3CW7A

Crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cw7A02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cw7A03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cw7A01
3I0WA 4YPHA 2OFKA 2OFIA 4E9HA 1EBMA 3CVTA 1KG7A 1XQOA 1HU0A 3FHGA 1KEAA 1NGNA 4EW4A 1KO9A 1LWWA 2NOEA 4B23A 1N3AA 3S6IA 2NOHA 5AN4A 1XQPA 1MUYA 3G0QA 1PVSA 1PU8A 4OFHA 5KN8A 2H56A 1ORPA 1YQKA 4EJZA 3FSPA 1PU7A 1KG5A 4EW0A 2I5WA 1NKUA 3KTUA 1LWVA 4E9EA 1P7MA 3OGDA 1M3HA 2NOLA 1RRSA 3D4VA 4PIIA 1KG6A 1WEIA 5CHZA 1P59A 1VRLA 4B22A 3CWTA 4UNFA 1KG3A 1RRQA 1YQRA 2JHNA 4EVVA 3CVSA 4EA4A 4E9GA 3OH6A 1WEGA 5KN9A 4EA5A 2JHJA 4UOBA 1ORNA 1WEFA 1N39A 4EJYA 1MPGA 1MUNA 4AIAA 3CWAA 3F0ZA 1YQMA 1DIZA 1XG7A 3IHOA 1KG2A 4AI5A 1N3CA 1KQJA 5DPKA 3I0XA 1KG4A 4B24A 2JG6A 3OH9A 3FHFA 1MUDA 3N5NX 3CW7A 4AI4A 3N0UA 3CWUA 4OFEA 3KNTA 1YQLA 3IH7A 3CWSA 1PU6A 2NOBA 2YG9A 4YPRA 1LMZA 4E9FA 2NOFA 2NOZA 4B21A 2XHIA 4DK9A 4OFAA 2ABKA 4HSBA 1LWYA 1FN7A 2NOIA 4YOQA 1M3QA 2YG8A 3F10A
chains in the Genus database with same CATH superfamily
2W03A 1V5SA 1TUOA 3CVTA 3LCNA 1PZDA 3KRMA 3OYMA 2NOEA 3NNQA 5IYCP 1D3UA 2YH5A 1MUYA 4EJZA 1KG5A 4EW0A 3TE5A 4ZTJA 1EUVA 3VW4A 1LWVA 2DKDA 3OS0A 4EAJA 2NVMA 3OYHA 3OYKA 2V92A 4BDZA 1T6AA 3L2WA 3D4VA 1KG6A 2FUVA 3PDKA 4UNFA 2OOYA 4EVVA 3OY9A 2V75A 1WEGA 2EHBD 3HS8A 1MUNA 3CWAA 1JDYA 1XG7A 2G30A 3L2VA 1Q9UA 3D7QA 2Z8UA 4B24A 2JG6A 1JFIC 3OYEA 3FHFA 1QNAA 3N0UA 4OFEA 3CWUA 3CWSA 2HKPA 3IH7A 1LMZA 2NOZA 2PWWA 2XHIA 4BJUA 2W04A 4E7IA 4DK9A 3ENOC 2ABKA 1FN7A 2FKFA 4IL8A 2YG8A 3OYFA 1MP9A 3OYCA 1HU0A 2DKAA 3FHGA 1QN4A 5BMNA 1TBAB 2IV8A 3OYIA 2JPIA 4HJHA 3S6IA 5AN4A 3DPTA 1NVPA 4OFHA 5KN8A 1VOKA 1P5GX 3FSPA 1C9BB 2I5WA 1C47A 1NKUA 1K2YX 3KTUA 4E9EA 1LXTA 2Y8QA 4B0AA 4E7KA 2HZSA 1WQAA 1QN5A 4EAIA 3UW2A 1WEIA 4TPSA 2QLVA 1YTFA 1KG3A 1VKLA 2JHNA 3OYNA 5JMVD 2JPSA 3OH6A 4EA5A 5FRNA 1KY6A 2Z0FA 1QTPA 1TGHA 2NLVA 1YQMA 4PY5A 1E42A 3EIKA 5DPKA 4D7RA 3OYLA 4I8OA 1KG4A 3DPUA 4C7PA 2JOIA 1VOLB 3ENCA 4DULA 3CW7A 1CDWA 3KNTA 5IYBP 1PU6A 2NOBA 3EAYA 4E9FA 5FRMA 3TDHA 4B21A 2Y8LA 