4BE0A

Pfv intasome with inhibitor xz-115
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be0A03
3NF6A 1Y97A 4C5IA 1C1AA 4Z02A 4NYNA 2E4LA 3M8RA 3AVFA 4KRFA 3AVAA 3AO3A 2KFNA 1HYVA 3RMBA 3ZCMA 1U45A 4CFCA 3PV8A 3KLHA 4PQUA 4KTZA 4DTMA 4N47A 3LALA 3SCXA 4B9TA 4Z4HA 4OJRA 4C5GA 4F2SA 4LSNA 5HLFA 1HNVA 3JYTA 3VQEA 4KPYA 4CEFA 4N76A 3QLHA 3P83D 1NJXA 1SL0A 4FJ7A 4B3OA 4NCGA 5T7BA 3NE6A 2GFUA 2E6LA 2IGIA 1Q8IA 1TV6A 5JS2A 3ZSQA 3HP6A 1B92A 4LD0A 3L3VA 3NDKA 3NF8A 4M42A 1WLJA 1RBSA 2ZE2A 2ZQBA 4PL6A 2RJDA 3BGRA 3HYFA 4FVMA 4FJIA 4DLEA 3P1GA 4E19A 3VQPA 4CJPA 3NH1A 3K57A 2HQXA 3ME9A 5IN1A 4Q5WA 4E7KA 2BIVA 3OMCA 2R7YA 3LGLA 1T05A 3DMJA 4E7IA 1D8YA 4FZXC 2G8WA 3TR8A 4HCCA 1QE1A 1HQEA 3PNWC 4CEBA 1A5WA 1KLNA 3F73A 3MEGA 1BGXT 1BI4B 4KV8A 3RWUA 4FLWA 3AVCA 3E01A 1SL1A 4BWJA 4PLLA 1UWBA 4PY5A 4RG8A 1DTQA 3NGYA 4OKJA 4J2DA 3C4SA 2A1RA 4Q5VA 3DLEA 3MEVA 3C6UA 2FBTA 3TABA 4DSKA 1OZ3A 3OJSA 1EETA 3I8DA 1S5JA 3AA2A 3UIQA 1NK8A 3DLMA 4FLVA 2G8HA 4KFBA 4W5QA 3E9FA 1LW0A 1JXBA 5C0MA 1WGSA 1BIUA 1N6QA 2L8DA 2OA8A 1RT4A 4FJKA 2GF7A 4DTRA 1RI0A 4F8RA 3MO8A 3ALYA 1YTUA 1BCOA 3OMGA 2P0KA 4B8CA 3PO5A 2RJCA 1ZBLA 4N41A 4FK4A 2I5JA 4QCLA 4DFMA 2VWJA 2GBZA 1ASWA 4OVLA 2PYJA 4I2PA 2K3YA 3V4IA 3NFAA 4YFUA 4IG0A 2RHYA 5J2NA 4NS5A 4CHQA 2E6NA 3FC3A 3AVIA 1ZBHA 3TAQA 4FJHA 4KI6A 4F3TA 3V1QA 2HHXA 4F2RA 2RHIA 1IKWA 4Z4EA 3PX4A 1QQCA 3KKRA 3NF9A 3AVKA 2RJEA 3ASMA 4DFPA 2D0AA 2QQRA 4NCBA 4IUVA 3LAMA 1NJZA 2YNFA 1HMVA 2XK0A 4FM2A 2Z1IA 1U04A 2EFIA 3OYJA 4FJGA 1SKSA 5KTQA 3HL8A 2OYQA 3LX7A 2RF2A 4HTUA 1TKDA 1MU2A 3KD1E 1X9MA 1TK0A 1EX4A 1U4BA 5KRTA 1T03A 3RRHA 4FLUA 3QEXA 2YHAA 2EQMA 3U6FA 3DLBA 1WJSA 3LZIA 3QEIA 5KE3A 5DK5A 2ZD1A 1UA0A 2Z1GA 1UA1A 3L2UA 1WN7A 4M3WA 4AHUA 3LWMA 3KD5E 4DQIA 3DRSA 4HUGA 5FDLA 4CGFA 1J5OA 3OYNA 4B9LA 1Z26A 2VG5A 1BCMA 2YNHA 3HJFA 2M1HA 3V9XA 2RI3A 3K2PA 3OYGA 3VQDA 1HJRA 3LPTA 4CF8A 4M3TA 1BI4A 2X35A 3HVTA 4FJJA 1L3TA 3NH2A 4CCHA 1QHTA 3CFPA 3KIOA 3TWHA 2HMIA 4IKFA 4JS5A 1XC9A 4FLYA 1MHNA 3IAYA 4QW2A 3L2VA 3ITHA 1IG9A 3BDLA 4CJ4A 3CFRA 5J2PA 4DSFA 1JLBA 2AJQA 5FRMA 3SD4A 3AO2A 3K5LA 4CFBA 2Y1JA 4CJLA 3S3NA 3LP3A 4AHVA 5KCHA 4KI4A 2HVHA 3KLGA 1Z25A 3MEUA 3DM2A 4NYFA 3ZSZA 3SUOA 4DWIA 4QVZA 2IAJA 3SQ0A 3ASKA 4RW9A 1IKXA 3DLRA 4IUQA 4XIUA 1GOCA 3HM9A 2WONA 3KKSA 4QQGA 4KHNA 4B08A 2LVMA 2K3XA 3U3GA 3LGFA 4HVJA 4QQDA 2LRQA 4E1NA 1BQMA 1RDBA 3VQ8A 2R58A 4CHPA 3ZT1A 1RCHA 2X4XA 4W5RA 3LPUA 1QSSA 3RR7A 3S9HA 4BACA 4KTQA 4CERA 3SV4A 1C0MA 3HSTB 4EZ9A 1XWLA 1L3VA 4A4FA 4OLBA 3OYHA 1SKRA 1KHCA 1RT1A 3TARA 3SQ2A 2D5RA 4B9VA 4J2BA 3MP6A 2YHBA 3QEWA 4ID5A 1LV5A 1FXXA 4RW6A 2RHZA 4QQ6A 1S9EA 1D9DA 4CGDA 3OA6A 4CIEA 3LZJA 3MP1A 3B6PA 3QESA 1YVUA 3LH0A 2HVIA 3RMAA 2MWOA 4DQSA 1NK5A 3CQ8A 2EHGA 1H3ZA 4CHYA 4FK2A 3MEWA 4LH4A 3QEPA 3S3OA 1LAWA 4Y1DA 2XRIA 4CK2A 2Y1IA 1SSFA 1RDCA 3BDPA 3C6TA 1RT3A 3CFOA 4DSJA 4I2QA 1YTAA 1Q9XA 1K6YA 3V1OA 4CECA 2IG0A 4FJ9A 2P5GA 1VSMA 3IG1A 4E7LA 4UC4A 1BL3A 3OY9A 1VRTA 1KCFA 1ZYQA 1SV5A 2EQJA 3HP9A 4Z4GA 4EZ6A 1JLQA 4CJVA 1YT3A 3AVGA 3VQCA 1XHZA 4DU3A 1NKEA 1EKEA 1BHLA 4E3SA 3SNNA 3L2RA 4HCZA 4CEQA 2HNZA 3F9KA 3T1AA 1U47A 3AA5X 3ULDA 2DFEA 3LWLA 4M41A 2HHUA 1S1TA 5HP1A 2G8IA 2D0BA 3OB9A 4E7JA 1TL1A 3RR8A 1BQNA 3G10A 4Z0UA 4C8KA 3MXIA 5HROA 1JL2A 1RTHA 4RW7A 5D6WA 5D6YA 2B4JA 1RT2A 4HCBA 1S1VA 2NLUA 3KUFA 3AVMA 2QKKA 2HHWA 2WACA 1TKTA 4IUTA 5M9OA 5SZTA 2YV0X 3NGZA 5FRNA 4B8AB 1NKCA 2F5KA 2FC0A 3P8HA 3NHGA 1TKXA 1NK0A 1WJQA 3PO4A 2YRVA 2WOMA 1RBRA 3V9WA 2P5OA 4IG3A 3FFIA 2EQUA 4L8RB 2RKIA 3TAPA 3DLGA 4BDZA 3K5NA 1LW2A 3OYAA 3LYIA 2XY8A 1ASUA 1WJRA 4CHZA 2RPIA 5KRSA 1G5VA 5J2QA 5HRRA 1C0UA 4IUPA 4FM0A 4C8OA 1T7PA 3NAEA 1NK4A 4WE1A 3H08A 1KVCA 3KK3A 3TANA 3PFSA 3DLKA 1KFSA 4CGJA 4CEDA 3SZ2A 4W5TA 2RI5A 3CG7A 4C5EA 3WNGA 2CKKA 2HW3A 2YNGA 4FJMA 1N5YA 1VSLA 3VQ4A 1TK5A 3H6ZA 2E5QA 2FHDA 1JKHA 3ZSWA 2VG7A 4CF1A 1KTQA 5IAYA 3LLRA 3O3GA 1U48A 1NK7A 3HPOA 3LDSA 3HO1A 4CJSA 5CYQA 4FK0A 3HPGA 2LDMA 1J53A 4E7HA 4MFBA 2RHXA 2L89A 4EP5A 4IDKA 4CJQA 1KRPA 4DTNA 4ELUA 4PUOA 4IUUA 3NTIA 4CJ3A 4AH9A 1UAXA 2F8SA 2KZZA 1S6PA 1TK8A 2BKDN 1QS4A 4AHCA 3RMDA 3L2QA 2XY6A 4I9LA 3NCIA 2FBXA 1GOAA 4N4IA 3DB3A 3QEVA 4FJ5A 3DB4A 5J2MA 3L42A 2VWKA 3PY8A 4CEAA 2XHBA 1OYXA 2D0CA 4KHWA 3F70A 1LAVA 1HQUA 3UT1A 3PMTA 3VA0A 3HVRA 4DSLA 1VK0A 4FZZA 3DRRA 4C5HA 3S6WA 5J26A 3P8DA 2HHQA 3EYZA 3H8ZA 4KTWA 1SKWA 5J1EA 2O4XB 4CJTA 2RHUA 2RI2A 2LTOA 4CHNA 2X4WA 2HHSA 3I0RA 3SUQA 4O4GA 3KLFA 4BD3A 3EY1A 3GOXA 3U3YA 2RN2A 4GW6A 3IS9A 4DFKA 1GOBA 1RDDA 5CYMA 4KHSA 3S3MA 1L5UA 2DAQA 5KH6A 2YKMA 2M16A 4CF2A 4DSEA 4FM1A 3ZT2A 4FJXA 1RNHA 1XI1A 4Q0BA 3PMIA 3VQ9A 4ELTA 4GVMA 2KFZA 3AVHA 1X1PA 3QJ6A 5K14A 3OYFA 3SUPA 2PZSA 2QXFA 4CJUA 4M3YA 1CLQA 3DYAA 4DS4A 2X78A 3VQBA 4ID1A 1X9SA 4B9NA 2ETJA 3ISNC 3K58A 3L3UA 1S1UA 4FL6A 4GY5A 2YKNA 4OKKA 3V9ZA 1T8EA 4Y1CA 3TAEA 1LWCA 1WNSA 1HNIA 3AO1A 5KCOA 3ZT3A 3LANA 4O55A 4CEEA 4B9UA 4CFAA 3MECA 4KAZA 5I3UA 3TAGA 3KTQA 2IC3A 1TKZA 2X6NA 4M3UA 4AHSA 1BISA 1A5XA 2G3RA 