4BE0A

Pfv intasome with inhibitor xz-115
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be0A03
4CEZA 3VQ4A 4FLUA 1Y97A 4KPYA 1EETA 2HHTA 3QBYA 1LAVA 2IOCA 1U48A 2EQMA 1LWCA 2YHBA 2LDMA 5FRMA 5CYMA 4WE1A 3MEDA 3VQDA 3P8HA 4DS4A 4C5HA 1FK9A 3NFAA 4YNQA 2D9TA 3SD4A 4E1NA 3OA6A 5FROA 3HM9A 4O55A 4O0IA 2W42A 2EQJA 1ASUA 4KHSA 3FLGA 4MFBA 3DOKA 3WNEA 1U49A 2BUDA 2YNIA 3V1OA 4EP5A 3RMDA 1XHZA 5DK5A 3DB4A 2ITGA 1S1XA 4LD6A 4J2DA 4OGCA 3JSMA 1NJZA 1NK6A 2YRVA 1ZBFA 2L3RA 3DLKA 4IUUA 3V9ZA 4OVAA 4C8OA 4F3OA 3DLEA 2ETJA 3KKRA 5HRPA 1ZBIA 1TL1A 1QSYA 4CHOA 2GUIA 4I9QA 1NJYA 1XNIA 2D0AA 4C5EA 3E9GA 2HVHA 3DM2A 3HSTB 1ZBHA 4BD3A 2BE2A 4E3SA 2O4GA 5CY4A 2RI2A 1IKWA 5KRTA 3TABA 5J26A 2IG0A 3SZ2A 5J2NA 1RBRA 4AH9A 1S5JA 4F2RA 4ELTA 1W9HA 4N47A 4KKOA 2D0CA 3LX7A 1JLQA 1S9GA 1X9WA 4L59A 1FKOA 1TV6A 3DLMA 3I0SA 4ZTFA 5JS1A 4OPKA 4XIUA 1NOYA 1HPZA 1RT4A 5HRNA 3AO4A 3AVFA 3SUOA 4UQGA 4DF4A 4JS5A 1KRPA 4KHYA 4ZHRA 3A2FA 2JZ2A 4DTJA 3AVGA 3VA3A 3HPOA 4QAGA 4IFYA 2F8SA 4FJJA 3CFRA 3HPGA 3VQPA 5CYQA 4RG8A 3Q1JA 1SKRA 3KLHA 2GV9A 4CJLA 2XY7A 2K3XA 3RMBA 4AHUA 4HVJA 1J54A 1VSKA 2HNZA 4KFBA 2QK9A 1RDCA 3O4QA 4DFMA 1NK7A 3LWMA 4AHCA 1HRHA 1S6PA 4DU3A 1OZ2A 2RJEA 3H08A 4EZ9A 2Z1GA 1VRUA 4H4MA 2XY5A 4LD0A 3L3UA 2QXFA 1TK0A 2E5QA 3MEUA 1JLCA 4FLYA 3L2RA 1YT3A 2P51A 4K8ZA 1VSLA 1OYXA 1HQEA 2P5OA 2HNDA 3HO1A 1S1UA 4N41A 2M1HA 3KTQA 1WAJA 4QCLA 1RNHA 3OYDA 3AA5X 3F70A 4J2AA 3NH0A 3ZSWA 4B8AB 3ASMA 2G8VA 2RKIA 4PLLA 3KK2A 2YNGA 4QVZA 3TANA 1S6QA 1GOAA 1OZ3A 4HTUA 4CF0A 4DTRA 2BDPA 2OYQA 4CIFA 3AVKA 4PQUA 5C6SA 1WLJA 2JTFA 1CZBA 3MP1A 1NK8A 1GOBA 3QIOA 1JXEA 1NKBA 2OZMA 1CZ9A 4H4OA 5C25A 2M16A 4M42A 3QERA 3EAEA 4KREA 2YKMA 1J9AA 4ID5A 3TAEA 5HP1A 3ME9A 3HL8A 3OS2A 4CF9A 4RW6A 4NZGA 3IS9A 1S1TA 4BWJA 2RHIA 4IFVA 3AVLA 3HVRA 4OJRA 3T1AA 3PMTA 4CERA 3TWHA 2KQ2A 3KLGA 4B9TA 2HNYA 3THVA 4LY7A 4Z4HA 4C5IA 4DSIA 3DLGA 3O3FA 4IUVA 2ZE2A 4Q5VA 2F5KA 3FDRA 4RW8A 2X35A 3EZ5A 4CF8A 1RT1A 4RW4A 3QIPA 4FM0A 2WOMA 4E19A 3L2QA 3ULDA 4B9MA 1X1PA 1U04A 3LYIA 3OYBA 4OKKA 2B5JA 1Z25A 4CJ4A 3HK2A 4FLVA 4J2EA 3P1GA 4FJ5A 1VK0A 4I2PA 5HRRA 3QEXA 3NDKA 1HNIA 3OQ5A 4BE0A 4GVMA 3NGIA 4M3WA 5J2QA 1L3VA 1ZBLA 3FC3A 1C0UA 2ATQA 3I8DA 1C0TA 1J53A 1BGXT 1IG9A 4CECA 4NS5A 2O4XB 4CJKA 3KLFA 2G8FA 4E7LA 4JRQA 3KLEA 1D9DA 4N76A 2X78A 1C0MA 4F2SA 1LW2A 3LLRA 3VQ7A 2L8DA 3AO2A 4DTMA 3P5JA 1VSJA 3P8DA 2Y1JA 1RTJA 2DIGA 3AVMA 4Z4FA 4M3XA 1RDDA 3LH0A 3LP1A 1SL1A 3RTVA 4DU4A 3ISNC 4JLHA 3AVHA 2KFNA 2R5AA 3NTKA 3CYMA 1T05A 4CRIA 3WNGA 2L89A 5IN1A 3ZT0A 1RTHA 2HQXA 3VQ5A 5E41A 2IC3A 4DSFA 3PO4A 4PLIA 4II1A 4DTSA 1LW0A 3WNFA 4KRFA 1DTQA 2FBTA 3S9HA 2OPSA 2DTUA 1JL1A 1TKDA 2G8WA 4BE1A 4ELUA 3E9FA 4E89A 4QOZB 1S9EA 2RHUA 1TK8A 4NYFA 2MWOA 3D45A 1L3SA 3AV9A 4BDYA 1WSEA 1BISA 3AO3A 2LCCA 3VQ9A 3P83D 2IAJA 1X9SA 1TAUA 3SV4A 1T03A 2O4XA 1FXXA 2OA8A 1A5XA 1GOCA 3K5OA 4CEEA 2QKBA 1H3ZA 4FLXA 4KI4A 3DB3A 3MP8A 3S3OA 4QQ6A 3OY9A 3O3GA 2KTQA 1EX4A 3CFPA 4CJ5A 3CM6A 4FU6A 1NK4A 1LWFA 3F9KA 2JGUA 2DFFA 4B9VA 1SUQA 4PUOA 2NUBA 3OYLA 2HHUA 4FLTA 3AA4A 3RWUA 3AVIA 3SUPA 4HUFA 4FYDA 4CEFA 3PX0A 3NF7A 3NNQA 4FLZA 2HVIA 3U3YA 1RT6A 1WN7A 2A1RA 4HUGA 3VQBA 3PV8A 4OVLA 3M8PA 4BACA 3L2WA 1WAFA 4W5OA 2P5GA 3ZSVA 4CE9A 4NYNA 3QLHA 3RRHA 4LH4A 1RT7A 1RTIA 2M0OA 1T8EA 4N56A 4EP4A 4ICLA 1Q9XA 4M41A 3OMCA 4PWDA 4C8NA 1REVA 2RI5A 4B9SA 4RW7A 4DTUA 1SV5A 2KZMA 1JLBA 4QW2A 4KTWA 1XC9A 1UAXA 2VG5A 3CEYA 4GW6A 1JLEA 2AJQA 1MHNA 2G8UA 4Z4EA 2HW3A 3LALA 1L3TA 3RR7A 1TGOA 1WSFA 4DTOA 4CIEA 2X6NA 4CK1A 2P1JA 2XDPA 3E01A 4IDKA 2RHXA 4FJ9A 2IS3A 1HYSA 4M3ZA 1BCOA 1VSDA 3C6TA 4KHQA 5K14A 4DWIA 3HP6A 4MQ3A 4IG3A 5KI6A 3DLBA 4B8CA 3QIIA 3HJFA 3CG7A 4I7FA 3V81A 4Z4GA 4A4FA 3BGRA 3OYFA 3EYZA 3MEEA 1G5VA 1RT2A 4H8KA 2GF7A 3QNNA 1NK0A 3K58A 3TAMA 2PZSA 1QSSA 3NGYA 3PY8A 1G15A 3D0PA 3META 4RG2A 2LSNA 3LPUA 2ZD1A 4DSKA 2XY6A 1BHLA 1JKHA 3HPHA 3H6ZA 3C95A 3OMGA 4IURA 4A4GA 4CFBA 4CFAA 2F96A 4FJ7A 1C1BA 4DMNA 3QEWA 3OYHA 3BDLA 1BI4A 5FDLA 3NAEA 4C5GA 3KUFA 2R5MA 1HYVA 3PX4A 4FZZA 3LAMA 2BIVA 3OS1A 1Q8IA 1WJRA 1KVAA 3SNNA 2HMIA 2G8HA 4FJHA 4CGIA 3LWLA 1VSHA 3DRPA 4C8LA 1D5AA 4FK4A 2PY5A 3DRSA 3NF6A 4FW1A 1NJXA 3M9QA 3L3VA 3OYJA 4E1MA 3S6WA 4HCZA 2VG7A 1KTQA 1KLNA 2XK0A 3AO1A 5JS2A 4W5RA 2XY8A 1IO2A 1D8YA 2LRQA 3V9WA 1W0HA 4CJQA 3HXMA 1KFSA 3IRXA 3ZSQA 1QTMA 1NKCA 5C42A 2YKNA 2D0BA 3VN5A 4CHYA 3IG1A 4CJWA 4B3OA 3SQ1A 3BDPA 3NH2A 4JS4A 5CIUA 4KB1A 2BANA 3SYZA 4CJUA 4JRPA 4AHTA 2EKOA 3ZSOA 4IUPA 1LWEA 3VQCA 1OI1A 1ZYQA 4GMJB 1R0AA 4KTQA 3K2PA 1HJRA 3LDSA 4G1QA 4FZYA 3MP6A 4Z02A 1ITGA 1RCHA 2E4LA 3K5NA 2OPQA 3SQ2A 3S3NA 4CFCA 3KIOA 1ZBUA 2B8AA 3SI6A 4HCCA 3DYAA 2RN2A 3DRRA 2WACA 3ZCMA 2HHXA 4FJ8A 3HVTA 2EQKA 3U3GA 1NJWA 4B9UA 1BCMA 2R7YA 4E7JA 4OPJA 3AA3A 2EQUA 2D5RA 4FJLA 3OYIA 1B9FA 3NGZA 1FKPA 4FVMA 1TL3A 4FW2A 4DSLA 4B9LA 4BE2A 3SV3A 3TARA 4KB0A 4CHQA 3OB9A 3MXMA 3OYAA 3QO9A 1BQNA 3MXIA 2X4YA 3M8QA 5KE2A 3OVNA 3ZSXA 3KKSA 3TAQA 1XWLA 2R57A 3OJSA 3VQAA 4PL6A 3S3MA 1U4BA 4FK0A 1KCFA 2X6SA 