4BE0A

Pfv intasome with inhibitor xz-115
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be0A03
3JYTA 3DMJA 2HMIA 4HTUA 4KHNA 4KI6A 1YTUA 1EP4A 4DG1A 4CHZA 1X9MA 3L2QA 1D9DA 4PUOA 2D0CA 4OVLA 4DQSA 3QJ6A 3M8RA 2RJEA 3JSMA 3QEPA 2LSNA 1HNIA 1RT5A 1WAJA 4DTXA 4TSXA 4CEZA 3SUNA 4KO0A 3L2UA 5KE3A 2B4JA 1C0TA 2D0AA 4AHUA 3MEUA 2VWKA 4CJ4A 3TR8A 1SL0A 4DTPA 4KV8A 4O0JA 3UIQA 3OYCA 1D8YA 4M3UA 4Z4IA 3HJFA 3OYMA 1YTAA 4LH4A 1D9FA 2HHXA 3SUOA 1S6PA 4CIFA 4AILC 1JLBA 4IUPA 1XC9A 1J5OA 1VK0A 1KRPA 2E4LA 2IC3A 4CJWA 4B9LA 2ZE2A 4QOZB 3QKJA 1R0AA 4BDPA 2X78A 4BE0A 3K2PA 1TKZA 4HUFA 1U49A 4DSJA 1HNVA 2RI3A 3HXMA 4AHSA 3FLGA 3PX4A 3SCXA 4HCBA 2PQWA 2OZMA 1BI4A 2XY7A 1TKDA 4CERA 2L8DA 2EQUA 3WNGA 4B9WA 3SZ2A 3AV9A 1J9AA 3DRRA 2X4XA 1HPZA 3LALA 4OJRA 2IG0A 4OKEA 4CF0A 4N5SA 2F5KA 4KHQA 2DIGA 4JLHA 5J2NA 4LH5A 4DSLA 3E9FA 3L2VA 3K59A 3E9GA 3PX6A 3PX0A 1C1AA 1TV6A 4FL6A 2EX3A 3TAEA 1SV5A 4AHCA 3M8QA 4CHOA 5HROA 1RBTA 1NK6A 2FHDA 2GFAA 4BDZA 1WJSA 2BUDA 3NBPA 4AHTA 4CIEA 1NK4A 1JL2A 2M0OA 5JS1A 3OMCA 4X34A 1ITGA 2E5QA 4GMJB 4Z4GA 2VYTA 4CHNA 4QQDA 3KLGA 4DTRA 2PY5A 4FJ7A 3VQCA 1JLAA 1NJXA 3ME9A 4CF8A 4IG3A 4CJRA 4F3OA 4FJHA 2HB5A 3O3HA 2KTQA 3QEWA 3KKRA 1BCOA 3NGIA 3RRHA 4B9XA 4NCAA 3NFAA 2HHVA 2BKDN 4DFMA 4CCHA 3QETA 3VQBA 2X4WA 4IDKA 5C24A 4FLXA 4PQUA 1TKTA 3TWHA 1SKSA 3S3MA 2YHBA 5D3GA 5KGXA 3NCIA 3ALYA 2GF7A 4M41A 3DLRA 4FZXC 2OA8A 2HW3A 2RHIA 2KFNA 3SPZA 4EP4A 3LH0A 3C6TA 4G1QA 1A5WA 1S1XA 3GOXA 1I39A 4CJEA 3CFRA 1T8EA 4IUQA 1QQCA 2ITGA 2Z1GA 4B9UA 4KI4A 3OYGA 3KK2A 4EZ6A 4M42A 4CF1A 3VA0A 1ZBUA 1B92A 3LAKA 3P8HA 2QQRA 2LRQA 1VRUA 3NHGA 4FM2A 4KTQA 1WN7A 3MEAA 3QLHA 1OZ3A 4FVMA 3ZT1A 1TK8A 3SQ2A 2YKMA 5J26A 4B08A 5HRSA 1RT7A 2IDOA 3ASKA 2Z1HA 4WE1A 2XY5A 2KFZA 1YT3A 1LV5A 4H4OA 3U3YA 2HHUA 3AVIA 2RHYA 3HSTB 3SD4A 2JLEA 2LDMA 5D6WA 4EDUA 5KH6A 3I0SA 3LPUA 2K3YA 1BCMA 2O4IA 3QIIA 3O8VA 5IN1A 3AVJA 4PLIA 4NYFA 2P51A 3M8SA 4IUTA 4DTOA 4Z4EA 2B6AA 1LAVA 3OYHA 1QS4A 4LSLA 4E89A 2HNDA 3VQPA 3OJSA 3FDRA 4CJLA 2HNYA 3AVMA 4JS4A 4FLYA 2HQXA 3TAQA 3L3UA 4J2BA 1OI1A 4ID1A 4CGGA 1DTQA 1SUQA 1B9DA 3VQQA 3SV3A 5HP1A 1UA1A 2KZZA 3PV8A 1HMVA 3RRGA 4ZHRA 3PUFA 1JLFA 1J54A 4QW2A 3TABA 2DAQA 3LP3A 3CEYA 3ZSVA 3RMDA 2NUBA 4E19A 1C1CA 1S1TA 2IAJA 1IO2A 3VQAA 3K57A 2KZMA 2QXFA 3IRXA 2HHWA 1OYXA 3KKSA 2Y1JA 5C0MA 2O4GA 4FJJA 4B9VA 4C5HA 1U47A 3PY8A 1OZ2A 3DLBA 2X74A 4B9NA 3OVNA 1IKWA 1EETA 3T19A 2DY4A 4FLZA 5FROA 2R5AA 3CFPA 1BL3A 4A4GA 1ASWA 4H8KA 2EQJA 2YNGA 1RBUA 1SL2A 3PO5A 4FJNA 2AJQA 3ZT3A 3LYIA 3S9HA 1U45A 4M3TA 4CJ5A 4QCLA 3OJUA 3TAPA 4M3RA 4B3OA 3SUPA 1FKOA 3MP8A 4HVJA 1TK5A 1CLQA 1NOYA 2RKIA 4DQRA 3MEVA 1S6QA 2Y1IA 4RW8A 1S1UA 3M8PA 3LP2A 2VWJA 3META 1JLCA 3TANA 3MP1A 4A4HA 1RCHA 3DM2A 1RNHA 4CGIA 3EYZA 3F73A 3SQ1A 2D9TA 2D5RA 4FJLA 1BISA 1WSFA 4IFYA 3QERA 4M3WA 2EQMA 4QQGA 2R7YA 2R57A 5EU7A 4DTJA 4FJ9A 3PMTA 3OYFA 2F96A 4BWJA 4DS4A 4C8MA 4DSKA 4W5QA 3RTVA 1WNSA 4CJPA 3K58A 1X1PA 2FBTA 4IG0A 1NKEA 4HUGA 2P5GA 5KCOA 1FKPA 4CRIA 2RJDA 3DOLA 3QEIA 3V9ZA 4F4KA 2EFIA 4FK4A 3NE6A 1Y97A 2OPRA 1SSFA 4J2AA 3TAGA 1RBSA 4CGDA 4DQQA 1IG9A 4FLWA 4PA1A 4DF8A 2G8HA 1GOBA 4HUEA 5J2PA 3AA4A 3B6PA 4EZ9A 4CEBA 2X6NA 4Y1CA 5KRSA 4M3YA 3KLHA 3PFSA 2P0KA 4KHUA 5CZ2A 4CJSA 2RHUA 1KFSA 3LWMA 4MQ3A 2GUIA 3NH1A 4DSEA 4M3XA 4LD6A 4DMNA 1IH7A 2L89A 2RI2A 4L59A 4ZTJA 4Z0UA 4CK1A 1WJRA 1UOCA 2RI5A 1UAXA 2G8WA 4RW9A 1TVRA 4F3TA 2YNFA 4KFBA 3MXJA 1CXUA 3BGRA 1C0MA 4FW1A 3OMGA 5J2QA 1A5VA 3WNEA 2MWOA 3ZSRA 3AVNA 3OY9A 3VN5A 1GOAA 4CIGA 1UA0A 5D6XA 5FDLA 3KJVA 2I5JA 3AVBA 3K5NA 3AA5X 4PY5A 3MAQA 4JRPA 1WSHA 4O0IA 3AVHA 3MEDA 1TKXA 2BIVA 3AVAA 3AO2A 4CF2A 4R5PA 1U04A 1NJWA 2GFUA 5FRMA 3V6DA 3OYAA 3D45A 3O3GA 1QSYA 4KAZA 4DTUA 4BWMA 3QBYA 4Y1DA 3NGZA 3SNNA 3EY1A 1NJZA 1L3TA 1D5AA 4FJXA 4QQ6A 1WSIA 4II1A 5KTQA 4BD3A 3I0RA 3O3FA 2WACA 3UT1A 1RT2A 3NDKA 3DB3A 1WGSA 1W9HA 3LX7A 5IAYA 1KHCA 1QSSA 3KUFA 1VSJA 2XDPA 3CFOA 2HHSA 4KREA 4CJTA 4OLBA 4CHPA 2E6NA 2M16A 3OYDA 3ZCMA 4OLAA 1KVBA 4ZTFA 2FBYA 4UQGA 3SPYA 3Q1JA 3MP6A 4IUVA 3L2WA 2WOMA 2OZSA 2F8SA 1HYSA 2YV0X 4OGCA 1CZBA 2HQEA 1K6YA 2LTOA 2QK9A 1C6VA 1ZYQA 4NCBA 3LDSA 1JXBA 3AVLA 3MEGA 1SKRA 2JGUA 4DLEA 1JLEA 3QO9A 1O1WA 1WSJA 3CG7A 3QIPA 4I7FA 5T7BA 3OYLA 1HQEA 2XO7A 1QTMA 4B9MA 3TAFA 4FK2A 3NTIA 4DSIA 2HHQA 2EHGA 2MWPA 4GW6A 1RT6A 4E7JA 2RF2A 4A4EA 5KRTA 2RHXA 3ZT0A 4O5BA 4C5GA 3S3OA 1HYVA 3G10A 4CEFA 1YVUA 4W5RA 1N6QA 1Q9XA 3QEXA 4LSNA 1TAQA 3VQ8A 4RG2A 2DFHA 2FBXA 3U6FA 3I8DA 3QEVA 3K5MA 2L3RA 3H08A 3ZEHA 3KLIA 3LPTA 3QESA 3V1OA 3UWNA 1BQMA 1GOCA 1TAUA 2K3XA 4CEQA 4E7IA 1VSMA 1LW2A 2KW4A 1ZBFA 3QNOA 2G8VA 4JRQA 3TI0A 1L5UA 3F70A 2VG7A 1DTTA 4OGEA 1KVCA 4BE1A 4CK2A 2G8UA 3H8ZA 2VG5A 4LY7A 4Q5VA 1CZ9A 3VQ6A 4B9SA 4E0DA 3MEWA 4C5IA 3B6OA 3MEEA 4I2PA 4Z4HA 5SZTA 4DU4A 4HCCA 2RO0A 2G8FA 4KPYA 5J2MA 1RDDA 3HP9A 3AVKA 4I9LA 3LZJA 4FJ8A 1RDBA 3NTHA 3OQ5A 4H4MA 3T3FA 4FLTA 4N56A 3RWUA 4LD0A 4OKKA 3ZSOA 3NGYA 1W0HA 4EP5A 4E3SA 3TAMA 4DQIA 2CKKA 3CQ8A 1RDCA 3C95A 3VQ5A 1A5XA 1VSEA 