5FRMA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz384 (compound 4a)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frmA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frmA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frmA03
1J54A 2Z1HA 3LAMA 5IN1A 3RR7A 1WGSA 3TARA 4EZ6A 2OPRA 5J2PA 5HRPA 3V9WA 2K3XA 3G10A 2XO7A 4LD6A 4XIUA 3OYEA 3VQ7A 4M3RA 3AVKA 3ULDA 3DLMA 3EY1A 4LSLA 4KRFA 1U04A 4PLIA 3M8RA 3C95A 4DSKA 4NYNA 4FM2A 4K8XA 3HP9A 4CFBA 3QEXA 3ALYA 1NOYA 4JRPA 4EZ9A 1W9HA 1T8EA 1J5OA 4CJ5A 1NJWA 1NK4A 3K5MA 4CEOA 4NZGA 3V1RA 4O4GA 3QERA 1S1UA 4N47A 1G5VA 2IAJA 3PUFA 3ZT3A 3LGFA 3MO8A 1RBVA 3NBPA 4DQQA 4ELUA 4B3OA 2HNDA 3OMCA 2HHUA 4FU6A 4CIGA 1U49A 2KZZA 3KLFA 3AVBA 4Y1DA 3LP1A 4F2SA 4BDPA 2RHUA 2RO0A 3NTHA 1Z25A 1ZBFA 4CF2A 3K5NA 3SPZA 2O4IA 1VSMA 3AVHA 3NF6A 4CEQA 4DTRA 3S6WA 3FFIA 2HNYA 5KRSA 2HNZA 4DU4A 4NCBA 2DY4A 2CKKA 1GOAA 1RTIA 4O0JA 1IKWA 3G0ZA 4W5NA 2GFAA 3VQ8A 4KTQA 4CEZA 1OYXA 3NF8A 1ITGA 2F96A 2LCCA 3HXMA 2ZQBA 1VSJA 3O8VA 4CJEA 3KLGA 4KB0A 4A4GA 5CYQA 2EQKA 1D8YA 3TAMA 2YNHA 1WSGA 4L59A 2P0KA 4GMJB 3ASKA 4QVZA 4FJIA 3OS2A 3OYCA 4FJKA 1K6YA 2LDMA 3L42A 5D6YA 2HHXA 3LP2A 1DTTA 3VN5A 1LWCA 4E7LA 4FK4A 3ISNC 4OPJA 4DMNA 5C42A 2P51A 3LH0A 3TWHA 1MHNA 4LH5A 3TAFA 1KHCA 2IOCA 3M8QA 2IS3A 2EQMA 3TAEA 3SJJA 2L8DA 1T7PA 4CHNA 5HRSA 3HJFA 1I39A 3PMTA 3AA5X 2DFHA 1S1TA 1BCOA 4CGJA 3OS0A 3NNQA 1FXXA 1EKEA 3LWLA 1UA1A 3ZEHA 2PQWA 1D9FA 1LAWA 1S9EA 2D0BA 3I0RA 3CFRA 4FLTA 1XHZA 4O44A 1OZ2A 4CIEA 3MP1A 4KHSA 4FVMA 1QSLA 4B9WA 2YHBA 1KRPA 1VRTA 2Z1JA 3B6OA 4HUEA 4Q0BA 4NCAA 1CXQA 3VQPA 1O1WA 3AVMA 2YNFA 4F8RA 3ZT2A 4IUUA 5CYMA 1ZYQA 3NFAA 1HRHA 4BE0A 1NK8A 3VQEA 2NUBA 2Y1JA 4M3ZA 3WNGA 2W42A 5JS1A 5I42A 3OYJA 4F4KA 5KRTA 3QO9A 3HPOA 2JTFA 5KTQA 3ZT4A 4OKEA 1WSHA 4BDYA 1IH7A 3HSTB 1WLJA 4CJPA 2BUDA 4BWMA 4DTNA 4PWDA 4CEBA 4KI6A 4KKOA 5FDLA 4Z4GA 4DSFA 4YFUA 5SWMA 1S1WA 2YKMA 4CEEA 4DQIA 4QOZB 4DTOA 3KLIA 4QQDA 5KGXA 3NH1A 2XHBA 4FLYA 2R5AA 3KKRA 3NHGA 4FLUA 1SKSA 1YTAA 4CFAA 1XHXA 1VSFA 4PLLA 3L3VA 3I0SA 4LY7A 1WJSA 1NK5A 3BDLA 1NOZA 2PY5A 1J9AA 4PUOA 4FM1A 1R0AA 3MXJA 3H6ZA 3VA0A 3OVNA 2MWPA 4CK2A 1HPZA 4KTZA 4CGHA 3O4NA 3KLEA 1I3AA 4NCGA 3SUPA 3LAKA 4AHCA 2RPIA 3OYAA 3Q1JA 1IKXA 1VK0A 2AJQA 5KH6A 3HT3A 3QBYA 4DTPA 2B8AA 4M41A 1HMVA 3KKSA 3DLGA 3K58A 1WSFA 4BWJA 1NJZA 4W5OA 1DTQA 1TL1A 3KLHA 3MXMA 1BI4B 4KV8A 1HNVA 3ZCMA 2X4XA 3OJSA 3AO1A 5J39A 3RWUA 3EZ5A 3VQAA 1JL1A 1WSIA 1VSEA 3K2PA 5C0MA 3AO5A 1VSHA 1B9FA 2O4GA 3PX0A 3HP6A 1YT3A 2L89A 2G8UA 3DMJA 3DB3A 1RBRA 1WJRA 4KTWA 1LV5A 3P1GA 4HHTA 4RG8A 3HVRA 4N4GA 4H4MA 4FZYA 1RTDA 3PX4A 2RHZA 3L8BA 4WE1A 4IURA 3NGZA 3OQ5A 3P8DA 1ZBHA 4OVAA 1FKOA 1ZBUA 1YTUA 4MQ3A 4DF8A 2KW4A 2X78A 3VQCA 5FROA 2RJEA 4IFVA 1X9WA 1RDAA 4DSLA 2GV9A 1WNSA 3AVGA 3NAEA 3PO4A 4DQSA 4E0DA 4BDZA 4OPKA 5E41A 4B9UA 3NTIA 4II1A 2KFNA 3DLEA 1LW2A 4C8OA 3QINA 1TVRA 1JL2A 4KHUA 4I9QA 4KPYA 2FBXA 3MP8A 4UC4A 4F3TA 4H4OA 2X6SA 1RT2A 1RNHA 4FJGA 3BGRA 3TANA 2Q3SA 4DTJA 3DOLA 4DFPA 1C6VA 1EP4A 2XY8A 2IDOA 1WJQA 1ASUA 1RT6A 3T1AA 4DQRA 5IAYA 1RILA 4B9VA 1DLOA 1N5YA 3SCXA 3DRRA 3QKJA 4NYFA 4LSNA 4Z4HA 2F5KA 4GVMA 4E89A 1RT5A 3P8HA 1SKWA 1JLCA 1RI0A 2D9TA 1B9DA 1Q9XA 4W5QA 5SZTA 1UWBA 3HPHA 2D5RA 2X4WA 2ETJA 3E9FA 4IKFA 1C1AA 3BDPA 1WAFA 3O4QA 5D6XA 1BCMA 2XRIA 3LYIA 2E4LA 2E5QA 2HHTA 1BIZA 3T19A 3KTQA 4JLHA 1KFSA 1S9GA 3DLRA 3NH2A 2JGUA 3OS1A 2RKIA 3ZSQA 3CEYA 4TSXA 1UAXA 1ASVA 1LWFA 1JXEA 2HHQA 1UA0A 4FZXC 1TKZA 4IUPA 2O4XB 1Y97A 4O5BA 1QQCA 2R5MA 3CYMA 3AVNA 1RT4A 1CLQA 1C1BA 3DRSA 4G1QA 4HCBA 3ITHA 1TGOA 3C94A 1OI1A 4OKKA 2Y1IA 2GUIA 3V1QA 3CFPA 2VG6A 2X6NA 4N41A 1GOBA 2R58A 3MEWA 4JS4A 4OVLA 3GOXA 4NS5A 1QSSA 4KI4A 3PFSA 1S1VA 3AVCA 4OGCA 4KFBA 1TK8A 1T03A 1XC9A 4FLVA 5JS2A 3QIPA 3V81A 2YKNA 4CK1A 4Z4CA 2ZD1A 1ASWA 4AHSA 4E19A 1TK0A 2K3YA 2X4YA 3K59A 3PO5A 1C0MA 4QCLA 4FJ8A 2B5JA 4JS5A 4ICLA 3V4IA 3QEWA 3KIOA 1NKEA 1NK6A 3DI6A 1NKBA 4CHYA 1GOCA 4PY5A 2GF7A 5FRNA 4B9SA 3NE6A 3SV4A 3OYHA 3L3UA 1IKYA 1RDBA 2FBYA 3OYKA 5CY4A 4Q5WA 3MXIA 4CESA 5FRMA 2PYJA 3QNNA 3NGYA 3VQDA 4CF0A 3AVFA 2OPPA 3OMGA 4HUGA 3LWMA 3CG7A 3EYZA 4A4EA 2D0CA 3O3HA 1S6PA 1ZBLA 4Q5VA 3VQ4A 1C0UA 4GW6A 3JSMA 5J2NA 1RTHA 5HRNA 4R5PA 4O55A 3K57A 4CFCA 4B9NA 3QJ6A 4CHQA 4RG2A 4ELVA 3ZSYA 1IG9A 2I5JA 5HRRA 2BGGA 3QESA 2FBTA 5C24A 2OPSA 5KCOA 1L3UA 3OYBA 2BDPA 1NKCA 1NJYA 1CZ9A 3HL8A 4E3SA 3U6FA 3P5JA 4JRQA 3HK2A 3S9HA 1CXUA 4CEFA 4IUQA 3RTVA 3RR8A 3NTKA 3VQBA 2XY5A 1RT7A 4DLGA 2OA8A 4CRIA 4CEDA 4DSIA 3SUOA 3KD1E 3HO1A 1HNIA 3KK2A 3LPTA 1BGXT 3RMBA 3KD5E 3QEIA 4C5IA 1U4BA 3ZT0A 3NF7A 3OYFA 4FM0A 4CK3A 4CEAA 3LANA 3SD4A 4CJUA 1HYVA 4AHUA 2Z1IA 4C8MA 2G8HA 4A4FA 2M1HA 3FEOA 4UQGA 3MEEA 3ZSVA 4B08A 3F70A 5I3UA 1HQEA 1TKXA 3D45A 3LZIA 2BE2A 1B92A 1H3ZA 3C6TA 4OLAA 1IO2A 4RW8A 2RJDA 2G8IA 4C5GA 2E6LA 3OJUA 1N27A 4M3TA 1NK0A 2RF2A 1TV6A 4Z4FA 3LPUA 4FZZA 4FJLA 3AO3A 4CGGA 4KHWA 3IG1A 1X1PA 2DAQA 4FW2A 2EKOA 1JLGA 4W5TA 3C4SA 1RBSA 3PX6A 3L2QA 4FJ5A 4FJNA 1U48A 2P5GA 1J53A 2G3RA 5CIUA 4KHNA 