5HLFA 4LSLA 1JLGA 3L2VA 1CLQA 2YNHA 3JYTA 5KTQA 2RHYA 3MEVA 4QQDA 3LZJA 1N6QA 1UA0A 2G8IA 3QEPA 3MEGA 3L42A 3KD1E 2X4WA 3HYFA 3O3HA 4J2BA 1RBTA 4GY5A 2E6MA 3MAQA 3AVJA 2B6AA 3K57A 2BKDN 2EX3A 4DQQA 4OLAA 1EP4A 3RMAA 2DFHA 3PNWC 4FJGA 3ZSYA 2PYLA 5EU7A 4AHRA 1IKVA 3PX6A 4C8KA 3ASKA 3C6UA 3IAYA 4DQRA 2YV0X 3KK3A 4HCBA 3LAKA 4DFKA 4IBNA 1HMVA 3NF9A 4IUTA 2Q3SA 3SCXA 1JLFA 2DIQA 3F73A 4FJXA 3K5LA 4EZ6A 1NOZA 1DLOA 3QEIA 1QSLA 4IKFA 3SJJA 3I0RA 1VSFA 4FK2A 3UT1A 2E6LA 4DF8A 3SPZA 3V9SA 1WJQA 4B08A 3OJUA 3LGLA 5HROA 4KHUA 4Q0BA 2Y1IA 3K5MA 4CJRA 4NCBA 3LP3A 4DFPA 3NTHA 4UC4A 3B6OA 1SL0A 4O4GA 3NCIA 3O8VA 4O0JA 1KHCA 1KVBA 4N5SA 1UA1A 4N4HA 2KW4A 1RT3A 3QNOA 4CJSA 4QQGA 4KI6A 4CCHA 2OZSA 3LP2A 4NCGA 1QS4A 4M45A 3QJ6A 4DQSA 4DG1A 5CZ1A 1BIUA 4YFUA 4CHPA 4DQIA 4FJIA 5KH6A 4C8MA 1U47A 3AVNA 4CEAA 3H8ZA 2KZZA 3M8RA 4Z4IA 1F21A 3G10A 1L5UA 3DI6A 3NHGA 3TAPA 1BQMA 2G8KA 2RJCA 1A5WA 5SWMA 3SQ0A 4X34A 1CXUA 1XHXA 2FC0A 3QESA 3DOLA 4O5BA 3NH1A 1JL2A 3OYEA 4KAZA 4DS5A 4Y1DA 2X4XA 3O4NA 1HYZA 4OGEA 5FRNA 1QQCA 3KJVA 5CZ2A 4FJMA 2GFAA 4CJ3A 3G0ZA 1BI4B 3CM5A 4FL6A 1TKTA 4A4EA 3CFOA 4B9XA 4CJPA 4RW9A 1VSIA 1LV5A 1C1AA 4E7IA 1WGSA 5KCOA 3QINA 4I9LA 3L2UA 3NF8A 3MXJA 1SSFA 3OYKA 3MEWA 2X74A 3VQEA 4KHNA 2GBZA 4DU1A 2QQRA 2E6NA 3KD5E 1QE1A 3DLRA 3V9XA 3FFIA 3AVAA 1HNVA 3L8BA 1VRTA 3SUNA 4CEDA 3TAFA 1IH7A 5I42A 1KFDA 2XHBA 2GFUA 5J2PA 3AO5A 4F8RA 4DLEA 5KGXA 3VA0A 3LZIA 4IUQA 4IG0A 3RR8A 4CJEA 2R58A 1RBUA 2HHVA 2BGGA 3NBPA 5I3UA 4BDZA 2QQSA 2PYJA 2G3RA 3RMCA 2VWKA 4CESA 1JXBA 1BIZA 4O44A 4OLBA 4M3RA 2RI3A 4CIGA 1N5YA 1X9MA 2NLUA 4CGJA 3AVCA 4CF1A 4KHWA 1WSJA 3AVBA 1RBVA 3LP0A 5DMRA 4Q5WA 4DLGA 5HBMA 2CKKA 1HQUA 1YVUA 2WONA 4LSNA 3OYGA 2KFZA 2FBVA 1WSIA 3SQ4A 4PA1A 4CHZA 3B6PA 3MO8A 3VQQA 4E0DA 1ASVA 1LAWA 1Z26A 2OPRA 3TR8A 3NTIA 4PY5A 1I3AA 1N27A 3GOXA 3ZSRA 1A5VA 4B9NA 1RDBA 3C94A 3RRGA 4Z0UA 3ZT3A 4M3TA 2LTOA 4CGFA 1K6YA 4DTXA 1IKYA 4EDUA 2VWJA 1BL3A 1WSHA 4AILC 3QETA 2HHWA 2YHAA 1EKEA 4OKJA 1DTTA 4CK2A 4CF2A 3OYMA 3ZT2A 3LANA 3PUFA 4CEBA 4DSEA 3TI0A 4AHSA 5J1EA 4W5NA 4FM1A 2XRIA 4DSJA 1UOCA 4LH5A 4A4HA 3OYCA 2JLEA 1WSGA 3M8SA 3SPYA 2VYTA 5C24A 1ASWA 2RPIA 3V1RA 4BDPA 4F4KA 4B9WA 3PO5A 1XI1A 5J2MA 5SZTA 1KLMA 3ZEHA 2RF2A 1TK5A 1TVRA 1SL2A 3AA2A 1D9FA 3OYNA 3ZT1A 2FBXA 3ZSZA 1C1CA 4CGGA 1NKEA 1UWBA 4KO0A 2K3YA 4ELVA 1WNSA 4CEQA 4BWMA 1I39A 3UIQA 1QHTA 3SUQA 4W5TA 3K59A 4R5PA 4OKEA 3T3FA 3V1QA 4KTZA 3V9UA 1RI0A 2RO0A 3KLIA 2O4IA 3VQ8A 2EFIA 5KCHA 4TSXA 1O1WA 2LVMA 4FLWA 4FXDA 2A1SA 1RBSA 4DFJA 3LGFA 3LPTA 2FBYA 5HRSA 2IGIA 4FCYA 3ITHA 3PMIA 2HQEA 5KRSA 3CQ8A 2I5JA 4W5QA 4DQPA 3WNHA 1YTAA 3MECA 1JLAA 5C0MA 2HHSA 3DMJA 4I2QA 5M9OA 4FJKA 4ZTJA 3FEOA 1B92A 1RDAA 1IKXA 4L8RB 2FHDA 5IAYA 1C6VA 4CEOA 2ZQBA 2VG6A 5D3GA 4DTNA 2Z1HA 4E7HA 1U45A 2HHQA 2F8TA 1T7PA 1MU2A 3V6DA 3QEVA 2DFEA 4FM2A 4CJTA 2DAQA 4CFDA 2OPPA 4FJNA 1J5OA 3PFSA 1S1VA 3QKJA 1RILA 1TKXA 2Z1IA 4CGDA 3V4IA 4NCAA 3ALYA 4CJFA 4N4GA 4KV8A 4CK3A 5KGWA 5D6YA 1SKSA 3C4SA 2HB5A 1WJSA 2XO7A 5T7BA 3VQ6A 2P0KA 4HHTA 3T19A 4M3YA 2DY4A 2B4JA 1NK5A 1VSMA 1CXQA 1B9DA 4AHVA 2RHZA 1VSEA 4M3UA 3OS0A 2QKKA 4E7KA 1NK9A 4CJVA 3NE6A 2PQWA 4CHNA 1RTDA 1KVCA 1EXQA 4F3TA 1TKZA 1TAQA 5D6XA 2RJFA 3DLHA 5J39A 3ZT4A 4Z4CA 2RJDA 2YNFA 1YTUA 4N4IA 3U6FA 1L3UA 4ID1A 1RT5A 3TAGA 4HUEA 5D6WA 5KE3A 4FZXC 3HP9A 3EY1A 2IDOA 1S1WA 4DTPA 2EHGA 2MWPA 4K8XA 3HT3A 2Z1JA 1Q9YA 4Y1CA 1SKWA 1KSPA 3UWNA 3MEAA 4CGHA 3KK1A
chains in the Genus database with same CATH superfamily
4NC6A 1RZ4A 4II3A 1ZHIA 4RAFA 4Q48A 4PL8A 1XSVA 5F6FA 4U0YA 2ZSIB 3A8HB 2GAUA 4AD9A 1VQLQ 1VQPN 5GADJ 1LWCA 3MN2A 2HKXA 1YJNI 4NL3A 4UB8C 2DOAA 5FRMA 4AFUC 4NXNK 1DU6A 2OJ2A 5I21A 5EG0B 2COYA 5FLXK 1BIAA 4MZMA 5ADXA 5K5QA 5AFUH 4AUXA 3P8HA 1R0CB 4C5HA 3MCZA 2HQHA 5I11A 1FK9A 3DU5A 1K9MU 1W7PA 2IVPA 1K8AO 1ENHA 4E1NA 1U1TA 3T5XA 4PJOC 1ASUA 5AQKA 1IGUA 2CQNA 1N77A 2YNIA 2DOFA 4HT8A 2Y0SN 3RMDA 4EGYA 1ZR4A 2CUEA 4DYCA 1SS6A 3EGXB 2FBIA 1GCPA 3RVCA 3CP8A 3PIOF 1RABB 3IL2A 2X1DA 3BJAA 3TTDA 2AXTC 4BRDA 1IXSB 2KR3A 3EZWA 1LMZA 1VQ7T 3VGLA 1NK6A 4HVVA 3Q0WA 5H6QA 4FT2A 3RMQA 4LNPA 2P0QA 2F2XA 2KZVA 1W97L 3DLKA 2CQXA 2FMYA 4IUUA 5M1QA 3QYHB 2R7VA 2XMFA 4OVAA 2DO7A 3H9GA 4C8OA 4NQWA 4DR5K 2QGUA 3UA6A 3PLAA 3A98A 4YDUC 2OANA 1BWFO 2X4JA 2YDLA 3VS3A 3OV8A 1QSYA 3K2AA 2LFBA 1KU9A 1IV0A 1USSA 5C10A 4FETA 1SAZA 4XLCA 3QDKA 3ZPLA 3MMVA 4F04B 1FMVA 2XU8A 5LJ5f 3J7AF 3WT0A 2HVHA 2NOJB 1VQNQ 2GNCA 4ZGJB 2BE2A 2ZJRF 1D09B 2EFPA 2JHNA 3BZCA 2O4GA 2HMAA 5CY4A 1IKWA 3BPXA 3AL0B 1YIOA 4CSWA 3SZ2A 2VQHA 4ON0A 3FB9A 3CCMA 1RBRA 2LX9A 2Z1DA 3E9LA 4ELTA 1ATNA 2Y75A 2ZFWA 1WCMJ 1IN6A 4KKOA 4UNFA 3LX7A 1S9GA 1TQPA 2EFQA 3SEMA 4JK9A 3HJEA 1XMAA 4JJBA 1ZTRA 1X1AA 1XTAA 2RNAA 1HPZA 2BTTA 2W40A 3R3LA 3WTUC 2NNNA 5J4YA 3CCMI 3VA3A 3U9DA 5AQWA 2F8SA 3GNFB 2W6LA 2UXDK 1QVPA 2CDTA 2FF6A 3WE3A 3VQPA 2NOIA 4CICA 4X66K 4HNTA 3ISPA 3SAFA 3E1SA 3CCJQ 3K4CA 2PI0A 3RQ4A 3KLHA 3EYIA 1KO9A 1B34A 3OBYA 4M77G 2K9MA 4J9DA 4HVJA 1VSKA 3U21A 3FKIJ 