3T4NA 4WX8A 4QG5A 4WXAA 4OFAA 3S3OA 3I0WA 4YPHA 4ROEB 2D0CA 4MRQA 4E9HA 1EBMA 1XQOA 2MZ8A 3HS9A 4EALA 3NA5A 3H1ZA 2DKCA 4BACA 4EAKA 1N3AA 1XQPA 2NWVA 3G0QA 4BE2A 1PVSA 3S3MA 1PU8A 3OSTA 1NGMA 1PCJX 3OYGA 1YQKA 4BDYA 2QRCA 4ROCB 1QNEA 4Q11A 3S3NA 1QN7A 3OS1A 1M3HA 3PMGA 2FKMX 2MJ7A 4PIIA 1P5DX 3OS2A 4IKFA 3RSMA 3L2QA 4D7QA 5CHZA 1P59A 4E7JA 3OSEA 1KFQA 3C04A 4NZGA 1C4GA 2D0AA 1YQRA 1K35A 1W80A 5KN9A 4UOBA 3L2RA 1ORNA 1N39A 4EJYA 4AIAA 5KL0A 3F0ZA 1DIZA 1UT4A 4E7LA 5F9CA 1N3CA 1KFIA 3L2UA 3I0XA 1QNCA 3BKQX 5EPCA 5BMPA 5IYDP 1B9KA 4YPRA 2NOFA 1QN6A 1NH2A 2R5XA 2HL8A 1LWYA 5HSHA 2ZFDB 2OFKA 2OFIA 1RM1A 1TBPA 1KG7A 1KYDA 1KEAA 1NGNA 4EW4A 1KO9A 2LAEA 1LWWA 2FGTA 1QTSA 4B23A 2NOHA 3R2XC 2VJ0A 3OYDA 2H56A 1ORPA 1R4XA 1U84A 4BE1A 2YA3A 1PU7A 1VTOA 3ULXA 1KY7A 4WZSD 3OC3C 1UT7A 1P7MA 2OOXA 3OGDA 3ASMA 2NOLA 1AISA 1QN3A 2HL9A 1RRSA 2H4LX 1QN9A 2IV9A 2QREA 2V8QA 3N89A 4EAGA 3OYJA 1VRLA 4B22A 2QRDA 3CWTA 1YTBA 1RRQA 4ZTFA 2H5AX 2HZMA 3CVSA 1J3MA 3OYAA 4RODB 4EA4A 4E9GA 3OLPA 2JHJA 5FROA 1WEFA 3VN5A 1MPGA 3OCIA 1PCMX 3IHOA 1KG2A 4AI5A 2D0BA 3SNSA 1KQJA 3RPJA 1PCZA 2O3OA 1UL7A 1QNBA 3OH9A 1QN8A 1M5Q1 1KYFA 1MUDA 3N5NX 5JN5A 4BE0A 2QR1A 4E7HA 4CFFA 4AI4A 1KYUA 3OYBA 1YQLA 2YG9A 1VTLE 2F7LA 3OSMA 1WJWA 2V9JA 4HSBA 2NOIA 4YOQA 1M3QA 1XSZA 3F10A 3I3WA
chains in the Genus database with same CATH topology
3I0WA 4YPHA 2OFKA 2OFIA 4E9HA 1EBMA 3CVTA 1KG7A 1XQOA 1HU0A 3FHGA 1KEAA 1NGNA 4EW4A 1KO9A 1LWWA 2NOEA 4B23A 1N3AA 3S6IA 2NOHA 5AN4A 1XQPA 1MUYA 3G0QA 1PVSA 1PU8A 4OFHA 5KN8A 2H56A 1ORPA 1YQKA 4EJZA 3FSPA 1PU7A 1KG5A 4EW0A 2I5WA 1NKUA 3KTUA 1LWVA 4E9EA 1P7MA 3OGDA 1M3HA 2NOLA 1RRSA 3D4VA 4PIIA 1KG6A 1WEIA 5CHZA 1P59A 1VRLA 4B22A 3CWTA 4UNFA 1KG3A 1RRQA 1YQRA 2JHNA 4EVVA 3CVSA 4EA4A 4E9GA 3OH6A 1WEGA 5KN9A 4EA5A 2JHJA 4UOBA 1ORNA 1WEFA 1N39A 4EJYA 1MPGA 1MUNA 4AIAA 3CWAA 3F0ZA 1YQMA 1DIZA 1XG7A 3IHOA 1KG2A 4AI5A 1N3CA 1KQJA 5DPKA 3I0XA 1KG4A 4B24A 2JG6A 3OH9A 3FHFA 1MUDA 3N5NX 3CW7A 4AI4A 3N0UA 3CWUA 4OFEA 3KNTA 1YQLA 3IH7A 3CWSA 1PU6A 2NOBA 2YG9A 4YPRA 1LMZA 