4BE0A

Pfv intasome with inhibitor xz-115
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be0A03
4PL6A 2KW4A 2YHAA 1T7PA 4FVMA 2R7YA 4WE1A 1X9WA 3NF8A 4CEEA 2VWJA 1L5UA 1DTTA 3ZSRA 4FJXA 1KVAA 4DFPA 3IG1A 1BI4B 2KTQA 2G3RA 1QS4A 1UAXA 3NBPA 4EP4A 3LX7A 3VN5A 4FLUA 4KHYA 4M42A 3O3HA 3BDPA 4FJJA 4FJ5A 2RHYA 2XDPA 4IFVA 2G8VA 3META 4CFAA 2D0CA 3V9SA 4CJPA 1IG9A 2R58A 2IGIA 3AVKA 3VQ6A 3PY8A 1HYVA 1R0AA 3K58A 4C5HA 2RJCA 1RT7A 2HHXA 3M8RA 2L3RA 1JXEA 1NOZA 4FLYA 2F8SA 3C6TA 3AVLA 2OA8A 1A5XA 2F96A 3ZSZA 1BGXT 1JL1A 1WSIA 2WOMA 3LP1A 1QSLA 1NJZA 3OJUA 1C0UA 3ASKA 3O8VA 2EQKA 1A5VA 4BWMA 3RRGA 4PWDA 2BANA 2ATQA 4C5GA 3CM5A 2EFIA 4DS4A 1S1UA 2BE2A 4LY7A 3S6WA 4CF0A 2BKDN 3MP8A 2M1HA 1BCOA 3AVGA 1JLGA 4FLZA 4W5TA 1REVA 3LWMA 3KKRA 4HHTA 1SL2A 3H08A 1JXBA 3CM6A 2XY7A 1H3ZA 1TK5A 1WAFA 1TKDA 2VG7A 3HT3A 4M3TA 2DFEA 3QESA 3DLHA 4DQIA 1KSPA 1CZBA 1VSKA 4JRPA 4FZXC 4QCLA 4HCCA 2OZMA 4Q5WA 1WNSA 4B9MA 3WNFA 2YNHA 4LSNA 5T7BA 2F5KA 1EX4A 1MU2A 3IRXA 3O4NA 3ZT3A 3OMCA 2ZD1A 1LW0A 5KI6A 1VRTA 4BDPA 1JLCA 3L2VA 4Z02A 3DLGA 3FC3A 3BDLA 2XRIA 3OYDA 1WJRA 4H4OA 4E3SA 2HHVA 4ZTFA 3DRSA 1KFSA 1JLAA 2ZE2A 2GV9A 3GOXA 2EQUA 3DB4A 3B6OA 3M8QA 5CZ1A 1XC9A 5HRSA 4E1NA 3SUOA 3V4IA 3DLRA 5CY4A 3MP1A 3OYEA 3NTHA 4O5BA 1C1CA 3ZSVA 1KVBA 3ZT4A 4CHOA 4FL6A 3ALYA 5J2QA 3KTQA 3E9FA 2Z1IA 4FW2A 4OPJA 1VSDA 3O3FA 3F73A 1C0TA 3RR8A 4KB0A 4FK4A 3TAPA 4C8LA 3DLEA 4M3XA 5DK5A 2IG0A 5SWMA 4HUFA 3QETA 1TL3A 3FDRA 3QJ6A 3EZ5A 3NE6A 1VSJA 4QQGA 4DTXA 3QEWA 4FLVA 1VSHA 3TAQA 5J39A 4N5SA 1B9DA 4M3WA 2IOCA 3MO8A 4YFUA 1RNHA 1HNIA 3ME9A 3QLHA 3QERA 2PYJA 1NKCA 4DTSA 4M3ZA 4PLLA 4A4HA 3KJVA 3KIOA 1KLMA 2VG5A 4RG2A 2G8HA 3QIIA 2HW3A 2MWPA 4BE0A 3MEWA 4OGCA 4RW6A 4KTWA 4C8MA 4KB1A 2KZMA 3OS0A 4N47A 3MXIA 1RBUA 1RILA 2DAQA 1GOAA 4DFJA 3U3GA 4DMNA 2PYLA 4CEBA 2E6MA 3LP3A 2RHZA 1SKRA 4QW2A 2D9TA 1MHNA 2WONA 3WNHA 3NH1A 3L8BA 3OYKA 3OY9A 2P5GA 4B9VA 4AHSA 3TAEA 2BDPA 2B4JA 4CIGA 5FRMA 3V9UA 3IS9A 3KK2A 4DFMA 4F8RA 1RTHA 3TAFA 2GFUA 2O4XA 4DF8A 2XY5A 3SCXA 4FJIA 2HQEA 3UIQA 4CJFA 2OPPA 1S1TA 2HNZA 4J2EA 4QOZB 3ZCMA 2NUBA 3ISNC 4OKEA 4R5PA 4CF1A 3P5JA 3EYZA 4M41A 2L8DA 1T03A 2P5OA 4M3RA 4CF9A 3LGLA 4CEZA 3SV3A 3M8PA 2Y1IA 4LH5A 4NYFA 3NGIA 1YTAA 3S3OA 1KTQA 4CJWA 3AV9A 3QBYA 1U48A 4FM1A 1BQMA 2PQWA 3LANA 3V6DA 5J1EA 3LP2A 4I9QA 1TKZA 1VSIA 3DLKA 4GMJB 3MECA 4I9LA 4I2PA 4CJRA 2YNFA 1L3SA 2RHIA 1EXQA 3IAYA 4FK0A 1U47A 3AVMA 3O4QA 3WNEA 3PO4A 4DQRA 4E7KA 1VSFA 4KFBA 5FDLA 4CJ3A 1RT5A 3QO9A 3DLMA 3G0ZA 1QHTA 3A2FA 3KLEA 4E7JA 1HQEA 3HXMA 4DSFA 3L2UA 4DS5A 3LAKA 1SKSA 4B9NA 1YTUA 1S6PA 3AA3A 4FCYA 5I42A 3RMAA 4DTRA 4FJ7A 2B5JA 4CGFA 2D5RA 2EX3A 3LYIA 3MXJA 4EP5A 3SPYA 1GOBA 3DYAA 4NZGA 3V1RA 4AHUA 1BISA 3ASMA 2RI3A 3LZIA 2RHUA 3OYCA 3T1AA 3AVIA 4ELTA 2G8IA 4FZZA 4OJRA 2KFZA 3VQQA 3OB9A 3V9ZA 4CHNA 4M3UA 2M0OA 2X6SA 5HRNA 4B8AB 2G8UA 1G15A 1B9FA 3SYZA 1Z26A 4I7FA 3ZSOA 2K3YA 3HPHA 2HVHA 4OVLA 3P8DA 4A4FA 4QAGA 3LH0A 1RTIA 3NF7A 4B3OA 1ZBLA 3QKJA 5J26A 1J53A 3NH2A 1RBTA 2OYQA 1S1WA 4UQGA 2PZSA 4F3TA 5JS1A 4F2SA 1IKYA 1UA0A 4CECA 3VQBA 4FLXA 2EHGA 3AVBA 2OPRA 1YT3A 3MEVA 4M45A 1G5VA 1SL1A 3MEDA 5CZ2A 3V1OA 1WSEA 3E9GA 5KH6A 3PFSA 4E7LA 1B92A 4FLTA 1CXQA 5D6XA 3SJJA 3PO5A 3SUNA 4F3OA 3AO3A 3TAMA 4E0DA 3ZEHA 3VQEA 4CHYA 3D0PA 1TK8A 1SV5A 3DM2A 5CYMA 5EU7A 4AHVA 2ETJA 5KCHA 1FKPA 3HSTB 4CJKA 4FJGA 4GW6A 1NK5A 2HVIA 2Z1JA 4FM2A 1Q9YA 3SQ0A 3Q1JA 2EKOA 2PY5A 4DWIA 4CESA 3KD1E 2HHUA 1FXXA 2JLEA 4JRQA 3AO1A 4OVAA 2ITGA 5CYQA 4HVJA 3MEAA 1FK9A 4O0IA 3L42A 3I8DA 3K59A 4DTJA 3OS1A 1BIUA 4B9UA 3CG7A 4PQUA 4NYNA 5KRTA 3TI0A 2G8KA 3SUQA 4HCBA 2O4GA 1HNVA 1KVCA 4CEFA 1BQNA 2K3XA 1D5AA 1HMVA 1RBVA 4Y1CA 4CGHA 1N5YA 4FZYA 4BD3A 1OYXA 4JS4A 4HUGA 4J2BA 2AJQA 2JTFA 1LAWA 4CEDA 4CJTA 4DSLA 2HHTA 3OYHA 3VQPA 4IDKA 5D3GA 2XO7A 4L59A 4CCHA 2D0BA 4PA1A 4FJHA 2LVMA 1TK0A 2HB5A 4BACA 4YNQA 1NK4A 1I3AA 3TR8A 5HRPA 1N27A 2RN2A 4KHSA 3S9HA 1WJSA 2GBZA 1LAVA 2RKIA 2Z1GA 2NLUA 3AVFA 4H8KA 3T19A 5J2MA 3FFIA 4DSJA 3DRRA 2IC3A 4HTUA 1NOYA 2L89A 1RDCA 3AA5X 1X1PA 3D45A 2R5MA 5IAYA 2Z1HA 4DSKA 4FW1A 1WSHA 3OYJA 1JLEA 4II1A 4NCGA 2X4YA 1TL1A 5KE2A 3HVTA 3LPTA 2P1JA 4CFCA 3KLHA 4AILC 3KD5E 3O3GA 3OYGA 4CIEA 5HP1A 2XY6A 5FROA 1CXUA 4AH9A 5FRNA 1BI4A 2YKMA 3LGFA 1XHZA 3ITHA 4W5NA 4K8XA 1NKEA 4CJ5A 3K5NA 4KTQA 4CHPA 2RPIA 1IKWA 1SUQA 2I5JA 4X34A 3QEXA 3OYAA 4RW8A 1ZBFA 4DU1A 5HRRA 1SSFA 4W5QA 1S6QA 4CJ4A 1NKBA 3RMDA 2LDMA 4CGGA 4CGJA 4Z4HA 4KPYA 3K5LA 1W9HA 4OKJA 2LRQA 3KLIA 3BGRA 4FJNA 4FU6A 2X78A 4BWJA 2CKKA 5KTQA 3NF6A 5JS2A 1NJYA 1ZBIA 4Q0BA 2E4LA 4CEOA 2RI2A 4DTOA 4KRFA 3DLBA 3VA0A 4OLAA 4IUTA 4KV8A 2B6AA 3NH0A 1W0HA 4CGIA 4E19A 3PV8A 1OZ2A 1GOCA 3MP6A 3ZT2A 3MAQA 2P0KA 2FBXA 4H4MA 2GUIA 3SD4A 4CFBA 4IUUA 1QTMA 1L3UA 3P1GA 3LWLA 3QNOA 1N6QA 4N76A 4E1MA 2Y1JA 2VG6A 1NK0A 3ZSXA 1HPZA 2A1RA 3V1QA 5CIUA 4OPKA 2QK9A 4OGEA 3RMBA 2RHXA 4N56A 3CEYA 5IN1A 1WJQA 3CFOA 1LW2A 4DG1A 1X9SA 1D9FA 3OS2A 4UC4A 1TVRA 3KKSA 5SZTA 4OLBA 4Z4GA 3HK2A 3ZSYA 2Q3SA 2JGUA 3AA2A 4CJEA 