1BIZA 4FJ8A 4ZHRA 1S9GA 1VSIA 1L3UA 1QSLA 3RTVA 2XY5A 1TAQA 4OPJA 4CJKA 3QNOA 4K8XA 2ATQA 1RTJA 3V9UA 2R5AA 3QIPA 2OZMA 4N4GA 2G8KA 4RG2A 1WSFA 3NF7A 1TAUA 2OPQA 3JSMA 4KHUA 5CZ2A 1FK9A 3I0SA 4A4EA 3QINA 1TL3A 4E1MA 3NNQA 4CEOA 4IURA 4CFDA 1NOYA 3AVLA 4F3OA 3KK2A 4TSXA 2EKOA 1QTMA 1WSJA 1ZBIA 2QQSA 3HT3A 3DI6A 3WNHA 4YNQA 1O1WA 1N27A 4IFYA 1RBTA 3M8PA 5CIUA 4N56A 3TAMA 3NTHA 1KFDA 1C6VA 1JLFA 1TGOA 2O4XA 3AO5A 3OS2A 4CIGA 3CEYA 4OPKA 4H8KA 3V9SA 3LP2A 4DTSA 4C8NA 5D6XA 1NOZA 2EX3A 2IS3A 3KLEA 3OS0A 3PUFA 4DF8A 1UOCA 4LY7A 4CK1A 2OPRA 4C8LA 4M45A 3VA3A 2BANA 3OYKA 4R5PA 4NCAA 4FLZA 3ZSXA 3MEAA 5C6SA 3NGIA 5KGWA 4KREA 4B9SA 2DFHA 4IFVA 1REVA 4O5BA 3SPZA 3M8SA 3AA3A 1NK9A 2A1SA 3QETA 4CESA 4E0DA 4PA1A 4CJWA 2XDPA 4J2AA 2F96A 1VSEA 1C0TA 3CM5A 4FW1A 2E6MA 3SYZA 2FBYA 3V1RA 1R0AA 3ZSOA 3HPHA 4HHTA 1SL2A 3VQ5A 2BUDA 1D9FA 4O44A 4QOZB 4DS5A 4N5SA 4HUEA 2DIQA 1JLCA 3D0PA 3OVNA 4ZTJA 3QO9A 3QERA 4DTPA 3META 4N4HA 4CJEA 1ASVA 1S1WA 2KTQA 2GFAA 3QNNA 3K5MA 2LSNA 3VQAA 3V6DA 2HNYA 5J39A 2OPSA 4O0IA 4DQPA 2IOCA 1NJWA 3WNFA 4A4HA 3TAFA 4DTJA 3O4NA 4KO0A 4PLIA 1KLMA 4GMJB 1IH7A 2PQWA 4B9MA 5HRPA 1IKVA 4F4KA 2QKBA 1ZBFA 4CHOA 3T3FA 4BDPA 4RW4A 1VSKA 5C42A 3SUNA 2L3RA 1D5AA 1WSEA 4KHYA 4LH5A 4I9QA 2Z1JA 1VSHA 4CIFA 4JRQA 1RILA 3PX6A 2D9TA 2KW4A 4M3ZA 4IBNA 1C1BA 3L8BA 4FJNA 3KK1A 2O4IA 3HK2A 4E89A 4A4GA 4CF0A 1HYSA 4CE9A 4CJ5A 2ITGA 4CF9A 1FKPA 1VSDA 2B6AA 3DOKA 1KVBA 1RT7A 4CGIA 3LAKA 3M8QA 5SWMA 3AVBA 3LP1A 4C8MA 3AV9A 3CYMA 2X74A 4CGHA 1WAJA 3QBYA 2M0OA 3QIIA 4CRIA 3KLIA 4DTUA 1S1XA 2R57A 5KI6A 3OQ5A 4ICLA 3P5JA 1RTIA 4BE0A 1LWFA 5EU7A 3AA4A 4KB1A 4DSIA 2X4YA 4OKEA 1NKBA 3A2FA 3SQ4A 3TI0A 3ZT4A 1HYZA 2MWPA 2HNDA 3QIOA 3DRPA 3DLHA 3MAQA 2F8TA 2VYTA 4RW8A 4DU4A 4DQQA 1B9DA 3MXJA 2XO7A 4BE1A 3SJJA 4DMNA 4BWMA 3K59A 3O4QA 1JLGA 1RBUA 2X6SA 4OGEA 2OPPA 4CEZA 1B9FA 5CZ1A 1VSFA 3IRXA 1CZ9A 3B6OA 1LWEA 4FYDA 2DIGA 2Z1HA 5HRSA 4CGGA 2JZ2A 1I39A 4AHRA 2O4GA 4NZGA 2R5MA 4CK3A 2B8AA 4Z4FA 1WSIA 4FU6A 3HXMA 3C94A 3ZSRA 2GUIA 2G8VA 4KB0A 4I7FA 4JRPA 1OZ2A 4MQ3A 1EP4A 5DMRA 4JS4A 3SV3A 5KE2A 3WNEA 1W9HA 4H4OA 4M3RA 5KGXA 4EP4A 2HHTA 3MEDA 1A5VA 4OVAA 1RBVA 4Z4CA 1XHXA 2QK9A 1S6QA 4B9WA 3QKJA 3FEOA 3OYEA 4FCYA 3OYBA 1SUQA 4DQRA 1IKYA 1I3AA 2DTUA 1G15A 3E9GA 2RO0A 3KJVA 2XY7A 1WAFA 1L3SA 5FROA 1HRHA 4BE2A 5JS1A 4FW2A 3AVJA 5HRNA 1JLEA 1RTDA 1DTTA 1JLAA 2P51A 3ZEHA 2JGUA 5E41A 2KQ2A 3V81A 3OS1A 2B5JA 4G1QA 2BGGA 2HQEA 3FLGA 2PYLA 1NK6A 2JLEA 4FLTA 3ZSYA 1KSPA 1EXQA 4II1A 4DF4A 4KHQA 3OYDA 1DLOA 2DFFA 3PX0A 2FBVA 4CJFA 5I42A 2G8UA 1FKOA 3OJUA 4DTOA 1QSYA 3SQ1A 1HPZA 4M3XA 3LP0A 4AHTA 4FJLA 3MP8A 4J2EA 4LD6A 4OGCA 4PWDA 4B9XA 4FZYA 1TVRA 3AVNA 4DU1A 2JTFA 4HUFA 3OYIA 4FLXA 3VQQA 2DY4A 2BE2A 1ZBUA 5C24A 3DOLA 3O8VA 2YNIA 1F21A 4ZTFA 3OYMA 4DFJA 2IDOA 2GV9A 4H4MA 2OZSA 3FDRA 2Q3SA 4K8ZA 3SI6A 1J9AA 4ELVA 3MEEA 3Q1JA 2P1JA 3VN5A 3AO4A 4KKOA 2BDPA 3OYLA 4EDUA 4O0JA 1CXUA 3M9QA 4BDYA 3ZSVA 4DG1A 5C25A 3NTKA 1CXQA 5HBMA 3MXMA 1IO2A 4OLAA 1W0HA 3D45A 1VSJA 4JLHA 1JL1A 2RJFA 3ZT0A 1KVAA 1RT6A 3CM6A 3EAEA 5D3GA 1Q9YA 4L59A 3VQ6A 4W5NA 2G8FA 3RMCA 1WSGA 3RRGA 1RT5A 3T19A 3O3FA 4UQGA 1NJYA 1OI1A 3UWNA 4X34A 4AILC 5CY4A 2LCCA 1J54A 2W42A 4QAGA 3L2WA 1XNIA 1WSHA 3G0ZA 1JXEA 2KZMA 3C95A 4W5OA 3VQ7A 3NH0A 1U49A 4DTXA 2HHVA 1ITGA 4LSLA 4FXDA 4DLGA 3NBPA 1X9WA 3OYCA 3THVA 1RDAA 1VRUA 2EQKA 4Z4IA 2NUBA 1C1CA 4CJRA 1CZBA 2HB5A 2VG6A 3K5OA 3EZ5A 3SPYA 3O3HA 2PY5A
chains in the Genus database with same CATH superfamily
3WE2A 5JHUA 1Q82U 4DNCA 3RIRA 2DK8A 1BOTO 1JGSA 4ZH4F 2NOEA 4NYNA 2KE9A 2H8RA 2EW3A 1KC8R 2DMQA 4DJAA 3AO3A 1A36A 3RMBA 2MCNA 3PV8A 1U78A 2BY2A 4BHBA 1X4PA 1NGFA 5DPKA 4DTMA 1YJNT 2QSHX 3A5OC 4FWSA 2NRXA 3PFIA 2KZVA 3H0DA 4M7DB 1BN5A 4F2SA 1X1AA 5AQFA 2D2WA 1Y96B 2EJ9A 4BC2A 4J9IA 3O9QA 5CPRB 4AU7A 4NCGA 3HL2A 3ABMH 3E2UA 3DQVC 5TJJA 4JYKA 3NE6A 2GFUA 3LM2A 1BKBA 1A04A 1RAEB 3PNVA 4DHYA 1SS6A 5FKLA 1B92A 4LD0A 3UKRA 3L3VA 2EINH 1F43A 3NDKA 3CF5F 3SJMA 3NF8A 4D0PA 2FPFA 1WLJA 3O1WA 2JPSA 4HX7A 4Z6YA 3HKZN 5AQYA 4PL6A 2DT7B 1MNDA 1WVRA 2O5RA 1RFQA 5L3DA 2YRCA 4BY9C 1EWRA 2EIFA 5KYUA 2JSCA 4FVMA 4FJIA 4D8KA 4ZDOA 2KP6A 3NH1A 1VQ8T 1H3HA 3K57A 1QVPA 3CDHA 3ME9A 2BXYA 4Q5WA 5AQOA 2RK1A 1ORPA 3LGLA 2H27A 4RDUA 2QM1A 1T05A 2GQVA 1OPLA 1D8YA 3K9KA 2G8WA 2HTSA 2E60A 2H6BA 3W6KB 2VB6A 1O3RA 3VS1A 5ICEA 5M5WJ 5FU7B 3CCJQ 5FO5A 4EMKA 2QEXQ 3E5UA 1QE1A 4CEBA 2CSIA 2CUJA 5AZJB 2X4HA 4CZKA 2NUZA 5GANe 3F73A 4RGRA 2OTJA 1SPKA 3ZETA 1BGXT 1BI4B 2M9HA 3WG7H 3AVCA 5E20A 4M78E 1VQ6A 3E01A 3ZL7C 3QYEA 4FASD 3AG3H 2JWLA 3WXJA 2R3SA 1KYWA 4EPCA 4OKJA 4J2DA 2A1RA 4NXMK 4D5FA 1U84A 4BI3A 3C6UA 2V1NA 1VQKT 4J8FA 4ISEA 3R9PA 1V4RA 1UEBA 1QQIA 1IHWA 1S5JA 2O7OA 5LHIA 3NFCA 4M7AB 3FXRA 1S8NA 4M63C 2JJ9A 1SMYF 1T8IA 3I0WA 3E6CC 4FLVA 3VGLA 4KFBA 1KSWA 2G8HA 4FISA 3CJ1A 1JXBA 4PJOG 4CZMA 2XPVA 1WHHA 1WGSA 1BIUA 1N6QA 3NEUA 3D2FB 2DXBA 1D1BA 1POGA 3EUHA 3UA6A 2K5FA 2W6KA 1VQ5A 2VL8A 3EKUA 2H09A 3I4NJ 3OMGA 2JG6A 4B8CA 3WGHA 3UA7A 