2BKDN 3V6DA 4CGFA 1QE1A 4IG0A 4DF4A 5DK5A 3TI0A 3KUFA 3PMIA 3ZT1A 4I2PA 2F8SA 2IC3A 3SNNA 5EU7A 1G15A 3WNEA 4DQPA 1KCFA 4CJLA 3S3MA 4L8RB 2LVMA 3TR8A 1XWLA 2DTUA 4M3WA 2FHDA 2RN2A 2XDPA 5J2MA 2HB5A 2VG5A 4CHZA 1MU2A 3IS9A 4FJ7A 1S5JA 1LW0A 4ID1A 3E01A 1VSIA 4J2AA 1WAJA 4DU1A 4FLWA 4DS5A 4H8KA 1BL3A 1VSKA 4B8AB 3F73A 2EFIA 2WACA 3TAQA 3H08A 2ZE2A 2QKKA 2OPQA 3LX7A 3A2FA 3RRGA 2HVIA 4J2BA 4ID5A 5HLFA 5HBMA 1KLMA 5M9OA 1T05A 4CJ4A 1NJXA 1TKTA 2DIGA 3FDRA 1JLQA 4C5EA 2BANA 3V1OA 4BD3A 1RBTA 4E7IA 1L3SA 1U45A 2RJCA 1ZBIA 4DFJA 2E6MA 4CFDA 2OZMA 1RDCA 3VQ9A 2QKBA 3QIIA 4FJMA 4QW2A 3TAPA 4HUFA 4QQGA 2Z1GA 1S1XA 3S3OA 3ZSWA 5CZ2A 4IUVA 3V9ZA 4B9LA 1NK7A 4X34A 1CZBA 4KHYA 4CJTA 1TAQA 5J2QA 3UWNA 1A5XA 4LH4A 4OLBA 1L3TA 4FCYA 3K5OA 3EAEA 1VSLA 3QLHA 3SI6A 2MWOA 4IG3A 1RCHA 4RW7A 4CHPA 2YNIA 3ASMA 4DU3A 1BQMA 4ZTJA 3LP3A 3OB9A 1FK9A 3SV3A 2G8VA 2OYQA 4N56A 3OYLA 3B6PA 2NLUA 3U3GA 4IDKA 1QTMA 1QSYA 2R7YA 3M8SA 4E7KA 1WSJA 4RW6A 1KLNA 2HHVA 1LAVA 3DM2A 3HPGA 4ZHRA 5HP1A 1D5AA 3V9SA 2WONA 3HYFA 1RDDA 3LALA 4CGDA 2ITGA 4CGIA 4J2DA 4PL6A 1BQNA 3VA3A 2JZ2A 4AHRA 4AILC 3PV8A 2PYLA 2JLEA 3AO2A 3OYDA 1N6QA 4RW9A 2G8KA 3S3NA 3WNFA 4C8KA 3AVAA 3HVTA 4CF8A 3QIOA 2B4JA 3MEDA 2OZSA 3OA6A 5KCHA 3MEVA 4CIFA 1XNIA 2RHXA 4CF9A 3SZ2A 1RT1A 3C6UA 5D6WA 2YNGA 4FYDA 3META 4AHVA 3SQ0A 4KB1A 1X9SA 4DWIA 2O4XA 3VQ5A 2FBVA 3QEVA 5KGWA 2WOMA 2PZSA 5K14A 4IUTA 3L2VA 4LD0A 3CFOA 2RI5A 1C1CA 3LLRA 4CJKA 3QEPA 2G8FA 4E7HA 1W0HA 4DTUA 1JXBA 3KJVA 3RMDA 4FLZA 1JLAA 1HJRA 2B6AA 4CHOA 3T3FA 3ME9A 1JLEA 4N4HA 2HHSA 1TAUA 2E6NA 4CJRA 4EP4A 3DYAA 1A5VA 2P1JA 1SUQA 1BHLA 4M3XA 4C8NA 3AVJA 3H8ZA 3SQ4A 3MECA 3RRHA 4DG1A 3V9UA 4QAGA 1VSDA 2KTQA 3DLKA 3SPYA 3ZSZA 1WN7A 2HQXA 4MFBA 4QQ6A 2HHWA 3O3GA 3LDSA 3CM6A 2HVHA 5T7BA 4HCCA 1TKDA 3RMCA 1RTJA 2VWKA 3TABA 4KHQA 1KVCA 4Z02A 1WSEA 4CJWA 3SUNA 5KE3A 4FK0A 2XY7A 2P5OA 3AA4A 2FC0A 1QHTA 4DTXA 3RMAA 1NK9A 4M3YA 4FJHA 3UIQA 1HYZA 2DIQA 4FL6A 2RHIA 4RW4A 3E9GA 4KAZA 3CQ8A 4CJQA 4FXDA 2LRQA 1HYSA 3LGLA 3P83D 3OYNA 2YV0X 2VG7A 1JKHA 1JLBA 3FC3A 1UOCA 4E7JA 4CERA 2YRVA 1FKPA 1YVUA 4BACA 4HCZA 1Z26A 3IAYA 2DFFA 1X9MA 5CZ1A 4DFKA 1TK5A 3OY9A 3K5LA 5C25A 3OYGA 2EQJA 5DMRA 4I9LA 3QNOA 3OYIA 4OJRA 3L2UA 1KTQA 4CJSA 4IBNA 4CCHA 3KK1A 3LP0A 1L5UA 2DFEA 3CM5A 4ELTA 3L2RA 4CJFA 4N4IA 4BE1A 3AVIA 4B9TA 3AO4A 4DTSA 4FK2A 3NDKA 2ATQA 2A1RA 4B9MA 4B9XA 4A4HA 1EXQA 2M16A 4J2EA 3PNWC 3UT1A 2RJFA 4B8CA 2XK0A 4FJJA 4DSEA 3SQ2A 1KVBA 1REVA 1VRUA 1S6QA 1A5WA 3DOKA 3VQQA 4W5RA 1RBUA 2QQSA 4KREA 3NCIA 1L3VA 4F3OA 2RI3A 3DLBA 3LZJA 4EP5A 4FJXA 4AHTA 3PY8A 2EX3A 4N5SA 2QQRA 4GY5A 4CECA 4M42A 1JLFA 2RI2A 1TL3A 4E1NA 3AV9A 3QETA 3FLGA 2HQEA 3OYMA 3SYZA 4FLXA 4ZTFA 4DSJA 3MP6A 4FW1A 4HVJA 5D3GA 1LWEA 1SV5A 4OGEA 4PA1A 3DRPA 1BISA 4DS4A 4CJVA 2XY6A 3IRXA 3ZSRA 2VWJA 3U3YA 4PQUA 3JYTA 1QS4A 1EETA 3ZSXA 3THVA 2D0AA 1SL1A 5C6SA 3NH0A 4F2RA 3AA2A 1Q8IA 1BI4A 1IKVA 1KFDA 4Y1CA 4E1MA 3M9QA 2QXFA 2IG0A 2M0OA 4DFMA 5HROA 4DTMA 1EX4A 2GBZA 1SSFA 3DLHA 2LTOA 4DLEA 1Q9YA 2G8WA 3NGIA 2LSNA 1U47A 1XI1A 4M3UA 4Z4EA 4Z0UA 3ZSOA 3AA3A 3DB4A 3D0PA 2IGIA 1C0TA 3AVLA 5KE2A 2HMIA 2VYTA 3I8DA 2KZMA 4I7FA 4FJ9A 3F9KA 4M45A 1SL0A 3L2WA 3VQ6A 2A1SA 3KK3A 4OKJA 4YNQA 4C5HA 4I2QA 3SQ1A 4CF1A 1D9DA 2X35A 2X74A 4K8ZA 1SKRA 3TAGA 1OZ3A 1BIUA 1SL2A 2KQ2A 3WNHA 2BIVA 3O3FA 4IFYA 1KVAA 2QK9A 2KFZA 1HQUA 5J26A 3V9XA 3MEGA 1KSPA 4AH9A 2EHGA 1F21A 4CE9A 2HW3A 4C8LA 4CJ3A 3M8PA 5J1EA 4O0IA 3NF9A 3MAQA 2F8TA 2YHAA 3SUQA 2RHYA 4KO0A 2R57A 3MEAA 2L3RA 4EDUA 4BE2A 5KI6A 4HTUA 3MEUA 4N76A 1RT3A 3HM9A 4Z4IA 2EQUA 2GFUA
chains in the Genus database with same CATH superfamily
3EETA 4CYCA 3M0PA 4FE7A 2ZXIA 3EFRA 3HOUJ 1U5TB 2W25A 3BFMA 3IRRA 2RN8A 3RR7A 2PNIA 3DKYA 1RAFB 1IF1A 2OPRA 4D9JA 1AZGB 2Z5UA 3W3DA 1KYZA 2RQWA 1YI2T 2K86A 2E7XA 4AD9A 3BDDA 4RGSA 1ZBXA 3HOZJ 1PYVA 1TUUA 3F10A 2OJED 5H1SQ 4M3RA 4HW0A 1R58A 1OOTA 2L7MP 3EY1A 1YIJI 3VRYA 4KRFA 1U04A 2QW9A 1ZX6A 3G0QA 3C95A 4FM2A 2HNIA 5DUKA 4K8XA 2SRCA 1IW7F 1YXQA 5I21A 3QEXA 2HVSA 1WCMJ 1JTXA 4JRPA 1UMQA 4M7DA 2C0IA 3DPTA 2ITMA 4EZ9A 4B43A 3PL8A 4CEOA 4NZGA 3WGHA 3UE5A 1TL8A 2KT1A 2GWKA 2K3BA 1KG6A 1JCFA 1KU9A 1VQ5I 1VQLI 4Z6YA 4N47A 1G5VA 2IAJA 3PUFA 3BF1A 1QVTA 3TO6A 2KT0A 3VPRA 1ZR4A 5BR8K 2CP3A 5EEAA 4PJOB 5GMKl 1XX5A 2KJBA 2FRWA 4JI7K 2HNDA 2MFZA 1TUYA 2CP6A 1ZSZA 2W6KA 3DTKA 1SMYF 3CCJQ 3AAFA 2DRKA 2RQTA 1U49A 1GCQC 3CXCA 1TNSA 3KLFA 2RDPA 3FZLA 4XTVA 4JKCA 4BDPA 5IP6A 2XPUA 1PNJA 2RO0A 1Z25A 3LWFA 4MZTA 2V51B 3WU0A 3CQXA 4XK8E 3K5NA 3SPZA 2P6SA 2O4IA 1VSMA 4CEQA 3VS4A 2NAZA 4M63C 3VETA 5KRSA 3LFKA 2PVDB 3A1YA 2HNZA 1WJDA 1ERDA 1ZLJA 4DU4A 1KA8A 2QGGA 3M9AA 4KNYA 3RCOA 1RTIA 4O0JA 1N75A 4GFBA 5GAOl 1Z05A 2C06A 2G0EA 4O3MA 2M1BA 2G7HA 4KTQA 3C1DA 3NF8A 4FWPA 3HXMA 3KP6A 2P0PA 3MZYA 4A3MJ 3EHRA 2KIMA 3GEZA 3L1PA 4E9EA 3E97A 3VYUB 2QLZA 1VQMN 2GBYA 2MIOA 4RUGA 2E12A 3ASKA 3QZ9B 1Y0MA 2K79A 4JI1K 4EMGA 4M77G 1ZBJA 2XHKA 4FJIA 3OYCA 4FJKA 1E6GA 4N9HA 2RKHA 3I55A 3FXRA 3LP2A 3CCSQ 5BPNA 3VN5A 1E3OC 1D1AA 