4ICLA 1WGSA 1S5JA 4W5RA 1EETA 3SNNA 3MEGA 1JLFA 3V9WA 3AVJA 4CHQA 3C95A 4B9SA 1KCFA 5J2PA 1DTQA 3NTIA 5C24A 3P8HA 2YNGA 1HYZA 3SI6A 2G8WA 1Q8IA 1UWBA 1U4BA 1NJXA 1NK9A 2DIGA 2QXFA 2X74A 5C6SA 4CF8A 3KK3A 1LV5A 4FK2A 2DTUA 3SQ2A 4O0JA 3KK1A 1IO2A 2YNIA 4KHQA 1NJWA 1K6YA 1O1WA 3AVHA 4A4GA 3CYMA 4DLGA 4FYDA 4Q5VA 1VSMA 2WACA 5HBMA 4XIUA 1QSYA 3I0RA 2KZZA 2X4XA 1LWCA 3VQCA 3HP6A 4DTMA 3UT1A 2RJFA 3QNNA 2OZSA 3HO1A 3OQ5A 4CK2A 2FHDA 3HPOA 3AVNA 3FLGA 3MEUA 2FBTA 5J2NA 2HHSA 2LTOA 1BHLA 3K2PA 1WSJA 3VQ7A 2DIQA 2RO0A 2XK0A 4Y1DA 3VQDA 3KUFA 4HCZA 1RT4A 1RT1A 3OMGA 4W5OA 4IUPA 2BIVA 1XWLA 1TAQA 4DFKA 1L3TA 4QVZA 3LZJA 4CJVA 4F2RA 1SKWA 3ZSWA 4K8ZA 3VQ4A 4QQDA 2RF2A 2HMIA 1BCMA 4IFYA 4OKKA 4A4EA 2IAJA 3LAMA 4I2QA 4RW9A 4CERA 1ASUA 4C5EA 4IURA 3RWUA 3NCIA 1U49A 3U3YA 2KFNA 4EDUA 1TKTA 1OI1A 1WN7A 2R57A 3NF9A 5KGWA 4CJLA 4CIFA 4BE1A 4ID5A 3AVCA 4CEAA 1RT2A 1C0MA 4CEQA 4HUEA 1Z25A 1J5OA 4KREA 5HLFA 2FC0A 1UA1A 4Z4CA 4AHCA 3AO2A 3LALA 1J54A 2M16A 2RJEA 2HHQA 2IS3A 3PMTA 2HQXA 1RTJA 1S1VA 4IG0A 2HHWA 2RJDA 3FEOA 3NDKA 4BDYA 3HJFA 2GF7A 1L3VA 4IKFA 1KHCA 1RT6A 4CK1A 3THVA 3DMJA 4DTNA 2VYTA 4N4GA 4RW4A 1NK8A 4B9TA 4DQPA 3AA4A 1VRUA 2QKBA 3PX0A 2EQMA 2OPSA 3C6UA 4ELVA 1VSEA 3TANA 4F4KA 3LP0A 1IH7A 4Z4FA 3HM9A 4DU3A 1IKXA 1S9EA 3CFPA 3VQ9A 4B08A 4C5IA 2F8TA 3MXMA 3DB3A 4JS5A 3H8ZA 1EP4A 2OPQA 1JKHA 3P83D 2E6NA 3VQ5A 5KGXA 3V81A 1QE1A 4CHZA 3G10A 2XHBA 1ZYQA 4CF2A 1EKEA 1U45A 3RR7A 4Z4IA 4IUQA 1FKOA 3EAEA 1RDBA 1RDDA 3ZT1A 3ZT0A 3KLFA 5M9OA 4NCAA 4KHUA 3OYNA 3NTKA 3NGYA 2GFAA 3RMCA 1HYSA 2JZ2A 3AVAA 3L2WA 3DOLA 1Q9XA 1U04A 3U6FA 4LSLA 1ZBHA 3L2QA 4KHNA 3OYMA 1XNIA 4ZHRA 4DF4A 1TGOA 2E5QA 3E01A 4B9XA 4JLHA 2QQSA 3WNGA 4M3YA 4E7IA 4E7HA 1LWEA 1ASWA 1BL3A 2YV0X 2X35A 4CFDA 3JYTA 4DU4A 2BGGA 4GVMA 1C1AA 1HJRA 4CRIA 2DFHA 4B8CA 3KLGA 3SZ2A 3H6ZA 3LPUA 4C8OA 3T3FA 4N4HA 3RRHA 4PY5A 1WLJA 5D6YA 1XHXA 3TARA 3OYBA 3S3NA 3DRPA 4IG3A 4AHRA 1TKXA 5DMRA 1SL0A 1KRPA 1RBRA 2FBYA 2KQ2A 3AO4A 1JLQA 3C4SA 1DLOA 1HQUA 4O55A 4CK3A 5E41A 2XY8A 4EZ9A 1TV6A 5I3UA 4CJUA 3L2RA 3QINA 4LD6A 1C6VA 1CZ9A 1RDAA 2B8AA 3PNWC 2RI5A 4O4GA 5C25A 4KI6A 4ID1A 3QEPA 2MWOA 3TAGA 4B9LA 3LDSA 4EZ6A 4KAZA 3QEVA 3PX4A 1X9MA 1RI0A 3QIPA 2W42A 4DLEA 3JSMA 4FLWA 3HL8A 2YHBA 1LWFA 2EQJA 1RT3A 2LSNA 3HYFA 4Z0UA 2HNDA 1NK7A 3M8SA 4C8KA 4CJSA 1TAUA 4CE9A 3DI6A 1BIZA 4L8RB 4PUOA 2O4IA 3NGZA 3SPZA 4FXDA 1QSSA 2DY4A 3SUPA 1A5WA 4FJKA 2ZQBA 4B9WA 1S1XA 3C94A 4DSIA 1RTDA 4DTUA 4G1QA 2E6LA 3RTVA 2YRVA 1D9DA 1S9GA 3NNQA 2FBVA 3OYIA 1NK6A 2HNYA 1WAJA 4FJLA 4MQ3A 3M9QA 3OVNA 3ZSQA 5HROA 3OJSA 3QIOA 4DSEA 4TSXA 4NCBA 2X6NA 2A1SA 3MEEA 4FJ8A 4ELUA 4NS5A 4FJ9A 2BUDA 3VQAA 4DTPA 3PUFA 1YVUA 4GY5A 5KE3A 2VWKA 3K57A 4AHTA 2D0AA 2LCCA 3F70A 1JLBA 5C0MA 1QQCA 1ZBUA 3PMIA 1WSFA 4RG8A 3V9XA 1T8EA 3NFAA 1KLNA 4Z4EA 3I0SA 1OZ3A 5D6WA 4PLIA 2YKNA 1RCHA 3L3VA 4DQQA 4LH4A 2DFFA 1HRHA 4FJMA 1VK0A 3OA6A 3F9KA 4IUVA 3CFRA 1XI1A 4IBNA 3L3UA 1Y97A 3OYLA 3VQ8A 3K5MA 3UWNA 4N41A 4KTZA 4DQSA 4BE2A 2P51A 3DOKA 3ULDA 4C8NA 1RBSA 1KFDA 4MFBA 3SV4A 4CGDA 2R5AA 3QEIA 3LLRA 2O4XB 3HVRA 1T05A 3NHGA 4FM0A 4KI4A 1J9AA 4E89A 3S3MA 4O44A 3EY1A 1VSLA 5KCOA 1C1BA 1F21A 1UOCA 4ZTJA 1ITGA 3B6PA 4BDZA 3HPGA 1WSGA 4KKOA 3NAEA 1CLQA 3TABA 3VA3A 3TWHA 3K5OA 1D8YA 4J2DA 2IDOA 4KHWA 1ASVA 4KO0A 4CJQA 5C42A 3SQ4A 4LD0A 3SQ1A 2G8FA 1JL2A 3AO5A 5K14A 2X4WA 4QQ6A 3OYFA 4RW7A 3CQ8A 3PX6A 1IKVA 4J2AA 5KRSA 2QKKA 4N4IA 2QQRA 3HP9A 1I39A
chains in the Genus database with same CATH superfamily
1E17A 3IG1A 1YHQI 3HOVJ 3WTZA 5M3FJ 2VQHA 3M8RA 1YJWI 1GVDA 1QU3A 2H6CA 1YHQQ 5JI6A 3OW2M 5IP9J 2XKOC 2XY7A 1TKDA 5CCAA 2E1CA 3SFZA 2HTJA 1M1KC 1ZBJA 2FBHA 4M77D 3WXMB 4DOVA 1W6XA 5A2QZ 3KP5A 3OIOA 2UWMA 2QBYA 4CBXA 3CC4Q 3U8XA 1S7OA 4FL6A 2O8FA 3E9FA 4Z6YA 2FOKA 2PJRB 2IG0A 2F69A 2CP6A 3WXJA 3LDPA 4K11A 5JR3A 3O2PE 1MV0B 1UHWA 1VSHA 4DV3K 3P39A 4YFUA 2EILH 3EUHC 2DO3A 1UE9A 3QB0A 1BWFO 2VT2A 3BWGA 3FBIB 3ZRGA 4HSBA 3U3GA 2ZPFB 2M9UA 2HFHA 2CJJA 1HKTA 2L9NA 4K25A 2B4JA 4CIGA 2QW9A 4GV6A 2QWWA 4NC8A 3CCJI 2RK1A 3GF5A 3WE2A 4ABZA 4C8QG 4R5PA 3EO3A 3S1RJ 1R4NB 3T69A 3VESA 2KIFA 4CJWA 3O6BB 1KTQA 5CKFA 2K4BA 4MHGA 2A6HF 4FL9A 4BYYA 4DV2K 3KX2A 3LH5A 1L3SA 5D6FA 2GA2A 2IA1A 4KFBA 5EZHA 2CZ0B 1OH7A 2JRMA 3KFWX 4E7JA 3A2FA 4DSFA 2UXXA 2RDPA 3L6QA 3BJ6A 4Y3OA 5M3MJ 1GOBA 1IO6A 4I99C 4PFOA 3V9ZA 5HRNA 3CWAA 3RPUA 2LMDA 1UB4A 3ZEUA 4BAYA 4B3OA 3KNTA 4UQGA 1MDUB 1IREB 5IHKA 3SJJA 5EVZA 5CR4A 3ZEHA 4IOAL 1NG7A 4HOBA 2ETJA 3Q1JA 1YIJA 1LDDA 3ECOA 3CG7A 2QLZA 3I56N 2O4GA 2AHQA 3JSCA 1GBQA 2E35A 1U6GA 2QASA 1KQ1A 3CCMQ 2I7NA 4E9GA 2XO7A 1KU3A 3AT1B 4BACA 4CZHA 2RN2A 5BPDA 2JWKA 2PVGB 4H0OA 2YG8A 4DSKA 1S7EA 5KN9A 1WSHA 2H8RA 3LPTA 1KYZA 4EPCA 2RKHA 1YQLA 4W5NA 3RZDJ 1NKEA 4KH5A 1NK3P 1SSFA 5JMVA 1X4OA 5KYUA 1J2XA 1ZBIA 3HOUJ 2SEMA 1IDYA 3CP2A 4EMKB 4KRFA 2CUFA 1E3MA 2XKOA 2LT1A 4J83A 1Y0NA 2ZPBB 3G71Q 3W6KB 1S9HA 2P0KA 3SD4A 3P1GA 3ZSXA 1YG2A 2D1KA 4AYBN 3CEYA 1YW8A 1RRQA 1T98A 2JGUA 5CVVA 1OU8A 4B9SA 2A5WA 3PFIA 