3S1QJ 1PKSA 3M0TA 4BS9A 4WFBL 3ZQ7A 1HKTA 2OFKA 4FK4A 3O9UA 4A57A 4C92D 1R5HA 3O8HA 1WFWA 1MH3A 3SDGA 3DEEA 4XH5A 1WCMJ 2GBZA 1I1GA 4LFAK 2M9UA 1MBKA 1QZ5A 1JEGA 3JRHA 4IG0A 5J1RA 3CCSN 1K0SA 2K9MA 3FC3A 2RK2A 3HOTA 2BGCA 1G3YA 1Y7XA 2RQTA 3V1QA 3VEOA 2M8EA 5JR3A 1AT1B 1KG3A 2H1KA 4AIJA 2F2EA 1P7IA 3HUGB 4BRLA 3SK3A 3O2PE 4JKCA 3AVKA 3INZA 5EGOB 2QQRA 5ELZA 4NCBA 4IUVA 4W97A 1HMVA 5E26A 2YS9A 4NDLA 2Z1IA 2OAUA 2K5IA 1M1KR 1QQJA 4FJGA 4BR5A 5C2FA 3HL8A 1IJWC 4IHWA 3CPWA 4O8KA 1R5GA 4KN4X 2P6SA 2DFIA 3ZMDA 1TKDA 3KD1E 2VBXA 1R1TA 1YX5A 3UR3C 2A07F 1X9MA 4J6WA 5F1RA 3EGXB 4LB6B 4PJLA 2HKNA 3ROUA 4WX9A 3QEXA 2G9WA 3G6EN 2CJJA 2NVYJ 1YIJQ 3LZIA 4F7UB 2LF8A 2W04A 2VXDA 1FN7A 3JCMV 4JKHA 1ZN2A 4ELYC 2DL4A 4O5FA 3G4SQ 1BR2A 1JJ2P 2XF5A 5CLSA 4D7MA 3I59B 5CKTA 3A4CA 1XGOA 3KZYA 3LWMA 1ZC6A 1OR7A 2UU9K 2Y9YA 3VSLA 4HUGA 5FDLA 4XQFA 1J5OA 3FB9A 4BRAA 1P59A 2PG4A 4O3MA 1M27C 2FF6A 2DXIA 5FD5A 3K2PA 2E5NA 3OYGA 5EC7A 2B0LA 1ARKA 2LQ8A 3C2HA 3THXA 1XMKA 3W2VA 4ZC3A 1WDXA 4RAZA 4KIFA 2D1XA 4CZHA 3NH2A 2PMUA 4A69C 4WF9L 1IN7A 3CFPA 3KIOA 1OYWA 2NS8A 2EAYA 2QWPA 4QLCU 2EFWA 1MMDA 4IKFA 2G7UA 1HXDA 4FLYA 3IAYA 1M3QA 4ZDPA 2C6YA 2DMOA 3CMET 2P4WA 3UF4A 1IG9A 4D9JA 1S72T 4GY2B 3CFRA 1VQOQ 1V76A 1ETWA 3KHYA 1ZA1B 5J2PA 2FMYA 4DSFA 3CCQI 3SD4A 2IP2A 1ZRDA 2D4WA 5E79C 4E6RA 1M3AA 4C92E 3S41A 3VYSB 4FWPA 1SVOA 2DMPA 4C0DC 3P9IA 2EVRA 3QYGB 3SUOA 1IBLK 2O8BB 3TQ7P 2JN0A 3VS7A 4YOTA 2DL8A 3HM9A 1AOYA 2KIMA 1VQLQ 1S1NA 4N0AA 4M6YA 1S7AA 3FJ5A 3OGDA 2ZSHB 4B08A 1ACIA 4OPAA 2E20A 1W7AA 4JNEA 2LDUA 4F17A 2F2XA 1W97L 1SRMA 4OB2B 4C3IJ 4NL3A 1NG6A 4QIWN 1RDBA 3V7CA 2R58A 1UCRA 2VWBA 2FJ1A 1R36A 3O4WA 4W5RA 2L3PA 1VHXA 1YHQI 3RR7A 4IHXA 3EGDA 5DCMB 1ZQ1A 1HOMA 3VS2A 1HJOA 3C3WA 4EZ9A 2FXAA 2A37A 1D0XA 4NLBA 3OSVA 4AF1A 4U0VA 2DBBA 3MD2A 5AYFA 1RT1A 4C0ZA 4CC4B 2D5RA 4BXFA 1R1VA 2WFBA 3MP6A 2YHBA 3I5RA 3EN9A 2XGCA 5K5OA 3CLQA 1VYVA 1ZSZB 4ID5A 4G12A 4HZFA 1TS9A 3OW2P 1YI2N 1LV5A 4AMCA 4XKWA 1JXMA 4GLKA 4EJOA 4LK0F 1HYOA 4M3FA 1X3UA 4A93J 4OU0A 4CGDA 2CSOA 4IO9F 4CIEA 3DFGA 3B6PA 1ZLJA 1AWXA 3QESA 5AT1B 1NE8A 2M4KA 3NPFA 2JWTA 2RN8A 4ORZA 2NZTA 3UPUA 3FXLA 4JKGA 1XX5A 1TG0A 2V8JA 1D1CA 4JI2K 4CHYA 5L3EA 3EG9A 2CH6A 2CGLA 4M72A 2ZJPF 4LH4A 2VBWA 1IZ6A 2BE7D 2QYOA 2EPDA 1M90O 1GCQC 4B47A 1SSFA 3NQOA 1RDCA 4F55A 2NOZA 4JAXA 4F7ZA 4VUBA 1Z6RA 1VQ8I 1VQNT 5M5XJ 1VSMA 2OC6A 3IG1A 1R23A 1BA0A 4Y52J 4CSWA 3OIPA 3OY9A 3DP7A 2FX0A 2YUPA 3A03A 2YRDA 3CP8A 3FXJA 4Z4GA 4EZ6A 4M7AF 1WGXA 5CQEA 4ENKA 4G7HF 2K5LA 1XHZA 1MDMA 3RZOJ 1U5TC 1NKEA 5C10A 3LSGA 2UXNA 2JS0A 1CKBA 4HCZA 2MAMA 1WQ7A 2X4JA 1NGDA 5K7HA 1MSEC 1S9HA 3LWLA 2YX6A 4JRKA 2NOFA 2X6XA 2M51A 2NVTJ 2HHUA 1XSXA 2ZXHA 1ON2A 1BI0A 2KRCA 2G8IA 3QAHA 1FX7A 4DUZK 3T9NA 1A31A 3QOEA 4AT1B 3MXIA 5HROA 1SVLA 1RTHA 1KG4A 1Q86O 3CQTA 5D6YA 3PVQA 4OFEA 3GTKJ 4HCBA 2QF7A 4AFQC 1ZUYA 3C7JA 2L01A 1KAYA 3KFVA 5KQDA 3P8BB 5KVRA 2QI2A 5CKDA 5AZIA 1ORKA 2QKKA 2F5CA 3H3NO 1PSEA 4BQAA 4FWNA 5M9OA 5DYMA 4QS8A 1EH6A 5SZTA 5AQKA 1I1SA 3NGZA 4B48A 5D4SA 1SMTA 1MJ9A 3Q3SA 4FX0A 3PO2J 3H0HA 4IXCA 5DEQA 3J81Z 4RLFA 5GAOm 4KNYA 2LF7A 1J7KA 4C8QB 3MCPA 4XLNF 2Y2ZA 2DJQA 4NB5A 3S1MJ 3FIWA 2EQUA 3ABTA 3BOQA 4Z89A 2ZPEB 3K5NA 1LW2A 3LYIA 4JJNK 3QSUA 4M77G 4A59A 2L02A 2G7HA 1WJRA 2RPIA 1EWQA 1AHJB 2NUTA 5BOXA 1IV8A 3X28B 1RDWX 4BRIA 2WADA 3C18A 5D6EA 2K4YA 3F5TA 1TWCJ 3ATVA 4NQWB 3H46O 2OAZA 2HF3A 2ROTA 5I21A 4ENMA 3NAEA 3W6VA 1NK4A 1XN7A 2P9KA 3A5ZB 3TANA 2Y4XA 2EZKA 4RBOA 4UY8I 2ZKZA 4KH4A 1M1GA 2DMUA 2KNBB 1WH5A 1HNXK 3C7NA 1EV7A 3AGRA 1U1TA 4JDSA 4JJCA 3WNGA 2YNGA 3CCQA 3AHUA 5CKHA 1N5YA 1VSLA 1W7PD 3VRYA 2DPDA 3JCMf 2ASPA 3BG9A 1N3AA 2DT6A 1V3FA 3I5SA 1Q81O 2QM3A 5IAYA 1H8AC 3MX5A 5FU6B 3I56N 1SFOJ 2EGAA 4BUPA 2WUSA 4GDFA 2GWRA 2LDMA 3QWYA 4UNFA 2DRMA 4F16A 2IBDA 4WFNL 4F92B 3RSEA 2RHXA 4M7AG 2L89A 4H5VA 1TZLA 2F9TA 4A3BJ 1K8AR 4DTNA 4ELUA 4EHUA 2VQHA 4IUUA 2MH9A 2ICWG 3NTIA 4BBRJ 3A2KA 1RI9A 1NJIR 4CJ3A 3IRQA 1Z9QA 2VODA 1FJLA 3VYTB 1UAXA 3QBWA 1WSUA 1Z9CA 3IUOA 3BTLA 2NRVA 2OBPA 4I6MA 5GAOp 1YRNA 3K70D 4M9SA 2LR8A 1GLLO 3K4BA 4PUSA 2VASA 4KRTA 2L7MP 3C2BA 2QLZA 1YHQA 4FJ5A 3FXOA 1TWFJ 4ZNXA 3EFSA 3L42A 2HR3A 3LSKA 3VS6A 5H6RA 1HLUA 1GFCA 1K7AA 2W41A 4CEAA 4C23A 3N97A 3REOA 4KHWA 3F70A 5HNHA 3FBIB 1FYKA 3VS4A 3PMTA 9ATCB 2DD5A 3VA0A 3HVRA 1NK3P 1XQSC 1JI8A 4ILHA 3GEZA 3LL7A 2JVHA 1KD1O 1FTTA 3S6WA 3O8MA 1JT6A 2HQAA 4H4KC 3EYZA 3H8ZA 1SKWA 2O4XB 5LLQA 3G25A 2V9KA 1D09B 4DQ8A 2BUPA 2RI2A 3QP5A 4M7DC 1ATRA 4O4GA 3BPVA 3KLFA 4JI0K 2NLXA 3LMMA 3GOXA 3U3YA 1Q81C 4LD9K 5IP9J 2D0PA 1KU7A 2RGVA 4FT2A 1GOBA 5JLWA 1RDDA 4Y3OA 1RUNA 5CYMA 5FFZA 2XPUA 3X2QH 4F91B 3P7NA 2JVGA 3PFYA 5KH6A 2M16A 1IBKK 1B4AA 4LLGF 2CGJA 4CF2A 1Y07A 3LWHA 4A3EJ 2P9NB 3ZT2A 2QA4T 2DL3A 4FJXA 2FO0A 4PNOA 2XC7A 1YXQA 1J0RA 4GVMA 1VI0A 3AVHA 5DM7F 5AQUA 1KAXA 3H0GJ 3OYFA 4DV3K 1VQ8A 2ZCWA 3C2GA 3F2KA 2DA2A 1M9SA 4A12A 1KQSM 3JB9I 4AYBN 2M0YA 4XEIA 2GZWA 3DYAA 3RMSA 3VQBA 2HQNA 2MI6A 3HYIA 2V9VA 4C0FA 4J83A 1ZRCA 