5FRMA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz384 (compound 4a)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination
molecule keywords PFV INTEGRASE
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frmA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frmA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frmA03
2D0CA 3SUOA 4BACA 3ZSQA 3QIOA 2DIGA 3ISNC 4E1MA 2FC0A 1LWCA 1ZBIA 4PWDA 5FROA 2X74A 4JLHA 5J2NA 1L3UA 2WOMA 3DI6A 4OKJA 4RW9A 4XIUA 3ULDA 4PQUA 3QEIA 1JL1A 1TK8A 4DQIA 4OGEA 2R5MA 4Q5WA 2XY6A 2PYJA 4MFBA 4CJFA 1JLQA 4JRPA 4DSFA 4DLGA 3OMGA 2BIVA 4B8CA 5I42A 2DY4A 1D9FA 4K8XA 4FJGA 2F8SA 3E01A 4AHVA 3OQ5A 1B92A 2R57A 4KRFA 3OYJA 2MWOA 2HVIA 1NOZA 3UT1A 3LGFA 1C1CA 4FJLA 1HPZA 4HUGA 3AVFA 3MECA 2HMIA 3L2VA 1IKWA 3AO2A 4QQ6A 2GUIA 4CJVA 4NYNA 3RMAA 4NCBA 2B8AA 3HYFA 4CK2A 3SQ4A 4CJ4A 5JS2A 4FK0A 4ELTA 3FFIA 3KKSA 2PYLA 2KZMA 2NUBA 3ZSOA 1WAJA 1ZBUA 2GFUA 5KI6A 3RMCA 2B6AA 1W0HA 3LZJA 1HYVA 3DRPA 1KVBA 2G8WA 1KTQA 1WAFA 3D45A 3IS9A 4FJ7A 2G8FA 4CIEA 1GOCA 3G10A 1KLMA 3PV8A 4Z4FA 3LP2A 3HP6A 3P5JA 2P1JA 3G0ZA 4CE9A 4DU4A 3SI6A 4RW8A 3NGYA 3PY8A 1OZ3A 4EZ9A 1BI4A 3TAPA 4CJWA 3T19A 4CEOA 4B9LA 4KKOA 2LTOA 3L2UA 2WONA 3D0PA 1ZBLA 4H4OA 3VQ6A 2Z1IA 4CEBA 3NF9A 1VRTA 1CZBA 4H4MA 4LH4A 3F73A 4FJKA 1VSFA 4M3TA 3E9FA 2DFHA 4M3YA 5EU7A 3HPGA 3CFPA 2RHYA 2E6NA 4F4KA 1TL1A 3OS0A 3OS1A 3ZSZA 4CESA 4CIFA 2XK0A 5J39A 3ZSRA 3VN5A 4GMJB 5DMRA 1RT1A 3SJJA 3DRSA 4L59A 2LCCA 1IKXA 3NF6A 1CXQA 3PUFA 4JS5A 3KK2A 4IBNA 5J26A 4EP5A 4CEEA 3NGZA 3DLHA 4FJMA 2YNHA 4I2PA 1S6PA 4FCYA 4IUPA 1N27A 3AVAA 3K5LA 4IG0A 3QEWA 3SPZA 3NH2A 1MHNA 1CXUA 1EXQA 2P51A 3LWLA 3JSMA 2PY5A 2RO0A 4FL6A 4CRIA 3PMTA 3ASMA 4CEQA 4UQGA 4FLZA 4DQSA 3AV9A 4DSEA 3MXMA 2P5OA 4KHNA 3OMCA 3HO1A 4W5NA 3NE6A 2OPRA 2RHIA 5J2PA 3V9XA 1N5YA 3TAGA 1N6QA 3M8QA 3RMBA 4CHQA 2PZSA 2FBXA 1VSMA 1JKHA 4B9XA 4QW2A 3QEXA 4M42A 3RTVA 3MAQA 1QTMA 3WNHA 3SNNA 4CERA 4E19A 2G8KA 3OYGA 2VYTA 1U49A 4RW7A 5D6YA 2G8VA 4FXDA 4C5GA 2JTFA 2EQKA 1WLJA 1SSFA 4ICLA 5KH6A 4O55A 4W5QA 3KK3A 2O4XA 1ZBHA 3Q1JA 2O4IA 4BE0A 4N76A 3VQEA 3C6TA 2B4JA 3DM2A 3NTKA 4FZXC 3CEYA 4DTPA 4Z4GA 3S9HA 2YV0X 4DTMA 4LD6A 4CEZA 4KHSA 1J9AA 2JLEA 5HLFA 1XWLA 1QQCA 4OVAA 1LAVA 2K3YA 2FBTA 1IH7A 1NK4A 2LVMA 2OZMA 3L2RA 3AO3A 3NF8A 4K8ZA 4Q0BA 2YNFA 5HP1A 3AO1A 1O1WA 3K2PA 4CFDA 3TABA 3OA6A 2D5RA 3LAMA 5C24A 4KAZA 1LWFA 1ASWA 1RBVA 4W5OA 3SV4A 1HQUA 1J53A 3DLEA 4A4GA 3NBPA 3ZT2A 5SZTA 4CJRA 3LDSA 3OYMA 2K3XA 3OYHA 3ITHA 2LSNA 2KZZA 4KFBA 3OYCA 1RT5A 4DQPA 3AVJA 1VSJA 1RI0A 3OYEA 4CFCA 1UWBA 1Y97A 1YTAA 3DLBA 5C0MA 4CJQA 3M8RA 1U45A 4KI6A 2EKOA 1NOYA 1A5XA 1YTUA 5CZ2A 3QNNA 4C8KA 3NCIA 3RMDA 2G8HA 4KI4A 2HQXA 3OYAA 3THVA 2E6MA 1J54A 2Y1JA 2EQJA 4RW6A 1SKRA 3HPOA 4B9WA 4OPKA 1Q9YA 2X6NA 2ITGA 4CK3A 3ZT3A 4YFUA 4A4EA 4N4GA 5HROA 3MP1A 3ZT1A 2YHBA 3DLKA 4Y1DA 4CJLA 5HRSA 4OJRA 4DTNA 3RWUA 3IAYA 2QQRA 4B08A 4DTSA 1SL1A 3PO4A 4ZTJA 4II1A 4AHRA 3MP8A 4EP4A 4FLWA 1NJXA 4I7FA 4DTJA 3BDPA 1IKVA 3ZSWA 3K5OA 2P5GA 1VSEA 4IDKA 3QJ6A 4CGGA 5E41A 4OLBA 4FJIA 3VQQA 4FLYA 2HHUA 3WNFA 1BI4B 4N4IA 2L8DA 4AHTA 1C6VA 1U47A 3SQ2A 4QOZB 4CHYA 3E9GA 3AA3A 4M3XA 1SUQA 3AVKA 4CEAA 1TGOA 4CGIA 2G8UA 2AJQA 1QS4A 1RCHA 1S1XA 5T7BA 2W42A 3QNOA 4F2RA 3TAFA 3S3NA 1RBUA 3I0SA 3GOXA 4OPJA 2YKMA 4F3OA 3P8HA 3HJFA 1LV5A 1X1PA 3KLIA 2RJDA 3ZT0A 4CCHA 5HRNA 3KLGA 3HT3A 4DFPA 4FJ9A 4PL6A 4WE1A 4HCBA 4UC4A 1JLEA 2O4GA 4C5EA 1LWEA 3ASKA 2ZE2A 1WSEA 4M45A 4NS5A 1XC9A 4O0JA 4HCCA 4CJKA 1DLOA 2HHTA 3MP6A 2KFZA 1TAUA 2BDPA 3PNWC 2Z1JA 2OZSA 2QK9A 3ALYA 4G1QA 3VA0A 2IS3A 4W5TA 5HBMA 3NH0A 4KTZA 4FLUA 3QERA 2BUDA 4BDPA 4AILC 3K58A 3WNEA 4N4HA 2L89A 1K6YA 2MWPA 2QQSA 3BDLA 1TKDA 1KRPA 4ELUA 1A5WA 3WNGA 3HL8A 2XO7A 2ZD1A 1IO2A 4BWJA 4CF1A 1JXBA 4DTUA 2E5QA 2RHUA 2RJCA 1LAWA 4BE1A 2A1SA 3EY1A 3LH0A 2F5KA 4C5HA 2VG7A 2XRIA 3V1QA 4CHZA 2KQ2A 1RT6A 1KVCA 2BANA 4B9VA 4FJ8A 1RBRA 3QEPA 1TKXA 3MO8A 2F8TA 4HCZA 1CZ9A 4R5PA 2LDMA 1JL2A 1S5JA 1KFSA 1S6QA 3S3OA 2DFEA 1NK9A 3AVIA 3MEGA 1SKSA 4CJTA 4KREA 1HQEA 3OYLA 3HVTA 3QO9A 3VQBA 1H3ZA 3KTQA 3OYIA 1VSHA 4FJJA 5KRSA 3AVMA 3M8SA 3OYNA 3IRXA 1BQMA 3NH1A 2Y1IA 4IUUA 1TL3A 3IG1A 4DWIA 3OVNA 4NCAA 1JLCA 1RDBA 3OB9A 4ID1A 5CZ1A 4DQQA 5J2QA 3QETA 4FK2A 3MXIA 4M3UA 2YHAA 2O4XB 1D8YA 4FYDA 1EX4A 2ZQBA 3DLRA 4M41A 5SWMA 3S3MA 1TKTA 2IGIA 1WJQA 2RF2A 5D6WA 3MEEA 3L2QA 1T05A 3VQ4A 2OPQA 4HVJA 2QXFA 4Z02A 3NFAA 1ASVA 1EETA 2Q3SA 4C8NA 3OS2A 4DTXA 4QCLA 5CIUA 4BDZA 1EKEA 1W9HA 3NF7A 2HQEA 3VQCA 3LALA 3U3GA 3LLRA 3AVLA 4JRQA 3LX7A 3V9SA 2ATQA 4E1NA 2NLUA 3CFRA 2PQWA 4W5RA 1D5AA 4KPYA 1C1AA 1VSDA 4FW2A 4O0IA 1Z26A 2XHBA 2BKDN 2WACA 4GVMA 3HM9A 4FU6A 2F96A 3BGRA 3SV3A 3CQ8A 3DYAA 3LPTA 1OI1A 1QE1A 2XY5A 1R0AA 3EZ5A 1L3VA 1KSPA 4KHUA 