4BE0A

Pfv intasome with inhibitor xz-115
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be0A03
2HVHA 2AJQA 4W5QA 2OPQA 1N5YA 4CFAA 1SV5A 3ZCMA 3DYAA 5J2NA 4OJRA 3DLRA 1WJSA 3PMTA 1FK9A 2RKIA 3UWNA 4DTPA 1UOCA 5D6XA 3K5MA 1RT6A 3M8QA 3NTIA 4DSFA 1DTTA 3LPUA 3H6ZA 1T03A 3L42A 4CJRA 2HMIA 1JLEA 4E89A 1F21A 3OA6A 4GVMA 3OYKA 1G5VA 2NLUA 2F5KA 4RW4A 1VSJA 4N56A 2RJEA 2K3XA 3KLEA 3VQ6A 1B9DA 3I0SA 1S1WA 4LSLA 1TL3A 2YNIA 1VRUA 1CXQA 1ZBLA 3HSTB 4A4EA 2YHAA 4PWDA 4N76A 3LP2A 2DFEA 3AO5A 1OI1A 2E6LA 1TK0A 2VYTA 3OJSA 1QSLA 1NJWA 3KLHA 1SL2A 3DRRA 2HHUA 4DTJA 1SSFA 1TKZA 1RDCA 2RI2A 3VA3A 4IUPA 3O3HA 3PFSA 1C0TA 3NCIA 4CGDA 3RR7A 4M3UA 3PO4A 3OQ5A 1D5AA 1L5UA 3LALA 3I8DA 1QQCA 1HYVA 4CEAA 1WN7A 5K14A 1KLNA 3QNOA 3AO1A 2G8VA 2GF7A 3L2RA 4XIUA 2FC0A 4LH5A 4EP5A 4DSEA 4CIGA 4BWJA 5KE3A 2R58A 4DSIA 4FLVA 1BI4A 4FW2A 4RW7A 4NYFA 3BDLA 3PMIA 2ATQA 3ME9A 1J9AA 1MHNA 3OMCA 3V9SA 3ZSZA 1OZ2A 1HNVA 2KFNA 4JLHA 1FKPA 4FM0A 2IAJA 2PY5A 2YV0X 2YRVA 3LZJA 4IG0A 3EYZA 2DTUA 4E1NA 1NK0A 3NGYA 1Z25A 4CEBA 2G8KA 4OKJA 1XHZA 4AHVA 3M8SA 1NJYA 2P5OA 2HHVA 3QEXA 4M45A 1BQMA 1QSYA 1H3ZA 2OZSA 5CY4A 2HNYA 1K6YA 3ZSOA 1TAQA 2ZE2A 1IKWA 3OVNA 2E6MA 5CZ2A 1UAXA 4E3SA 3VQCA 2HQEA 1JXEA 3VQ5A 1RT1A 2HHXA 3AA3A 3HPGA 1HJRA 3KK1A 4IURA 2O4XB 2DIGA 5J1EA 3AVCA 4CK3A 3NTHA 1IKXA 3V9WA 3SI6A 2P1JA 1YTAA 2DIQA 2IGIA 4HUFA 2BDPA 4CJEA 2X35A 1S5JA 4LD6A 3LPTA 5CZ1A 5HRSA 4DU3A 4RW6A 3MEWA 3UT1A 1HNIA 3S3MA 2P51A 2W42A 1VSKA 3AVGA 3WNHA 2PYJA 2KFZA 4N4HA 4GY5A 3AVHA 5CIUA 2FBVA 4C8NA 4OLBA 4OVAA 3K58A 1KTQA 4YFUA 1W9HA 4DMNA 2G8IA 4FLYA 1Q9XA 5D6YA 5JS1A 3O4QA 2GUIA 1TGOA 1RBTA 4M3TA 4I7FA 1JLBA 3C95A 4E7JA 2Y1JA 3HP9A 4CJ4A 4B9MA 1X1PA 2RHIA 4CCHA 3QIIA 5HRNA 3V4IA 2B8AA 4F8RA 3OYMA 1WSGA 1C0MA 3KUFA 4DG1A 5KTQA 3NHGA 1D8YA 4HTUA 1XNIA 2ZD1A 4MQ3A 3HP6A 1UWBA 2L89A 4I9QA 3VA0A 2E5QA 2L3RA 3ZSQA 3HT3A 4KKOA 3C4SA 4UQGA 1O1WA 1KFDA 3AVAA 3V9XA 4F4KA 1EP4A 3V1OA 1S1TA 1RDBA 1S9GA 5JS2A 3L2UA 2WONA 4FLTA 2OYQA 3DI6A 1IO2A 3LX7A 1Q8IA 4QQGA 3KIOA 4KAZA 1KVBA 3LP0A 4BDZA 5KI6A 1BGXT 1NK9A 3VQDA 2D0AA 2P5GA 4LH4A 4QW2A 4A4FA 3L3UA 4Y1CA 3MEGA 3U3YA 3TABA 4KTZA 3U3GA 1WJRA 1ZYQA 3DM2A 2FBYA 3L2QA 1U4BA 4FVMA 3DLHA 3OYNA 4B9LA 1WAJA 1RCHA 1SKSA 4CJSA 4CF0A 4KV8A 4DFJA 1NOYA 4B3OA 2X6SA 1RTIA 4KHYA 1TKDA 4IFVA 1CZBA 4H8KA 4RW9A 4OGCA 3H8ZA 3SCXA 3TAFA 3B6OA 3LP1A 3K5NA 3PX0A 4NZGA 2A1SA 3HK2A 4AHSA 1TAUA 1RI0A 4KPYA 4N5SA 4FM1A 4F2RA 2HNZA 2M16A 4O5BA 2LVMA 4M42A 4IUQA 3CEYA 3V9UA 3AVMA 1UA0A 4CFCA 4DS4A 2QKBA 4KREA 4OKEA 1A5WA 1KLMA 2LDMA 3BDPA 5CYMA 4CGFA 4FLWA 4DLEA 5C6SA 4H4MA 5SWMA 3EY1A 2IOCA 4BWMA 3OYCA 2HHQA 2RPIA 2X6NA 3AVKA 4OKKA 3F9KA 4DSLA 3MEEA 3TAGA 2RJDA 1TL1A 2EFIA 2EQKA 2ETJA 3KK2A 3H08A 1NKBA 3AVJA 5D3GA 4FJ5A 3TR8A 2FHDA 3LP3A 3VQ9A 4JS4A 3LANA 3S6WA 3NH2A 1I39A 2X4YA 1R0AA 1Y97A 4I9LA 4Q0BA 3SQ4A 5DMRA 5KGWA 4PUOA 3SUNA 4CJTA 3P5JA 4O55A 4Q5WA 1XI1A 2D9TA 5KCOA 4FCYA 4L59A 1HMVA 2MWPA 3E9FA 4E7HA 3O8VA 2G3RA 3CYMA 3OYDA 4BDYA 1VRTA 3K5LA 4RW8A 4FYDA 2E4LA 2XY8A 4JRPA 1WSEA 1RTJA 2CKKA 3AA4A 1NK5A 5KRSA 1L3VA 3M8PA 5M9OA 2O4XA 3OYAA 1TV6A 3RTVA 3SUPA 3MEAA 4B8AB 5HLFA 3VQQA 1VK0A 3AVFA 3D45A 3ZSVA 1QSSA 4IFYA 3CM6A 3PNWC 2LRQA 1YT3A 3L3VA 3SPZA 4C5HA 4R5PA 2QXFA 3PX4A 1VSHA 3IG1A 2X78A 3MP1A 4O44A 3OYBA 4UC4A 3MAQA 4W5TA 4N4IA 3AVBA 1QHTA 1S1XA 5KGXA 1YVUA 1RT4A 4BDPA 1RBVA 3QERA 2GFUA 3MO8A 3CM5A 3K59A 1RDAA 1NKEA 5FROA 4ID5A 3LLRA 4KTWA 4EZ9A 3KKSA 2EKOA 5I42A 1FKOA 4PA1A 4QOZB 5SZTA 4B08A 4Z4CA 1KSPA 3PX6A 3S3NA 3PV8A 3NBPA 4CJ5A 5EU7A 4E7LA 1TKXA 3OYLA 4KB1A 3DB4A 1BHLA 4CHOA 3UIQA 5KCHA 4CF9A 4J2AA 1SL1A 1I3AA 1RT5A 4B9NA 2F96A 2WOMA 2BE2A 1N6QA 2YNFA 3SZ2A 1ASVA 1XC9A 3ZSWA 3JYTA 2OZMA 5DK5A 1KFSA 2JGUA 1DLOA 3OYFA 4CEFA 1W0HA 3KLGA 2BGGA 4CERA 1HQUA 3M8RA 3MXMA 3DLGA 4CE9A 2Q3SA 4C8OA 3THVA 2OPSA 2RJFA 4HVJA 3IRXA 1LAWA 4PQUA 2F8TA 4N4GA 1EXQA 3OYEA 2PZSA 3ZT3A 3VQBA 1J53A 4G1QA 2R57A 1JLFA 4CEEA 4NS5A 2DY4A 4F2SA 1EX4A 3V1RA 3O4NA 2RF2A 4J2EA 1VSIA 4C5GA 3OB9A 3CFRA 1GOAA 4KI6A 4CESA 3NAEA 4Z02A 2X74A 1IKYA 3QLHA 1S6QA 1JLQA 4HCZA 1NK6A 4KHSA 2DFHA 1XHXA 4M3XA 3VQ8A 1RBSA 3LDSA 4K8ZA 3SPYA 1A5VA 1CLQA 2GFAA 3HL8A 1LAVA 4FJIA 3ASMA 4DQRA 4FLUA 2XY7A 2B6AA 2RHZA 1L3TA 3I0RA 3VQ7A 4DQQA 3AVNA 3ZEHA 1WGSA 1QS4A 4H4OA 1MU2A 4AHUA 4O4GA 1ASUA 4ZHRA 1RTHA 2EQUA 4FJGA 4CGIA 4FJNA 1WAFA 4M41A 4ZTJA 4IUUA 2VWKA 2RN2A 4Q5VA 3RMBA 1LV5A 4Z0UA 4CGHA 3RMCA 3ITHA 4YNQA 4AH9A 1C0UA 1RILA 1C1AA 3PY8A 3NF6A 1ZBUA 3CFPA 4KRFA 1WNSA 3T19A 1RBUA 3TWHA 2LCCA 3KJVA 2A1RA 4BD3A 4DFMA 2YNHA 4QAGA 4GW6A 3ASKA 3CG7A 3V81A 1BISA 4E7KA 1REVA 4CJPA 4E7IA 2JZ2A 4EP4A 1Q9YA 1RTDA 1SKRA 1TVRA 2IC3A 3NDKA 4B9WA 1C6VA 4LSNA 2HW3A 3CQ8A 2RI3A 1JLCA 3HVTA 2K3YA 3KKRA 4E1MA 3DMJA 2NUBA 4CFDA 4M3ZA 1X9WA 4KB0A 2QQSA 3O3GA 1CXUA 1HRHA 2G8HA 1ZBHA 1NJXA 2OPRA 1GOBA 3T1AA 1U48A 3DLMA 4CJFA 3AV9A 2PYLA 4KFBA 3NNQA 1NOZA 5FDLA 4BE2A 4CRIA 5E41A 3LWMA 4RG8A 1LW2A 5I3UA 4B9TA 1WJQA 4FU6A 4IBNA 3DLEA 5FRNA 1ASWA 4MFBA 1RBRA 5C24A 