3V8KA 1HKTA 3ISNC 1XD7A 1AWWA 3G4SA 4JK8A 3RKYA 4VUBA 4IPAA 3CCJT 4BGBA 3O9UA 3I5SA 1SF9A 1N33K 4IEIA 5IYDJ 1OPCA 4JZ4A 3SJJA 4HX8A 5LJ3f 3MKYB 4CCKA 5GAN6 2XB5A 2CH4A 1W0TA 1QU3A 4IHYA 3BLYA 2ELKA 1VQ9I 5M3FJ 1FBSA 1GLDG 2NRRA 4ZGJB 1IG8A 2RN7A 5EYRA 1FJLA 4M3EA 1RR8C 4IXCA 1KG3A 4V19K 3FGUA 3EN9A 3ZEHA 4U0WA 2KSSA 2D0BA 4ZN1A 1VHXA 2HOTA 1DJ7B 5F27A 4UNFA 4BC3A 4O44A 1OZ2A 3IUCA 4RLFA 4IZZA 2DZCA 2FB7A 3LSHA 4CA0A 2W6LA 2EAYA 2LQ8A 2YHBA 1KQJA 4EW0A 3V7CA 1KRPA 3J81Z 3M54A 1HJOA 3SAGA 2VCPA 4DQ8A 4Q0BA 3KEYA 2IGMA 2VODA 3SBTA 5CYMA 1ETWA 1ZYQA 2OTJQ 5FLXO 2KHOA 1Z6TA 2EFPA 2KRNA 1QVGS 1NGIA 2NUTB 4F7UE 4J19A 3VQEA 3W2AA 2JSCA 4M3ZA 4XLPF 3OYJA 2D6FA 4J6XA 4X64K 5HLTA 4P5NA 3HPOA 3DF8A 1MJ9A 1XSDA 2DTRA 3T7ZA 3HOXJ 2YXYA 1Q82R 4C92C 4IXAA 1PVSA 2CFXA 3FMSA 3MEXA 4LLGF 2J5PA 3INZA 1WLJA 4O8UA 4CJPA 2YS9A 2K57A 3C0BA 3R1XA 1D8JA 4BWMA 3FK6A 2Q31A 4CEBA 4PWDA 2P9NB 4KI6A 2DNUA 3CC2N 4QVDA 5GAGP 5SWMA 4YFUA 3IKVA 3C7NA 4XTYA 3EEQA 4QOZB 2WUSA 4M7AB 3CJQB 1QVFA 2JT1A 2HHHK 3CDLA 1IZ6A 1V55H 1DP3A 5GAOp 1YTAA 1D5YA 1D0ZA 4B4CA 3EGXA 3L3VA 4MDBA 1M3AA 1O75A 3VF4A 1X58A 4EMHA 4LY7A 3G71N 2CH0A 1R5GA 3DLLF 3BDLA 4LOCA 3SHFA 4F7UF 2DT6A 1JI8A 4JI0K 3UKGA 5E17F 2W84A 3CC4I 1Y96A 1HPZA 4KTZA 4N4NB 5CHZA 4CGHA 2NVTJ 2OTJT 4M7DC 4LF4K 3LDNA 4XM3A 4EVIA 4NCGA 3SUPA 2UZKA 5AQRA 1ON1A 5HLGA 3F8MA 3Q1JA 1RAGB 1CZAN 5CHIA 1VQKN 3HT3A 3HSRA 1BYMA 3QBYA 4DTPA 3BR5A 4M41A 1IC8A 4HG2A 1HMVA 2JZYA 5ICCA 1UEBA 3DLGA 1BJAA 3CXCP 1WSFA 4BWJA 1NG2A 2OZUA 4W5OA 3VGLA 5J6XA 4AU7A 4C92D 2COYA 1A0NB 1ZSZC 2A3ZA 2ISZA 2ZJ2A 1C0FA 1HNVA 4F52A 2HKOA 1NG9A 4DBFA 1R1TA 1AT1B 1QQMA 2IBDA 1WJAA 2KZGA 3AO5A 2O4GA 2Y9ZA 3HP6A 1IBLK 1YT3A 2FEIA 2OZ6A 3KTUA 2E5LK 3DWLE 1RBRA 1RI9A 2VBZA 4EEFG 4BEHA 3P1GA 1RC9A 3B73A 4N4GA 2F48A 5D6FA 4FZYA 3QUIA 2Q0OA 2QM3A 3KP7A 3B8AX 2NUZA 1WGXA 3C6HA 5JFRA 3PX4A 1XCBA 3L8BA 1BDGA 5BN9A 3FZHA 5K5OA 4IURA 1M9SA 5KPRA 4MGRA 2CZ1B 3NGZA 5EGOA 3P8DA 2E1CA 5HL7L 1KQSP 1O3SA 2EGEA 5EEHA 2JMCA 2X78A 4GLMA 3Q0UA 2WADA 4IFVA 2B9SA 5M1PA 1RDAA 1X9WA 4DSLA 1RKTA 5EY4A 4M7DD 2JTMA 1ZG5A 1GVJA 3PO4A 1X1BA 2LKXA 3S93A 2PAVA 1EBMA 1EV7A 1RRQA 1RI7A 5GANj 5AFUA 1U3EM 5FKNA 3D5RC 2DX1A 1ZARA 2L3DA 1XQPA 1ZRFA 2V9KA 1VQMA 1LW2A 4C8OA 5DDGA 3K1PA 3QINA 1UAAA 1NYGA 5IT9K 4KHUA 3MP8A 4WCGA 2W57A 1Z21A 2O9SA 4H4OA 1ZK8A 1RT2A 2H94A 2X6SA 1EO1A 1RACB 2Q3SA 5BREA 4R8HA 4LFCK 2LNHB 4HSTA 2I5WA 2LC4A 2HBKA 1WJQA 2FZGB 1HUXA 5IAYA 2DO3A 3J81K 2BHZA 4ESBA 4IJNA 4RTFD 3H3ZA 3P9KA 3H9NA 3SCXA 4BH9A 3D4VA 2KPMA 4N9IA 4LSNA 4GVMA 4E89A 3P8HA 2HI3A 4GLKA 3MQ0A 1MZBA 2RH2A 1UB9A 3BQZA 2QEXQ 1Q9XA 4W5QA 1UWBA 2AO9A 2ZFWA 4ZYEA 1LMZA 1XOVA 3E9FA 4IKFA 5L3FA 1VQ6I 4CI6A 3UB5A 3WTZA 1WAFA 5D6XA 2R4GA 2F2EA 3D2FA 1I27A 5JLFA 5E1WA 3R9PA 2W03A 3IFRA 5BPMA 1QNTA 2NRWA 5MLCQ 2FU4A 1S72I 1OR7A 4UUTA 3M4GA 1PG5B 1HR0K 4E9FA 2DXTA 2RQRA 2ZJQL 1ZSZB 3HC7A 1MUDA 1XDUA 3JSCA 2XPVA 2HHQA 3PIPL 4RAZA 2KIQA 3X20B 2O4XB 1K4US 2M30A 1Y97A 4ZJZA 1QQCA 1KC8O 4AT1B 1M1FA 3CYMA 2DQLA 2EW3A 2EZHA 1CLQA 2LK2A 4G1QA 4X62K 1VQ5N 1VQLN 2EYZA 3K10A 2FNAA 4AMCA 2L9VA 1QVFP 3GBGA 3HRSA 4JP0A 2ZJRF 4DEXA 2Y1IA 1FPQA 2BVMA 4ZNXA 2NZTA 4B44A 1JJ6C 1WHJA 1XSXA 3ZQCA 1TQPA 5IP7J 2HL5C 2X6NA 3SDBA 2NRVA 1SHGA 5JVHL 3HHGA 1YQAA 3K6GA 3S17J 4OVLA 3GOXA 4KI4A 1KJWA 4S0HB 4MMLA 3SQNA 1M1KC 3CMAQ 2A05A 2IPQX 4M72A 1S1VA 5GAMj 4KFBA 3JREA 4ZN3A 3A8LB 4GGGA 3MKLA 5TRDA 2VC0A 2YKNA 1G4DA 1T98A 2HEOA 1UB4A 4UUVA 4IEJA 3PO5A 1C0MA 2M9UA 4C1NK 4QCLA 4FJ8A 4JS5A 3BTIA 1MV0B 1Q81R 2L7ZA 1MDMA 3KIOA 3CMEI 2YSRA 3I54A 4Q47A 4XONA 2OJ2A 1K1ZA 4JK9A 3G71A 5L3BA 1YJWI 3ISPA 5K1YA 4QS9A 4B9SA 2XI9A 1OCCH 4OB3B 2CJJA 2YHWA 3BY5A 3TSUA 4CZHA 3JR9A 4EJTA 1YHQQ 3OYKA 2O31A 2IXSA 5AQLA 5LGTA 4PJ0C 3LDQA 3FBIB 2PBIA 2VOPA 4DYQA 2DU9A 1MBEA 1T6CA 2HQAA 4L9VA 1QWFA 3ZQLA 2JWKA 5GAOq 1VQKA 3VQDA 1JKPC 1U2VA 2A36A 3CCRA 3JRDA 1W6XA 4A59A 3OW2M 1GXQA 1J0RA 3HGGA 2HVQA 2LQKA 5F2RA 1PP7U 3QWLA 3FZFA 4IDHA 5IHKA 1RLQC 3CMAT 1C0UA 4C8QA 1IRXA 2KFDA 5J2NA 1RTHA 4MFDA 1QZ5A 3CC7I 4R5PA 1Z9CA 4O55A 4L0YB 3ULEA 3I3LA 2LY9A 1IG9A 3PQJA 4EFHA 2I5JA 5HRRA 2HBMA 2V9PA 5IY5H 5C24A 2VL8A 1WHHA 4WF2A 4IOAF 2MSYA 3OYBA 3PSIA 3L2ZA 2F4IA 3H9GA 1NKCA 5BPLA 3ZEUB 1CZ9A 1D3YA 2I2LA 3HL8A 4E3SA 3V7RA 1FJGK 1P7MA 2JQ7A 1M90C 4JRQA 3O5ZA 3LL7A 3A8OB 4JN4A 4BUGA 1J59A 5GANf 1Z3YA 4EJZA 1JEGA 3RR8A 1YHQT 4AIKA 4GV3A 1ZR2A 2V1NA 2X1EA 3GFLA 1VA7A 4ELYC 1REPC 4ENKA 2OA8A 4ILJA 3WG9A 4NBQA 3LOCA 3BCBA 4HF2A 4CRIA 3HOSA 2PQ8A 3CCVI 3OOPA 4M78G 4KN7X 2GM4A 3AG3H 4CD3A 2DILA 3KD5E 5E26A 3QEIA 3K0LA 1X9JA 4QLCU 3OYFA 2J6KA 1WOQA 2DJNA 1AA7A 3I8BA 1X2NA 4PJMA 1WJFA 4D5FA 4IEEA 1R0CB 3IAM2 3EGXB 3H46O 4CJUA 5D8LB 1W1WE 2Z1IA 3ASNH 2YWWA 1R59O 2M1HA 4UQGA 1XG7A 3RSEA 2ASOA 3JTGA 3ZSVA 1WXUA 3WG7H 1Y8QB 4BRIA 5F1JA 2UYTA 3FKJA 3O1BA 3EG9A 4JKEA 3K4MA 1H3ZA 3C6TA 2RJDA 1P6RA 2RF2A 4XRMA 2EFOA 4RKUE 5I2SA 3AO3A 5ERIA 4KHWA 3PO3J 1IUYA 1X1PA 4FJ5A 2ASMA 4RTWA 2P5GA 2VQCA 1J53A 2G3RA 4CICA 1OR7C 2DCEA 3D7EO 2XHCA 5AT1B 3V6DA 