4ZTFA 5FRMA 1BCOA 2E6LA 4PUOA 4CGFA 3ZT4A 3T3FA 3OJUA 3NNQA 2X35A 1NJYA 4QQGA 3O4NA 3L2WA 2IG0A 1X9SA 3LGLA 1QSSA 2EQUA 1BCMA 1BHLA 3VQ5A 4RG2A 4KB1A 4MQ3A 3V6DA 1SL0A 1EP4A 3NGIA 3HSTB 4J2EA 1IG9A 4M3ZA 4GY5A 1SV5A 2X6SA 3SZ2A 1XHZA 3V9ZA 1TV6A 3T1AA 4C8OA 4CEFA 3SYZA 2RJEA 3TARA 2IAJA 1DTTA 4KV8A 3SCXA 4PLIA 4HTUA 1RTDA 3H6ZA 1U04A 2RI2A 4EZ6A 3MEVA 2HW3A 3H08A 4E7JA 3DOKA 4OLAA 1RNHA 3VQ7A 3PFSA 3O3FA 3LPUA 3CFOA 2RPIA 5CYQA 3M8PA 4DTOA 1L3SA 4FJ5A 4CJSA 3KJVA 4FJXA 3MEDA 1GOAA 1BISA 2VG6A 2RI3A 3P8DA 4IUQA 1B9DA 2D0AA 1YT3A 2YNGA 3CG7A 3C4SA 3LP3A 3KLEA 3K5NA 1KHCA 4PLLA 5J1EA 2X78A 4DU1A 4DTRA 3DRRA 5J2MA 1T8EA 4E7IA 4CGHA 4DMNA 4B9SA 4B3OA 4M3WA 1KFDA 1XHXA 3QINA 1VSLA 2HNYA 2Z1HA 1UA0A 2HHVA 3KLHA 1RTIA 5KCHA 1X9WA 4DSIA 1G15A 3V1RA 3LP1A 1S1TA 4OGCA 5KE3A 5D3GA 4O5BA 5HRRA 2VWJA 4RG8A 5CY4A 4Y1CA 3FC3A 2D0BA 3SQ0A 4JS4A 2DTUA 4IUVA 1OZ2A 4Q5VA 1UOCA 3S6WA 5FDLA 3MEUA 2I5JA 4Z4EA 4CF0A 3QIPA 3V81A 1NK6A 3RR7A 2BGGA 4Z4HA 1WGSA 3PX0A 4N56A 3SUNA 3OYKA 1NKEA 3FEOA 3ZSXA 4LSNA 3VQDA 1BGXT 2RHZA 1KVAA 1REVA 1TKZA 4CJPA 5C25A 3LZIA 4C8LA 4KHWA 2RJFA 1LW0A 4LD0A 2HHSA 1A5VA 3SD4A 4FLXA 1FXXA 1XNIA 1MU2A 5C42A 4FZZA 5KCOA 3F9KA 1S1VA 1BIZA 1C0MA 4IUTA 2DAQA 3OY9A 3AO4A 3F70A 5K14A 4CEDA 1U4BA 3ZSYA 2YRVA 4FLVA 3B6OA 1TAQA 4PA1A 3AVNA 3L3VA 4B8AB 4E89A 5I3UA 2EHGA 1QSLA 1RDDA 1S1WA 3HP9A 1ASUA 3KKRA 1T7PA 1UAXA 3K57A 4DFKA 1TK5A 4F2SA 3VA3A 4FJHA 4C5IA 1RT2A 1HNIA 1S9GA 3V9UA 3B6PA 3TAMA 3DMJA 3SUQA 3AVBA 1NJWA 3TAEA 3AA2A 3OYFA 4LY7A 3NTHA 4QQDA 3META 4NZGA 3MEWA 3QKJA 4E3SA 1Z25A 3PX4A 2QKKA 1HNVA 4ID5A 4F3TA 1NK5A 3HPHA 3TAQA 1TVRA 1XI1A 4CJ3A 2CKKA 1RBSA 1L3TA 3FDRA 3AA5X 1L5UA 4DG1A 4FLTA 4J2AA 4NCGA 2A1RA 1RBTA 2JGUA 4TSXA 1YVUA 4O4GA 1U48A 5JS1A 4CECA 1WSHA 1OYXA 4EDUA 1JLAA 4CHOA 2L3RA 2X4YA 4FW1A 4KTWA 4DU3A 4B9NA 1C0TA 1I39A 3TWHA 1RDAA 3O8VA 3P1GA 5HRPA 3TI0A 1ITGA 3KUFA 4I9LA 1SL2A 1QHTA 4QVZA 1WSFA 4LSLA 3ZSVA 1LW2A 1NKCA 3MEAA 4E7HA 1RTHA 3C94A 4ELVA 1RILA 3O4QA 1JLGA 3PO5A 1DTQA 2HNDA 3NHGA 2X4XA 4L8RB 1Q8IA 2OPPA 1WN7A 2BE2A 5KE2A 3QBYA 2M16A 4IG3A 4CJEA 3NTIA 4DLEA 4FM0A 2OPSA 3EAEA 2G8IA 3NDKA 2FBYA 1HYZA 1WSJA 4FVMA 4CJUA 1F21A 3AVCA 3H8ZA 4RW4A 3VQAA 4CHNA 3U3YA 4B9TA 3SUPA 1WJSA 1FKPA 4AHSA 4CFAA 1X9MA 3LWMA 1HMVA 5KGXA 4FM2A 5M9OA 4DFMA 4BDYA 1RT3A 3QIIA 2HNZA 3DOLA 3RRHA 1D9DA 4FJNA 3AVGA 4M3RA 4CF8A 2OYQA 2DIQA 4HUEA 1KLNA 3HK2A 5KRTA 2RN2A 2OA8A 4N41A 3DB4A 2M1HA 2GFAA 4C8MA 3O3HA 1CLQA 4B9UA 2RI5A 1HRHA 4A4HA 2Z1GA 3LANA 1C1BA 5IAYA 4CJ5A 1NK0A 2YNIA 4N5SA 2EFIA 4DFJA 3RR8A 3TR8A 4DQRA 3QESA 4E7LA 1VSIA 5D6XA 5C6SA 2R58A 2R5AA 5DK5A 3KK1A 3V9WA 4KHQA 4NYFA 4DF8A 4CF9A 3C95A 1VSKA 4IFVA 3EYZA 1RT7A 3TANA 1S1UA 2RKIA 3AVHA 1VK0A 4QAGA 1ZYQA 3OYBA 1WSGA 2FHDA 5KGWA 3K59A 1JXEA 1S9EA 3VQ9A 3VQPA 1HYSA 1FK9A 2GV9A 1FKOA 3L3UA 4N47A 3KIOA 4H8KA 2VG5A 4Z4IA 3QEVA 2KW4A 4KHYA 3PMIA 2IDOA 1UA1A 1Q9XA 2X4WA 4J2BA 3AO5A 3MXJA 1J5OA 1GOBA 3C6UA 4OKEA 2JZ2A 1BL3A 3U6FA 3PX6A 4J2DA 3LYIA 3ME9A 4CIGA 4DSLA 2QKBA 3ZEHA 2HVHA 4LH5A 3P83D 1ZBFA 2B5JA 1RDCA 1WJRA 3V1OA 1C0UA 4KB0A 4FK4A 2LRQA 4OVLA 4CGDA 3KD1E 4CHPA 2YKNA 3HXMA 2D9TA 2DFFA 3A2FA 4CFBA 4HHTA 2RHXA 2IC3A 4Z4CA 4B9MA 1NJZA 4E7KA 1IKYA 4I2QA 2VWKA 3SPYA 4KTQA 3FLGA 3ZCMA 3DLMA 1KCFA 3KLFA 1I3AA 3QLHA 4KO0A 4IFYA 5CYMA 4AHUA 1NK7A 1SKWA 3LAKA 4F8RA 4YNQA 2E4LA 4CF2A 1G5VA 4IURA 4AHCA 4GW6A 4DSKA 4CGJA 2HHXA 1NK8A 1WNSA 2GBZA 1TK0A 3M9QA 3VQ8A 2FBVA 1NKBA 4E0DA 3OYDA 4X34A 1WSIA 4I9QA 3CM6A 1BIUA 1JLBA 2XY8A 4BE2A 1VRUA 4DS5A 3V4IA 4DS4A 4AH9A 1RTJA 1HJRA 1B9FA 4HUFA 3JYTA 2HHWA 2KFNA 3RRGA 5FRNA 3UWNA 2EX3A 2ETJA 2P0KA 3CYMA 4CK1A 4BD3A 1BQNA 1JLFA 3HVRA 4ZHRA 4IKFA 2HB5A 4OKKA 2KTQA 3LP0A 2GF7A 3NAEA 3L42A 4PY5A 4Z0UA 3I0RA 4O44A 1T03A 3SQ1A 1RT4A 3O3GA 2HHQA 2EQMA 4BWMA 4DF4A 1QSYA 3L8BA 3UIQA 3K5MA 3DB3A 3KD5E 4FZYA 3I8DA 2IOCA 3CM5A 2XY7A 2XDPA 5KTQA 2M0OA 4DSJA 4FM1A 3DLGA 4A4FA 2R7YA 2G3RA 3AA4A 3OJSA 5IN1A
chains in the Genus database with same CATH superfamily
1VQPN 3NWTA 2HR3A 2HAXA 2FC0A 1SFEA 1V5EA 5J2NA 1L3UA 4XIUA 4RWTA 3S1MJ 2COYA 2J5OA 4F04B 2L3DA 3CQYA 4XK8E 3E9OA 2L3PA 3EGDA 2GGRA 1PKTA 1JLQA 1M1FA 4K8XA 3F8CA 4FJGA 4E4HA 2E1CA 3FHFA 2D6FA 1RI9A 2D1XA 3I56Q 2AZSA 2QCOA 2RK2A 4CK2A 4KIFA 1OU8A 3K0SA 3O8MA 1FY7A 3FXLA 3ZXSA 2XVCA 1W0HA 1T3VA 3H5AA 1WAFA 3WGIA 3U23A 3HP6A 2Y69H 1ZLKA 1RNLA 4RLFA 1P4WA 1TL1A 2A28A 3K4NA 2CUJA 5J39A 2E1OA 1VQ6Q 4Q5SF 3H1CA 4FCYA 4IFEA 3KFVA 2ELHA 2RO0A 3ZMUA 1ZRCA 2XDBA 4S0HB 1DGKN 5E84A 2KJCA 3ABTA 1QTMA 1RLPC 3HOXJ 5KH6A 3VV0A 2RREA 3FSPA 4XIDA 2WV0A 1A31A 2D5RA 3MCZA 4HQMA 3CBPA 1SD6A 6PAXA 2F2VA 1Z7LA 4A4GA 2K3XA 2KZZA 1E0EA 2L7FP 4AM3A 1V4TA 2L9SA 4JEPA 1YTUA 4XU3A 4KI4A 2XAQA 3CPWA 3IH7A 1CF7A 2SEMA 1X3UA 1TSFA 