1LWCA 4FXDA 2EQMA 2Z1HA 2IG0A 4CJLA 4PY5A 3P8HA 3NFAA 4CJUA 4FJJA 3HM9A 1B9FA 4AHTA 3AVLA 1C1CA 4FJKA 3MECA 2BIVA 3WNGA 3C6TA 3VQEA 2KQ2A 2M0OA 2L8DA 2I5JA 2YHBA 1FXXA 2R5AA 4M3WA 1C1BA 3V6DA 3S9HA 3F70A 3NTKA 2B4JA 4ICLA 1T8EA 3HXMA 3LAKA 2QQRA 2XHBA 2HNDA 3OMGA 1NKCA 3C94A 3C6UA 3K5OA 2R7YA 4C5EA 4KI4A 3MP8A 3TAQA 1IG9A 2HHSA 3DLKA 2HQXA 2YNGA 2YKMA 1UA1A 2RI5A 5HBMA 4CECA 1DTQA 3META 4DS5A 5C25A 3QNNA 2R5MA 5J2PA 4B9UA 4M3RA 1HQEA 1L3UA 1SL0A 1TK5A 1VSEA 3HVRA 3K2PA 2KZZA 4DTRA 1JLGA 4M3YA 4FJLA 3O3FA 4GMJB 1KVCA 1A5XA 1KVAA 2BKDN 3ZSXA 5J2QA 4ID1A 4TSXA 3EAEA 1VSLA 3E9GA 4QQDA 3G10A 3ZT4A 4CF1A 3DB3A 3FDRA 3ZT2A 1D9DA 3SV4A 1JLAA 4AHRA 4FJ7A 3NH0A 3QJ6A 4CFBA 3U6FA 3G0ZA 2LTOA 4N41A 3LGLA 2WACA 3OS1A 2OPPA 3MXJA 3KD1E 4OGEA 4X34A 1HYSA 1WSHA 3TAEA 1JKHA 3SJJA 4CK2A 2DFFA 1SUQA 4CJ3A 3V9ZA 1NK4A 3A2FA 2RHUA 4DFKA 2KZMA 4CEOA 1S1VA 3OYJA 3JSMA 1KHCA 3RRGA 3RR8A 3NGZA 3QINA 3NE6A 4DQPA 3AVIA 2D5RA 2XK0A 3CFOA 4LY7A 3MP6A 3SQ0A 3B6PA 5CYQA 3D0PA 1JL2A 4OLAA 4CJVA 4B9SA 5C42A 3QETA 4FLXA 4Y1DA 1VSFA 3L8BA 3KTQA 1YTUA 3S3OA 1BL3A 4DTNA 4II1A 4I2PA 3HPHA 3ZSYA 5HROA 2X4XA 2O4IA 3TAPA 3Q1JA 4CIEA 1HYZA 4FK2A 3QEIA 3HO1A 3MEUA 2LSNA 3LAMA 4PLIA 4DF4A 1RNHA 1LWEA 3NH1A 3HJFA 3ISNC 3PO5A 2XDPA 2RJCA 2DAQA 3L2VA 1S6PA 4O0IA 3P1GA 3K57A 2IDOA 1KCFA 3NF8A 2ITGA 3TAMA 1ITGA 1OZ3A 3EZ5A 4CEZA 4FM2A 5J2MA 4CHZA 3WNFA 1NK8A 4IKFA 3NF7A 4FJ9A 1LW0A 4KHQA 3L2WA 3QESA 2OA8A 4Z4IA 1G15A 2XRIA 4CHYA 4O0JA 2HHTA 3OYGA 4NCAA 3RMAA 3KLIA 1X9SA 4F3OA 1WSJA 3SV3A 3DOKA 4PL6A 1NJZA 4FLZA 4KHWA 2G8FA 2JTFA 2M1HA 4PLLA 3GOXA 4DQSA 4W5RA 1RT2A 1BCOA 4KHUA 4Z4EA 4CJWA 2E6NA 2G8WA 3PUFA 3V1QA 1RT7A 4HHTA 4W5NA 1Z26A 2VWJA 1HPZA 4CJQA 5KE2A 4CIFA 2IS3A 2FBXA 4HCCA 4CK1A 4C8MA 4F3TA 4FK0A 3KLFA 3ZSRA 4NCGA 4HUGA 3P8DA 4FZXC 4CGGA 1S1UA 1SKWA 3IS9A 4CF8A 2JLEA 1BCMA 5FRMA 1B92A 4CEQA 5T7BA 1EETA 4CHPA 2X4WA 2QK9A 2Z1GA 4DLGA 2RHXA 5IN1A 4I2QA 4DSJA 2GBZA 4KHNA 2D0BA 4DF8A 1U49A 2G8UA 2HB5A 4CF2A 1U47A 5C0MA 1D9FA 3FFIA 2KW4A 1TKTA 3QIPA 3DOLA 3QIOA 4DQIA 4ELUA 4ZTFA 5HRPA 3HPOA 2MWOA 3OY9A 2FBTA 4NCBA 1IH7A 3AA5X 3VQAA 4JRQA 4L8RB 3FEOA 2RO0A 2Z1JA 1L3SA 1LWFA 1T05A 3T3FA 1S9EA 3AO2A 4WE1A 4C8LA 3QO9A 3RMDA 3LH0A 1RDDA 4CHQA 4OPKA 4FJ8A 3LWLA 3DLBA 4EZ6A 4CGJA 3KK3A 4DTOA 3AA2A 4J2BA 3MEVA 4E0DA 4KO0A 1BIZA 1CZ9A 1T7PA 1WSFA 3OJUA 3ULDA 4IUTA 3SQ1A 4C8KA 3MXIA 3FC3A 4JS5A 4DU4A 4DWIA 3SYZA 1XWLA 3MEDA 4N47A 3VQPA 3TANA 3FLGA 4B9XA 3KD5E 4AHCA 3LZIA 4DTSA 4NYNA 4ELVA 4CJKA 1TK8A 3SNNA 3SUOA 3OS2A 1BI4B 3OS0A 5HP1A 3QEPA 4A4GA 4IG3A 3RWUA 3IAYA 4AILC 3QEVA 3M9QA 4FW1A 5D6WA 1VSMA 3ZT1A 4Z4HA 2B5JA 3TARA 2XO7A 4FJXA 2Y1IA 3BGRA 3P83D 2YKNA 4QVZA 1OYXA 4A4HA 4FL6A 2EQJA 2PQWA 4QCLA 3VN5A 4Z4GA 4CEDA 4EDUA 2BUDA 4HCBA 5J26A 4DSKA 4BACA 3NF9A 4KTQA 1JL1A 2VG5A 5KRTA 3TI0A 2GV9A 3QKJA 3LYIA 1J54A 1QE1A 1N27A 4DTUA 4DU1A 4FJMA 3RRHA 1BQNA 1WLJA 4HUEA 1NK7A 2BANA 4E19A 4OVLA 3QBYA 3SUQA 1KRPA 4DFPA 4OPJA 3ZT0A 5HRRA 3AO4A 4RG2A 2VG7A 1X9MA 3LGFA 2F8SA 5J39A 4FJHA 1U45A 3OYHA 2EX3A 4FK4A 4ELTA 4K8XA 1ZBIA 2XY6A 3QEWA 3SQ2A 4DTXA 2RHYA 4BE1A 1IKVA 3VQ4A 3NGIA 4LD0A 2VG6A 2O4GA 3E01A 2EHGA 4C5IA 4Z4FA 4CHNA 2XY5A 1GOCA 3DRSA 4J2DA 1RT3A 3F73A 4DTMA 1JXBA 3WNEA 3SD4A 3HYFA 2HHWA 2P0KA 3ALYA 3AO3A 5KH6A 2D0CA 2Z1IA 1QTMA 3OYIA 4FZZA 4QQ6A 2KTQA 5IAYA 1U04A 2ZQBA 1J5OA 1VSDA 4B9VA 4IDKA 1EKEA 2QKKA 4FZYA 4W5OA 4IUVA 2HVIA 1WSIA 4BE0A 3DRPA 1BIUA 4B8CA 1ZBFA
chains in the Genus database with same CATH superfamily
2HVHA 2L3QA 5JLHA 2O61A 3REBB 4JUVA 4W5QA 2FEIA 1MGTA 3ULEA 1EWQA 1BL0A 3IDHA 4EMSA 3VS2A 1ZTRA 3UWNA 1Z91A 1U5TB 2FE3A 3K5MA 3SHFA 1MBHA 2ZKZA 3NTIA 4LOCA 3HRMA 2DPNA 4FL9A 5ILVA 3OL3A 2Q1ZB 2KKOA 1YX3A 3GTKJ 2JVVA 1T03A 4IRIA 1R5HA 1JLEA 4DYRA 3OA6A 3E2UA 1G5VA 1F1ZA 4BJ6C 4YOVA 3QICA 4CC3A 4B1UB 4LDUA 2WA0A 3WGIA 4M3FA 4LE9A 3CMYA 4C1NI 1QKXA 1E17A 2F5VA 1ZBLA 4A4EA 1HOMA 1W4MA 1TP4A 1VYTA 3DXKB 3URGA 4N76A 3VEPA 1JKOC 2HR3A 5GAN5 5LY3A 4BRAA 3AO5A 2A36A 2E6LA 1M2VB 1TK0A 5CK9A 1TXQA 2NOZA 3VSLA 1EBMA 2I7NA 2CGLA 3DRRA 2ID3A 3JSPA 1YN8A 2IGMA 1YJWI 2CW8A 3HJEA 2JT4A 2MYSA 1K73C 3SYTA 1M3BA 1KG2A 3HDDA 4XLPF 1YBYA 4JKDA 1C0TA 1OH6A 4M7AC 5L23A 3PO4A 1L5UA 3DU5A 3CCRA 1XTAA 3KTUA 3FZMA 1G4DA 4CEAA 2W7NA 2Y48A 3C2GA 2ZJQL 5KPTA 4L5IA 2OANA 2PFBA 4BY1J 1A31A 1K73O 3AO1A 1YCYA 2IVMA 3L09A 3L2RA 4XIUA 3KX2A 1H89C 4BRPA 2LX7A 2GLOA 3IH4A 3FB9A 4DSEA 3ZL7C 3VWBA 3ASOH 2V8KA 4PL8A 2R58A 3DLLL 1M1KR 4DSIA 4FLVA 4IXCA 3HYIA 4RW7A 1R58A 2Q0RA 2UXDK 5EEAA 1FMWA 2QF7A 2ATQA 2KY9A 1J9AA 2DA2A 1WLPB 2JK3A 4IHWA 2NOIA 2DL5A 1FNNA 3H0DA 4PKHA 1SD7A 4LFCK 1K4SA 3QP5A 2P9LA 3TSUA 5FLXZ 1UHFA 2MCNA 2F69A 2IAJA 3H46O 5HVQC 1JKPC 1LWWA 4RWTA 2NOLA 2A5XA 2DTUA 2WTUA 2BXZA 3NGYA 5GPCA 4IO9F 5JHUA 3ZX0A 4OKJA 2LSOA 2BEOA 2LD5A 5AQTA 3ESWB 2P81A 2IA1A 5DM7F 2Z99A 3AG1H 2P9KA 5HOOA 4E7SA 2HNYA 4ZYDA 1MWKA 3J80Z 3GLLA 1TAQA 3I59B 2P9UA 2DAOA 1W97L 4XR6A 1X19A 1UAXA 4RM3A 4E3SA 4B9QA 2DILA 3X20B 1RT1A 2QSFX 3GMEA 3HPGA 3LAPA 