1DTQA 5C24A 1ATRA 2CT3A 3VETA 1NK9A 2WAEA 2OTJQ 2LX7A 4RTYA 2YNIA 3C18A 3CCLA 3AVHA 5B66C 1ZG1A 3CJAA 4C92C 1O75A 2FNAA 2NOEA 3QXEB 2PAVA 1ZA1B 2JS2A 2HHSA 1WEFA 2KISA 2HEQA 3CCSQ 4HCZA 1W2BP 1T3LA 1U0JA 1QKXA 2RF2A 3QJYA 4JK9A 2BUPA 5LEKA 2O8FB 4CJLA 1BA0A 4MDBA 2DA6A 2ZCFB 1H641 1PD0A 1HKSA 4O5FA 4EMSA 1XGNA 2M16A 3FBNB 3JCMh 1VQ6Q 4DTNA 1NK8A 2QQ8A 3F6VA 3DKMA 2OPTA 1DPUA 3VV0A 1WXTA 4CCJA 1V4TA 5GIPA 1VQNQ 4XU1A 4EJVA 2QDLA 4CF2A 3RR7A 4B21A 4LLGF 3EAEA 3ZT1A 2Q1ZB 3SZPA 3M0QA 4IPAA 3HHTB 3F0CA 1VQ5T 1VI0A 4A5NA 2HNIA 3P9KA 5GADJ 3ISPA 3RKQA 4H03B 4NB4A 2DZ9A 3I58A 5H20A 2W0ZA 5IP7J 3OR2C 2F7TA 1W7PA 3UA7A 4ELZC 1VQ9I 4IOCF 2EV6A 4B8CA 4CRIA 3QBXA 1FSHA 4H0XB 3LPUA 3DAWA 3CC2N 4KN4X 1VQPA 5DMRA 3AO4A 4YELA 3TW7A 2K40A 1TWBA 4LFUA 4M7AE 2LY2A 4Z0UA 5JVHL 1SVLA 1TAUA 5B3SH 4E6KG 3JXUA 1KU9A 2L7KA 2FA5A 3CP8A 1QSSA 3M07A 1ZRCA 1SD5A 3G3ZA 4C1NK 1I8FA 4G1QA 1OR7A 2EFOA 2Q97A 4MQ3A 2PEXA 4F14A 5LD2C 2JN6A 1QQCA 4QIWN 2MI6A 3T1HK 1VIFA 5LJ5d 2WSEE 2MFZA 2ZAEA 3C12A 2UYTA 1T56A 3A0BC 4IDHA 3OA9A 2DA7A 2CFOA 2JTEA 1RBSA 1FC3A 2NXNB 4JI3K 3K70C 3REAB 1GXIE 1QCFA 1XSDA 3HPGA 4L5IA 2Y30A 5LJ3j 2W57A 3CXCP 3FHGA 2CSQA 5LJ3e 5AQNA 3WXLA 1V4RA 4ZYEA 2CWEA 4LMYA 2DPPB 3NF6A 2VKEA 4XLHA 1YX3A 2QM1A 1T7PA 3ZSRA 4R55A 3EETA 3CUQB 3K10A 4XLPF 3O3HA 1TL8A 1HLUA 3JW4A 4CFAA 2CS3A 4IQJA 2NOHA 2R58A 1AWXA 3VQ6A 5GINA 3TPQA 2HHXA 2LF8A 1A5XA 1QSLA 1WEIA 4LD5A 3OJUA 3QOPA 3BY6A 2P5LC 2ATQA 2EFIA 4XM3A 4DJAA 4M75A 4MMLA 3GOIA 4XLAA 1JLGA 4OPAA 3JRDA 1WAFA 2PG4A 1FWZA 1SHGA 2RM4A 4KRTA 3VTHA 4B9MA 1M1KU 2VWBA 4E3SA 5F1RA 3FHFA 5ED4A 1LPLA 4OFEA 3M8QA 3KTUA 3KEYA 4BXUA 1C1CA 3I56A 3ULEB 2EGAA 4J9HA 1HW2A 1TG0A 3NE6A 5F1JA 2QWMA 4FLVA 4FTHA 3JRCA 5AJ3K 3SWNB 4WFBL 5IT9K 3I55Q 2E1YA 5DCFA 3QERA 1X69A 4DV5K 4HSTA 1QWFA 1P59A 1PC0A 3C2HA 4BE0A 4OGCA 3AL0C 2H1LA 2XVCA 4MZTA 3H46O 2EFNA 5C15A 4A3CJ 3OYKA 4LK0F 4HVVA 1MNEA 3M4GA 2FD5A 3H0IA 5A2QK 2M4GA 3BJAA 5K7ZA 4EJYA 3GIBA 4RLQA 4J2EA 2EZHA 2GGRA 1X43A 4YPRA 1M3CA 3SV3A 1IBKK 3QBYA 4QS7A 3UB5A 5J1EA 3O3KA 4MZPA 2VGMA 3CC2Q 1PHTA 2O9LA 3S15J 3JSOA 3SJMA 4A5BA 2VJIA 3CIPA 3F3XA 4BRCA 3C6AA 4L6V5 2P9NB 2EX3A 4BNCA 2K86A 3AVIA 5K1YA 2ZXJA 4UY8I 2XRLA 2G8UA 2HVHA 4A4FA 5DTDA 1D09B 3IWFA 4JKGB 4IHVA 4U88A 4RTFD 1B7TA 2OAZA 1JUMA 1VQ4A 3U9DA 2K5FA 3CDIA 4ZZLA 3A8HB 2A6EF 5M5YJ 2ZNZA 5KQDA 3MEAA 3BFMA 2M8GX 2P9PA 4AM3A 2P9KB 2XPWA 2V79A 1ZBXA 4F7UB 3PJRA 1N5YA 4U67L 2P0WA 5F08A 3IC7A 4M78F 4PZJA 3ZXSA 3B02A 2OI3A 2FLOA 2WC2A 3LL7A 4J9DA 4MDWA 1PU6A 2L89A 2HOAA 1GCPA 1FLIA 4U0WA 2KDZA 2NRTA 3DBLB 3JAMO 3CCJN 5HP1A 2FMYA 3G4ST 2IGKA 3LGFA 2C6YA 2CH5A 5KYYA 2TCTA 2E1HA 3HG9A 2DE0X 4W5QA 2YHXA 2E41A 1GLFO 3A5OC 1NJYA 4JP0A 2BYVE 3LSGA 3ZT2A 1AOYA 3MAQA 4H4MA 2KDOA 4ELYC 2YT6A 2GWJA 1NK0A 1HPZA 4RGRA 2A07F 2DJQA 5ECAA 3LAJA 2HSEB 4DG1A 4A63B 3WTWC 2QXLA 2QKLB 4XAXB 4FWPA 3TTFA 4WWCA 2VB6A 3SWNC 3KP3A 3MEGA 4OP0A 4X64K 1I6XA 1OYYA 1XMXA 2EGEA 3NTIA 1UWBA 3KK3A 3DP7A 3FHZA 4O0JA 3A5MC 3QU6A 5KNLA 3CYMA 1LNXA 5M5XJ 3QDRB 3QWYA 3UT1A 2GXBA 3UNGC 4A4KA 4C30A 1KD1R 1YE9A 1K8AU 1KQSA 2RO0A 4DR7K 1RT4A 2V7YA 3CMAN 2DJNA 2WV1A 1H8KA 4OKKA 4ZH4F 2BE5F 1TKTA 4EW0A 3ULEA 4CIFA 4HDUA 2MC3A 5GAMf 3OW2A 1C0MA 3I56T 4BRIA 3F2KA 3UKGA 2P7CB 4Z89A 2HYGD 3SWNA 1H9GA 1CGPA 4DQPA 4EIAA 2F4OB 1K73O 3KEQA 3IAS2 1D5YA 1MH4A 3H5RA 3P83D 2I7PA 3CCSN 4HX8A 1RDDA 5GAOp 4JKDA 4JNEA 3BR3A 5KYXA 2HSPA 1NM7A 2FBKA 2XF7A 4V19S 1QHHD 2F4IA 4DF4A 2X1EA 4JLHA 2MH9A 2ZGZA 2EVRA 2R7QA 2DFHA 3KLGA 2HBWA 4I09A 1JUPA 4PJJA 4M9ZA 3VYTB 4F91B 2A28A 1FOYA 4CZJA 3S16J 2RVCA 5CO7A 1VQ6I 3L2RA 2XC7A 1TYQA 2LQ8A 2GM4A 1JT6A 3A8LB 3T0YA 1AU7A 2DYRH 1PYVA 2A3ZA 1QVGA 2VQLA 3CF5F 1W1FA 4B9WA 4DTUA 2VCPA 4JKGA 3OYIA 2HNYA 4FJLA 3VF6A 1GCQC 1OH6A 2DXTA 4IO9F 3VQAA 1GLLO 2DMPA 3L3VA 1C0GA 2DFFA 3JTGA 4IUVA 2WB1A 2DMTA 1I1SA 2JHJA 1S7AA 4BE2A 1NYGA 2H8HA 3CC7N 4A0XA 2DAOA 3HRUA 4C92D 5EX5A 3AG4H 1RUWA 2IGMA 2GTOA 5EEAA 3SFIA 3WEEB 3P31A 2IDOA 5EY4A 2VIXA 3SQ1A 1UELB 4QQ6A 3VODA 2O8KA 1UAAA 2WOMA 4PL6A 2KW4A 1LPQA 4JX5A 1DTTA 3SLCA 1R1TA 1GXQA 3NBPA 2JMWA 4E9EA 2XDPA 1XJWB 2YPRA 4F93B 1IG9A 4ZC3A 2LJ1A 4BGAA 3CCEI 4P9FA 1OPCA 1EV7A 4M6YA 2F8SA 1VNDA 2FB7A 3HFOA 1ZR2A 3H1VX 4LLNA 4MFDA 1Q7YU 4YOVA 1Y1WJ 1SL2A 1XQHA 1S3JA 2CUDA 2EYZA 3LSRA 4M3TA 1USSA 3DWLA 2CMPA 2M0YA 1IGNA 1Q82U 4L5GA 2RQTA 4CVNE 3CO6C 2XGXA 3U9ZA 4RMNA 3RKWA 1R8OB 2Z16A 3MP1A 3U1DA 3OYEA 5GAOl 2EBIA 1BIBA 5J2QA 2IA0A 4DZPA 2QA4I 1XGMA 2DJZA 4RDUA 4XKVA 4P1WA 2DYSH 1TL3A 3QJ6A 3HKZA 4X1VA 1VQOI 2F2WA 5GAGJ 5FO5A 3B73A 3MO8A 1F9NA 3KJVA 4KGXB 4JEPA 1N32K 1TUYA 4M7AA 4ZDPA 4DV4K 3OS0A 1IZ1A 2DEUA 3HKSA 4LGWA 4DFJA 4MO4A 2UUCK 4M72A 2RHZA 3ZQ7A 2YLBA 4B9VA 3L8BA 5FKMA 3CC2T 3W3CA 4UY8O 1Z3YA 6AT1B 1E6GA 2M8EA 3Q7BA 4DU4A 3FR0A 2P5OA 1YITN 3W6VA 4LH5A 4NYFA 2DK5A 1PKSA 2EFWA 1N9SA 1U48A 3VEOA 3CD6I 1VSIA 4GMJB 5IWAK 2JA6J 1EXQA 2JJ9A 1VQPQ 4M7DF 1U47A 3WNEA 3ULQB 2AK5A 3BPVA 1AEYA 2JW4A 1ZN2A 4UOBA 1HQEA 4VUBA 3G7ZA 4XN0A 1S6PA 3GTPJ 5FWBA 