2NRXA 2Y48A 4KFBA 4BNCA 3CC4T 2K4JA 4HTLA 3O4QA 5ILUA 1RKTA 3EKSA 3A0IX 5CO7A 1NK7A 2KRCA 2XDBA 3QPLA 2CP0A 3ZLJA 1S6PA 2R5YA 4PDKA 3QP6A 2MK5A 2RJEA 1YQMA 4BRPA 2O8KA 2YI1A 5D8LB 3DLLF 2RQWA 5J1YA 4JBAA 2E5QA 2KRMA 4CC4B 3I33A 4JRIA 3L2RA 2P51A 3GTPJ 1K4SA 1R5ID 1H1VA 1ON2A 3AG2H 3L4QA 2KP6A 4FT8A 4Y13A 2PMHA 3T1YK 4AIJA 2QQBA 4OINF 4EJUA 2M1HA 3KTQA 4QCLA 2L02A 2VV5A 1VQMA 2V1NA 2GELA 4PLLA 3EH2A 3G1OA 2ZPBB 1FBSA 2AO9A 4HTUA 5I22A 4DTRA 5J3BA 3OL4A 1V5EA 3M3ZA 4PQUA 5C6SA 2QGGA 3RI4A 1WLJA 3PO3J 4XL9A 2OTLN 4RB0A 3IWZA 4K43A 5GAOr 3JR9A 3OIOA 1BOBA 4JX6A 2LC4A 2CV0A 1JXSA 2X6XA 1NU0A 2FE3A 4RTWA 1VQMI 4NBQA 4H4OA 2DA5A 2VJIA 4LK0F 3G6ET 3CC2Q 2LBFA 1X4OA 4XTYA 3BOQA 2GCXA 2AQFA 5EEAA 3TAEA 1TUCA 2EZKA 5EX5A 3AY9A 5FWBA 1VQ9Q 2KY9A 4JKBA 1ETKA 3R60A 2BZTA 3OWTA 3ZN0A 4IZZA 2ZNYA 2RHIA 1OYYA 4O3MA 3HVRA 2XF5A 4DBRA 1NZ9A 1BBZA 3T1AA 1I4K1 2HYGD 3TWHA 3PSFA 3CCEN 2O8EB 4JJCA 4LY7A 3TOBA 3AAFA 2LNBA 4BHPA 1Y56A 3VRZA 2DEQA 3EE9A 5CQGA 1ORNA 2DLPA 1IUFA 4WFNL 1NKUA 3FDRA 2NVQJ 3F9MA 4FPAA 2RC4A 3EZ5A 2E1MB 4CF8A 3BG7A 1AT1B 2RN7A 3G71Q 1KIKA 1LCUA 3L2QA 1S72Q 5JICA 2NOBA 2CMPA 2DLLA 1RI7A 1TWBA 3LYIA 5H2FC 4E70A 1BC8C 1PKTA 4CJ4A 4FLVA 9ATCB 1D1AA 1N34K 1XGSA 4F17A 2FOKA 1VK0A 2HVRA 3OQ5A 4GVMA 3NGIA 3Q7CA 1C6VX 5LJVA 4N4NB 5HDGA 3CCLQ 2UWMA 1REPC 2O8FB 3D2EB 4GYGA 3CCSN 1VQMT 5AQUA 2RQTA 2MLKA 3JRDA 1VQOT 2WTUA 1GXQA 5AZIB 1LDKB 1MGQA 4NS5A 2M9HA 4CJKA 3KLFA 1SSHA 2L01A 4DQ2A 1Z67A 2DETA 5FW9A 3OL3A 4MFEA 3RJPA 2H27A 3DF8A 3UKRA 1LW2A 1WQWA 3LLRA 1CKBA 3FZHA 2DPNA 1MBKA 3AO2A 2Z5UA 1VSJA 1FWZA 2Y1JA 1EH7A 1ZG5A 2E5ZA 3LH0A 3FXMA 1SL1A 2IGKA 1JI8A 3CXCP 1VQKQ 1LEBA 3NVMA 3PIPL 2HYFA 5E18F 2YLCA 5LJ3e 1MV3A 3D7SB 3DKYA 3AHUA 3CF5L 4ELYC 3BR1A 1AWJA 3N4PA 1W7PB 1X3MA 4DUZK 3MWPA 1P59A 4II1A 1XDUA 1LW0A 4BH9A 2O8XA 2KT0A 4B3AA 1HW5A 1YIJQ 2D45A 4KRFA 2DJIA 5GAMg 4XBFA 1DTQA 3FZLA 2FBTA 1IV8A 4O6JA 5JLFA 4HA8A 1BDGA 4CA0A 2G8WA 5ADXH 3ONQA 1KYWA 3BR2A 1O3TA 4UXNA 4ILJA 1Q95G 1NGCA 1NPRA 3M57A 1WNLA 1TK8A 1L3SA 4BDYA 1WSEA 1RGIA 2CQQA 3VQ9A 2A61A 4IWVA 5H6RA 3P83D 2IAJA 2QWLA 4BS9A 1E4FT 5EZHA 3CD6N 2NLXA 1YI2A 3DKWA 2XGCA 4XNFA 3MMYB 1J5YA 2OA8A 4BG8A 4LFAK 1H3ZA 4FLXA 3S1MJ 4YY3K 3DB3A 2EIFA 5F1RA 3GO5A 3TMOA 1QCOA 1KD1O 3HG9A 1EX4A 4IHSA 2DJNA 3CM6A 3IH2A 1VZ0A 5D8KB 2DODA 3V7SA 1APLC 4FU6A 1NK4A 1LWFA 4M6VA 1RKWA 2MABA 2DFFA 4B9VA 1SUQA 1FSEA 1UEBA 2QEXN 2NUZA 1MNDA 2DXTA 2VQEK 2RMOA 2A6HF 2MFZA 1YI2I 4A3CJ 1K73O 3ID8A 2CRGA 4QPQA 2X4HA 4Z8AA 2EK5A 3CXCS 1GLNA 4DV4K 3E66A 4FIBA 4FYDA 2IP2A 3EDPA 1B4AA 2KQRA 1YHQQ 3AFHA 5FB2A 4G94A 4PJJA 2HXIA 3MHXA 2NVXJ 1FOYA 3NF7A 1E0EA 1ZSZA 1RT6A 1WN7A 4HUGA 1QNTA 1MGTA 1O13A 4OVLA 2Z3YA 2CT4A 4NC7A 2WSFE 4IO8A 4XOPA 4CE9A 2AZSA 4NYNA 1F1BB 2A5XA 3G1JA 4LH4A 1RT7A 1T8EA 1Q7YO 1YWOA 4E9HA 2OCCH 2JRMA 4NC8A 1N9RA 4L6V5 3OMCA 1OYIA 1JUPA 2HBMA 4JI3K 1REVA 1KAZA 3H0IA 4XKWA 2DERA 1GXPA 3T0YA 4DTUA 1M1KO 3OR1C 1JCEA 2CYZB 2VG5A 2OU2A 4PFPA 2F5DA 2G8UA 2F69A 4A69C 1Y1WJ 4FX0A 4FWMA 1K83J 2MC3A 3OOUA 4H0TB 1RIOH 4K42A 5GAOp 2WV1A 2IIRA 5GAMe 2DA2A 4MQVA 1A04A 1OCTC 2GOXB 4H5TA 4EMGA 1LWVA 3F22A 1Q82O 3SAHA 3THKA 2R5YB 2ZJQF 5KI6A 3OR2C 3DLBA 2QSHX 3VTHA 1BJZA 1O4XA 1UG1A 5AZJA 1PYVA 3CG7A 2GZWA 4Z4GA 4LK1F 1R23A 3ZQQA 3HRTA 4E9EA 1G5VA 1RT2A 5KCMA 2GF7A 4D7MA 5CE3A 1ZXOA 2CS3A 1B72A 2PZSA 4BC5A 1TYQA 1PM3A 3WTXC 1OCOH 3KVGA 4U7BA 2F2VA 4KFCA 2FSJA 4EA5A 5FPNA 4BG9A 4X9CA 5DM6L 4IO9F 1B59A 3HPHA 3H6ZA 3A5MC 1X1BA 2V26A 1LQ1A 4IURA 3URGA 2NRWA 2P7VB 5J1RA 2YX6A 1T0FA 4CD1A 3KZIC 4CFBA 3AG3H 2HHHK 4CFAA 1NPPA 4JN4A 3LA3A 5M1FA 3DJCA 4FJ7A 3NQOA 4OMLA 2HMPA 4YFXF 2ELHA 3QEWA 1IBMK 1BI4A 2EFWA 2DMNA 3IQLA 2R5MA 2FNPA 3PX4A 1KYZA 4OFHA 1JJ2P 2TCTA 1KJWA 1QWEA 3H1CA 3WE2A 5CHZA 4I6ZA 2GOMA 1U2VB 1Q8IA 1WJRA 2E1HA 4CGIA 1WH5A 2E12A 3J8AA 1IUYA 3LWLA 2JRTA 4E6RA 1VSHA 4CHUA 2D1XA 3W3CA 4LFBK 4OWRB 2EPDA 2NAZA 1FYLA 2M8EA 1XQSC 2PTKA 4I2OA 2JTVA 2DXCA 3TW6A 3OYJA 1TUDA 3M8FA 5ICCA 5E26A 3RDVA 1KLNA 1XPXA 1RI9A 1EQYA 2IAIA 3GFIA 3EUHC 1RACB 1E4GT 4D8DA 2LQNA 5CJ9A 4W5RA 4A3IJ 1UMQA 1M90O 2XGDA 2COWA 2OZUA 1IXRC 3V9WA 4ESBA 3HXMA 1U84A 1MBJA 3N0UA 2NNWA 3SDBA 3DBLB 3G73A 3ZSQA 3VODA 3QUIA 2WAQN 3H3ZA 2Y90A 2JK3A 3G3ZA 1PD1A 1E3OC 4CJWA 2C6YA 2CH4W 4M3FA 5J8FA 3FE1A 2BY1A 4BKXA 5KPZA 4KB1A 5ED4A 3L2CA 2MAMA 5BPDA 4E7ZA 4AHTA 1WZ2A 2BV6A 3LL3A 4Q47A 1T38A 5C2FA 3LSIA 1LWEA 3CMEQ 4GMJB 3K2PA 3AAPA 2XVCA 2J6FA 2VBXA 1I6HJ 2KMTA 1JJ2S 1RCHA 4M4ZA 1TH7A 3K5NA 1WJAA 4IRGA 1W7PD 3KIOA 4TV7A 1BW6A 2HKNA 2B8AA 4LLNA 3DYAA 2WACA 3CCQN 1T6DA 5CVUA 3NPFA 3HVTA 2EQKA 3UKRB 1HKSA 4YOUA 2OV7A 2OX7A 3HOWJ 5JMVA 1BCMA 1BK2A 2E64A 2KRFA 3BUZB 1OV3A 3ZFJA 3CMAT 4JEPA 3DBRB 2RV8A 1I50J 3MN7A 4FJLA 2VJJA 3NGZA 4F7UA 3EQLF 4Z88A 4FVMA 4A3KJ 4OFAA 4UUTA 5GAN4 1MUZA 5LRRA 1U5TA 1VI0A 3F8NA 3OIQA 3QYBA 4IIOA 1HKGA 1YJ9A 4XSZF 4MGRA 1LB2A 2NWMA 2X4YA 2GXBA 3ZSXA 2HXOA 3OJSA 1O3SA 1U2WA 1NLOC 2FBKA 3S3MA 5BRFA 4FK0A 3CC7Q 2R7QA 5HLFA 4I01A 2OZ6A 3CCVN 3COAC 4QS7A 3I5SA 