3ITHA 2X6SA 3RMAA 1ASUA 3OYJA 3HVTA 4DLGA 1RTDA 1KLNA 2Z1IA 4CEEA 2RJFA 1NKCA 2QKKA 3DLHA 1LW0A 1NOZA 3HPHA 3KD1E 1WSGA 3MO8A 1Z25A 4K8ZA 4A4FA 4DTSA 1VSDA 3NTKA 4ELTA 4CEAA 4CESA 3O4QA 2NLUA 3DI6A 3NF6A 2RHZA 5E41A 4DFKA 3ZSQA 1BIUA 4FJIA 2R58A 3KTQA 4KHWA 4W5TA 2D0BA 4F2SA 3VA3A 3AVFA 1NK0A 3MECA 3F9KA 3NH2A 3OS0A 4O55A 3L3VA 2QKBA 3DLEA 1LWFA 4JS5A 5M9OA 4NZGA 1RT4A 4CE9A 4B8CA 1LAWA 4OVAA 2YRVA 4KKOA 1ZBLA 4FJMA 3ZSZA 3VQEA 2W42A 3EZ5A 5CYMA 2F8TA 3FEOA 4RW6A 4RW4A 1RILA 2B5JA 4CJKA 3ASMA 5C6SA 1NK5A 1Q9YA 2BGGA 5KGWA 1L3UA 4F2RA 1FK9A 4CFCA 3OB9A 3BDLA 4CFDA 3HPGA 4C8KA 3IS9A 2G8KA 2XY6A 1RTIA 4L8RB 5C25A 3DRPA 3SI6A 4FM0A 3FFIA 4Q0BA 1IKVA 1S1WA 2FC0A 3DYAA 4CGHA 4OPJA 2HNZA 1QSLA 1B9FA 4N4HA 4CJFA 4FLUA 2XK0A 3ZSWA 3FC3A 3PNWC 3PMIA 4CEOA 4FJ5A 1IKYA 4IBNA 3SV4A 1NK9A 2P5OA 3V4IA 2E6LA 4MFBA 2E6MA 4FXDA 3V81A 1X9SA 2G8IA 1TL3A 1XHXA 4YFUA 3CYMA 2O4XB 1EXQA 1LWEA 4PLLA 1J53A 2RN2A 4KTZA 3C6UA 2O4XA 3C4SA 4FJKA 3LAMA 3LGLA 4ELVA 4CGJA 3SQ4A 1TGOA 3LANA 5CYQA 1BQNA 1WLJA 4IFVA 3WNHA 4CF9A 2LCCA 1FXXA 3C94A 4Z4CA 2YNHA 4B8AB 1Q8IA 4M3ZA 2M1HA 4E1NA 3RMCA 3MXMA 5KE2A 1MHNA 3AA3A 4DQPA 1NJYA 5I3UA 2R5MA 2Z1JA 1L3VA 2HVIA 1N5YA 4DSFA 3KIOA 1U4BA 1U48A 1TK0A 2FBVA 3DOKA 3LP0A 4DF4A 4C8LA 4Z4FA 2EKOA 4FU6A 2XRIA 4CJQA 4BE2A 3OYKA 3QINA 2B8AA 2OPQA 3LP1A 5C42A 3L8BA 1S5JA 3IAYA 1JXEA 3KLEA 1XWLA 3VQ4A 3D0PA 2ZQBA 4AHRA 5SWMA 4FJGA 4RW7A 2YHAA 3OS2A 1JL1A 1G15A 1DLOA 1EX4A 2QQSA 1VSLA 3ISNC 2PYLA 2IS3A 2DFEA 1BIZA 1WSEA 3AO3A 3AVGA 2HVHA 3V9XA 1KVAA 3QNNA 3EAEA 1VSFA 2IOCA 2XHBA 1C1BA 4BDYA 4M45A 2PYJA 1VSHA 4DU3A 1REVA 1CXQA 2YNIA 3SUQA 3P5JA 4O44A 3LZIA 4KHYA 1ZBHA 2KQ2A 4YNQA 3O4NA 1ZBIA 1HJRA 4CFAA 5HRPA 4GY5A 3HP6A 3V9UA 3HK2A 2EQKA 4KRFA 4N76A 4C5EA 2HHTA 5KCHA 1JLQA 4UC4A 1ASVA 4FM1A 3BDPA 3HM9A 3E01A 3S6WA 4K8XA 4FZZA 3PO4A 5K14A 1JKHA 3QIOA 3NH0A 1F21A 1S9EA 4NYNA 4AHVA 4DTMA 3SQ0A 3NNQA 3LGFA 4AH9A 1WJQA 4CECA 1BHLA 3L42A 1S1VA 3KLFA 4DU1A 5I42A 5D6YA 2DFFA 2Q3SA 3S3NA 1RI0A 4DS5A 2BANA 1X9WA 5HRRA 3A2FA 1T05A 3KD5E 4J2EA 5CIUA 4E1MA 4FCYA 1SL1A 2OYQA 3DRSA 4N47A 4BACA 5CZ1A 1HQUA 3ZSYA 4I9QA 3P8DA 2P1JA 4CJVA 3AA2A 5KI6A 5J39A 4IKFA 4CGFA 4DTNA 3V9SA 3AO5A 3AO4A 3LLRA 3ZT4A 2OPSA 1SKWA 5DK5A 3HT3A 1NK7A 3ZSXA 4DFPA 1RBVA 3RMBA 4DWIA 3HPOA 3VQ9A 2A1SA 3HYFA 4HHTA 4FZYA 3OYBA 2LVMA 3OYNA 3T1AA 1TL1A 4OKJA 3IG1A 1XNIA 2ZD1A 4CHYA 3SYZA 1EKEA 1VSKA 2VG6A 5HBMA 1NKBA 1JLGA 1UWBA 4PWDA 3K5OA 4KHSA 4ELUA 2X4YA 4PL6A 1RT3A 4FW2A 4Z02A 3V1RA 3V1QA 3VQ7A 2A1RA 1XI1A 1LWCA 3NAEA 3DLMA 1KTQA 1H3ZA 4KTWA 4E7LA 3RR8A 4CK3A 1VRTA 5HRNA 3LWLA 3L2RA 4Q5WA 5FRNA 3WNFA 4XIUA 4KB1A 3V9WA 1HRHA 3SJJA 1IKXA 3OYEA 1QE1A 3P83D 1NK8A 4B9TA 3CM5A 3NF8A 3MXIA 3AVCA 4N41A 4RG8A 2XY8A 5DMRA 1BGXT 4GVMA 4CEDA 4QVZA 3HVRA 3THVA 4W5NA 1RDAA 3KK1A 3OA6A 1VSIA 3KK3A 1T03A 4F8RA 3VQDA 4CFBA 1XHZA 3NF9A 4J2DA 2JTFA 3NF7A 1KSPA 3OYIA 4C8NA 4N4GA 1KFDA 4KB0A 4CJ3A 1L3SA 3DLKA 4FLVA 1QHTA 4ID5A 1RTHA 2ATQA 5HLFA 2JZ2A 1N27A 4N4IA 1RTJA 2BE2A 1BI4B 3G0ZA 1S9GA 3K5LA 1Z26A 2PZSA 3TARA 2BDPA 1WAFA 4NS5A 3DLGA 3OS1A 1I3AA 2DTUA 4DFJA 3HO1A 5JS2A 1KLMA 4FYDA 4IURA 1RT1A 4HCZA 2ETJA 2DIQA 2RPIA 2WONA 3H6ZA 1C0UA 1T7PA 4C8OA 2RJCA 1HYZA 4CJUA 4O4GA 4ICLA 3ZT2A 2YKNA 4OPKA 2GV9A 3AO1A 2X35A 5CY4A 1RBRA 4W5OA 1KCFA 4I2QA 3U3GA 4CHQA 3RR7A 2OPPA 3DB4A 3HL8A 3P1GA 2G3RA 1MU2A 2GBZA 3CM6A 5J1EA 4E7KA 4IUUA 3M9QA 3ULDA 4QAGA 4E7HA 1G5VA 4NCGA 4FK0A 2IGIA
chains in the Genus database with same CATH superfamily
2LREA 4IZZA 1M3AA 3M8RA 1HNIA 2I5UA 5FWCA 3J80E 3TDUC 3EPZA 2AHJB 3RQIA 4XRSA 1D9FA 2QWRA 3LA2A 2R7ZJ 3LM2A 1R0AA 2G7UA 2WB1N 4DSJA 4RTWA 3K9KA 1OKJA 2JJ9A 1ODDA 4DEXA 1NWKA 5FU7C 1QQMA 3BCBA 4RGSA 3LALA 1UGRB 1I5LA 3E9GA 1FBQA 2ZPGB 1IBKK 2HHHK 1MBJA 2P6SA 4AHCA 4CHOA 5L3CA 3K4MA 2YUOA 2FZGB 1ITGA 1FSHA 1SFOJ 2EIKH 5KVRA 4FYVB 3UE5A 1M3QA 3QYBA 4F52A 4DFMA 1FP2A 1UB4A 4UOBA 1DP3A 3DLRA 5CVVA 5CVIA 5ICEA 1MIJA 4X0GA 4GVEA 4A0XA 1QQCA 2ITGA 2L4AA 1ZBUA 3ESWB 4DEYA 4JKCA 2LRQA 3TU5A 4JN4A 5GAN4 3KFVA 3I9QA 1YWOA 3M4GA 1WJCA 3OMYA 2XPWA 4DBQA 1VQ6T 4O8KA 4KH0B 3CC7N 3AVJA 1JJ6C 2O8FA 2VB6A 4EJOA 1QS4A 5CKTA 3P4IA 3FDRA 2XHKA 5EEGA 2HQXA 4JK8A 4ID1A 1ZC6A 3IRRA 1VQMN 3PLAA 4XU2A 4RBOA 4OIQF 1DU0A 3CCLI 3E66A 1G3YA 1KAZA 1XG7A 1YI2N 2VQCA 3WODF 3HRTA 4GRIA 1IG7A 2L2OA 2V8IA 2ZPIB 3H1CA 1ACIA 1UJ0A 3KEYA 3DBRB 2O8BA 2IW5A 1XQPA 2EZIA 4P96A 2K4BA 5FLMJ 3F73A 4RTXA 4Y15A 2KFDA 3QJYA 4CJPA 1EWRA 2OAWA 2IRFG 4N4NB 2LT4A 3M8JA 4ILJA 2CT3A 2DILA 2X6NA 3KLHA 3SDZA 4KHUA 1BR4A 4M7DE 3EHQA 4GLMA 1AWXA 3LDPA 1D0YA 2QM1A 3KE2A 4ZTJA 3G0QA 4AM6A 3PL8A 4F3TA 3OIQA 1CXUA 5FPEA 2EFOA 1FIPA 3AVHA 3RBBB 1H8AC 3AVAA 2VUBA 4QWQA 4HKEA 1L3TA 2DYIA 2B86A 5CAIA 2WACA 5GINA 2VJ5A 3DB3A 1YJ9I 3OSFA 4CHPA 1V4TA 2Z1DA 2E2IJ 2E12A 4R56A 2FQ4A 4M77D 2DO3A 2KRHA 3FKIJ 2P4WA 4M7DD 1LQ1A 2WUSA 3EUHC 3M0UA 3FK6A 3ECHA 1TUCA 1QWFA 2JHNA 3QSUA 5GAN7 1G6NA 1BOAA 4M75D 4CEFA 2IAIA 3VENA 3VQ8A 1VSMA 5CKEA 2G8VA 3LA7A 2YS9A 2HNHA 2NNYA 1RADB 