3HGGA 1NGBA 3KK1A 5GMKi 3F9MA 2HHHK 4BEHA 1K9MR 2D1XA 5FWBA 1R1VA 5J1EA 3O9UA 2DRMA 2VC0A 5L3CA 2G6FX 2DIQA 2IGIA 4HUFA 2GQIA 2XD0A 5AQFA 1XSDA 2XPVA 2Z33A 4N9HA 5CZ1A 5GAN6 4NL2A 1UGSB 1HNIA 2BE5F 2P51A 2EA4A 1VSKA 2AQEA 4EGYA 1QVGP 1ZARA 3L4IA 2E2QA 3F8CA 3D0SA 3R4KA 3UA7A 1RPWA 3EKSA 1QHHD 1UTIA 2CS7A 4XQ3A 3U21A 2A68F 1GXQA 4ON0A 3LM2A 1YJNQ 2GNCA 5GANj 2J06A 3K58A 4ITVA 3HHTB 2JN0A 1W9HA 2DQRA 3THYA 4FLYA 1P4WA 1Q9XA 5E3LA 2VJIA 3KNTA 4M77D 4CSWA 2HAXA 3G4SA 4JKAA 2HBLA 3CCRI 4IL6C 4KICA 1M1GA 2YU9J 1TNTA 4CZEA 1K61A 3SWNC 1MJBA 1M2OA 4BS9A 4J8FA 2AQFA 1JLBA 2ASMA 1K78A 1P4AA 2QM3A 3M5RA 3QXEB 2EPFA 3BY7A 4CJ4A 2W41A 5GAMj 1U8BA 1ZG1A 2V1NA 5GIOA 2EWNA 1QMCA 4ATOA 3CLQA 4F7UF 1KXPA 3E7LA 3QIIA 1YJWN 2XB5A 2B8AA 1C0FA 1QVFM 3SDBA 5FLVA 1WHGA 1C0MA 3CCSI 2E8AA 1ZQ3P 3D7EO 2NRTA 4M7AE 1F36A 3SMPA 2F48A 3L1AA 2AXTC 3N0UA 3TU4K 1U5TA 2ADUA 1CF7A 2YG9A 5LJ3j 4BRQA 1VQ9Q 2OAZA 2WWYA 3JB9H 3HSRA 5CJ9A 3QWLA 4EVVA 2MI6A 2HQAA 2E5QA 2L3RA 3VA0A 2FRWA 3PIOL 3G6ET 3V9XA 2A07F 4JNEA 3PSIA 3V1OA 5J8CA 1VQ8I 5GANf 2ZPEB 4ABZA 3KLOA 2X1EA 1IO2A 3LX7A 2E88A 2IP2A 2VODA 1SMTA 1R1UA 1KG1A 4XTWA 3PL8A 4KAZA 1YG2A 4G6DA 2ZNYA 1OCCH 2CG4A 3DXKA 2OTLA 2E1MC 1EZZB 2FPDA 3DWLE 1BGXT 3CCUT 4M9SA 3W2AA 4LN2A 2D0AA 4FIBA 2P5GA 2KLAA 1M2VA 4LH4A 4IOCL 5CQGA 2BTFA 3I0XA 4ISEA 1BN5A 2DOAA 2F1LA 5CR2A 2O6GE 1FOYA 5GAMf 3K4BA 3JAMZ 1ATRA 1WJRA 1ZYQA 3DM2A 4FVMA 3DLHA 4PJOG 4B9LA 4LDXA 4CF0A 1NOYA 5KVRA 2QG9B 2DYRH 2PMUA 4YOTA 2V8JA 4H8KA 1XG7A 4RW9A 4OGCA 4CA0A 3B6OA 1WEIA 3LP1A 3SAFA 1FYKA 2V79A 3CQZJ 5LJ3f 2BY2A 4D8DA 1UELB 4EW4A 4XICA 4R56A 1HPMA 1O3QA 2W10A 4NHJA 3JTGA 1ZUYA 2O8XA 2WV0A 3MN6A 4IUQA 4CZGA 1VQKQ 3NQOA 4KREA 1KG5A 1KLMA 1OCPA 3MMYB 3CQYA 1F1BB 4A6EA 2A37A 2FQ4A 3MEXA 2DTZA 2BYVE 3BDPA 1SHGA 3D7SB 1M90C 5SWMA 2VYPA 1ZG5A 4RCCA 2DBMA 3AAQA 1YQMA 1RL2A 2FBIA 3AVKA 3TAGA 1WXBA 1TL1A 2EQKA 3KK2A 4LK0F 4XU2A 5HDKA 1VQNA 2Z16A 1V4RA 4A3MJ 1E6HA 3SLCA 1WUAA 2XAJA 3CCVQ 5DCMB 2ZXIA 2YS9A 3VB2A 4C2MJ 1FX7A 4ZZLA 1M90O 2ZZDA 1R0AA 4PSXA 2XGXA 3MD2A 2JHNA 4A5NA 1VQLQ 5DMRA 1UAAA 2FL7A 3TOAA 2ISZA 3GDQA 4Y28E 1XDSA 4CI0C 3SUNA 4ZZDA 3I58A 4Q5WA 3F3XA 5D5WB 1JE8A 1XI1A 4M3DA 5IT9O 2MWPA 3EYIA 2FNPA 3R2XC 3I59A 4XN0A 3O8VA 1D0ZA 3OYDA 1CKAA 3CCRN 4LXCA 1Z6TA 4RW8A 2I5WA 4FYDA 3GO5A 1K1ZA 3I56A 4BY9C 4HQMA 2E4LA 1X1BA 2NRAC 1VQ4Q 1N36K 4XKCA 2LF7A 1Z9QA 2K3FA 3AA4A 2UUZA 2EK5A 5M9OA 2JUCA 3CMAT 5C0YA 3SUPA 3IQLA 2BXYA 2UXCK 1ACIA 3FSPA 2EFWA 5GTIC 5I2MA 1Q18A 1QSSA 4HNTA 3HOTA 4JN4A 4RAYA 3CCSN 5GJVB 5HNHA 1DP7P 2LRQA 3L3VA 3U9GA 1KU7A 1B3QA 2X4JA 2CH4W 4J6XA 3OSFA 4R5PA 2LREA 5J1UA 2V7ZA 3SEMA 5AONA 2DCEA 1Y0NA 3F0CA 3V7SA 4OPAA 1YHQT 2BY0A 2F5TX 2LJ0A 3MAQA 3AVBA 1QHTA 5KGXA 1BI1A 1JHFA 3SJMA 2W40A 5IPAA 3ULQB 3PO2J 2EIFA 1RBVA 1W0UA 2HOSA 1I50J 2O5RA 1VQ8N 4J7IA 3CD6A 2K86A 4E6RA 2PJRB 4DR5K 3ULRB 1PU7A 1JJ2P 1W5TA 1NGEA 4HZFA 1EH6A 3QYHB 3BTLA 5I42A 4BY6C 1BBYA 2YSQA 2HBJA 2EV5A 3TP0A 3H92A 4PA1A 3I54A 2BE9B 1AWXA 3FR0A 4QOZB 2FBKA 5H6RA 2VASA 1F43A 3VESA 1RI7A 3QFPA 1S29A 3NBPA 1LNXA 2GXAA 3GFIA 2MF2A 1TKXA 4KB1A 5KYUB 4DZPA 1IBKK 4CHOA 3JCMJ 4HV5A 4CCNA 1Z67A 5M1NA 2VN2A 1RT5A 3GZ5A 2RHKA 3PFIA 1BU1A 1YQAA 3KFWX 1M5Q1 1TBXA 2YNFA 3SZ2A 1VQNI 2V9PA 3JYTA 2YRCA 4WQ5A 1AWOA 4KT5C 2PLYA 5B5EC 5AQLA 5LJ5d 4M78F 2FMLA 2CH5A 3MXMA 4PZJA 3M8EA 3QPLA 3PO3J 4CE9A 4PJNA 1K8AC 4C8OA 4M77F 4FWLA 3THVA 3CVSA 2CP2A 3KP6A 3A1PA 3S17J 3IRXA 4M7AD 4PQUA 4M4ZA 2NRVA 2ZXWH 4N4GA 1EXQA 1FZPB 5C2FA 3JV3A 2WSFE 2O8CB 1J53A 1Z3XA 3HBLA 3F72A 3RPUD 1K8AO 1VNDA 4NS5A 3GG4A 2OX7A 5IT9E 2NNNA 3D2FB 3ZQ7A 4J2EA 3GTGJ 2CH4A 3FM3A 2JWLA 1K4US 2A5YB 2CUFA 4XH5A 4GVEA 4J9DA 5D5XB 2QGUA 3NAEA 3HHGA 1YWOA 5H6QA 1IKYA 2LT4A 1S6QA 2OA4A 5L3DA 3AGKA 4JPBW 3CC2A 1QZEA 4G9ZA 3I5UA 2XSDC 4B4CA 4M3XA 3VQ8A 5EF6A 1JB0E 4CC2A 3F5TA 1A5VA 1R00A 2GFAA 1Q82R 2KRSA 5F0CA 1IBLK 4Y92A 1GLJO 2CZ1B 2W84A 4DQRA 1W4SA 4F7UB 1JJ8C 3O8HA 2RHZA 4NXNK 3HUGB 3I0RA 3JCMP 4B1YB 4RDUA 4UB6C 3T1YK 1VQ7A 1WFWA 4AFQC 4O4GA 1RTHA 4JI7K 3SZPA 3H9JA 1MH4A 2O9VA 2V1RA 5CHZA 4H0VB 1S6LA 3VW4A 1ZX6A 2F4VK 3VS6A 3HKZN 4CGHA 3RMCA 4A3CJ 1M1FA 5DCMA 1E7OA 4YNQA 2VKEA 4RBOA 1MPGA 1C1AA 1TUCA 3NF6A 5HK3A 3CW7A 3KZYA 4O8KA 5A0LA 3WXMB 2GGRA 3CCLI 5KN8A 1HUXA 3V81A 1SVOA 4CZMA 4LITA 4QWQA 3KP7A 2Z0WA 2ECBA 3IHOA 5HK0A 1GCPA 4HRIA 2JZ2A 3TVTA 1Q9YA 1ITYA 2M51A 3X26B 5KNLA 4ELYC 1YYVA 4OPHA 1P4XA 4KUMA 1C6VA 2HKXA 1DPRA 2EPDA 1ETWA 3JB9D 1B9NA 3HVTA 4K43A 5M3FJ 1WQ7A 2LDUA 3T0YA 4BR0A 4YTLA 2FPEA 2PBDA 3LSKA 2Q2RA 3C2HA 3O3GA 1OQKA 2QSGX 2R7VA 1HRHA 4C8QG 1TUDA 1Q1VA 3ZRGA 3FGUA 3JRFA 1O3SA 2KZGA 2W6LA 2FPFA 2G8HA 2ZJQF 3M4OJ 3ECOA 5JVTA 3DLMA 2QW9A 1YI2A 4CJFA 1APLC 1PVSA 4A0YA 4EJOA 4A3KJ 4KFBA 2JSCA 2Q2EA 5H1SQ 1NOZA 4EJZA 2QKMB 5FDLA 2E65A 3VF6A 4IHYA 5GAN2 3DLLF 5E41A 1VQNN 1BUPA 2K5FA 2HD0A 3LQRA 5JLXA 2XRLA 5I3UA 4A0XA 3DLEA 3R6OA 4KGXB 4C0FA 4MFBA 5C24A 3NAUA 1LWCA 3Q9SA 4FXDA 2PJRA 1IN4A 2Z1HA 4PY5A 2RA2A 3P8HA 1HQCA 3NFAA 4CJUA 4FJJA 3AVLA 4XU0A 