2E2OA 3JTHA 3MP1A 4Y1DA 3ZT1A 2JJ9A 4LE9A 4DTSA 2X1EA 3MP8A 1XMXA 3EZWA 2N8GA 3JSCA 2QGGA 3IKMA 4N4IA 2FO0A 1XGMA 4PSWA 4R56A 3J80O 3FE1A 4F3OA 5D6EA 1QGPA 4A0XA 3KLIA 3G71A 4JK8A 2IP2A 4C92E 4D7MA 4FJ9A 3ERMA 2E4HA 1JLEA 2OC6A 2Z2SB 2LF7A 1GUUA 5KYYB 2HF4A 2W41A 5TISC 1UFMA 4IRIA 4Q48A 4WTOB 3VA0A 4W5TA 3QERA 1KGSA 1XD7A 2LJ0A 4C1NI 4A3LJ 4UXNA 3V1QA 4ESFA 4ZGEB 1AWXA 2HQAA 1RBRA 2AHJB 3EYYA 5HS9A 4DBQA 4BG8A 4BJ6C 4CI6A 4C3HJ 4XTXA 1IJJA 3EH2A 1TP4A 4MQVA 1HQEA 2DETA 1DPUA 5KRSA 1N8RR 2RQQA 1TW2A 4IJNA 5F27A 1T05A 4R79A 4C8QA 4C8NA 3E6BA 2KLAA 1QQIA 1WXBA 2C06A 1FJLA 3MVPA 4B8XA 4KITB 2LKPA 3DPTA 2JWTA 1Z26A 1HCRA 1YJ9A 2RHKA 4M7AA 3CQ8A 4KHUA 1QO0D 3DKXA 4BRPA 1WJAA 4CBUA 3E5XA 1G3TA 2E71A 1EZZB 4C8QC 1BHLA 3INZA 4BJTA 2FNPA 3PFYA 1SHFA 1VFCA 2WV1A 1N36K 1MH4A 3KZYA 4BY7J 1DTTA 1QNTA 4KV8A 4PLIA 4BHPA 4KUMA 2MCNA 3J8AA 4O6JA 1L3SA 2RPIA 2M3AA 2ISZA 3QBWA 2K4BA 3P8BB 3DKWA 3C4SA 2XICA 5J47A 4E7IA 1IN4A 2UYTA 3VS1A 2E88A 5LJ5e 2WWYA 1HUXA 3TP3A 2AXTC 3EG9A 2DTUA 1D1CA 5GPCA 3THKA 4Q5VA 1UOCA 3TEEA 1T56A 2VUMJ 2KI7A 1T33A 4V2FA 3MX2A 1BWFO 4JX6A 2XPWA 1TKZA 5IT9E 1Q81O 4LD0A 4BQOA 1T0FC 2NRRA 2EIKH 1U8RA 1JEGA 5K14A 3OY9A 2H8WA 3AO4A 2GWJA 1GFDA 3VS7A 3FZMA 3KKRA 4JKDA 1X3ZB 2FA5A 4F2SA 4DR6K 3IWFA 3AVBA 1MDMA 3HOVJ 3MN2A 5AQLA 1Q7YR 3MEWA 3GCMA 3G6EI 2GQQA 4I02A 3QODA 2VPRA 3TTFA 2FB7A 4DV2K 4CECA 5GTIC 3EG3A 1VQ9T 5HRPA 1WSFA 1XSVA 4JD2B 2F5FA 4XRFA 1S5LC 3FR0A 2Y0MA 4N9IA 4LB6B 1S6LA 4BBRJ 4H03B 1FKPA 2C0OA 1V1CA 4RDUA 3RRHA 4M3RA 1H8AC 3WEEB 4FWQA 4XLCA 1Y07A 4B9UA 1NG6A 1Z3YA 1I4K1 2OQRA 2Y9YA 4CCLA 3PL8A 1BR2A 3IL2A 3X25B 2OTJT 5GJWB 2FSKA 5CVVA 1S9EA 4XRMA 4H8KA 1I5LA 3PMIA 3PLAA 2X0LA 3PX6A 4DSLA 5JLWA 1ZBFA 4KB0A 2DMPA 3CCSA 2X1CA 2KGTA 3LQQA 1D3BA 4A3GJ 3HHGA 3J7ZI 3FHZA 1JKRC 3I4PA 4XOTA 2L5QA 1NGIA 1FWZA 3BP8A 2NRXA 2HB5A 1DEJA 3GWZA 1RLQC 4HLXA 3P9IA 4F14A 2XDPA 1DGWY 4PHTX 2DIGA 2G3RA 3A0BC 1FC3A 4ATOA 2J6OA 2ZF5O 1WJDA 2E3IA 5AZIA 4OKJA 3DI6A 2Q0OA 4DQIA 4LDWA 4DLGA 5GAN2 2CO5A 4FJLA 5CK9A 1HPZA 2VKDA 1Q82U 3MECA 4ZZDA 4QQ6A 2VYPA 3WQTA 4ELTA 1KQ2A 2M0CA 1XGSA 3D2FB 1UB9A 3H3OB 1B9NA 2JSPA 3DPLC 1KTQA 2G8FA 1GOCA 2L9NA 1Y8QB 4Z4FA 5F1JA 1VNDA 1HKCA 2VLAA 4JDSA 1TWGJ 4CEOA 4KKOA 3AL0C 3M0SA 2NUPA 4HNTA 4K42A 3S15J 1U5TC 3OA9A 5LD2C 3TQ7P 3OS0A 4CIFA 3KLOA 1WEIA 3D5RC 4PKGA 4IBNA 3NGZA 5GMKl 1KC8U 5LEKA 5BN8A 1FIPA 2MC4A 3M4GA 4XTZA 3DXKB 4FX0A 4LN2A 1UB4A 4A63B 2F9WA 4CICA 3RQIA 2DU9A 4A3CJ 2M4KA 2EQKA 3R4KA 1ZBHA 1MBHA 3TSUA 4TV7A 3JCMP 1GLCG 3S6IA 3CC4A 4LLNA 3ER0A 5IH2A 3THWA 1NK4A 1IH7A 2W40A 1R4MB 3Q3SA 1OYWA 2V1UA 4NO7A 1N3CA 2KROA 1WEFA 3DLEA 3PM1A 3K4LA 3CCLT 2V1XA 3FWEA 2WA0A 3ATVA 5GPAA 1H3HA 3M8RA 4XNFA 1A5XA 4PIIA 3MN5A 2XAUA 5LL6S 1J54A 1SKRA 3A5LC 3HRTA 3SJMA 1OQKA 3TGNA 5HROA 3J7AF 2GBQA 4FK0A 3A02A 4Y17A 1KQ0A 2BZYA 4XMYA 1M2OA 4M7DA 2DPUA 4JRKA 2LQNA 4I09A 5GMKm 5AQVA 1KD1U 4KUDK 4H5RA 4DCHA 4CEAA 2BTTA 5M3FJ 2P8TA 3CCQQ 3HJFA 3P8HA 1X1PA 4A5NA 4F7UA 2RMOA 4F9OA 4CSWA 4C5EA 3H1QA 4CJKA 4YY3K 1JUPA 2QK9A 5HBMA 1V3FA 1VQPA 2XAJA 4BRNA 1K6YA 4LK1F 2E5QA 2MW8A 2VG7A 3HYIA 3VS3A 3SMSA 1TYQA 3A5MC 4R5PA 3SDGA 1S6QA 1UAAA 2ZSIB 4HV6A 4PCQA 5GAHP 4E1JA 4RGUA 2Y1IA 5GAN4 5GANd 4NCAA 4G6QA 3OB9A 7AT1B 1EX4A 3IAM2 5C3EJ 1WPKA 3WG7H 5F6FA 2QXFA 4AIHA 3BR6A 3W6KB 1MW7A 3C3WA 2K2VA 1EKEA 4II3A 3NF7A 4PL8A 1R6RA 2F5CA 3V9SA 3HOTA 3ELKA 2QA4Q 4O0IA 1BI2A 5FO5A 2XY5A 1QWEA 1VQ6A 3EZ5A 1XN7A 3NNQA 1FW6A 2R7ZJ 2DBBA 3WHCA 3JRDA 3J81K 2C6YA 2RQTA 2DFIA 4M75C 1XTDA 3AG3H 2BGCA 3H08A 3EUHA 4WXDA 2BVMA 1PCXA 3MQ0A 1D0XA 1XDUA 3CXCP 1VTNC 2X78A 5EEAA 1EWRA 2VL8A 3JSPA 2FPFA 3UATA 5ED4A 1OCTC 2HKXA 1G15A 4ZYDA 2EWSA 3BY5A 1OZ2A 2I5JA 2EV5A 1X3WB 1HC8A 1REVA 1AVZC 5ILVA 2ENMA 5KCOA 2LRDA 4M77C 1I27A 1WA7A 2YRVA 1MZBA 4B8AB 1J6ZA 4DFKA 5IYBJ 3VA3A 3CCMT 3DMJA 2CJJA 1X2NA 2OFKA 3CZ6A 3OYFA 3JCUC 4C8QB 4ID5A 2ZXWH 1VQLT 4WF2A 2CKKA 2LFBA 3FDRA 2IAIA 4LG3A 2LNVA 3P4IA 5ILUA 4TSXA 1YVUA 4CYCB 4HVVA 1ABOA 2F69A 2YUSA 2DERA 1RDAA 1T6SA 1GRIA 4A0ZA 4YOVA 2HXIA 3O4QA 3QBXA 1R9TJ 1Q8IA 1WN7A 2QI2A 2K4YA 4CJUA 2H27A 1F21A 1NK2P 1Y96A 4CFAA 3WXLA 1HXDA 1QPIA 4HPQA 4DR1K 1SVOA 3CWTA 9ATCB 3KP7A 3E1YA 4MZPA 1N8RO 1NK0A 1KG5A 1X9JA 5DK5A 3QJYA 5GAN3 2QEXN 2LC4A 3PSIA 1OPKA 2EIMH 3VEPA 5E8IA 3KYLA 2D45A 4XU2A 3VQ9A 2IS4A 4BRLA 1Y64A 4C8QD 1BBYA 2EJFA 1W36D 2DXCA 2HVHA 2LMJA 3VETA 1C0UA 3H92A 1VQ4I 1K1ZA 4OB3B 2VB6A 3CQTA 4DBHA 1NK7A 1A0NB 2E4LA 2YX7A 1T6DA 4BR7A 5H20A 2HBMA 3JCMW 1VQ5Q 4JK1X 4DS5A 3RCOA 1QQNA 5FRNA 4RTFD 2P0KA 1Q86C 4ABZA 1CQTA 3O9SA 2E2IJ 4DZPA 4GKJK 4FM1A 1KQSM 3AA4A 1I07A 3K4BA 2D0CA 1F36A 2GXGA 2QEXA 1NJIU 4A93J 3NAUA 3OOPA 5DYMA 4JLHA 3SWNA 4LF4K 4U7BA 1VQPT 9ANTA 4UB8C 1LE8B 2ZCWA 5C4XJ 3WXJA 1JU5C 4HUGA 4NYNA 4KGXB 