4XRFA 2DL3A 3JSPA 2ICWG 1RDDA 4EJWA 3HP9A 1X3WB 2LF8A 2YX7A 1U9NA 4FLTA 1R1UA 4OB3B 1VQ5T 2AO9A 2Z2SB 3MZ8A 1OX9A 3CCRT 2L7MP 3VEXA 3SDBA 3DLHA 3MDQA 1Q82U 2CWEA 4XAXB 4XNFA 2K02A 1WB9A 3HOXJ 1G59A 1NK0A 1IC8A 5M9OA 1WXBA 4JJNK 2D4WA 3H9NA 4BQZA 3OOPA 2F8TA 3O08A 4KMUX 4BRPA 5J8CA 4F2RA 4FWNA 4UUSB 3DWLE 2UUZA 1VQPA 5IY5H 4ILHA 4ZDOA 3IC7A 2LKXA 3H3OB 1KG4A 1VQOT 4UVBA 1Z9QA 3SV4A 2AP1A 3BTJA 2G8IA 4L9NA 5DUIA 3CYMA 1FMKA 1RAGB 1WKMA 2PG4A 3E9OA 3SQ4A 2DBBA 5FKOA 2Q36A 1BI0A 2LCCA 4PHTX 4CC7A 4M3ZA 3OSVA 3I54A 2Q2EB 4M6VA 4JJCA 2DYBA 3FZLA 1HK9A 2YSQA 3LP0A 1WSUA 4BE2A 3L8BA 2OPQA 3CCQN 4HQEA 2PYLA 2QW9A 1NK3P 4HX7A 1MJBA 1KVAA 3A0IX 3OS5A 1G8XA 2QYOA 3O4NA 1HJRA 2CH0A 3E5QA 3CTAA 2O2OA 3OWTA 3A0BC 2DQLA 4K8XA 2DTIA 4PKGA 3GNFB 1NGGA 2PMUA 4AHVA 2P9IB 4CI6A 4N9IA 2BY0A 1RRQA 4C9YA 2DPPB 3J8AA 5LJ3h 3Q0WA 2GZWA 3DXMB 1Q81R 4IKFA 1TYQA 3D2EA 3GXOA 2EFWA 2OPSA 5E3LA 5JHFA 1EKEA 1N5ZA 4HNVA 2QWQA 3JW4A 3LSIA 2JA5J 3HKZN 1YJ9Q 2QWMA 2UXNA 1XSVA 5HOOA 1DJ7B 3HXLA 3U9DA 3MN5A 4F17A 1W5SA 1BG3A 4YDUC 5GIPA 1W4SA 2JUCA 1F4KA 5EG0B 2HGCA 3CCRA 1JJ8C 1AKHA 1QPIA 1NTCA 3UKUB 4BRFA 3FIWA 1FLIA 2BDPA 4NS5A 3SYTA 2DVJA 1JCEA 4HCZA 4NLCA 3OH9A 1K9MU 4ICLA 3ZT2A 1ULYA 3HSBA 2ZXHA 1YN8A 1XQSC 4BKXA 1YI2I 4RCBA 2FYKA 2ATCB 1TWBA 3UKGA 4N0BA 4NCGA 2XDVA 4KI6A 2F4OB 5FW9A 3JSMA 4O8UA 4CJ4A 1VOMA 2D0AA 3MEUA 1O75A 2WTEA 3OL3A 3CVTA 3HJEA 4E9HA 4AILC 3ONQA 2DT6A 2WAQN 2RNJA 3VGMA 4JDSA 3IFRA 2Z9OA 2L8DA 3N4QA 1N9SA 3SZ2A 3OV8A 2VODA 2EZHA 2VOOA 4OKEA 3IV5A 5AONA 4BY7J 2DTOA 3BQYA 1YJNN 3BR0A 2DAOA 2OZ6A 3A8YA 3DQVC 3ML6A 4BS9A 5M1FA 1DU6A 2XKOA 2E2OA 2BUDA 4BNCA 1SEMA 5JS1A 3J81K 4PNOA 5GMKe 3RDVA 2GCXA 2DL8A 3A1PA 1Z0XA 4B4CA 3KP6A 3CCQT 4BI4A 3VYUB 3FX3A 3C0CA 2OA8A 2RHIA 4M75F 3CCSI 3VEYA 3IMXA 3VS7A 1HKCA 4M3YA 1N6AA 2JOYA 3SXYA 1PD0A 4B9UA 4LF9K 1SMYF 1GVDA 3RERA 3M58A 4OOIA 3VB2A 2XGXA 2XC7A 2QEXI 4KTQA 1OZ3A 5J26A 1T6CA 4A4KA 4DV2K 2HHUA 1MMDA 3L9FA 4B9QA 4FSSA 1VQNQ 2G0EA 3BF1A 3D2FA 2HBWA 1HSQA 2JMAA 4EFHA 3ZSVA 1W7PA 2F7TA 2HHWA 1F1BB 2FLOA 5KYXB 1Z7UA 3LAPA 2GM4A 4B6MA 4B9VA 1EETA 1IV8A 1P90A 1GFDA 2YNGA 4HDVA 2YHTA 5GAMg 2DMTA 1N33K 3T1HK 4F7UB 3N4MA 1E7OA 1JQQA 3MEVA 3KEOA 1IW7F 3I0XA 2DE0X 2VGMA 3A98A 2VUMJ 1NNEA 4DSKA 1PCXA 3SLCA 1OYWA 2WSEE 2STWA 4KN4X 3KP3A 4A3LJ 4JI5K 1IG9A 4KT5C 4PFZA 1JTXA 5GP9A 4A12A 2K40A 2KHMA 3MXJA 1KHIA 1Q82O 2Y30A 3P39A 4BI3A 2ECCA 3UKRB 4O0IA 4FO0A 1SD6A 1U04A 1NJWA 1T0FC 1KXPA 5CKHA 4UXNA 4JRKA 2KRNA 3MK6A 3X20B 4RA2A 3NDKA 3LX7A 3J80Z 1QSSA 3K69A 4CJTA 3ZQCA 3ABUA 2CP3A 2HKNA 2TRTA 2YHWA 2FBYA 5GAN3 1RC9A 3FGUA 4G9YA 2BY2A 2V4JC 3LSHA 4CXFA 3DWLA 1PP8F 1VQKT 3A8HB 5CJ9A 4IIOA 2JUGA 2VV5A 3GFLA 4E7JA 1X01A 4CCOA 3GO5A 2RQQA 1LWWA 5L3DA 1XQHA 3QESA 3RSEB 1ENHA 3O1BA 4PJOA 3IKVA 5JI6A 3O2PE 2ZJQF 5KPRA 4B44A 1MNEA 1X58A 2VI6A 2UYTA 5J2MA 4OAZA 1RDBA 4I6MA 1YJWQ 2XROA 1WRJA 4IIMA 1UJ8A 1Q86C 1MBKA 3N97A 4NBQA 5B8HA 1T0HA 3DU5A 3MKWB 3RSNA 4K8ZA 4RB3C 4MLEA 1PU8A 4WFNL 2LT1A 4DNCA 4BR9A 3HGYA 1H89C 3QDKA 4J00A 4F2SA 4KHPK 3F9KA 3L4QA 2E41A 5GAHP 2NUZA 2JK3A 4M75E 4KKOA 1ZBLA 3CJBA 5HK3A 3IHOA 1NEGA 3VQEA 2W42A 5LGUA 3VWBA 1ARKA 1HU0A 4BY9C 1E3OC 3RUXA 4CFCA 4B3RK 3H5NA 3VOEA 1J3TA 4M77E 2EZKA 1QHHD 2EWNA 1MBHA 3RKYA 3CI5A 2Y4YA 3QXEB 4EJZA 2D1VA 1NK9A 1YJWA 3A5OC 1SPKA 2RNAA 3ENHA 4DR7K 3LAMA 1MNMC 2ZJPF 3LANA 1OPCA 2XUBA 5D4RA 1FXXA 4ZJZA 2A6EF 4KH4A 1NZ9A 3PNVA 3V42A 1N5YA 4PJMA 3I5UA 1MMAA 2FBVA 1GCQA 5M3FJ 1I4K1 2GTDA 2R5YB 1OQKA 1VSLA 5IYCJ 2DD4A 1HLVA 2EV5A 1QKWA 3K2ZA 1ZG1A 5B3SH 2OBPA 2Y2ZA 4UC4A 2P4RA 3PUBA 4KGXB 2MOXA 3SQNA 3RZDJ 4NYNA 1MSFC 4J6XA 5M1OA 4AH9A 4OMFB 1WPYA 2BANA 2XB5A 1KQSA 1ZA2B 1UGQB 4NDLA 2PZ1A 4XICA 1NG9A 2E4HA 4BGAA 5DM7L 2AXLA 2OPTA 1YJNQ 4F55A 3VRZA 3OYBA 2ZKZA 3IG1A 5HBMA 2FA5A 4PFPA 4C3JJ 1SD5A 1RT3A 2KDZA 3TVTA 3ZFJA 4Q5WA 4XIUA 4MO4A 3QRFF 4M3FA 2YG9A 2BGCA 4EJYA 4IHSA 2LY9A 4A3CJ 5L23A 2P9IA 2V7YA 5C3EJ 1USTA 3PFIA 1Z6TA 1JE8A 2RGVA 1VQ7Q 4XIDA 2JA2A 2R7SA 2VYPA 4M7AF 2QUFA 1BC7C 4ABZA 3CXCA 3OS1A 3QICA 4CZMA 5JS2A 5LEKA 2MK5A 1HJDA 4ZGEB 1HCRA 2RPIA 2JS2A 2GV9A 4PJOG 3G4SI 3IAM2 4CA0A 3U23A 4IRGA 2HYGD 5F0HA 2RNGA 4NUBA 1FBUA 1PRLC 1I6HJ 4QVDA 1WJDA 4JX5A 2B4JA 1C0TA 3WTSC 4G6TB 3CC2T 5C2DA 1D8YA 1PYVA 4JZ3A 4CIFA 4DCHA 1PU6A 3BWGA 4M3BA 1KRPA 1RZ4A 2E4LA 1J7KA 4I76A 4HCBA 1B34B 1BI4A 4CW7B 3BW1A 2EQIA 3WNGA 2RQVA 3VS1A 1J9IA 4DZJA 3CPWA 4CF0A 3K4LA 3E9FA 2O9VA 3EN9A 1YW7A 4UV8A 3CUQA 3WTXC 3M8QA 1RBTA 2XAFA 3CWSA 2FSNA 2COBA 3C6AA 1KD1R 4FJ7A 3LFUA 1NJXA 4CZJA 1SEUA 4Y7NJ 3DKWA 1RABB 1VQ8N 4NCAA 1Z77A 3VQBA 4DQ8A 1TW3A 3M1EA 2BZ8A 3M6GA 2FVUA 1HA8A 4MMKA 1MUDA 3QP5A 2HQ5A 5LGNA 3LL7A 4CJEA 3EFSA 1RRSA 3QPHA 3E5XA 1VYVA 2XU8A 1FOYA 1G4DA 4WF2A 1BU1A 3U3YA 2JA7J 1E4GT 3HSTB 3CCMA 1VTNC 4E2FB 5JHUA 3FSPA 3GTPJ 4NOYA 4NYFA 1VIFA 2B6AA 1LNWA 3FHGA 4ZZDA 1PHTA 4GGGA 1WIEA 3ERED 4XLEA 1SUQA 3CQXA 5HP1A 1WHUA 2QA4N 2VXFA 4CICA 3GLXA 4RMOA 3NAUA 2QQ8A 4Y52J 1QCOA 1TWGJ 4Z2YA 2P6TA 5D4SA 1SANA 4G7ZF 4C2UA 3TOBA 