2WV0A 2E65A 1X6GA 1ITYA 2NRTA 4HSRA 3J7AY 3SWNA 2RF0A 4BU2A 2L4AA 3CC4N 2A3LA 3VYHB 1XQHA 2K40A 3S3MA 3LA3A 4L8RB 1OMIA 1UTIA 2GAUA 3S2WA 3TR8A 4FYVB 4LDUA 5E1XA 5F1RA 1XWLA 2Q1NA 3F72A 2HKNA 4YDUA 3QPTA 1T2KA 4B8XA 4EA5A 4BY6C 4M3WA 4K25A 3LW5E 2RN2A 5J2MA 4NL2A 1UZCA 3NQOA 8ATCB 3ZMTA 2F2VA 4BEHB 4X9DA 3E66A 1S5JA 4CDGA 1LW0A 2DA1A 4ID1A 1I07A 1U0JA 3QHSA 3A5MC 1LPLA 5DTDA 4IVNA 4DU1A 1X4OA 2R7SA 2ACJA 1VSKA 1OFCX 5EGOB 2WACA 1X2MA 2D0QB 1VQ5A 1VQLA 3TAQA 2LVSA 3J7AP 2QKKA 1G3WA 2Y30A 3A2FA 2HVIA 4BBSJ 1P92A 4FWSA 1Z9ZA 1KLMA 1WJ5A 2LJ0A 4CJ4A 3AAPA 1TKTA 2M4KA 2UXBK 2ED1A 3FDRA 4C5EA 5LMNK 4BD3A 1RBTA 2WAQA 2RJCA 1ZBIA 1WQ7A 1BI0A 4DFJA 4I6MA 3QMLA 1B9NA 1T6DA 2ESHA 3D1NI 1NBEB 1F1ZA 1R49A 2DDBA 3VQ9A 2QKBA 3C6AA 3HXLA 3I9QA 2BOLA 3TAPA 3SEZA 2RK2A 3ATVA 2EIJH 2RVCA 2CS7A 2CZ0B 3N5BB 3ZSWA 3IKTA 2ETHA 4IUVA 3V9ZA 1QVUA 2P9PB 2BZTA 4NUBA 3G4SQ 4CZIA 1VQ4N 2JWTA 3R6OA 4IZ9A 2L9SA 2JT4A 3DPLC 2MC3A 3EAEA 3QB0A 4IHTA 5ADXA 4H5WA 4AM3A 1KU7A 3VSKA 2XMFA 1T3SA 2XU8A 1RCHA 4CHPA 1IV0A 4DU3A 2HZDA 4LDYA 1FK9A 4C3HJ 3GFMA 1QP2A 1P4AA 4KH5A 5EZHA 1QZYA 2K5FA 2X0LA 2CDTA 3CPFA 2WFBA 1FBQA 4A0YA 3EKSA 4IDKA 2QQBA 2KT8A 4C8QC 2R7YA 3M8SA 1YFHA 1W97L 2K9SA 2W24A 3D2FB 3ULRB 3HYFA 4FX4A 4G8XA 3S15J 1RDDA 4J2DA 1V76A 2M0MA 1MBKA 4PL6A 4LFAK 1FTTA 2K4JA 2PMHA 1FN7A 1BQNA 5IWAK 4RM3A 3MWMA 5FPDA 3PV8A 3EE9A 1YYVA 2PYLA 1WHMA 3I55T 2D0OA 5KVRA 4FT8A 1MPGA 4C23A 1N8RR 2EILH 4OAZA 1E6HA 1BM9A 2VONA 3O4WA 1KD1R 3F21A 1XC3A 3VWBA 2JA6J 3HVTA 1VQ9A 3G4ST 1HKGA 3QIOA 2B4JA 3MEDA 2K9GA 1XNIA 2MK5A 3H41A 2XIDA 4HRIA 5BN8A 2RHXA 3M58A 3IUOA 1R8OB 5JLWA 1S9HA 4BY6B 3JRFA 4M75E 5FLXE 2QAZA 1RAEB 3S6IA 3O9RA 2IGKA 4LFBK 4FYDA 3F3XA 3META 4OP0A 4KT6A 4KB1A 3VYRB 1I6HJ 5E3NA 2EV6A 5GPAA 2FBVA 1G3TA 2EZIA 1YUWA 3VQ5A 1JUSA 3COAC 3EFSA 4XLCA 3RI4A 3DLLL 4TVRA 4KUIA 2DERA 1U78A 3BPXA 2HD0A 3H9QA 4IUTA 2KROA 3NHNA 5GADJ 2RI5A 3LLRA 2P84A 3QEPA 5B1AH 2E2JJ 2VGMA 3OW2A 2F5VA 2FOKA 3QPSA 2E7WA 4C8QD 1G6NA 3M0QA 5I9EB 5AN4A 2QWLA 4JUVA 4DTUA 2WBNA 1UHCA 1T56A 2W41A 3JCMP 1BR2A 4FLZA 3FJPA 2KHMA 1VQPN 1JLAA 3I0TA 4CHOA 1WUAA 1WHLA 2AZSA 4XQ3A 5FPMA 1NTCA 4L5EA 2W40A 2HHSA 4EP4A 1X3ZB 2VQHA 4M75F 1A5VA 4XTUA 1RRSA 3BC8A 3E5XA 4C8NA 3AVJA 4BR4A 3H8ZA 1NJIC 1IXCA 3OSSC 2HSPA 4X1VA 3V9UA 1R4MB 3DLKA 5C44J 1WN7A 3E0JB 2HQXA 1HOMA 3SWNC 4GCVA 3MWPA 4LNPA 1NEGA 4QQ6A 3O3GA 1KC8U 2HVHA 3HKSA 1F4KA 2HF3A 4ENNA 4B6MA 2K5LA 1HD3A 4CZZA 2QSFX 3I0WA 1U2VB 4YDUC 1KVCA 1JJ2A 4Z02A 1WSEA 4CJWA 3SUNA 4FK0A 2P5OA 5LRRA 3AA4A 4RB1A 1Z91A 2PI0A 1TWFJ 3OV8A 4PFPA 3JAMZ 1I50J 2COZA 3EFOA 3DP7A 1RAIB 3CC4A 5BR9A 2R92J 4C8QB 4BRHA 2XKPA 3WTYC 3E9GA 4GY2B 3C18A 4IHSA 1NGGA 4F7UG 4FXDA 1WXBA 2EBIA 5E18F 2XRLA 4BHCA 1K8AC 3HB9A 1WRJA 2GWJA 4HNTA 2A68F 2LP0A 2D1HA 3LCNA 3CCQN 1J75A 4XTZA 4FYWB 4MTDA 2IVNA 2ISYA 5ICEA 2YV0X 2VG7A 3VTIA 1JLBA 3V7SA 4P55A 4L0ZB 2DTZA 4II3A 1PP8F 3DQVC 2HS5A 1FTZA 4ISFA 5CZ1A 4A57A 1NK2P 1XTDA 1XMKA 1O7FA 2L01A 4A93J 2E5ZA 2EQRA 3K5LA 2L3SA 1X1DA 3CBPA 5LJ5e 5C25A 3CC7N 5DMRA 3CJCA 1KU2A 4I9LA 3I33A 1E2XA 3WVDB 3SDGA 3IQLA 3ENOA 2DJZA 4YIFA 2KRCA 3L2UA 4BVPA 2MD0A 1LQ1A 3KK1A 2DFEA 3CBOA 4A3EJ 2P0WA 5CKDA 1VQMQ 4N4IA 3QOEA 5AQXA 4EAHD 4KH4A 3AVIA 3R60A 4ASNA 4B9TA 4OB1B 1RLPC 2NNWA 1IRFA 1AHDP 2R5YA 3W0LA 5EZGA 2J6OA 2ATQA 2A1RA 3HTRA 1R9TJ 4A4HA 1EXQA 2ZJPF 4GYGA 5L3CA 2LSOA 3CCLI 5JI6A 2RJFA 4B8CA 2QWMA 1OCRH 4FJJA 5L8RE 3ATUA 4YY3K 4EPCA 1KVBA 2JVGA 1V4RA 1VQ4A 1S6QA 4ESJA 3RSEB 2KAFA 3W2WA 1M3HA 6AT1B 1O3QA 1XGSA 3M59A 2A61A 3EG9B 4F3OA 3PSFA 3LZJA 4JQFA 5E8GA 2EA2A 1M2VB 4AHTA 3PY8A 2LX9A 3N97A 2AQFA 2FSKA 1BIAA 4I0BA 3CWTA 2VWFA 2IIRA 3ESWB 4XRSG 3GTPJ 3CLOA 1TWCJ 4CZJA 4M42A 4B22A 4RCBA 1JLFA 3M6GA 1S8NA 2KYMA 1TL3A 4D0PA 3SYZA 2VJ5A 4FLXA 3MX5A 1R77A 3O8HA 3SWNB 4M6VA 1LWEA 1ETKA 3K4CA 1BISA 4DS4A 2ZJRL 4F55A 2CUDA 2IRFG 1NGDA 3ID8A 3IRXA 4EHTA 3MMYB 1VZ0A 1VQMT 3G6EI 4B23A 4Y92A 1IREB 4JKGA 1IAWA 2F5TX 3RKQA 4KGXB 2ZM6K 1ZTRA 1A31A 3JYTA 3M1CA 2PFBA 1NKUA 1VQ7I 2GTDA 4H5TA 2V1UA 4F2RA 4RTZA 3AA2A 1Q8IA 4H0TB 2R0QC 3JRAA 2HAXA 1VYVA 3M9QA 2BTTA 1FMKA 4EM0B 1HXDA 3OW2P 4DTMA 1EX4A 4E70A 2LTOA 3L4IA 4DLEA 4YOYA 2G8WA 2VPRA 1S72A 3SMSA 5K5QA 3R61A 4LE9A 3J80Z 1I8FA 3UATA 4XTXA 2H8WA 3IHUA 3F8FA 3RSNA 2HDDA 3REAB 5BRFA 3DB4A 2ZAEA 2IGIA 2GIVA 1ATSA 3AVLA 5KE2A 4FETA 2HMIA 3O9SA 2J06A 4NC8A 3WHCA 1KO9A 5AQPA 4BXXJ 4I7FA 3CC2Q 2XAUA 3EGDA 3R6SA 1WJEA 4G12A 2A1SA 3HOTA 4I6MB 3HUGA 5M3MJ 3KK3A 3GX4X 3BJAA 1PJRA 3CVSA 3QYHB 4I2QA 2X35A 3K7AJ 2GTJA 2L2OA 2ZPFB 1X75C 1NU0A 1KQ1A 1OZ3A 5M1FA 1BIUA 3TEEA 4C3IJ 3LSTA 4IWVA 1GBRA 4GKJK 2BIVA 3O3FA 4IFYA 3DLLA 1HQUA 5J26A 3V9XA 3O2PE 4PNOA 2EHGA 4JHDA 1HKSA 4BREA 3G71Q 4CE9A 3Q3SA 3AY9A 3JAMK 1KG5A 4CJ3A 3M8PA 2NS0A 4O0IA 2GX9A 1FOYA 4KICA 2V9VA 3CDHA 1JJ2P 4KO0A 3JTHA 2UXNA 2XKOA 4BXFA 3MEUA 5D4RA 1GXIE 4N76A 1RT3A 3GWZA 2I0NA 2H1KA 2NOZA 2EQUA 3OYMA 2GFUA 2E34A 3OH6A 4LK1F 4B24A 1VQKQ 3OBWA 5CVVA 1AVZC 3R0AA 4WQ5A 4DOZA 3TARA 1YP5A 4LC9B 5J2PA 1MSFC 3V9WA 4LUEA 3EUKL 