4E9FA 2NOFA 2NOZA 4B21A 2XHIA 4DK9A 4OFAA 2ABKA 4HSBA 1LWYA 1FN7A 2NOIA 4YOQA 1M3QA 2YG8A 3F10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0W A;  4YPH A;  2OFK A;  2OFI A;  4E9H A;  1EBM A;  3CVT A;  1KG7 A;  1XQO A;  1HU0 A;  3FHG A;  1KEA A;  1NGN A;  4EW4 A;  1KO9 A;  1LWW A;  2NOE A;  4B23 A;  1N3A A;  3S6I A;  2NOH A;  5AN4 A;  1XQP A;  1MUY A;  3G0Q A;  1PVS A;  1PU8 A;  4OFH A;  5KN8 A;  2H56 A;  1ORP A;  1YQK A;  4EJZ A;  3FSP A;  1PU7 A;  1KG5 A;  4EW0 A;  2I5W A;  1NKU A;  3KTU A;  1LWV A;  4E9E A;  1P7M A;  3OGD A;  1M3H A;  2NOL A;  1RRS A;  3D4V A;  4PII A;  1KG6 A;  1WEI A;  5CHZ A;  1P59 A;  1VRL A;  4B22 A;  3CWT A;  4UNF A;  1KG3 A;  1RRQ A;  1YQR A;  2JHN A;  4EVV A;  3CVS A;  4EA4 A;  4E9G A;  3OH6 A;  1WEG A;  5KN9 A;  4EA5 A;  2JHJ A;  4UOB A;  1ORN A;  1WEF A;  1N39 A;  4EJY A;  1MPG A;  1MUN A;  4AIA A;  3CWA A;  3F0Z A;  1YQM A;  1DIZ A;  1XG7 A;  3IHO A;  1KG2 A;  4AI5 A;  1N3C A;  1KQJ A;  5DPK A;  3I0X A;  1KG4 A;  4B24 A;  2JG6 A;  3OH9 A;  3FHF A;  1MUD A;  3N5N X;  3CW7 A;  4AI4 A;  3N0U A;  3CWU A;  4OFE A;  3KNT A;  1YQL A;  3IH7 A;  3CWS A;  1PU6 A;  2NOB A;  2YG9 A;  4YPR A;  1LMZ A;  4E9F A;  2NOF A;  2NOZ A;  4B21 A;  2XHI A;  4DK9 A;  4OFA A;  2ABK A;  4HSB A;  1LWY A;  1FN7 A;  2NOI A;  4YOQ A;  1M3Q A;  2YG8 A;  3F10 A; 
#chains in the Genus database with same CATH topology
 2W03 A;  1V5S A;  1TUO A;  3CVT A;  3LCN A;  1PZD A;  3KRM A;  3OYM A;  2NOE A;  3NNQ A;  5IYC P;  1D3U A;  2YH5 A;  1MUY A;  4EJZ A;  1KG5 A;  4EW0 A;  3TE5 A;  4ZTJ A;  1EUV A;  3VW4 A;  1LWV A;  2DKD A;  3OS0 A;  4EAJ A;  2NVM A;  3OYH A;  3OYK A;  2V92 A;  4BDZ A;  1T6A A;  3L2W A;  3D4V A;  1KG6 A;  2FUV A;  3PDK A;  4UNF A;  2OOY A;  4EVV A;  3OY9 A;  2V75 A;  1WEG A;  2EHB D;  3HS8 A;  1MUN A;  3CWA A;  1JDY A;  1XG7 A;  2G30 A;  3L2V A;  1Q9U A;  3D7Q A;  2Z8U A;  4B24 A;  2JG6 A;  1JFI C;  3OYE A;  3FHF A;  1QNA A;  3N0U A;  4OFE A;  3CWU A;  3CWS A;  2HKP A;  3IH7 A;  1LMZ A;  2NOZ A;  2PWW A;  2XHI A;  4BJU A;  2W04 