3G6EN 5JS2A 3FFIA 4AIDA 4AFSC 4B3SK 3ID8A 3SWNC 1NNEA 1NMNA 4DYCA 2EK5A 1RAIB 4HVWA 3KHYA 1Q82O 3KTUA 1YJWA 1W7PB 4HSBA 2L9VA 4UVCA 5EZHA 2K6DA 1K73U 2X4JA 4H4MA 5F04A 3FGUA 1U2VA 1A36A 1N25A 3OS1A 4BL0B 1NTCA 4J83A 3RDIA 2CQ7A 1WHKA 2BBYA 1M8VA 1W0UA 1QVFS 2ZKZA 4CRIA 3HFOA 4KHNA 3HRGA 3HSRA 1QHGA 3M8QA 4BY6B 4CHQA 5TGTA 3QEXA 4BRGA 2VJ5A 4ZNXA 2M30A 3EUAA 3SEMA 4M7XA 4BHCA 1VQ9I 5D6YA 1LWVA 4O55A 1D0YA 3CCJT 3CCEN 2O4IA 2F2XA 1SZ2A 1VQ7A 1N9RA 2I5UA 3W6JB 2WY8Q 5HLFA 1XMQK 2MYSA 2K3FA 3TPQA 3OBWA 1QKWA 3EHRA 3RQ4A 3CWAA 5HP1A 2QWLA 2PI0A 3OA6A 3CMYA 3ULEA 3F6OA 1AEYA 4XTUA 4L9TA 1J53A 2LQ8A 2O8CB 3VYSB 3A2KA 2AIRB 5JHFA 3VTIA 3OYEA 4CFCA 1UWBA 2HQRA 1NOYA 4JHDB 1MUYA 4QLCU 5L3GA 3CCLN 3CWUA 1Y0MA 1K73C 4PL7A 2HEQA 1MBKA 4Y28E 3RWUA 2JM9A 3HEFA 1NGAA 3ZP5A 2XAHA 1NJXA 3HRUA 3EFSA 5KYXB 2FQ3A 3JCMc 2X6OA 1YJWQ 4IDKA 3TW7A 1BG3A 2EZHA 1KAZA 4E9FA 1ORNA 1HQCA 4M3XA 3WGGA 4D1QA 2W25A 3R8EA 4ZN1A 3TBIA 4WFAL 3V8LA 4KNYA 4EJOA 1ENHA 2W6KA 4M7YA 1DLOA 2KFZA 1TAUA 1RR7A 4KUIA 3JCMQ 2JUFA 1TKDA 2K5FA 3BF1A 1V76A 3RMSA 1LDDA 3ROUA 3S1NJ 3VEXA 3CETA 2KQ2A 2BANA 4AIJA 2EYZA 1CZ9A 2Y2ZA 4JJBA 3L7WA 5CKDA 4BC4A 2M8EA 4XORA 2QM3A 5AQUA 4EATA 3E66A 4PKCC 2P7CB 4IHYA 1D8KA 1IJWC 5D6WA 1HNZK 4CBWA 1VQON 3DEEA 4BDZA 2LOOA 5M5XJ 5BR9A 3T1YK 3PVLA 4IHTA 1MA9B 4JJNK 2KMUA 2LYCA 3JRZA 1ESVA 1BCOA 2YJEA 4BI8B 3W2VA 3PO2J 3LGLA 3A03A 4PSXA 2OQGA 3L09A 4JHDA 3S1RJ 4AVZA 2ZFUA 4GY5A 2X6SA 3LSIA 1ZRDA 3QSUA 5F64A 4YPRA 2IAJA 1M1KC 4PUSA 4ENNA 3GTOJ 5ELZA 1GLDG 4BS9A 4RGSA 3FXKA 2VOPA 2XGXA 1BISA 3P8DA 5LJ5f 4IUQA 5GAMh 5ECAA 1C0GA 3WUHA 3I55I 3A4CA 3LP1A 1U2WA 3M53A 4BNCA 4I6MB 5LJ5d 1LVAA 3OBYA 3JW4A 1UGVA 3LZIA 2EIJH 2RJFA 3M1EA 5JFRA 3H5RA 1XNIA 2PMZA 5BS6A 3CJ1A 1BIZA 4HT8A 4WFBL 4E89A 1T44A 4CBXA 1NYFA 4UVAA 2DD4A 5DPKA 1KAXA 1TK5A 2NRZA 1YBYA 1G4DA 5EG0A 4PJJA 4NZGA 4UNOA 2KZVA 1OISA 2QGFB 4AQYK 4DGWB 1GLEG 3G71N 1VQLQ 4RAZA 1OYXA 4EDUA 3Q0VA 1SL2A 3I56A 2XSJC 2R5ZB 1WHMA 2K5CA 4CJEA 2IBDA 4IOCL 2E1NA 1F43A 3LA2A 3K4KA 5KRTA 3TCJA 3OW2A 4FWMA 4BRAA 2DZ9A 2CP7A 4DK9A 2O8BA 3ZGKA 1HRHA 3LANA 2DBKA 1Q1VA 4CW7B 2R58A 3IHOA 3TANA 1SL1A 2RKIA 1N39A 1GLNA 4J6XA 2DO7A 2NS0A 2V1DA 3KPHA 2ZPHB 1DPRA 2YLCA 5HNFA 1FOWA 1YJ9N 3EDPA 2JVHA 4E2FB 1DT9A 4OKEA 2KRSA 1PD0A 3GFMA 4BC2A 5M1FA 4H5NA 4RB0A 3LL3A 1RAHB 4YNQA 4CF2A 4ZJZA 1X6GA 1RRJA 1BIUA 3C2BA 1W2BM 4EM0B 1VRUA 4HNVA 2ZPIB 1C0FA 2R0QC 3BF3A 5GAOl 3MJXA 3WTZA 4HX8A 2H8RA 4W97A 4G7HF 2EQMA 1MDMB 4YIRX 3UIQA 3GIBA 4FZYA 1FP2A 4B3MK 3EYIA 4D5FA 4LB5A 1LE8A 1AU7A 5FFXA 2KEAA 1E4GT 2OTJI 4PFPA 1SKUB 4FM4B 4BBSJ 1TWFJ 2LX9A 1Q1HA 2BVLA 1E4FT 3OQ5A 2JT1A 4H0VB 4DR7K 4IL6C 3UT1A 3CCUN 2OF7A 1RKTA 2CU7A 3RYPA 2P9LA 2YG9A 4KRTA 4OX9K 3OSSC 4KA4A 3CWSA 2H94A 5HL7L 3T0YA 4BJ5C 4M72A 5AN4A 3D45A 2FMYA 1D09B 3LP2A 3CBMA 1BI4A 3I4NJ 2R7TA 4B9LA 4XBFA 2QQ9A 2IVNA 5EG0B 2WB1A 3GLXA 5BREA 4MZMA 4BQLA 2K3PA 1YQAA 3WODF 1KD1C 2Q2RA 1BA5A 5JICA 1UZCA 1IKXA 4JS5A 3QYEA 1LB2A 4FJMA 1S6PA 4XICA 3CUQB 5H6QA 1MHNA 1KJWA 3O8HA 3HO1A 1K8KB 1YAGA 1QZZA 1M27C 2OPRA 1WBDA 3ZQHA 3HTRA 2FOKA 3R1XA 1HNWK 2QUFA 1SVMA 1ODDA 4QT7A 2NAZA 1U9NA 1NG9A 2GWKA 1BW6A 4FJXA 3BY6A 2OAUA 3M0UA 2W1OA 4PJ0C 4U0YA 3DM2A 3X28B 3CCJQ 4CHUA 2XHKA 2YV0X 1JI8A 5EZGA 1YHQA 2KRCA 4CEZA 2E64A 4A3FJ 5DM6L 1XWLA 3BG3A 5LJWA 4FIBA 3NFCA 4NC6A 3AO1A 4CI0C 3DCFA 1SAZA 1B34A 4L0ZB 1J09A 1W1WE 3DTKA 2CP2A 1X3MA 4K25A 4F7UE 3FX3A 2LD5A 1YTAA 1ON2A 5E20A 3CCQA 1QU3A 2COZA 1VQ5N 1U45A 3FFKB 5CZ2A 4C8KA 3NCIA 4H0OA 3RMDA 1W5SA 2A5YB 5JR3A 3LSPA 4B9WA 4GVEA 3OGDA 1TXQA 5D3GA 2QQRA 1I3QJ 3D5LA 4RB3C 3WTYC 4EMGA 4DTJA 4PFOA 1WDXA 1E17A 3MKYB 2YI1A 2HCKA 5AQJA 1KG3A 4AHTA 1C6VA 4B43A 1EBMA 3BFMA 2VXZA 3SBGA 4JI3K 1Y7XA 2M45A 3I56I 2JWKA 1BM9A 4GXOA 3ZT0A 2KT0A 3IRRA 4HCBA 1SFKA 1JHHA 2QAZA 3O4WA 4QCLA 4M45A 4LDXA 1VYTA 2EV6A 3CUQA 2O6GE 5J3LA 2BDPA 1IN6A 3LSGA 5LGUA 1PU7A 1N9SA 1R5GA 3IH4A 4BDPA 2VJ4A 4AG2C 2FF6A 2VOOA 1IRFA 3BCAA 3L1PA 1YQLA 3K58A 1KRPA 1IBMK 4JX5A 2F1LA 2OA4A 2F5VA 4NXMK 2O8DA 2LJ1A 3S3OA 3M4YA 1JKQC 3JB9F 2ID6A 3I55Q 1ZG5A 5CVRA 3GF2A 3W6VA 3MEEA 2P5VA 1VI0A 4YIFA 3L2QA 1VQPQ 2E1YA 3VQ4A 4EJUA 3UPUA 3RTRA 2W24A 3LALA 3CCSN 4J8FA 1G8XA 3W3CA 2Z9OA 4CZLA 1T3SA 2WFBA 3E6DA 3M5AA 2W85A 3DXJF 3FM5A 2ZJPF 1NJYA 1JT0A 4IO9F 3L2WA 2CH4W 4ETSA 2XC7A 1YIJQ 4UUTA 3HSTB 1V4RA 2KPMA 5K7FA 3REAB 5FPEA 1XHZA 3G2BA 3V9ZA 1LKXA 3UA6A 1RI7A 2BTFA 4DR5K 3DOKA 1MNEA 3VGKA 4WWCA 2WTEA 2A40A 4F7UG 4ENMA 1YJNT 1N8RC 2A5WA 3I0WA 3MKDA 1IGUA 5HNHA 2G6FX 4M75E 4BRDA 4IOCF 1UA0A 2QWRA 3KLHA 1RTIA 5KCHA 4QIWN 2BEOA 1D3BB 2DL7A 4DOVA 3S6WA 4Z4EA 4HWIA 4Z4HA 1B6AA 4YELA 3VQDA 1BGXT 2E2JJ 1XNQK 3RZOJ 4B1UB 2EPDA 4CEDA 5FLVA 1QSLA 2ECZA 4M77F 2HOEA 3HP9A 4UV9A 1VQMQ 3B6PA 1U84A 3JAMZ 3M58A 3META 