2KRSA 4PUSA 2VQLA 2XAJA 2H3GX 2D45A 4LD6A 4XIUA 5M1OA 2LREA 3IH7A 3CC2T 5M1QA 1GLEG 3ULDA 4CI0C 1I94K 2NUPA 5DCMA 3CWSA 4PLIA 4DSKA 2RGVA 3HP9A 4CFBA 1N36K 4WWCA 2CGHA 4MO7A 2KR3A 4JEPA 1NOYA 4JDSA 4LIVA 3C2BA 4HAMA 4J7FA 4KA4A 1J5OA 3TL4X 1SRLA 3K5MA 1B59A 4C1NI 1QZZA 4BQNA 5AFUH 3TREA 5HOOA 3G71T 1KEAA 1S1UA 2DFIA 5ECAA 4XBFA 3F0ZA 5J4VA 1Y71A 1LUJB 4QTRA 4AIHA 3LWHA 2DOAA 2X3WD 3NBPA 1E3HA 4F7ZA 4J9HA 5GJWB 4ELUA 4CCLA 1K4TA 2HHUA 1LDJA 4FU6A 4BAYA 2V8KA 4HNUA 4RMNA 3CC7A 5HNHA 1PSEA 1JTYA 4CZCA 4UV8A 2CQNA 5M5YJ 1PD1A 1VQKT 4GKKK 2R7DA 4CF2A 2E3HA 1ULYA 4CZKA 1Z0XA 2ZCFB 1E3PA 3PFIA 1NZ9A 4CBUA 3IH3A 2XB0X 5EG0A 5CKEA 5D7UA 3K0SA 3G0ZA 1P90A 1KONA 3VYSB 5A2QO 5M1KA 2A5WA 4NC6A 2LCCA 2VVKA 1ZG1A 3O8VA 3KLGA 3BG3A 4JI6K 5CYQA 3I9V2 1T0JA 2EQKA 4ZDOA 1EF4A 3LDLA 3ABLH 1D3BA 2DTHA 1VQNN 1MGTA 4L59A 2P0KA 4KBOA 4GMJB 1ZREA 3JCMQ 1MIJA 1MNEA 4HKEA 3CCVA 3EQLF 2FQ3A 4B3SK 1K6YA 2LDMA 3JSPA 2QQAA 3MPUB 3TQNA 1QPMA 4IHXA 3RYPA 3TP0A 4OPJA 2VI6A 1AWJA 2OQRA 4BC2A 5CQEA 1GDTA 4Y52J 1TYQA 3TSQA 1KG1A 5DCFA 3LH0A 3HHHA 3TWHA 2K9QA 2JPBA 1EJ9A 4LH5A 3J80K 2IOCA 3M8QA 2IS3A 3JRCA 2EQMA 3K70D 2L8DA 3FHNA 2JVVA 2PMZA 4U67L 5LLQA 3EFOB 2E71A 1SD5A 4IRGA 2D5VA 3BR2A 4FWKA 1HU0A 1BBYA 2FPFA 1YJNI 2YCHA 1XS9A 1NLOC 1WHGA 1IGUA 2FZKB 1TG0A 1LB2A 4CVNE 1EKEA 2OTLI 2NS8A 1UA1A 1GUUA 2PQWA 3T5XA 1LAWA 4ELZC 2EFQA 2NOFA 3NEUA 4EMKA 5CQYA 1VQ5Q 1VQLQ 2FF6A 3BEXA 1IN8A 3MAJA 4K11A 4AF1A 2CQ7A 3GW2A 1UJYA 4ENJA 1KIKA 2D0PA 1CXQA 1S3XA 5F0CA 1YI2I 1IDYA 4IUUA 3R0JA 1R71A 1I4K1 1K9MR 4EATA 3NFAA 1HRHA 5AZIA 1MKMA 4XOPA 4BE0A 4WYBA 1N6AA 2NUBA 1Z7UA 2GOMA 4C0ZA 3WNGA 2W42A 5I42A 1PVEA 4EVVA 3WVEB 3TSWA 4DCHA 3TQ7P 4M77F 3G2BA 2R5YB 2JTFA 3H5RA 3HRTA 1T0FA 4HPQA 4BQLA 4AI5A 2NOLA 2XKOC 3A0IX 3KLOA 3ELKA 1OH8A 1S5LC 2OBPA 4ILHA 4QPQA 4GXOA 2BUDA 1OISA 1IJJA 3H0IA 3JCUC 4RTXA 3PVQA 5LJ3e 4DTNA 4KKOA 5FFXA 1WI3A 5FKKA 4AG1C 2YKMA 1OU9A 4DQIA 4WQ5C 1U6GA 4J9CA 2DI3A 2P9IA 5KGXA 2F4VK 3T1BA 2XHBA 3TU4K 3KKRA 4L5IA 2OAUA 3KZZA 2K5IA 1SKSA 2HR3A 1VQ5T 1VQLT 4CFAA 1HBXG 2CU7A 4PLLA 4HLYA 5FPEA 3CUOA 5LGNA 2P4WA 1ZGWA 1U8RA 1MW7A 4A53A 3CLQA 4DOVA 4TV7A 2JJ9A 3QU6A 2Y9YA 2PY5A 3M55A 1RNLA 1PC0A 1K73R 2KKZA 4IJAA 2KIUA 2GGRA 1APLC 2YDLA 1DU0A 2HBLA 4M3FA 3ZX2A 4CK2A 3QJYA 1IN7A 2GA1A 4DW6A 4OMFB 4C0DC 3CJBA 4MHGA 2YI1A 3H5NA 2DT5A 3CETA 3LAKA 3ECHA 2F2WA 1GLJO 1NGAA 2CQXA 2PJRA 2EJGA 5KYYB 2OF7A 4KRTA 4D7NA 2VUMJ 3SFIA 2B8AA 5LJ5d 2V7YA 4KFCA 3O5BA 1YX5A 3RIRA 4PJOE 5CK9A 4PZJA 1FZPB 1DTQA 2YU3A 3KLHA 2XGXA 4KV8A 2X4XA 1J7KA 3AFHA 2M7BA 1MD0A 3AO1A 4J9GA 4JX6A 2OCCH 2JHJA 2VQGA 4BQOA 3EZ5A 2LMDA 2CRGA 4KGVB 1WSIA 2XHIA 2IVMA 3K2PA 1YWPA 5C0MA 2QCOA 1BW6A 1UHSA 1TP4A 3G6EN 4B1UB 1RESA 3QYFA 3DMJA 4LF6K 3VUZA 3DB3A 2QVOA 4M6YA 2DD4A 4GDFA 1VQ7N 4NNJA 3CCJI 3OSVA 2DXBA 4H4MA 3MD2A 1ARKA 3MHXA 4BXUA 3AGKA 3M8FA 3CESA 4C30A 4BRQA 3GTGJ 3EGDB 1M90O 3OQ5A 2IA2A 3HUGB 4AI4A 1DIZA 1LFBA 4OVAA 1FKOA 1YTUA 4MQ3A 3K4NA 1BR1A 1O3RA 3JRGA 2E41A 4G7ZF 4PL7A 2ZF5O 2HPIA 2F9WA 3NRVA 1FY7A 3L7WA 3FSPA 4JHDB 5DPKA 4F7UB 4DQSA 4WXDA 1U6ZA 4E0DA 4BDZA 3BTJA 3SZPA 4S05A 3EG1A 4OPKA 3PJRA 1X01A 4DOWA 2EZLA 2R7QA 1NLPC 2KFNA 2TDXA 2HDWA 4BRKA 1ETYA 2GOXB 2KBTA 4OPAA 3UA6A 4A69C 3GBQA 2FPEA 1IDZA 1TVRA 1JL2A 1EQYA 2EGAA 4KPYA 2FBXA 4RAYA 3G1LA 2D0NA 3M0UA 1V5FA 4Z88A 2H1LA 4H5RA 3CCSI 3TU5A 1BOAA 3BGRA 3DFGA 1IRGA 2YPRA 3IH2A 1AOYA 2O8BB 2OCEA 3BG7A 4XSZF 4EJVA 4JKFA 2ZMEA 2PX9A 3SFMA 3LWIA 1EP4A 2XY8A 3HPWA 1ASUA 3T1AA 4DQRA 4CGZA 1BK2A 1RILA 3VS7A 2OAWA 1HKQA 5B66C 3CC4Q 3KP2A 3GPLA 1Q86R 3DRRA 3QKJA 4Z4HA 1XDSA 1RT5A 2DK5A 2QDYB 4OIQF 1OJLA 5LRSA 3I4NJ 5EVZA 1KZHA 4LG3A 1JE8A 4KIBA 4EMKC 3FBNB 3QDRB 4B3MK 4M75G 3EHQA 1NE8A 4C0DB 1KG2A 3WXKA 1BCMA 1VQ8I 2DJIA 2E4LA 3T9NA 5CKTA 1BIZA 2P4RA 1ONVA 3CUQA 3T19A 2A28A 3QFPA 1KFSA 2JGUA 4Y15A 1USSA 2F5EA 3ZSQA 3HG9A 2ZJPL 5FLVA 3QICA 1W1FA 2OV7A 4JJNK 1NYFA 3W3CA 3LH5A 3M4YA 4TSXA 4A3IJ 2WB1A 1UAXA 1SFEA 2C0OA 3LSKA 1LWFA 3NFCA 1JXEA 5J1RA 2K2VA 1UA0A 4LF9K 3H9JA 1B07A 2V1DA 3ZQIA 5EEGA 2F4MB 2I10A 1X3UA 1J6ZA 5LEKA 1T0FC 2RA2A 3AVNA 4BRAA 5ADXH 4C2MJ 2YRDA 4J9IA 5BOXA 2VKVA 1OULA 3F22A 4PJNA 1CF7B 3V1QA 3KZIC 2QI2A 3ERMA 3CC4T 5AYFA 2UUBK 4N41A 1GOBA 4OF1A 1AOJA 1VQ4Q 1O9SA 4JS4A 4IRIA 3SK3A 4JX4A 3PNVA 4EV0A 2VC1A 2K9NA 4L9JA 5GADP 3AT1B 1SEUA 4FWRA 2E2PA 4OGCA 3U23A 3LFUA 1WVRA 1T03A 2ZFUA 1X69A 5JS2A 1JKRC 2O8DB 2CS3A 2DT7B 2BUPA 3H45C 4Z4CA 1ASWA 1TK0A 5GAEJ 3C7JA 2DBKA 2X4YA 3K59A 3L9FA 4BY9C 2CP7A 1Q7YC 3BR0A 4ICLA 3MZ8A 3QEWA 2R7RA 3M0SA 1NKEA 3U9DA 1NK6A 3CCLA 2DA5A 5F0HA 1TYQB 2FF3B 2FBKA 2X48A 2OQGA 1LPQA 3FM3A 1U3OA 4H5NA 1Y6IA 3SV4A 1OX9A 4BI3A 3X2QH 4J5YA 3VUBA 1XMQK 1AWOA 2CUZA 1NGJA 4DA4A 3LA2A 4WFNL 2IS2A 3NVMA 2Z3YA 4CH7A 3J7YJ 1MWMA 4J6YA 4E1JA 3MXIA 2DJQA 1RDWX 5FRMA 4DBQA 3QNNA 1BKBA 1KXPA 5LL6Z 1G2BA 3RMSA 2H6CA 1A36A 4NO7A 2OPPA 3OMGA 3BR6A 4HUGA 3LWMA 2DA3A 2BGCA 2CP5A 1VQ4T 2NOIA 1PRLC 3HBTA 4A4EA 2D0CA 4FWNA 2V7FA 5HK0A 3RPUA 4AFUC 4XN3A 3O8GA 1ZA2B 3FMRA 5E3LA 3VQ4A 2ESWA 