1X6OA 1U06A 4RS8A 2HAXA 3FE1A 3FZMA 3ZQ7A 5KYWA 2MLKA 3LP2A 3M8PA 5GAMf 3L0QA 4BREA 4M3WA 3FZKA 1FX7A 3NEUA 1B72B 3A01B 3LDLA 1K8AO 4WXCA 3I9V2 1WEFA 5FKKA 4M77F 4BXXJ 4XQ3A 1Y97A 4UB6C 3U8XA 3IP4B 2G8HA 3K0LA 2R7VA 4HT8A 1HBXG 3AA4A 1UDLA 1TQMA 5DCFA 2P0KA 4CJSA 3THXA 3CD6A 4DMNA 4M7AB 3JCMQ 1UHSA 2RI5A 1QBJA 3VKIA 4H5TA 2DYSH 4H5VA 3TW7A 2HYFA 1GOAA 1ABOA 4UB8C 3K5NA 1KG3A 3AO2A 3HFNA 2L7ZA 2VE9A 5IT9K 4D1QA 5FGMA 1LB2A 3EY1A 1D5AA 5GAMh 4BY6C 2Q8KA 2A3LA 2PMZA 1W1FA 2MFZA 4F7UF 1KHCA 2LVSA 3KUFA 2HHSA 5I9EB 3CCJN 3DKYA 1GFCA 1KG7A 4LC9B 3SPYA 4A54A 2XGDA 2QVOA 3MMVA 2YV0X 3E1YA 2DMQA 1JLEA 2TDXA 3CCJI 1FYNA 3ZL7C 4A4EA 1PNJA 3EG2A 4I0BA 4C92A 4B47A 2V1RA 5KNLA 4PL8A 3CO6C 4BE1A 2DK3A 4DKWA 2QK0A 1AWOA 4N56A 3NGYA 4JYKA 2H6BA 1S8NA 2K9GA 3HVTA 1RTDA 3G1OA 5DTDA 1RAFB 5BNGA 4EGZA 4M7AD 3O4QA 4DFKA 5ICCA 2R7FA 4HLYA 1W36C 2YR2A 3MECA 2XMFA 4O55A 3LH5A 3EETA 3D0SA 2E3HA 1K9MO 4M7AE 4ZGJB 5FU6B 3TREA 5C6SA 1NEBA 2O8FB 2CSIA 1Y96B 3DRPA 1QSLA 4A59A 1BOTO 4NQWA 2CDTA 2XK0A 4CJFA 1OFCX 4CEOA 2AA4A 4IBNA 2PJRA 1YQKA 1J6ZA 4KTZA 2BXYA 3T7ZA 1WPKA 4MZMA 1TGOA 4A6DA 2M02A 4U0VA 3BY5A 1BK2A 4XKWA 3CDIA 3CC7Q 2ETHA 1NG6A 1ZN2A 1GV2A 1ZX6A 2XRIA 4XU3A 3IAYA 2H94A 3D0PA 3GYHX 1VQ5I 3OS2A 1DLOA 4J9FA 4DBRA 1HYOA 3IRQA 1K78B 2YI1A 4L5GA 2PYJA 5HLGA 4J7IA 3QOPA 1FEXA 4LFAK 5LJ3d 4YOYA 2VBZA 3G4SQ 4YNQA 4LUDA 5EZGA 3IKTA 4RLFA 2HHTA 1JLQA 3VUBA 4ZYHA 4FZZA 2V51B 4BJTA 1XOVA 4WF9L 3CCSQ 2GOXB 3VS4A 3MCAB 5GPAA 4XONA 4FCYA 4E1MA 5GJWB 3BP8A 3GIBA 2ZXIA 2ZMEA 3ZEUB 3KZZA 3V9SA 3IUCA 5DK5A 4JP0A 1YFHA 2A1SA 4FZYA 1KGSA 2EK5A 4PL6A 3V1QA 2A1RA 4M3DA 1OCCH 1KTQA 1N3AA 3DLLA 3W3CA 2QF7A 3CC2I 4RG8A 3VPZA 3CCMI 3HUGA 1GXPA 4H0VB 2GGRA 2HF4A 1SFUA 3OYIA 1ZR2A 4H0YB 4KB0A 2OUMA 3I33A 4XOPA 4ID5A 1MV0B 3G0ZA 3BG5A 1Z26A 5CVRA 3M59A 3D5SC 5IP9J 1T7PA 3OIPA 2HDCA 3SAGA 1T44A 2J05A 4FK0A 4C3HJ 3BFMA 4AVZA 4CHZA 5GANd 4DQSA 2LSNA 3VU3C 5EGOA 2Y0MA 5GAHJ 4F7UE 2V1NA 2GTOA 4S05A 3E3VA 2VBXA 3FZHA 3MX2A 2HDDA 2DIGA 4LGWA 3GEZA 1S72A 5D5XB 1BB9A 3PX6A 1M4ZA 1TV6A 3BPXA 3JRAA 5IHNA 1DPRA 2RN8A 4UY8O 1IRXA 4DV4K 2L02A 1RDUA 3EKUA 4NO7A 2ZJRL 2KTQA 3IH4A 3D5RC 5BRHA 1HNXK 2ZFUA 3QETA 2GXAA 2AIRB 5LJ3g 3BLYA 5J3BA 2PLYA 2W1OA 4ESRA 3SAHA 3OYGA 3VA0A 2M0YA 3K4NA 1R23A 3EGDB 3WU1B 1Q81U 1VRUA 5IXBA 1UMQA 2ABKA 3JTHA 2LDMA 3CCEN 5IN1A 2P51A 3WHBA 4ZYAA 1ZREA 4QLCU 2PBIA 2O8EA 3HTVA 4HV5A 3EG9A 3OIOA 1DTQA 3SDGA 2RV8A 1BA5A 5AQMA 1KD1U 3TABA 2EVRA 3RMDA 3CEYA 1A5JA 3BJOA 1ATSA 3PY8A 1VQ7A 2CH5A 1MGTA 1RDWX 2A5XA 3INZA 1X6BA 1LNXA 3H1VX 5CQXA 4QVCA 2CQXA 4ITVA 3LYIA 5K7FA 1TK5A 2Y1IA 4DR3K 2UZKA 2XPVA 2ASMA 1X1BA 2M5WA 3DTEA 4CO8A 4L9TA 4KT6A 4U67L 4EGYA 2HDWA 3GNGA 3OYFA 1JKQC 1QVPA 2P5LC 1YQMA 3OR2C 1WNSA 1O7LA 2DA1A 1D09B 2K27A 1X3MA 4Y1CA 2EJ9A 1MWKA 5GAEP 2WB1A 5CZ2A 4ZYGA 4AU7A 3SBGA 2GUIA 1SFKA 3QQAA 1IJJA 3NH1A 5AQRA 2E1MC 2F69A 2YSRA 1R9TJ 3CF2A 1A5VA 2LR8A 4CIGA 1E6HA 3CJ9A 1K6OA 2BIVA 4R8HA 1Y71A 1EF4A 3QBYA 4AG2C 4Z94A 4L18B 2VXEA 1QQIA 3IUOA 3VMFB 3JB9I 4OLBA 2C0IA 1WJAA 3MCPA 2V6EA 2E20A 2O61A 4CYCA 3SWNC 2F8SA 5GMKj 4M9XA 2FBHA 3TKYA 3NTIA 4EJUA 2B7EA 2CW7A 3A8OB 4IEEA 3M7GA 2HL3A 1TNSA 5D5VB 1GLDG 3BG9A 2KW4A 4MIMA 2GX9A 5IT9Z 5KYYB 3CCLN 2XIGA 5KYYA 1XMOK 1Y0NA 3KK7A 2E64A 2A36A 4AD9A 2Q0OA 2DXUA 2CKKA 4CCJA 1WSGA 4AQYK 1J59A 2H3EB 4ON0A 1YRNA 4CEAA 2CP0A 2HOEA 3AL0B 3CC2A 2JXBA 4XQFA 1UCRA 4PGHA 4G8XA 1L3UA 3D4VA 2KDOA 1HKQA 3J7AF 3O3KA 5BPDA 1LFUP 1IKVA 3B02A 1P4AA 2HNZA 1OPKA 2K7AA 3AAQA 3MKLA 1YIJA 1FYLA 1RKTA 1K7AA 1N25A 2NYXA 4HT9A 3ZMVA 3WNHA 2JWTA 3RKQA 3REBB 3CCLQ 2M1HA 1XUPO 3D1NI 1QHAA 3AA3A 2DK5A 3KIOA 1XQOA 2E1MB 3JRGA 3H0IA 4DOVA 5LHHA 4E4HA 5CKBA 3A8LB 1MBFA 2XF7A 2AK5A 5SWMA 5L8RE 5EDNA 3I58A 2EJFA 1NGNA 4B48A 1VI0A 3HB9A 3M3YJ 2V1UA 1JJ2P 1C1BA 2YNIA 4CI0C 3LZIA 1HQCA 1ZXOA 2K6DA 3WTWC 1JGSA 2JPSA 1I1GA 3R0AA 1WQ7A 2KGTA 1S7AA 4D5FA 5CLSA 4DTMA 3JCMd 2XAUA 2KDSA 2DFFA 3PNTA 3NWSA 4MLHA 1ZGAA 3FHFA 4DR5K 1YIJQ 3AO4A 3FLCO 3HPOA 2EQRA 4WCGA 3OYNA 3JB9F 1BA1A 4XTUA 2FPEA 3RKWA 3URGA 4KJZA 4FW2A 4Z02A 4DR1K 2OJ2A 4KT0E 2BE5F 4CK3A 2YUPA 3LWLA 2Y90A 3CBOA 3WNFA 3WU2C 4P5OA 3V9WA 3SJJA 4IHXA 5GAMe 3CHWA 3AVCA 1QWEA 1HW1A 2E35A 2RVCA 2UWMA 2OCCH 2PTKA 2XASA 2KZGA 2M1BA 2KT1A 1W4MA 4M63C 1KSPA 3PE0A 3G71Q 3E7LA 3UA6A 2MD0A 1QHTA 5HVQC 1G3TA 2JZ2A 3IHUA 5L3FA 1QZ5A 3VESA 5LGTA 1RNLA 5ED4A 3M4YA 2NRZA 4ESFA 2WWYA 2ZJQL 2VPLA 3THKA 2XD0A 4KISA 3CMEA 3CCUT 2DIQA 1I1SA 2KISA 1NM1A 3CCUI 2DODA 2CGKA 1YS6A 3GW2A 2W7NA 2HSTA 1EH6A 1TUGB 5LL6S 1W7PB 2H3GX 2ZSHB 1TTHB 3OA9A 3Q7BA 3LCNA 4O0JA 1EIFA 1JT0A 3VF4A 4PJOD 1IGNA 3TU4K 1HW5A 4CJWA 2IBDA 3L00A 3CJ7A 1D5VA 4EW0A 3GFIA 2PQWA 2HOAA 3HIFA 1SRMA 5ICFA 2BXZA 4N0AA 3JCMg 3GMEA 5J2NA 3LWIA 1VQ9Q 5CYVA 3MVPA 3I0WA 3A4CA 2LP0A 1KQSS 2AXTC 3X26B 3PFYA 2ZGWA 1B7TA 1Z3XA 3KKRA 2DTZA 5GMKh 4PQUA 3H9QA 1HKBA 2MMPA 3BDDA 4BQAA 3C6TA 3EKSA 3I56T 4O3MA 2Z1GA 4FWPA 5FKLA 3TO9A 3HOVJ 4M42A 4S04A 1XGMA 5KK1A 4Y13A 1W97L 3GWZA 3GDQA 4FWKA 5C12A 3DJCA 2ID6A 