3CW7A

Crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 88
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cw7A02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cw7A03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cw7A01
2NOHA 4EVVA 1WEGA 3I0WA 2H56A 4YPRA 1WEIA 3KNTA 3FHFA 3CWAA 2JHNA 4E9FA 3IH7A 1KEAA 2JHJA 4B24A 1MPGA 1YQMA 3CW7A 1VRLA 2NOEA 2OFKA 1P7MA 3CWTA 3CVSA 3F10A 5KN9A 3I0XA 3N0UA 3CWUA 1KG7A 1WEFA 4B21A 2I5WA 2NOIA 1YQLA 1XQPA 4YOQA 4EA4A 1M3HA 1KO9A 4AIAA 3G0QA 1YQRA 1PU6A 2JG6A 4HSBA 3D4VA 1PU7A 5DPKA 4OFAA 4UOBA 3FSPA 1DIZA 2NOLA 2YG8A 2NOZA 1RRSA 1N3CA 1N39A 4E9GA 4EJZA 5CHZA 3CWSA 1YQKA 4E9HA 1NKUA 4UNFA 1RRQA 2ABKA 1N3AA 4OFHA 1FN7A 3KTUA 4EA5A 1PVSA 3S6IA 4YPHA 4DK9A 1NGNA 1XG7A 4PIIA 3F0ZA 1LWWA 4EW4A 1MUDA 3IHOA 4OFEA 1PU8A 1KG3A 3N5NX 4AI5A 4B23A 2OFIA 1KG4A 2XHIA 1LWYA 1EBMA 1ORPA 1LMZA 4E9EA 1KQJA 3OH6A 3OGDA 1LWVA 1P59A 1MUNA 1XQOA 4B22A 3FHGA 1MUYA 3OH9A 1HU0A 4EW0A 1M3QA 1KG2A 2YG9A 5KN8A 4EJYA 1KG5A 2NOBA 5AN4A 2NOFA 3CVTA 4AI4A 1ORNA 1KG6A
chains in the Genus database with same CATH superfamily
2NOHA 4EVVA 1KYUA 2YH5A 1K2YX 1K35A 3RSMA 1QN8A 2JHJA 4B24A 1QNAA 1MPGA 1YQMA 2NOEA 2OFKA 4MRQA 1W80A 4BACA 2I5WA 2QRDA 1YQRA 4ROCB 2JG6A 4HSBA 1D3UA 1NGMA 1PCMX 4UOBA 2IV8A 3OCIA 4Q11A 2NOLA 2YG8A 3TDHA 1RRSA 1KFQA 1AISA 1KYDA 3OS2A 1YQKA 1WJWA 4E9HA 5FRNA 1YTBA 4UNFA 4I8OA 1CDWA 1VOKA 2D0AA 1Q9UA 1KYFA 1PVSA 3S6IA 2DKCA 3SNSA 4DK9A 1TGHA 2V8QA 4E7JA 1XG7A 3OSTA 3F0ZA 3OYHA 1KG3A 3N5NX 2DKDA 2R5XA 1XSZA 2OOYA 1C4GA 2XHIA 1LWYA 4D7RA 3NNQA 4E9EA 3OH6A 3S3OA 2VJ0A 3OYAA 1MUYA 4EW0A 3TE5A 2V92A 1KG2A 4E7LA 1UL7A 1V5SA 4EJYA 2JOIA 3OYDA 4EALA 3PMGA 2FUVA 2NOFA 4AI4A 2D0BA 1ORNA 3DPTA 1WEGA 4E9FA 1QTSA 2G30A 1P7MA 1QN3A 3H1ZA 3F10A 3N0UA 2HZMA 5BMNA 1KY7A 3N89A 5FROA 4EA4A 2FGTA 1VOLB 1KO9A 4IL8A 1PU6A 2W04A 3OLPA 5KL0A 4RODB 3OYBA 3D4VA 5DPKA 1TUOA 4OFAA 3BKQX 3ASMA 5IYBP 1N3CA 2V75A 4HJHA 4EJZA 2QREA 1RM1A 4DULA 1UT4A 1NKUA 1UT7A 5BMPA 1VTLE 1C9BB 5IYDP 1RRQA 1EUVA 3OYLA 1FN7A 1PCZA 4EAGA 4TPSA 3OYGA 4WZSD 3OYNA 