3JYTA 3H3UA 4XKVA 1I5OB 1N36K 4GV3A 2R3SA 2UXXA 3ENOA 5KTQA 4M9XA 1U3EM 4B21A 3MEVA 1YJ9I 2NS0A 1LE8A 1UA0A 1PDNC 5L3GA 2HNIA 4GXOA 2GBQA 4BAYA 2KSSA 2ZNZA 2G9WA 3G4SQ 2KBTA 3MKZA 4PJMA 3P31A 2A3SA 3KD1E 2R7OA 3I3LA 1BI0A 1QHAA 1FIPA 1RBTA 3CCRT 1N33K 1EF4A 2CV1A 3J80O 2KGTA 4GY5A 1UGQB 1R4MB 2TDXA 4B48A 2HZTA 3BY6A 4I0BA 3UA7A 5IT9O 4XM3A 3GNGA 2B6AA 4C3HJ 2BKDN 1M8MA 3MD2A 2EX3A 1YG2A 1G3TA 1M30A 2DMOA 3PNWC 1NG7A 1IGQA 2ED0A 2CUDA 3K1MA 1J3TA 1XS9A 4AHRA 2D8JA 1QQOA 2DA3A 1ZSZB 2K5IA 3FFKB 1VQ8N 2L7KA 3PX6A 3ASKA 3TSPA 5FU7B 2AK5A 3C6UA 2O61A 3KK3A 1HW1A 3LAKA 3RCOA 3JCMc 1HMVA 2FEIA 2GQQA 4IBNA 2NOEA 4IUTA 4H03B 1R5HA 4IDHA 4C92A 3QO3A 2XF7A 2XB5A 5E3MA 3THYA 3WTYC 2O01E 1DLOA 4IKFA 3M59A 5F1JA 3R1XA 4QVDA 4M7AB 5LJ5g 2F5FA 3SPZA 2DN0A 3SQNA 4OMFB 3WVDB 2L9VA 3OJUA 3G25A 4C0ZA 4CI0C 1D3BA 4KHUA 3HEFA 4XU1A 2DL5A 2KRNA 1YJ9T 2Y1IA 2IGOA 1FOKA 4DFPA 3NTHA 4D0PA 4ZYDA 1GLBG 4UC4A 1YE9A 1UZCA 4KDPA 3B6OA 3CERA 2Y0MA 3NCIA 4LB6B 1JJ6C 1BR1A 1Y8RB 2HKOA 1KHCA 4ZDPA 1KVBA 2P6SA 2ZXWH 1BB9A 4A93J 1FJGK 1JGSA 2VGNA 5EY4A 3QNOA 3DXKA 2WWYA 4IRHA 3F6OA 2OZSA 2BY0A 3GEZA 4M45A 3QJ6A 4DQSA 2E3IA 1RR8C 1WEIA 2DT7B 1UHCA 5JHUA 1BOTO 4K25A 2EYQA 1PRLC 4L5IA 2R7ZJ 5H20A 1D0XA 1LPLA 4OB2B 1Z05A 3E5QA 4OMOA 4L9JA 3FRNA 3HGYA 1GBRA 2KZZA 3M8RA 2WBMA 1EWRA 2DDAA 2E20A 4PJLA 3JRBA 4Y91A 4IQ4A 4OF1A 2E2JJ 1X2KA 3EG0A 1WI7A 5SWMA 3I55N 3SQ0A 1NLPC 2CH5A 4ZNXA 4X62K 4XQ3A 1XHXA 1MUNA 1T2KA 3K4KA 3OYEA 4Y1DA 2O8CA 2ZFUA 1VQ6N 1HYZA 3GZ5A 1QRYA 2ASMA 5FRNA 2JZYA 3HSEA 4LF9K 3JAMK 2JWKA 2RNGA 4I0AA 2A69F 3DV8A 4HNVA 2KEAA 3G0ZA 2OF7A 1Z9CA 2MIOA 1BI4B 3CM5A 2PQ8A 1K0XA 1TKTA 2DVEA 4BC4A 2LX7A 3ZR8X 2F48A 2KXDA 4RW9A 4E7IA 3QPHA 1J0RA 2IS1A 2V79A 2EPFA 5ELZA 1IB8A 4M77C 4F9OA 1ZBSA 1XNRK 2DK3A 3CO7C 1IN4A 2Z99A 4CBUA 4GKJK 3OYKA 1YUWA 2V1RA 4BUPA 2X74A 1W5TA 2EZIA 4KBOA 3HBTA 4XU2A 2QQRA 1X1CA 1VQ5A 3GFLA 1T44A 3LWFA 4BY6B 1IXCA 5A0GA 1HNVA 1MNMC 3L8BA 4P5NA 1WHLA 4BB7A 6PAXA 3TAFA 4JLGA 3AO5A 3Q9SA 3D4VA 2Q2EB 3BT9A 3LZIA 3J7YJ 3GYHX 5DY9A 4CJEA 2YHTA 2FXUA 1TWGJ 2ZMEA 3DU6A 2R58A 2MMPA 2HHVA 1KQ0A 3RSEA 1EBMA 1BUPA 1DP3A 1U6ZA 3HBLA 4BDZA 3CWSA 5IOZA 4M75A 1MJAA 1X69A 2GWKA 1VQ5I 2VWKA 2V9PA 4R1HA 2XPWA 4M3RA 2DBMA 3WXJA 1BI1A 2CH4A 1QP2A 1X9MA 2HDCA 3TO7A 4CGJA 4CF1A 4KHWA 1EV7A 2EYZA 3BC8A 2DO3A 2X48A 4DLGA 4LXCA 2NRHA 4IX7A 4A3FJ 2CKKA 4KH1B 4BQLA 2V7FA 5AQOA 2OC6A 2EH3A 3LA7A 2KISA 3SMPA 5AQGA 3J81Z 3H0HA 4RB3C 2YG9A 4C92G 5IOYA 3G7ZA 4RMOA 3K4LA 4NDLA 4PY5A 3QODA 5CVIA 4LDUA 5IP6A 1YNZA 3R0JA 4IHXA 4IF4A 1RDBA 4H5RA 3P9IA 3LM2A 3JXUA 1QQIA 3DPUA 3JAME 1XD7A 1E7OA 3I56A 3KXTA 4QSHA 1N9SA 4IOAL 2IGMA 3FK6A 5TKWA 4F7UB 1ERDA 4MEXF 4XORA 3LANA 2BHYA 3BPVA 4RB1A 4CEBA 1SAUA 3UNGC 3VSKA 2RN8A 2E2IJ 1G3YA 2FSWA 2ASOA 1F1ZA 4LH5A 4MNUA 3IKVA 4U67L 3J7ZI 5CAIA 3E1YA 2E2HJ 3GMEA 2K2VA 3JCMf 4AG2C 1UELB 3BJOA 5AT1B 4BDPA 3HZ6A 1M4ZA 3I56I 1DGWY 4AVPA 2X6YA 5HS9A 1BL0A 5B66C 1XI1A 2NOHA 3K0LA 1PCXA 3I64A 3DEUA 1L3LA 5A2QZ 2XKOA 3LSPA 3A4CA 1OCRH 2JPSA 2Y9ZA 3ZEHA 2RF2A 4ZGEB 1JE8A 2VCPA 4HDVA 3EETA 5MLCQ 1JJ2M 3O9QA 1XSDA 1XQHA 4BEHA 2FO0A 2NOLA 3VS7A 4V2FA 2DVJA 3ZT1A 2DK5A 4M78G 3CJCA 2OTJA 5BRDA 1KGSA 4KUIA 2ECCA 1I39A 1VQ4A 1QHTA 3SUQA 2O9LA 4OKEA 2ZPFB 4OIOF 3FWEA 3WU0A 1TG0A 5I9EB 1BOAA 3FXKA 5FO5A 1BYMA 1MMNA 1T33A 4HLYA 3Q3SA 4KN7X 4MMKA 3TSZA 4J8FA 1KC8O 4F7UE 1MMDA 3I59A 3SBTA 1ZUUA 1IXDA 5KCHA 2ME0A 2L9SA 5HS7A 3HHGA 3I54A 4FXDA 2IEKA 1RBSA 3BCBA 2FBYA 2Y4XA 2IGIA 3ITHA 3PMIA 2GEMA 5KRSA 3KPHA 1VQ4I 3CQ8A 2NYXA 4GRIA 3LFUA 2CUJA 3WNHA 5C0MA 3DMJA 2X1EA 3TEEA 4ZTJA 4BC3A 3CUQB 3L9FA 2PFUA 4O8UA 2I7PA 4MZPA 1C6VA 4CEOA 2F5TX 2DF6A 1FYKA 2VG6A 4PJOA 5FGMA 3ZP5A 3THYB 1ESVA 1TC3C 3K69A 1TP4A 4XTVA 4OAYA 1VQPT 4C1NI 3W6KB 2F8TA 3I55Q 3P38A 2W25A 7AT1B 4F52A 4HWIA 2K79A 4NNJA 1ILYA 1NJIU 3QEVA 1ODDA 1QVFP 2DFEA 4B3XA 1N8RU 4FM2A 4C8QG 3L6QA 4CFDA 1ETWA 2IS4A 1X1DA 3CCMN 2R7RA 1ETYA 3OH9A 3OW2P 1VQ6Q 1J5OA 2LY9A 3JRZA 3LSGA 3X2QH 3PFSA 4F7UF 2QA4A 1TKXA 4JAXA 1I5ZA 1BIBA 3KCCA 4M75G 3BFMA 1HA8A 1Q81U 1YRNB 2K5CA 1UE9A 3HSFA 5KGWA 4JPBW 3CQTA 4YDUA 4DR1K 3C4SA 3EG2A 1WJSA 2VOOA 3DTKA 3SAGA 4JI4K 2DY4A 2COZA 3L1AA 4H0PA 1NK5A 4GO1A 1CXQA 5TJJA 2F5EA 4CYCB 3BG5A 3FM5A 2QKKA 1NK9A 3TDZC 3NE6A 2QA4I 1X4PA 5EC7A 5DUKA 2O9VA 1RTDA 4MIMA 1VQ4T 2NYSA 1TKZA 3F8BA 1U9NA 3ZQLA 4XLHA 1YJWT 4Z4CA 3K0SA 1WH7A 3NARA 4LMYA 2EWSA 2Q31A 4J5YA 3ZQ7A 3AKZA 5KHDA 4ELZC 3GG4A 1S7EA 5LHGA 4CUGA 2G0EA 5KE3A 2HF4A 4FZXC 3CF5F 3HP9A 4C23A 4A5NA 3TO9A 4DTPA 1VA7A 5E1ZB 3HT3A 1RETA 3HRGA 3GWZA 2M4KA 3IH3A 4Y1CA 4B4CA 3RDIA 3MEAA 2Q1NA 2VUBA 2FVUA 3A8GB 3VQ4A 4FLUA 5TISC 4A0XA 4DR2K 5IT3A 1Y8QB 3O8MA 5DM7F 1QVFS 1IBKK 2HHTA 1LAVA 3A8YA 2L0KA 2IOCA 3OW2S 1LDDA 2P6TA 4OMNA 2PBIA 5F2RA 1KU2A 4BJ5C 4AG1C 4CBWA 2LDMA 4KICA 1I6XA 3LM9A 1YAGA 4FQGA 1ZQ3P 3LNQA 2FBHA 2A7YA 2R5ZB 1VQMN 1JKRC 2VONA 2QBYA 1R1VA 1FC3A 2GA2A 1VQ7Q 4RTXA 4P9UA 3M53A 4C92F 3OA6A 3A2KA 4JP0A 4O0IA 2FEZA 2H6CA 2EB7A 1ON1A 1DJ7B 2D5VA 4KH0B 2KE9A 2HOAA 