2K3FA 3NWTA 2RHYA 1T6DA 5D6WA 1Q82R 3M8SA 4DTOA 4YOQA 3IWFA 4B3OA 1JLFA 1J54A 4L5IA 4E19A 2KZMA 2IAJA 3JXUA 2D1KA 4ELYC 1OZ2A 4B9NA 4ME7A 2G7HA 2F4MB 1RIOH 2E1OA 1KSWA 2A37A 1SL2A 3QDFA 4JKFA 2LD5A 3OJUA 3J81Z 3RDIA 4BHPA 2WFBA 1T2KA 4HVJA 3M07A 3SHWA 4DQRA 2FEZA 2O5RA 3CCVI 1RNHA 4GV6A 5LY3A 4FJLA 3F8MA 4ESJA 2VE8A 1WZOA 4BWJA 3OW2S 4YOXA 4HNUA 3FXQA 2A0FB 2LBFA 1YHQN 3H3VK 3V9ZA 2PU9B 3CPWS 1WXTA 2ZNYA 1AD5A 4EJVA 2J7IA 2EPFA 1NKUA 5ADXA 5LD2C 4CK1A 2X9HA 2G8WA 1HR0K 4IO8A 3V8LA 1TP4A 3H0FA 4D8KA 4FW1A 1XC3A 1M1GA 4X1VA 2P8TA 2DJZA 2DXBA 2EWSA 1X3UA 4R5PA 1QSYA 1U0JA 4OB2B 3D45A 4VUBA 1HDPA 4BWMA 4QQ6A 4II1A 2JVVA 4FWQA 2YUNA 3ASNH 4OIRF 4R1HA 2I7PA 3ZCMA 4FYWB 2KI7A 4UQGA 4E9FA 4ILGB 4GO1A 2PMZN 1U5TA 2WY7Q 1NLVA 4L3QA 2HZTA 2LTOA 1ZQ1A 3CXCS 1JXBA 2G8FA 3CG7A 2DTRA 4Q47A 1M2VA 5GAOn 2DFUA 1RT6A 2XAQA 1HYVA 3G6ET 2M45A 1N6QA 1IREB 5J8FA 2L3RA 1TAUA 1Q86U 4WQ5A 1P59A 2LY1A 3I5SA 2OTLT 2VG7A 2X6WA 1KVCA 4CK2A 2MC3A 4RGXA 4BG9A 1TXQA 1WQWA 4E3SA 3CJQB 1VQPI 4L5JA 1UHFA 1YUWA 3PIOF 2LX9A 2ZGYA 3WT0A 1NKCA 4AI4A 1D3BB 2DPNA 1D8JA 5FLVA 3DXJF 1IN4A 1NLOC 2DEUA 1LAWA 3OL4A 1JO8A 4FJMA 3ZSZA 2A3ZA 1BI1A 4J19A 2NUPA 2NUTB 3ASMA 2DA6A 4A93J 2C06A 3NGPA 1DGRM 4C8KA 4UNOA 2XY6A 2WV1A 1N3CA 4GY2B 2Q0UA 1I5ZA 1QQOA 3JCMf 4CGHA 1WBBA 1T6SA 2P5OA 4C92G 1X9SA 4FXDA 1FOKA 3OYYA 2AQEA 5CHZA 4EQQA 2YJFA 1YW9A 2L2PA 4FX4A 3O9UA 1NJIC 1D1CA 2NAZA 3QYHB 4CJ7A 2RN7A 1WEIA 1LPQA 1XD7A 5GAN2 1H1VA 5BPLA 4OMPA 4DF4A 3QINA 2FSWA 2XAHA 2ZQBA 3FF5A 3BY7A 4PJJA 2ZZDA 3AO3A 3VS6A 1ZBHA 2EIFA 3ELKA 4LDUA 3GPLA 4YOVA 4FWLA 1ZSZC 4D9JA 4AIKA 1GHCA 3S6WA 3TQNA 2KP6A 1BJAA 1S9EA 3SQ0A 4MMLA 1S1VA 3L42A 1X9WA 3S3NA 4JLGA 1PUFB 1LEAA 2GWRA 4MO7A 1TOVA 3O6BB 4A2BA 1BU6O 4JK9A 3E6CC 2NNWA 4FWOA 4AI5A 1PVSA 2QM3A 3RR8A 2QWNA 3G6EN 4XORA 5AT1B 1M90U 4KB1A 1Y96A 2CYYA 4YORA 4PSXA 1OCTC 5ADXH 3V7RA 3B73A 4OIPF 1PKSA 4X6AJ 2IGOA 2Y9ZA 4LLGF 3R6OA 4XTWA 3K5LA 1KQ1A 1S3XA 4GKKK 5C2FA 4D7MA 1M1KC 3ZETB 4LIUA 2DTUA 4AT1B 4DFJA 1IJWC 2JTVA 4ISEA 4IURA 2W85A 4G94A 3F9MA 2RJCA 1HYZA 3LNQA 4O4GA 1LKXA 2ID3A 1RBRA 1NJIU 3R9PA 2O8CA 1AZGB 1O3TA 1XX5A 4E7KA 2ZB9A 3ULDA 8AT1B 4G6QA 3ROUA 3U1DA 2LNBA 3QWLA 3BDUA 3F23A 2O3FA 4KO0A 2FF4A 5GAGJ 3Q7CA 1SL0A 5KN8A 4HVUA 1I94K 4JAXA 3QKJA 2KIQA 1PJRA 4Y91A 2VN2A 1IN7A 1YHQI 1TKDA 4CERA 2QEXN 3FHZA 1P2FA 1HPZA 3H3NO 4MGRA 1VQ5A 1O7FA 5A2QO 2P9PA 1W2BM 1NG2A 4YRVA 1TNTA 4FL6A 4PFOA 2FHDA 1ESVA 3SMSA 1WBDA 1EWQA 1JUPA 2FD5A 2E5QA 4M71A 4Z4GA 3FJ5A 5CQYA 5AQVA 2FSJA 3O8MA 3RRHA 1JJ2S 2BKDN 3LDQA 3D5LA 2O6GE 3H92A 4JOMA 4WYBA 3CD6T 3H1QA 3MN9A 2D1XA 1LFPA 1YIOA 2UUCK 3CFRA 4IUQA 5JVGF 4ENNA 3KK2A 4A3KJ 2IVOA 3V8JA 4M74A 2HKQB 1HLUA 3ASKA 2L3SA 4B1YB 2KFZA 3O5BA 2BTTA 3SD4A 4WQ4C 1SVMA 3D7EO 3SEQA 1S22A 1WHHA 1QVGA 3TTCA 4YDUA 1TH7A 4E89A 4OU0A 5GADJ 1X27A 3TAQA 4KGZB 1B9DA 1NK2P 1EV7A 2ZXWH 2NUBA 4V19K 1TWHJ 2KKZA 2QXFA 1OYXA 2O4GA 2K9SA 1JHHA 1Q1HA 1VA7A 1BW6A 5FROA 2R5AA 2M87A 2AJQA 3O9RA 4WFAL 3OW2M 4QCLA 2QSHX 2VLAA 3LSPA 2CS3A 5KCMA 7AT1B 1YX3A 2ACJA 1A36A 2RKIA 5EJCA 2VWJA 4OB0B 2EYXA 1JLCA 2BW3A 1QO0D 1U9OA 2IEKA 4B3MK 3RZOJ 2F5EA 1QVFP 4IFYA 3KETA 2EQMA 4U0WA 2XKPA 3IH2A 1REPC 2KXCA 1W2BS 2XB0X 1A31A 5GAEJ 1OCRH 5FLXK 1NGDA 2P9NB 4BR0A 4L59A 1UOCA 4AC0A 2LJ3A 2X48A 3ZSRA 5FDLA 4ESBA 4PY5A 2HNIA 1X9JA 2NLXA 3MEDA 4KAZA 3VPRA 4DOZA 1LJOA 2WC9A 2DA4A 3CXCP 2V79A 2GWJA 3CCUN 3P9IA 3H9JA 3KNTA 3HHTB 4MQ9F 1UEBA 3CCJT 4K25A 3LOCA 1K9MR 4CZKA 2CS7A 2I8DA 2A7YA 2DLPA 1MGQA 4ENKA 2G9WA 3EGXB 3VDXA 1C6VA 1QZEA 5FO5A 2OFKA 3MHXA 4LF4K 3WE3A 4GXOA 2LC4A 2MWPA 2FOWA 3AG2H 2R4GA 3JB9G 3JAME 1ZRFA 2JHJA 3CCMT 2QLZA 3U6FA 4RG2A 2LCSA 2YLBA 4M78F 4CEQA 3M55A 5LMNK 3EYIA 5AQPA 4ETSA 4OGEA 2CUFA 4IEIA 2X4HA 1NPPA 1T3SA 3DXMA 3BEXA 2HBMA 3WQTA 4CDGA 2X1EA 1GL5A 3TAMA 4FL9A 5JR3A 3CQ8A 3K4KA 2VGNA 3WUHA 2UXDK 5TRDA 1VQ4I 1LW0A 3IH3A 1X1AA 1MJ9A 4EMGA 3ZSQA 5BN9A 4LB5A 3KTQA 2P0WA 5IOZA 3I55N 1MBEA 1VYUA 5HS9A 3MN6A 4BRDA 2QSFX 2DX1A 1QVGM 1IXRC 3SJHA 4J8FA 5ILVA 3HPWA 2W0ZA 1FC3A 1APLC 2K2MA 2F5CA 1WHJA 4RMNA 3S15J 4CD1A 5D8KB 3DYAA 3SZTA 2HOTA 2IJLA 4M78D 4FLUA 2BY3A 4A3FJ 4FJ5A 2QWPA 1K73R 4E9EA 4LF7K 2E6LA 4YY3K 1K8AC 4YOWA 3C6UA 1VQ7N 4J9EA 4F9OA 1WVRA 4M7XA 1Q8IA 2XF6A 4XU0A 1WXUA 3G1LA 2YCHA 5GANg 2ENMA 3I8BA 1E4FT 3TL4X 1LE8A 1VQOA 1XMQK 5BPMA 1VQPT 1WHKA 1VQ6Q 1WEGA 3E2UA 2IS3A 3EL2A 2HVHA 2EFPA 3CQTA 2XHBA 4BDYA 1VSHA 2JTMA 1FMVA 2HPIA 3EUAA 1RACB 3UPUA 3HP6A 2KLOA 3LMMA 2R7XA 1IG8A 3T1BA 4YTLA 4JKAA 2XHIA 1TT0A 2CW8A 5DM6F 2JN6A 1U2VA 4GBQA 2KRFA 3BR6A 4DU1A 4OFEA 3MZYA 1S3JA 5CIUA 3DRSA 1D0ZA 2ZPHB 2EB7A 3QZ5B 3CUQB 3RMBA 1UG1A 3T1AA 1JLGA 2W4SA 2A41A 4KHSA 3LSJA 4IRHA 4X9DA 1ZQ3P 3NQOA 1PSFA 3ENBA 4J9IA 1QMCA 1HW2A 1NK8A 3P83D 1GCPA 5DMRA 4E9GA 5KYUA 4RGUA 4PKIA 3KK3A 4XRSG 2D8HA 3RR6A 5JFRA 2MW8A 1MNDA 2RQUA 2VASA 4PKCC 1TQIA 3CCSN 1KQSM 3KYLA 3O8GA 4CZHA 3HO1A 1M90R 1KIKA 4WTOB 1ETOA 3ZCOA 4ZGDB 2ROTA 1IV6A 2GUPA 4OMLA 2X35A 4CZEA 2OTLQ 3U3GA 1M2VB 2EYWA 3EO3A 3CM6A 3KHYA 