1XTDA 3M1EA 4DGWB 3ISNC 4U67L 2CZ6B 1KD1C 1S1UA 3CVSA 4FL6A 2M30A 1U8RA 5FU7C 5GAOl 3KP3A 2K9QA 4Y1CA 1ZBSA 3G71T 4FSVA 3GG4A 2GTJA 1HNIA 1W0UA 1J9IA 3CWUA 4CEEA 3F0CA 5HS7A 4CFAA 3MECA 1KO9A 1R71A 4L5EA 3CC4Q 5I3UA 5M1NA 4B1WB 2FZCB 3ZX0A 2ZFUA 4M3UA 1YJ9N 2G3RA 5E1ZB 1IN6A 4L18B 3P31A 1S9GA 1VSIA 2EGEA 3RTVA 2XY5A 3EFOB 1FIPA 1DGRM 4M7AC 1BI2A 4Q5SF 2NUPA 4CJKA 1QQOA 2DRKA 3QNOA 2MLKA 1K9MC 5EZHA 3QUIA 4MNUA 2R5AA 3FX3A 2DU9A 2NRAC 3S6IA 3CESA 4XKCA 3CCMN 1GRIA 4RG2A 2E1MB 3CCSI 4BC3A 5HK3A 1WSFA 4MEYF 4JI1K 2EWSA 1Q81U 1Z6TA 3S17J 3TO7A 4A4EA 2YU3A 2UXCK 1TNSA 1TL3A 4E1MA 1QKWA 2D0OA 4CEOA 2LKSA 2R5YA 1MUZA 5GAN3 1XMXA 2G6FX 1QTMA 1KJWA 3CCUN 5B8HA 4RAGA 3MCAB 2FPDA 2QQSA 3HT3A 4KN7X 3PGGA 1O1WA 1UHCA 2VJ4A 4IFYA 3CUQB 3TAMA 3EKSA 1C6VA 3E6DA 4EJUA 3FISA 3S16J 3TSUA 1FZPB 4J19A 2F1LA 1AEYA 1STZA 1XJWB 4PJOD 3QO3A 3OS0A 3PUFA 4BU2A 2YHYA 3SMSA 3FIFA 1RIOH 3G6EI 2QKLB 4YOQA 1RADB 4C8QF 2OPRA 1U8BA 4M45A 2E65A 3SJHA 3M55A 2DKGA 1SFEA 2GOMA 1KD1U 2DTZA 1KAZA 4FO0A 1GBRA 5CVVA 3MEAA 3ID8A 5C6SA 1GLCG 5KGWA 3C0BA 3MKYB 2BY1A 4O5BA 3M8SA 2IRFG 3AA3A 4LUEA 4WFAL 3W2AA 4PA1A 4FT8A 3JCMc 1YQAA 1T3VA 1ATSA 2J7IA 1VSEA 4C92A 4XR6A 1IHVA 2EYZA 1WZOA 1KG7A 2RVCA 1A0NB 3K4MA 4YHHK 1H9GA 4A4KA 2VKDA 3EPZA 2D5VA 1CKAA 4L5IA 5GAMg 4Q4ZF 3ZSOA 4EVIA 4A63B 2GUPA 3BPXA 3CMAQ 4PZJA 1XS9A 3HBLA 4DS5A 4N5SA 1K4TA 4AD9A 2CT4A 1F9NA 1K9MU 1IAWA 3BROA 4NLCA 1MKMA 2RC4A 2R7ZJ 4J9CA 1NPRA 2ABKA 3QO9A 5A2QO 2XAJA 1WFXA 4M75B 5KAIC 2JA2A 3WTXC 4IHTA 3CPWS 1TP4A 1FW6A 4H5TA 2KTQA 4MLEA 2P7VB 5B5EC 2GFAA 3CWSA 4M78B 2ECZA 3HC7A 4ESJA 3WNFA 4GV6A 1QLYA 3TAFA 3O80A 4GMJB 3CCLQ 1IH7A 4EVVA 4BI8B 1X27A 1RETA 4JP0A 2H8WA 2RD1A 3HKZA 2KIFA 4RGXA 2OTLQ 1BUPA 2KT8A 1IKVA 3D5LA 1VQ4N 5L23A 4BDPA 4KYWA 1OPKA 4RW4A 3CPWM 1DUXC 3L7WA 1R6RA 2JA8J 1QVFA 4LH5A 4DV2K 2Z1JA 2L9RA 1U2VB 1Y64A 4DIQA 3KETA 1F36A 4A3MJ 3KYCB 3KWGA 3SWNA 2BZ8A 2DBMA 1F1ZA 2XMFA 1JCFA 3KK1A 3FK7A 1TTYA 4A4GA 2NRWA 3CJ7A 1HYSA 4EV0A 5I2SA 2B6AA 1LOJA 3M8QA 1ESVA 1Y0UA 3FHGA 4AM3A 2IS4A 2XAQA 1VRLA 2X74A 3IH4A 5AQTA 1Q1HA 1TNTA 4B1VA 3QBYA 4KITB 1T3SA 2FEZA 1NGHA 1UHWA 1YI2I 1BO5O 4NC8A 1S1XA 4M6VA 1KZHA 5HKCA 1QVGP 3CC7N 1LWFA 5GAN2 1D8JA 5K7ZA 1XGMA 3WHCA 1B59A 1RKWA 1QVFP 2JQ7A 2E35A 1NKBA 3LSMA 3A2FA 3CMMA 2CUEA 4H03B 2P9IA 4I09A 5FKOA 4I76A 2MWPA 3WTYC 1QP2A 1LEBA 2HNDA 2QWQA 2B9SA 2MLGA 3G1JA 5L8RE 2GA1A 1IREB 4RW8A 4DQQA 5GIOA 4J9DA 3MXJA 2ED0A 1HW1A 1ZSZC 3JB9J 1ZYRF 3CCRT 4DMNA 2HS5A 2IXSA 3O4QA 2I0NA 2R7VA 2LNHB 8AT1B 3THKA 1B9FA 4M71A 3T1YK 2V1DA 1VSFA 3O5ZA 3IRXA 3HSCA 2XDBA 1CZ9A 1LFUP 1RUOA 4FYDA 4E6KG 4OMOA 1T0FA 1I39A 4J7FA 2O4GA 3MKZA 3E6BA 2R5MA 4QS9A 3COAC 1E0EA 1IUYA 4S0HB 2ZNYA 2GXAA 4Z4FA 3W3DA 3A8LB 3CCSA 3VV0A 3TSZA 2KRNA 4U88A 4BJ6C 2LCLA 3ZSRA 3ZQCA 4JRPA 3P9CA 4A0ZA 4XRMA 1IXSB 3SHWA 4BY7J 3CXCS 4MQ3A 5E84A 5M1KA 2H3EB 3KP4A 3F9MA 4JS4A 2K3PA 3SV3A 3DBRB 2D0NA 4BGDA 2EJFA 4H4OA 2HI3A 5GMKj 2LY9A 1AWJA 1YITT 3I55Q 3WTWC 3MEDA 2Y0SN 1A5VA 1XOVA 2OTJQ 4Z4CA 3GPLA 2W10A 4OMLA 4U0YA 4DR5K 1XHXA 2QK9A 4G94A 2I7NA 1VQ6Q 4EW4A 4XTZA 2FVUA 1N8RR 3H3VK 3TL4X 1WKMA 5BPMA 1KA8A 5GANf 4PIIA 1KYZA 2DL7A 3MZ8A 3E9GA 3TW7A 1W5CC 4J9EA 1OCZH 3KJVA 2XY7A 2A0FB 2J4RA 4CC3A 3RDIA 1HSJA 4ESBA 3GWZA 4IOAF 1UE9A 2VGMA 1UECA 3G6EA 2BW3B 3MQ0A 1RTDA 4GV3A 1JLAA 4OIOF 5K5RA 3K4KA 1ZARA 4XTUA 3ZEHA 2QW9A 2PX9A 4JQFA 2KQ2A 3ZMTA 2PJPA 1KU9A 1IG8A 1I50J 5D8KB 3AAFA 5LBQA 1EZZB 2HQEA 3JREA 2JLEA 4FLTA 5LFAA 2RREA 2X6YA 1FYNA 2C0TA 3U1KA 1VQMT 4L5GA 1IZ1A 2O8KA 1DLOA 2F5TX 2FBVA 4HTLA 2IGKA 1JBMA 2G8UA 1WXTA 2DPNA 1QSYA 4M3XA 1QRYA 1WXBA 2PVGB 2M2EA 4FJLA 3MP8A 5BMZA 4LD6A 4FZYA 1OQKA 2FSJA 3GX4X 4DU1A 1HKSA 2JTFA 5EEGA 3VQQA 3WGGA 1EA3A 3OSFA 5CKEA 3SQNA 2CT3A 1EQYA 5C24A 3PIOL 2MC3A 2YNIA 2EV0A 4C8QC 4HVVA 2LREA 3F3XA 3OYMA 4DFJA 1YS7A 3GFMA 4OFHA 1B72A 3LAPA 5IT9O 2Q3SA 1K9AA 3CF5L 2PJRA 1TQPA 3VEWA 3MEEA 1U5SA 2JMAA 5GAGJ 2P1JA 1PRMC 5EXWA 4XICA 3AO4A 1TUYA 3EZWA 5B1AH 1VQ4T 4EDUA 1CXUA 2YLCA 2VJIA 4LF7K 1K73O 3ZSVA 2KBTA 1UZCA 3CC2A 2PZ1A 3TGNA 3VJPA 3MXMA 4OLAA 4RAYA 5IWAK 2CQNA 2ME0A 1W0HA 1W4MA 4ENJA 3S1RJ 3CBOA 2HYGD 3B73A 2DXUA 1P90A 2RJFA 1Q86R 5KQ8A 1KG6A 4ZDLA 4DR2K 3CCYA 2HKXA 5D3GA 2CP0A 1YJWN 3K2ZA 4W5NA 1VQPT 2IVOA 1WSGA 2PLYA 3RRGA 4J6XA 2K2MA 3PSFA 4JD2B 4RM3A 2JHNA 3O3FA 1WJEA 5FU6C 4I02A 3VGKA 3CERA 3OIOA 2K4BA 5CY4A 3K69A 1H92A 4M77D 1XNIA 2CZ7B 2JA5J 2A68F 1BU1A 1U9OA 4RMNA 3V8KA 2DYBA 3VOVA 5D8LB 1VQ9N 4C1NI 4M78F 4W5OA 1H9TA 1U49A 1H0MA 3QPSA 1OFCX 4DBFA 1G59A 2EFNA 4LSLA 4FHTA 4A6DA 4D1QA 1X9WA 4ZGDB 5GMKh 1OYIA 3THVA 3OHRA 2P9IB 4L9VA 1YI2A 2BVLA 1CZBA 3WXIA 3K5OA 3F23A 4GFBA 4RCCA 4X62K 1YQLA 1LWWA 3JCMW 3OYYA 5GANj 2FNPA 2IW5A 1Y97A 1H1VA 4C5IA 1C1AA 4Z02A 4BR0A 3D4VA 1LWYA 2E4LA 4RM2A 2YR2A 2CP3A 4QSHA 2KFNA 1HYVA 2IPOB 4ON0A 3ZCMA 4CFCA 5JLXA 1W2BA 2DETA 1X3ZB 5FW9A 4KTZA 2COYA 3MWMA 4N47A 2V1RA 3TP3A 3SCXA 4B9TA 5AIPA 2GIZA 1Q1VA 8ATCB 2DF6A 3DAWA 1HNVA 2CW0F 1GL5A 2GWJA 3LCNA 3T5XA 5ED4A 1HW2A 3CETA 3VQEA 