2BIVA 3CC2I 5DM6L 3N4QA 3AGRA 3GTOJ 3C6TA 3VQEA 1D09B 3ZBDA 1VF9A 2KQ2A 4A53A 3VEZA 1ODDA 2A6EF 3H5AA 2KSSA 2BW3B 4JX4A 4M3WA 1FJLA 4EMGA 4RKUE 4FVUA 2P9IB 1DKGD 1C1BA 2M7AA 1LWYA 4FWQA 4BXUA 3WTUC 5KYUA 2OTJQ 4GRIA 1VQPT 1PM3A 2HDAA 2XF7A 4CJ7A 2HNDA 1Y6IA 1UG1A 4ILHA 4BJTA 1XD7A 2FU4A 2R7YA 1T08B 1OX8A 3REAB 2AKLA 1XQSC 3H0GJ 2NVUB 3P31A 1YXQA 3DLKA 2WC9A 2FXUA 4XTZA 4YFXF 1ETKA 4F14A 1KFZA 4DBHA 2KHOA 4MQVA 3META 2P8TA 1M1KU 4D5FA 4FYYB 4YPHA 4WYBA 4E70A 1RACB 3ZLJA 3EHQA 2W25A 2R5MA 1VQ5A 2HZDA 5IY5H 1LCUA 2RM4A 3EZWA 2ED0A 2YX6A 2ZM6K 4DTRA 4J9IA 3BG5A 3KEQA 3OIPA 1VQ6T 4M3YA 4ZDPA 2O8CA 1LUJB 4LUEA 2ED1A 4ID1A 4BRGA 4TSXA 3EAEA 1HNZK 3BTIA 4WK8F 1MV3A 4QQDA 2JXBA 3D6RA 1XMOK 1VIFA 3CJ9A 2HTJA 4LD5A 4BXFA 4CF1A 5FO5A 4LJZF 3FDRA 1JTYA 2XGEA 5HY6A 3D2FA 4DR1K 4UUTA 1JLAA 2KROA 4FJ7A 4EM2A 4CCOA 1Q1HA 3QJ6A 1YOVB 2QUFA 2EZHA 4CFBA 3QYEA 1D0YA 2D1KA 4BH9A 2LTOA 3UATA 4N41A 2YR2A 1QVFP 2HGCA 1UEBA 2J6KA 2WACA 3CCLN 2PI0A 2OPPA 2K3PA 3K9KA 1DPUA 3WUHA 5GAEP 5KPZA 3BDDA 2EYWA 2IA2A 3TAEA 5HS9A 5AQYA 5HCKA 5TISC 3HSFA 1YP5A 3MWTA 1JKHA 1YI2I 1MMGA 3SJJA 3CJ1A 3A2FA 1EFNA 2MC4A 4CH7A 2L3DA 2OPTA 2GWJA 3DCFA 1VQ9N 3WXKA 2IBDA 1WHKA 2KZMA 2QXLA 3O8MA 1RRJA 3RRGA 1NMDA 3QINA 3BEXA 3AVIA 4A3JJ 2VKVA 4NDLA 1D1BA 3CCJI 4F7UA 3AG4H 1K9MU 3ZQIA 4MEYF 1ZREA 3HUGA 3G3ZA 4FWKA 4M7AF 3B6PA 3EL2A 1H8AC 1JL2A 1NNEA 3L6QA 3LSRA 1XS9A 1YITA 5C42A 4FLXA 1KHIA 1D1AA 4Y1DA 3DTKA 2EGCA 3KTQA 3CC7Q 1QPMA 1ZC6A 3FJ5A 5AQKA 3A8OB 3EQLF 3J81Z 5TKWA 2G9WA 3HPHA 3CPFA 1U3EM 4LLGF 1ZUKA 5HROA 4KH4A 3I9V2 2O4IA 2Z2SB 4XOTA 3U1KA 3TAPA 2DM1A 4D1QA 1PSFA 1A6QA 1NLVA 3A8GB 1HYOA 1GRIA 1HYZA 4ZN3A 3QEIA 3RMQA 4J01A 4M78B 1A04A 1I0CA 4PLIA 2B86A 1RNHA 4ENJA 4IOAL 3NH1A 2KRFA 4M77B 2E20A 3SJHA 2RJCA 1QCOA 2D0NA 2B9SA 2K9QA 2ECCA 2QEXT 4FE4A 4GXOA 5CQXA 3K57A 3VODA 3W2WA 3I55T 3G2BA 4XK4A 1J59A 3H5NA 3LSIA 1ZBSA 3G71Q 2IS2A 1CZAN 5F1RA 3FZVA 3CLOA 1NBWA 3A5LC 4FM2A 1SG5A 5J2MA 5IT9K 2E36A 4XM3A 1NK8A 4BRMA 3OHRA 2J5PA 5BPIA 1GFCA 4IFEA 5K5QA 4KHQA 4NL3A 3WU2C 3L2WA 1PSEA 1G15A 4IF4A 4B44A 1HR0K 2M0CA 2XRIA 4HSRA 5GAOr 4CHYA 1S72Q 2UXNA 1U5TC 4ZGJB 2KDSA 3JRGA 1ETXA 1G2HA 2JTEA 5L3GA 4PGHA 5DM7R 1MUDA 1HW1A 3DV8A 2D0OA 3MN5A 3R0JA 4XLAA 3SV3A 3ASNH 5KQ8A 2H94A 4FLZA 2CGJA 2M1HA 4PLLA 1ETVA 4JI1K 2NNWA 2XF5A 1Q95G 3EDPA 4U0WA 1UHMA 2DDBA 1QP3A 4Z4EA 2RE2A 2KNBB 3MVPA 4CJWA 2G8WA 2QA4A 2R7FA 3PUFA 1ZXOA 2VOPA 3FHFA 3V1QA 3R6MA 4MDAA 3OH9A 2RQUA 2LKPA 5AQJA 1ENHA 4CCLA 1NKUA 1BJAA 2CZ6B 5AYFA 4CZHA 4RAGA 2JA2A 3O9QA 4CZJA 4L5JA 1LFPA 4CIFA 2IS3A 4HCCA 2FBXA 4WXDA 4CBWA 2BW3A 1POGA 2OBPA 4YIRX 3JREA 5B1AH 2P9IA 1IRZA 3A01B 3IS9A 1VOMA 2JLEA 1BCMA 4KYWA 1B92A 3ZMVA 4LG0B 1W2BM 2Z1GA 2RHXA 4NC8A 5IN1A 4I2QA 4DSJA 1P7IA 3BR5A 3WG7H 3LSTA 1BK2A 3HI0A 2D0BA 1MNEA 1H641 1H3HA 4DF8A 3CO7C 5CVRA 5IOZA 5B1BH 1YITI 1DIZA 2A41A 4BHCA 3QU3A 4H5WA 1D9FA 3FFIA 3KETA 2KW4A 2JUFA 4HEA2 4E9FA 4DQIA 5GAOm 5KYXB 4ZTFA 2ZXJA 2ABKA 3HPOA 2MD0A 4NCBA 2ATCB 3FHZA 2ZMEB 1IH7A 3VQAA 4L8RB 5C15A 3TO7A 2ZPHB 3FEOA 1HSQA 4DKWA 5ICEA 1NGNA 4B6MA 1LE8B 1BIBA 3CCJN 1Q86R 2LNHB 4HAMA 2Y0SN 4ESJA 4DR3K 4C8LA 2O8EB 1QNTA 1YIJT 2A0FB 3RMDA 5BN8A 2RMOA 4LIUA 4QKUA 5EZGA 3CCMT 2MGQA 4FJ8A 2IGOA 3HIFA 2XGCA 5HLTA 3LWLA 3HRGA 4BC2A 5D4SA 1IG7A 1PKSA 1ZELA 2VBYA 2DX1A 1AA7A 2CUEA 2FQ3A 3OW2M 3MEVA 2QWMA 1BIZA 4HT9A 4FO0A 1WSFA 3OJUA 3SQ1A 1WCMJ 1OU9A 1Y0UA 2O7OA 4D5CA 2KEAA 2DVJA 2HCKA 4DU4A 4O3MA 1J5EK 1G3TA 4UUSB 4DOVA 4U0VA 1XC3A 3TANA 5FKOA 2L7ZA 5M5XJ 4M7AG 3LZIA 4ELVA 3DF8A 5AQRA 4NBQA 1RKTA 1BI4B 3OS0A 4BGBA 4A4GA 2K4BA 1MBEA 4K25A 3RWUA 1V3FA 2D2WA 1MDUB 2B5JA 3CESA 2STTA 1W36C 2Y1IA 1Z77A 3GNFB 2YKNA 4OU0A 4QVZA 4FL6A 4A0ZA 3JRCA 1ZN2A 5CVIA 3CC4Q 5AQGA 5CCAA 2EFQA 4JZ3A 1WHJA 4Y15A 1OH5A 3VN5A 2O8DB 4ORZA 2K9MA 1M8MA 2EJ9A 2BUDA 5FKKA 5LHIA 4HCBA 4C92C 3H3UA 4HA8A 2HBKA 4CZCA 3JCMV 4FYVB 4Y7NJ 1Y1VJ 4JRIA 1QE1A 2P9NB 1N27A 4DTUA 2VL8A 2BVMA 2W82A 4DU1A 2K6DA 2AHQA 1OVQA 3J7ZI 4M78A 3TSZA 4XU1A 4OVLA 1IW7F 3CDIA 2W85A 4DFPA 4M77A 2ZPIB 1KU2A 3DPLC 3CCQI 2Q0OA 1YS7A 1WJ5A 3NRVA 4BQAA 2JT1A 4C3IJ 2OV7A 4WX9A 2ZPGB 4H5RA 3S2DJ 1X1AA 4OB0B 2VG7A 2HOEA 3IKVA 1FLIA 4JV5K 3TO6A 5J39A 1O75A 3CJNA 1U45A 2EX3A 1BM9A 3TSQA 5IP9J 4BREA 3E0JB 1HW5A 3GCMA 3S2WA 2X6OA 4L5GA 3A8YA 3ZQLA 2RHYA 2D1HA 4BE1A 3A5ZB 2KR3A 2Z1DA 4YDUC 2EWSA 1TLHB 2HKQB 4L9JA 3FIWA 2F4MB 4B1ZA 3CERA 3UB5A 3LSPA 1RT3A 3F73A 1YITN 2J5OA 1JXBA 2QCOA 1EWRA 5KHDA 4GLMA 1VHXA 3M1FA 2RNGA 3SD4A 3HYFA 2FVUA 1PKTA 3QZ5B 2P0KA 3ALYA 3AO3A 1YJ9Q 2NRHA 3BF3A 3RUXA 5EVZA 3JB9G 2KRHA 1CSKA 2HEOA 1OPCA 1BI3A 2ZSIB 2DODA 5BOXA 2DOEA 3G4ST 4Y0WA 3R8EA 4QQ6A 2KTQA 2CFXA 5IAYA 1U04A 1KG3A 2OZUA 4LLLA 1J5OA 1RZ4A 2MOXA 4B9VA 5KAIC 2KRCA 1NU0A 1UMQA 3EETA 4IDKA 2QKKA 4DW6A 3WT0A 2XRNA 4MLEA 4W5OA 1U1TA 4GBQA 1UJ0A 4UVAA 4BE0A 1ZBFA 2XDVA 3KZIC 1PVEA 3GP8A 2AJQA 3VGKA 2OPQA 1SV5A 1TC3C 4GLKA 2FLOA 1ZLJA 3DLRA 1WQWA 3I33A 1WJSA 4A2BA 3A01A 3BUZB 4B1VA 3J80O 3EE9A 2RKIA 3UDCA 5BRFA 4CICA 2LY1A 1GVDA 