3FZHA 3GWZA 3J7ZI 1E2XA 1PP8F 4HV6A 3SYZA 3ZSOA 1UA0A 1X19A 1P92A 4EA5A 3IV5A 2EHGA 3EPZA 4XK4A 3THYB 3HOWJ 4RTZA 3HSTB 1FKPA 2QEXI 3QNOA 1HW5A 2VWFA 2JMAA 2K9NA 3ZCOA 4B9UA 2ZXIA 4OMFB 4AUXA 2OQRA 2HSTA 4HT8A 1ZR4A 5F1XA 3K0SA 1AWCA 1MNMC 1D5AA 3BCAA 5LRSA 4HUGA 4CC4B 2HHTA 5F0FA 1G3YA 2LMJA 2MW8A 4BB7A 2DCEA 5AQVA 5E8GA 2HB5A 2IIRA 2NRRA 2HU9A 1J5EK 3SEQA 3JRGA 2NAZA 5C0YA 4A57A 3NEUA 2DMNA 2J5PA 5L8RE 1ZQ1A 3N5NX 2LQKA 3H0HA 2LDUA 2XY6A 2X48A 4HWIA 3CCEQ 3HRMA 4ISEA 2P9SB 2W10A 2H3GX 5M1PA 1U5TB 4V2FA 1TT5B 2HKOA 4KPYA 4EVVA 4FU6A 4BWJA 2KL4A 2WB1N 3BG9A 1HNZK 3DLBA 4OLAA 2B6AA 2YSQA 1LKXA 2KRCA 2XIDA 2YCHA 2EYWA 2LK2A 2RHXA 5J4VA 2RQUA 4KBOA 4OLBA 3LSJA 5D5XB 2Q3SA 3X24B 3LFUA 3ZMUA 1NTCA 1O7FA 4BC2A 1WX6A 3IRRA 4OMPA 1OV3A 5D8LB 4KHQA 5CK9A 2HBKA 1JCFA 3WTUC 4Q5VA 2OJ2A 3ZMTA 1MJ9A 2GBYA 4N9HA 4XLEA 1QW1A 1F43A 2AS5F 2XPVA 2KVQG 1IHWA 3FLGA 1K4TA 3KXTA 3REBB 1USTA 3VQDA 4W5OA 1RT1A 1R77A 5KQ8A 3T1YK 2HVSA 3Q9SA 1VQLN 4DFKA 4CJVA 3E6DA 3HZ6A 4P5NA 4M77C 2X9HA 5ELZA 3TU4K 3V7SA 1JJ8C 1OI1A 5LJ5f 3GFLA 1BOBA 4CEAA 4KREA 5HLFA 3VS7A 1SC7A 2X6YA 1V5GA 3CC7A 4M9XA 2RQQA 2VKDA 1W4MA 1RT6A 5JICA 4H0EA 3BOQA 1F4KA 3VF2A 3C6UA 4ELVA 1IH7A 1M27C 1IKXA 1E6HA 4M7AB 4OAYA 4U87A 3RCOA 3L4IA 1QE1A 1W1WE 3IH2A 1TQIA 4IUQA 2ZMEA 3KLFA 2R7RA 4YPHA 3RZOJ 1OULA 1SPKA 3ONQA 3QP6A 4KHNA 2HOSA 3OYMA 4BU2A 2YU9J 1VQKA 1YJWQ 4C8QA 4B9XA 2ZO4A 4L18B 1B72A 2Y2ZA 5AQLA 3E66A 2RA2A 3T3FA 1VZ0A 1XHXA 3LA3A 4BC3A 2AO9A 3F72A 4IG3A 3RSEA 1AHDP 2MMPA 3C4SA 3I4MJ 5E41A 4HQEA 3CCMN 3MZYA 4F04B 2BXZA 1RDAA 4KI6A 2RI5A 1ZGJA 3EG3A 5BOXA 1LEBA 2WAFA 4D8DA 1NPPA 2E1NA 4GGGA 3O80A 1BU6O 1KAYA 3NGZA 1HSTA 3FSPA 5TKYA 2KJBA 1BK2A 2JK3A 4KJZA 2NOFA 2E6LA 3NNQA 1ORPA 3H0GJ 3WU2C 2CS7A 1YRNA 1RI9A 4C0FA 4H0YB 1HF0A 2Q31A 5CHZA 2XKPA 3T1BA 4GY5A 1M5Q1 4M75F 3M4OJ 1XG1A 2P84A 2STWA 3L3UA 5F27A 4XTUA 2YHTA 1VQ4T 3EG9B 2F1LA 2EKHA 4BI4A 3PL8A 3I64A 1ZLKA 1A31A 4AIAA 3SQNA 4JKHA 3MJXA 1IKVA 5KRSA 2KGTA 2QKKA 4BJTA 1I39A 4K41A 5A2QE 3GL1A 5DM6L 4Y7NJ 4CEEA 1WPKA 3QUIA 4DNCA 3KCCA 3NWTA 2KTQA 5CQXA 3DLAA 2RHYA 4IFVA 3AVKA 1MBJA 1WEGA 1MMGA 3K58A 2E65A 1RR7A 1BGXT 3OYYA 1S1UA 3RPQA 4G6DA 4E4HA 4MLEA 1KC8C 2WBNA 4HHTA 1JXBA 3THWB 3SAFA 4J9GA 1LJ9A 2EK5A 3JCMW 1ZHIA 2E1ZA 4JD2A 2Z5UA 4M7DE 2R7VA 5KAIC 1LE8B 1VQOQ 2VE9A 4IHSA 4FWQA 3HOXJ 6PAXA 3ASOH 1G59A 3V42A 1UG1A 1XX5A 2HF4A 2V8IA 1HC8A 4FW2A 4OPJA 3F73A 1VSDA 2FU4A 3GPLA 3TSZA 1ESVA 4FWOA 4DTXA 3VOEA 2OFKA 5HS9A 2NOBA 3M5RA 1IBLK 2XV4S 2LKXA 4DTSA 4QT7A 3KIOA 4CI0C 4RG2A 1WHLA 3IMXA 4C8MA 5GANh 1I5LA 3NHNA 1K79A 5FKOA 2K3FA 4YTLA 2ENMA 2HS5A 4DFMA 5HNFA 4BREA 1N8RR 4G12A 3M8JA 2DDBA 3L2ZA 4FQGA 2VQEK 5IYDJ 3AV9A 2BTTA 1BQMA 1R49A 3UDCA 2COZA 1WKMA 4I9QA 2ZMEB 1M1EB 3UF4A 3IAYA 2YNFA 1MBKA 1K9MR 1EA3A 4RB1A 3I5UA 2VJ5A 5GAN6 3M3YJ 2E19A 2L2OA 1B72B 1Z6TA 1RAAB 4ORZA 4PJOC 4CHNA 5ERIA 3NF7A 4M78C 3I55I 3H5NA 3HOSA 1SFXA 2QWOA 1NGAA 3JCMJ 2OAWA 1X3NA 1R5GA 5D4SA 4E0DA 1TK8A 1K9MU 2VXFA 3J81K 4JJCA 5KCHA 1NK5A 2RD1A 5AYFA 4PJ0C 4CZMA 2ITGA 4L0ZB 1SD4A 3OL3A 2LCLA 2K3XA 3U2RA 1Q86O 1ETWA 4CGHA 4BD3A 1YRNB 3FFKB 3CCUI 2RAEA 4PKGA 3TR8A 3DRRA 2GEMA 2HPIA 4HDVA 1XNQK 2R7WA 2XAQA 1UDLA 2X4YA 3FM5A 1HKCA 2VKHA 4AH9A 3BG3A 2E4HA 3EG9A 1WI7A 4CD1A 2QEXN 1SAXA 3GO5A 3CCVA 2ABLA 3LSMA 1W9HA 3BGRA 2P9LB 1XMOK 3RKYA 5LL6S 4CGIA 5HDNA 1GOCA 2ROLA 2JA7J 1BDGA 4RCHA 5CE3A 2A1RA 3EHRA 1R5HA 2GTDA 3F5TA 2ESHA 4LDXA 1RDUA 4NQWA 3ZQQA 1WJQA 5IXFA 3VOVA 5SZTA 3JV3A 1IXCA 2NVTJ 3MDQA 4EMGA 1VQOT 4A12A 3MPUB 3V9WA 3J7AF 2A42A 2AZVA 5FGMA 4FETA 1Q8IA 2JJ7A 1ZGAA 1YQMA 3GZ6A 3FE1A 4ILGB 5ILUA 4L9JA 3M53A 4JD2B 5HBMA 1Z9ZA 3H3ZA 5LJ5h 2Y0SN 5EJCA 3I35A 3MCAB 3D4VA 2XD0A 2K9QA 1W4SA 3LWIA 4N4NB 1F1BB 4QQDA 4IFYA 2EFQA 3W2VA 1FEXA 1V3FA 4CERA 3RWUA 1JJ6C 1Q81C 3NF9A 2XROA 2BE9B 1NGEA 2M4KA 1D0ZA 2P6SA 2X6XA 2LT4A 2KPMA 4ZYHA 1S1VA 1M1GA 3NDKA 3GTGJ 1L3LA 4IL6C 2CGPA 1X3MA 5DUKA 4XQFA 1BC8C 4J6YA 5GMKi 3JB9I 4MQ9F 1J75A 2OTLI 4PIIA 3DB3A 4HVUA 3HBLA 2H6BA 3KE2A 1FKOA 1HQCA 3ECHA 4NCAA 4Z88A 3MZ8A 1KQJA 4LJZF 2JZ2A 3WG7H 4JDSA 1ZBHA 5DD8A 2R7TA 4E7IA 3FXRA 5DM7L 3JCMc 1K76A 3RYRA 5A0DA 4C8OA 3M1EA 4AG2C 1YUWA 5AN4A 4AFQC 3IUCA 4S04A 1EIFA 1SMYF 2I5WA 4CBUA 1FYKA 4LD6A 1C6VA 4O4GA 2WY7Q 4C0DC 3TREA 3GBTA 3T8TA 4HCKA 4M4ZA 2YHBA 2FUG2 2EQJA 1NK7A 4RM2A 5EG0A 4GLKA 5HLIA 3CUOA 4C8QE 1LNWA 5E3NA 1IDZA 1FSEA 2CP3A 3GNGA 4TSXA 2QF7A 4FJ8A 2G7HA 3K4MA 2NZTA 5LY3A 1IAWA 4DKWA 4M3FA 2QKMB 3HSBA 1RAGB 3NPFA 1HRHA 3KZBA 5BRHA 4FISA 3CC4N 3BR2A 4C8NA 2L0AA 4H5WA 2M3AA 2PBIA 4JKFA 1MJBA 4ZTJA 2XAFA 3RBBB 2JZYA 2P0PA 1S5LC 2PMUA 4FYYB 1ORKA 2KZZA 3N5BB 3ZL7C 5AFUA 2VXDA 4FASD 4DV0K 2Y69H 1PJRA 3BDPA 4EJZA 4FYVB 2J6KA 1FBSA 1T6CA 2CUJA 1LOJA 1RT7A 2HDCA 4KIBA 1WSIA 5AQYA 4DS4A 2HTSA 4CF0A 3SDGA 2OUMA 3FXMA 4W5TA 3RTRA 5DS9A 4O6JA 4HT9A 1PRMC 2L3QA 3KBGA 1MGTA 3A01A 1KAZA 1VSKA 2DL3A 4JZ4A 4OO1J 4OF1A 2F5KA 3JCMf 4BDPA 2EFPA 4UNOA 1I3QJ 5EOYA 4DB3A 4XU0A 2Q2EA 3GOXA 2NNYA 4D1QA 4LG3A 5FU6C 2A61A 3CMAA 2W48A 