4KPYA 2I8DA 2Z3YA 2V9PA 4N76A 3UE5A 3QLHA 1NJXA 3T1BA 1XGNA 3N5NX 2R7XA 1WPYA 4B3OA 3L6QA 3F8FA 3IV5A 4AIHA 2IGIA 3EH2A 1VF9A 1A5JA 4K25A 4BL0B 5J4YA 3GE1A 2J5OA 4LE9A 1I1JA 3CMYA 5LJ3h 3T7ZA 1Y6IA 3Q7BA 5J6XA 2DODA 2ZPIB 3H5AA 1IDZA 5LJ5g 1PUEE 2EFOA 1MGTA 5F1JA 2Q2RA 5J3LA 5F1XA 2CZ1B 2O8EA 2PBIA 3WTUC 1OOTA 1W0TA 5FLVA 5FKNA 2W25A 4L6V5 3HYFA 2HOEA 3CJNA 4DLEA 5EVZA 1SHGA 3TSPA 3VQPA 3H5NA 4YEJA 4LK1F 4B23A 1B34B 2RA2A 4BR7A 4K0KK 3TU4K 3NRVA 1RGIA 2BIVA 4WXCA 2R7YA 3DMJA 4E7IA 4FZXC 1VTNC 3TR8A 2OCEA 3WHBA 4BXUA 2QAZA 2DYSH 1HQEA 1YJ9I 5BREA 4GKJK 2GNCA 2HYFA 3FR0A 3ML6A 2DTIA 1MA9B 2YX7A 4KV8A 2CUBA 5LY3A 4X1EA 1BBZA 2O31A 1SL1A 2NRHA 1LFPA 4M77E 3K4CA 1UWBA 2EFPA 3VF2A 2PFUA 3NGYA 2QENA 3HOXJ 3GBQA 1X2QA 3DLEA 4OOIA 3MEVA 3TABA 2YX4A 3CCMI 1K73U 1OZ3A 4IWVA 3HM5A 3GZ5A 3OJSA 1EETA 5M1QA 2L9SA 4M7XA 3CD6N 5L3GA 1NK8A 4V2GA 1FBQA 1N9RA 1HKQA 3OH6A 5GJVB 1HJDA 4FTHA 1LW0A 1ZELA 2RF0A 2CW8A 3QYBA 2FU4A 2L2PA 2HPMA 1Y39A 4WXHA 3D7EO 2P81A 4B3RK 5LL6S 1OV3A 1YCSB 4IIMA 3CJCA 3ZXSA 4F8RA 3JCMJ 2DJIA 3MO8A 4AI5A 3DXMB 5L3BA 3VEVA 3ALYA 4XH4A 1K79A 1KC8O 3SAHA 2E1MC 4DBQA 1FBSA 1ZTRA 3H3UA 2HQHA 3J80O 4NHJA 2O8CA 2RJCA 4CUGA 4N41A 3S93A 2OAWA 5E17F 5AQHA 2I5JA 1XC3A 1W36C 1G2BA 3CIPA 5J40A 3CCJT 1QZ6A 2QEXT 4OVLA 1TUGB 4I2PA 3ZMZA 1B07A 1X43A 1AVZC 3EE9A 4C92F 4A5MA 3V4IA 4M3GA 3WU0A 2KJCA 4YDUC 1QNTA 4NS5A 2KJBA 3I33A 1XMOK 3CUQC 1BW5A 3I56A 3HTVA 4FJHA 4KI6A 5EEHA 3F8MA 1WOQA 3AG2H 2A40A 2JRTA 4G9YA 2HHXA 2RHIA 4JJBA 4R8HA 3BR5A 3ULRB 4KULA 2KL4A 4HCKA 4CD1A 4X65K 1D5YA 4ZZLA 3LAMA 1NJZA 2E7XA 2YNFA 2MMPA 4JLIA 2OA4A 1YFHA 1REPC 4KIBA 4XQ3A 2Y75A 4KGZB 1R22A 4HXJA 1N78A 5EY4A 1MV0B 1SKSA 3QFPA 3A1YA 2CP7A 3THYA 1ABQA 4CYCA 1OULA 3LX7A 1MU2A 4XL9A 1BG3A 3EFRA 1OCTC 1E6HA 1EX4A 4NBQA 3ABUA 3OR2C 2OANA 1GV2A 1LDDA 2EQMA 1UFFA 1WJSA 1ACMB 4DV4K 1OPCA 3H6EA 2ZPFB 2M7BA 5KE3A 5DK5A 1ZAOA 2ZD1A 1TUDA 3KE2A 4L9NA 5FLMJ 5FKMA 3GBGA 1S3XA 5E1XA 1GLFO 4IO9L 2FZKB 4EJYA 3DV8A 2WTEA 4AHUA 2H8HA 5ICGA 2O2OA 4BRPA 4XU1A 2A28A 4B9LA 1Z26A 4MTEA 1LWVA 4AFUC 1BCMA 1W7PB 2KKZA 2VJJA 2YNHA 3LFKA 1GLDG 3HJFA 2M1HA 2HKOA 3BQYA 4IOXA 4RB2C 4BRNA 4XK8E 3J8AA 3VQDA 2ZJQF 1K83J 3Q0VA 4EJVA 2W00A 1UJ0A 4B1XB 2ZJPL 1VQ4I 1LQ1A 3KBGA 4MZTA 2X35A 3HVTA 2WSEE 1L3TA 1S29A 4M75C 4RWTA 4P55A 5FPDA 4CCHA 1MZBA 5F6FA 2OD5A 5HLHA 3MX2A 2L9VA 1MBFA 2J6FA 4JS5A 4LITA 4M78C 1O3TA 5D5WB 1G99A 1U3EM 4QW2A 1GLAG 3ECHA 3ITHA 1MMGA 3BDLA 2MF2A 1Y56A 3A01B 2PUOB 5C3EJ 2AJQA 2KYMA 3K5LA 4EA4A 4YOVA 2C0OA 4E7SA 3QPTA 4HOBA 1HKBA 4CFBA 2Y1JA 2WBNA 2ZBKA 4CJLA 4AYBA 4KI4A 1YIJT 3LDOA 2VBYA 2FYKA 1Z25A 4D5CA 3JCMg 2J6KA 2N8GA 4HVUA 1MBEA 4DYCA 4C92G 3ZSZA 2QTDA 3G4ST 4QVZA 4PKCC 2IAJA 3ASKA 3DLRA 2E88A 2XKOA 3VSKA 2HSPA 1YHQQ 3EEQA 2EFQA 2ZJRF 1MW7A 3CC7I 3I54A 1DU0A 2R5ZB 2CGPA 4B1YB 5JMVA 4JKBA 2LVMA 3OTOK 4XN3A 4RTWA 1BOBA 4MDWA 1JCEA 1VQ7N 3OSSC 2BHZA 3FXUA 4LF4K 4CCKA 4HVWA 2HBMA 5D5UB 1RESA 1R7JA 2HBWA 4CHPA 2X4XA 3K4JA 1QSSA 2X9DA 3IKTA 3S9HA 3M8EA 4BACA 3SFZA 1YJ9A 1KC8U 1NEBA 4YTLA 4X9DA 3HSTB 4UY8O 1L3VA 4A2BA 4OLBA 1FLIA 1LNXA 3R0AA 5TRDA 4JOMA 3QU6A 1KHCA 1UB9A 2DBKA 1K76A 1U2WA 1FTZA 3BR2A 1VQOT 1OCCH 4ITVA 1WYXA 4XTXA 2O88A 1FXXA 2QQ8A 4IEJA 3CCMA 4JKFA 3G73A 5A2QE 4RW6A 4MO7A 3J7ZI 3L09A 3VWBA 3HOWJ 3O9SA 1QVFM 4LDYA 1RRSA 2PAVA 1VA7A 3V7SA 4H0OA 3D2EA 3LZJA 1WPKA 3CPFA 3SYTA 2KHOA 1WJFA 3H1QA 3CCUA 2EA4A 1MBJA 2HVIA 1VQLT 5DD8A 2MWOA 4I01A 1NK5A 2NVQJ 3CCEQ 3DXKA 1H3ZA 2KDOA 5AIQA 4MGRA 3CPEA 4FK2A 1AKHB 4BXXJ 3JB9G 3MEWA 1W70A 1LJ9A 2QZ8A 1NBEB 4QS7A 3E6MA 3S3OA 3VS0A 4CI6A 3OOPA 2WC9A 4Y1DA 3KP6A 3DKMA 4CK2A 3NVKA 2Y1IA 3C6TA 4DSJA 2FG0A 2X3WD 4CECA 4FJ9A 2IG0A 4NB4A 2JPCA 1M1KC 2HDWA 3TOBA 4UC4A 1WI3A 4UUTA 1HU0A 3M0PA 1JJ2S 1KCFA 1C0GA 1ZYQA 1UB4A 2EQJA 3HP9A 3WXLA 3V42A 2UXBK 2HGCA 2ZC2A 3T8RA 3RERA 3LDNA 2O8DA 3RYPA 3ENOA 3U4LA 1IB8A 1F5TA 2HNZA 3F9KA 2NRRA 1Z3XA 4O5VA 2VV5A 4CJ7A 2TCTA 1KIKA 4OP0A 4BG8A 3GTPJ 2M87A 3K1PA 1M8VA 5F0CA 4HNUA 1CQTA 1UMQA 3JW4A 3SFMA 3TEEA 2ZNZA 1F4KA 1P7JA 1SKUB 5GIPA 4C8KA 1JL2A 3UKUA 1TUUA 3GZNB 3V4GA 3ZQQA 2EYXA 1KK7A 1IGQA 2B4JA 2LMDA 1OQYA 5CO7A 1RT2A 5ICFA 2KQWA 2LYCA 3KUFA 1UAAA 3ZGKA 4PL7A 2DA5A 3R8EA 2PMHA 2QTVA 3ZN1A 1YW8A 2XAGA 3VKIA 2JA6J 2JS2A 4IUTA 3JCMb 1WHMA 1JE8A 4WK8F 2QBYB 4CO8A 1NKCA 5KYXB 2XI9A 1JTXA 1TKXA 3I3LA 3T0YA 4XM3A 2LQWA 5FWCA 2YRVA 1RBRA 3V9WA 5DUIA 5E3NA 4PJOB 5GAN8 4V2SA 4WCEL 1QVTA 5KYWA 3WTVC 3TAPA 4FWLA 2ZMEA 3DLGA 2D1HA 4BDZA 2OZUA 3L4IA 2L7KA 4TVRA 2ZWHA 2XY8A 2HSEB 3BP8A 4NNJA 2JSPA 3A8YA 1YJWI 1VQ4A 1UGVA 4OFAA 2OZ6A 5LJ3d 3GF2A 2K4JA 1T7PA 5H20A 3KZZA 5I22A 2DD4A 2YUQA 2XICA 4J9BA 3H08A 1KVCA 4YPRA 1LB2A 3WTSC 3QOPA 5AFUA 2W82A 3IL2A 3SZ2A 1K78A 2Y30A 2ZGZA 3R6MA 2WAQN 2LG4A 5KYYB 4B21A 1BBYA 1BK2A 2Q31A 2LT1A 5HOOA 1M1KU 2CKKA 2HW3A 1DP3A 1WQ2A 1ZHFA 4FJMA 2QGUA 5AQLA 3MZYA 2I10A 4CHUA 1T95A 2LLKA 4PFOA 4L0YB 3O9TA 4CZEA 2E5QA 1JKHA 3R60A 1D3BA 4FWMA 2Q2EA 2VG7A 5IYBJ 4ZGJB 2JMWA 2Z0WA 5J1UA 3JRCA 7AT1B 3DLLL 2NNYA 