3CW7A

Crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 88
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cw7A02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cw7A03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cw7A01
1WEFA 4UOBA 4OFAA 1M3QA 1ORNA 3KTUA 2ABKA 2NOLA 3CVSA 4E9HA 4B21A 3IHOA 3FHFA 3F10A 3N0UA 5CHZA 2I5WA 1YQLA 4E9FA 4EW4A 1P59A 1MPGA 1FN7A 3FHGA 3CVTA 2YG8A 1KG2A 4E9GA 1YQMA 1MUNA 1PU7A 3I0XA 4YOQA 1N3AA 1KQJA 5DPKA 2JHJA 1KG7A 4EJZA 1NKUA 2YG9A 1LWWA 5AN4A 1YQKA 1XQPA 1WEIA 1LMZA 4EA5A 4HSBA 4EVVA 1NGNA 1PU8A 4EJYA 4AI4A 3CWUA 4OFEA 1KG4A 1WEGA 3S6IA 2NOFA 1KG3A 1N39A 3CWTA 4E9EA 1HU0A 2NOEA 3OGDA 1RRSA 1MUYA 1PVSA 2OFKA 3CWSA 3OH9A 1EBMA 4YPHA 1KO9A 2NOIA 2NOBA 3FSPA 4OFHA 4PIIA 1M3HA 1P7MA 4EW0A 1DIZA 1ORPA 3KNTA 2H56A 1PU6A 3N5NX 5KN8A 4B22A 5KN9A 4UNFA 4DK9A 1KG5A 4YPRA 3OH6A 1KG6A 1KEAA 3I0WA 1VRLA 3CWAA 1LWVA 3D4VA 1YQRA 3CW7A 1N3CA 3G0QA 2JHNA 2JG6A 4AI5A 4B24A 3F0ZA 2OFIA 2NOHA 1XG7A 4B23A 4EA4A 1MUDA 1RRQA 2XHIA 1LWYA 4AIAA 3IH7A 1XQOA 2NOZA
chains in the Genus database with same CATH superfamily
5IYDP 3KTUA 1QN5A 3LCNA 4E9HA 1M5Q1 1E42A 3S3NA 3OYJA 1NGMA 3KRMA 4D7RA 1NVPA 2YG8A 1KYDA 1KG2A 1QN3A 3I0XA 2QRDA 4D7QA 1LWWA 1YQKA 1XQPA 4EA5A 1LMZA 4HSBA 2JPSA 1P5DX 4BDZA 1Q9UA 3OYAA 4OFEA 3OYDA 1U84A 4ZTJA 1YTBA 4E7JA 1KG3A 3SNSA 4BE2A 3CWTA 2YA3A 4E7IA 1QNEA 3S3OA 1QN4A 1PVSA 2OFKA 4RODB 2QREA 2V8QA 2NOBA 5BMPA 4OFHA 4PIIA 1EUVA 1ORPA 1PU6A 5KN8A 3OYKA 5EPCA 2W03A 4ROCB 5KN9A 3S3MA 3OH6A 1VRLA 3I0WA 4EAKA 3CWAA 3PDKA 5JMVD 3OYEA 1VTLE 4AI5A 3OSTA 3NNQA 4EAGA 3OYGA 2XHIA 3OS0A 5BMNA 1C9BB 3OYLA 3IH7A 3H1ZA 5FRMA 1XQOA 3R2XC 2R5XA 4OFAA 3D7QA 3VW4A 3VN5A 1W80A 1QTSA 3FHFA 1KY6A 3N0UA 2PWWA 1WJWA 3ENOC 1JFIC 1MPGA 1QN8A 4BE0A 1KFQA 1FN7A 1MP9A 4YOQA 4WXAA 2OOYA 2JHJA 3OS2A 3C04A 1J3MA 1QN9A 2MJ7A 3N89A 3CWUA 5JN5A 2DKAA 2H5AX 3PMGA 1NH2A 1PZDA 3S6IA 2NOFA 2D0BA 2QRCA 1YTFA 4NZGA 1HU0A 2HZSA 3OGDA 2FGTA 2HKPA 2NOIA 1KO9A 3FSPA 3BKQX 2H56A 2FUVA 3N5NX 2D0AA 1AISA 3OYIA 2Y8LA 4UNFA 2YH5A 1KG5A 5HSHA 1YQRA 1P5GX 