4M3XA 4LDUA 3WODF 5DV5A 5F2RA 2J7IA 1YI2N 2RNAA 3QYFA 5DEQA 3QBWA 3AHUA 2GQIA 4FE4A 3OBWA 1IN7A 3PQJA 2LNBA 2RHKA 4CI6A 1TH7A 4C8QC 4AVPA 3J81Z 3PSIA 1GOAA 4D9JA 2WONA 2ZPIB 4AHSA 1GLBG 5FD5A 1T39A 2JHNA 3RR6A 2L5QA 2KT0A 4IVNA 2BV6A 2MGQA 2XB5A 2L8DA 2Y1IA 1QVGS 1ZG5A 4ZDLA 3M8PA 3S3OA 3KVGA 1W97L 3PQKA 1I94K 1DT9A 4NBQA 4I9LA 4E70A 4M7YA 1IN8A 4I98B 1VQ8T 1SD7A 1XB4A 1IGUA 4JPBW 2N8GA 5ICEA 2L3DA 4YIRX 2B5JA 3CJ9A 5HS8A 4NZGA 3CERA 1K4SA 2JVGA 5GAOn 3T7ZA 1N75A 4ZZDA 3G71N 3JSPA 2K3YA 3BQYA 4EHTA 2LLKA 2FQ3A 2CGLA 2O8DA 1S1WA 2YU3A 1TC3C 4FLXA 2HXOA 2DFIA 3AVBA 4PKHA 1VQ4N 4FLTA 1IZ6A 4MIMA 2HVIA 4CESA 2HHUA 3VYGA 1UHMA 4JHDA 2E36A 3ENOA 3O9SA 3HO1A 2DA3A 3GDQA 5DDGA 4C92F 4CC7A 1U84A 3TI0A 4RTTA 3GBGA 4KIGA 1EWQA 2D4WA 1LAWA 3OYHA 3VQPA 5EEHA 1MNDA 2IEKA 2ELJA 1N27A 2Z99A 2Z1GA 4H8KA 1NLOC 4F7ZA 2JUGA 2KKOA 2G0EA 3K1NA 2JA2A 3OYJA 1JLEA 3HGGA 3HHHA 3HVTA 3KD5E 1YJWA 2ZM6K 1P90A 2YX4A 5CKBA 4XKCA 1SAUA 3ITHA 1EO1A 3WUHA 5AONA 1ZLJA 3OYAA 1X1AA 4CJ4A 2GIVA 1VIEA 1IJWC 2X78A 5KTQA 3VU3C 2IGNA 2RH2A 4KV8A 4Q48A 4FVUA 4OU0A 3HTRA 3GG4A 5LMNK 4KDPA 3RQ4A 3J7YP 2GUIA 3LWLA 3R6NA 3G71A 5FFZA 5AQFA 4DQ2A 1IF1A 1ETVA 2VPLA 5CAIA 4ICLA 1B9NA 4H5VA 3H92A 2DOEA 2HQHA 5GAEJ 4A6EA 1RC9A 1S72I 2O0YA 2DL5A 3SK3A 4FK2A 3GFJA 2WACA 4HEA2 4WXHA 3A01B 3TKYA 2GLOA 3ML6A 1H0MA 1M4ZA 3KZZA 2FHDA 3CCSI 4DR2K 3KUFA 2FO0A 3LZJA 1AKHB 1NG6A 2HQ5A 5JLWA 3CVSA 5BPMA 1RT2A 1Z67A 5AIQA 2PMZN 2EPDA 2B0LA 4RA2A 1VYTA 4C92E 4BS9A 2JXBA 1NMDA 3CFPA 2IXSA 2JPCA 3VGKA 2V26A 2ZXWH 5I2MA 3H45C 3CDLA 3G71I 2DXUA 3AL0B 5CKHA 2FZCB 3RSNA 1PUFB 2GFAA 2DTIA 4WXCA 1KG5A 2CW8A 4IOXA 1MDMB 1YITI 1KYWA 3BCBA 3N4MA 2MPXC 4M3YA 2WTEA 3I71A 4G9YA 3C0BA 3P9CA 2E1OA 3TARA 2W84A 3HFNA 4N4OB 3ZBDA 1DLOA 4CK3A 3VEXA 2D0NA 1WRJA 3EGXA 4PSWA 3MKLA 2A36A 3SEMA 2XHCA 4HF1A 3PX4A 1FN7A 1HYOA 3J7AY 3JSMA 2EZIA 4C8KA 3DI6A 3C7JA 4PUOA 2EQIA 5DUIA 1SVOA 5KK1A 4FYXB 3PIOA 3FK6A 4ZYGA 2KDSA 3M9QA 2X6NA 1EF4A 3MEEA 1WHGA 3QWLA 2LCCA 5L3GA 1Q95G 2OA4A 4BRNA 2E3HA 4GYIA 1GFDA 2M51A 4MFBA 5AZJB 3QEIA 3HVRA 3HRTA 2DVJA 3CC4A 1EH7A 2OX7A 5FKLA 1P4WA 2JOYA 2KMUA 5LGUA 3GVAA 4KO0A 1Y6IA 1TLHB 5KPTA 3AO5A 2X4WA 2QQRA 2EZKA 5FB2A 4FVMA 3BROA 1V76A 2IVNA 2ASPA 4M7DD 4JI6K 5HKCA 2R5YA 4RAYA 4FLYA 2I2LA 2V8JA 1T6SA 3F8FA 4BWMA 3ASKA 3HHGA 3LNQA 3QPLA 1WHKA 2D5VA 1FOWA 1VQ8A 2AKLA 2ID6A 1YXQA 2NVQJ 1H3ZA 2FX0A 2JPBA 1FZPB 2EIFA 1JXOA 3ZT3A 1LW0A 1YVNA 2L9RA 1OQYA 1IV8A 2DZCA 2XRIA 3OYDA 3F0ZA 3HYIA 2ZE2A 4KULA 1YOVB 1XC9A 3SUOA 3CC4I 1KVBA 3K69A 1N8RU 3EGUA 1BU1A 4QQGA 2P9UA 1TQPA 2F4MB 1KFZA 1TS9A 4W97A 4V2SA 3QLHA 2JM9A 1BBYA 2W85A 4FWRA 3H1CA 1KLMA 2MWPA 1XGOA 2KZMA 2VQFK 3CF5L 3G4SQ 4IHTA 3VTIA 2QEXA 3D7EO 1N36K 2HDWA 1SKRA 1F1ZA 1MMAA 1KG4A 3QAHA 2O4XA 4PDKA 4DF8A 1AOJA 1T08B 4CCKA 2RF0A 1T03A 3EYZA 5DLQE 3NGIA 3M0SA 3ZETB 5L23A 1YWPA 4NO7A 3ULRB 2OANA 1ZTRA 2ELKA 2ZJ2A 1PUFA 2OFIA 1KK7A 2HCKA 1VSFA 4CJ3A 3CZ6A 1QHTA 2A69F 2F2EA 1J6ZA 2FPFA 3FRNA 5E20A 4EJTA 3M1FA 1Y57A 4DTRA 3MXJA 2CDTA 3CWSA 1JQQA 3BR5A 3M9AA 3EDPA 2F5TX 2L9VA 3JB9H 4XLFA 3LH0A 4I6ZA 1OVQA 3QKJA 2LKPA 4N0AA 2LQNA 3DKYA 3NH2A 5ILSA 3CW7A 1Q7YR 2NOIA 3EGXB 4ZJZA 5M1NA 2F2XA 4XSZF 4UNFA 1B92A 1Y39A 2XG8D 4CD3A 2NVXJ 3D0SA 3DLLA 1YI2A 1TW2A 1STZA 2PBDA 1KVCA 2KIMA 1BQNA 5JLFA 3CESA 5IY5H 4J9FA 2D0BA 4FJHA 2W04A 4WCEL 2DVEA 2ZGYA 1LAVA 2IC3A 2KT8A 5FPMA 2CQ7A 4M77A 5GAN8 2P1JA 2ED1A 3O5BA 4HV5A 3O3GA 1UGQB 5FROA 5AZJA 5E17F 2ZGWA 4MGRA 1IKWA 1SUQA 2FEIA 5LHIA 1V54H 1FMKA 3CC7I 2X85A 3RMDA 2LRQA 2JT4A 5HY6A 2NRVA 3MK6A 5JS2A 3RMSA 5HDKA 1W0HA 1FT9A 1Z9QA 3O8GA 2R7DA 4NCBA 4WFNL 2B63J 4JI1K 5LJ3d 1QVFS 1JGSA 3WTXC 3KKSA 1IUYA 3VS2A 5FLXK 3MKDA 1ZSZB 3AA2A 2COYA 5DYMA 4YHHK 2E7XA 1WUAA 3ZR8X 2BY3A 5GANd 4RLFA 2ELHA 4I6MA 4OIPF 3WHBA 2BGCA 1AZEA 2IS6A 4JZ3A 3TQNA 2IS1A 5FWCA 1YHQT 2E5LK 1VQ7I 4LF5K 3VQCA 2CP5A 4M77G 3OQ5A 1T44A 5AQOA 2BZYA 3AVNA 5J2NA 2I0NA 1WSJA 1TOVA 3LSIA 2PLYA 4IUPA 1X4PA 4QVZA 3K4NA 3CMEA 3MX5A 3BY5A 3BW1A 4WQ4C 3QDFA 1RUNA 1E4FT 4EMKC 2DFUA 3THXB 2IVWA 3D5RC 5FLMJ 1H1VA 1UA1A 2DM1A 3K4BA 2HHWA 2HQXA 1BKBA 4BDYA 3AY9A 2XDBA 4PNOA 1MGQA 1VRUA 5JVGF 1KC8R 1P7MA 1VQMQ 3I55N 3CCVT 3PO3J 1EP4A 1Q18A 3KP4A 1OH5A 3VQ5A 4CCMA 2XHBA 4NDLA 4LUDA 4BQAA 1HJOA 2H1KA 1IV6A 2DBMA 5M9OA 3L1PA 1ABOA 3RMCA 3K9KA 2EV0A 2KRMA 2K5LA 1HJDA 2HBMA 1QPIA 4OAZA 1BO5O 4ZHRA 4KYWA 2QQSA 1QQIA 4Y52J 1OISA 1T3SA 1OCOH 2OC6A 1H3HA 2BW3B 1OCPA 2GCXA 4Y13A 4PY5A 3ZETA 3IKTA 2CP2A 3VUBA 2DNUA 2O9VA 4C92A 1JLQA 1NBEB 2E2IJ 2QYZA 3A8GB 3JB9J 2XY8A 1Q1VA 3RPUD 1YS6A 2KEAA 4AFUC 4ME7A 3QDKA 1OCZH 1GV5A 3ID6A 4OFAA 2QDYB 3CPWA 4LITA 2GQQA 5CYVA 3OWTA 4CJSA 1K8AO 2KBTA 1KQ2A 3LQQA 5AQUA 1NJIO 4BROA 3EFRA 2FBVA 1NGDA 1SFOJ 2PVOB 4Y92A 3R9PA 4ELUA 4GKKK 2P7VB 3PUFA 1YVUA 3FKJA 1W2BM 4AHTA 2D0AA 2D1XA 1ZBUA 1WSFA 2DI3A 4M3BA 3FMSA 1RCHA 2QA4Q 2DTRA 2RQRA 1ENHA 3PTAA 2QGGA 2YI1A 4IBNA 1Y97A 3FZMA 1SFUA 4KTZA 2B7EA 3DOKA 1QLYA 3SMSA 2FXUA 2AHJB 3JRZA 4A0ZA 2R7XA 3B6PA 1MD0A 4KKOA 4M3GA 3SDZA 