA 4JKFA 2PUOB 3JRZA 4ELUA 1VQ4T 2UU9K 3CO7C 1NYFA 4WK8F 3VGLA 3QBWA 1QVTA 4N0AA 2HBMA 2ID3A 4B9XA 3CPEA 2RKIA 4BUPA 1XPXA 3AT1B 4CC3A 5J3LA 5F0HA 1VQPQ 4B9SA 1KC8O 3LQRA 1MWKA 2CT3A 1R22A 2CG4A 2WSEE 1QVGM 3L4QA 1VSIA 2NRAC 1NK0A 2EPDA 3ZT0A 4RAZA 4GFBA 2HHHK 3BLYA 3K9TA 1VQ4N 3BF1A 3KLGA 2FD5A 3RKYA 3PQKA 4JI7K 3NAEA 2NUBA 1XMKA 3SNNA 3KK1A 4H0OA 1XC5A 1WJRA 4JI6K 3SWNA 1NGIA 1KQSM 1SD5A 3NFCA 1YQAA 2L02A 3VQ9A 1TK0A 5I9EB 1FBUA 3O5BA 4DYRA 2QQ9A 2Q0OA 5FPEA 2SEMA 1BN5A 3CCRA 3QWLA 3OR1C 2FSKA 1JKQC 1IBMK 3QU3A 5E79C 3M4OJ 3QDFA 1X19A 4LUDA 4ZYDA 4YDUA 2DXCA 2NUPB 2ME6A 4EMKC 2K9MA 2D45A 1TWFJ 4UY8I 4KH6A 1WSGA 1SF9A 1FIAA 1OCZH 3SUOA 3KLEA 3QOEA 2I10A 3QG1A 4E9GA 3EUKL 3ZETB 2BE7D 2VONA 3CUQA 4FU6A 2Q36A 2BZ8A 1X2MA 4PFOA 2JMWA 1EXQA 4FWOA 4RB1A 2Z1GA 2OPPA 4DQ8A 3FX3A 4WFBL 4F4KA 2GBYA 3O3GA 1D9FA 2Y31A 1D8KA 3OJUA 3FXOA 1KJWA 4C92G 1NJIO 1BG3A 2F48A 2D6FA 1D9DA 5CR4A 5AZIA 1IDZA 1EX4A 3MKZA 3ZBDA 4G6QA 3CCQN 2E7XA 5M1QA 1H3ZA 1JQQA 3VEPA 3HUGB 1OYWA 3HHHA 3ZT1A 2I8DA 1KYZA 1TTYA 2W7NA 2QASA 2FOKA 2OF7A 4JK8A 5AQNA 3CBOA 2V51B 3G6EN 2Y30A 5CVUA 4W5NA 1Z9QA 4C3HJ 1P59A 4FT8A 4M42A 4CCHA 2LRDA 1TQMA 3VQ6A 2P9LA 1YI2T 1POGA 1ZELA 4I7FA 2L7FP 2HZTA 4DR3K 4C92E 4M3WA 1JGSA 4IRGA 4B3XA 1W70A 1JKHA 1TWBA 1KZHA 2FEIA 2M51A 5GJWB 4FPBA 1NJXA 2M4GA 4FJIA 4DGWB 4IURA 4ELTA 4A3IJ 5JS2A 5KE2A 4DMNA 5AONA 1K79A 4BXFA 1B9MA 2PFBA 2L3PA 4WFAL 3E19A 1F21A 2QA4N 2EH3A 1VUBA 4M3DA 2M0YA 4M7XA 2KHMA 1HYZA 1USTA 2VWJA 2CO5A 5JHUA 4EVIA 3PX6A 3UA7A 2KL4A 5AIPA 4I7HA 3LYIA 1ZKGA 1L0OC 1UG1A 1M1GA 3BW1A 4A3CJ 4C1NI 2CH6A 3QP6A 4M9ZA 3A0BC 1NYGA 2H27A 4O8KA 1C0UA 2NS0A 2CS3A 1JT0A 2JM9A 3KYLA 4AVPA 1ZREA 1S8NA 3BJAA 3ASKA 1D0YA 4E6KG 1YJNT 4NQWB 3QB0A 2RVCA 3HKZN 1RL2A 3KUFA 4N41A 1OX8A 4X9CA