3SXYA 3C7NB 3O9SA 3DEWA 4W97A 2MK5A 3R60A 3LAJA 2YLCA 2DA5A 2E2NA 5M1PA 3H6ZA 4XMYA 2EQRA 1F21A 4X1EA 3H0FA 3E1YA 3OYKA 4BRNA 1Q82U 3LDPA 5D6EA 1YJNA 2F5KA 2B7EA 2RJEA 5KYXA 3WTYC 3M56A 3M0TA 2ZMEA 3MMVA 4LSLA 1XJWB 2Y9ZA 1LE8A 3L9FA 4PWDA 1MMDA 2VJJA 1BI0A 2O8EA 2JN6A 4H0PA 2OTLT 1SRMA 2V1QA 3SDGA 3OJSA 1QSLA 2XAFA 3CMEQ 4EA5A 4AM7A 5J3LA 1HCRA 3LWIA 4JYAK 1TWFJ 2HHUA 4C92E 3EPZA 3LMMA 2VXEA 1QQIA 3KZZA 1MJ9A 2L3SA 1TOVA 4AIJA 1X2NA 1HDDC 5LGNA 2VUBA 2VUMJ 2EZKA 3GFMA 3P9IA 3RR7A 4BHPA 1B34B 3DBRB 2COWA 4JD2B 1VUBA 4XH4A 1DDNA 1ACMB 4YFNF 2E5LK 1NPRA 1T3LA 3V7RA 2BUPA 3QNOA 1X43A 2G8VA 5DM6F 3RDVA 4JOMA 2FC0A 4LH5A 3CCQN 2XMFA 4EP5A 5KYNA 1QWFA 4CIGA 4BWJA 5KE3A 3UE5A 3KP3A 1ETOA 5GAGJ 1J5YA 1BI4A 3FISA 3KZBA 3FZLA 3K69A 1MHNA 3E19A 5IP7J 2ISYA 2E71A 3IAS2 4J00A 1JRIA 3NPFA 3G6EA 4Z89A 1HNVA 2KXCA 2Y2ZA 3QBXA 5F0HA 2X9HA 5C3EJ 1QVGA 1HSTA 1FKPA 2O8DA 2FSWA 2YV0X 2YRVA 4LDYA 3CJAA 3ZQHA 3EYZA 2GIVA 2O0YA 3IHUA 1XMKA 2LMDA 2VGMA 1SVLA 1Z25A 4CEBA 5LMUK 2CU7A 1NEBA 1XHZA 5J4YA 1IUFA 4WF2A 3WEEB 3M8SA 4Q5SF 3CF5F 3N5NX 1NJYA 2VQHA 3K1MA 3K4MA 1R1TA 4IHTA 2NUTA 2P5OA 4WCEL 5AQVA 4M45A 1BQMA 1QSYA 3CCEQ 1FOXA 1H3ZA 4X0GA 3E5QA 3EO3A 1SFEA 1PRLC 4PNOA 3CDHA 1LDDA 2DFUA 1WSUA 3VQCA 3VQ5A 2M2EA 1D8JA 4A4KA 3J80E 3I56T 1X3NA 3CPWP 4IHSA 3ML6A 2ZPFB 3VRZA 2QSHX 1HJRA 2CJJA 1TW3A 2EFOA 1F9NA 3GIBA 2EILH 4IURA 3V8JA 2E5ZA 1YNZA 1VQKA 3A5MC 2CP0A 1R5GA 2V1DA 1R4MB 1IZ6A 1YTAA 3WXIA 1Q81R 1X2MA 2B63J 3OR1C 5GTHC 4CJEA 4LMYA 3JRAA 1M1KO 5TGTA 3A5OC 3LPTA 4I09A 2EZLA 3AARA 1X2KA 5C44J 2W42A 3AVGA 2PYJA 3CCVA 4N4HA 4WFNL 2E1MB 3O80A 4UOBA 2OI3A 3AVHA 1USTA 5GAOp 3NMZC 2AHJB 4AIHA 1KTQA 1VQLA 3LOCA 1BA1A 5EGOA 4YFUA 1FW6A 4DMNA 3HG9A 4DUYK 4AT1B 4UY8I 4DV7K 5AQOA 1K8KB 3CD6T 4DEYA 1PCXA 5D6YA 5AQMA 2C0OA 4IEIA 3F8FA 1QVTA 1VQOQ 1HK9A 4I7FA 3WHBA 2X4HA 4X1VA 4BRFA 1N8RR 3BR0A 1LCKA 3C95A 3VGMA 5KN9A 3FHGA 3DKMA 3K1NA 1VQ4A 2Y1JA 1MZBA 3VS3A 4CCHA 4BQLA 1KD1C 2OFIA 5KCMA 2NRXA 1SVMA 3O08A 3TMOA 1T0HA 2CREA 2RQRA 3J7AY 1U3OA 4F8RA 1WSGA 1FP2A 1HKGA 4XLCA 3M0QA 1AKHB 1ON2A 2HFHA 2KP6A 2M4GA 2ZGWA 4JI8K 4A6DA 5HDGA 2YXYA 4DG1A 5KTQA 3G6EI 4FT8A 1Z7UA 2I10A 2Y69H 4HTUA 4JQFA 1HNWK 1IGUA 4YPRA 1SFKA 3I3LA 3C7NA 4R79A 1KD1O 4MQ3A 1UWBA 2L89A 1QHAA 3VS5A 5DD8A 5C10A 3K0SA 1VIEA 3C4SA 1O1WA 3BROA 1KFDA 3A5NC 1SC7A 3VYUB 1R0CB 1RDBA 5FGMA 5JS2A 4FLTA 4B23A 4U88A 4GV6A 3CCUI 3LQQA 4AYBN 3VF2A 5E1XA 2DA3A 3LDOA 1JJ2S 4JHDA 2L9RA 1RADB 4V19K 4QQGA 1FT9A 3AG3H 3VYRB 3PSFA 4JEPA 1K79A 1JBMA 1KVBA 1BKBA 5KI6A 3FDYA 3CI5A 2K4YA 4C2TA 3VQDA 4AM6A 5LEJA 3R1XA 5J47A 3N05A 2ELJA 3M1CA 1QCNA 2FX0A 3CCYA 5L3BA 3MEGA 1H9TA 4RCHA 1N3CA 3U3GA 1I27A 1BOBA 1U4BA 2D0PA 3GF5A 4CZKA 1LEAA 1WAJA 1RCHA 4PJJA 3K4JA 1SKSA 1XG1A 5ED4A 4CJSA 4DFJA 4B3OA 3C6AA 1T0FA 1B34A 1RTIA 3DKYA 4EMKC 2ZFUA 4JD2A 1CZBA 1FSEA 4YOXA 2W04A 3JRHA 1W36D 1W2BP 4MMLA 1D5VA 3K5NA 1UG0A 2A1SA 3EGUA 4AHSA 2CGKA 1TAUA 2QK0A 3SMSA 2NUPB 1H9GA 1U9NA 2ZB9A 3RKXA 3M57A 1RI0A 3HRUA 2NNYA 4N5SA 1V54H 2DZ9A 2K5IA 1IRXA 4F3QA 4O5BA 1XCBA 1RR8C 4J19A 2KJBA 4JJNK 2VT3A 3TP3A 2KAFA 4NB5A 4B21A 3RQIA 4HX7A 1UA0A 5FPNA 4OKEA 4Y91A 1BR1A 1Q7YC 2L4AA 3S16J 1P7JA 2IRFG 4LDWA 2V9VA 2ESHA 2VVKA 2QM1A 3NVMA 4CGFA 2OC6A 1TW2A 3U9DA 2YUPA 4PKGA 5C6SA 4IO9L 2IS1A 1NGJA 1VQ7T 2M3AA 2LT1A 1WJBA 2RPIA 4P1WA 4OKKA 4DSLA 3MEEA 4EGZA 1YFNA 3WVEB 3JCMh 4FJ5A 2IIMA 5DM7L 3TR8A 5JI6A 3CWSA 3HTRA 4AMCA 1Q7YO 2FHDA 4GFBA 2YU3A 3TQ7P 4FX4A 2BY1A 4BY6B 3RBBB 4JS4A 1I07A 1SRLA 1KQJA 3NH2A 1FBSA 4FM4B 2X4YA 8ATCB 2WB1A 4Q0BA 1LQ1A 3E6BA 1O13A 4DK9A 3SQ4A 4HLXA 1JJ2A 2DD4A 5KGWA 4CJTA 3JS6A 4U67L 4KN4X 1LPLA 4O55A 1HLUA 4IIMA 2L7MP 5K7HA 5K5OA 1LJOA 4XLFA 5KCOA 2LKSA 4L59A 3E9FA 2OAUA 4RLQA 2F5EA 3WE3A 4AD9A 1K73R 1VRTA 3CMAI 4DR7K 3NEUA 3HOYJ 1UHSA 1JJ6C 3C3WA 2ASPA 1XSXA 2XY8A 1RDUA 4JK1X 1TU0B 2CKKA 2JWKA 3FBIB 1LFBA 1HKQA 1L3VA 2H6CA 3QODA 3M8PA 1JTXA 1I1JA 3JCMe 4B3XA 2Y4YA 3RTVA 3D5SC 3MEAA 4EV0A 3VQQA 3AVFA 4RM2A 2DLLA 2QENA 1ORKA 2XAQA 1ZKGA 3CM6A 1YHQI 4M6VA 2XC7A 1YT3A 1N33K 2FSKA 5BPNA 1YI2T 3G6EN 4WFBL 3OSGA 2QXFA 4DHYA 2E6ZA 3E5UA 2WC2A 1VSHA 3IG1A 1FP1D 1T6SA 4M7DB 4H4KC 3OYBA 4UV9A 2ZF5O 3IMXA 4JAXA 2DJIA 4EHUA 1S1XA 5DLQE 1QVUA 2KI7A 1Y56A 3N4MA 2R5ZB 1V4TA 3CBOA 3BZ6A 3ZN1A 2W1OA 4B48A 1XUPO 3CCUN 1RDAA 1K8KA 5FROA 2LQNA 4ID5A 4OMPA 4KTWA 1KU9A 1OYIA 3ZPLA 2VCPA 4M3GA 4LD9K 3FLCO 2F2XA 2COBA 5ICCA 3ZQFA 4B08A 5LL6Z 1KO9A 4Z4CA 2HBWA 2R4GA 3H9NA 2BE7D 2WY7Q 3KLNA 3BJOA 2JNGA 1BW6A 2E19A 3H41A 3C2BA 2EH3A 3S3NA 3JB9I 4A3GJ 5EU7A 4E7LA 4KH5A 2FMYA 5LHGA 1YJWQ 4MDXA 1BHLA 3UIQA 1WIEA 1AKHA 4IRHA 1BDGA 2DXTA 2AKKA 5BN9A 2K9NA 2RQVA 3VRYA 4B9NA 3KEOA 3LSGA 3BZCA 4XSXF 1W7PB 1NLPC 1LPQA 1QZYA 2F96A 2L4MA 2X6XA 2ASOA 4IOXA 2OZMA 2HXIA 1T56A 4DYCA 1YLFA 3O3KA 1G6NA 2IW5A 4BRCA 1E6GA 3J80K 2LCSA 1T44A 1KGSA 2BGGA 4CERA 4CBXA 2JPSA 1DUXC 1OULA 1PP8F 1MMAA 2EINH 2XI9A 1B07A 2ZJRF 2J6OA 4HVJA 4I0AA 1VQ5T 2P0QA 3ZQCA 3WE2A 2EVRA 3H9QA 2HDWA 2XDDA 5DCFA 2MIOA 1X9JA 5IXFA 