2EBPA 1U49A 5GANj 2VKNA 3C7NA 1NMDA 4KN4X 1AOJA 3SEZA 4LF8K 5JVHL 1P4XA 5DK5A 5GAMd 2OCEA 2HL3A 1W2BS 1NJIR 2ITGA 4C0DB 1N8RR 4LD6A 2ZMEB 4QS8A 1FBQA 1B9NA 1TUGB 3RSEB 1WBDA 1BM9A 2RH2A 1N25A 3ULEA 3QFUA 1NJZA 1N6AA 4KRTA 3RKXA 4L5EA 2OA4A 2KKZA 4PNOA 1QVGS 2L3RA 4GLMA 3HM8A 1YOVB 3NEUA 3A8OB 2DKGA 2CQKA 4FYVB 2QWNA 3TW7A 3QYEA 3SJMA 3UPUA 5EF6A 2CJJA 4UY8O 3TQ7P 4CHOA 2YS9A 1HSJA 4I9QA 1ZBJA 1JT6A 3PNVA 2D0AA 1TNSA 4AIHA 5J1UA 5GAEP 1IRGA 4G9ZA 2P9KA 1LKXA 1NK3P 1I8FA 3MFKA 2VBZA 3HKSA 3S1RJ 4E3SA 2RI2A 2VUMJ 1CF7B 5J26A 2WB1A 4HXJA 3K9KA 1PSFA 4AH9A 4RAZA 1S5JA 3NFCA 1ETOA 5C0YA 2D0CA 2NOFA 2XRLA 2QUFA 2EKHA 3J7AO 1M1GA 3VGMA 4EW4A 1FKOA 2IW5A 1BI3A 1GT0C 3WXIA 3QHSA 2OTLT 3X20B 4OPKA 2SEMA 4XIUA 1NOYA 5FLXZ 3IC7A 2Q0OA 3CC4Q 4LIVA 1RT4A 1TU0B 4BVPA 1HR0K 3T8TA 3JREA 3AO4A 3E6DA 1JXMA 4M75E 5JI6A 4JS5A 1KRPA 4P5OA 5K5OA 1Y0UA 3HM5A 4DTJA 3L7WA 3HPOA 4IFYA 3C1DA 4M7DC 2BH1A 4FWQA 1I1GA 1UGVA 2NZTA 4FJJA 1UTIA 3CFRA 3M4YA 4RG8A 5HKCA 2LMDA 2FQ3A 4L18B 1XB4A 4RA2A 2CREA 3RMBA 1J54A 4C1NK 4XAXB 2LCSA 2JN6A 1TNTA 2QK9A 2VC1A 3IHUA 4IQJA 4MTEA 2CP2A 1RDCA 2H8HA 3N05A 3CCET 4YEJA 2CZ1B 4HV6A 4BEHB 3LWMA 2MBFA 3SZPA 2K6DA 2ESNA 1W6XA 3C0BA 1OZ2A 3PJRA 2DW4A 1MBFA 1E3MA 1VRUA 3M1EA 2XY5A 4LD0A 5F0CA 1I1SA 3L3UA 3CCUA 2HOSA 1YX3A 1TK0A 1Q86O 3IAM2 3GLLA 2ID3A 4EGZA 3GZNB 1U1SA 1JLCA 1OQKA 4PKCC 3RIRA 5E17F 1VF9A 2HQNA 5AQPA 4JKCA 4E6KG 1OYXA 4M75F 3FXLA 2C06A 2P5VA 4C92D 1S1UA 3I59B 2RKHA 1WAJA 4RGSA 3JRGA 5EG2A 3OYDA 2V4JC 4ANJA 3F70A 2V6CA 4A6DA 2DM1A 1G3WA 1YI2N 3ASMA 4AM6A 2G8VA 1QPIA 2YNGA 3DCFA 3O6BB 4QVZA 3G6EQ 1F4KA 3CCUI 3CCST 1Z0XA 2F4IA 4CF0A 5BR8K 2LY1A 4BY1J 3O08A 1RUOA 3FR0A 2YJFA 4JD2A 3AVKA 3ABLH 4YHHK 2WUSA 5FLXO 3SZTA 5GMKj 3MP1A 3VEYA 2W0ZA 1J09A 1T39A 2WSEE 3M0QA 1GOBA 2LCLA 4PJOB 5JVTA 2JA7J 2E5NA 2HBLA 1ZREA 2CH0A 2AQEA 2ELJA 1WPKA 3QERA 1X3UA 3M0TA 3GX4X 1ZA1B 2X6OA 3OS2A 3D5RC 1YITA 1PU8A 4RW6A 4NZGA 4K2EA 4DNCA 3IS9A 4V2SA 4QLCU 3O3KA 1FJLA 1EO1A 3AVLA 3DXJF 4MLOA 3THXA 2A68F 1ETQA 3KLGA 4B9TA 4CO8A 1YYVA 2DD4A 3THVA 1I94K 2VQFK 1A31A 2DZCA 2DQLA 4DSIA 2UV1A 3HOVJ 2ZE2A 5BNGA 1T6SA 4RW8A 5DCFA 2ISZA 5KN9A 2BZXA 3TSWA 3QIPA 2WOMA 3ULDA 1YITI 1T8IA 1VQOQ 3QOPA 2QKMB 1X1PA 3JRAA 1P7IA 3CD6T 2M1BA 1U04A 3BE3A 5EJCA 3M8JA 4AFZC 4OKKA 2HL5C 1MBHA 1Z25A 1YS7A 1CGPA 2CZ7B 1YXQA 3CQXA 4Y3OA 4J2EA 3WHCA 3FM3A 4FJ5A 4PJOE 4I2PA 3GP8A 3NDKA 3MQ0A 5AQNA 4BE0A 4GYIA 4M3WA 5J2QA 3DTEA 2EW3A 5B1AH 3VW4A 3VEWA 2H94A 2ATQA 3I8DA 3SHFA 5AN4A 3M0RA 1SRLA 4HQEA 1BGXT 3LSKA 2QEXT 2VKDA 2XDVA 1YX5A 4RKUE 1Z6TA 1H8AC 4E7LA 3ULRB 3GBQA 4JRQA 2H3JA 2L3SA 2HQRA 3ABMH 4F91B 4B22A 1VQLA 1RAFB 1LNWA 3KLEA 1D9DA 4WF2A 2JJ7A 4JYAK 4HVUA 2ZPEB 3NAUA 3WGHA 4DTMA 3ERMA 3P5JA 5LJ3f 4YORA 4JOMA 1HPMA 4JKEA 4FYXB 2DIGA 3AVMA 1P7JA 5FD5A 4DU4A 2W10A 4C8QD 1FP2A 4JLHA 5IP9J 1Z77A 2KFNA 3NTKA 1T05A 4CRIA 5IN1A 1RAGB 1WWXA 4PJNA 5E41A 2COMA 3CPWM 2K7AA 3BQYA 1KG1A 1MWKA 4DSFA 4B3TK 2KIMA 1V3FA 5K7FA 1YITT 4PJOF 4M75D 4XRSA 1VQLI 3CLQA 2H6BA 3LDPA 1XMXA 4G7ZF 2CWEA 2HZYA 2DTUA 3SYTA 1TKDA 1P8ZA 4I99C 3E9FA 5EZGA 5LEJA 1JGGA 5M1PA 4HQMA 4CH7A 3D45A 2VJ4A 3CDHA 3AV9A 1K9MO 3EKUA 2HBWA 4MLHA 5DUIA 3EFOB 1WEFA 2WY7Q 4M3BA 1IDYA 2NUPA 3FZMA 3M58A 3QFPA 1X9SA 4AFQC 4YOYA 1MKMA 2O4XA 5GAHJ 2B63J 1MUYA 1FXXA 3ATUA 3Q7BA 1A5XA 4A0ZA 4CZKA 3RQIA 4IL6C 4RCHA 3M0PA 1K9AA 3D2FB 2PLYA 2E70A 2JMAA 3EHQA 5TGTA 3JRHA 1KZHA 1YN8A 3CFPA 2VB6A 4JI7K 2EGAA 3DEEA 3G2BA 4GGGA 4A57A 2P0PA 2M0MA 1U9OA 2VBWA 4RLFA 1VQNA 2W04A 1U5TC 3A1PA 1QCFA 5IYCJ 1Y64A 5EXWA 4FLTA 4ZZDA 2P9KB 2E71A 3IDHA 3RWUA 1W5SA 3AVIA 3SUPA 1SQKA 1KSWA 3PX0A 4RCCA 3BTJA 2JVHA 2J6OA 3NNQA 4FLZA 1G8XA 3CPEA 2A1RA 2L7FP 2ENMA 3OA9A 4L9TA 1QZZA 1P92A 2NUTA 3K1PA 1IHVA 2LQ8A 1R5GA 2NOGA 3M8PA 1W2BM 5ICEA 1H9GA 1OU8A 2P5GA 2CW0F 2P9UA 3KP3A 2JXBA 1VQNI 5HS8A 1J59A 3QLHA 3RRHA 3HTUA 4XTZA 3A0HC 4M41A 5IY5H 4A54A 1U06A 2RI5A 4WXCA 1QVGM 3VB2A 2EYYA 1P7MA 3SLCA 2F4OB 2COBA 1XC9A 3O9SA 3KZYA 3Q0VA 3N4MA 3S1NJ 2RB6A 3H41A 3VESA 4OMQA 5LJ5d 1F5TA 3ZN1A 2F9WA 4BRFA 2A6AA 1T0JA 3EUHA 3CCJA 3TOAA 5HNFA 1DGKN 4Y7NJ 5GAMf 4IEIA 4Z4EA 2HW3A 1T6CA 1TGOA 2CSQA 1WSFA 2E1MC 3HOXJ 1BA1A 3FZFA 4CK1A 4UUSA 2P1JA 4IDKA 1YFHA 1HDDC 2W24A 3H9QA 1HYSA 4OMZA 2FPFA 3GW2A 1GHCA 5K14A 4DWIA 2IS6A 2ISYA 6AT1B 3DLAA 1YJ9N 2V8IA 2CZ0B 3G1MA 3CCJI 3V81A 1J6ZA 2L9NA 3EYZA 4C92C 3MEEA 4H8KA 3P9CA 2K9SA 3KP4A 2XGXA 2RQUA 3PO2J 1U0JA 2KDZA 1PU6A 3D0PA 1ZX6A 3LPUA 3CQZJ 4PJOD 1M8VA 4DSKA 3UF4A 1PVSA 5CQXA 3VENA 3H6EA 1JBMA 2O88A 5IHKA 3BG9A 4XOTA 3LDLA 1JKQC 2O3FA 1KQSS 4JD2B 2GA1A 1JHHA 3LSJA 1V4SA 4J9CA 4EM2A 3D0SA 1RUWA 4FT4A 3CPWA 2DL7A 3TL4X 3BDLA 2YX4A 4KGXB 4BRQA 3CCQT 3W3DA 3I0TA 3J7AP 4C5GA 3ZGKA 5HNHA 3H36A 3KUFA 2QWOA 1YFNA 1NH3A 1GLLO 3CC2A 5DV5A 4FZZA 2KYBA 3LAMA 3IH7A 1R4NB 5LHHA 1VQ9A 3A02A 3EGUA 5FPEA 2QDYB 3SNNA 4J6WA 3RERA 3ZEUB 4FJHA 1T98A 4JJNK 4X65K 3CI5A 3T8RA 2FSKA 4C30A 5GANe 1D5AA 1V4RA 1IN8A 4M78C 2BUPA 2NS8A 2PY5A 3THXB 4XRMA 3DRSA 3NF6A 2DTIA 2AIRB 