4EW4A 3IHOA 4OFEA 2H5AX 3R2XC 1PU8A 1PZDA 1T6AA 1TBPA 2FKMX 2OFIA 1KG4A 4WXAA 3OS1A 1LWVA 3OYMA 1XQOA 4B22A 3VN5A 3HS9A 2NOBA 1QNBA 1TBAB 2MJ7A 2Y8QA 5JN5A 4ROEB 2NLVA 3ULXA 4YPRA 2JPIA 3CWAA 3ENOC 3IH7A 1PCJX 4PY5A 2OOXA 3CW7A 3CWTA 2HZSA 5KN9A 3CWUA 1R4XA 1WEFA 2NOIA 3D7QA 1YQLA 3OYKA 5F9CA 1XQPA 5JMVD 2Z0FA 1M3HA 1KY6A 4D7QA 1QN7A 3KRMA 1PU7A 4BE0A 1P5DX 3FSPA 4BJUA 2NOZA 1WQAA 3LCNA 4E9GA 5CHZA 3CWSA 3S3MA 2MZ8A 4OFHA 4EA5A 4YPHA 1NGNA 2JPSA 2HKPA 1MUDA 2ZFDB 2IV9A 1C47A 4AI5A 3OSMA 4QG5A 4B23A 1QNEA 4BE1A 1JDYA 3L2VA 3HS8A 2NVMA 2LAEA 1EBMA 1YTFA 3RPJA 1ORPA 4NZGA 2Y8LA 2FKFA 2QRCA 3OGDA 4EAIA 3L2QA 1P59A 1MUNA 2F7LA 1HU0A 3FHGA 3UW2A 4CFFA 4E7IA 5KN8A 5FRMA 1U84A 2D0CA 3OYJA 1KG5A 5AN4A 2YA3A 1VTOA 2EHBD 5EPCA 3CVTA 1KG6A 2DKAA 3I0WA 2H56A 1WEIA 2NWVA 3KNTA 3FHFA 2V9JA 2JHNA 3S3NA 3PDKA 1P5GX 1KEAA 3I3WA 3VW4A 3L2RA 1VRLA 3OS0A 4E7KA 3CVSA 3I0XA 3OYCA 1KG7A 2W03A 4B21A 1QTPA 3ENCA 5IYCP 4C7PA 2Z8UA 1NH2A 4YOQA 4EAKA 2PWWA 4AIAA 3G0QA 2QLVA 1B9KA 4EAJA 1KFIA 3OC3C 4ZTJA 3EIKA 3OSEA 1M5Q1 1DIZA 3OYIA 1VKLA 3NA5A 4BE2A 2H4LX 1QNCA 1N39A 1QN9A 1QN6A 4BDYA 1QN5A 1NVPA 4BDZA 2HL8A 2ABKA 1N3AA 3KTUA 2O3OA 4PIIA 1LXTA 1LWWA 1E42A 1QN4A 2HL9A 2QR1A 1J3MA 3EAYA 4B0AA 1MP9A 3DPUA 1LMZA 1KQJA 3OYFA 3L2WA 4ZTFA 3OH9A 3T4NA 1M3QA 2YG9A 3OY9A 3L2UA 3C04A 5HSHA 4WX8A 1JFIC 4E7HA 4IKFA 3OYEA
chains in the Genus database with same CATH topology
2NOHA 4EVVA 1WEGA 3I0WA 2H56A 4YPRA 1WEIA 3KNTA 3FHFA 3CWAA 2JHNA 4E9FA 3IH7A 1KEAA 2JHJA 4B24A 1MPGA 1YQMA 3CW7A 1VRLA 2NOEA 2OFKA 1P7MA 3CWTA 3CVSA 3F10A 5KN9A 3I0XA 3N0UA 3CWUA 1KG7A 1WEFA 4B21A 2I5WA 2NOIA 1YQLA 1XQPA 4YOQA 4EA4A 1M3HA 1KO9A 4AIAA 3G0QA 1YQRA 1PU6A 2JG6A 4HSBA 3D4VA 1PU7A 5DPKA 4OFAA 4UOBA 3FSPA 1DIZA 2NOLA 2YG8A 2NOZA 1RRSA 1N3CA 1N39A 4E9GA 4EJZA 5CHZA 3CWSA 1YQKA 4E9HA 1NKUA 4UNFA 1RRQA 2ABKA 1N3AA 4OFHA 1FN7A 3KTUA 4EA5A 1PVSA 3S6IA 4YPHA 4DK9A 1NGNA 1XG7A 4PIIA 3F0ZA 1LWWA 4EW4A 1MUDA 3IHOA 4OFEA 1PU8A 1KG3A 3N5NX 4AI5A 4B23A 2OFIA 1KG4A 2XHIA 1LWYA 1EBMA 1ORPA 1LMZA 4E9EA 1KQJA 3OH6A 3OGDA 1LWVA 1P59A 