3E1YA 2AKKA 5EXWA 4J2DA 4J9CA 2CYYA 4DGWB 1TQMA 3VPZA 4MDXA 1V5EA 4J2AA 2FEZA 4N4IA 5GADP 4FX0A 1J5OA 5JVGL 1N78A 1F36A 1KVAA 4Q5SF 5HLHA 4UUSB 1K0XA 3DPLC 4KHYA 4R1HA 1U78A 2ISYA 5LLQA 4LF6K 1NG2A 1KGSA 3MKWB 2NYSA 4UVAA 1MWMA 1JXEA 1WNLA 1VQON 2R7UA 1OMIA 2F96A 4DCHA 3ESWB 3ZSZA 3SZTA 3RRGA 1YLFA 2ISZA 1T0FC 2BANA 2EA2A 4C5GA 1S22A 1YIJN 2HZTA 4LY7A 2D8JA 3GFIA 1VQLT 2BKDN 4YY3K 1Y96A 1MUNA 3H08A 5TRDA 1MV3A 2VG7A 4HZFA 4BY6B 1Q86U 4BR0A 1ZRDA 5L3EA 4Q5WA 3D2FB 1U1SA 2MF2A 2HGCA 3TSQA 3RVCA 3FC3A 1XPXA 2OTLT 1K4US 5HRSA 4E1NA 3F8NA 3DLRA 3M58A 2DLLA 3K1PA 1SVMA 5J1UA 3LCNA 1P9QC 1LFUP 3TSWA 2WADA 3GTJJ 2J6OA 1KXPA 4HUFA 3R6OA 2CW0F 3N97A 3T5XA 2WAQN 2M7AA 4M3WA 2IOCA 1ETQA 1WBDA 2PYJA 3DKXA 3P8BB 1YS7A 4A4HA 4RB3C 1YBYA 1XDSA 3DPTA 1VQLQ 3MXIA 3JREA 1AVZC 1K6OA 3S41A 4CEBA 3EUKL 3GFMA 2J05A 3WNHA 2P5GA 1Y8RB 2PUOB 2BDPA 2V75A 2CP7A 3IS9A 5BMZA 4FJIA 2VE8A 3VS0A 5LGNA 3MN5A 4CEZA 5AQTA 5E79C 5E18F 3V6DA 2OV7A 1FBUA 2C06A 5I21A 1YJ9I 1TKZA 5K5OA 2W40A 3ZFJA 5D5WB 5GPCA 3CCEN 3TO7A 2CQXA 2DA9A 3DLMA 2NRZA 3NVMA 3CJ1A 3VJPA 2K6DA 3CCVI 3DYAA 3ZX2A 3KYLA 4PJOF 3VSKA 1UG2A 1HCRA 1BI3A 1HLVA 2CQKA 3CJNA 2LJ3A 4PFPA 1VA7A 1ZBLA 2OTLQ 3I9QA 2IP2A 4XNFA 4L5EA 1J53A 2EWSA 3H3OB 2QG9B 2QQAA 3K0LA 4HXJA 4PHTX 2FE3A 3M0UA 2LG4A 1RPWA 5KH6A 3J7AP 1G99A 2XF6A 4CJKA 1KQ9A 2XB0X 2EKOA 4IEIA 4OX9K 4O0IA 2XHKA 3I8DA 4DTJA 3QYHB 3ABLH 4BGBA 5FD6A 4FWLA 5BN9A 3RYPA 4HPQA 5GAN7 5EEGA 4JS4A 2V51B 4HSRA 4ZYDA 1WQ7A 4M3DA 3BR1A 1RABB 1ZKGA 4MEYF 1X6GA 2GBZA 3WU1B 1HUXA 1LWYA 1BI0A 4HTUA 4KN7X 3AA5X 1FYLA 3D2EB 2EIJH 3I33A 1TW3A 2QGFB 3C7NB 2BOLA 5J3BA 3ZOBA 2RPIA 1XMQK 2WBMA 1ZBFA 5A0GA 2M1BA 4J7IA 3A5NC 4JI0K 5TISC 5GAMh 3K5LA 2NS8A 1PU7A 1G83A 2E4LA 4AFZC 3E6CC 1WVRA 4DTOA 3U4LA 1WJCA 2E2PA 2O8EB 2MCNA 4LK1F 2XDVA 4CFBA 2QA4T 3S2WA 5DY9A 1M3HA 4J01A 3O9UA 3QZ5B 4C8QD 1X9SA 1D9FA 4FX4A 2K9GA 1R71A 1JLFA 5AZIB 2HMPA 3ELKA 4X0GA 4CHUA 1VQOA 2G8WA 3I3LA 2X74A 4AF1A 2MH2A 4BC5A 4CF8A 2JTMA 5E84A 4FYDA 4IXAA 2ITMA 1U1TA 2L54A 2OBPA 3QNNA 1ZARA 8ATCB 2BHZA 2L0KA 1X58A 5BQTA 3QQAA 3DXKB 4GDFA 2Q1NA 1LDKB 3AKZA 2BH1A 4RW9A 5LHGA 4BR2A 1UFFA 1OU9A 5EYRA 4HF0A 5C44J 2FC0A 9ANTA 1IG7A 4BY1J 4M75C 4NUBA 4BEHA 4PUSA 2IS4A 3HJFA 3CD6A 3DMJA 4N4GA 3IDHA 3OH6A 2TRTA 2EJRA 3UKUA 4C2UA 1RL2A 1TTYA 2LBFB 4CXFA 1ZYQA 1Y07A 5DCMA 5KGXA 4CHZA 1KD1U 4UV9A 4GYGA 3ZT0A 1XCBA 4JBAA 1D4XA 2WSFE 2CH4W 3L2WA 2GX9A 3F8MA 5CVUA 4M73A 3L2QA 4J19A 5LMUK 3TSUA 2E10A 3J80K 3FZLA 3O6WA 1VQ5Q 4E7ZA 4E7HA 2VQCA 3CBPA 3LDNA 2X35A 2W24A 1GT0C 1Z0XA 3BJOA 5D6YA 3CC2A 1D3BA 5FFXA 2COMA 3FJPA 1H92A 2B8AA 1D0XA 4RBOA 3CWUA 4RKUE 4CJ7A 4DHYA 1IRFA 4KAZA 2QBYB 3TDUC 2A5YB 4AVZA 1RESA 4YIIA 1TUGB 2VYPA 4DQ8A 2R0QC 3ID8A 4JQFA 3SPZA 4KUIA 4Z8AA 3C6HA 4AMCA 2JNGA 4M77F 1VQ4Q 2HI3A 4P9UA 1J7KA 1X2KA 2KHOA 3NFCA 1NE8A 3ZSQA 1ZC6A 2K7LA 5BR8K 4A54A 2BUDA 4BQZA 3QOEA 1ZA2B 2EIMH 1JLBA 4BI3A 1KD1C 2C0OA 3N4PA 1IBMK 4HLXA 1NK2P 4X9DA 5LJ5g 3CFRA 4N9IA 4N41A 1CF7B 2L4AA 4RCCA 4LF4K 1MUDA 3CWTA 4DBQA 2ZJRF 4C23A 2X1DA 4E89A 4AQYK 1U5TC 2X6WA 3CCLT 4B3MK 4BDZA 3AGKA 1WSGA 2ZCWA 1C6VX 2E20A 2E2JJ 2Q8KA 2K9LA 3DCFA 3HOYJ 1YWOA 1MMSA 4C9YA 3SQ4A 5K14A 1NG9A 2JSCA 2BEOA 2LC4A 1YJ9Q 2R7FA 1YJNI 1UEBA 4FHTA 4WE1A 2YX6A 1R22A 4WCIA 1OX8A 3O1WA 1QS4A 1MW7A 3R60A 2W7NA 4Z94A 4FJ5A 1UHSA 4HTLA 2RJCA 4JYKA 3C6TA 2OA8A 4IHWA 2W4SA 1A5VA 2DYBA 2FZGB 1YJWT 4UB8C 2L3PA 1MMDA 5CKEA 3KP6A 5J4YA 4XLCA 3HSFA 2HKQB 1WSUA 2M02A 3DLGA 3R1XA 1WJRA 5AZIA 3K4JA 4J00A 5GIOA 3CCLN 1G2BA 5GAHJ 3ZSVA 1IXDA 2DOFA 4FZYA 2CRGA 3QYBA 3K4LA 2ZFWA 4I7HA 3KP2A 3F6OA 4M7AD 4K2EA 1O3RA 1VSJA 3A8MB 3LSHA 1AZGB 1CQTA 1RACB 3TP3A 4BGDA 1HNIA 4M3ZA 3FZKA 2G8HA 2DRMA 1NJIU 3VMFB 4KB1A 4RW6A 1ZYRF 4O3MA 2XGCA 2IJLA 2FSJA 1RILA 3CCET 1YQAA 4ZGDB 2KRHA 3MZHA 2JUFA 4BR5A 4NOYA 4L5JA 2BZXA 4G8XA 3FXKA 4OMYA 3UIQA 2PFBA 4QOZB 4EMKA 3UKUB 1K9AA 2V1DA 3BTCA 4CF1A 1ZUYA 2AIRB 2LBFA 1H88C 5DCMB 4FM1A 2VASA 1LCUA 3SDBA 3DLKA 1I6HJ 4FWKA 1QQOA 1WQWA 2M87A 4I2PA 3CD6T 2CQNA 4E7KA 4OOIA 1M3QA 4P96A 3QO9A 2V9PA 2J06A 1N25A 3WU0A 3PO4A 1I27A 1DDNA 2EIKH 3CLQA 3ASMA 4IO9L 5J1RA 1JJ2P 4YOXA 4FT8A 2E8AA 1FYNA 1XN7A 1G15A 2LKSA 3P8DA 1D3BB 3E9LA 1VQNI 2XHIA 2HYJA 2VUMJ 2KRSA 1G5VA 1M9SA 4Q4ZF 2E5ZA 5C10A 5EC7A 1QZZA 3Q3SA 1QQJA 3SUNA 1J09A 3D0PA 4J6XA 2H94A 4IWVA 4FM2A 2L9SA 3G6EI 2Q0OA 5B1AH 4ATOA 2VONA 5IYCJ 3L42A 2J4RA 1UHFA 1LVAA 2MA3A 4JYAK 1VQPT 1NGGA 5IHIA 4Y1CA 1S72A 1VQ6T 4Y15A 3CLOA 3FB9A 2A5XA 4GVEA 2WV0A 4CEDA 4CJTA 4BR9A 4CCHA 1ARKA 1LWWA 4PA1A 3MX2A 4YNQA 4XTVA 1YIOA 3CHWA 3T19A 1D1AA 4BHCA 2NVYJ 1D8JA 3HI0A 2MIOA 4BRGA 2JMCA 2YSRA 3HUGA 2VKVA 3BLYA 4AILC 5EZGA 2HNHA 1C0WA 3MFKA 1CXUA 3LDOA 2YKMA 4QSHA 2YX7A 1QGPA 3MWPA 2CH0A 1E3OC 4LB6B 3JRIA 4CGGA 3F21A 1VQNA 3JTHA 4GLMA 1K0SA 2Y90A 5KVRA 3LOCA 1JKQC 4IUUA 1L3UA 1VQMI 1NPRA 1EFNA 4OPKA 3RMBA 2R4GA 2ZPGB 5IN1A 3FDYA 2EA4A 5B8HA 3HSRA 1K1ZA 3EG1A 2FBIA 4XKWA 4EM1A 1IJJA 1U4BA 3K2AA 2ZNYA 4DLGA 1QSYA 2M30A 1PWTA 2X4XA 5LJ5e 4CK2A 2DKGA 4ENNA 