3CW7A 5FROA 4WZSD 4E7HA 4BACA 4B23A 1T6AA 2NVMA 4MRQA 2Y8QA 1ORNA 1KY7A 2ABKA 2NOLA 1KYUA 2V75A 1WQAA 3IHOA 1LXTA 3T4NA 2DKDA 3F10A 1QNCA 2IV8A 3UW2A 5CHZA 2I5WA 1YQLA 1QN7A 2HL9A 3CVTA 2V9JA 1TBAB 2IV9A 2H4LX 1QNAA 1CDWA 1V5SA 3EAYA 3NA5A 3EIKA 1MUNA 1PU7A 3OYHA 1N3AA 1KQJA 3DPTA 5DPKA 1TGHA 4E7LA 3OY9A 2D0CA 1KG7A 1NKUA 1UL7A 3L2QA 4CFFA 1NGNA 4WX8A 1PU8A 3L2VA 1JDYA 5F9CA 1D3UA 1PCZA 1WEGA 3L2UA 3L2WA 1N39A 4E9EA 3OSMA 1B9KA 1R4XA 2W04A 4BDYA 3DPUA 1RRSA 3ULXA 3CWSA 1QTPA 1EBMA 1PCJX 4ROEB 2OOXA 4EW0A 3OSEA 3KNTA 2Z0FA 1UT4A 4B22A 4TPSA 4DK9A 2O3OA 1KG6A 1KEAA 4BJUA 1KYFA 1PCMX 1UT7A 3G0QA 3OYNA 2JHNA 3OYBA 2OFIA 2NOHA 1XG7A 1MUDA 1RRQA 2F7LA 2HZMA 1VOLB 3I3WA 1LWYA 4AIAA 4ZTFA 1RM1A 3RPJA 4HJHA 3HS9A 2NOZA 4EAIA 1WEFA 4UOBA 1M3QA 4Q11A 3HS8A 4PY5A 3CVSA 4IL8A 4B21A 3L2RA 3OYFA 3OS1A 2HL8A 4E9FA 4EW4A 1P59A 4BE1A 2LAEA 3FHGA 2DKCA 4I8OA 1VKLA 4E9GA 1YQMA 1XSZA 1K35A 2FKFA 3TE5A 3TDHA 4EAJA 4EJZA 2YG9A 2NLVA 4C7PA 5AN4A 1TUOA 1QN6A 1VOKA 1WEIA 2MZ8A 4EVVA 2QLVA 4EJYA 4AI4A 1KG4A 3OYMA 2JOIA 4QG5A 2ZFDB 1TBPA 5KL0A 2EHBD 5IYBP 1C47A 3OCIA 3OC3C 2V92A 2NOEA 1MUYA 3OH9A 2NWVA 4EALA 4YPHA 1C4GA 2G30A 1KFIA 3ASMA 1QNBA 1M3HA 1P7MA 3RSMA 1DIZA 2JPIA 4IKFA 4E7KA 4YPRA 2Z8UA 2FKMX 3ENCA 4DULA 1LWVA 3D4VA 2QR1A 1N3CA 5IYCP 3OYCA 1K2YX 2JG6A 4B24A 3F0ZA 4B0AA 2VJ0A 3OLPA 1VTOA 4EA4A 5FRNA
chains in the Genus database with same CATH topology
1WEFA 4UOBA 4OFAA 1M3QA 1ORNA 3KTUA 2ABKA 2NOLA 3CVSA 4E9HA 4B21A 3IHOA 3FHFA 3F10A 3N0UA 5CHZA 2I5WA 1YQLA 4E9FA 4EW4A 1P59A 1MPGA 1FN7A 3FHGA 3CVTA 2YG8A 1KG2A 4E9GA 1YQMA 1MUNA 1PU7A 3I0XA 4YOQA 1N3AA 1KQJA 5DPKA 2JHJA 1KG7A 4EJZA 1NKUA 2YG9A 1LWWA 5AN4A 1YQKA 1XQPA 1WEIA 1LMZA 4EA5A 4HSBA 4EVVA 1NGNA 1PU8A 4EJYA 4AI4A 3CWUA 4OFEA 1KG4A 1WEGA 3S6IA 2NOFA 1KG3A 1N39A 3CWTA 4E9EA 1HU0A 2NOEA 3OGDA 1RRSA 1MUYA 1PVSA 2OFKA 3CWSA 3OH9A 1EBMA 4YPHA 1KO9A 2NOIA 2NOBA 3FSPA 4OFHA 4PIIA 1M3HA 1P7MA 4EW0A 1DIZA 1ORPA 3KNTA 2H56A 1PU6A 3N5NX 5KN8A 4B22A 5KN9A 4UNFA 4DK9A 1KG5A 4YPRA 3OH6A 1KG6A 1KEAA 3I0WA 1VRLA 3CWAA 1LWVA 3D4VA 