3BTCA 4YFKF 3CC2I 3S6WA 4JI2K 2GQIA 3GBGA 5GANh 2YRCA 1KTQA 5KYXA 4NHJA 2R7TA 3PUBA 3G71A 3CDLA 1S72A 1VQ9I 3WTTC 3CQYA 4H5WA 5JS2A 5LRSA 3CCVT 2XY8A 4IJNA 4L9VA 1Y7XA 2P5KA 3QG1A 1B3QA 3M4OJ 1KFSA 3RYRA 3IRXA 2I10A 2CSIA 1U3OA 4CCJA 2FSNA 4WCGA 4XQFA 4GDFA 3DXMA 3HL2A 2YKNA 5I2MA 4CHYA 2QWWA 1I07A 2IT0A 3BDPA 3SDGA 1OH8A 4IOAF 1XCVA 3CCLA 3CJ7A 3TTCA 1WJBA 3FMSA 2ADUA 5FKMA 3G71I 2H8RA 9ANTA 5EGOA 1S72I 2LJ0A 2QENA 3CMAQ 3ELKA 1KQ1A 3GUDA 5D7UA 1P4AA 3VQCA 3R61A 4KTQA 4B43A 3MP6A 2YSRA 3VYGA 1G99A 2X0LA 2MD5A 3ZL7C 3SQ2A 2A3ZA 5AQTA 3S3NA 4CFCA 2L0AA 4NXMK 2BE7D 3FK7A 1A36A 2F2WA 3RMSA 4C8QC 1QVGA 1QA6A 2QWRA 5K1YA 1TWCJ 1VQ8T 4EA4A 2IPOB 4B9UA 3CCLI 2ROTA 2P81A 4R8HA 5GP9A 1VQKA 1YW7A 4E7JA 1WB9A 3MN9A 1R77A 5GAGP 3RZDJ 2L4MA 5GPAA 5ILSA 1R8OB 3OYIA 3ZYYX 3QRFF 2K3PA 3RKQA 4RTFD 1FKPA 5E84A 4BI3A 2X9HA 1O75A 3A5NC 2BTFA 1TL3A 4DSLA 2FLOA 3TPQA 1R49A 4BE2A 4DW6A 1E17A 1NGJA 1YIJA 2M0CA 1UHMA 3SV3A 3TARA 2ETHA 1VTNC 2ZGZA 3SFMA 3H3NO 3CJTB 3ZX0A 3MXMA 1WZOA 5KVRA 3OYAA 4I6MA 5GTIC 3QO9A 1F36A 4MLEA 1VUBA 1A6IA 4A4KA 1SD4A 2O5RA 2B86A 1VQKI 4N0AC 4FL9A 3H0DA 3TAQA 3CCRQ 1FTZA 3VQAA 4PL6A 4I98B 1Y39A 1T08B 2LNHB 1HNXK 1KCFA 2JA2A 2HOEA 3KFWX 4MQ9F 1ZBXA 3UKUA 1MMAA 1RESA 2YWWA 3LAPA 1N3AA 4WQ4C 2YUQA 3KK7A 4EM1A 1TZLA 3MCAB 1YIJI 5EYRA 5HDKA 1AHDP 2RHYA 1LEAA 4DBHA 4TVRA 1N6QA 1VQ5N 2G8IA 5CVRA 3L1PA 2W1OA 2DMTA 2OFKA 3QOEA 4FWKA 2ZZDA 3W2WA 4XTXA 2IA0A 3HB9A 3WTVC 2P4TA 3WG7H 2D0OA 3O9RA 4J2BA 2KHMA 2C0OA 3EG3A 3M07A 1IJJA 2DEUA 1SMTA 4DKWA 1SHGA 3MAQA 2HNHA 1WJEA 3I4PA 2XSDC 2MG4A 1M1FA 1H8KA 1VOMA 2HTSA 2JT1A 2RD1A 3P7NA 3K57A 4AM3A 1YHQA 3K9JA 2FU4A 2ABKA 5IYBJ 5B5EC 3PTAA 1NLVA 3RMAA 2YLBA 2PYLA 1WFXA 3FXUA 4IHVA 1Q18A 5EU7A 2VL8A 1TLHB 1SEUA 3BROA 1ATSA 1C0GA 4M77A 1YJ9Q 2F5CA 1WHHA 3RESA 2XIGA 2RE2A 3IAYA 2D0QB 2DMQA 2NUTB 4ESFA 5GMKe 5M5WJ 4FISA 3UDCA 2XKPA 1JLFA 1UHSA 2XI9A 2JSPA 3F73A 5A0DA 4EW0A 2BOLA 2LOOA 1YHQI 4EZ6A 5EDNA 1NOZA 4P55A 3SJJA 3I0RA 2JTEA 2QSGX 2R7SA 4DF8A 4LG0A 4B08A 4L5GA 2CGHA 3F8MA 2OD5A 5HROA 1YQKA 3EG9B 2F6CA 3JRFA 2FD5A 3K5MA 2BZYA 1JT0A 2RK2A 3LP3A 4LF4K 4JK7A 4O4GA 3O8VA 1NGNA 3I56N 4O0JA 4Y92A 1WHGA 1NYGA 4OMYA 3JCMP 3R6SA 2VLAA 2LZ6B 3PIOL 1USTA 2KW4A 3OIPA 1E2XA 2E2PA 5J3LA 1X43A 4KI6A 4XSXF 4J6XA 2KAFA 5E3OA 3UB5A 1J7KA 3L09A 4AFSC 2HKQB 1NHAA 3NMZC 1VHXA 5A0LA 2DPUA 5CZ1A 1A0NB 1LNXA 4YFUA 2DZ9A 1QZYA 2A36A 3BF1A 2XPUA 4BR7A 2ZGWA 4FJIA 5KH6A 4LLLA 2EBIA 4S0HB 4C8MA 4JK1X 1GRIA 1U47A 1XGOA 3AVNA 4H5NA 1HCRA 2QTVA 5FU6B 3E0JB 1L5UA 3ZCOA 3WTSC 2RQRA 3EG1A 5DS9A 1RAIB 1A5WA 2JA5J 2KVQG 5BPIA 5GAOm 4X34A 2HSPA 3JB9J 1MPGA 1CXUA 2FC0A 3DOLA 4O5BA 2FX0A 2ZJRL 4GCVA 2R92J 1W0TA 2X4XA 5CKHA 2QQ9A 1HXDA 3QDFA 4AI4A 2CFXA 3ML6A 1QQCA 1J75A 3VWBA 1VQ4N 2LH9A 3L0QA 1K8AC 1YJWN 3O1BA 2J06A 4OX9K 3ZQGA 5IPAA 2G7UA 2DYRH 4A4EA 3EUKL 1ZK8A 4B9XA 4EATA 3VFZA 2L2OA 2HCKA 1KK7A 2M02A 5KCOA 5AONA 1IZ6A 1YLFA 1YJNT 4ILHA 4A5BA 2JS0A 2W84A 1AOYA 1OPKA 3EE8A 2WTEA 3VQEA 2AHQA 3VS5A 2GBZA 2E6NA 3K70C 3V7CA 4HF0A 1QE1A 1PUFA 3FHFA 1STZA 4HAMA 4XU0A 3EN9A 1VFCA 5AQJA 5HODA 3RKWA 3MAJA 4CEDA 1SD5A 1WXUA 4LDYA 4CVNE 2XHBA 2Q0UA 3U4LA 1BBYA 4F8RA 1HJDA 3VA0A 2CGJA 5KYXB 4IUQA 2GWJA 3KNTA 4S05A 2PU9B 3I9QA 2BVLA 5LMNK 3EEQA 1S9HA 1FMWA 5ILVA 1JRIA 1KQSM 3QAHA 5I3UA 2CGLA 2QQSA 2G3RA 2GTDA 2O8DA 3HXLA 2B9SA 3RMCA 4CESA 3OH6A 4ZGDB 2GXGA 1I27A 1DEJA 1BIZA 4OLBA 2XUBA 2QA4N 3A03A 1N5YA 4M3GA 2NLUA 1R6RA 1WSJA 3VS1A 2HDWA 4MFDA 4Q5WA 4QT7A 5HBMA 2M30A 4A5MA 3CMEA 5EGOB 2EGEA 1B7TA 2Y9YA 1K9MR 1WLPB 2L3DA 3HSRA 4H0OA 4J9HA 2HR3A 1HKBA 3KP2A 1XCBA 3BTLA 2ZPGB 5M5YJ 3LW5E 4UB6C 3QPTA 3KETA 5GJWB 2DOEA 4CHZA 1TXQA 2I2LA 1PC0A 5GAN6 1ASVA 3VUZA 2XSJC 4MDXA 3NTIA 1QW1A 2HPMA 4DZPA 2QXLA 4OPAA 1BU6O 4OB3B 2JJ9A 1HLVA 3PM1A 4CI6A 4G7OF 1ZSGA 2VN2A 2LRDA 4KHPK 3P8BB 3SJHA 3RRGA 3BLYA 4M7AC 3ZT3A 2QWQA 1K6YA 1IKYA 3IH4A 3KHYA 2ELKA 4JX4A 3CMEI 2VYPA 2ZKZA 1X2NA 4DGWB 4BYYA 2H56A 1EIFA 1WSHA 2E1ZA 5GMKi 1VIEA 2HHWA 2YHAA 3QMLA 3F0CA 1EKEA 3FXOA 2ZM6K 3M1FA 4CK2A 3ZX2A 3PVLA 3OYMA 1ITYA 3RZOJ 3ZT2A 1NNEA 2Q97A 5IHIA 2V1UA 1PP7U 4HKEA 1O3QA 3H46O 5J1EA 5GAOn 3C65A 1IRZA 5E3LA 4DSJA 2LMJA 5BOXA 4A4HA 2W41A 2JLEA 4I6MB 1HW2A 4JKGB 2KXCA 3SPYA 1MJ9A 3JV3A 2GTOA 4A3DJ 4WCIA 3V1RA 1T56A 3CC7A 4F4KA 4M71A 3CCMT 4HYEA 1HOMA 1P90A 4KITB 1PKSA 3IMXA 5LJ3g 2RQVA 1I81A 1N78A 2E1OA 2VC8A 1ZKGA 3ZMZA 3R6MA 1LUJB 1TK5A 1SL2A 3E5XA 1FYNA 2NXNB 5TRDA 4BHCA 3QYFA 3G4SA 2ITMA 3OYNA 1SD7A 3HHTB 2HF3A 2FBXA 2O8BB 3EGDA 4Y15A 2L7MP 1NKEA 3S32A 2GX9A 2K3YA 2PVGB 4FPBA 3CC7I 1N5ZA 4CEQA 2I7NA 3J7AY 5JR3A 3UIQA 1ZGAA 2BW3B 3N5NX 3HKZA 3BR5A 4EV0A 3V1QA 5CHIA 3MKDA 3JSPA 3DP7A 1P6RA 4IOCF 2UYTA 5KAIC 3V9UA 3S2WA 2ED1A 3JAMO 1ZQ1A 3H92A 2K5LA 1RI0A 1XN7A 2RO0A 3KLIA 1VQPQ 4PJ0C 2DRKA 2V8KA 3G4SI 2LVMA 1QP3A 2ZSHB 2IVNA 2DMPA 2A1SA 3QZ9B 5C2DA 1IHWA 3KYCB 1ZG1A 3UE5A 2A28A 3LPTA 1K0SA 3RUXA 2VASA 1GDTA 3FHGA 3LDQA 3M5RA 3VV0A 4M77B 2KMUA 1BR2A 2HQEA 4KMFA 2I5JA 2JWTA 4DQPA 3MECA 1JLAA 3MPUB 2HHSA 