2FBTA 3L09A 2HYFA 3VQ7A 1QHGA 3CPEA 4BQQA 3D5LA 1SKWA 3BR6A 4IURA 2KFNA 4J5YA 2ZJQL 3QHSA 1Z25A 3CCUN 2HBJA 3E5XA 2HHQA 1JHFA 1K61A 1WWXA 4BH9A 4RW4A 1WBBA 3AA4A 3PX0A 2OPSA 5F64A 3I0TA 4F4KA 3NMZC 1X3WB 4PJNA 3VQ9A 4B08A 4M77E 2OPQA 3G10A 2GA1A 3CUQA 5LJVA 4KHPK 2E60A 2MC4A 1GLCG 3DTKA 5LRRA 4I2OA 3AVAA 1TZLA 3DBHB 2PNIA 4J9BA 2KYMA 4BXXJ 5E3LA 4C2MJ 2NS0A 4M75B 2FNPA 2R5ZB 1XDUA 3E2UA 1HDPA 1UB9A 4IFEA 1NLVA 2DD5A 1WLJA 4WF9L 2LY9A 1YQKA 4CJUA 4E1JA 4ENMA 2V8KA 1IRGA 2QZ8A 1BYMA 5BPLA 1HOMA 3HOTA 2QWNA 1QHAA 1RT3A 2HNDA 3M8SA 1NGIA 5AFUH 1SRLA 3CCUA 2MD0A 2LJ0A 4KICA 1S1XA 4D5FA 3C94A 1PP7U 2M45A 3UATA 2ASOA 3BZCA 1U06A 2LCSA 4F2RA 1XMKA 4XTWA 1S9GA 2GZWA 1WAJA 5IPAA 5HROA 4LNPA 2Y9YA 3BY7A 3BEXA 5HDGA 3S17J 1LCKA 4AI5A 2MK5A 2FVUA 1N34K 4JX4A 4NC7A 4RAFA 1LVKA 1NZ9A 3GNFB 1RUOA 4JJDA 4AM6A 3KYDB 4Y33A 3SB2A 1XI1A 4IRGA 3OYLA 5E1WA 4A3MJ 5GAMj 2VBWA 4WXDA 4EJOA 4XRFA 3ZGKA 3V4GA 3NAUA 1N8RC 3FK7A 4A2UA 2RNGA 1SD6A 3PVQA 1U3EM 3NAEA 1CLQA 2FRWA 4FOIA 3IP4B 4AIHA 3TO9A 2R93J 3URGA 4LD0A 3OYFA 3V8LA 2R7YA 3HUGB 2H3JA 5M1QA 4JLGA 4QPQA 3I53A 4II3A 2FF4A 1IXSB 5KYWB 5KCMA 3G1MA 4DK9A 1SEUA 5FLXE 3M54A 2O8BA 1WXBA 2XI9A 1KZHA 1NJZA 2O61A 3M1CA 2F9TA 3G4SI 4WF2A 3O9QA 1Z9CA 1RDWX 1KSWA 2AQFA 3HT3A 2CZ6B 2EJGA 3VS1A 5HS7A 4BKXA 1Q1HA 4XLNF 2IVPA 1MU2A 3O4NA 4HX7A 1RRSA 1JLCA 4J6WA 5C2FA 2KIUA 1OCCH 3J7ZO 2P9PB 2P9KA 3G4SN 3EGDB 3WQTA 3ZQGA 1C0TA 3I55T 4A3EJ 4ESFA 1SHFA 3QEWA 2F4VK 3HTUA 3S93A 1YJWN 3FKIJ 5HVQC 1IG8A 3TAQA 3BR0A 4WX9A 4CA0A 4UB6C 1ZXOA 4JK8A 1DP7P 2O8CB 4A3FJ 3A0IX 5GP9A 3WG9A 1OYIA 1UZCA 1W36C 2W6KA 5ILVA 5E1XA 4ZN1A 3K70D 1IW7F 5CKDA 5FU6B 1KC8O 3SCXA 1VQPI 3BTLA 2MOXA 3CXCA 3CCQT 1YI2Q 3FXOA 1JCEA 2KRNA 4M41A 2XGEA 3TVTA 4M63C 4EAHD 5M5WJ 3HRSA 2CU7A 4XONA 4JKAA 5BRDA 3QFPA 1H89C 3KEOA 2WSCE 2CO5A 3KLNA 1AWJA 3TAEA 1YTUA 1MBEA 2XF5A 3ZP5A 1KU7A 4XOPA 5H6RA 5LJ3g 4FCYA 4H5NA 4FJ7A 2W25A 4EP5A 1E3HA 3V1RA 4AHUA 1CKBA 2R5ZA 2EWNA 3AAQA 4J9IA 3HPHA 1L0OC 4EFHA 4W1UA 1RBTA 1ZSGA 1OLTA 1K9MO 1YT3A 4EV0A 3THKA 1ONVA 3WGIA 2CV1A 3ENBA 3D5SC 4IHYA 1LJOA 3L1AA 4LDVA 3S6IA 3CCMI 2G6FX 4JRQA 5CYQA 5HNHA 1I1JA 5KRTA 3H35A 4M7AC 1BA5A 4KISA 1HNVA 1JE8A 1GVJA 1VQ7T 3LFKA 3HL2A 3W3DA 3J80O 1SS6A 4PJOA 1NHAA 3A98A 3MVPA 3R3LA 5D3GA 2RQVA 2W1OA 2AXTC 4AI4A 1VQ7A 3S9HA 3CCRI 1X1PA 2R5MA 4E7SA 4XK8E 3C3WA 4TVRA 3UR3C 3CMEI 1YFNA 5KYXB 1BI1A 1MZBA 2XPUA 3EYIA 3PUBA 4JJBA 4CHPA 2L02A 1YITQ 2E6ZA 1HKGA 3BPXA 1KG7A 1NKBA 3GP8A 1QVUA 2V1XA 4CGJA 4Z4HA 3PSFA 3REOA 4Z2YA 3KLIA 2CKKA 1Q81U 1GLJO 4EVIA 2RI2A 2YHWA 2ASMA 3NH0A 3VUZA 4KT6A 2BHYA 4A3GJ 2VG6A 3TCJA 3ZQLA 4EEFG 4RAGA 1W7PD 4FT4A 4Z4GA 4UC4A 3PNTA 3HK2A 2E3IA 2HKNA 2RN8A 3SNNA 1BJZA 3TOBA 1WH5A 3FXUA 4LG0A 2F48A 3DLLF 3T9NA 3PNVA 4J8FA 1QMCA 4M75G 2L7FP 2Y31A 2DTUA 1BOAA 4JK1X 4IRHA 4CICA 3Q0WA 4XIUA 2MAMA 4GNIA 3ZLJA 3MEUA 3CCRA 5EF6A 2LTOA 3VWBA 3JRHA 1XQSC 1DKGD 3NQOA 2R7ZJ 2BIVA 4CZCA 2ACJA 4LF9K 1Z7UA 4FOEA 2AZSA 2DRKA 3VQ4A 4J7FA 4A4EA 1YNZA 3HTSB 1R0CB 4I2QA 4DR3K 3DEWA 4JI5K 1NEBA 4G7HF 5F0XA 4ID5A 1TU0B 1KQ0A 2K7AA 3BTIA 2OAUA 2ZC2A 3C65A 2ESNA 2EQMA 3ER0A 3GLLA 3M57A 4A3LJ 2F8TA 2DA1A 1RKTA 3H8ZA 4AD9A 1G2HA 2NUZA 4F7UF 1KEAA 4JKCA 2BY2A 2M5WA 1N33K 4A3IJ 1K73R 4PJLA 3E97A 3SBTA 3OSSC 1TGOA 3JYTA 4C1NI 4F3QA 4N4HA 2M34A 1VQ9T 3N0UA 3BF3A 4X65K 1YI2T 2CZ1B 2KQ2A 3NWSA 1TV6A 2IBDA 2PX9A 2Y4YA 2GWKA 4EZ6A 2D2WA 1X9MA 5HOOA 2EBPA 1QQNA 2W42A 5CR2A 4FLWA 3SHFA 3EG2A 4QTRA 1BB9A 2LSNA 2DK3A 4B48A 4A62A 2CH4A 1NU0A 3AG1H 4L8RB 3OS5A 2L7MP 2DY4A 3CCJT 1BG3A 3J8AA 3DTIA 1MUZA 1PVSA 2QEXQ 4X66K 2KFDA 3QIOA 1DEJA 1UECA 3B6AA 3KFVA 3H3UA 5CKTA 3I0SA 4PLIA 3GLXA 2NOGA 4BG8A 1FX7A 3OHRA 1WH7A 3OW2P 4DQSA 3ULDA 4M78G 1KFDA 4C0ZA 2M0CA 2DK8A 1B8IB 3S3MA 1YIJI 1VOMA 3EY1A 2QTDA 1X2NA 1NGFA 4MQVA 2STTA 4H5RA 3U9GA 3TWHA 4KHWA 3TTCA 3L7WA 4KT5C 1WLPB 2FPEA 3CD6Q 1IHVA 2UUAK 4IX7A 4YIFA 1VQ8Q 2EJ9A 2JSPA 4FJJA 1FYMA 2D1HA 2IGIA 5JLXA 4BY9C 4B3SK 3QFUA 3LP1A 5L3DA 5TJJA 3UA6A 3B8AX 3CF2A 3CM5A 3R8EA 3EQLF 5GAN5 5D5UB 2K57A 3MP8A 4BR7A 5GAHP 1REVA 2HR3A 2VPRA 3THYA 3OSFA 2CQQA 1FP2A 2LY1A 1PUEE 2NRWA 3JS6A 4JRKA 5GAGP 3PM1A 4JRPA 3DBRB 4HCCA 2KHMA 4LE9A 4QVCA 2HEOA 1Z3XA 4AG1C 3I56Q 4Z02A 4C3HJ 3DJCA 2V7FA 4E9FA 2EQUA 3B6OA 4IOCL 3CCQN 3V4IA 5D6EA 3TTDA 3ALYA 2FG0A 3RESA 1YF5L 4TV7A 4HNUA 3HOZJ 2FPDA 3SAHA 3ZMVA 5SWMA 4GKJK 4CZFA 1EH6A 2IS2A 5J39A 2PU9B 4B1ZA 4AIDA 3RKXA 3CCLI 4L9NA 5IT9Z 1LFBA 3KETA 2QQBA 3TU5A 5FPDA 2KYBA 4I01A 2DMOA 4F9OA 2P0QA 3U21A 4UVBA 1GBRA 1MHNA 1HK9A 3LSPA 4B1WB 1IN4A 1BC7C 3CETA 3JCMd 4JKEA 1QBJA 2CREA 2KQRA 2YDLA 4L9VA 4D7NA 3LA7A 4LDYA 3DEEA 5J3LA 3H9JA 5AT1B 4BRHA 2Z9OA 3EFSA 3BUZB 1N39A 3P7NA 5EDNA 3QO3A 3GYHX 3L2UA 2D0QB 4NXMK 1SKSA 2K2MA 5AQGA 5CQEA 2F5EA 1XC3A 3RMAA 5GAOq 2D5RA 3LZIA 3O1BA 4EATA 2RHUA 4GO1A 1JTYA 4OJRA 1T8IA 4RMOA 3NVKA 2HQAA 4GCVA 1BJAA 2EAYA 4UHTA 2FXAA 3PGGA 3SXYA 1C0FA 2CV0A 1VQ9A 4ESRA 2OPRA 4IIOA 3KPHA 5CZ2A 4JKBA 3EKSA 1NYFA 5D6XA 1KG1A 2VC0A 5C12A 1Q86R 1EQYA 5CYMA 