2RD1A 2DY4A 1JHHA 3Q0UA 4F2SA 1EX4A 1RESA 3DU6A 1M3QA 3RQ4A 1VSIA 3Q0WA 4C5GA 3OB9A 3CFRA 3JCMg 3A1YA 3VPRA 5FW9A 1N6AA 1YRNB 4CESA 3HOXJ 2RKHA 3WG9A 2OTJA 2HVSA 1KQ9A 2NS0A 1FTTA 2GM4A 1ZGJA 2W6KA 4EQQA 2QTXA 3FZHA 4HCZA 1NK6A 4KHSA 3BG7A 2DFHA 5FKNA 2IGKA 4K8ZA 4DB3A 3LSMA 2NUPA 3SPYA 3HL8A 3CMAN 3FKIJ 1DP3A 1LAVA 4FTHA 4KH6A 2HPMA 2O03A 3ASMA 1V5EA 2E64A 2MLGA 4X65K 2B6AA 3OIQA 3NVKA 3S32A 3QYBA 1ZA2B 2YHWA 3VQ7A 1WGSA 1WH7A 2H6BA 1MU2A 4DCHA 3QPTA 4J6WA 3KE2A 2JJ7A 4DV1K 2EQUA 4FJGA 4QVDA 3BWGA 1MUYA 1XNQK 2L9NA 1YHQN 4ZTJA 3PTAA 5IYBJ 4IUUA 2RN2A 3RMBA 1B72A 4XU3A 2K5CA 4J8OA 5BR8K 1AU7A 1NG2A 2LLKA 3F21A 1C0UA 1GFDA 1B6AA 2VC1A 3BP8A 4A3FJ 1B59A 4Y3OA 4C8QA 1JKRC 4DFMA 4ZH4F 1WHHA 3ZCOA 1XGSA 2LJ3A 2HOAA 1REVA 4CJPA 1S9HA 4L18B 1NHAA 4EP4A 3BR2A 1SKRA 1RTDA 3FMSA 4OMFB 1ZQ1A 3NDKA 4B9WA 2XKOA 1BA0A 3IWZA 1T0JA 3CQ8A 1RIOH 3VEVA 4C92F 3CCRQ 1TYQB 3WU0A 2K3YA 2R7QA 1RAIB 4ISGA 4E1MA 3DMJA 5AQXA 4M3ZA 2STWA 3HRTA 4KB0A 2ZPBB 3TDZC 1CXUA 3CXCP 2HSPA 1SS6A 1Q82O 1ZBHA 3VYTB 5LJWA 3SDZA 4BUGA 1OFCX 1P92A 4OB2B 3U9ZA 2HI3A 3FHNA 3AV9A 2PYLA 1A6IA 5LGUA 4MIMA 2LYCA 2HL5C 3CC7A 3CCSQ 4C1NK 4LF8K 5TKYA 3D1NI 3R3LA 2FF4A 3OYYA 4M7DA 1YFHA 3TSWA 1M90R 1T38A 4RG8A 1IZ1A 2XGDA 1IN7A 3WQTA 2R5ZA 4IBNA 4M6YA 2E5NA 4NLCA 4MO4A 2ZMEC 3WTSC 3DBLB 4M3EA 2C6YA 1Y8QB 1VQ8Q 1M27C 2QA4T 4AHTA 1BC8C 4J9EA 5IHKA 4C0DB 3J81O 3HOSA 5J4VA 4H5NA 4OFAA 3MECA 2DEQA 4RTFD 5B3SH 1FWZA 3TKYA 3PM1A 2PU9B 3K10A 2NOHA 2IAIA 3QP6A 1VQPI 1U1SA 2I5JA 5KPRA 2YHBA 3G71A 1FXXA 4DV4K 1K0XA 4PSWA 2R5AA 3QYFA 2DL4A 3EG2A 4PJLA 1QVFA 3S9HA 3F70A 1N25A 2B4JA 2TDXA 3KEYA 1JXSA 1C0WA 4ICLA 3H35A 2GEMA 1R23A 4JLGA 1E4GT 4MTEA 2RC4A 3DFGA 3DKWA 4FE7A 4ZYEA 3C94A 3C6UA 3K5OA 5AZJB 1ZLKA 4HLYA 1W7PA 3C6HA 2R7ZJ 4ZYAA 3PVQA 2HQXA 2RK1A 2XU8A 4CO8A 5HBMA 3BZKA 3QWYA 1PU6A 3ZQGA 5EC7A 4EVIA 1VQ6I 4FYXB 3LA3A 4MZMA 4OMMA 5LHHA 1PNJA 4B3AA 1Y07A 2M0MA 5AQHA 4F9OA 5J2PA 5BQTA 4B9UA 2CQNA 2E3HA 1TK5A 2KZZA 2QQBA 4A2UA 4JDSA 4M3BA 2PMZA 2GX9A 1I5LA 2EW3A 5M5YJ 3I71A 4EJYA 3EGDB 3U8XA 4IIOA 3M9AA 1KVCA 1A5XA 3TSPA 3ZSXA 2A6HF 3COAC 3IH7A 1VSLA 1XTDA 3DB3A 4BR4A 4IRGA 3MHXA 5EG0B 2KVQG 3O5BA 4AHRA 3NH0A 3JR9A 1TWAJ 4L0YB 1MA9B 1WA7A 1YRNA 4A63B 3EH1A 1Y96B 1NJIU 2FZCB 4RB3C 1X4PA 4KN7X 3LGLA 5JLFA 1AD5A 3KD1E 5FD5A 1DU6A 4KULA 2IS6A 4OGEA 2JSPA 3IFRA 5J40A 4YRVA 1ERDA 1NK4A 4CJ3A 3V9ZA 2CQXA 4HQEA 1CF7B 3JSMA 1KHCA 1MSFC 4KGZB 3JCMd 2H3GX 3RR8A 4DYQA 3NE6A 4DQPA 1BO5O 5HODA 4KT6A 2E70A 4HCKA 3CFOA 4LY7A 4DNCA 3MP6A 3SQ0A 4MQ9F 3BLYA 3K6GA 1WBBA 1YCSB 1VQMA 1Q81U 3P7NA 1NLOC 2DERA 3QETA 3IUOA 4HXJA 1LMZA 2X85A 2QASA 3S3OA 2DXBA 3ZETB 1FSHA 1ZRFA 1K8AR 2X4XA 3OBWA 3RVCA 5ICGA 1YIJA 5J3BA 2L7KA 1Y0MA 3CCMA 2KISA 2DI3A 1IAWA 4KJZA 3J81E 3MEUA 4Z88A 3H36A 2LSNA 1I8FA 9ANTA 3L0QA 3MX5A 2QEXI 4CZIA 3F0ZA 4DF4A 4M7YA 3IKMA 2P4WA 3AKZA 2LRDA 3A8HB 4XLHA 5K7ZA 3H6EA 4RB1A 3I55I 2YHXA 2ZBKA 3L2VA 2EKHA 4O0IA 3P1GA 5DPKA 5IH2A 4M71A 2YUSA 3VOEA 4E6KG 3E9LA 2X1DA 2MMPA 2IDOA 1TYQA 1N8RU 3H3ZA 1LOTB 4KITB 3ATVA 3SHWA 2HVQA 5FKLA 2Y30A 3S93A 3F6VA 1ITGA 2L01A 1VQPN 2DJZA 4Q47A 3R9PA 4DOWA 5FKMA 4ENNA 1K9AA 4CHZA 3F22A 2CV1A 2K40A 1WEFA 4WF9L 4BGDA 3VUZA 4CYDA 4BHBA 2C06A 3CC4A 2ETHA 3QESA 4Z4IA 2E35A 2UU9K 3CWUA 1VRLA 1YAGA 2HU9A 3OYGA 4NCAA 4P9FA 1LFUP 1MUNA 4BBRJ 4DJAA 2WSCE 1TUUA 4ZYGA 2RGVA 1WSJA 3CUQC 4L9TA 4XTUA 2ID6A 3VUBA 2ZFWA 4PJOC 3DOKA 1GLFO 1S8NA 2JS2A 2ELKA 4JK9A 1G3WA 3LH5A 4BI8B 3KBGA 2VE9A 2JMWA 3TREA 4BQOA 2DJNA 1VQNQ 5GADP 1ZH5A 1MWMA 2KMUA 2P0PA 4W5RA 4I01A 3RMSA 1IV6A 1RT2A 3BJ6A 2MFZA 1VQ6N 1YQRA 4JLIA 3S1QJ 4S05A 2AZVA 2BZ8A 2DF6A 3FM5A 4EW0A 1HKSA 1QO0D 2ZC2A 2CT3A 2CP5A 1IUYA 3GL1A 2O8BB 4W5NA 3BR3A 5BS6A 1HPZA 4AI4A 4CJQA 1S7OA 4C8MA 4I99C 3KLFA 2COYA 3J7YJ 3I5RA 4DA4A 1S1UA 4H0OA 4NO7A 2DA1A 4FISA 2P5KA 5HDNA 5FRMA 4ESBA 4A12A 1XDUA 3FZKA 2VPRA 1T0FC 2GOXB 2X4WA 3E97A 1I1SA 3VS1A 2M45A 4B1WB 4I0BA 4XLNF 2WAQA 1V5GA 1D3YA 2CDTA 5AZJA 1VQMI 3LL3A 4AG1C 1U47A 4AG2C 2HS5A 5C0MA 1XX5A 3X24B 2PBIA 1D1CA 2JVHA 1OCZH 4C92B 1YJ9A 2JRMA 4ELUA 1IXSB 1YJNT 1YIJI 1PD1A 3OY9A 2FBTA 2GA1A 3DTIA 4E47A 5LRSA 3CCMI 1X3MA 4V19S 2Z1JA 1L3SA 2NOJB 4DGWB 2J7IA 2B0LA 1MIJA 3RKYA 2FRYA 1Y64A 2IA0A 3QO9A 4KRTA 1W1WE 5EDNA 3CDLA 4M78D 1IV8A 1WQ2A 4OPKA 2ME0A 1U2WA 3I53A 3L1PA 3EGDA 3ZN0A 3E9PA 3PLAA 4BQZA 1G59A 1WVRA 1OLTA 4CGJA 1J09A 4KBOA 3KK3A 4DTOA 3BPXA 3AA2A 3A98A 2GA2A 2LCLA 2JG6A 1N75A 4KO0A 2YUOA 5EG0A 1CZ9A 1ZG3A 1E3OC 2VKHA 1M30A 3ULDA 4IUTA 3M4GA 4JS5A 1Y96A 2DD5A 3GUDA 2QEXN 4OIOF 2F2VA 4I76A 2YT6A 2XB0X 3A4CA 3GOIA 3MEDA 3ZX3A 4B9XA 3CCLQ 3I55N 1VQ9T 4DTSA 1K73U 1NYGA 3SUOA 3OS2A 1OKRA 3J7YP 3EN9A 3RKQA 4IVNA 4RTYA 4IG3A 1GBQA 3UNGC 3W6JB 4FW1A 3CVTA 1VSMA 4N4OB 1OKJA 1W1FA 2V6CA 5ADXA 3TARA 1SFUA 2D1VA 3BGRA 2PG4A 3VEXA 1OYXA 4BVPA 2EQJA 3UKUA 2WV1A 4I98B 3IC7A 2XHKA 4Z4GA 4CEDA 3GXOA 2JRTA 5GAOq 5B66C 5CR4A 5J26A 4DSKA 1JCEA 3HL2A 3O1BA 3CMEA 1PD0A 4KTQA 3ZETA 1XMXA 1I3QJ 4WWCA 4BI3A 3S6IA 2K9SA 2LJ1A 2HKNA 1SANA 2L2PA 