A;  4E7I A;  4DK9 A;  3ENO C;  2ABK A;  1FN7 A;  2FKF A;  4IL8 A;  2YG8 A;  3OYF A;  1MP9 A;  3OYC A;  1HU0 A;  2DKA A;  3FHG A;  1QN4 A;  5BMN A;  1TBA B;  2IV8 A;  3OYI A;  2JPI A;  4HJH A;  3S6I A;  5AN4 A;  3DPT A;  1NVP A;  4OFH A;  5KN8 A;  1VOK A;  1P5G X;  3FSP A;  1C9B B;  2I5W A;  1C47 A;  1NKU A;  1K2Y X;  3KTU A;  4E9E A;  1LXT A;  2Y8Q A;  4B0A A;  4E7K A;  2HZS A;  1WQA A;  1QN5 A;  4EAI A;  3UW2 A;  1WEI A;  4TPS A;  2QLV A;  1YTF A;  1KG3 A;  1VKL A;  2JHN A;  3OYN A;  5JMV D;  2JPS A;  3OH6 A;  4EA5 A;  5FRN A;  1KY6 A;  2Z0F A;  1QTP A;  1TGH A;  2NLV A;  1YQM A;  4PY5 A;  1E42 A;  3EIK A;  5DPK A;  4D7R A;  3OYL A;  4I8O A;  1KG4 A;  3DPU A;  4C7P A;  2JOI A;  1VOL B;  3ENC A;  4DUL A;  3CW7 A;  1CDW A;  3KNT A;  5IYB P;  1PU6 A;  2NOB A;  3EAY A;  4E9F A;  5FRM A;  3TDH A;  4B21 A;  2Y8L A;  3T4N A;  4WX8 A;  4QG5 A;  4WXA A;  4OFA A;  3S3O A;  3I0W A;  4YPH A;  4ROE B;  2D0C A;  4MRQ A;  4E9H A;  1EBM A;  1XQO A;  2MZ8 A;  3HS9 A;  4EAL A;  3NA5 A;  3H1Z A;  2DKC A;  4BAC A;  4EAK A;  1N3A A;  1XQP A;  2NWV A;  3G0Q A;  4BE2 A;  1PVS A;  3S3M A;  1PU8 A;  3OST A;  1NGM A;  1PCJ X;  3OYG A;  1YQK A;  4BDY A;  2QRC A;  4ROC B;  1QNE A;  4Q11 A;  3S3N A;  1QN7 A;  3OS1 A;  1M3H A;  3PMG A;  2FKM X;  2MJ7 A;  4PII A;  1P5D X;  3OS2 A;  4IKF A;  3RSM A;  3L2Q A;  4D7Q A;  5CHZ A;  1P59 A;  4E7J A;  3OSE A;  1KFQ A;  3C04 A;  4NZG A;  1C4G A;  2D0A A;  1YQR A;  1K35 A;  1W80 A;  5KN9 A;  4UOB A;  3L2R A;  1ORN A;  1N39 A;  4EJY A;  4AIA A;  5KL0 A;  3F0Z A;  1DIZ A;  1UT4 A;  4E7L A;  5F9C A;  1N3C A;  1KFI A;  3L2U A;  3I0X A;  1QNC A;  3BKQ X;  5EPC A;  5BMP A;  5IYD P;  1B9K A;  4YPR A;  2NOF A;  1QN6 A;  1NH2 A;  2R5X A;  2HL8 A;  1LWY A;  5HSH A;  2ZFD B;  2OFK A;  2OFI A;  1RM1 A;  1TBP A;  1KG7 A;  1KYD A;  1KEA A;  1NGN A;  4EW4 A;  1KO9 A;  2LAE A;  1LWW A;  2FGT A;  1QTS A;  4B23 A;  2NOH A;  3R2X C;  2VJ0 A;  3OYD A;  2H56 A;  1ORP A;  1R4X A;  1U84 A;  4BE1 A;  2YA3 A;  1PU7 A;  1VTO A;  3ULX A;  1KY7 A;  4WZS D;  