1U48A 2YSRA 4CZIA 1O13A 3E0JB 3LDSA 4FK0A 1IRZA 2AXTC 4EP5A 1LPQA 3R0JA 1A6QA 1FNNA 3PT9A 4XNFA 1KRPA 2IS6A 4PUOA 5CQYA 1FOXA 3CC7A 2A61A 5H1SQ 3A0BC 2VBZA 1DT9A 2MFZA 1BDGA 1OH6A 4H0YB 1FIAA 3WVDB 1R77A 5ICCA 2BKDN 4E9GA 1QS4A 2R7DA 3HOSA 3L2QA 1AWOA 1EH8A 4H0TB 3K6GA 2XY6A 2FBXA 3QPLA 1M2VA 3QEVA 3VDXA 2MGQA 3DB4A 2PMZN 5J2MA 1YJNN 3FZVA 4ETSA 2NNWA 1FPQA 4JK9A 3PY8A 2D0CA 2LSOA 1Z05A 1R59O 3G3ZA 4MFEA 2WV1A 1HQUA 1FP2A 1GBQA 2K79A 3BW1A 1N32K 3TO6A 4DSLA 4FZZA 2KISA 1TBXA 5DV5A 4C5HA 2MYSA 3D2EB 2HHQA 2P8TA 4MZPA 1ZR4A 5IT9E 1LE8A 2E2OA 5TKWA 1K8KA 1MUNA 2FE3A 1CSKA 4OAYA 4CHNA 1ZQ3P 1LJOA 1GXPA 3AFHA 1RZ4A 1QQNA 2KXCA 3A0HC 4FL9A 4GW6A 1XCVA 4K42A 5GADJ 5K1YA 1UGPB 3OH9A 4XH1A 3CW7A 3LSRA 4KHSA 5C44J 2DAQA 3LAJA 2Y0SA 4J7IA 4BEHA 2VT3A 4LLLA 4WCGA 2YKMA 3DU6A 2SRCA 5IYDJ 4DSEA 4M9XA 4FM1A 2K02A 3BLYA 3TMOA 3FK6A 3BG7A 2H3GX 4PKGA 1XI1A 1P4WA 4Q0BA 3PMIA 3JTHA 4J9HA 3VQ9A 2ZM6K 3EYYA 5H2FC 3LSIA 3QJ6A 1XC5A 3KEOA 2GBQA 2NOGA 3SUPA 1W2BS 2UWMA 1IXCA 3ZPLA 1OJLA 2R0QC 4BROA 4ID1A 4E9EA 1YOVB 3WQUA 2RHKA 4B9NA 2NOLA 3S1NJ 1TQMA 5H6QA 1Q82C 5GAMf 3L3UA 4JKDA 3V9ZA 3I64A 3CMAN 3AKZA 4OX9K 1VQKN 3RQ4A 3CD6I 2E5LK 1W2BM 4P1WA 1WNSA 3ZT3A 3LANA 4BRGA 4XN0A 4B9UA 2A41A 4UV8A 1OYYA 2W03A 1E3OC 1K8AO 3ZRGA 2LCSA 5GP9A 3IKVA 2Z99A 5ADXH 1NJIO 1PSFA 1RAHB 3VF6A 1AZGB 1TXQA 4BBSJ 1O7LA 4LXCA 4BHPA 1BISA 2FL7A 1BIZA 3GLLA 3CCSQ 4FETA 4AQYK 5BRHA 3A8OB 2MD5A 3HRUA 1YAGA 2LBFA 3H1VX 3L00A 3JAMK 3K4LA 1X2MA 2ZGYA 4AG1C 1CF7A 4AG2C 2O9VA 2OZMA 4N4GA 1NYGA 3ELKA 3SDZA 1M2OA 5EG0B 3K2AA 4LD5A 3KTUA 4JI8K 3NF7A 1G3SA 2GWKA 4ENNA 1LCUA 2W57A 2DK5A 1P8ZA 2LQKA 4IIOA 3VYHB 1FK9A 4BRMA 4V2FA 1NOYA 4F3OA 3QDRB 2E34A 3BCAA 1WSJA 3K10A 1X75C 3AARA 4CCJA 3CJQB 3H9NA 5AJ3K 1YJWA 1R58A 1U3OA 1PC0A 4LMYA 2JHJA 2K6DA 1ZGWA 3M8PA 4N56A 4EATA 3G6EQ 2P4RA 3NTHA 1KFDA 1WHGA 2LOOA 3RUXA 3CC4T 1PUFA 1E6GA 3RYRA 4WCIA 2E71A 2LKPA 3FJPA 4B6MA 4OPKA 2H6CA 3V9SA 4DTSA 1XUPO 4C8NA 3R2XC 5D6XA 1QHGA 1IO6A 5FPEA 2IS3A 3KLEA 2IT0A 4YOWA 5GANg 4DF8A 1WI9A 1VQ9A 2G0EA 4B4CA 2OQGA 4M74A 4QVDA 4C8LA 3C65A 5GMKl 2VGNA 3TW6A 3MVPA 2CQXA 1KG5A 2HPIA 1T0JA 2M34A 5TISC 2RMOA 4KBMB 3PQKA 1I4K1 2M7AA 1OH7A 3NGIA 4KREA 4B9SA 2L9NA 4LF8K 5E18F 1TYQA 2YSQA 1J5YA 4J8OA 2DDBA 1HC8A 2P0WA 3IP4B 2XDPA 1UHFA 2F96A 3RZDJ 4N4OB 2LX7A 5C15A 3PJRA 2XAFA 4PKHA 2NRZA 3V1RA 1HX1A 2P0PA 3VUZA 3HPHA 4HHTA 4B9QA 3Q0UA 3DCFA 1SL2A 3GYHX 1FYLA 2YLBA 4M7DE 3CC2Q 3D0SA 4HUEA 1BW6A 5GAMj 1KQSP 1JLCA 1GCPA 5AQRA 2BTFA 3H9QA 4N0BA 4P5OA 5F0HA 3J7YJ 4ZTJA 1TWAJ 1LDJA 3CMEN 1KGSA 3J80E 4K41A 1S72N 2A42A 4ZJZA 1UGQB 2ZF5O 1ONVA 3I55N 2XIGA 3GIBA 1S1WA 3J7YP 3TVTA 3QNNA 3K5MA 3VQAA 5KN8A 1TUCA 4FE7A 2HNIA 3T69A 5J39A 4B3XA 5LGUA 2HKQB 4O0IA 1USSA 4AWXB 4M77B 1NJWA 1DGWY 4Z2YA 3JV3A 3E9PA 4A4HA 4XLAA 2QUFA 1C0WA 4DTJA 3F8BA 3O4NA 4JHDA 4PLIA 1KLMA 2FEIA 3B6CA 3H35A 5I9EB 1YUWA 2EYWA 5D6FA 2P9PA 3SAGA 3JSOA 4CHOA 2GQIA 3MCZA 3ZEUA 1MV3A 5C42A 2L3RA 1D5AA 5J8FA 1JXOA 1WSEA 5BR8K 3OV8A 3GW2A 3K70C 2P9LA 4KHYA 3GFLA 1VQ7I 1JKQC 3SEQA 1KFZA 2Z2SB 2DA4A 3D6RA 2W40A 4JRQA 1K8AU 1G3TA 3IHUA 3PX6A 4CZCA 2D9TA 2B63J 1NJIU 2XROA 2ISYA 4HLXA 2E4HA 4HYEA 2O8FB 5EOYA 4GVEA 3P9KA 4MHGA 4A2UA 2JK3A 3HK2A 4DUYK 1YI2Q 2GAUA 3DKYA 4CJ5A 2ITGA 2V6EA 1NGIA 4N9IA 3EH1A 2RDPA 4CF9A 3CMAT 3BG3A 5AN4A 1XPXA 1KXPA 1C0FA 1KVBA 5SWMA 4DA4A 3OIQA 1V1CA 3AV9A 4CGHA 2P5KA 2M0OA 2P9UA 4CRIA 3QIIA 3OL3A 2E1YA 4DTUA 2XIDA 5AQVA 2HHHK 2R57A 5KI6A 3OQ5A 4EW0A 2XB5A 3GF5A 3QYHB 3AA4A 3CD6A 5AQXA 3CCLT 5C4XJ 1E17A 3GFIA 2Q97A 3SQ4A 3GVAA 4CCOA 2KVQG 3ZT4A 1HYZA 3IFRA 2OTLT 4FOIA 5GMKi 2KQRA 3QU3A 1JGGA 4JX5A 1IGUA 4FYVB 3DRPA 2UUCK 4XKVA 2VUBA 1HBXG 3MAQA 4UVBA 2K85A 3ABLH 1UUEA 2VYTA 4DU4A 1B9DA 5DDGA 3ULEB 3SJJA 1AOJA 3KEQA 1NPPA 1AWWA 2X6SA 3VUBA 4CEZA 2QYZA 5CZ1A 4IHVA 2CS3A 3BY6A 3GCMA 1LWEA 4UUSB 2XKPA 3BTJA 3EO3A 2WSCE 1GV5A 4CGGA 2E19A 2MIOA 3O08A 5EZGA 1DU6A 3M5AA 4GO1A 4CH7A 2BEOA 2B8AA 4OIPF 2STWA 4CW7B 3TPQA 5GAN7 1VQNN 1WSIA 4HSRA 4FU6A 4NL2A 3HXMA 4BHCA 5DTDA 3OR1C 2ZO4A 2ZZDA 3SEMA 4KB0A 3HHGA 2CDTA 1SC7A 3DWLA 1OZ2A 2WWYA 3DKXA 1EP4A 4DV5K 4EIKA 1G2HA 3WNEA 4WQ5C 1X01A 1NH3A 2E12A 4RB0A 1Z21A 4EP4A 1O9SA 4OVAA 2PVDB 1RBVA 3JCMQ 4ESRA 5GAMh 2YI1A 5LRRA 1X1DA 2XHCA 1GLJO 4LFBK 5A2QZ 3AL0B 4FCYA 1MUDA 1IG7A 2FA5A 4DQRA 4E4HA 2DTUA 4MFDA 2RO0A 4ATOA 3ZMUA 2R7FA 1WAFA 1YCYA 1ZLMA 2LJ0A 5FROA 4BE2A 5JS1A 5AQIA 1OMIA 3CBMA 1WJ5A 1BR4A 1DTTA 2NAZA 4M3BA 4ASNA 1I3QJ 1T2KA 4F7UE 3M4YA 2VQGA 4EGZA 3IH7A 2JGUA 5E41A 3EHRA 4G6QA 3JB9D 3FMSA 3V81A 3WUHA 2V51B 4RTFD 2BGGA 1PP8F 3NHNA 2AK5A 2PYLA 2ITMA 2F7TA 2EQRA 1HKGA 2EJRA 3HHHA 5BN9A 3ZCOA 4G8XA 1ILYA 3CPWP 4DF4A 2VPLA 4BYYA 2HU9A 3QP6A 3ZMSA 4CJFA 5I42A 1DGKN 3IH2A 5GTIC 3OJUA 3OL4A 4DTOA 3N4QA 2I7PA 1GVJA 3BDDA 2K5CA 4AHTA 3THWA 4L9JA 4PWDA 4ZYEA 4B9XA 4YIRX 1BL0A 4HV5A 4YFKF 3UKRB 3AVNA 5CKFA 3I55T 2X51A 2Y69H 2OTJT 2LJ3A 4AC0A 2BE2A 2YPRA 3DOLA 2EKHA 2MABA 4PSWA 3PIOA 3J7AY 5LJ5f 1VQ6T 3HG9A 2M5WA 4PJOC 4YOYA 5KYUB 2R92J 4HX8A 