2FXAA 4PJOE 4M74A 2DU9A 2K5LA 2CQ7A 2DE0X 2KK4A 4OMZA 3QAHA 3M4YA 1HNXK 4E19A 3SB2A 2NLXA 4LF5K 3HSCA 3K1PA 1BI2A 3QDFA 2M8EA 5LMNK 2LH9A 5HRRA 4N9IA 3AO4A 3T1HK 1MBJA 3C0BA 3V8KA 5E26A 1RLPC 5GAOn 4FJHA 4RTUA 3I9QA 4ELZC 1VQKT 4G94A 1YIOA 4RTXA 3CC2Q 4K8XA 1ZLMA 1ZBIA 1MBFA 5EJCA 3ZMUA 3L4QA 2F4IA 4RGRA 4ILGB 4AIDA 2DTRA 3HHHA 5I11A 2XDBA 1UGQB 2NRRA 3GEZA 4YELA 3HPWA 1SAUA 4H0TB 3T5XA 2O4GA 4B22A 2PQ8A 3ZGKA 2OFKA 3VOVA 1H0MA 1IG8A 4G12A 4C5IA 4D6WA 3OWTA 2XY5A 1OX9A 3DRSA 4J2DA 4XRSA 4DTMA 3KP5A 3CCVT 1XN7A 2A6TA 5E17F 3RZOJ 3JCMb 2DT5A 3G4SI 3PNVA 1OJLA 3JRDA 4PDKA 4MZPA 2FYKA 4J9GA 1VQLT 3THXB 4PHTX 3H5RA 1YIJN 2ZXHA 3CCEA 1JCGA 2E1CA 1UGPB 3OYIA 3CCMN 2K02A 4GYGA 1YW8A 2ZQBA 5AQUA 1M3HA 3CPWS 5IHNA 4FZYA 2H09A 2O8BA 1R5ID 3DPUA 1WSIA 3IV5A 3DRPA 1MBKA 1VQ4T 1NGFA 3BF1A 1GXIE 1GHCA 1FOWA 3EUAA 1N5YA 4CFAA 2F9TA 1JGSA 4PJ0C 3ZCMA 4Z6YA 4HWIA 4GY2B 5HLGA 4XQFA 3THKA 1JCFA 1HKBA 1NMNA 1T8IA 3V7CA 2DL3A 1FK9A 5M3MJ 5CYVA 4DTPA 4KUIA 5D6XA 2CUZA 2ROTA 3VSKA 3J81K 1OVYA 4GGGA 3UKRB 1W5SA 1R8OB 3M8QA 3D4VA 4CZLA 2RQTA 4DSFA 2NAZA 2CYYA 1DTTA 1XCVA 4CD1A 1Z1DA 3L42A 4QVCA 3M07A 4CJRA 4E89A 2CP3A 3J7ZO 4GVMA 5JICA 4BJ5C 4OMOA 4A93J 4JKGB 4C92A 4BI4A 1B9MA 1YI2Q 2K3XA 2OCEA 1IHVA 3CP8A 3HBTA 2Q2EB 2OTLI 3KLEA 3VQ6A 1B9DA 2Q1NA 3THWB 3I0SA 1W0TA 3L00A 2F4OB 1TL3A 1B7TA 2YNIA 1VRUA 1CXQA 3HSTB 2Q31A 2YHAA 4V2FA 4BQNA 4KIGA 2R7UA 3LP2A 2YDLA 2QQ8A 4QTRA 3CCJQ 1VQOA 2DFEA 5HLIA 1KC8C 1OI1A 2O2OA 1Z3YA 2VYTA 2CYZB 1WI3A 2VB6A 4IQ4A 3KWGA 3KLHA 2R93J 4F7UG 2DDAA 5GAN8 4DTJA 1SSFA 3M7GA 1TKZA 3X2QH 4KHPK 2RI2A 3VA3A 1ORPA 4H0EA 5FFXA 2HSEB 3NCIA 1R6RA 2KT1A 2VQGA 1I5OB 4Y52J 3OQ5A 4C8QC 2WSEE 1KC8O 1RAFB 3LALA 3CQXA 2VE8A 4C23A 3I8DA 4AFSC 1QQCA 1HYVA 1YTYA 3M1EA 1WN7A 2EYQA 3CPWA 3M58A 5K14A 1KLNA 4XTVA 1B4AA 3FBNB 2GF7A 4YDUA 3ERED 1JT0A 4B43A 2XKOC 4N0BA 1VYUA 2VBXA 2V9KA 3CO6C 4D0PA 1AEYA 3GFJA 1F4KA 1XGOA 5FFZA 1SAZA 4Z2YA 3VV0A 3JRBA 3ZSZA 1OZ2A 3Q5FA 3LA7A 2A08A 1KAYA 1O7LA 2KGTA 2Y75A 4TVRA 3W0LA 4JLHA 2JS0A 2HBPA 1NG7A 2CUDA 2PY5A 4Q4ZF 1QWEA 3LZJA 4IG0A 1U2VA 1U0JA 2W24A 1D3BB 3ENHA 2FA5A 2UXXA 3M0UA 1NK0A 4Y17A 2G8KA 4KGVB 3VU3C 1P90A 4I6ZA 1KQSP 1I6XA 4M7DC 3CBPA 4F7ZA 4AHVA 2EAYA 1X3WB 3G4SN 1OMIA 2DXCA 1OR7A 5CPRB 1LWVA 5JHFA 3GWZA 3I56I 2CUJA 2OZSA 3NARA 1K6YA 5KYYB 1XNRK 2FF6A 2J4RA 2JA6J 1H88C 1AT1B 1AHJB 3VFZA 2MH2A 2E6MA 1SEUA 4O6JA 3CJQB 3U4LA 1FBUA 4E1JA 2HHXA 3AA3A 5FPMA 4HG2A 3OSSC 2CQQA 3DAWA 5H20A 1VA7A 2DIGA 3AVCA 2P5LC 1HLVA 1GVJA 2LG4A 1XMQK 4HF2A 2MW8A 3V9WA 3P4IA 1MD0A 2KXDA 1KIKA 4F92B 1X3ZB 1KAXA 2P1JA 3SI6A 2RV8A 1EH8A 3W3CA 4MGRA 4OFHA 1S5JA 4LD6A 4JI0K 1NGAA 4DV2K 2CT4A 2LTPA 1P59A 4MO7A 3MEWA 4UNOA 3OBYA 3UT1A 4B3RK 2CSOA 2AZSA 3SQNA 3S3MA 4L9NA 3VDXA 2E7XA 4P9UA 1TQPA 3CD6I 2EQIA 5CIUA 3O9TA 4DV3K 3IWFA 3ZMDA 4FX0A 1NJIC 2VKDA 4OVAA 2NWMA 1YITQ 3T7ZA 1ZK8A 1ZRDA 3K4KA 2IT0A 2LQWA 2G8IA 3THXA 4GCVA 2KT8A 2RQQA 2OTLN 2RQPA 3UPUA 2LP0A 2NOEA 4NC6A 2H1LA 5F1JA 5JS1A 2E34A 4M75B 1HU0A 1TGOA 2QWPA 2HQ5A 4M3TA 4EMKB 1JXOA 2KYMA 2M30A 1NJIO 5CAIA 4OF1A 4ZDOA 5KK1A 2AT1B 2MA3A 3HP9A 1WGXA 1X1PA 3PJRA 4A5AA 2PVGB 4HBLA 4A5MA 1J2XA 3RTRA 5HRNA 2PN6A 4OB1B 4KUDK 3HTVA 2X9DA 2NRWA 2KRNA 3SZTA 3V4IA 1DGWY 2G0EA 3ABLH 4A3BJ 1B8IB 1W2BA 3Q3SA 3AAPA 3EG0A 4ILJA 2VGNA 1WYXA 4C8QE 3NHGA 1TWCJ 2NVQJ 3MCAB 4FYWB 4X62K 3UKRA 4OWRB 3ER0A 1OV3A 1WJDA 1XNIA 3HP6A 2VC8A 3HT3A 3ZSQA 5DS9A 3H0IA 2FOWA 2E2IJ 1KA8A 4F4KA 1DT9A 4F91B 2K85A 3M54A 2QTVA 1S9GA 2WONA 1XQOA 4JKGA 2OYQA 1CQTA 3DQVC 1IDZA 3THWA 1K0SA 4X6AJ 3JSOA 1Q8IA 3BY6A 4BNCA 3QYGB 2GXBA 4RTTA 1JKQC 1LJ9A 2LX9A 3LP0A 1LNWA 5J8FA 1X3UA 2Q36A 4FSVA 4JX5A 1AVZC 1YW9A 4QW2A 1FYNA 1JJ2M 3U3YA 3TABA 4KTZA 3W2VA 3PIPA 3K9TA 1J75A 3OYNA 1TNSA 2W48A 3WTXC 4LF9K 3HKSA 5GAEJ 1N34K 4KV8A 4M7DE 1J0RA 1R49A 1N8RO 1TT0A 5AQNA 1YJWA 1WZOA 3CWAA 2NVXJ 4MMKA 1TKDA 2OTJT 2L0AA 4IFVA 4C3JJ 1DJ7B 5DLOA 3TAFA 3I56N 3IP4B 4HT8A 1WFXA 2V75A 2XIGA 3M3YJ 2FNAA 2M0YA 3HK2A 4RTWA 2EGEA 1HJOA 1WX6A 4KPYA 3GZNB 4RB0A 4F2RA 3NGPA 3PT9A 4CVNE 4BRLA 4M78G 2DEUA 2LVMA 4M42A 1NEGA 3CEYA 1NM1A 3V9UA 3GNGA 3CCQQ 5D6FA 4UY8O 1VQ7I 1K83J 3AVMA 2YG8A 4FWSA 4IHXA 4CFCA 4DS4A 1M4ZA 2QKBA 1A5WA 4M77G 1TS9A 2CP7A 2LDMA 1WXTA 2OUMA 1ORNA 4OIPF 2ACJA 1X58A 5CYMA 2L7FP 2L9VA 4FLWA 2Q0UA 4H4MA 2NYSA 2E60A 4OOIA 1E4FT 4G7OF 3B73A 2VBZA 4KT0E 1UJYA 2DN0A 2RJDA 3CF5L 2ETJA 3H08A 2K79A 1NKBA 4UV8A 1ZAOA 3TW7A 3AVJA 3FMQA 4UVBA 2XHIA 4UVCA 1D3BA 1GUUA 2L54A 2YSRA 3MCPA 5FU7C 3CD6N 1Y97A 4I9LA 3EHRA 3HEFA 3EEQA 3N4PA 1NE8A 5HS8A 2LQKA 4NQWB 5IWAK 2NOBA 4PUOA 4E2FB 2YI1A 3HFNA 1ZHFA 5HL7L 2P6SA 2RN8A 2D9TA 5KYYA 4DUZK 1YX5A 4E7HA 3CYMA 4I2OA 3BQZA 1UUEA 4EAHD 2VKNA 3CJBA 2BHYA 1WH5A 2IXSA 3MZ8A 3IRRA 4C0DC 2R3SA 4JRPA 3VETA 1VAZA 1RTJA 3O1WA 3CWTA 2QQ9A 1IF1A 3CJCA 4JKFA 1HDPA 2OF7A 1O3RA 1I5ZA 3OYAA 2GOMA 1P7MA 1V4SA 2DA4A 2HZYA 1FY7A 3FRNA 3ZSVA 2QYOA 4IFYA 4R8HA 3DXJF 1E3PA 3GTQJ 3SPZA 2Q8KA 1KQ1A 1FOKA 2IPOB 3UA6A 3D5RC 5A0DA 3U2RA 1SHFA 3CC7T 2V51B 