1YQRA 3CW7A 1N3CA 3G0QA 2JHNA 2JG6A 4AI5A 4B24A 3F0ZA 2OFIA 2NOHA 1XG7A 4B23A 4EA4A 1MUDA 1RRQA 2XHIA 1LWYA 4AIAA 3IH7A 1XQOA 2NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEF A;  4UOB A;  4OFA A;  1M3Q A;  1ORN A;  3KTU A;  2ABK A;  2NOL A;  3CVS A;  4E9H A;  4B21 A;  3IHO A;  3FHF A;  3F10 A;  3N0U A;  5CHZ A;  2I5W A;  1YQL A;  4E9F A;  4EW4 A;  1P59 A;  1MPG A;  1FN7 A;  3FHG A;  3CVT A;  2YG8 A;  1KG2 A;  4E9G A;  1YQM A;  1MUN A;  1PU7 A;  3I0X A;  4YOQ A;  1N3A A;  1KQJ A;  5DPK A;  2JHJ A;  1KG7 A;  4EJZ A;  1NKU A;  2YG9 A;  1LWW A;  5AN4 A;  1YQK A;  1XQP A;  1WEI A;  1LMZ A;  4EA5 A;  4HSB A;  4EVV A;  1NGN A;  1PU8 A;  4EJY A;  4AI4 A;  3CWU A;  4OFE A;  1KG4 A;  1WEG A;  3S6I A;  2NOF A;  1KG3 A;  1N39 A;  3CWT A;  4E9E A;  1HU0 A;  2NOE A;  3OGD A;  1RRS A;  1MUY A;  1PVS A;  2OFK A;  3CWS A;  3OH9 A;  1EBM A;  4YPH A;  1KO9 A;  2NOI A;  2NOB A;  3FSP A;  4OFH A;  4PII A;  1M3H A;  1P7M A;  4EW0 A;  1DIZ A;  1ORP A;  3KNT A;  2H56 A;  1PU6 A;  3N5N X;  5KN8 A;  4B22 A;  5KN9 A;  4UNF A;  4DK9 A;  1KG5 A;  4YPR A;  3OH6 A;  1KG6 A;  1KEA A;  3I0W A;  1VRL A;  3CWA A;  1LWV A;  3D4V A;  1YQR A;  3CW7 A;  1N3C A;  3G0Q A;  2JHN A;  2JG6 A;  4AI5 A;  4B24 A;  3F0Z A;  2OFI A;  2NOH A;  1XG7 A;  4B23 A;  4EA4 A;  1MUD A;  1RRQ A;  2XHI A;  1LWY A;  4AIA A;  3IH7 A;  1XQO A;  2NOZ A; 
#chains in the Genus database with same CATH topology
 5IYD P;  3KTU A;  1QN5 A;  3LCN A;  4E9H A;  1M5Q 1;  1E42 A;  3S3N A;  3OYJ A;  1NGM A;  3KRM A;  4D7R A;  1NVP A;  2YG8 A;  1KYD A;  1KG2 A;  1QN3 A;  3I0X A;  2QRD A;  4D7Q A;  1LWW A;  1YQK A;  1XQP A;  4EA5 A;  1LMZ A;  4HSB A;  2JPS A;  1P5D X;  4BDZ A;  1Q9U A;  3OYA A;  4OFE A;  3OYD A;  1U84 A;  4ZTJ A;  1YTB A;  4E7J A;  1KG3 A;  3SNS A;  4BE2 A;  3CWT A;  2YA3 A;  4E7I A;  1QNE A;  3S3O A;  1QN4 A;  1PVS A;  2OFK A;  4ROD B;  2QRE A;  2V8Q A;  2NOB A;  5BMP A;  4OFH A;  4PII A;  1EUV A;  1ORP A;  1PU6 A;  5KN8 A;  3OYK A;  5EPC A;  2W03 A;  4ROC B;  5KN9 A;  3S3M A;  3OH6 A;  1VRL A;  3I0W A;  