3WE3A 5AQWA 2VWFA 4DIQA 3E97A 2ZC2A 2I5WA 1D0ZA 4M6YA 2Z33A 4F93B 1Z3XA 1U48A 3J81Z 3PNVA 4B9NA 2NOZA 2L3RA 1RAEB 4FW1A 2LX7A 2VGMA 5KYWB 5DCMA 1VF9A 3C7JA 4HF2A 3FXOA 1ZRFA 3GTPJ 2VKEA 2X4XA 2OPPA 4M3DA 5KAFC 4I76A 1TH7A 3FRNA 4B9TA 4BGDA 4X66K 1GLJO 4UNFA 1U78A 2ID3A 4FJNA 2GXAA 1JJ2S 5KYYA 1VQNQ 1JBMA 1X01A 4P55A 3THWB 4RAYA 5IAYA 2RE2A 3CCRT 3RR8A 1VAZA 2QTXA 4KHQA 2I7PA 3EHQA 5D8KB 2PBIA 3E6MA 4J01A 3ZX0A 4HF1A 4X9DA 4ZH4F 2JMCA 2O7OA 4HTLA 4JI7K 4KHYA 5FD6A 4LLLA 1TUDA 3AO5A 3WTSC 3LDQA 2K7LA 1VQ8T 2LRQA 4C30A 2DFFA 4HHTA 1NJZA 4DR4K 2JA7J 1ZKGA 3K1PA 3HKZN 1PU8A 2JA5J 4GW6A 4CGJA 1UECA 1IAWA 4Y13A 3CCUT 1R7JA 1IF1A 5A0GA 4BE2A 1FSHA 3U21A 3BWGA 1B9FA 2Q1ZB 1IBLK 5EOYA 4LD9K 3VFZA 4O44A 3SZPA 2XGCA 3LW5E 5BN9A 1NGJA 3MK6A 1SC7A 5KN8A 1PP7U 1PUFA 2RQWA 1WI3A 1XCBA 1Y1WJ 3JS6A 2VE8A 1FMKA 4RKUE 4BGAA 3CW7A 2WOMA 1Z21A 5C4JJ 3DLLL 5M3MJ 2K5LA 3CERA 4IHXA 3OL3A 4C0ZA 3AVFA 2XKOA 2L4MA 1QPMA 5EJCA 3RMAA 4NL2A 3SQ4A 1K73O 2IS2A 3ENBA 3ZSOA 3VYGA 1WAJA 3N97A 4CZJA 4M74A 1P2FA 3DRPA 1UELB 2DRKA 4D6WA 5LJ3h 4EAHD 2L7KA 2QEXI 4Y4RA 1AHJB 1R49A 2Z1IA 5CYVA 1WQ2A 4KMUX 2BY1A 1BYMA 1ERDA 2IW5A 1LDJA 2HD0A 3KK2A 3JB9G 3DBLB 4JKEA 2Y31A 2YNHA 4I2PA 4ENKA 4B21A 1M3CA 2ZO4A 1V54H 2MSYA 5E79C 4FLZA 1D3YA 3DTEA 3SAFA 4KGVB 4UUSB 4QPOA 1B7TA 1OH7A 3VRZA 1QP3A 1VSMA 3WE2A 1ZSZC 3CLOA 3Q0WA 2JMWA 3EQLF 2KBTA 1VQ6I 3EG9B 4KMFA 3MMYB 3CC4T 1VQPI 3SZGA 4DHYA 3GTGJ 2GZWA 2JLEA 3L2RA 2NYXA 5J4YA 2YNFA 3CC2N 1ZSZA 1KEAA 2XAGA 1BO5O 1HQUA 2LSNA 1XNRK 2XRNA 3BR0A 3ZQIA 3FBIB 5C0YA 4RW6A 5C15A 2LTPA 2HKQB 1YJ9T 1H641 4MHGA 3KP6A 3OH9A 3ZT3A 3RKQA 3VB2A 1OYIA 4DTNA 2JPCA 3PO4A 4JKGB 1Z0XA 4I7FA 1ZXOA 2ZMEC 5LMUK 2Z16A 5HKCA 3B8AX 4EM2A 2DYRH 3HSBA 2NS7A 4ILJA 3UA7A 1SUQA 1K76A 2J6KA 3HIFA 2V9VA 3VESA 2LQKA 4NB5A 3F72A 3M8FA 4FOEA 5JVHL 4PL6A 4UC4A 2MABA 2OD5A 1WSEA 1IHWA 3LM9A 1YHQI 3CCUI 1W5TA 4BAYA 2BY0A 2XO7A 1S7EA 1JXBA 1LAWA 4OMOA 4C5HA 1PNJA 4MLHA 3RSEB 5GANe 3K10A 1CKAA 2F8TA 2F4IA 2QVOA 1YIJN 3MEGA 4H0XB 3QO9A 3VQBA 1HBXG 5KPRA 2CT4A 3OVNA 4YOWA 3NPFA 4LFCK 1XPXA 5F1XA 4OWRB 1TKTA 2R7WA 2XV4S 4XM3A 1Z9QA 2Q1NA 1I5ZA 1XB4A 4ZN3A 3G6ET 5B3SH 4IHVA 1S7AA 3K1NA 1TUYA 3IRQA 4A53A 1KSPA 1ABQA 4ZTFA 5ICEA 3T5XA 2XF6A 3VPRA 2H1LA 4M78F 3R6MA 3UE5A 3M8JA 4D8KA 4MDWA 5DM6F 3SYZA 3HM8A 5DLOA 5FU6B 3P9CA 1N75A 3WU1B 4C92A 2R7VA 1W6XA 3HSCA 3ZRGA 1IXCA 3G1MA 3CFOA 4XEIA 1LPLA 1M30A 2QKMB 2D0AA 3JTGA 1N3AA 1T0FA 3KLEA 1YJNQ 1QVFM 4GGGA 3GZ6A 1T8EA 1OLTA 1IZ1A 4LG0A 2GIZA 1DIZA 1X19A 1XHXA 1WI7A 1ZG3A 2HNYA 1FLIA 3M9AA 2E3HA 1XMKA 4A4KA 4JS4A 3C7NB 2K2MA 3RR7A 1TS9A 5FKNA 4BR9A 1AKHB 1VQNI 1NLPC 4EQQA 5J4VA 3RIRA 3THXB 1LW0A 4G9ZA 3K9KA 2KL4A 2ZGZA 1PYVA 1U4BA 2IIRA 1TT0A 2ED0A 2CMPA 2HXOA 4M3GA 4D5CA 3MDQA 4NB4A 2JJ7A 3U4LA 3CVSA 3AA2A 2QKKA 2BW3A 3QKJA 1XI1A 1YW7A 1B9MA 1KU9A 1XOVA 5AIQA 4J2AA 1F1ZA 2CFOA 1HKBA 1UG2A 4CHOA 3TSWA 2EFOA 3TWHA 1S3XA 1MJBA 2R7DA 3MWTA 3PSFA 1QZ5A 3ZSVA 3R0JA 2M51A 5ERIA 3TTCA 2P0QA 3U8XA 4RM3A 2K9SA 2AKKA 2AKLA 2BE2A 3G4SI 4FSVA 4BVPA 3FXQA 3JRHA 3LSRA 3EAEA 3REBB 5D5UB 1TG0A 1PRLC 3KETA 1UDLA 4JRIA 2H3GX 5E1ZB 2W10A 1UJ8A 4CF8A 1U5TA 4C8MA 2UXCK 2LMDA 4H0YB 2YNIA 1Z6RA 2P9IB 1AHDP 5D6XA 2R5AA 3V9WA 3GO5A 4LG0B 4BVOA 2COMA 3DFGA 2Y0SN 3ZQLA 2IVMA 1Z1DA 1HKQA 3V7CA 2FVUA 2H6CA 3TQNA 4XL9A 3BDDA 4N47A 4Z4IA 1LQ1A 1M5Q1 1ZC6A 1N8RU 3BR3A 2UXDK 1YX5A 4N0AC 1JO8A 2V79A 1LVKA 1ATSA 2UV1A 2JT4A 1RDCA 1JUSA 1XDSA 5DY9A 2D9TA 2YKNA 5AJ3K 4FT8A 1R5HA 3HG9A 2VWKA 1AA7A 1HJDA 3CESA 3VEYA 3L4QA 1R8OB 2PTKA 4BXFA 4OU0A 1W97L 4HUFA 3JYTA 1Q82R 2F6CA 3Q0UA 3NAEA 5GMKe 3H3UA 4BRQA 1TC3C 5AQGA 3E7LA 3KD5E 4JYAK 2K5IA 1IV8A 1OV3A 4OF1A 3OJSA 5AQPA 3R6OA 4JN4A 4AFQC 2CQNA 4FWKA 2YHTA 1Y96B 3QQAA 2EZIA 3ULDA 1ZSZB 3Q5FA 2NOHA 4AUXA 3QEIA 3C12A 1ZELA 2TRTA 3BG9A 2MWOA 1NOZA 1UHSA 4K41A 2P9KB 3O9TA 5C12A 6AT1B 2DJIA 4QS7A 5DUIA 5GAOq 1WRJA 1BDGA 4XLNF 4CD3A 5KI6A 1Y39A 1SPKA 1ORPA 2WAQN 3G10A 3FZKA 4M7DG 1MWMA 1ACIA 2COWA 5GANg 2VQFK 2LJ3A 3OV8A 5HOOA 2XB0X 4XKCA 1G3YA 4A69C 3VQ6A 2UXBK 4EMKB 4GV9A 2QA4N 1WFWA 1DJ7B 4M3YA 2RHYA 3BROA 2VWBA 4DYRA 1GDTA 2ESWA 3X2QH 4GMJB 2P84A 3OYYA 1USSA 1PUEE 5KQ8A 1D4XA 4HV5A 4IUPA 3CQZJ 3K5LA 1V5FA 4A3DJ 4YDUC 2P51A 5TKYA 3PQJA 3PMTA 2R4GA 3MXMA 2GLOA 5J2PA 3FZFA 4H0PA 2CWEA 1ZH5A 3LWHA 1J59A 3IH2A 4GRIA 2HHSA 3KK3A 2O4XA 1YF5L 3BZKA 1HW5A 5AQMA 1O13A 2LP0A 4YDUA 5IWAK 4LD5A 1LFPA 3GNGA 4UV8A 1X1BA 4CVNE 4ENJA 1WPYA 4CZMA 2OZMA 2A69F 2DA1A 2W7NA 2J6FA 2BV6A 1QZYA 1VQMT 4KAZA 2HI3A 3OIPA 3KVGA 3I55N 4B3AA 4Z88A 3ZT2A 2XPVA 3BTIA 3CCEI 2D1VA 4N4OB 1GT0C 1MUNA 3X26B 1IGNA 3CCRQ 1HNXK 1KK7A 1JT6A 3LFKA 2O8EB 2HBWA 3L6QA 3HXLA 2P9PB 2YHBA 3EGDB 3IAYA 5GAOm 4AHRA 1IKVA 3QB0A 3SAHA 3DPUA 1U0JA 2W00A 3VQQA 4FLYA 3SJHA 3EG1A 