1MUNA 1XQOA 4B22A 3FHGA 1MUYA 3OH9A 1HU0A 4EW0A 1M3QA 1KG2A 2YG9A 5KN8A 4EJYA 1KG5A 2NOBA 5AN4A 2NOFA 3CVTA 4AI4A 1ORNA 1KG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOH A;  4EVV A;  1WEG A;  3I0W A;  2H56 A;  4YPR A;  1WEI A;  3KNT A;  3FHF A;  3CWA A;  2JHN A;  4E9F A;  3IH7 A;  1KEA A;  2JHJ A;  4B24 A;  1MPG A;  1YQM A;  3CW7 A;  1VRL A;  2NOE A;  2OFK A;  1P7M A;  3CWT A;  3CVS A;  3F10 A;  5KN9 A;  3I0X A;  3N0U A;  3CWU A;  1KG7 A;  1WEF A;  4B21 A;  2I5W A;  2NOI A;  1YQL A;  1XQP A;  4YOQ A;  4EA4 A;  1M3H A;  1KO9 A;  4AIA A;  3G0Q A;  1YQR A;  1PU6 A;  2JG6 A;  4HSB A;  3D4V A;  1PU7 A;  5DPK A;  4OFA A;  4UOB A;  3FSP A;  1DIZ A;  2NOL A;  2YG8 A;  2NOZ A;  1RRS A;  1N3C A;  1N39 A;  4E9G A;  4EJZ A;  5CHZ A;  3CWS A;  1YQK A;  4E9H A;  1NKU A;  4UNF A;  1RRQ A;  2ABK A;  1N3A A;  4OFH A;  1FN7 A;  3KTU A;  4EA5 A;  1PVS A;  3S6I A;  4YPH A;  4DK9 A;  1NGN A;  1XG7 A;  4PII A;  3F0Z A;  1LWW A;  4EW4 A;  1MUD A;  3IHO A;  4OFE A;  1PU8 A;  1KG3 A;  3N5N X;  4AI5 A;  4B23 A;  2OFI A;  1KG4 A;  2XHI A;  1LWY A;  1EBM A;  1ORP A;  1LMZ A;  4E9E A;  1KQJ A;  3OH6 A;  3OGD A;  1LWV A;  1P59 A;  1MUN A;  1XQO A;  4B22 A;  3FHG A;  1MUY A;  3OH9 A;  1HU0 A;  4EW0 A;  1M3Q A;  1KG2 A;  2YG9 A;  5KN8 A;  4EJY A;  1KG5 A;  2NOB A;  5AN4 A;  2NOF A;  3CVT A;  4AI4 A;  1ORN A;  1KG6 A; 
#chains in the Genus database with same CATH topology
 2NOH A;  4EVV A;  1KYU A;  2YH5 A;  1K2Y X;  1K35 A;  3RSM A;  1QN8 A;  2JHJ A;  4B24 A;  1QNA A;  1MPG A;  1YQM A;  2NOE A;  2OFK A;  4MRQ A;  1W80 A;  4BAC A;  2I5W A;  2QRD A;  1YQR A;  4ROC B;  2JG6 A;  4HSB A;  1D3U A;  1NGM A;  1PCM X;  4UOB A;  2IV8 A;  3OCI A;  4Q11 A;  2NOL A;  2YG8 A;  3TDH A;  1RRS A;  1KFQ A;  1AIS A;  1KYD A;  3OS2 A;  1YQK A;  1WJW A;  4E9H A;  5FRN A;  1YTB A;  4UNF A;  4I8O A;  1CDW A;  1VOK A;  2D0A A;  1Q9U A;  1KYF A;  1PVS A;  3S6I A;  2DKC A;  3SNS A;  4DK9 A;  1TGH A;  2V8Q A;  4E7J A;  1XG7 A;  3OST A;  3F0Z A;  3OYH A;  1KG3 A;  3N5N X;  2DKD A;  2R5X A;  1XSZ A;  