3OC3 C;  1UT7 A;  1P7M A;  2OOX A;  3OGD A;  3ASM A;  2NOL A;  1AIS A;  1QN3 A;  2HL9 A;  1RRS A;  2H4L X;  1QN9 A;  2IV9 A;  2QRE A;  2V8Q A;  3N89 A;  4EAG A;  3OYJ A;  1VRL A;  4B22 A;  2QRD A;  3CWT A;  1YTB A;  1RRQ A;  4ZTF A;  2H5A X;  2HZM A;  3CVS A;  1J3M A;  3OYA A;  4ROD B;  4EA4 A;  4E9G A;  3OLP A;  2JHJ A;  5FRO A;  1WEF A;  3VN5 A;  1MPG A;  3OCI A;  1PCM X;  3IHO A;  1KG2 A;  4AI5 A;  2D0B A;  3SNS A;  1KQJ A;  3RPJ A;  1PCZ A;  2O3O A;  1UL7 A;  1QNB A;  3OH9 A;  1QN8 A;  1M5Q 1;  1KYF A;  1MUD A;  3N5N X;  5JN5 A;  4BE0 A;  2QR1 A;  4E7H A;  4CFF A;  4AI4 A;  1KYU A;  3OYB A;  1YQL A;  2YG9 A;  1VTL E;  2F7L A;  3OSM A;  1WJW A;  2V9J A;  4HSB A;  2NOI A;  4YOQ A;  1M3Q A;  1XSZ A;  3F10 A;  3I3W A; 
#chains in the Genus database with same CATH homology
 3I0W A;  4YPH A;  2OFK A;  2OFI A;  4E9H A;  1EBM A;  3CVT A;  1KG7 A;  1XQO A;  1HU0 A;  3FHG A;  1KEA A;  1NGN A;  4EW4 A;  1KO9 A;  1LWW A;  2NOE A;  4B23 A;  1N3A A;  3S6I A;  2NOH A;  5AN4 A;  1XQP A;  1MUY A;  3G0Q A;  1PVS A;  1PU8 A;  4OFH A;  5KN8 A;  2H56 A;  1ORP A;  1YQK A;  4EJZ A;  3FSP A;  1PU7 A;  1KG5 A;  4EW0 A;  2I5W A;  1NKU A;  3KTU A;  1LWV A;  4E9E A;  1P7M A;  3OGD A;  1M3H A;  2NOL A;  1RRS A;  3D4V A;  4PII A;  1KG6 A;  1WEI A;  5CHZ A;  1P59 A;  1VRL A;  4B22 A;  3CWT A;  4UNF A;  1KG3 A;  1RRQ A;  1YQR A;  2JHN A;  4EVV A;  3CVS A;  4EA4 A;  4E9G A;  3OH6 A;  1WEG A;  5KN9 A;  4EA5 A;  2JHJ A;  4UOB A;  1ORN A;  1WEF A;  1N39 A;  4EJY A;  1MPG A;  1MUN A;  4AIA A;  3CWA A;  3F0Z A;  1YQM A;  1DIZ A;  1XG7 A;  3IHO A;  1KG2 A;  4AI5 A;  1N3C A;  1KQJ A;  5DPK A;  3I0X A;  1KG4 A;  4B24 A;  2JG6 A;  3OH9 A;  3FHF A;  1MUD A;  3N5N X;  3CW7 A;  4AI4 A;  3N0U A;  3CWU A;  4OFE A;  3KNT A;  1YQL A;  3IH7 A;  3CWS A;  1PU6 A;  2NOB A;  2YG9 A;  4YPR A;  1LMZ A;  4E9F A;  2NOF A;  2NOZ A;  4B21 A;  2XHI A;  4DK9 A;  4OFA A;  2ABK A;  4HSB A;  1LWY A;  1FN7 A;  2NOI A;  4YOQ A;  1M3Q A;  2YG8 A;  3F10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...