4NO7A 4FJKA 2OAUA 1B92A 1RDAA 5GJVB 1IKXA 3ZXSA 2E5LK 1PJRA 1X27A 1FN7A 1WBBA 4DJAA 3HHHA 2XRNA 1U45A 2HHQA 4JV5K 2E65A 1T7PA 1QBJA 3CBMA 3F21A 2RM4A 2H8WA 2DAQA 2WB1N 5M1NA 1Z3YA 3PNYA 2GGRA 3EH1A 2DT6A 3LCNA 4LD9K 1RL2A 4M9ZA 2NS7A 1S1VA 2V9VA 1KQSA 4XIDA 4CGDA 1VQ4Q 3ZX3A 2MH2A 2PUOB 2H3GX 4H0VB 5DCMA 1YJWQ 1GLFO 4DV0K 2FZKB 3ALYA 4KV8A 4O5VA 3TU5A 2A42A 4CK3A 2DXBA 5D6YA 1GLCG 1DP7P 5JVGF 1W36D 4OIQF 1QMCA 2E4HA 4CC7A 2HB5A 1UECA 5HLIA 4Y0WA 4J01A 1SFKA 3K10A 4EM0B 2STTA 4FSVA 4CBXA 5CYVA 2B4JA 2PVDB 3FLCO 3TP3A 3JCMW 5IHNA 1B9DA 4AHVA 3IP4B 2RNJA 2RHZA 4HBLA 3RTRA 4M77E 1B07A 2ZBKA 4B09A 1JKOC 4F3TA 4W1UA 1TAQA 4FO0A 1PUEE 2PEXA 1HBXG 4KT0E 2M0YA 3ZT4A 2YNFA 1YCYA 3U6FA 1L3UA 4HW0A 2DJQA 4HUEA 2YU9J 5D6WA 3INZA 3IWFA 3U1DA 4XEIA 1XC3A 3C6AA 3EY1A 1S1WA 2EHGA 1QQNA 2E8AA 2XG8D 1EH6A 1YW9A 3KE2A 1XNQK 3CCUN 2E6ZA 3UWNA 4OMMA 3CMMA 2E2QA 3KK1A 4L5JA 1NM7A 1Y97A 4D1QA 4BR0A 4KPYA 4EMHA 1GBQA 4RB2C 5GAN3 4NQWB 1SVLA 4B1RA 3WTWC 2W6KA 4PKHA 3MKWB 5JLWA 2EYXA 2EQMA 1RC9A 3ZETA 4M7DA 2G7HA 1YP5A 4JYKA 4A5AA 5CYMA 3TVTA 4M77F 4WE1A 3MEDA 3VQDA 2CH6A 4DS4A 1BW5A 4YNQA 2D9TA 2LREA 3SD4A 1NGBA 4RUGA 3NWSA 5FROA 4BRCA 4MO4A 4BC2A 4DQ8A 4G9YA 3HM9A 4O55A 1PUFB 2W42A 5LLQA 3FLGA 2YHWA 3DOKA 3WNEA 1S8NA 1W7AA 2BUDA 3TTFA 2HWVA 2VXEA 1GLDG 1K61A 1TW3A 3E5UA 4HDUA 3JCMV 2XB0X 3N4QA 4NB5A 3E2UA 2XDDA 1S1XA 2QWPA 1KD1C 2HGCA 3J81K 2IS2A 3VS4A 8AT1B 1V4TA 2C0IA 4JJDA 3JSMA 4IEEA 2YRVA 2O8DB 1D1CA 4NLCA 1ZBFA 5AFUA 3M6GA 1UAAA 1YITN 2E19A 3V9ZA 4PCQA 1K73C 2LDUA 3JB9I 1LCKA 1T3VA 1XG7A 4BY9C 2KJBA 1D0ZA 2WY8Q 1YQLA 3DLEA 2O03A 2ETJA 4JHDA 5D5WB 1NWKA 3OYYA 3ECOA 1ZBIA 1KG3A 4DYRA 1TL1A 3O4WA 4Y17A 1T0HA 1KG5A 4IXAA 1B34B 3BR3A 1NJYA 1XNIA 3CCYA 3FZKA 4C5EA 4IO9L 2OTLQ 1BI2A 3DM2A 3HSTB 1Y0NA 1ZBHA 3FF5A 4BD3A 3CUQC 1Z91A 1Q7YC 3GTMJ 2H3EB 5AQYA 3ZBDA 3HGGA 1YI2T 1FPQA 4L3QA 3LAJA 4QKUA 2IG0A 3VYSB 2KYMA 4NB4A 5J2NA 4BVOA 1WEGA 3BY7A 4G7HF 4LOCA 1AEYA 4BGDA 1M1KC 3CETA 2HU9A 4WXDA 2YUOA 3O9UA 5D6FA 1W9HA 4N47A 5GADP 5IH2A 2J5OA 5A2QK 1JLQA 2I0NA 2L3QA 2ECBA 1TV6A 4X1EA 4AIKA 3DLMA 3I0SA 2K3FA 3IKMA 4ZTFA 5JS1A 4AQYK 2M7BA 3C7JA 3I4NJ 1M9SA 1E3PA 4WX9A 2D1VA 3CCEQ 3AVFA 1PHTA 3SUOA 4MTDA 2R93J 4JZ4A 3CVSA 4JDSA 1WPYA 1BU1A 5GIOA 4ZHRA 3GZ6A 1UB9A 4N9IA 1Q82C 4OB0B 3OTOK 3WGIA 1VQLN 5DD8A 1G83A 2F7TA 4WFBL 4A3JJ 1D5YA 3FMRA 4BRKA 3S2DJ 2GXAA 3T7ZA 3HPGA 5CYQA 1Y96A 1FIAA 4CZFA 4LLGF 1SKRA 1UCRA 3VU3C 4CJLA 5AQHA 2XY7A 2K3XA 1OPLA 4AHUA 1UJYA 1JKPC 1HNWK 1HQCA 1KQ8A 3ZMTA 2FB7A 4HVWA 4IZ9A 1NG6A 1HUXA 1XJWB 4FM4B 4F3QA 1HRHA 3J81E 4DU3A 2GM4A 3EGDB 3QSUA 3GTKJ 2LBFB 2Z1GA 4H4MA 1R1UA 1QCNA 3NRVA 3CCSQ 3BDDA 2RK1A 3GXOA 5FJ8J 2NOZA 3F5TA 5CLSA 2DX1A 4M77D 4XH1A 1WJDA 2LY2A 4NOYA 1ZELA 4XH4A 4K8ZA 1VSLA 3AGKA 2EJGA 1HQEA 4JUVA 2HNDA 1XDSA 3JCMd 4H4KC 2R0QC 3BTIA 2FPEA 4N41A 3DWLA 1RNHA 4BR9A 1S6LA 1OVYA 2NRZA 4J2AA 3GPLA 1B8IA 2RKIA 1IO6A 4CZEA 2CSOA 4ZZLA 1WHKA 2OQRA 2GUPA 2H1KA 1ZAOA 3Q5FA 1S6QA 3I58A 4HOBA 4M7DG 3O8HA 2BDPA 1ATRA 4CIFA 2LF8A 1KG6A 1ZR2A 3L4IA 2MSYA 3T1BA 2FOWA 4DV7K 3VSLA 2JTFA 2QASA 2QTXA 3QIOA 2VVKA 5EOYA 1JXEA 1VQNN 1HLUA 3I55A 2CV2A 2VT3A 2OZMA 4ZYGA 2CYYA 1X01A 3JCMh 5M1OA 1XQOA 3JSCA 5A2QE 1CZ9A 3JB9G 5LY3A 3RR6A 1BR4A 5C25A 4EHTA 3BY5A 3QPSA 5BN9A 4BQAA 1VQ6A 2QZ8A 4G12A 3EAEA 4WQ5C 3E9OA 3J80Z 2YKMA 1J9AA 4ID5A 1AU7A 3S41A 3HL8A 2W00A 3HOTA 4C0DC 2ACJA 1BJAA 3GBTA 1M90C 2YUSA 5IT9Z 4AM7A 3CD6Q 3EYYA 2E88A 4BWJA 4IFVA 5CVJA 1AZGB 1G59A 4M6XA 1H88C 1W36C 2AZVA 5C44J 4YPHA 4OJRA 3M0SA 4CERA 3I55I 1X6GA 3J7ZO 2KZGA 3CPFA 3V4GA 3BR0A 5H1SQ 4XU3A 1DPRA 3F23A 4C5IA 3FXQA 1KAXA 1NJIO 4IUVA 4Q5VA 2BVMA 5J40A 1N8RO 1JU5C 4DA4A 1D0YA 1Q1HA 2ZCWA 3QWXX 2HSTA 1RT1A 2JM9A 2ZO4A 4LF5K 4E19A 4R0KA 3D5SC 2QEXQ 4B9MA 3CCJN 3I8BA 2WSCE 1M5Q1 4OPHA 4CGHA 3OYBA 4A2AA 1Q81O 2FRYA 4MZTA 1Y57A 2B5JA 3HK2A 3SXYA 2ZXHA 3WU1B 3ZMDA 5JLXA 3P1GA 2E3HA 2LP5A 1K4TA 3MX2A 2Q1ZB 1HNIA 1I5LA 4LJZF 4DV2K 3FHNA 3CO6C 1E3HA 1L3VA 1JUSA 3ESWB 1R22A 1ZBLA 4BQNA 3OHRA 2JQ7A 3FC3A 2L2PA 3EFRA 4MMLA 1GFDA 1C0UA 4BJ6C 1YBYA 3ZRGA 2D6FA 3FBNB 1AA7A 3IUOA 4ZYAA 2G8FA 1QPMA 1JQQA 5AIPA 3PIPA 2E2NA 2UUBK 2X78A 1J2XA 1XC5A 1C0MA 1S3XA 4F2SA 5KN8A 4A6EA 1KQ2A 1ETXA 3O80A 2L8DA 2O8EA 3VS0A 4ZJZA 3K1NA 5BRHA 3B8AX 4EJOA 1RTJA 4Z4FA 2PJRA 2Q8KA 3LP1A 3RTVA 1VQ7A 2NRRA 4U87A 3HTSB 2R5AA 3ROUA 2L89A 3QICA 1LDJA 3WXKA 2HQXA 3VQ5A 4BI8B 3CJ1A 4PLIA 4DTSA 3WNFA 2HPIA 4DBQA 2EA2A 2Y69H 2NRAC 2KRHA 2LLKA 3CBPA 2ZB9A 3S9HA 4EJWA 2OPSA 2XIDA 1JL1A 3SHWA 1UG0A 3ZQFA 4BE1A 3VS6A 2YCHA 4KH6A 4KH4A 4E89A 2GTJA 2JA6J 3O1WA 2LNVA 4XRFA 1O3RA 3CC2N 2MWOA 1VQ7I 2K7LA 1BISA 4JI8K 1M3QA 1WA7A 2LCCA 1EZZB 4DB3A 5GMKl 1AWXA 3BQZA 3D2EA 4EMKC 2D0NA 1VQ9N 3MVPA 2K3BA 4MDWA 2XAFA 1K7AA 1ZLJA 1D8KA 1MW7A 1S5LC 3BZ6A 4E7SA 2Q36A 5AZIA 3PQJA 1HD3A 2DL3A 2IBDA 3KEOA 3SV4A 1T03A 1GOCA 3K5OA 4CEEA 2QKBA 1WFWA 2LKPA 5GAOq 4KI4A 4YOTA 4JHDB 4QQ6A 2HDAA 2KRSA 4YG2F 1CZAN 5B3SH 2KTQA 1QGPA 2EILH 1SD6A 2R4GA 1ORPA 3H0GJ 3DPTA 3CWTA 2LKSA 