1S72Q 4GW6A 2M45A 1M3CA 1LOJA 1ZN2A 3CCYA 2HXIA 3WXLA 3BY7A 3LSPA 1FMWA 4C2UA 3QFUA 1HF0A 2VXEA 4CFCA 3G6EA 4JYAK 4CHQA 4RG2A 3ZSYA 1WFXA 2NRHA 4DBRA 5LGUA 3BF3A 3U4LA 2BGGA 3QESA 1WI9A 1VQ7A 3F9MA 1T6SA 4I2OA 1TW2A 1JKOC 1L3UA 2LT4A 2D4WA 2BDPA 3H0DA 4DUYK 2FYKA 5AZIB 1W2BA 1BOTO 3EG0A 2DEQA 4YOWA 3DCFA 5E3OA 3HK2A 4CEFA 4GYIA 2DETA 2CV0A 1LFPA 3NTKA 3JCMV 3C3WA 3VQBA 4C92E 2WY8Q 3E6MA 2K5CA 1HNWK 3K9TA 2MG4A 3REOA 3QO3A 1WZOA 3ZMDA 4KH6A 1XC5A 3A98A 2DKGA 1IXSB 2KLOA 4DSIA 4KH1B 1EH6A 4Y3OA 3KD1E 2KIFA 5C0YA 1TWBA 3LPTA 2UUAK 2CT3A 4C5IA 4G6QA 3TTCA 4CBWA 1Z67A 2ZMEC 3SJHA 4FM0A 1I0CA 4CK3A 2DTIA 4CEAA 2BEOA 4F92B 1S72T 3SD4A 1HYVA 2P9NA 2XGDA 2VPLA 3S8PA 3BTLA 3BW1A 1YITI 4RMOA 4M7AA 2YUQA 1TKXA 1NJIO 3WHBA 4DEYA 2GQIA 4YFNF 3I55N 3K9KA 1IO2A 4DYRA 3TOAA 1QP3A 1WYXA 2L3QA 4ZDLA 4Z89A 1Z9QA 4C5GA 2E6LA 2IS1A 4M3TA 3S2HJ 4Z4FA 4M7DE 3M8JA 1RUWA 3LPUA 4KT5C 1DKGD 2FVUA 4C92F 3J7ZI 2HGCA 2DAQA 3ZCOA 1R7JA 2HF4A 4L5GA 3LQRA 3L2QA 1K78A 2PJRB 4FJNA 4BR7A 2HTSA 1U48A 3CUQC 2QEXI 2DMQA 5HLHA 3CPWA 2Z99A 5CIUA 3F2KA 5JHFA 4LXCA 1J5YA 3CCQQ 1QE1A 4IG0A 4Y13A 5AJ3K 4ZC3A 1YQRA 2B0LA 4I2PA 2F8SA 5D6EA 5CQXA 2A0FB 4DQPA 1HLUA 5GANe 1H0MA 2FMYA 3H3VK 1BI2A 3ZLJA 2LVMA 4B1VA 2JS0A 1MUZA 4A62A 2DTUA 1K8AO 3ZX3A 3KLNA 2FHDA 3CC7Q 1IHVA 3EYIA 3K4BA 2XDPA 4BRNA 2HB5A 2OPTA 3KETA 3QP6A 2KXCA 3S1RJ 4KIFA 3QYBA 4YFKF 2DMNA 1Q81O 1BI1A 3IWZA 3WTTC 3RVCA 3E01A 2EYYA 4M7DF 3M1FA 2LKSA 2NVXJ 5LJ3d 3CJNA 1WAJA 3HSCA 4FLWA 4DS5A 1UJ8A 3J80O 4M78F 4AVZA 2L4MA 2JWLA 3UDCA 2GELA 2ZZDA 3VTHA 3ZYYX 2NNNA 2OPQA 3GOIA 3R8EA 4J2BA 4ID5A 5HLFA 5HBMA 5DS9A 5M9OA 1LCUA 5FKOA 1ZH5A 1X19A 2LD5A 2HDAA 4H0VB 1X6BA 4Y91A 5CVUA 4B48A 1U45A 3R6NA 3HM5A 1HSJA 2O6GE 5A2QE 5HKCA 1JQQA 4RTTA 2BBYA 2VGNA 4DJAA 2ZXHA 4MQVA 3IHOA 2LG4A 4V2SA 3QIIA 1SKUB 1QRYA 4QW2A 2DL3A 2X4JA 3CF5F 2XC7A 4HYEA 4HUFA 4QQGA 2Z1GA 1EIFA 4EGZA 5E79C 4H0XB 3K69A 4WK8F 5FO5A 2VJ4A 4OMMA 1WHUA 4X34A 4G9YA 1CZBA 1ATRA 5J2QA 4LH4A 5FU7C 1K0SA 4H0EA 3CC7T 4OIPF 4XORA 3I53A 1M3QA 2YG9A 2ZMEB 2MWOA 1RFQA 1ACIA 1ZSGA 1RIOH 3ASMA 1MBHA 4MZPA 2HQHA 4KYWA 3N0UA 2HOEA 4ZTJA 2KYBA 2X6XA 4ATOA 1YHQI 3GL1A 1AWCA 1NLVA 4YORA 5K7FA 4RM2A 3GZ6A 3KWIA 3U3GA 2NLUA 2DMOA 4UUSA 3R4KA 2EJ9A 2E70A 1QTMA 1N9SA 2BE7D 2GLOA 5J8CA 1MSEC 4I09A 4E7KA 1M90U 1KLNA 3TOBA 3KYLA 3ULQB 4ZHRA 2WA0A 1N25A 1R0BG 2DA6A 4CGDA 2ITGA 4CGIA 1W2BP 5GAMe 2Q97A 3CUQB 4BKXA 2PVGB 1W5CC 3VA3A 2K3PA 1WEGA 4MO4A 1ORKA 3CCVT 4E6RA 5IOYA 1K0XA 3AO2A 3OYDA 1AHJB 4LJZF 4ENMA 4ZYDA 1N6QA 2OUMA 1UFFA 1P7IA 3BZ6A 4BQZA 2E1OA 2R3SA 1YJNA 3M7GA 4IQ4A 1VQ8N 1XTAA 3RPQA 3MEVA 2DA9A 2OTLA 3C65A 3SZ2A 3DXJF 3UPUA 3VGMA 3SQ0A 4X65K 1XCVA 4L9NA 2JS2A 2IGOA 1X9SA 2O4XA 1QZ6A 2KI7A 3QEVA 3GTQJ 4NQWB 4PJJA 4RWTA 4KULA 1DU6A 1G2HA 1OLTA 2ZCWA 4JYKA 4Y17A 3THYB 5D4SA 4XLHA 5K14A 2Z16A 2LFBA 3RPUD 2RQQA 4HX7A 1YI2A 4CJKA 1GLBG 5AQOA 4BHPA 4GRIA 4W97A 1X1AA 4MDAA 3IWFA 1JXBA 1VQOI 4M7AC 1UGPB 3ZR8X 4XKCA 3CD6I 2ZNZA 3S1MJ 2L2PA 2HZTA 1Q1HA 1HJRA 2GXGA 4AC0A 2FXUA 3T3FA 4PIIA 5F08A 3ZN1A 2X6OA 1Y0NA 3CPWP 4XKBA 1NG7A 3OBYA 3JCMg 2JTEA 3JRZA 5HDGA 2E19A 4FWQA 1I1GA 5AQTA 3L6QA 3RYRA 2YLCA 3TSZA 5BPDA 1SUQA 2LMJA 2E4HA 1G99A 3PQKA 3CJ1A 2XDVA 4DG1A 2AXTC 4QAGA 2KISA 2D1XA 2KTQA 3I35A 5FU7B 4HTLA 2YHTA 4MFBA 1HSQA 3VEVA 4OFEA 4D8KA 3CM6A 3FX3A 4V2FA 3ROUA 4HCCA 1K79A 2UXXA 2KXDA 1SMTA 4CXFA 4JX5A 2HQ5A 1TKDA 2IS4A 4L9TA 1RTJA 1WLPB 5CKHA 1FC3A 2FJ1A 3H5AA 2VWKA 3A0BC 1ATNA 4CHUA 1EWRA 1U5SA 1LWYA 1Y7XA 3I0XA 1NK9A 4HT9A 2KLAA 1P2FA 3Q0WA 3QSUA 1YCSB 3HGYA 4O6JA 2XPWA 3J8AA 3WEEB 2RHIA 4RW4A 5IH2A 3CDIA 1X3WB 2A41A 3FXLA 3CQ8A 3NAUA 1MBGA 4CJQA 5IT9Z 4ZYGA 1Y57A 2M2EA 4M7AD 3LGLA 1VI0A 2BE5F 4N0BA 5CCAA 2RD1A 2G6FX 2LYCA 1H8KA 2HKXA 3JCMf 1HYOA 1JKHA 3VW4A 1SD4A 3KNTA 1E7OA 4FOIA 4HDUA 1ZHFA 4FPBA 4BG8A 5FPNA 4E7JA 4CERA 2VBYA 2YRVA 4RGUA 2R5ZB 3BUZB 1LVAA 1YVUA 4BACA 4WTOB 2DFFA 2DPPB 2PZ1A 3W6JB 5FLXZ 3FK7A 1FX7A 3A5LC 2EQJA 4M7YA 5F6FA 5LHIA 1ZUKA 1KTQA 3ZEUA 4CJSA 5HCKA 4PKHA 4IBNA 4A63B 4M75B 5I2MA 4ELTA 3BOQA 2Z2SB 5GAGJ 1VQNQ 4G9ZA 2MC4A 1ETXA 3GTJJ 3AO4A 4DTSA 1PM3A 4AM6A 2M51A 1YWOA 4DR4K 5FLMJ 2M8GX 4NL3A 1FOXA 1WXTA 3KVGA 1ORPA 1ZQ3P 5BNGA 5TJJA 4J2EA 3PNWC 4BR5A 5FGMA 4DSEA 2MI6A 4AIDA 1IO6A 4YHHK 4IL6C 3CWUA 1D1BA 4XKWA 3LSMA 3HTUA 4IO8A 1N8RO 2QQSA 4I01A 2AK5A 5KPZA 1L3VA 1ZC6A 5GTHC 5JHUA 2P9SA 2DDAA 4PJOG 2X1CA 2DPDA 4C0FA 1BW5A 2F69A 3NMZC 2CGJA 2EX3A 3ZN0A 4GY5A 4A5NA 1K78B 2MGQA 3T1YK 1F36A 1OKRA 1YW8A 4XL9A 5LFAA 3TDUC 2PJPA 3AV9A 3SZGA 1YITN 3CCSA 2HQEA 4JKHA 3MN6A 2QBYA 5GJVB 1GLCG 4ZTFA 4A12A 4PCQA 3MP6A 4FW1A 4HVJA 2RHKA 2DOEA 4Y7NJ 4OGEA 4PA1A 5KPTA 2LLKA 3CVTA 3LL3A 3AHUA 3ZSRA 4M4ZA 2ESNA 5GMKh 1SFXA 1VQNT 2LCSA 3U3YA 2D8HA 2HFHA 5DM7F 1SS6A 3JCMb 2FX0A 3CCRN 1UHMA 3RNJA 1EETA 1V29B 3U8XA 1JJ8C 1ZBSA 3SHWA 4QSHA 4D6WA 2HSTA 5CQGA 3E1YA 2EV0A 4E1MA 3K9JA 2KDZA 3CXCS 2GXAA 3KHYA 4HT8A 4DFMA 5HROA 4HWIA 1VQ8A 1KAZA 3TTFA 1R1UA 4D5CA 1ABQA 1NBWA 2GBZA 1LCKA 3DLHA 4M77A 3OH9A 1W70A 2HYGD 5M5WJ 4HLXA 2YR2A 