2OOY A;  1C4G A;  2XHI A;  1LWY A;  4D7R A;  3NNQ A;  4E9E A;  3OH6 A;  3S3O A;  2VJ0 A;  3OYA A;  1MUY A;  4EW0 A;  3TE5 A;  2V92 A;  1KG2 A;  4E7L A;  1UL7 A;  1V5S A;  4EJY A;  2JOI A;  3OYD A;  4EAL A;  3PMG A;  2FUV A;  2NOF A;  4AI4 A;  2D0B A;  1ORN A;  3DPT A;  1WEG A;  4E9F A;  1QTS A;  2G30 A;  1P7M A;  1QN3 A;  3H1Z A;  3F10 A;  3N0U A;  2HZM A;  5BMN A;  1KY7 A;  3N89 A;  5FRO A;  4EA4 A;  2FGT A;  1VOL B;  1KO9 A;  4IL8 A;  1PU6 A;  2W04 A;  3OLP A;  5KL0 A;  4ROD B;  3OYB A;  3D4V A;  5DPK A;  1TUO A;  4OFA A;  3BKQ X;  3ASM A;  5IYB P;  1N3C A;  2V75 A;  4HJH A;  4EJZ A;  2QRE A;  1RM1 A;  4DUL A;  1UT4 A;  1NKU A;  1UT7 A;  5BMP A;  1VTL E;  1C9B B;  5IYD P;  1RRQ A;  1EUV A;  3OYL A;  1FN7 A;  1PCZ A;  4EAG A;  4TPS A;  3OYG A;  4WZS D;  3OYN A;  4EW4 A;  3IHO A;  4OFE A;  2H5A X;  3R2X C;  1PU8 A;  1PZD A;  1T6A A;  1TBP A;  2FKM X;  2OFI A;  1KG4 A;  4WXA A;  3OS1 A;  1LWV A;  3OYM A;  1XQO A;  4B22 A;  3VN5 A;  3HS9 A;  2NOB A;  1QNB A;  1TBA B;  2MJ7 A;  2Y8Q A;  5JN5 A;  4ROE B;  2NLV A;  3ULX A;  4YPR A;  2JPI A;  3CWA A;  3ENO C;  3IH7 A;  1PCJ X;  4PY5 A;  2OOX A;  3CW7 A;  3CWT A;  2HZS A;  5KN9 A;  3CWU A;  1R4X A;  1WEF A;  2NOI A;  3D7Q A;  1YQL A;  3OYK A;  5F9C A;  1XQP A;  5JMV D;  2Z0F A;  1M3H A;  1KY6 A;  4D7Q A;  1QN7 A;  3KRM A;  1PU7 A;  4BE0 A;  1P5D X;  3FSP A;  4BJU A;  2NOZ A;  1WQA A;  3LCN A;  4E9G A;  5CHZ A;  3CWS A;  3S3M A;  2MZ8 A;  4OFH A;  4EA5 A;  4YPH A;  1NGN A;  2JPS A;  2HKP A;  1MUD A;  2ZFD B;  2IV9 A;  1C47 A;  4AI5 A;  3OSM A;  4QG5 A;  4B23 A;  1QNE A;  4BE1 A;  1JDY A;  3L2V A;  3HS8 A;  2NVM A;  2LAE A;  1EBM A;  1YTF A;  3RPJ A;  1ORP A;  4NZG A;  2Y8L A;  2FKF A;  2QRC A;  3OGD A;  4EAI A;  3L2Q A;  1P59 A;  1MUN A;  2F7L A;  1HU0 A;  3FHG A;  3UW2 A;  4CFF A;  4E7I A;  5KN8 A;  5FRM A;  1U84 A;  2D0C A;  3OYJ A;  1KG5 A;  5AN4 A;  2YA3 A;  1VTO A;  2EHB D;  5EPC A;  3CVT A;  1KG6 A;  2DKA A;  3I0W A;  2H56 A;  1WEI A;  2NWV A;  3KNT A;  3FHF A;  2V9J A;  2JHN A;  3S3N A;  3PDK A;  1P5G X;  