1U5SA 1IO6A 2V9VA 3COAC 4HTUA 1EP4A 2BVLA 1YIJI 1N75A 1ACMB 1D9DA 3CCVT 5F0XA 5KE3A 4AM7A 1PM3A 2VWKA 1MDMB 4WCEL 2IA1A 2O01E 3VV0A 4I02A 2EV6A 5FJ8J 2BZYA 2IC3A 4B9LA 1VNDA 3UATA 4QOZB 2BEOA 2VC1A 3FBIB 4BEHA 3K70C 3GTQJ 1ORPA 4B9WA 2GELA 4MLOA 5K5OA 4RM2A 1WI3A 1TWAJ 4LH5A 2ZPEB 2ZNZA 1YITN 3EH2A 1KEAA 1R0CB 1RESA 1HNWK 1M5Q1 4AIHA 4JI6K 1WJSA 2DZ9A 4Y0WA 1XGSA 4X34A 5B1BH 3WTTC 1I1JA 4A3MJ 2VYTA 4UUTA 1KU3A 3GZ6A 2ESWA 2M9HA 1BCOA 4JRIA 1Q81C 4FLXA 1XB4A 3TWHA 3S3MA 2YHBA 5KGXA 4LNPA 1EA3A 2EJRA 1FYMA 1IRZA 3I55A 3H3UA 1CGPA 2VQFK 4H03B 1YQAA 3SPZA 4EP4A 2L0AA 3K7AJ 3MCZA 4FQGA 3ZR8X 1E3MA 1PP7U 4H0XB 4EZ6A 1FWZA 3DPLC 3CC4T 5I11A 1IXDA 4X64K 5A0DA 1BJZA 1ZG3A 4F7UA 4B08A 5HRSA 4M7AA 2Z1HA 3SK3A 4IZ9A 1SFEA 1YT3A 4YIFA 1LV5A 1QGPA 1K73C 3AVIA 1X3ZB 3I0SA 4KIBA 1G2BA 2LKPA 4O5FA 2HNDA 3JCMV 3SEZA 2HNYA 3I56N 4UUVA 2EINH 3NHNA 1R71A 2JRTA 2E1NA 2OV7A 5GAMd 3KKSA 2UU9K 4FJJA 1FMWA 2NVXJ 3EHRA 1B59A 2BW3B 2RE2A 2YHYA 2DY4A 3R6MA 1FBSA 4FJNA 2EIJH 3WGGA 1D1AA 4JX4A 1YQLA 4M3RA 1MV3A 2M2EA 3K6GA 1MJAA 1YJNA 2CP7A 4ZYDA 1YJNT 1X69A 2D5RA 4KA4A 1BISA 3QERA 5GANf 2Q97A 5BQTA 1Y07A 3L1AA 5LHIA 2F96A 3K10A 1SAXA 3JAMZ 3DOLA 2V1QA 2CSOA 4CGDA 4EA4A 4XKCA 1ZLJA 4LXCA 2E36A 1KFSA 3QODA 2R3SA 2KK4A 2QGUA 1WJRA 3SFIA 2YNFA 1KONA 4KFBA 4C0GA 1NPRA 3BGRA 3RQ4A 3WNEA 2QTDA 2PUOB 4B1UB 3KJVA 2NZTA 3AA5X 4JRPA 4M78C 3RRGA 4LITA 3WEEA 3WG9A 2JPCA 5BN8A 1VQKN 1YXQA 1SS6A 2IIMA 2I7NA 3CC4A 5GAGP 3UT1A 5E20A 2HFHA 5J1RA 3ECOA 2ABLA 4KREA 2F1LA 1QVGP 2K9MA 5LRRA 1VQKI 1D8KA 1GLCG 2W00A 3L2WA 4B24A 4U88A 2QK9A 4L6V5 4MDXA 1SFXA 2W24A 2HEOA 2WAQA 4XK8E 3HI0A 1T8IA 1IDZA 2LFBA 4PJOF 3ZT0A 4O5BA 2H6CA 3S3OA 1Q9XA 4LSNA 2QEXA 2E19A 2NOEA 2K3XA 3ZN1A 1ZBFA 2CW0F 5ELZA 2CV2A 4Q5VA 2QA4A 4E0DA 3QYFA 3WE2A 4I2PA 1JRIA 4DW6A 4JI2K 5M1PA 3CLOA 4FT2A 4Y33A 3CCQA 4LB6B 1IBMK 4BR4A 4FWSA 3RPUA 3U21A 3RMAA 1ASUA 2FEIA 3C65A 4JI4K 2DTHA 1LUJB 2NLUA 3GFJA 5E41A 2P9SB 3CZ6A 1QA6A 4KHWA 2DBMA 4W5TA 4CE9A 4M7AG 1D0XA 3IL2A 3UKRA 3SJMA 3K1PA 5K7ZA 4F3QA 4C0ZA 3CIPA 3HHHA 3WXJA 1VQ5N 4GNIA 1NJIR 1FK9A 4Y17A 4HAMA 1YLFA 3QPTA 3DXKA 4KH5A 5HCKA 1SAUA 3JRIA 3SZGA 2E1YA 2OAUA 2KZVA 2E5ZA 4HQMA 4M77B 2X9DA 1EXQA 1LWEA 2O4XB 2XKOC 4PLLA 4CBUA 4HF1A 2O4XA 2YNHA 1KQJA 3BJ6A 4XK4A 3S16J 5LJ5f 4BXFA 4M75B 3ERMA 3GE1A 5I3UA 3QUIA 2HVIA 3KX2A 2EKOA 2LQKA 3M1CA 2IGMA 2RMOA 1G3SA 4Z8AA 5AFUH 4BHCA 2HDAA 2HTSA 4HX4A 4M45A 4RTVA 4AIDA 1SAZA 1YQRA 3ZP5A 2DM1A 4GY5A 1ZUKA 4C8QC 2KY9A 3NMZC 1TUYA 2ZCFB 1RLQC 4JHDB 5JMVA 2HQHA 3HOTA 1YO5C 2I2LA 1BHLA 5I42A 4DS5A 4KGVB 2XDBA 1LE8B 2KRCA 1OR7A 4PJ0C 3BG3A 4BQOA 1XC5A 4I9QA 2CV0A 3P8DA 1TT5B 5EZHA 1UG0A 2JSCA 1XJWB 2IXSA 3HT3A 2L9RA 3A03A 1NGBA 4M3EA 3SYZA 3H0DA 3K5OA 1T95A 4CYCB 3V1RA 3FMSA 2KNBB 2DDAA 4KDPA 4RAFA 1TC3C 2F5VA 2ED1A 2LRDA 3DAWA 4QPQA 1SRLA 1YX5A 3GF5A 2F4VK 4J83A 3J7YP 5FKNA 4W5NA 2V1DA 2DU9A 4YG2F 2ZO4A 3NF9A 2XAJA 3BZCA 1M1KR 2H1KA 4N4GA 1B1BA 1I8FA 3DLKA 3R3LA 1RTJA 1YI2T 2BE2A 1Y64A 4YIIA 2UXBK 1LMZA 5GAN6 2K4JA 3S32A 1IF1A 2DMOA 5AQHA 4YOTA 2HMAA 2ZC2A 1OVQA 4KBOA 3SB2A 4RTZA 3ZYYX 2IPOB 2RKHA 3EFOA 3BR2A 3J81E 2G3RA 2GBZA 2Z16A 5J1EA 4ZH4F 4FJKA 3HDDA 5HLTA 5IH2A 4DG1A 1MUNA 1V1CA 1YJNI 3S2DJ 2CZ6B 1RT5A 2W6KA 3MKZA 1K61A 2KEAA 2VC8A 4LG0B 4C0DC 5AIPA 4IJNA 1MDUB 1QNTA 2ZE2A 2X78A 3AG1H 1TKZA 4AHSA 3CXCM 4DJAA 1Y8RB 1BOBA 2JT4A 1K1ZA 2J6FA 3PIPA 1NYFA 3I4PA 1UHCA 3PX0A 5IP7J 2EX3A 5H6RA 4I6ZA 2E1HA 4NL3A 1N8RR 2EYYA 4F3OA 2CJJA 5DV5A 4JKGB 2HB5A 5M5YJ 4B9XA 4IDKA 1S5LC 4J9GA 4LDYA 3VEZA 3NCIA 2HW3A 4FZXC 3EYYA 1KO9A 4GCVA 2BVMA 4OFHA 2QA4T 3MPUB 2FSKA 2K9LA 4MZPA 3VS2A 1B92A 3NARA 2K4YA 1B9MA 4FX0A 1K0SA 3CDLA 4I01A 2YKMA 1RT7A 2A40A 2IVMA 1DGWY 4J8OA 5C0YA 3FMQA 3OBWA 1S29A 3FKJA 2E1ZA 3R60A 3AVMA 2IA0A 2DFIA 4I0AA 3K57A 3GX4X 1TYQB 3D2EB 2W48A 2OTJN 1EBMA 2BTFA 4C5HA 4XSXF 3A1YA 3JAMO 4BY6B 3CCST 3TGNA 3PO3J 4YIRX 1XSXA 2L7KA 2DQRA 3THXB 1U45A 5E1XA 1Z9CA 1VQLI 4B8XA 1S6QA 3META 2OTLA 1NYGA 3VYTB 1DDNA 1WSFA 4OWRB 4X66K 2OC6A 4J9DA 3BR1A 3K4BA 3JB9H 4D5CA 2PVOB 2HI3A 3G6EA 1LJ9A 4IG0A 4N41A 2NRAC 1GV5A 4MTDA 3FRNA 1J09A 2XV4S 3BJAA 4FHTA 2HVSA 5FLXE 2VXZA 5FLXO 4MQ3A 4M3XA 3CCJQ 1WA7A 2R5ZB 2AT1B 4BRQA 1EJ9A 4CCMA 3X2QH 3TP0A 1U1SA 3HG9A 2E7XA 5GJVB 3HM8A 4MZTA 4QIWN 1P4XA 2EW3A 1IN8A 2MH9A 3P7NA 2JN0A 1A6IA 1NJZA 5KTQA 3O3FA 3EH1A 4DR4K 2QWOA 1R1TA 3AT1B 2XDPA 5KPTA 2V6CA 5E3NA 1KVBA 3T1YK 4F91B 1Y8QB 1HNZK 1HYSA 4HEA2 2QKMB 4DLEA 2M0CA 4DSIA 4BB7A 3X24B 3ZQLA 5AQLA 3FM3A 2K5FA 1FN7A 1BR1A 1RUWA 2VL8A 1Z1DA 2LLKA 1ZBJA 4JX6A 4E7IA 5HK0A 3EZWA 2E8AA 4JRQA 2D0OA 3JB9J 1Z67A 1MMSA 3B6OA 3F8FA 2KT8A 4ZDPA 5C4XJ 4H4MA 2GWKA 4LD0A 4EP5A 5D5UB 5LJ5d 1ZGWA 1IDYA 2O8CB 4DLGA 5HS7A 3RMSA 5BRDA 4D7NA 1Y0MA 3DBHB 4A4FA 4LLLA 2PX9A 4KYWA 1LWFA 1TSFA 1WJ5A 2D1HA 3A5ZB 2NRVA 5CYMA 2XPUA 4RB0A 2ME6A 2KXDA 3X25B 3K70D 4QTRA 4RW4A 3CCMN 1VQLT 1R4MB 4LDVA 1I6XA 5C25A 3SI6A 5CQGA 5E3OA 3N5BB 3ULEA 2L0KA 1Z9ZA 3PIOA 1XNQK 3T69A 3ZX0A 1UZCA 4FETA 2GQIA 2LJ1A 1W2BA 2V7ZA 3MAJA 