4QOZB 3VPZA 1HD3A 3KEOA 1J3TA 1TGOA 5DEQA 5IP7J 1POGA 2ECBA 3ZCOA 2RNJA 4HSRA 4U88A 2JN6A 4M78G 4I6MA 4VUBA 2YXYA 2O4GA 4H0TB 4I7HA 4HCCA 1VQ9Q 3QU6A 3AGKA 2IEKA 2QQSA 2O03A 4DV7K 1A5WA 3ULRB 1NG2A 1IO2A 3M56A 4CF1A 3A98A 2RHUA 4RGXA 2CGKA 3CMEA 1GXIE 4E6KG 1Y0NA 2OTLN 1NJIC 2FSNA 4E70A 3QEPA 1NGEA 1U3OA 1G2BA 5J1UA 4KYWA 1TUCA 3CDIA 3OYLA 4A57A 3I64A 3OYNA 2MIOA 3SBTA 4W1UA 1LEBA 3ENHA 1BU6O 1O3RA 5SWMA 1SL0A 3OSFA 2FPEA 2NOEA 4YOXA 2OPQA 4Z02A 5FWCA 1FIAA 1YI2Q 5AYFA 1HX1A 5FPDA 1ZR4A 2EYXA 2P9NB 2PFBA 2CP5A 2XHBA 2OTJN 3SV3A 2M7AA 4Z6YA 2LY2A 2BHZA 4M75D 3I0XA 3VW4A 2YRCA 4ILGB 3FXJA 3T3FA 1WCMJ 4LJZF 4QQGA 2DOFA 3T1BA 1MKMA 1X9SA 4MQ3A 1I6XA 3NGIA 4J2EA 1SV5A 2DX1A 2DK8A 5E17F 1TV6A 2KK4A 5GAMg 4IIOA 4BRHA 1X2QA 3ZEUB 3R6SA 3S14J 4PFZA 3SCXA 4HTUA 1O7FA 4KDPA 3FKJA 3ZYYX 1G6NA 3CCSQ 4XAXB 5GAN7 1HR0K 3EPZA 2P9IA 3BQZA 2OTLQ 4M3WA 4X1EA 1HJOA 1IRZA 1SHGA 4N4NB 2VWJA 4PJOB 4MDBA 3ASOH 1G3WA 4ZZLA 2HMAA 4PNOA 3AT1B 1KVAA 4EA5A 5GAOp 3BTCA 1KQ8A 3F70A 2QSFX 1Q86R 5GANh 3ZSYA 2NZTA 3L3VA 5D7UA 1FMWA 4MDXA 3TAMA 1EQYA 1EIFA 2CSOA 3WGHA 2UWMA 4GLKA 1TVRA 4NDLA 4CJ3A 2XG8D 1YIJT 4M71A 5HDKA 2P9SB 1U1SA 2CSQA 2OJ2A 1GV2A 4KTWA 1W7AA 4ELZC 4V2SA 4AIAA 2XKPA 4QKUA 4I9LA 1ZK8A 4LSLA 1K4US 3KE2A 4IX7A 3NHGA 2BZTA 5AQOA 1J9IA 4DLEA 4FM0A 2DTRA 4RCCA 3ERED 2M8GX 1ZGAA 1QWFA 5FGMA 3U3YA 3VOEA 3SWNB 4FM2A 4JKHA 3M3ZA 4AWXB 2DPNA 3HK2A 1IW7F 1U6ZA 3F22A 5EDNA 2GFAA 3CJTB 1CLQA 2NVYJ 1UTIA 2E2PA 4DFJA 2EFIA 1LNXA 4Y52J 3QESA 2L9RA 1RAAB 5HLHA 1KA8A 3OYBA 5KGWA 2O8XA 1X4PA 3CP8A 1BKBA 2YX6A 3KIOA 3NWSA 3MCAB 1GVJA 2HOSA 1F1BB 4DUZK 4ZDOA 2FNAA 3ZEHA 4C2UA 1P4AA 1FTTA 2HFHA 1NZ9A 1UG1A 4E7KA 1NJIR 4BC5A 4YTLA 2LBFB 4WX9A 2K02A 1WNSA 2GBZA 1TK0A 3ZLJA 2FBVA 3JB9I 3E6CC 2M2EA 4UVBA 4MMLA 2PVDB 1RDWX 4B22A 4C92C 3G3ZA 1M90R 3BTJA 4ZHRA 1D5YA 1PP8F 2LKSA 3U9GA 1U6GA 3BG7A 2QXLA 3P7NA 1TOVA 2R7YA 3ZX2A 3VS0A 1ZUUA 5AQRA 3CXCS 3LAJA 2OAZA 4JJDA 2M5WA 2OTJQ 3O6BB 2O8CA 2UUBK 5AQTA 3M3YJ 4X9CA 2RV8A 2X4HA 1GVDA 5AQYA 2CV2A 2KKZA 3BLYA 2A7YA 3ZQGA 1XMOK 2B8AA 2DJQA 4PDKA 2YRDA 3RMCA 3MKLA 1MWKA 3PFIA 2P9KA 3I5RA 1KG2A 2FU4A 1QVUA 3G0ZA 2RDPA 2EINH 3FMSA 2KIUA 3HB9A 2R7UA 4MQ9F 1OZ3A 3V7SA 2CS3A 2WONA 4Q0BA 4CEBA 3HJEA 5CQXA 1CZBA 3JAMO 1VSFA 4ISEA 2QENA 5FD5A 4YFKF 5CKHA 3D0SA 4RB2C 4NLBA 2CGLA 3SMPA 4L59A 4EVVA 5IT3A 2QA4T 1CXQA 1JTYA 2XB5A 2LNHB 3FM3A 2OTLI 2QDLA 3ASMA 4CEQA 2MF2A 4DQSA 4DSEA 2HDAA 3OMCA 2RHIA 2BE9B 2PZSA 1WIEA 4WQ5A 1LWYA 3ISPA 1KSWA 1ZX6A 2VC1A 2VKVA 3CCMA 3MCPA 2M7BA 3S9HA 1K9AA 3OS5A 1BI3A 1M90U 5IY5H 2RQUA 1LAVA 2B0LA 1ARKA 1SANA 2VN2A 3NF8A 4LFBK 2CZ7B 2KJBA 2RQRA 1Q18A 2HNHA 1LWFA 4IRGA 1QLYA 2EGAA 2GXBA 3I9QA 2J05A 5AQHA 4NQWA 4M7AD 2E6MA 3ZFJA 4X0GA 4M7AB 4A2AA 2ITGA 3S2WA 1M1KU 4CJLA 4GYGA 1F5TA 4CC4B 2XKOC 3DLAA 1CZAN 1O3SA 4JI2K 1U47A 4A3EJ 5HVQC 1S72A 5EXWA 4CZIA 1ZGJA 3S2HJ 1S1XA 3CMEQ 1NM1A 3ABKH 2OX7A 3HT3A 4F91B 5DTDA 2ZFWA 4DV3K 3K7AJ 1LWEA 3C6HA 4NS5A 2UUAK 3PNWC 5LJ3e 1IXRC 3BC8A 2RF0A 4C92F 1B59A 1OCOH 3R9PA 3BDUA 1M4ZA 5M1NA 3HL8A 5DV5A 3CP2A 3AHUA 4CC3A 3CCVI 2QTVA 2F4MB 4JBAA 3VGLA 3MO8A 2BW3B 3VKIA 4CJTA 3CCJA 3HUGA 3LA7A 2HQHA 2K9NA 1NJIO 2GA2A 3VUZA 1I1GA 4RCBA 1QVFP 4DWIA 1RDBA 1VQ8N 1J0RA 4PJLA 4UOBA 3MXIA 4ZYGA 3RR6A 4DV5K 1WXTA 4RTWA 2E2NA 2FZKB 3COAC 3BJ6A 3NFAA 2Q3SA 2OPTA 3VQCA 4X1VA 3CFRA 1KG1A 3G4SN 3KX2A 2ZSHB 1X2KA 1R0AA 3JCMV 4D8DA 3SDZA 2GAUA 1WJFA 4B1RA 1BIBA 3VEWA 2X35A 3O4NA 2FD5A 2GTOA 1SF9A 3QYFA 2RN7A 3FK6A 1Q7YO 4BEHB 2IA2A 2O5RA 3TARA 3PE0A 3F10A 1U04A 4IEJA 2OAWA 5CR4A 3S16J 4PJNA 3V42A 5CYQA 3CCVT 2FRWA 5I9EB 1EA3A 2QWPA 4FWOA 3SB2A 4RAFA 4C9YA 1KFDA 3REOA 3QICA 4DSIA 5E8GA 4BKXA 2VIXA 5CY4A 4JLIA 1VQ5A 2E65A 3CCQN 5FDLA 4F7UB 4ESBA 2EJGA 4ZYAA 4M7DF 4JKCA 4C8LA 5F2RA 1RKWA 4FLXA 4FZZA 2DAQA 2ROLA 2HL5C 1EF4A 3VJPA 3A8MB 2R5ZA 3AAPA 1UAXA 3LWIA 4C5IA 1VQMI 3V9UA 3SUQA 2RQPA 2NOLA 5L3BA 2ASOA 1IXSB 5CPRB 4FO0A 4IWVA 4U0WA 4OMYA 2DM1A 1OCZH 1RBTA 4O4GA 3L4IA 2X4YA 2NS8A 1I39A 3SQNA 3RRGA 4I0AA 2DODA 2PEXA 3BJOA 1YP5A 1LW2A 2V6CA 2VT3A 2MI6A 1M2VB 1DTQA 4C0DC 2JTVA 3J7AP 4CZFA 4NBQA 1QP2A 2CW0F 2DMQA 3GBQA 3JCMh 4RW4A 3QAHA 1HMVA 5FU7C 1RT3A 1SAXA 3AVGA 2OYQA 3F23A 2DIQA 4KHPK 2WSFE 2CZ1B 2DN0A 4RGRA 2ZJ2A 3D6RA 1NWKA 3O5BA 1XMAA 1BR1A 4LUEA 4EV0A 5TRDA 2EFNA 5C6SA 1VQ4A 3KK1A 5J8CA 4CO8A 4ITVA 1K8AC 3VODA 3HTUA 5JLFA 1NM7A 2KFDA 5CVIA 2TCTA 1FK9A 2MMPA 2JZYA 4UY8O 4XKWA 1SMTA 3SXYA 1BL3A 3DXMB 3LSJA 3FBNB 1MJ9A 1KZHA 2EPFA 5BNGA 4CGDA 4C2TA 1SFXA 1QVFA 2KDSA 3MN9A 3CJNA 5CCAA 1I3AA 4AHUA 3CMAT 3LAKA 1IN5A 2FX0A 2UU9K 3OYDA 1WSIA 1YXQA 4BRCA 2LQWA 4EMKC 3DWLA 3G1LA 1N77A 1YJWT 4RS8A 2EVRA 3LP0A 1BJAA 3RMQA 2ZJQL 1K6OA 2PVGB 3NVMA 2RNAA 2XY7A 1LCUA 1MNDA 2WUSA 4E6RA 2LBFA 3HZJA 4EPCA 1HLUA 