1KEA A;  3I3W A;  3VW4 A;  3L2R A;  1VRL A;  3OS0 A;  4E7K A;  3CVS A;  3I0X A;  3OYC A;  1KG7 A;  2W03 A;  4B21 A;  1QTP A;  3ENC A;  5IYC P;  4C7P A;  2Z8U A;  1NH2 A;  4YOQ A;  4EAK A;  2PWW A;  4AIA A;  3G0Q A;  2QLV A;  1B9K A;  4EAJ A;  1KFI A;  3OC3 C;  4ZTJ A;  3EIK A;  3OSE A;  1M5Q 1;  1DIZ A;  3OYI A;  1VKL A;  3NA5 A;  4BE2 A;  2H4L X;  1QNC A;  1N39 A;  1QN9 A;  1QN6 A;  4BDY A;  1QN5 A;  1NVP A;  4BDZ A;  2HL8 A;  2ABK A;  1N3A A;  3KTU A;  2O3O A;  4PII A;  1LXT A;  1LWW A;  1E42 A;  1QN4 A;  2HL9 A;  2QR1 A;  1J3M A;  3EAY A;  4B0A A;  1MP9 A;  3DPU A;  1LMZ A;  1KQJ A;  3OYF A;  3L2W A;  4ZTF A;  3OH9 A;  3T4N A;  1M3Q A;  2YG9 A;  3OY9 A;  3L2U A;  3C04 A;  5HSH A;  4WX8 A;  1JFI C;  4E7H A;  4IKF A;  3OYE A; 
#chains in the Genus database with same CATH homology
 2NOH A;  4EVV A;  1WEG A;  3I0W A;  2H56 A;  4YPR A;  1WEI A;  3KNT A;  3FHF A;  3CWA A;  2JHN A;  4E9F A;  3IH7 A;  1KEA A;  2JHJ A;  4B24 A;  1MPG A;  1YQM A;  3CW7 A;  1VRL A;  2NOE A;  2OFK A;  1P7M A;  3CWT A;  3CVS A;  3F10 A;  5KN9 A;  3I0X A;  3N0U A;  3CWU A;  1KG7 A;  1WEF A;  4B21 A;  2I5W A;  2NOI A;  1YQL A;  1XQP A;  4YOQ A;  4EA4 A;  1M3H A;  1KO9 A;  4AIA A;  3G0Q A;  1YQR A;  1PU6 A;  2JG6 A;  4HSB A;  3D4V A;  1PU7 A;  5DPK A;  4OFA A;  4UOB A;  3FSP A;  1DIZ A;  2NOL A;  2YG8 A;  2NOZ A;  1RRS A;  1N3C A;  1N39 A;  4E9G A;  4EJZ A;  5CHZ A;  3CWS A;  1YQK A;  4E9H A;  1NKU A;  4UNF A;  1RRQ A;  2ABK A;  1N3A A;  4OFH A;  1FN7 A;  3KTU A;  4EA5 A;  1PVS A;  3S6I A;  4YPH A;  4DK9 A;  1NGN A;  1XG7 A;  4PII A;  3F0Z A;  1LWW A;  4EW4 A;  1MUD A;  3IHO A;  4OFE A;  1PU8 A;  1KG3 A;  3N5N X;  4AI5 A;  4B23 A;  2OFI A;  1KG4 A;  2XHI A;  1LWY A;  1EBM A;  1ORP A;  1LMZ A;  4E9E A;  1KQJ A;  3OH6 A;  3OGD A;  1LWV A;  1P59 A;  1MUN A;  1XQO A;  4B22 A;  3FHG A;  1MUY A;  3OH9 A;  1HU0 A;  4EW0 A;  1M3Q A;  1KG2 A;  2YG9 A;  5KN8 A;  4EJY A;  1KG5 A;  2NOB A;  5AN4 A;  2NOF A;  3CVT A;  4AI4 A;  1ORN A;  1KG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...