4FT4A 2VQGA 3WQUA 1U78A 1K8AU 2K9NA 1GLNA 1L3VA 3BTLA 4CCLA 2YUQA 3MEXA 2X1DA 3MX5A 4U0YA 4E7ZA 1OYIA 2FMLA 2NRRA 1U8BA 4M78B 2FF3B 2XSJC 1G15A 4E47A 1JL1A 2QQSA 2JWLA 1KQSP 1HJOA 1E0EA 3ID8A 1WSEA 2UXXA 1FTZA 3HEFA 1G2HA 1WFWA 1REVA 4KHYA 4BUPA 3RPQA 4CFAA 2EQKA 1R8OB 1QZYA 2H8WA 2CO5A 4JEPA 2P4TA 3KP5A 5DCMB 1S7EA 4FT8A 3HSEA 5C44J 2PMHA 3ISPA 4N47A 2SEMA 3PSIA 3ZSYA 1YTYA 2JM9A 3CCRI 1F43A 4CGFA 5E3MA 3HM5A 4Y28E 2ZD1A 4BYYA 1BL0A 4LF8K 3CMET 3CCUA 4XN3A 4PDKA 4N9HA 4U87A 3KZIC 1LWCA 4P55A 3NAEA 3AHUA 1H9TA 3I59B 1BIAA 4IDHA 2J5PA 1QE1A 3OYEA 1STZA 4J9HA 4OMMA 1G99A 1YYVA 4IX7A 4G7OF 2O31A 1T03A 1YJ9A 3VRYA 3VQDA 4J2DA 2JTFA 2HS5A 4KUIA 4HX8A 1UE9A 2P5VA 4XRMA 3JCMJ 1B4AA 5DLOA 3F0CA 2GIVA 1RT1A 2ETJA 4B1VA 2WONA 2CGPA 4E7SA 3RIRA 3WTYC 1J5EK 4UUSA 4IUUA 5BS6A 3VQQA 1F36A 1V76A 1K83J 5C4JJ 4KHNA 4PL7A 3DPUA 2CU7A 3QJ6A 4RTYA 4M7DC 4DTXA 3KXTA 1RI7A 2FRYA 2YX4A 1J5OA 4BDPA 2IPQX 1T39A 1BUPA 3QYGB 3FLGA 1GLAG 2OZMA 4JJBA 4ASNA 3CMMA 2LQ8A 4ZC3A 5BMZA 2NRXA 4OJRA 3EGUA 1NMDA 4DSLA 3BG7A 1A0NB 2KYBA 3S1QJ 1RKWA 5A2QE 3HBTA 5HROA 2IVWA 4DB3A 4B3SK 1JKPC 2M0OA 3OMCA 2PY5A 4F92B 4B1XB 2RD1A 3H41A 2LP5A 1YNZA 4CCHA 1NHAA 2FJ1A 3V7CA 5C24A 2QTXA 1TKTA 3QG1A 4CZLA 3F10A 2GF7A 1OYYA 1YJWN 2MF2A 3HC7A 3HOSA 1A5WA 3PVLA 3HBLA 2R7UA 1E2XA 1UAAA 1HDDC 4OMYA 1XPXA 2XGCA 1H92A 3BE3A 5A0LA 1ZH5A 1OU9A 1C0FA 5GTIC 3LPUA 3QIIA 5FFZA 3R2XC 3PQJA 5I22A 3DP7A 4FLYA 1VQNA 2DMUA 4M77C 3PNYA 4RM3A 2WA0A 4Z89A 1D3YA 4J5YA 2FO0A 1S1TA 3QO3A 1NGJA 1V4SA 1VFCA 2E1CA 4FWMA 1R5ID 3ENOA 1P7IA 1OEBA 4M75C 3VYGA 3CMEN 1Q7YR 1F9NA 3ZT3A 2E7WA 1GVJA 4C23A 2RB6A 5AQGA 1LWVA 3J7ZO 2R0QC 2Q2EA 2DJIA 1FW6A 1LFBA 2WY8Q 2IGNA 1YITI 1ZTRA 1YITQ 5L3GA 4C8MA 2GOMA 3RTVA 5HLHA 5EEHA 4A5MA 3C1DA 1B34A 4RCHA 2P9KB 3VTHA 2RJDA 4FK4A 1MH3A 5KYUB 3RESA 1SSFA 4QSHA 3TSQA 2OQRA 5GMKi 2PNIA 3QFUA 3GCMA 3O5ZA 1LCKA 4FPAA 4Z0UA 1TVRA 1HOMA 4L0ZB 1V5FA 1B3QA 5AFUA 3HSRA 3OMGA 4H4KC 4RGRA 2NVUB 2F5DA 1X1DA 5LJ3j 3K4JA 4DTUA 2XDDA 1YHQQ 6PAXA 3LA3A 4BQLA 2FZKB 5F2RA 1TTYA 2GQQA 2E6NA 1K8KA 3CMEI 4OLAA 3CJTB 3Q1JA 4M72A 3M54A 2P7VB 1CZAN 3AVLA 2M30A 4ZDLA 1HQEA 1VF9A 2ZSIB 3HFOA 2HHQA 1YRNB 3CCRQ 1UHWA 4A2UA 3D2FB 2RHXA 2W84A 3VF6A 2DD5A 4FTHA 1VQNT 2ELHA 3H08A 2E6ZA 1KU7A 2Y69H 1LW2A 2ZFWA 2A5YB 3GBGA 2LZ6B 3MN2A 2G8UA 4A5NA 1O9SA 4A5AA 5KN9A 3VQ6A 4HCCA 5SZTA 2F4IA 4DU4A 2RO0A 3NRVA 2DYRH 3CBPA 1NGCA 4L9VA 4K2EA 1K79A 1NGFA 2KIFA 5I21A 1QVFS 3MQ0A 1VSEA 3ITHA 1AVZC 2X6SA 2ZJ2A 1UECA 1KLNA 3W6VA 3F8BA 3P31A 3GTGJ 1WHMA 3FXRA 4LOCA 2EPDA 2O03A 2VVKA 4PJOC 3RTRA 3I35A 4DR2K 1CSKA 2XG8D 1LVAA 2A28A 2B5JA 1OH5A 2AQFA 4A3IJ 2EIMH 4FPBA 2R5ZA 2FZCB 5J6XA 4XH1A 5TKWA 4L8RB 3GTOJ 1RR8C 4KULA 4FM0A 2FC0A 2LNHB 5HDKA 1KAYA 6AT1B 2YLCA 2I5WA 1FPQA 5HL7L 1RAHB 3C4SA 2EZLA 2D0PA 3HYIA 3HOUJ 5FD6A 4OPHA 2O8KA 2Q0RA 3LAJA 5I2MA 5GMKl 3AG4H 2OD5A 1I07A 2HD0A 3O80A 2B8AA 5LJWA 1XWLA 1X2MA 2HXIA 4AHRA 3JSCA 1ABQA 4RW7A 3ISNC 3VGLA 3C2GA 3AVGA 2M0MA 3ZETA 3C3WA 1VSFA 4DU3A 5AQKA 4AM3A 3HRGA 5EOYA 2GNCA 3HK2A 1EH8A 1OH8A 4A3GJ 1T08B 3M0TA 3WTZA 5CVJA 2EH3A 2WV0A 3PO4A 1JT6A 5CKFA 3HOZJ 1WJQA 5AQTA 4CECA 2P9LB 5J40A 5F27A 1ETYA 5D5WB 2EGEA 2AZVA 1VQ4T 4XTXA 2FNPA 2ZAEA 3VTIA 4ZN3A 1QP3A 3ZSXA 4L9JA 1U84A 2Y4XA 1X75C 5ILSA 3CWUA 4PJOB 1TLHB 3CCVN 3M0RA 5EF6A 4BH9A 1Q82C 3RSEA 4LDXA 1XMKA 4B09A 1X1CA 2D8JA 5DCMA 2VKNA 5LJ5h 3MXIA 3ZRGA 1BGXT 5IT9E 3DLAA 3TSZA 1JJ2A 3THVA 4C8QG 3CDHA 4C92F 2HKOA 1YIJT 5AZJB 3NF7A 4HRIA 2F2EA 4A2AA 2CGJA 4X1EA 1NGEA 4YPRA 4NQWB 4B1WB 2P9LA 3W6JB 1ZLMA 5GTHC 4C8OA 4BRKA 4A3JJ 4CJUA 3JCMb 4PJNA 3HL8A 2OPPA 1I81A 4R0KA 1AA7A 4AFZC 2QGGA 5J4VA 3ULRB 2IGIA 2A08A 1M8MA 1JEGA 2PVDB 2DETA 2RJEA 3QEPA 4RCCA 1NG7A 3WTUC 4CEZA 3K2AA 3DLLF 1YITA 2E65A 5TISC 3ULEB 2MYSA 2YDLA 2RK2A 1ETVA 4IUPA 1Q7YU 3TDZC 3JREA 4BE0A 5F08A 2DJNA 2W82A 2QBYB 1HNVA 3PX4A 1QVUA 1YE9A 1DGKN 5D7UA 4EMKA 3AV9A 1J9AA 4WXHA 2RQPA 1UTIA 3QWYA 3S14J 4A3BJ 5BREA 5HNFA 1NK6A 2GFAA 4BDZA 5AZIA 4B1ZA 2P9NA 2JVHA 3O3HA 2R7OA 2PAVA 1ZHFA 3W2WA 1QP2A 3HRMA 3S1NJ 1VQMT 2H56A 1S1NA 3QPLA 1X4OA 1XSDA 2CSQA 4Z88A 1WX6A 1YJWI 3VEWA 3VEPA 1UGPB 2DO7A 5DUKA 4NXNK 2KRSA 1XTDA 1ZUYA 2IVNA 1VQ6N 1VQNN 2HU9A 4WE1A 4BRAA 4W97A 1XG1A 3R4KA 1GLLO 5L3EA 2OANA 2R7QA 2O4IA 2HL5C 5HODA 2M7AA 4LSLA 3L1PA 2F48A 4FSXA 2DOAA 1WUAA 4CGGA 4ZHRA 4QW2A 1R7JA 1M1EB 3B6AA 1Y7XA 2BHYA 3WTVC 5C0MA 1FT9A 3G71T 3MKDA 4C92C 4DV6K 1VQ5Q 2PUKB 1K4SA 4FLZA 3CFPA 1BL3A 1RBUA 5GIOA 2D6FA 1Q18A 2I10A 1BI3A 1W5TA 3O1WA 3LDOA 3EYZA 3J81O 3K1NA 2WAEA 1SG5A 4CUGA 2R7YA 2R57A 4DS4A 4M6YA 3F8CA 3K58A 1S72T 1X1PA 2VCPA 2P5GA 5KCOA 3H35A 5DM7R 1IXCA 1SKUB 4JI0K 1N9RA 2M4KA 1RI9A 3CCLA 4EZ9A 1JTYA 1YOVB 3LWHA 1W2BP 1N8RC 1DUXC 2DMPA 1ETQA 5GAMj 2L89A 4XLCA 3HOWJ 4LLNA 1ZA1B 5J1YA 2KQWA 4XU1A 2KYMA 1EFNA 2C6YA 3F22A 2I5JA 2BE9B 2JA6J 3MAQA 4OMOA 5H2FC 1MZBA 4X9CA 1VQPQ 3CC2N 2N8GA 2X51A 3DXKB 2FQ3A 2XRLA 3VEVA 2LY2A 2W10A 3OYDA 3S17J 4KUDK 3NMUA 1KU9A 1VQMA 1M3CA 1S9HA 4G6DA 2YX6A 5H6QA 3DLLL 1O4XA 