2DPUA 4IFEA 2D1VA 2E8AA 4OMNA 1IGNA 2ZKZA 2NOHA 3ZSOA 1TUDA 1NJIU 4BNCA 3KK7A 2DXUA 1B72A 3THWB 3VPZA 3I8DA 2KZMA 4FJ9A 3I56I 4M45A 3L2WA 3LQQA 4OKJA 1SFKA 3BG6A 1M8VA 3FZMA 3SQ1A 2X74A 2L02A 4HVUA 4K8ZA 1T0HA 1J09A 2JM9A 1KQSS 3QODA 3SMPA 5LJWA 5HDKA 2FG0A 2A6HF 4JKAA 1BA5A 2EFWA 1KVAA 2KFZA 2QQ9A 1IV8A 2A69F 2W48A 5EDNA 3MEGA 4GVEA 2P8TA 4AH9A 3EG2A 3OOUA 4C8LA 5J1EA 2R7TA 3NF9A 4O8KA 3MAQA 2F8TA 2VYPA 2RHYA 1Q1VA 1CQTA 2R57A 2IPOB 2L3RA 1NM7A 4EDUA 5IP9J 2OFIA 3PM1A 4WCIA 1HKCA 1K8AU 2SEMA 2GNCA 1QLYA 2P9PA 3VGKA 5GANd 3HM9A 3P7NA 1QQOA 1O7LA 4NLBA 1IBMK 2Z1HA 3TMOA 3J7AF 5KQDA 4C2TA 2EINH 4GV9A 1HW5A 4UUSB 2CW7A 2DAOA 2P5KA 3ZFJA 4BRMA 4DR1K 3VOEA 4C8QE 2JK3A 4PL8A 1C0GA 2K3XA 4FM4B 3CMMA 3G10A 2XO7A 2QTXA 5FLXK 2KMTA 2HYFA 4JJDA 2RM4A 1IN6A 2NOGA 3OYEA 4OWRB 5C2DA 2NNYA 3AVKA 2YUSA 2BXYA 3DLMA 3Q9SA 5J47A 3CCMI 2AZVA 4LSLA 2X9HA 3FJ5A 1QA6A 1K83J 3DEUA 3G6EQ 2KL4A 2P81A 4BS9A 2QYZA 3HOYJ 5K7HA 1M4ZA 1ZYRF 3CIPA 1VQ7Q 5LJ5g 2HTJA 2YHYA 1W9HA 4JNEA 2F4OB 1T8EA 4CJ5A 1X1CA 1L0OC 4GV6A 3V1RA 4O4GA 3QERA 3PTAA 2XAHA 3ZT3A 3ABMH 2CUJA 3LGFA 1PSFA 3HZJA 1RBVA 4MO5A 4PKGA 1YIJN 4CC4B 4BRLA 2COMA 3VFZA 3AL0C 5F1XA 3RR6A 2EIFA 1FP1D 2ICWG 4OMPA 3A4CA 1W7PA 3WTXC 1MJBA 2FLOA 4NXMK 3ECOA 4Q5SF 3A8MB 2KNBB 3AVBA 2EB7A 1JCGA 4HEA2 3GYHX 2RHUA 5AQGA 1ZBFA 2PBDA 1A35A 1T95A 4XLAA 4DV6K 3WGIA 3OSGA 3GTLJ 3AVHA 5DV5A 1SAXA 3FZVA 1OYYA 5D5UB 3KP4A 3S6WA 2CP2A 3FFIA 2HNYA 4NCBA 2DY4A 4DIQA 4XEIA 3THXA 1QVFS 3HIFA 3IV5A 1T39A 2O7OA 3NVKA 2JRMA 2BY2A 2WAQN 3CP8A 4IOCF 1IKWA 4W5NA 1BA1A 5GP9A 3H92A 2HBPA 3VQ8A 1FWZA 4CEZA 1OYXA 1ITGA 3G6ET 3MN7A 4XICA 1JT6A 3PUBA 1OCTC 1VSJA 4X9CA 4CJEA 4KB0A 3LNQA 4HF0A 2DVJA 4HF1A 5LJ5f 1UDLA 1D8YA 4KUMA 3TAMA 3A8GB 2HWVA 1VQ7T 2VXFA 2YNHA 2VJIA 2ZXWH 1WSGA 3A2KA 2LZ6B 4B1ZA 1MJAA 5KYXB 1N3CA 3MK6A 2I7PA 3CCUI 3OS2A 2A6EF 3LDPA 5HS7A 4XSXF 5GAMd 3CD6N 2O8FA 2HHXA 1K76A 2WTUA 2WC9A 2UV1A 1MWKA 2DL7A 1IN5A 5C42A 3E6DA 2P51A 4YOXA 2UUCK 2ABKA 1ZLMA 1IUFA 3WTVC 3SBGA 4DKWA 2VT2A 5L3EA 4KISA 1OV3A 3MFKA 2YX6A 4H0PA 2XF6A 1YITA 1MHNA 3TAFA 3THKA 3FLCO 4D1QA 1PCXA 2R93J 5HRSA 1OPKA 1QKXA 1PHTA 1YF5L 1I39A 1KQ2A 3PMTA 3AA5X 1UHFA 4A61A 5JVGF 2P5LC 1S1TA 2EA4A 2E1NA 2NLXA 2E1MC 3CCEI 1BCOA 1OH5A 3PGGA 3OS0A 1POGA 2DW4A 4M77C 2GTOA 1FP2A 3W6KB 4MZMA 2V26A 2QEXA 3FB9A 3LWLA 5KCMA 2V75A 2CREA 2AIRB 3DAWA 3K1MA 1S9EA 3N4MA 4C92G 3WQTA 3CFRA 2KRMA 4FLTA 1RRJA 4CIEA 1DT9A 3FXKA 1S7AA 3N4PA 4FVMA 3KCCA 3H36A 4XR6A 1O3TA 1N78A 1VQ9N 3DEWA 4I98B 3S1QJ 3B6OA 1SD7A 4HUEA 3VQPA 4A5BA 2GCXA 3AVMA 1T3VA 5L3DA 3MDQA 1JUMA 4F8RA 4NC7A 2DK8A 1J5EK 3GZNB 2GWRA 3AL0B 2PMUA 1ZA1B 3A5ZB 2M5WA 3GCMA 3CJ7A 2E35A 4DYCA 1PUEE 3CC2I 3KYDB 4BRFA 1YAGA 2F2XA 2ROTA 5BMZA 1BG3A 3T8RA 2Y4XA 1MDUB 1ON2A 2JXBA 1HW2A 3H0HA 1BBZA 2V1RA 3GIBA 2F9TA 3QO9A 5KRTA 3ZMSA 3WXIA 5KTQA 3BJ6A 4BB7A 1U9NA 1RL2A 4CBXA 2DVEA 3FMQA 1WWXA 2EYWA 5FWBA 2DYIA 3G73A 2EWSA 2BVLA 1JJ2M 4A54A 2DQRA 1NWKA 3GDQA 4M7DG 3WQUA 1ILYA 3RDIA 1NGHA 5FDLA 4Z4GA 4DSFA 1S1WA 2EIMH 1OCPA 5E84A 1OVQA 4HDVA 1KSWA 4CEEA 1NNEA 3SYTA 4MEYF 4M77D 2XICA 2G9WA 2RC4A 4LFUA 2P9SB 2R5AA 3NHGA 1Q7YO 2XIGA 2P9KA 2B63J 1AEYA 1XHXA 1VSFA 1HK9A 1MMGA 3I0SA 1U1SA 5DY9A 2I8DA 1YVNA 1H9GA 4DUZK 2IA1A 1NK5A 4LF7K 3G1MA 1VYTA 3GLXA 4EJWA 4F14A 5KAFC 1DEJA 1J9AA 5C12A 4FM1A 1R0AA 3MXJA 4NB4A 3LSRA 2QBYB 1M2VA 3OVNA 4IO9F 5HS8A 2MWPA 3ZXSA 2LNBA 2KDSA 2Y0MA 1I3AA 3E5UA 1XB4A 2HU9A 2AKKA 2PUKB 4YRVA 4OMZA 2X6YA 3OYAA 1IKXA 2LQNA 5BPIA 2CYYA 2AJQA 1W5TA 1KQ0A 4HNVA 3JCMX 2IGNA 1QHGA 3KKSA 2MH2A 1NJZA 3KP3A 3O1WA 3AARA 3GG4A 5AQQA 3VOVA 1MUNA 1Q82C 4LN2A 3MXMA 5D5WB 4G94A 1DDNA 1S7OA 3WTSC 2CO5A 2OFKA 3OJSA 2E1MB 2HBWA 3BCAA 3BTCA 3LAPA 4YPRA 2PU9B 3BY6A 3VQAA 1JL1A 3W2VA 4M77B 1WPKA 1DP7P 3F0CA 1B9FA 1YIJA 3OL3A 2G8UA 2JM8A 3OL4A 1WJRA 4KTWA 2CMPA 3AG2H 5B3SH 3E1SA 4HHTA 4RG8A 1NG6A 1N8RU 3HVRA 1HNZK 1W36C 2WAEA 4XIDA 3IAS2 1B72B 4M9SA 5IXBA 1S7EA 2M9HA 4FIBA 1KK7A 2RHZA 1IN4A 3RERA 4B1WB 1Z77A 3JB9D 2ECCA 1ZBHA 3QYEA 2K9LA 3LSGA 1ZBUA 3L4QA 2IVWA 4DF8A 2KW4A 3VQCA 3VEWA 3PIPA 2G7UA 2VE9A 2V7ZA 3BP8A 3VKIA 1ZG3A 5ICFA 4AIAA 1XMXA 1H1VA 2GV9A 3MVPA 1J3TA 2KKOA 2OA4A 1MMSA 2LDUA 1DQUA 5AIQA 3D5LA 1QVGA 4A0ZA 2H8RA 3M3ZA 1TOVA 1R1VA 2VKEA 1SVMA 5E41A 5CKFA 4B9UA 4FOEA 3I56N 3NTIA 3I55Q 2L5QA 1FLIA 3H0GJ 3EO3A 3FXOA 4YTLA 5C15A 4XH5A 4CC3A 2HNHA 2D8JA 3GXOA 5GIOA 3HRUA 1W7PD 1GCPA 3S1NJ 3LM9A 1TQIA 1VQOA 2V6CA 1I81A 3CD6A 1QMCA 1RNHA 1WFWA 4FJGA 1FYKA 2OD5A 4P96A 3ABUA 2CH6A 4DTJA 3RZDJ 1YX3A 4QPOA 5BQTA 4DFPA 2IVPA 1RT6A 4K42A 1H641 2VASA 4AQYK 3IH4A 3ZETB 1DLOA 3ERED 3H1VX 1RKWA 3P39A 1W36D 1R00A 4OMLA 1K9MO 1XG1A 1WPYA 2LR8A 3T8TA 4IF4A 1WJCA 5DUIA 4BG9A 3PIOF 2XROA 4NB5A 5GMKj 1SKWA 4UV9A 1JLCA 4PJLA 4BUPA 1RI0A 4EW4A 1B9DA 1M1KR 1B4AA 4J00A 4PK4A 3QPHA 3VF2A 2R7VA 4J9BA 2A08A 2DF6A 1C1AA 3BDPA 2ECZA 3MN5A 3O4QA 5LL6S 1YQMA 1QW1A 4Y33A 2HHTA 1XNRK 1BIBA 2RNGA 4WXHA 4M78A 5K5RA 3TDZC 2FO0A 2JPCA 2BZYA 4JLHA 3RDVA 1S9GA 3NH2A 3OS1A 3VSLA 3A03A 2CQKA 3CCMN 5HVQC 