3UF4A 3MP1A 1FYLA 1UB9A 4A59A 4UC4A 4W5TA 3TO9A 3QUIA 3WGGA 4BDPA 2IPQX 4B09A 5LJ5h 2E2HJ 2DVEA 4XKVA 3K59A 4XORA 5GMKl 2LK2A 4NC7A 4GKKK 1NKEA 5F27A 3ZYYX 4JJCA 2JPCA 3LLRA 3FK7A 5GPAA 2HZTA 4M75A 3GLXA 2QYZA 5JVGL 2EKOA 3U23A 2XSJC 5F08A 2VV5A 4EMKA 3OA9A 2V7FA 4EJUA 3BOQA 4FWRA 1YUWA 4XSZF 2A5WA 2ENMA 1TUGB 1KSPA 2GUPA 2FG0A 4EJWA 4E4HA 3H0HA 4EM1A 3C0CA 2KT0A 3PX6A 2R7WA 3CXCS 4RAFA 4JK7A 3RR6A 4N0AA 3G71T 4PK4A 4ZDLA 4PJOF 1ZBXA 2HPIA 3QDRB 5EYRA 1G83A 4N4NB 2KIQA 1B8IA 2W57A 3CC2N 4FOIA 4CF9A 1M3AA 5ILSA 3LM9A 1VI0A 5LJ5e 1RLQC 2IEKA 1S72T 3CCSA 3AL0C 2E2PA 5A2QO 1ASVA 4NNJA 3S8PA 4HVWA 2JGUA 1DLOA 1VQ5I 3I8BA 1I1GA 4GDFA 3QJYA 3HOZJ 3JCMf 1HQUA 3M8RA 5GMKm 3IH3A 1UZCA 1VQ7N 3DLGA 4E9GA 2ZJ2A 3OIOA 1A5JA 5E8GA 1QW1A 4CCJA 4YIIA 1VQ8A 2AS5F 1QU3A 4C8QD 1EIFA 2F8TA 2JMCA 3P9CA 1MW7A 3BPVA 4MLHA 3NWSA 3GTJJ 2PZSA 3HZJA 1MKMA 2ZNZA 2P7CB 1E0EA 1RFQA 3P39A 2DT6A 2QGFB 1JLFA 3J7AO 4GV9A 3V1RA 3KP4A 3O4NA 2JHJA 4B8XA 5HKCA 1EV7A 1YO5C 3OSVA 3AHUA 2V6EA 2BTTA 2R7XA 4WQ4C 5JFRA 4XKBA 2DMQA 3QLHA 4RAZA 4FWNA 1JLQA 2GTJA 1GLAG 2L0KA 1N39A 2R5YB 2FB7A 2X51A 4KIBA 4C2UA 3I0WA 1XHXA 4LFAK 1KD1R 1SZ2A 1RBSA 3LDSA 4FSSA 1Z7LA 1CLQA 1XB4A 1IJJA 3BY5A 3LNQA 1T6CA 2XKPA 3TOBA 4FJIA 2ELHA 4A61A 3E1SA 3CXCA 2EB7A 5AQSA 3QO3A 3PUBA 4FLUA 1RNLA 2XY7A 2ME6A 3LWHA 4AQYK 4M7DD 4L9VA 1L3TA 4BY7J 1SD6A 1U9OA 1TUYA 4H4OA 1YI2N 2LBFB 5ADXH 1RRSA 2EJGA 1A35A 5EOYA 2K57A 1ASUA 1YW7A 1XMAA 2FF3B 1VQMT 3RNJA 1TWHJ 3QB0A 1Z9CA 3W3DA 4XNFA 4MFEA 2VQFK 1LV5A 3VEOA 4Z0UA 3Q7BA 3CBMA 3TTDA 5E1WA 3RYPA 5L3EA 1GV5A 2NXNB 3ITHA 1W6XA 4AH9A 4OO1J 1RILA 1RETA 3M6GA 3DBHB 2DJQA 2P9PB 1ZBUA 3HM8A 1IB8A 2L02A 2LCCA 3KJVA 2A1RA 1WHLA 4GNIA 4NQWA 2YNHA 4QAGA 4GW6A 4LK1F 3ASKA 1AOYA 3GBGA 4E7KA 2CV0A 4E7IA 1OYWA 5DY9A 3AY9A 5ERIA 2VWFA 2VOOA 2IC3A 4AIAA 5LJ5g 1T2KA 2OQGA 4KH0B 2HYGD 4LSNA 4MHGA 2CUBA 1JLCA 1R71A 3MZYA 3S14J 2F5DA 5GMKh 1V1CA 3I4PA 5IOYA 4KMFA 1IN6A 1W7PD 2NUBA 4CFDA 4ZN1A 1X9WA 2QQSA 1PJRA 1PU8A 5A2QE 5CLSA 1TQIA 1W7AA 1BA5A 2OPRA 3ZX2A 4UUVA 1U48A 1MJAA 1VYVA 3OOPA 3CC4T 2ITMA 1NM7A 1X6BA 3A03A 4PFOA 3NNQA 3FX3A 4D8KA 3K4CA 2DFIA 1Q7YR 5AQZA 4PUSA 1YWPA 2EFPA 1XOVA 3G6EQ 3R6SA 1DGRM 4BE2A 4CRIA 5HNFA 2GTDA 4JI5K 3LWMA 3HKZA 5F04A 4IHVA 3O8GA 1LW2A 2QA4I 2Y90A 1ZR2A 5DUKA 3AT1B 4HDUA 2XROA 4B9TA 3V42A 1VQ5N 1QZZA 4FU6A 3VTIA 2GQQA 5GMKe 1XGNA 3SEQA 2YJEA 1C6VX 1WPYA 2IG0A 4G6QA 5BMZA 3HM9A 1G8XA 2YUQA 3CCUQ 2QTDA 2P84A 1IREB 2NUTB 4FJKA 2O9SA 2BBYA 3ERMA 1V29B 4CZZA 1USSA 3RSNA 2WADA 3JB9J 2HEQA 4EFHA 3NFCA 3KHYA 2DQLA 1SD4A 1PG5B 4G6TB 1G3YA 3H1QA 9ATCB 1UJ8A 1T8EA 3HXMA 3X28B 1KSWA 3A2KA 4YHHK 4MTDA 2MBFA 3K4NA 3JCUC 5D8KB 1FYMA 2YX7A 3LFKA 3WTTC 1LDKB 2QQRA 2XHBA 3OMGA 5E18F 1WPKA 3PGGA 4KI4A 3MP8A 2I0NA 3QSUA 1IG9A 4QS7A 3HM5A 2NVTJ 3R0AA 3RYRA 3FKJA 2CGHA 3L7WA 2ZJRL 3J7AP 2YNGA 2YKMA 3CJRB 5LRRA 3M5AA 1UA1A 3GFLA 2K27A 1IN8A 3FXLA 1YJ9T 2O31A 1BW5A 3L2CA 1QRYA 2HMAA 1U06A 3MJXA 2X6YA 4OP0A 2VQCA 5CE3A 4OIQF 1ZBJA 4IPAA 2EYXA 3QNNA 2DBBA 4G7ZF 1UHWA 3M53A 4M3RA 1O9SA 1BR2A 1FBQA 1SL0A 3EG3A 3HVRA 2HVRA 2X48A 1PP7U 4AIKA 2A7YA 2V7YA 1K4TA 5EGOB 1JLGA 1WZ2A 1TTHB 2D8HA 3QDKA 5L8RE 2DA6A 5BPMA 2HKOA 1VZ0A 2BKDN 5J2QA 1WB9A 4R1HA 1EH7A 3HFOA 3QPHA 2LZ6B 5FLXO 3IKTA 4Y4RA 3SZGA 3B6CA 3ZT4A 4Y33A 4AFUC 3HXLA 3ZT2A 1D9DA 2QLZA 1WXUA 1S3XA 2KQWA 3SV4A 3VEYA 1ETQA 2VQLA 1WHMA 4LF4K 2OAWA 5M1OA 3U6FA 1T95A 1OR7C 2O01E 2A69F 4QPOA 3ABKH 3WQUA 4AVZA 5C4XJ 2WUSA 4EEFG 2R5YA 1UECA 2DMOA 1HYSA 1GCQC 3DJCA 3S1MJ 1STZA 3S1NJ 3G1OA 3QFUA 2XG8D 4CK2A 1QVPA 1SUQA 3JXUA 1REPC 2HNHA 1T98A 4DFKA 3A8MB 1WJEA 3VPZA 4CEOA 1NGCA 4HYEA 4AI5A 3CMAQ 5LEKA 4J9HA 1J6ZA 3NGZA 1QVGS 3I64A 2D5RA 4A3LJ 2XK0A 5FU6C 3GW2A 3FXUA 4JKEA 4H5VA 3A0HC 3CUQB 4YOQA 4F55A 3WTVC 3DEUA 2RF0A 4PJOB 4MLOA 1FMVA 1KONA 5CYQA 2LBFA 3D0PA 4C8QF 1IC8A 4CJVA 3SAGA 4B9SA 1TWBA 4H0YB 4C3HJ 1VSFA 3L8BA 4UB8C 2NVYJ 4JKCA 4JHDB 1YTUA 4ESRA 2FZGB 4CHUA 3CMET 4I2PA 1HKTA 4I6MB 3AG2H 3ZSYA 2LF8A 1BB9A 1YHQQ 2HYFA 1SQKA 1IV0A 3AFHA 1C0GA 2ZO4A 3LCNA 3SFZA 4MDBA 1K7AA 4FK2A 2P9PA 1Y7XA 3HO1A 2A61A 1HSJA 1GLBG 2QA4N 4OMNA 3OV8A 4AM3A 3RCOA 2XPUA 2LMJA 1WWXA 1HF0A 3HJFA 3TCJA 1NZ9A 2HDDA 2XDPA 3VEWA 1AZGB 4HKEA 2K7AA 3TGNA 3GX4X 4UXNA 2UUAK 1TZLA 5M5WJ 3CCLA 3LDLA 3BCAA 1NWKA 8AT1B 1QZ5A 4HV6A 1OPLA 4LUDA 1IXCA 5E79C 4RGUA 2AP1A 2QWWA 2MSYA 5F6FA 3NF8A 3BTCA 4IEJA 4XIDA 3TAMA 4CI6A 1VQ9A 1OZ3A 3G1LA 2GBYA 4M7DF 1W5CC 3EZ5A 3CJ7A 4CEZA 2VPLA 3WNFA 3EE8A 3NF7A 1MMNA 2OA8A 4OX9K 2VJ4A 4O0JA 5AQPA 2JUGA 2Z9OA 4PGGA 1W70A 3RMAA 3QMLA 2GCXA 1X9SA 2HSTA 4QLCU 4F3OA 3I0TA 5M1KA 2M02A 4HW0A 4KMUX 4PL6A 3VYHB 5ILUA 3OH6A 3FF5A 1Y71A 1SFOJ 2G8FA 3LFUA 3O6BB 1PUFB 2EZIA 4DQSA 2H3JA 2DYSH 2XAUA 2PZ1A 3CCET 1RAHB 2JZYA 3E3VA 3WVDB 5FLXE 2V1XA 2QWNA 4O5FA 3R6NA 2EV0A 3T8TA 5DUIA 3BG3A 3E9OA 5D8LB 1RAEB 1NGHA 1GLCG 5GAHJ 1JUSA 1TH7A 2FO0A 1Z26A 1UB4A 4QPQA 3P9KA 5KE2A 2CH0A 2VIXA 3VMFB 1I94K 1HXDA 4F3TA 3M8FA 4FK0A 1Y1WJ 1YQKA 3M55A 5GIPA 4NCGA 3P8DA 4CDGA 4FZXC 3JAMO