4EAK A;  3CWA A;  3PDK A;  5JMV D;  3OYE A;  1VTL E;  4AI5 A;  3OST A;  3NNQ A;  4EAG A;  3OYG A;  2XHI A;  3OS0 A;  5BMN A;  1C9B B;  3OYL A;  3IH7 A;  3H1Z A;  5FRM A;  1XQO A;  3R2X C;  2R5X A;  4OFA A;  3D7Q A;  3VW4 A;  3VN5 A;  1W80 A;  1QTS A;  3FHF A;  1KY6 A;  3N0U A;  2PWW A;  1WJW A;  3ENO C;  1JFI C;  1MPG A;  1QN8 A;  4BE0 A;  1KFQ A;  1FN7 A;  1MP9 A;  4YOQ A;  4WXA A;  2OOY A;  2JHJ A;  3OS2 A;  3C04 A;  1J3M A;  1QN9 A;  2MJ7 A;  3N89 A;  3CWU A;  5JN5 A;  2DKA A;  2H5A X;  3PMG A;  1NH2 A;  1PZD A;  3S6I A;  2NOF A;  2D0B A;  2QRC A;  1YTF A;  4NZG A;  1HU0 A;  2HZS A;  3OGD A;  2FGT A;  2HKP A;  2NOI A;  1KO9 A;  3FSP A;  3BKQ X;  2H56 A;  2FUV A;  3N5N X;  2D0A A;  1AIS A;  3OYI A;  2Y8L A;  4UNF A;  2YH5 A;  1KG5 A;  5HSH A;  1YQR A;  1P5G X;  3CW7 A;  5FRO A;  4WZS D;  4E7H A;  4BAC A;  4B23 A;  1T6A A;  2NVM A;  4MRQ A;  2Y8Q A;  1ORN A;  1KY7 A;  2ABK A;  2NOL A;  1KYU A;  2V75 A;  1WQA A;  3IHO A;  1LXT A;  3T4N A;  2DKD A;  3F10 A;  1QNC A;  2IV8 A;  3UW2 A;  5CHZ A;  2I5W A;  1YQL A;  1QN7 A;  2HL9 A;  3CVT A;  2V9J A;  1TBA B;  2IV9 A;  2H4L X;  1QNA A;  1CDW A;  1V5S A;  3EAY A;  3NA5 A;  3EIK A;  1MUN A;  1PU7 A;  3OYH A;  1N3A A;  1KQJ A;  3DPT A;  5DPK A;  1TGH A;  4E7L A;  3OY9 A;  2D0C A;  1KG7 A;  1NKU A;  1UL7 A;  3L2Q A;  4CFF A;  1NGN A;  4WX8 A;  1PU8 A;  3L2V A;  1JDY A;  5F9C A;  1D3U A;  1PCZ A;  1WEG A;  3L2U A;  3L2W A;  1N39 A;  4E9E A;  3OSM A;  1B9K A;  1R4X A;  2W04 A;  4BDY A;  3DPU A;  1RRS A;  3ULX A;  3CWS A;  1QTP A;  1EBM A;  1PCJ X;  4ROE B;  2OOX A;  4EW0 A;  3OSE A;  3KNT A;  2Z0F A;  1UT4 A;  4B22 A;  4TPS A;  4DK9 A;  2O3O A;  1KG6 A;  1KEA A;  4BJU A;  1KYF A;  1PCM X;  1UT7 A;  3G0Q A;  3OYN A;  2JHN A;  3OYB A;  2OFI A;  2NOH A;  1XG7 A;  1MUD A;  1RRQ A;  2F7L A;  2HZM A;  1VOL B;  3I3W A;  1LWY A;  4AIA A;  4ZTF A;  1RM1 A;  3RPJ A;  4HJH A;  3HS9 A;  2NOZ A;  4EAI A;  1WEF A;  4UOB A;  1M3Q A;  4Q11 A;  3HS8 A;  4PY5 A;  3CVS A;  4IL8 A;  4B21 A;  3L2R A;  3OYF A;  3OS1 A;  2HL8 A;  4E9F A;  