4ANJA 4FISA 3CEYA 4IRHA 1YO5C 4PSWA 3HTSB 1W7PB 1ASVA 1VQ6N 2AHJB 2Y0SN 3MMVA 1TKZA 4IUPA 2NWMA 4RCHA 4O5BA 4F9OA 2XG8D 4R1HA 3IRQA 4BQAA 1RUNA 1C1BA 3AGRA 1S72N 4HCBA 3ITHA 1K73O 5LJ3g 3UA7A 2RQUA 1S22A 2GUIA 4ISEA 3CZ6A 4B3TK 2C0TA 3KFVA 1P7JA 1Y8RB 3THXB 3TCJA 1AD5A 5AQSA 4OFHA 3JCMJ 2GBQA 1JRIA 3TPQA 2VQEK 1OCOH 1Y07A 4NS5A 5LBQA 3PFSA 2JN0A 2E10A 4E47A 1R6RA 5C2FA 3O08A 3ZGKA 1Z6RA 2WWYA 3L00A 1S6LA 2PEXA 4FLVA 3QIPA 2NOJB 3V81A 3HSFA 1OPLA 4DZPA 2J5OA 4NXNK 4CK1A 3ONQA 2XV4S 4WFBL 2K3YA 1KQSA 4MLOA 1VUBA 2Q2EA 4LB6B 5C4XJ 5DM7L 3E6CC 1AZEA 2O8FB 1OCZH 2J05A 1RAAB 2AP1A 1WIEA 5KN8A 4R55A 4KGZB 2L0KA 3M0TA 3GP8A 3UF4A 3G3ZA 3O8MA 5D5VB 3A8YA 4CHYA 1FOKA 2NOEA 2QWNA 2EPDA 4CD1A 1U2WA 1M90R 3DKMA 4CJ7A 5IHNA 1V54H 2VKNA 1R22A 1IKYA 4FL9A 1RDBA 5TGTA 2FBYA 4PGGA 3I5RA 1JB0E 3CCUN 2MBFA 3OMYA 3MN9A 1GL5A 5BRDA 4QVCA 1YLFA 2PYJA 1R23A 4BY1J 3CMEN 1V5EA 3NGYA 5HLIA 1WHKA 3KZBA 2ZBKA 1CGPA 1YJWN 2VN2A 4DNCA 1SZ2A 2MPXC 1XUPO 2L9RA 3GFJA 1U84A 3EYZA 3E19A 1VQ8Q 2JJ7A 4WFAL 4FWOA 1R5ID 1NEBA 3O3HA 1S6PA 1ZBLA 4OMOA 3E6BA 4X1EA 4Q5VA 1BR4A 5IT9O 2CZ7B 3JSMA 1W0UA 2KDOA 5DM7R 1XSVA 5HRNA 1YOVB 4RB2C 1NPRA 4DR7K 2FF4A 3K57A 3VERA 3CCEN 4EJOA 4ELVA 1VIEA 2B86A 4AFZC 5GINA 4LLNA 4FSSA 2H09A 1QVGP 2OPSA 2MABA 2R7XA 1Q81C 1N32K 3J81O 3CCST 6PAXA 3EH1A 4G7OF 5L3GA 1NJYA 1TWHJ 3O6WA 4DZJA 3M3YJ 2AXLA 3M0RA 3OYYA 2E20A 3U6FA 3HZ6A 1UE9A 2FBIA 2L54A 4U87A 1BJZA 3ZMZA 2VKDA 3VF6A 1CXUA 4IUQA 3RTVA 1NK3P 3ZQ7A 3JB9G 1Q86O 1MH3A 2CWEA 2LBFA 2M34A 4XLFA 2ID3A 1JT0A 2CGPA 2XY5A 1YG2A 1RT7A 4DLGA 2CSQA 2V79A 4Z8AA 3H3OB 4HSBA 2DFUA 4CEDA 2JMAA 3QBXA 2MF2A 3HO1A 1RZ4A 1LE8A 4OMYA 1XJWB 3KK2A 3F8BA 3RMBA 5DYMA 1I3QJ 3CO7C 3ZT0A 5KNLA 3I56A 3HEFA 5AQVA 1VQ8T 4M71A 3NF7A 1TQMA 3LA7A 4EM1A 2HOAA 5JMVA 2P9KB 1L3LA 3URGA 4O5FA 5JICA 4EIKA 1QQIA 4HV5A 2NYSA 4EQQA 1RETA 1N39A 1YCYA 4A3JJ 1D0XA 2G8HA 2E60A 4JI2K 4A4FA 2QK0A 2JUFA 3MEEA 2E3IA 2BZXA 5I3UA 4FYYB 1SFOJ 3LZIA 2O8EA 3CCVN 4PGHA 4LITA 1HCRA 2WV1A 2ZPHB 5I11A 4OLAA 2FSWA 4M74A 2LC2A 5CAIA 2G8IA 1WJBA 2WSFE 3OJUA 1N27A 1TV6A 4BRPA 5LY3A 4CGGA 3IG1A 1JLGA 3C4SA 4M78C 5CO7A 3VS1A 1WBBA 4KHNA 2BKDN 5AQYA 4ZZLA 4CGFA 2PMZN 4DF4A 3HI0A 1B3QA 2O88A 3PMIA 3ZT1A 2H56A 4I7HA 2IC3A 3SNNA 5EU7A 4XN0A 2KP6A 4B1YB 5KYYA 4CJLA 3HM8A 4I6ZA 2JMWA 1FYNA 2P9LA 2VE8A 5FW9A 1FYLA 1M30A 1YJ9I 4HQMA 4IOCL 1U06A 1E0EA 3WXMB 3CCMA 5FB2A 1BOBA 5IYCJ 5J1YA 2RPNA 4L5JA 2K4YA 1FYMA 4PKCC 1VQ6A 4ON0A 2Y0SA 4HVWA 4OMQA 2PVOB 5CVIA 4BQQA 1ESVA 4BYYA 1Q7YU 1BC8C 2NXNB 5IT3A 4H8KA 2CT4A 1I5LA 4RGXA 3EPZA 3KYCB 4RTUA 4B8AB 2EFIA 2EVRA 4CCOA 3OW2S 1NGBA 1DUXC 2ZE2A 2NVYJ 2IEKA 3BDUA 1LVKA 2O9VA 4U7BA 1NJXA 1WZ2A 5AZJB 2DIGA 3X25B 3M8EA 2RQVA 1VQ4I 2ELJA 2K3FA 2QA4I 4JOMA 1A5JA 3BZKA 1L3SA 3MKZA 4M78D 3FR0A 4YELA 2E6MA 2HL3A 4CFDA 2OZMA 1SANA 2CH4W 2YRCA 2V1QA 1RDCA 5KN9A 1TTHB 4A4KA 4BVOA 4XU1A 1GVDA 4C8QG 4C92B 5H6QA 1SC7A 4Z94A 1S1XA 1UECA 1PDNC 5JVGL 2FQ4A 2A6TA 5CZ2A 3M1EA 5FKMA 4OFAA 4F7UA 1USTA 1Y1VJ 5ED4A 4KHYA 1RABB 4M6XA 4CYCB 3HFOA 2O0YA 1MMDA 1YITQ 3K5OA 3RQ4A 1QCNA 3QLHA 1X3MA 2DO7A 1RGIA 1SHFA 4IG3A 3WTUC 4CC7A 2O8KA 4RW7A 3EZWA 1JJ2S 3Q9VA 4LDXA 3DLAA 2NVQJ 3BG9A 4HZFA 4IX7A 4LGWA 1D0YA 4DV4K 3OB9A 3A5OC 4A6DA 3SV3A 2HCKA 4H5VA 2G8VA 5AQKA 3ZP5A 4N56A 3OYLA 3HRMA 3CCUA 3DKXA 2O8BA 5J3BA 3M56A 3CCRQ 2X4HA 3GBTA 3JRHA 3QDFA 1QSYA 1CKBA 3CMEA 4IOAL 1WI7A 1WSJA 4RW6A 4KITB 3MWTA 4XH4A 3K4KA 1YJWA 2HHVA 1LAVA 2JN6A 3DM2A 3HPGA 2QWWA 4M7DB 1C6VX 1UHWA 3LALA 1ZHIA 4M78B 1XNQK 1H8AC 5GIPA 2HEQA 1LWWA 2K6DA 3HDDA 3DBHB 1ENHA 2H6BA 4AILC 1B7TA 1BB9A 3T1HK 2WSEE 1W5SA 2JLEA 1SD6A 1HC8A 3VEXA 1P4WA 4RBOA 4BJ5C 5FWCA 2K02A 1TNTA 2G8KA 2VWBA 3S3NA 1NJIR 3CCEA 3WNFA 2YLBA 3S16J 2Y90A 2M02A 2DM1A 4CF8A 2OZSA 3OA6A 4CIFA 4XQFA 3RQIA 4E6KG 2EIKH 3GVAA 4E9HA 1YITT 3VYGA 5IPAA 1RT1A 3C6UA 2FRYA 3GTKJ 2YNGA 3U21A 3HTVA 1XN7A 3M5RA 3MKDA 3VB2A 1IRZA 4DWIA 1OU8A 1F9NA 5GAN4 4XRSA 4AIJA 1VQPI 1ORNA 2E1YA 5KGWA 2WOMA 3AAQA 2AS5F 2IVOA 2MOXA 2UWMA 3FHZA 3GO5A 1H9TA 4LD0A 3CCRT 1K9MU 3DWLA 1CF7A 1EH8A 2QEXT 3AKZA 4IO9L 3WE2A 4BC5A 3P38A 2HQNA 3FISA 4JI8K 3FRNA 2A42A 5A2QZ 4A3BJ 3CC2A 3A0HC 1K8AR 3JB9H 1EWQA 3L2CA 3KJVA 3RMDA 1IV6A 2PUOB 4A3CJ 5C4JJ 4RDUA 4XLNF 2Q2EB 1M5Q1 2Z0WA 2EJRA 5IYBJ 3ME9A 2ZGWA 4N4HA 1JLEA 4MLHA 1QHAA 2A5XA 2ZGZA 1MMAA 2E6NA 2QQ8A 4CJRA 3K1NA 2WAFA 4CUGA 1E4FT 2UUZA 1YRNA 1YNZA 2P1JA 2O8DA 1BHLA 3VS5A 1ZGJA 1N8RC 4M3XA 4U0YA 1D8KA 1GLNA 1TWGJ 3SQ4A 1KD1C 2CSOA 3FFKB 1JXSA 2JA2A 1M8MA 1VSDA 1QZEA 2O5RA 3CI5A 3ZQGA 2YHXA 4ITVA 5GANg 2X85A 2HHWA 4XAXB 3LDSA 2R7UA 5CR4A 5T7BA 2TCTA 1U8BA 5KYNA 1BO5O 3ZMVA 2YUOA 2LT1A 1I5OB 3RMCA 5ILUA 1T3LA 2NS7A 3HKZN 3CCQI 1K73U 2ENMA 4KHQA 2BHYA 4A5MA 4ZGDB 2X6WA 1QCFA 2IW5A 1QQJA 5GAN5 2NRXA 3REBB 3FXUA 1QHTA 3QZ5B 3ZBDA 5J1UA 2VC8A 4M3YA 1YIJQ 4KMFA 3A02A 1W4SA 2QF7A 3UIQA 1HYZA 3BR3A 3GE1A 2YX7A 1G83A 5TKWA 2O9LA 1LEAA 1Q18A 1SRMA 4KAZA 5J4YA 3QWXX 1WKMA 4OU0A 5IHIA 3H3NO 1HYSA 5BRHA 1NH3A 1I5ZA 2BY3A 2O61A 1PRMC 3A5NC 3OYNA 4B1RA 1H3HA 4C9YA