1EH8A 2BE9B 4M7DE 5D5VB 2L5QA 3GTQJ 3G71N 3HSBA 5BR9A 3E19A 1S72N 3VYHB 1O7LA 1RLQC 4GKKK 2NUBA 4XTUA 1MH3A 2EZLA 1NMNA 1YF5L 1BC7C 2HHUA 1AWCA 3AA4A 2DU9A 2LD5A 3VYUB 3K4JA 1N3CA 3CXCM 3I0XA 3SWNC 4HUFA 1RRJA 2CT3A 1NBWA 4CZLA 2PNIA 5AZJB 4N9HA 3DKXA 3QWYA 1MD0A 2HVIA 3M1CA 4J9FA 3H5AA 2A3LA 4BXFA 2CZ6B 4BACA 3CCLN 4YOWA 4W5OA 2DA6A 3ZSVA 4XLAA 4FWRA 3CC4A 1B72B 2H1LA 2K4YA 1TYQB 3DBHB 4UNOA 2BY2A 2EV6A 4P96A 4M78A 4RTZA 1Q9XA 3UR3C 1SRMA 2BXYA 2XHIA 4PWDA 1RUNA 2PMZA 4C8NA 2DJZA 4H0EA 1W4SA 2CO5A 4B9SA 2PMUA 4RW7A 3AARA 3KFVA 5D4RA 1SV5A 2FF4A 2KZMA 1JLBA 3BCAA 4QW2A 5LGUA 2KROA 1UAXA 1K78A 2LR8A 4XK4A 4GW6A 2VQGA 2E7WA 1OKRA 2AJQA 4M7DF 3QU6A 3AT1B 1Y96B 3LALA 1L3TA 3RR7A 1VQKN 1G3SA 4CIEA 5J8CA 5JLHA 3CC4I 2X6NA 3HIFA 2WAEA 3E01A 2M3AA 5DEQA 2RHXA 3ID6A 2QGFB 4FJ9A 4DOVA 1YCSB 3R4KA 4CW7B 1BCOA 3MZYA 4KT6A 5C4XJ 3MK6A 3KTUA 4DOWA 3C6TA 3HYIA 3HP6A 1YIJN 2K40A 3JB9F 4JK8A 3VUBA 2IGNA 5F1XA 4B8CA 2IA2A 1IRXA 4G6QA 3QIIA 4JNEA 4Y4RA 3THWA 4A53A 3KP5A 4A4FA 4JZ3A 3K9TA 2QQ8A 1BN5A 2K5FA 4MO5A 2QF7A 5CCAA 1KU3A 1NK0A 1QKWA 2WV0A 3PFYA 1XMQK 3TAMA 3VYTB 3MWMA 5GAN2 2D1KA 3CCQQ 1QSSA 3PY8A 4Z6YA 2KJCA 1FTTA 3MZHA 1H641 4RG2A 4C8QA 3G6EA 1B8IB 2CG4A 5FLXE 3FJPA 1U78A 3M7GA 4OO1J 3OMGA 1PWTA 3OSSC 4BQZA 4BQOA 1QO0D 4A4GA 2A6EF 2A05A 2E1NA 1UFFA 2KPMA 1OH7A 4HNUA 3ATVA 5JFRA 2F96A 1TUYA 2DYIA 2E10A 1KAYA 1NM1A 3FXJA 4DMNA 4AYBA 2YUNA 3BP8A 5FDLA 3NAEA 5ICGA 2VKEA 1M3CA 2CU7A 1UHFA 1RRSA 4IFEA 1MJBA 1HYVA 3G6EI 2K9NA 1YHQN 2P4RA 2QAZA 3FJ5A 4WK8F 1A35A 1OR7A 4N0AA 3K4NA 3QZ5B 1KEAA 3ZQHA 4RDUA 3TCJA 4QWQA 3CCVQ 4AI5A 5GANf 2DRMA 2DNUA 4WTOB 3L2ZA 4WQ4A 3I9V2 2B7EA 4E9FA 2MGQA 3DRPA 4FK4A 5LFAA 1RDWX 5B1BH 2DA1A 2DBBA 4LDWA 1M3AA 1UDLA 1H9TA 4JKHA 5KQ8A 1NJXA 4U0VA 3L3VA 4YIFA 4LFUA 4HCZA 4BROA 2VG7A 5GAN8 1XMOK 3DWLE 1YJNN 2XK0A 3DKMA 1VQOA 3IFRA 3AO1A 1KFZA 4ENJA 1XTDA 3AG1H 2JTMA 4BY7J 1IO2A 1ZLKA 1D8YA 2LRQA 3JTHA 1U5TB 5DM7R 2AA4A 4CJQA 2JUCA 1NGHA 3RPQA 4IRIA 3Q0UA 1IAWA 1VIFA 5C12A 3NWTA 5C42A 2XD0A 1PP8F 2AP1A 3VN5A 4HSBA 1VQ5T 5GAOl 4B3OA 5E20A 2QK0A 3CXCA 2NVTJ 4HX8A 4FSXA 3NH2A 4V2GA 2BANA 2A07F 1VQ8Q 1OVQA 5M3MJ 2D4WA 2D2WA 3SYZA 4CJUA 1SZ2A 2F4MB 1YQRA 2EKOA 3GDQA 3ZSOA 1VQOI 1X6BA 4FWSA 3TGNA 2DMUA 1LWWA 4OIPF 3ERED 1D8JA 4M7DD 1ZYQA 3M4GA 1U2VA 3UKGA 3U23A 1TTYA 1OOTA 1OULA 3GIBA 2WADA 1MMSA 4AVZA 5EEGA 2VWFA 1U8RA 1ITGA 2E4LA 2OPQA 1M27C 1LE8B 4HCCA 2XHCA 3ZCMA 4M3DA 4CCKA 4FJ8A 2BXZA 5TKYA 3U3GA 1NYFA 3V8LA 2Y31A 3JB9D 4YELA 3MWTA 1NGAA 2PJRB 5F0FA 1X58A 4OPJA 1HSQA 4KIFA 3LWHA 1UJ8A 3IV5A 3FGUA 3REAB 4RM3A 2PAVA 4KA4A 4FW2A 4B9LA 1MWMA 4G6TB 4KIBA 1Z9QA 3U2RA 3M5AA 1PRMC 4KB0A 2DE0X 3GTGJ 4C0FA 1ORKA 3KLNA 1GUUA 2OTJI 2UUCK 4X6AJ 1BQNA 1W0UA 2GWRA 5E1XA 4RBOA 3E6CC 2DFUA 4GV6A 5LL6S 4J7IA 3M8QA 5KE2A 3R6OA 3IRRA 4JX5A 1NEGA 2A08A 3FIFA 3OVNA 3E6BA 1F43A 1LJOA 5L8RE 1UGRB 4B1ZA 4C92B 1U4BA 1YQAA 3SMSA 3I56T 4LSLA 3RKYA 1HU0A 1ZRCA 5EEHA 4LE9A 1S1NA 2YPRA 1NGFA 5LJ3d 3ABTA 4BBRJ 2EAYA 1O7FA 2VC0A 1W70A 4LUEA 4QQDA 1MSEC 3LZJA 1KC8C 3U9GA 1D3BB 2L7ZA 3MEGA 3LDNA 1J9IA 4BRIA 4DV6K 4HLXA 4EAHD 1GCQA 4KISA 2X4WA 1Y07A 1KONA 1JO8A 4CCLA 2XF6A 3KP6A 4LG3A 1HNZK 5HK3A 1Y71A 3GFJA 4ORZA 3DXKB 3H9JA 5KK1A 1R00A 4LC9B 1N32K 1KG4A 4CCNA 4OLAA 1U6GA 2DFHA 3JW4A 2NNYA 5LJ3h 2QLZA 5E1WA 4CC3A 4ENNA 5LBQA 5LJ5j 4XN3A 1V1CA 3V42A 2JPBA 1IKVA 5DM7L 4IPAA 3R2XC 2XHKA 3CWUA 2OTJT 2YV0X 3V8JA 3JCMQ 4JKFA 4ITVA 1WXBA 2Q3SA 2HOTA 3CMEN 3HTRA 2DIQA 4XKBA 2M51A 1TUUA 4C92E 4FJXA 2Y4YA 1Z7UA 4M78B 3SB2A 4WXHA 4ABZA 3QEIA 1QSLA 2QG9B 2GQVA 1VSFA 2WC9A 3QU3A 4FK2A 3UT1A 3RYPA 3OOPA 3PIPF 4BRGA 3V9SA 2FL7A 4FX4A 5GAN7 1HF0A 1K78B 8ATCB 5AR0A 1WGXA 4LITA 2O8CB 5LGNA 3GFMA 1GVDA 2M5WA 2WA0A 3GF2A 2YT6A 1ACIA 4ZYHA 3F10A 4CGZA 1R36A 2OUMA 2PJPA 4DK9A 1FYMA 3JTGA 3WG9A 1HKQA 4N4HA 2JMCA 1RT3A 3LA2A 4M72A 3KWIA 4QQGA 2F9TA 4RGUA 1QHHD 4D5CA 3LP2A 1QS4A 2R7FA 2JA8J 3WU2C 5AQVA 4IVNA 1YS6A 3CLOA 4EHUA 1XOVA 1B9MA 2E5KA 3HRMA 2VQLA 1SANA 3THWB 1BIUA 2Z33A 4FTHA 4CHPA 2CP3A 4DQIA 4PIIA 2KIUA 4ISGA 1FNNA 4RS8A 4BRNA 1TTHB 4RCBA 3LFKA 3K7AJ 3HC7A 1A6QA 1TQMA 1JCGA 4CEAA 3CC7N 3TQNA 4M7YA 1DU0A 3SZGA 3C18A 1MDUB 1JJ2A 4KMUX 2KIQA 2J6KA 3ZOBA 2QA4T 3TAPA 2G8KA 2RJCA 4CYDA 4C8QB 1FLIA 4M78E 2YX7A 4BUGA 2IVMA 5I2SA 4M7AA 2D0PA 3VOVA 4B47A 2KDSA 1NGEA 2J05A 2OAZA 2AKLA 3NH1A 3G4SN 1TSFA 1YJNQ 4DS5A 1TQIA 1X3ZB 5CKTA 5CR2A 3O4NA 1FOXA 4M75B 1N75A 3KJVA 3QWLA 4D9JA 2A37A 4GNIA 1K8AU 4YOXA 1SFUA 2DPPB 1K8KA 1PVEA 3HKZN 1Q81R 1RAAB 4FL6A 2O2OA 5LEKA 1N39A 4H5VA 1ZA2B 4OIRF 3VYRB 4CZIA 2YG8A 3CFOA 3BZKA 5AIQA 2DTZA 1CSKA 4GVEA 1VSIA 1LV5A 1C1AA 3WVEB 4EJZA 1WGSA 2ZPIB 5GAMh 4I9LA 4A3GJ 3L2UA 3C2BA 3CUOA 3NF8A 4B24A 2LT1A 1D4XA 2VKVA 3MXJA 3QQAA 3MEWA 4E4HA 1YVNA 3MKLA 2BEOA 2XASA 3VF4A 3EPZA 3WHBA 4DU1A 2W85A 3UATA 4FE4A 5GPCA 3AVAA 2OFIA 4M78F 3SUNA 5KYWA 5F04A 2W57A 1WHUA 5D5XB 5I42A 4OOIA 2CGKA 1I1JA 1QVTA 4CZZA 2JUGA 2LK2A 4DLEA 3RSNA 1T3LA 2X85A 3H3OB 2XC7A 4C8QE 3RR8A 3G1LA 5L3DA 4EVVA 4D8KA 1LJ9A