3I56Q 2FB7A 2JM8A 4RUGA 2IDOA 4C2MJ 2GV9A 4H4MA 4LGWA 4HSBA 5IT3A 1ETXA 3Q1JA 4CYDA 3VN5A 5HLIA 4A61A 2RB6A 1YX3A 3PL8A 4ZYDA 4O0JA 1Y71A 3RTRA 1YBYA 3JRGA 2XAHA 5M3FJ 4DG1A 5C25A 4EQQA 1FOYA 1CXQA 4EMKB 5IXBA 1TW2A 5EG2A 2GEMA 4FX4A 1R1UA 2VIXA 2DQLA 2D8HA 2XGDA 3ZT0A 1KVAA 3BR0A 5BPLA 3JRAA 1OLTA 2Y31A 1FSHA 2E3HA 3HIFA 3ZETB 4H0EA 1MMNA 5GPAA 3BG5A 2LZ6B 1WB9A 2KLAA 1X19A 5JHFA 3PM1A 5JLHA 2G8FA 4CBXA 5CVIA 1VQ7A 3WU1B 3ZQIA 5KYNA 3CXCA 4EFHA 2BH1A 1OI1A 3UWNA 3BFMA 3O9RA 2FLOA 3WT0A 4X34A 2RNAA 4BVOA 5IXFA 1N8RO 3HOVJ 1GCQA 4IQ4A 2CH5A 4QAGA 1YJNI 3G0ZA 2KZMA 1NLVA 2M4GA 1QA6A 4DOWA 5JVHL 3VQ7A 3NH0A 5D7UA 2KPMA 4DTXA 4M77F 1HNZK 2JUFA 4FWKA 3M07A 1V4TA 4JK7A 1D0ZA 2P9SA 3WEEA 3OYCA 1RDAA 2NNNA 4LB5A 1U5TA 2ESHA 3HOYJ 3K0SA 2VG6A 3EZ5A 3SPYA 3BR1A 3ZR8X 3LFUA 2PY5A 1J2XA 3NF6A 2NOJB 4A3DJ 4DZJA 5F2RA 2E1OA 5J8CA 4OO1J 1PRLC 3M8RA 3LSJA 4CA0A 3AVAA 4IQJA 3ENHA 1RUWA 4G9ZA 3D1NI 3IDHA 4PQUA 5GINA 2YJFA 3LALA 2DJZA 4LNPA 2DA6A 2RKHA 4XONA 4Y4RA 4C5GA 2RAEA 2W85A 4F9OA 5JVTA 2X6OA 4LF6K 4KT0E 4UXNA 1ETOA 1TT5B 4JI4K 2QA4N 1JB0E 4P5NA 3BTIA 3FSPA 2JVVA 3P83D 3M3YJ 1V4SA 3AAQA 5CYVA 2F5DA 3RCOA 2HAXA 1M4ZA 2X1DA 2E6LA 1ITYA 3MN9A 4DV7K 1TV6A 1RNLA 3ZSQA 3HP6A 1WI7A 2L3QA 2UYTA 3LSPA 1RBSA 2ZE2A 1OCOH 2FUG2 2NOHA 4RGUA 3VS5A 2DILA 2M0CA 2RJDA 3EYIA 4BVPA 5LJ5j 1YJ9Q 2Q1ZB 3CMAI 4DCHA 1VQKI 1FP1D 5HLTA 1UHMA 4RS8A 3RI4A 4JJDA 3G71N 2L3DA 2HQXA 5IN1A 1NGCA 1QPIA 1O7FA 4E7KA 3JRFA 1NGAA 5IT9Z 3CCVQ 1T98A 2NRTA 1OH5A 1HA8A 1U6ZA 3PLAA 1PD1A 1NBWA 1IC8A 4RAFA 2KZGA 1I07A 3ZQFA 3PNWC 4FE4A 1M90C 4CXFA 1SRLA 3CCMQ 1A5WA 2FF3B 3LQQA 3CCLI 3BR6A 3PVLA 3MEGA 1BJAA 3THXB 1NHAA 2DO3A 2E36A 4CC7A 1DPRA 2NYXA 2V26A 4PLLA 1YW9A 3QRFF 2V75A 2VKHA 4JI7K 3FLCO 3CCUQ 1QHAA 4XLPF 4Q5VA 2MW8A 1LPLA 2ZJQL 3THWB 1VAZA 2L4MA 3B6AA 4M4ZA 2P0QA 1VFCA 2GTOA 3HFNA 2HXOA 3AA2A 3TU5A 3DLMA 4I98B 3JS6A 2WAEA 3H5RA 4W5QA 4XTYA 2STTA 2KI7A 4B1RA 4WXDA 2L8DA 1YF5L 4HWIA 1WXUA 1Q95G 1KQ0A 2VQCA 3SLCA 1QW1A 4RTVA 2GF7A 3CJBA 4NXNK 2KRSA 1QCFA 2CUDA 3R6NA 2QWRA 2CMPA 1BCOA 3G0QA 3AY9A 3DKWA 2P0KA 4B3SK 3CUOA 1Q86C 1WH7A 3BZ6A 2FF4A 5CAIA 1TC3C 3MN2A 3G1LA 3PO5A 3FF5A 2W1OA 2F5FA 2WTUA 2WAQA 4PGGA 4WQ4C 4DFMA 4L5JA 2R7UA 2HOSA 2XDDA 3IAS2 3WXMB 2WY7Q 4PJNA 2YDLA 1D1AA 3P39A 3NFAA 2RHYA 2ZJRL 2E6NA 1HR0K 4XORA 2KT1A 3AVIA 1G83A 2X3XD 3EGDB 2L54A 5KK1A 4E7ZA 2YUNA 2F4MB 4BRDA 2TDXA 4F3TA 4M7DA 2K2VA 2WV0A 1Y96A 1IKWA 3PX4A 3QB0A 3KKRA 3NF9A 3E97A 2RJEA 4C2TA 2D0AA 2E2PA 2OCCH 2LNVA 2XK0A 3ESWB 3Q5FA 5LEKA 1IN8A 2EFIA 3OYJA 1ORNA 1M90U 2LD5A 5AFUH 1OH8A 5KTQA 4OMNA 1DKGD 3EUKL 2FOWA 1QWFA 2DVEA 2P9SB 2DT5A 2Y48A 4YG2F 1JHHA 1YJNA 1U4BA 5KRTA 3LDPA 1NKUA 3RDVA 2YHAA 1LDKB 4GNIA 3U6FA 2V79A 4JKGB 4G7OF 2PQ8A 3UDCA 2V8KA 1WHUA 1XCBA 3CMEI 3V8LA 2Z1GA 4LN2A 1E2XA 5LJ5h 3EG9B 2ESNA 1S72I 3DU5A 3C0CA 3GTMJ 4EMGA 1WN7A 3I55I 3VU3C 3CCEN 1M5Q1 3I71A 3DRSA 3JRIA 3FKJA 1SHFA 4JI5K 1J09A 4N4NB 3OYNA 2AKKA 1W1WE 3IH3A 3BC8A 2VG5A 2E2QA 5B3SH 3VMFB 3WXKA 2Z9OA 2A05A 3V9XA 5AZJA 4HX4A 2RI3A 3R61A 3KP7A 5M1OA 2VQFK 1R00A 1QCNA 1NGGA 1HJRA 3LPTA 3BUZB 1DJ7B 1BI4A 2MA3A 5J4VA 1KG2A 4FJJA 1Q86U 1DDNA 5FPMA 3M0SA 3ZLJA 2LX9A 1NEGA 4LDUA 3A5NC 1MDMB 2CWEA 3TWHA 2HMIA 3GL1A 3KLOA 4A3FJ 4M77C 1ZRFA 2EBPA 2HD0A 5BS6A 1MDUB 3GXOA 3L2VA 4CJ4A 1FC3A 1SD7A 4BY6B 3M7GA 4GRIA 5GAMd 4HF0A 3AO2A 2EPFA 3CC7Q 2FXUA 3S2DJ 3S3NA 5GAHJ 3D2FA 3QWXX 5KCHA 2HVHA 2CREA 2CO5A 1BM9A 2AHJB 1WA7A 2AIRB 3DM2A 1ETKA 3EDPA 4DWIA 3SQ0A 2QVOA 5GAHP 4RW9A 1IKXA 3EQLF 3H36A 1P92A 2IJLA 1I6XA 4CBWA 5AZIB 5D4RA 1O3QA 2J05A 4XIUA 5KHDA 2FPEA 1JO8A 3AG1H 3CMAA 5IHNA 2H1LA 4QQGA 1VQKA 4KHNA 3J80Z 2KAFA 4EMHA 5IY5H 3LGFA 4HVJA 4M6XA 1PDNC 4A3GJ 4F3QA 2LRQA 4E1NA 2E10A 2VPRA 1KQJA 5TGTA 2IVWA 3VQ8A 3ZYYX 2DTRA 3ZT1A 3CJTB 3LPUA 3VS3A 5F27A 4MMKA 1HKCA 5FB2A 1P7MA 4KTQA 4CZLA 2KMUA 3LA3A 3I58A 5JVGL 3SV4A 3K7AJ 1C0MA 1SAUA 1XWLA 1QP3A 4A4FA 2Q0RA 1M3HA 3CCRN 2XF6A 2NUTB 1Q18A 2A6EF 1KQ9A 3QPHA 3HUGA 1QZZA 5BPDA 4HT9A 3TARA 2LP0A 3SQ2A 2FRHA 5F0XA 4J2BA 4IF4A 5EGOA 4HF2A 4BY1J 1B7TA 2KT0A 3HOZJ 2VC1A 3QEWA 2D0QB 2QGGA 3FGUA 2P9KB 5IHIA 3SZGA 5LJ3e 3FHNA 3QDFA 1VQNI 4FWRA 3L2CA 3VOEA 1BU6O 4BRFA 3C7NB 2R7RA 2A6TA 4DQ2A 3BY7A 3F8NA 3OA6A 2FBKA 3EGXA 3MP1A 2E1ZA 3QICA 2XAUA 1YVUA 4FT4A 2LVSA 4Y33A 4C2UA 1XNRK 1YHQT 4F7UA 3RMAA 1PU6A 4DQSA 3TCJA 3A1PA 2R7OA 2EHGA 1OX9A 3IWFA 2E6ZA 2X1CA 1YITN 3GNGA 2L7FP 3I59A 1Q7YR 4A2AA 2L0AA 3RSEB 4PFPA 3QEPA 1EF4A 1KQ1A 4C1NK 4YOUA 1H641 1SG5A 1I81A 3BDPA 1WJAA 4LF5K 1RT3A 1RL2A 3M1FA 4MQVA 4HQEA 5BRFA 2XSJC 4I2QA 5LL6Z 2RPNA 1HLVA 1K6YA 4KH1B 1T6CA 2P5GA 4XLCA 2DA9A 4I6MB 5AQWA 4EJZA 1YRNB 4E7LA 1Z9ZA 4OIRF 2QCOA 2L4AA 2LC4A 1SEMA 5GAN5 4B1UB 3VQCA 2P6TA 1NGBA 5KPZA 2PVOB 3PIOF 1EKEA 3CZ6A 3AL0C 4E3SA 3SNNA 5LHGA 1U47A 4KGXB 3M8JA 1ETQA 2ZFWA 3ULDA 2JUCA 2DFEA 3GTQJ 4YY3K 2AZVA 1VQMN 1GHCA 1S1TA 3SXYA 2VKNA 5E3MA 4JK8A 4UHTA 2WB1N 2D0BA 4E7JA 1TL1A 3RR8A 1BQNA 2NS7A 4BRCA 3G10A 4Z0UA 3ULQB 3UKGA 1UFMA 1UELB 4RW7A 2JZYA 2CQQA 