5J8CA 4AHVA 4DBFA 2Z1JA 2DOAA 3SQ0A 1FXXA 2I5UA 3GE1A 2IRFG 2LD5A 3CCMT 3L0QA 4RTWA 1TBXA 2E1MB 5E8IA 3S1MJ 1AHJB 2GXGA 3MD2A 1SSHA 3G6EQ 4KUDK 4BG9A 3HSEA 4ESJA 5HRPA 2QWLA 2RKIA 3FFIA 3KWGA 2Z1HA 4FW1A 4DOWA 3I4PA 3GTKJ 4CIEA 3CMET 2Z3YA 2QQ9A 2EPFA 3RERA 3K5NA 4LIUA 1DJ7B 5AQSA 2H56A 4C8QF 3CMAT 3QICA 1VQ8I 5HRRA 1VF9A 4KH0B 1O4XA 3GTMJ 1FY7A 3JRFA 5D8KB 2K9SA 3TBIA 1U6ZA 3MN7A 3K2ZA 5IT9O 1M1FA 3J81E 2PQ8A 4MLHA 1JJ2M 3G2BA 2E5KA 3PV8A 1WGXA 1CSKA 1QTMA 1N6QA 1LQ1A 3H0FA 3QU3A 4JI4K 4JI7K 3VRZA 2GELA 1TUUA 4U0VA 2ZJPL 1WGSA 4W5RA 4UUTA 2HHHK 2DQRA 4JJNK 2H27A 1N9RA 3SI6A 2AXLA 1BW5A 3VYUB 1SANA 3KK1A 1NJWA 1K6YA 3CCQQ 3CCRQ 3ZEUB 4DTMA 4WQ4A 3AAFA 3JCMb 3HPOA 1M8VA 3CJTB 3GMEA 3RI4A 2WUSA 2EYXA 1I81A 1TAQA 2QWQA 1WHHA 3EH1A 3DFGA 2NUTA 1BCMA 1ILYA 1MBGA 4EM2A 4EDUA 4XN3A 4B24A 9ATCB 2XSDC 4CEQA 4P55A 4M78E 2DYIA 3LALA 1JGGA 4YEJA 2A6TA 4H0TB 2QCOA 4XSXF 2DL7A 1VQ6N 1L3VA 4IKFA 1KHCA 3TOAA 3I56I 3OR1C 2OCCH 3F22A 3SAGA 3WQUA 2YS9A 1VQ5N 5TKWA 1Q86C 8AT1B 2Z1DA 2HZDA 4O8KA 3I5RA 4BHPA 2ZPEB 1E7OA 1VQ9Q 3IHUA 3CCVQ 2B86A 5E3MA 4XH4A 4EHUA 2ZSIB 2O8XA 2RK2A 4WK8F 2GQVA 1QVFM 2E5QA 2M7BA 3WNGA 4OB0B 1YIJT 2BGGA 1YYVA 1YX5A 5KYUB 3THWA 2KI7A 3RRHA 1IRXA 2O5RA 5ADXA 1G3TA 3EHQA 5BS6A 1LFPA 4F2SA 5B1BH 1HQUA 5GAMg 4CZLA 4EZ9A 1YI2I 4OB3B 1RI7A 3X26B 2K2VA 2FF6A 3TAGA 1NH3A 4RGSA 2WFBA 2KJCA 1ERDA 3QIPA 2L7ZA 3LL3A 2R92J 1JU5C 3CXCM 3KZYA 4FXDA 3I5SA 3SUPA 4NXNK 1YJ9T 1K8KB 4XIDA 4NHJA 1NK6A 5CVRA 3GCMA 5GANg 4XTYA 4NS5A 1BM9A 1HR0K 3F70A 3G6EN 1T8EA 4XMYA 3K4CA 5D6WA 2YKNA 5IT3A 4A5MA 4F17A 1VK0A 1YQRA 3P9IA 2QI2A 4IOAF 3C1DA 3MWMA 2D6FA 1GDTA 1VQ4I 3K5MA 4B9QA 5LJWA 4LN2A 1SRMA 1JEGA 4H4KC 1HA8A 1MBFA 2H3EB 4QS9A 1F21A 5DM7F 2X3WD 2R3SA 3OSGA 2G8FA 4I0AA 3E0JB 2K79A 1N3CA 1U9OA 1L5UA 1UAXA 3CJ7A 1RZ4A 2OTJA 3F8CA 1HYVA 2DXBA 3A2KA 3FX3A 4BBRJ 3J81O 4HG2A 3AVLA 2ZPHB 1NNEA 1DUXC 3CMEQ 4CZKA 3RDVA 3IH7A 1W7PB 2VN2A 3VRYA 3SFMA 3S6WA 2W00A 1QRYA 1DIZA 5GMKh 2C0TA 1ATSA 4KUMA 3OOPA 3UE5A 2DFEA 2Q0RA 3IKMA 3QESA 4KH4A 1HSJA 2E34A 3OMCA 2VOOA 2ECBA 2HHVA 1QVGP 4YOWA 3EN9A 3SHWA 4IEJA 3ZT4A 2K5CA 2K02A 3GX4X 2G9WA 2CGHA 4C8LA 3DLEA 3TL4X 2RV8A 1RRJA 4S05A 4N5SA 1KAXA 3K6GA 3CJCA 2HW3A 2NUTB 2OQGA 2KZGA 3CMYA 1I50J 4XR6A 1D8KA 3HDDA 1FJGK 1VQKI 2E2QA 4GY2B 3LP3A 2OTJI 3G25A 5IXBA 4XL9A 1HPMA 4AWXB 5AQQA 1Y8QB 3J7AO 5DD4A 2HQRA 5E3OA 1BL0A 1W70A 4OWRB 2P9LA 4L3QA 3ZCMA 1WJBA 3MWTA 1NGJA 2A3LA 4M3RA 4M78B 2V1NA 2M2EA 1B3QA 4A69C 1QKWA 1RAEB 2V1RA 2MG4A 2F5FA 4KA4A 4NQWB 1O9SA 1QA6A 2Q36A 1RT5A 1ZELA 3AAPA 4NLCA 4B9NA 3WVDB 1WI9A 4KMUX 1ZG3A 3EL2A 1VQKQ 4M6XA 2V1UA 3ZPLA 3T1AA 2X1CA 4DR6K 3OB9A 2M0OA 2KMTA 1NJIC 1DP3A 1WZOA 4CZIA 1YHQN 1HBXG 1M90U 2HBPA 2ATCB 2RQPA 3PT9A 4F3OA 4ZYAA 1X1DA 1S1NA 4BRPA 2DN0A 2F5CA 4F8RA 1FK9A 3OS1A 1BIUA 3H9GA 1WHJA 1K8KA 3SBGA 2HDAA 4RTUA 3A8OB 3HM8A 1KG2A 4ZNXA 4Q47A 4RGUA 2P81A 4RTXA 4LUEA 1OYXA 5KPZA 3QG1A 3G1OA 2EJFA 4L59A 2PMHA 4Y17A 1I3AA 5J1YA 1Z77A 2A37A 3QSUA 2FSKA 3IH3A 2XUBA 5I11A 3AVFA 3CXCS 2YHYA 2XRNA 1QVGM 4II1A 1TL1A 4BRFA 1ZAOA 2HF3A 4GV3A 1QZEA 1U9NA 4XTZA 1MBHA 4K8XA 1I5ZA 4WCGA 2P5KA 5C2DA 1FP1D 4DU1A 3VSLA 2CUEA 3ZQHA 1S6QA 3PIPF 2LDMA 1XSVA 2JA5J 4HF2A 3EEQA 3K7AJ 4Q0BA 4LFBK 4IZZA 4CDGA 4E19A 3LW5E 4V2GA 2FBXA 5GTHC 1KHIA 4IHXA 4MTDA 3G73A 4OGEA 3DPUA 2KRFA 3OS2A 1SQKA 1TVRA 2COBA 1Y64A 1SMTA 2CW7A 3J80Z 1PD1A 4A5AA 1ODDA 4R0KA 5J2PA 2P9NA 1WFXA 2YNGA 2YXYA 1HYZA 1RGIA 3IQLA 4LXCA 5CPRB 4ENJA 3CCEA 2OTJN 5FW9A 1O1WA 2X4JA 1ZSZC 3FZFA 2GXAA 3HZJA 1E0EA 1DGRM 2OZSA 4PJMA 3AG2H 1Z6RA 2LSOA 5IP6A 3JRBA 5JHFA 2ZBKA 2HMAA 1QZ6A 1EWRA 1JT0A 1Q82O 1XG7A 1NJIR 1KONA 2HVQA 4OINF 4Z4CA 4IIMA 1K8AR 4ZN3A 4B1RA 5CVJA 1NLPC 2NNWA 1X2MA 4F7UA 3THVA 2HL3A 4B9TA 2IT0A 2AP1A 4D8KA 2YR2A 2M9HA 1VSEA 2QAZA 1S9EA 1G4DA 4C5IA 4JUVA 4HRIA 4B09A 4CYDA 1JKHA 2AA4A 3JCUC 4Z4IA 1RDBA 4NL3A 2BBYA 3N4QA 3OYNA 3NTKA 3TQ7P 3IAM2 5LFAA 1FNNA 4CYCA 1MUYA 1Q9XA 3U6FA 3LWFA 3DXJF 5KYYB 2XIGA 3HM5A 1JUSA 4M78A 1BL3A 2Q2RA 4CFDA 3HSCA 1HJRA 4D0PA 1IRZA 3G6ET 3OYBA 1UJ0A 1KRPA 4CGZA 4O55A 2KQWA 5AQKA 1W5SA 1ZBSA 3FZVA 2H8WA 3H3NO 1Z21A 2MWOA 4MNUA 4F92B 3WVEB 3VYSB 1QPMA 1D1BA 4II2A 3PIPA 4CE9A 4YDUC 1KQSM 4UXNA 1A5WA 2ZQBA 1OR7C 3VEVA 2ECCA 4B6MA 2Z33A 1D9DA 4EGYA 2O2OA 3AFHA 3OVNA 3OJSA 1NM1A 4DSEA 2ZJQF 2NS7A 1O13A 2PFUA 2WY8Q 5KE3A 2A68F 3BF1A 7AT1B 3RIRA 4BY7J 4DQQA 2DXIA 3VERA 1VQ5A 1NWKA 3OA6A 5JHUA 2OU2A 2BXYA 1OX9A 3GBQA 5FLVA 4CGDA 2IIMA 1EH8A 4H0VB 4G7ZF 4DEXA 5HCKA 2QTXA 4CJQA 1VQPN 1B6AA 2Y75A 4RW7A 4KFCA 2F5DA 2YHAA 2DA4A 3S1QJ 2VWJA 1O3TA 4OB1B 2G3RA 4EP4A 3VEWA 3TO6A 3VN5A 1YJNN 4CJPA 1XQPA 4HAMA 4C0GA 4CCNA 2F6CA 2IW5A 1NOZA 1YAGA 2PMZA 2XMFA 3CQYA 1TWHJ 3X28B 3O4WA 2DDAA 4ANJA 3LWMA 5LEJA 3ZN1A 3QODA 4G94A 4DV7K 4IF4A 1WNSA 4IRIA 3G1LA 2DMQA 5BPNA 1VRTA 3EUAA 4B8XA 1TYQB 3TW6A 1G3SA 2DBKA 4ZTFA 4B47A 4BY6C 5CY4A 4YFNF 3NTHA 5H6QA 1H9TA 3O3FA 2XU8A 1ETOA 3SMPA 1E4GT 1JXMA 3CQZJ 1JJ2A 4B3RK 4RTVA 4OMMA 2YJEA 3QPSA 1IC8A 2RQWA 3ME9A 2PVDB 5KN8A