4EW4 A;  1P59 A;  4BE1 A;  2LAE A;  3FHG A;  2DKC A;  4I8O A;  1VKL A;  4E9G A;  1YQM A;  1XSZ A;  1K35 A;  2FKF A;  3TE5 A;  3TDH A;  4EAJ A;  4EJZ A;  2YG9 A;  2NLV A;  4C7P A;  5AN4 A;  1TUO A;  1QN6 A;  1VOK A;  1WEI A;  2MZ8 A;  4EVV A;  2QLV A;  4EJY A;  4AI4 A;  1KG4 A;  3OYM A;  2JOI A;  4QG5 A;  2ZFD B;  1TBP A;  5KL0 A;  2EHB D;  5IYB P;  1C47 A;  3OCI A;  3OC3 C;  2V92 A;  2NOE A;  1MUY A;  3OH9 A;  2NWV A;  4EAL A;  4YPH A;  1C4G A;  2G30 A;  1KFI A;  3ASM A;  1QNB A;  1M3H A;  1P7M A;  3RSM A;  1DIZ A;  2JPI A;  4IKF A;  4E7K A;  4YPR A;  2Z8U A;  2FKM X;  3ENC A;  4DUL A;  1LWV A;  3D4V A;  2QR1 A;  1N3C A;  5IYC P;  3OYC A;  1K2Y X;  2JG6 A;  4B24 A;  3F0Z A;  4B0A A;  2VJ0 A;  3OLP A;  1VTO A;  4EA4 A;  5FRN A; 
#chains in the Genus database with same CATH homology
 1WEF A;  4UOB A;  4OFA A;  1M3Q A;  1ORN A;  3KTU A;  2ABK A;  2NOL A;  3CVS A;  4E9H A;  4B21 A;  3IHO A;  3FHF A;  3F10 A;  3N0U A;  5CHZ A;  2I5W A;  1YQL A;  4E9F A;  4EW4 A;  1P59 A;  1MPG A;  1FN7 A;  3FHG A;  3CVT A;  2YG8 A;  1KG2 A;  4E9G A;  1YQM A;  1MUN A;  1PU7 A;  3I0X A;  4YOQ A;  1N3A A;  1KQJ A;  5DPK A;  2JHJ A;  1KG7 A;  4EJZ A;  1NKU A;  2YG9 A;  1LWW A;  5AN4 A;  1YQK A;  1XQP A;  1WEI A;  1LMZ A;  4EA5 A;  4HSB A;  4EVV A;  1NGN A;  1PU8 A;  4EJY A;  4AI4 A;  3CWU A;  4OFE A;  1KG4 A;  1WEG A;  3S6I A;  2NOF A;  1KG3 A;  1N39 A;  3CWT A;  4E9E A;  1HU0 A;  2NOE A;  3OGD A;  1RRS A;  1MUY A;  1PVS A;  2OFK A;  3CWS A;  3OH9 A;  1EBM A;  4YPH A;  1KO9 A;  2NOI A;  2NOB A;  3FSP A;  4OFH A;  4PII A;  1M3H A;  1P7M A;  4EW0 A;  1DIZ A;  1ORP A;  3KNT A;  2H56 A;  1PU6 A;  3N5N X;  5KN8 A;  4B22 A;  5KN9 A;  4UNF A;  4DK9 A;  1KG5 A;  4YPR A;  3OH6 A;  1KG6 A;  1KEA A;  3I0W A;  1VRL A;  3CWA A;  1LWV A;  3D4V A;  1YQR A;  3CW7 A;  1N3C A;  3G0Q A;  2JHN A;  2JG6 A;  4AI5 A;  4B24 A;  3F0Z A;  2OFI A;  2NOH A;  1XG7 A;  4B23 A;  4EA4 A;  1MUD A;  1RRQ A;  2XHI A;  1LWY A;  4AIA A;  3IH7 A;  1XQO A;  2NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...