3M58A 3UATA 2EBIA 4DR1K 3CCET 4KT5C 5K7FA 2NLUA 5EF6A 1RLPC 3MWTA 2O8BA 2I5WA 4CVNE 3AVMA 3FWEA 3TTDA 4DK9A 5BQTA 2P7CB 3ASNH 3LA2A 1IRGA 2GBYA 6PAXA 2WACA 3SBTA 2AS5F 3W0LA 4XKBA 2YV0X 3HEFA 5FRNA 3CMEA 3GTGJ 4B8AB 4M9ZA 3JCMh 2F5KA 1S72A 3RJPA 4M75E 2FC0A 3PIPL 1YJWQ 3I55A 1WJQA 2DL5A 2DQRA 1NG7A 2WOMA 2K3FA 4IDHA 3E5QA 4IG3A 3FFIA 3I4MJ 9ANTA 4L8RB 1JUMA 2V7FA 2RV8A 2IIMA 5DCMA 1B9MA 3X20B 4XU0A 4M3EA 4EJTA 4IO8A 5MLCQ 2D45A 1C6VX 4OMQA 1MIJA 1XD7A 3A8MB 2V6CA 4CHZA 3L2ZA 3S32A 5JICA 5J2QA 2ID3A 3JXUA 5HRRA 5IP7J 3TBIA 4C8OA 4FM0A 2QGFB 2K40A 1ZSGA 6AT1B 1VQ9Q 2ZXJA 2CZ0B 1VQPN 3LQRA 1RAIB 1WIEA 1ZSZA 2HZTA 5HCKA 2P5LC 2E70A 3PFSA 2BE9B 4CGJA 4CEDA 3WVEB 3BZKA 4EMKC 5LMNK 4C9YA 4H5WA 4KUMA 4QT7A 4W5TA 2RI5A 2F5VA 3IMXA 2A08A 4C5EA 3KNTA 2LRDA 4Q47A 4QPQA 1B8IA 2XUBA 2MPXC 3VQ4A 1TK5A 1IBMK 3H6ZA 2DX1A 1RPWA 2FHDA 2Q8KA 4UB8C 4BR9A 2AZSA 4CF1A 1KTQA 5GPCA 3VPRA 3LLRA 1ULYA 4H0XB 3O3GA 1NK7A 3GNFB 3DLLA 1XDSA 1Y1VJ 4HRIA 2Q0OA 1N36K 3FZMA 1D3YA 2PEXA 3HPOA 3M9AA 1ERDA 1ZG1A 2RH2A 5A0LA 3SAFA 3ENBA 4MFBA 1IDYA 2W24A 4IDKA 4CJQA 3CVTA 2NUPB 4XOTA 1BIBA 1ZUKA 4H5NA 1TTHB 1JJ2A 2PBDA 1WX6A 2LP5A 3KCCA 3ERED 1K0XA 1S6PA 2EB7A 1ETVA 1TK8A 2IGNA 3CWTA 3N4MA 3EUHC 4AHCA 1APLC 5CR2A 2BZYA 3RMDA 2QWOA 2L3SA 3BCBA 3BJ6A 3NCIA 1GOAA 4N4IA 3DB3A 3SBGA 3N4PA 1MWMA 2R5YB 4YOXA 2QASA 2VWKA 3RNJA 3PE0A 3LSHA 1OYXA 2VWFA 1X69A 2R93J 2HDAA 2CP2A 2QA4I 4KJZA 3UT1A 2KR3A 3O5BA 4LDVA 1HPMA 2K7AA 3DRRA 2VQLA 4UOBA 1ZGJA 1SVMA 3RBBB 2E2HJ 3CLOA 1JCGA 3P8DA 3A5MC 2ZXIA 3ERMA 5CQXA 5J1EA 2J5PA 4UV9A 4LG0A 2V52B 1RRQA 4BGBA 2BY3A 4CJTA 5KN9A 4O8UA 1VQNA 1RABB 4CBUA 2LTOA 3IQLA 2X4WA 2HHSA 3I0RA 3SUQA 4Z94A 2PN6A 5KPRA 1BC8C 2RN2A 2R7TA 4BREA 5DCFA 3IS9A 1VOMA 4X9CA 3QHSA 2CQKA 2E2JJ 5KNLA 3PUBA 3CXCM 3CO7C 2RE2A 3RPUA 1RAGB 1N75A 1PU8A 3VETA 5C4JJ 2VOOA 3S3MA 2XD0A 4XSZF 4WWCA 1WRJA 3G71I 3G7ZA 1N6AA 4L3QA 3MHXA 2FQ3A 5CJ9A 3JRZA 1JT0A 2XHKA 5HVQC 4B3AA 4EGYA 3FXKA 1PJRA 4C8QA 2AA4A 2KROA 4ELTA 4FWOA 1SF9A 4Y92A 2EZLA 1T38A 2IGMA 2KFZA 2PU9B 5JLFA 3L9FA 5K14A 3HFOA 3EG3A 3EG2A 3VYGA 4C92B 2RQWA 4FPAA 2PZSA 3CD6Q 4IVNA 2OU2A 5C0YA 1NMNA 1VQ5Q 4CJUA 1OEBA 3OA9A 2EV5A 3W3CA 2E8AA 4LIVA 1QU3A 2E2NA 5FWBA 4NQWA 4U87A 5TKYA 2FOKA 1OR7C 3ASOH 1UGRB 1TW3A 2VQEK 1NLPC 2LY2A 1OCPA 4GY5A 4FQGA 2YKNA 1T8EA 1WNLA 3CC2N 3LNQA 3TAEA 4F14A 1ZH5A 1K61A 1LWCA 5KCOA 5HDKA 4O55A 2CRGA 5AR0A 4JX6A 5LJ5d 4LUDA 3OW2A 2W84A 5BN8A 4ABZA 4IOCF 3TAGA 4A54A 4C3HJ 3KTQA 3GZ6A 3JSCA 1GXQA 2X6NA 4R56A 3KYLA 4M7DF 2RQPA 4ZHRA 2DA7A 5CKBA 1L3UA 1R49A 2O9SA 4EIAA 1FBUA 2HDDA 1TQIA 5GAGP 4IHYA 2B86A 1K1ZA 1UJYA 2IVPA 2JPBA 2KMTA 1RTJA 3V9UA 3CCJN 4YFNF 2QEXN 5LGNA 1L3LA 2Y90A 3QIPA 3SWNB 4EEFG 4DYRA 5EJCA 3OMYA 4DOVA 2G8KA 4FOEA 2OPQA 5FKKA 4KHUA 3I5UA 2BZXA 2YJEA 3I0SA 1IUFA 1PG5B 3G1MA 3NNQA 1KQ2A 1AWCA 4C0GA 5E8GA 3ZBDA 1LCKA 3KK2A 4X6AJ 1WUAA 4N0AC 3FZLA 4IRHA 1ZBIA 2O9LA 4MLOA 3PSIA 1R8OB 4AVZA 1WEFA 4E9HA 3DI6A 3WNHA 3MEXA 2QXLA 2WY8Q 1QO0D 3KVGA 1TWBA 4LFCK 4II2A 2IA1A 2COMA 1EIFA 1WEIA 1B8IB 2AHQA 1ENHA 1JLFA 1TGOA 2O4XA 3IKMA 3AO5A 1M30A 4MO5A 4H8KA 3LP2A 2K9SA 2XHIA 3B02A 2SEMA 2H3JA 2F69A 3F6VA 2F4IA 1S22A 4HA8A 3CCST 3QODA 3FFKB 4CK1A 1Y0NA 2HNHA 3KWIA 2DTOA 2HVRA 2BANA 3OYKA 2F48A 1K73C 3RMQA 2OV7A 4FLZA 4JX4A 1T33A 2BXZA 3CJAA 3FXQA 4XRSA 4Y0WA 3CCEI 2P9NA 2DFHA 5C12A 4IFVA 3HSBA 2Y4YA 1REVA 3BQZA 4U7DA 3MKLA 1NK9A 2A1SA 1JJ8C 4YELA 2F6CA 1HDPA 4E0DA 4CJWA 1X3WB 2A6AA 3W2WA 4J2AA 1OVYA 2E6MA 3VEYA 4HDVA 2QWMA 2VE8A 3HTUA 2FBYA 5E1WA 1WQWA 1IV0A 3HRGA 1GT0C 2W6LA 3VFZA 4OAZA 4RKUE 2YHWA 3HKSA 5CVJA 1TWHJ 1VYTA 1M1FA 2MD0A 3TTCA 3G6ET 2HVSA 1IN5A 4JZ3A 3T8TA 4QOZB 4LG0B 3WTTC 3MFKA 1DEJA 4AM7A 3GP8A 2QA4A 3VW4A 1W4SA 3FMRA 4M7DG 3TTFA 3QERA 2KY9A 3M4OJ 3U8XA 4DTPA 3JRDA 3META 5I2MA 1NZ9A 2OJED 2FRWA 1ASVA 1RLQC 2Q1NA 4DV0K 1Q82R 2JM9A 3GOIA 1LFBA 2OPSA 1G6NA 2RNJA 4DQPA 2IOCA 2IPQX 3ATUA 1VQ7Q 1GVDA 1FWZA 1Z1DA 1T6DA 1W2BP 2E2IJ 1NLOC 2OQRA 4EJWA 4KO0A 1YIJN 1PWTA 2DE0X 1YE9A 1WLPB 2PQWA 1X3NA 1TT0A 4FWQA 4B9MA 2D1KA 3G4SN 2QKBA 2I2LA 3DBHB 2QG9B 4IX7A 3EFOA 3T3FA 4P96A 4S04A 1VSKA 3URGA 2CV1A 2JTVA 5HDNA 4BY6C 3O6BB 1RACB 1LUJB 2KRHA 1UG1A 3CHWA 4IEEA 4V19S 3G71A 2DPPB 3HXLA 1YS6A 4UB6C 2BV6A 1GXIE 2KW4A 2DO7A 1D8KA 1OU8A 1N34K 1IXRC 4BI4A 4IBNA 3L8BA 2DXTA 4A62A 2GTDA 5CVRA 3GMEA 4CE9A 1OKJA 3D7SB 1BWFO 2BOLA 3JAMO 1T39A 3CC2T 4KUIA 1FKPA 3CCRI 1VSDA 4JK1X 1MPGA 4CGIA 4F7UF 3AVBA 4YDUA 4C8MA 3CYMA 3BF3A 1Z77A 1LVKA 2FNAA 1W5SA 3QMLA 1YG2A 2VC0A 3CWAA 3U21A 3CUQA 1FMWA 1VQON 1JUPA 2ASOA 3K0LA 3W6JB 1M3BA 5IYCJ 4ICLA 2E64A 1B72B 4JLGA 2PJRB 4OKEA 1S7OA 5DLQE 5A0GA 4CICA 4HNTA 2VONA 3TI0A 3JCMd 3I0TA 3JCMP 2FQ4A 3M4GA 3DLHA 4XU3A 2ELHA 3H41A 4YORA 5LGTA 1VQLN 1AD5A 2XO7A 1YITI 1MMSA 1OVQA 1R0CB 3K59A 2E41A 1JLGA 1RBUA 3RKXA 2O01E 5GANh 1LEAA 4MIMA 3B6OA 2DIGA 1VIEA 4AHRA 1YI2T 3HTSB 3MK6A 3HOUJ 1E4FT 5LRSA 2PI0A 4FYXB 2CFXA 5KCMA 4B1ZA 3BWGA 2G8VA 4LG3A 1XDUA 4B3TK 5DMRA 3VF4A 1T3LA 1PKTA 4A3JJ 1W9HA 3NWSA 2E3IA