4BRMA 3M55A 4BACA 4K2EA 3ISNC 3H0FA 2X74A 3ML6A 2ECCA 4B6MA 1Q86O 1RIOH 3FXUA 3KLNA 1UHFA 4OGEA 3QFPA 3IP4B 4IZ9A 1VQOQ 5DM7R 3K9TA 3E01A 3GOIA 1YLFA 3ZMVA 4KULA 1QA6A 2E10A 3HYFA 3X24B 2W0ZA 2B6AA 2CYYA 2P4TA 2OBPA 4L9VA 2KZGA 2EB7A 1SFOJ 2CRGA 2V7ZA 3CBOA 2JS0A 3CLQA 4OMLA 3NRVA 3OIOA 3HPGA 2V8JA 3FMQA 3ID6A 1A6QA 1RUNA 2KLOA 1RFQA 1N27A 2NVTJ 1U2VB 4EIAA 4RBOA 4XLAA 2HNIA 2KT1A 4IRHA 4AFUC 2V4JC 2BOLA 4AI5A 1MV0B 4B9XA 4OB1B 1PVSA 4LK0F 3SNNA 3CMEI 3WXKA 4C5GA 3OW2M 1S1NA 2CSIA 3DLLF 2B4JA 1H9TA 2XIGA 4EIKA 1R59O 1BA0A 3CCYA 3ABUA 2LVMA 2ROTA 4NHJA 4KH1B 1L3LA 2Y90A 2CP3A 4CFDA 4G9YA 4LITA 2DOEA 3J7AO 3J7AY 4W5OA 2Q36A 4IHSA 3V7RA 4A5BA 2X6XA 4P9FA 4CJRA 1K8AU 3N4MA 2EWNA 3JSOA 2YHWA 3CMMA 5BPDA 1RI0A 4CJQA 2DVJA 5KCMA 3CCJI 5AZIB 3CQXA 1OKRA 2W84A 4A4EA 5JLHA 1RDUA 1N78A 1YRNA 4XH1A 2PMZN 1M90O 4CXFA 1K8AO 3HOYJ 2DT5A 4F7ZA 4HX7A 4M4ZA 2XUBA 4FT2A 2HHUA 4FJIA 4U87A 4IPAA 5JVTA 3H41A 3TAFA 2EBIA 3QWLA 2RJDA 1HKTA 4WE1A 1SVLA 3S8PA 5C2FA 5FKMA 1P7MA 1HU0A 1RABB 1S72I 3BZCA 3DLLA 1GFCA 2Z1JA 1C0WA 1VYVA 1C6VX 2DA3A 2KIQA 3WNEA 1EWQA 1IG8A 3A8LB 4GY2B 2KYMA 3CJ7A 2LR8A 2XRIA 1ZHFA 3M0PA 2CUZA 2RK1A 1TKXA 2HVSA 3BG6A 2LDMA 3I5SA 3ZMZA 1SKSA 4HA8A 1FBUA 2VKNA 4FJJA 3M8SA 4EGYA 3IG1A 2H1KA 5CZ1A 2OV7A 2QKLB 1T2KA 2ZQBA 3K9JA 2IGIA 2RF2A 4FVUA 1ASVA 3OS2A 3CPFA 2HQEA 1V55H 1QKXA 1PU6A 4MTDA 2PQWA 3ZQ7A 2OCCH 1KYWA 2F96A 3QYGB 4CC2A 5GAMf 1P59A 3IDHA 2FL7A 4RTUA 2E12A 5A2QO 4KB1A 4CZEA 1E7OA 3JRCA 4DR2K 5I21A 2VBYA 3N4QA 3FXMA 2YG8A 1OX9A 3BT9A 1B3QA 3BCBA 1D1AA 4J9IA 3ZMSA 4KJZA 4W5NA 2E1MC 3I8BA 1R71A 3KJVA 2VG6A 4DTPA 1B9DA 4C0DB 1TQMA 5H6RA 5EY4A 2HTJA 5BQTA 2EQRA 3QINA 1O3TA 4OGCA 5DM7L 1I6HJ 3BPXA 2D0BA 3E2UA 2W48A 3UKUA 3QIPA 1JQQA 3A0IX 5E26A 3OYKA 1ZQ3P 2NWMA 3A01B 4EVIA 3C7NA 5GADP 2Y0SA 4PA1A 3K1MA 3QG1A 3AVNA 1OH6A 4DQ8A 2HSPA 1W2BS 5EX5A 3M1CA 2QM1A 4O5VA 4GLMA 4LY7A 1CF7B 4E3SA 1N34K 2B63J 2MFZA 2A08A 3TAQA 1RBSA 4DG1A 4CZHA 2A6EF 1JHFA 2O8KA 1VQKA 3KEYA 1ITGA 3KUFA 1QHTA 3S17J 3C94A 1H92A 2A61A 3CCST 3M5RA 5B66C 2DMOA 5IPAA 2A37A 3AVCA 3E5QA 5J3BA 3QPLA 5GANf 1M2VA 3KWGA 2PMUA 2QZ8A 2EYWA 1HKSA 2DYIA 4WXCA 2GM4A 3QDFA 2Z1GA 2QSHX 4M7DD 3C65A 2ZWHA 3GMEA 1N6AA 2NNNA 4E7LA 1VSIA 2G7HA 5I2MA 4RUGA 2KRHA 2MD5A 3DU6A 4MMKA 4QAGA 1K9MU 2CP6A 3F8MA 1FKOA 2KKOA 5CQGA 3UB5A 2GA1A 1IB8A 2IDOA 1TTHB 1R0CB 3NMZC 2CH6A 5GAMj 4J2DA 2PMHA 3BG5A 3ME9A 3CC2Q 2F5DA 1KU3A 3HOUJ 2EFPA 4C0GA 2BXYA 2O0YA 2L01A 3G71Q 3SPYA 3CPWS 4IFYA 4M77A 1MBJA 4AHCA 2VQCA 2KNBB 3VQ8A 4UUVA 1JLBA 3G4ST 3CMAN 2EH3A 2K85A 3PTAA 2AK5A 3JCMb 1JLFA 2KTQA 3VSLA 1WNLA 1AZEA 4DKWA 1T03A 3E5UA 4FWSA 2HHQA 1QQMA 4BWMA 1O3QA 3TOAA 1MSEC 3L8BA 1JCFA 4IO9L 3I8DA 4ZGJB 1P8ZA 3B6CA 4O3MA 2IOCA 3CF5L 2G7UA 1P7IA 4G12A 1YCSB 2FYKA 1A5JA 4PWDA 1SS6A 4XU1A 4RW9A 1KFZA 5EGOA 4OFAA 4LFAK 4CZZA 2BIVA 4J19A 2FSWA 2R57A 4DQ2A 1VQOT 3EUKL 2E34A 4HF0A 3BPVA 4GV6A 2HQ5A 1R1TA 3D2EB 4M7AC 5BPIA 3J80K 3PV8A 1PHTA 3SI6A 2RPNA 2VBXA 1NBEB 1K0SA 3NGYA 3F73A 2ZJRF 2LDUA 2Q2EA 4FISA 2ZM6K 3VEZA 2A3SA 4XLEA 4EP5A 2DA2A 2J7IA 4NLCA 1M8MA 2CUFA 3NH2A 5I22A 2PY5A 4EGZA 1MMNA 3CJRB 3O6WA 4AI4A 2F5EA 2FBXA 3H3ZA 3OW2P 2E60A 1JB0E 1FYLA 1VA7A 2WADA 1PSFA 2V9PA 3Q1JA 2VXDA 3VQEA 3RVCA 3NTKA 3CEYA 4DV1K 2M1BA 2RH2A 3CCUA 3THYB 5FLXK 4HCKA 3IKVA 2Y4YA 3MD2A 1Y56A 4JK7A 2YUQA 2KRMA 2O9SA 1JKPC 2QLZA 4Z94A 4XRSG 2LVSA 2ZMEA 3AAFA 3FZVA 3QNNA 2BY3A 1U8BA 4LF7K 2Y1JA 2ABKA 3HPOA 1UEBA 3KBGA 1W4MA 2OCEA 3DLKA 4L6V5 4Q4ZF 3WU2C 4B4CA 4GCVA 1YI2N 3IWZA 4OB0B 1DKGD 3LH5A 3ESWB 2NNWA 1GBQA 2P5GA 3GF5A 4A3MJ 1LMZA 5F0HA 4V19K 1X4OA 2X3XD 2PN6A 1MBGA 1SRMA 2ELKA 2NUPB 1H9GA 2L4AA 3AA3A 3AVKA 5HY6A 3D5SC 2W42A 3JAME 1VUBA 3NVKA 1FOXA 4A2UA 4BI3A 1KG4A 2V51B 1VQKN 4J5YA 3ALYA 3KP2A 3DQVC 2BUDA 3TDZC 3BDLA 4XQFA 2K40A 2D1HA 2XGDA 3UKUB 2XF5A 2NVUB 1S29A 2C0IA 3H9QA 1VQNT 1WJ5A 1KFSA 4N0AA 3MN6A 1MUDA 2CS7A 1UJYA 4KIBA 4DQQA 3F8BA 2P4WA 1YJNN 2LT1A 2O9VA 5IHIA 2ZMEB 1RUWA 1YI2I 1MMSA 2DK5A 2ATQA 1X43A 2NLUA 5KNLA 4KPYA 1C1AA 3G6EQ 3QZ5B 3FISA 5GMKh 4WQ4A 2GEMA 1T98A 3D7EO 2HU9A 2E6LA 1VQMA 4CGFA 1XG7A 4CZCA 3C0CA 3H45C 3V6DA 1VIFA 4DV4K 5F0XA 4CEFA 2E2QA 2KHOA 4XSXF 5FPNA 3WVDB 4A12A 2VQHA 2HW3A 4E7JA 5B1BH 4WQ4C 4XSZF 2VV5A 4N76A 3MEDA 3LSKA 3EO3A 1YJ9I 4JI0K 2KISA 5IYCJ 3H0GJ 1NLVA 4DMNA 2L2OA 2KYBA 2E35A 2Z0WA 2V6EA 3E9LA 1WLPB 2LSOA 5GAGP 2TDXA 2JRMA 1YE9A 5A2QE 4FSSA 4BY9C 5H1SQ 2CQKA 1YJNI 2A41A 5J40A 2A3ZA 4FLVA 1HKGA 4OFHA 4OP0A 1NG7A 3H3NO 3THYA 2IPOB 1Q86U 2O8DB 4X6AJ 3CCRN 1MIJA 1HW2A 3WTWC 3R61A 5C44J 4UHTA 2H6BA 3LQRA 1YI2A 1ILYA 4DA4A 2DL3A 3QDRB 5DLQE 1AWJA 4QVZA 1OOTA 1PG5B 2F2EA 4PK4A 2X51A 2K9GA 4LFUA 4J6YA 5JVGL 3PO5A 5KYUA 3QBYA 4C92D 3SYTA 4BG9A 1I50J 2KRNA 4FVMA 1MDUB 4CHNA 1BOBA 2DLLA 4A6EA 3CD6I 