4BHBA 2NOBA 4I7FA 1QTMA 2KHOA 3VSKA 2RF2A 2EV0A 2K3BA 4HLXA 2CUBA 2MI6A 3AAPA 3SBTA 9ATCB 3BG6A 1MD0A 1LVKA 4Y92A 1BQMA 2YU9J 1AOYA 1AHDP 3RVCA 1B8IB 1L5UA 5IWAK 4EJTA 1ORNA 3H8ZA 3I56A 4C5IA 3CJCA 4ZZLA 3ZBDA 4DBHA 1M1KU 4KPYA 1YHQA 1MMNA 3NTHA 4DUYK 3T3FA 2KVQG 4PKHA 2RH2A 1POGA 3ZSOA 5K1YA 1D5YA 2CFOA 3ULQB 2Z1IA 2RJFA 2QKKA 3GTJJ 2E88A 4XEIA 4K11A 1YJ9T 2ASPA 1MUYA 1IGQA 3REAB 2R58A 2HQNA 5GPCA 2DL5A 4OMNA 1BA0A 1KC8C 4OVAA 5FKMA 2M9UA 3FIFA 4DZPA 1KC8U 1NGHA 3FEOA 1C0GA 1VQOI 5EYRA 1FIAA 4M73A 3BC8A 3OB9A 5KYWB 4B22A 2G8KA 3REOA 1RAEB 2QENA 1B9FA 3PTAA 1JXSA 2YRDA 2YWWA 3DF8A 1FOXA 4MFBA 1JUSA 1WQ2A 4RTUA 2XICA 5EVZA 3J80O 2EBPA 1JGGA 1N34K 5D8LB 1UB9A 2NVYJ 2CH4A 2GXBA 3MXMA 3OHRA 1PG5B 2KROA 4XTVA 3CCET 4FU6A 2Q1ZB 1JXEA 3G3ZA 5KYXA 1U1TA 1GUUA 2HEQA 1Z05A 2DFEA 1BIZA 3TTDA 3G71I 3QNNA 3EAEA 2IOCA 4JBAA 4JNEA 1H641 5GAOl 4JZ4A 1ZBIA 2LDUA 4C5EA 4NXMK 5KCHA 1KQ8A 3CCMQ 2DRKA 5K14A 4KH6A 5D6YA 2MCNA 1RI0A 2P9UA 1SL1A 2JG6A 5EXWA 1Y56A 1Y0UA 3M0QA 4B3AA 3DV8A 2VXDA 1P9QC 3B6CA 1RBVA 4DWIA 4HHTA 9ANTA 4CHYA 1NKBA 3JCMh 4GV9A 2YHXA 4EHTA 3O9SA 2M3AA 3VQ7A 2TCTA 1GRIA 4E7LA 4Y3OA 4ZNXA 4E6RA 1FJLA 1HRHA 4MDBA 4JV5K 5LLQA 3ZMSA 4GVMA 3FBNB 4CZGA 1J2XA 1ZG5A 2L54A 3ZGKA 4UVCA 3O9TA 4CJ3A 2HWVA 1RTHA 5KAIC 1S9GA 1I27A 2X6OA 1WDXA 1BI2A 1KJWA 2DNUA 4LN2A 2FG0A 4DYRA 1KCFA 5JICA 2L3PA 1FZPB 3CCYA 3VYHB 1W70A 2F9TA 2ZCWA 1L0OC 2NWMA 3CWTA 2IS2A 2DOFA 4CYDA 3P38A 4I2OA 2ELKA 3L2UA 1NH3A 4Q4ZF 1V5EA 2WBMA 1SZ2A 3DU6A 4C1NK 1GXQA 5IYDJ 3RWUA 4KH1B 3IWZA 2HVRA 3WVEB 2EQUA 2DK8A 2QSGX 2HYJA 5AJ3K 3AGKA 5EX5A 3CESA 1ZLKA 2IS1A 1WHLA 3N05A 3M8FA 1R5HA 1WNLA 2EYZA 3TAEA 4BG8A 3BROA 3CC2Q 1XTAA 4GYGA 4LK1F 2LK2A 5HDGA 2E60A 4C2TA 4LK0F 3NFAA 2A3SA 3VYSB 4AYBN 4E70A 1GT0C 4A63B 3DKXA 2E34A 4K0KK 1LOJA 2MGQA 4QPOA 5EEAA 4J6WA 4HOBA 3WU0A 2CUDA 3BTCA 3ZMZA 2K2VA 3VFZA 1YP5A 4RKUE 1WLPB 5FU6C 3VOVA 3P8HA 2KRMA 4EMSA 3MEAA 5LJVA 1TUUA 4M7YA 3U4LA 2FX0A 4HTLA 3FXMA 3O8VA 3PQKA 1R00A 2F5TX 2BUPA 4J6YA 4Z4EA 2L3QA 2Z3YA 3HSFA 4DBFA 3PV8A 5CPRB 1PSEA 2JVGA 4LJZF 2ZXJA 3CCSA 1IN5A 3DLBA 2W03A 3P9KA 3EG1A 3QOEA 3MKYB 1JBMA 1ASWA 3B8AX 2SRCA 3H0GJ 1VQ4Q 3T8TA 4YFNF 1H8KA 5M1NA 1FKOA 1Z91A 1TQPA 1S1UA 1LDDA 5E17F 1EH7A 1RCHA 3DM2A 4FJ9A 5AQZA 5GAN5 1W1WE 4IRIA 3ZXSA 1HX1A 2JRMA 4A69C 3JRCA 5LMUK 1NKEA 1GCQC 5DPKA 1YCYA 4IXAA 2GIZA 3ABKH 4EM2A 2R7RA 4A3EJ 3K0SA 4DQQA 1GOBA 1VQKA 1YJ9N 2MG4A 2DA7A 4DSEA 4LD6A 1IH7A 5EGOB 1V5GA 1KD1O 3KP2A 4H0EA 3EG3A 4JK1X 3H0HA 1HKGA 2MWOA 4RWTA 3OY9A 4ZN1A 4Q48A 4MHGA 5BR8K 2E2NA 1ON1A 5FRMA 2DZCA 5B5EC 4K41A 3ID6A 4FJXA 3PM1A 4IHTA 2QZ8A 1M3HA 2RPNA 3M0PA 1B07A 1WGSA 2M34A 4FIBA 2R7TA 2XRNA 3SMPA 1V3FA 4ZTFA 3LSTA 3BZKA 3Q0UA 2C0OA 4IUVA 5FPDA 5IHKA 1RUOA 4JI8K 3L7WA 4LF6K 3MEGA 4QS8A 3E0JB 3E19A 3OH6A 2PEXA 2VJ4A 4JQFA 1ATNA 3OYLA 4JD2B 4B9MA 2JQ7A 3G4SA 2QCOA 2ME0A 4HF2A 2JWKA 1OH6A 5E84A 1VQNI 3K5MA 3ZEHA 2F2VA 3P8BB 2CMPA 1YF5L 3O8HA 3WHCA 1V55H 1CZ9A 3Q9VA 3TQ7P 5JLXA 4EIKA 1SMTA 2LQNA 1ATRA 1W0HA 3CF5L 1A5XA 3G73A 3JRHA 3ZPLA 2EFQA 2CP5A 1Z25A 4DTSA 1KA8A 4DYQA 3NTKA 1X19A 5AZIB 1I5OB 2D0BA 3QU3A 2PFUA 2OTLN 4RTTA 4XLAA 1T3LA 2LF7A 3HL2A 3I55I 2OZUA 5C15A 3QZ9B 3LSRA 4ISGA 2LYCA 3IS9A 1RTIA 3FFIA 2QI2A 5A2QZ 3TTFA 4A5BA 4O5VA 1GBRA 3PNWC 5L3BA 5JVGL 3V81A 1TL3A 1U6GA 3C7JA 3CPWM 1DEJA 2FBIA 3FWEA 3LGLA 4ELVA 3ZQQA 4B8AB 2QQAA 2H8RA 5JVTA 2XVCA 4E1NA 1IHVA 4RTFD 1TBXA 1KK7A 3A5NC 4FM4B 4CGZA 4M78G 4CC2A 3QP6A 3A5LC 1V54H 3SCXA 3LP1A 3AFHA 1YFNA 1EX4A 1SSHA 4BBSJ 2M7BA 2P0QA 3I55T 4EATA 2OTJQ 3SUQA 1CXQA 2VBWA 2AHQA 3V9UA 2LKSA 3QB0A 1OOTA 2J5OA 3HM9A 2Y9YA 1JKHA 3NH0A 1AOJA 1OCOH 4BGDA 3KLFA 4J9CA 3KD5E 3CPEA 3I3LA 2OCEA 4M7AC 4C2MJ 2NUPB 5CZ1A 2QEXQ 1HQUA 2YPRA 1DKGD 2P1JA 3MD2A 5FLXZ 3G2BA 2ZM6K 1Q95G 3LLRA 4EEFG 2OJED 4S0HB 1E6GA 4XH4A 4EA5A 2HHVA 3RKXA 3HZJA 2LVMA 5M5WJ 4HF0A 1S72N 4PWDA 2M8EA 2V7FA 2X85A 3CD6I 3A8MB 3NPFA 1VRTA 2K86A 3AY9A 3CM5A 1QPMA 4QVZA 3HVRA 1VSIA 2BHZA 1XHZA 3AARA 1FNNA 3ZLJA 2FB7A 3CJNA 2FNAA 1P6RA 5IXFA 1K73O 1DIZA 2Y0SN 5HS8A 4YPHA 4LG0A 1C0UA 3GOIA 3MWTA 2UUAK 1YAGA 4OPKA 1W6XA 3AO1A 2CP6A 4YFKF 1TG0A 1O3QA 1B72A 1C6VX 2O7OA 4E7HA 3KCCA 4AFQC 4XOTA 2P9KA 3DMJA 2BV6A 1IGUA 3QHSA 5IP6A 4CH7A 4A3DJ 4BJ5C 1Q81O 3N4PA 4AHUA 4KNYA 4DTPA 2OTJA 5BPNA 4LH4A 4RB2C 3ZMDA 4IOCL 1XC9A 4M7DG 1VK0A 3E6BA 4M6XA 1FTTA 4EHUA 1ZSZB 4C30A 3DRRA 1VQMQ 5CCAA 2DOEA 2AS5F 3EE8A 1IHWA 4CZFA 2ZMEC 1C1AA 5C10A 4A6EA 1Q7YO 2ESHA 2PJPA 3R61A 2DA2A 2MIOA 1R4NB 1JL2A 5A0GA 1K8KB 4FJHA 4RDUA 1BIBA 3H46O 2K9QA 1KG5A 3QEWA 4MEXF 4P1WA 3KLOA 3NGIA 1ZGJA 1W7AA 2EILH 4MDAA 1SKSA 1WJEA 1H3HA 3ALYA 1BDGA 3C2HA 2EA2A 3THWB 1S1XA 1I39A 3HRUA 1RUNA 1WZ2A 1B6AA 2UUBK 1B9NA 1YG2A 3HRSA 2XI9A 3R6SA 2W6LA 2QQRA 1EQYA 1TK8A 1CLQA 3TCJA 3CCEQ 3C7NB 2M51A 2DMNA 4H4OA 3CERA 3C7NA 1YBYA 3SHFA 2O88A 4HSBA 3IKMA 2V52B 4JS4A 2IS6A 1VQ9N 1KQ0A 1UFMA 4FYXB 1IB8A 3IRXA 2WAFA 4EM1A 2WSFE 4DV5K 4BL0B 1U47A 1IUFA 3DEEA 4EVIA 8ATCB 3T19A 3KBGA 1MA9B 4A4GA 2Y0SA 4C92D 1IV0A 1ZHIA