1SD5A 3M57A 2FRYA 1IV6A 4QTRA 1UHWA 1LJ9A 1C1BA 2JTMA 1NGFA 4M77B 5FLXO 2HQNA 3AAQA 4NXNK 1HYSA 2JM8A 2JNGA 3QEVA 2KW4A 2O8FB 3CJCA 3TDUC 4J2BA 1LDKB 2DI3A 3C6UA 3LYIA 2Q97A 2ADUA 1NHAA 2DA7A 4OVLA 2ICWG 1P9QC 4B1YB 4Z4CA 4I2QA 3KZZA 3S93A 1XQOA 3B6AA 3FLGA 2JHNA 1I1JA 3GX4X 2EA4A 4O8UA 2EW3A 4IJAA 5EYRA 1LNWA 1DU6A 5FPMA 1XQHA 3H5NA 3V4IA 2DT7B 1HK9A 4AH9A 1EH7A 2OFIA 2ZNZA 3FKIJ 3MAJA 2P9UB 3CC7A 3M0QA 4M63C 4ASNA 3PIPF 2L0AA 5LY3A 2HSEB 5K7ZA 4BREA 3DB3A 5L23A 3LCNA 2HTSA 4A4FA 4E7HA 1IC8A 2H8HA 2ZGYA 4NQWB 4PJOE 1WQWA 1LWCA 3E0JB 5LJ3f 3H9JA 5LLQA 1TK8A 2DNUA 3QP6A 2SRCA 1UUEA 2PYJA 3ZMTA 1RUOA 2YU9J 1D9FA 4KRFA 4J8OA 1IKWA 5GTHC 2CYZB 4RMOA 2KZMA 1ZBUA 3VEVA 2ACJA 4A5AA 2D8HA 1JXMA 2G8WA 1YIJA 1NGHA 2D0OA 4FJ7A 1YX3A 3QPTA 2OTJA 3TAPA 2LTOA 2Z99A 1ZBLA 5GAEJ 4M3TA 2DFHA 3H46O 1K8KA 3JXUA 4FHTA 3JB9J 3UKGA 4B1ZA 4CEEA 1Y1VJ 3FLCO 2DTIA 3NE6A 4A61A 1KC8R 3CCLI 3WHBA 1ETKA 2NOGA 3WNHA 4CERA 2G8KA 2VYTA 4K0KK 3BW1A 2DBMA 2DYSH 4C1NK 5GP9A 2KRFA 2JOYA 2H3EB 1MH3A 4L9JA 1QHAA 4IF4A 4OVAA 8AT1B 4B24A 1QVTA 1LFBA 1TZLA 1CGPA 2IPQX 4CC7A 3A01A 4PJOD 4F92B 2QDYB 1VSJA 2VJIA 4L3QA 1ITYA 3QP5A 1ZN2A 2VUBA 4HX4A 1M3QA 2EQJA 3RERA 4BQAA 4YFUA 1KD1R 1R22A 3BR1A 4X62K 1RRQA 1Z9ZA 2ESHA 2CUDA 4CGGA 3WNFA 1PSEA 5AFUH 4CHYA 4WCIA 3UNGC 3W3DA 5M5WJ 4BY6C 3QO3A 3N05A 1OVYA 4H5WA 1ACMB 2FXAA 1ZBXA 3KLGA 4FL9A 5M1KA 1WHJA 5IP6A 2PZ1A 4CH7A 5M1QA 5LJ3j 3EEQA 4O0JA 3NARA 3N0UA 3VS4A 3GDQA 2JPSA 2QWMA 3NH0A 4FX4A 1R36A 1BU1A 2ZD1A 4DTUA 4YOYA 5AZJB 1DUXC 3HSEA 3AGRA 4FJ8A 1DDNA 2R3SA 4DUYK 1JKOC 4B3RK 3MWPA 1XQSC 1WHUA 2YHYA 1H89C 4DJAA 2GNCA 1S5JA 2UUCK 2EILH 4KREA 2AQEA 4MEYF 4LDYA 3MZYA 3HVTA 3OYIA 1BQMA 3NH1A 4IUUA 4BU2A 3I59A 4M3UA 1ETQA 3HTVA 2MAMA 1NKUA 3MKZA 1WJQA 3TO9A 2HVQA 5J6XA 3H9GA 1M90C 4DTXA 2QWWA 3J7ZO 3TSPA 2PVOB 3WTXC 4N0BA 3BR2A 3G25A 4W5RA 4IQ4A 4JJCA 1ONVA 3EG2A 2FE3A 2CZ6B 1UCRA 3DYAA 1OI1A 2LF8A 4AT1B 4Z89A 5C2DA 5LBQA 3WXMB 3H1VX 1IZ6A 4M3ZA 3HI0A 2NXNB 4R55A 1S72T 4P9UA 4C8OA 3CCMN 5M1OA 3KXTA 3MEVA 2P0PA 2PU9B 4MNUA 4D7NA 3O8GA 4V19S 4CJSA 5LGTA 1NPPA 3DBHB 3CC7N 3KP4A 1HYOA 1SQKA 2QWNA 2K57A 1VSLA 3ZOBA 2HHVA 3WQUA 4M9ZA 5GMKi 3V1RA 4J9FA 2JS2A 4U7DA 1AWWA 4AM7A 3FJPA 1NKEA 3ZSXA 2ELJA 1QQJA 3DAWA 3CC7I 3OW2S 2HBKA 3SD4A 4HBLA 1E6GA 2ZZDA 4M7AE 3LSTA 2D1KA 2LC2A 2V7FA 1B07A 4IVNA 2R5YB 1RDDA 4RTTA 1ASUA 1M3AA 1XC5A 3K70C 2H09A 1X3NA 1Y71A 4M77E 1IG7A 1Z25A 1HNVA 3VENA 2AA4A 3HPHA 5KAIC 2W82A 2DXIA 2EJ9A 2X9DA 3C1DA 4FLTA 1ZA1B 2WAQA 3AFHA 5A2QK 1JLAA 4G6TB 4DU3A 4M7AG 3ZR8X 5BR8K 2D4WA 4LF6K 4OOIA 5I11A 2EKHA 1G3SA 1RTHA 1JGSA 4EEFG 1RILA 4CUGA 3O9QA 2KDZA 2OPSA 2EJRA 4PGGA 4R1HA 2FBYA 1WSJA 4H5TA 3ZQCA 2DA5A 3QIIA 3DOLA 1KLNA 1LOJA 2KE9A 2MD0A 4MLEA 3CUOA 3RUXA 2M1HA 3O3HA 3W2AA 1VQ4T 4X64K 4HKEA 4M9SA 1Z6TA 2LCLA 4DQRA 4FWRA 3G0QA 2O31A 4CF9A 2P9LB 4I2OA 2HL3A 2CT3A 4PJMA 3DP7A 5DDGA 5KPZA 2MLGA 3BQYA 2R7RA 2MH2A 3MXJA 2KR3A 1O7LA 4DBRA 3U6FA 1AWOA 1LOTB 5FU7B 3P83D 4M78C 3JRIA 3Q9SA 2FZGB 4CHPA 2DMNA 3G1JA 2B9SA 1ETOA 1VQ7I 2MA3A 4KTQA 3ZCMA 3GZ5A 3EFRA 3KLFA 1G5VA 5F0CA 3WTUC 1AKHA 2HHXA 2E7XA 3R6NA 3RZDJ 4YOQA 3FHGA 2D8JA 3LSMA 5AIPA 1J5YA 1RTJA 1HJRA 5GAHJ 1NEBA 4XTYA 1YS6A 3K2AA 4RM2A 1WJBA 3I33A 4Z0UA 4HSTA 2KP6A 5E3OA 1ZLJA 1P7JA 1QSYA 1APLC 3FZLA 2X85A 4PKIA 3HUGB 1VQLN 1XQPA 2M0OA 1FOYA 4C92B 4DB3A 1KU2A 2DTHA 5E18F 3SUOA 3CXCM 5AT1B 4E1MA 3KP5A 2V8IA 4GYIA 5HLIA 4J00A 2R5MA 4PGHA 3TSQA 4B8CA 5IT9O 4FWNA 2HVIA 4IQJA 4KH6A 2J06A 5LJ3g 3ABLH 1OEBA 4LIVA 2PYLA 3HRMA 1VOMA 2CQQA 4MFDA 1HYVA 1LJOA 1KVBA 2P5KA 5GINA 1FPQA 4CIEA 1KQSP 4XOPA 5K5OA 4BR2A 4RW8A 3T19A 2X3WD 5HDGA 1IDZA 4FJKA 3D2EA 3K69A 3G4SQ 1GBRA 1J7KA 5BOXA 1YJWI 2HDCA 4FTHA 2E1HA 3A0HC 3SJJA 2HKNA 3QRFF 2CREA 3SPZA 1WYXA 1DP3A 1PKSA 1OCCH 3GNFB 2F2WA 2YDLA 1K4TA 3RMBA 1HF0A 4V2GA 3R0AA 2LZ6B 5D4RA 1Y0UA 4MFEA 3SDBA 1MJAA 1WLJA 4RA2A 5JVGF 3VF4A 1TQPA 5FB2A 1UGPB 5LJVA 5BRHA 4QPQA 4RB1A 5FFZA 4R8HA 2HS5A 4KHSA 1B1BA 2P9UA 3HM5A 3DJCA 5TKWA 5IT9K 2VI6A 3LMMA 4XLFA 2OTLT 4K8ZA 2A6TA 1XJWB 1QVGM 2JWLA 1B4AA 4JZ3A 3H35A 1RBVA 4IEIA 3RYRA 5BPNA 1W7PD 2HGCA 5IOYA 2KXDA 4EMHA 3S32A 2DF6A 3MX5A 1D1BA 5GADJ 3OYCA 4DQPA 1JJ8C 4J9DA 5KYXA 1I8FA 2RC4A 2EZKA 5IHNA 1PC0A 5A2QZ 2VJJA 4N4GA 1GLLO 5HRSA 4LLGF 4E9HA 4II1A 4FLWA 3FMRA 2NVXJ 4OLBA 4M3BA 2PX9A 3CCET 4HXJA 3LM2A 3E9GA 3WEEA 3DKYA 4CGIA 1RCHA 3HOWJ 5T7BA 4QVDA 3LWFA 3I0SA 3CMET 2PJPA 1AZGB 3KCCA 3O1BA 1HSJA 4J9CA 1SEMA 1XC9A 2FBHA 2ZE2A 1ZR2A 1FYNA 3HKSA 3CXCA 5AQKA 3FHNA 4XKVA 4AILC 2E70A 2MPXC 4N4HA 2MWPA 2V9KA 5IYDJ 1VQKT 2VBZA 4Y3OA 1UMQA 5E3MA 4PJOF 2P9NA 1EH8A 2VQGA 2GTJA 5CKFA 1XGOA 2IA1A 1NK9A 3KTQA 1H3ZA 1VSHA 3JRFA 2DILA 2CGJA 2IA0A 1TL3A 3UR3C 5J2QA 2M4GA 3LDNA 2L7MP 2Z1DA 4EM1A 1WX6A 3CC7T 1EO1A 2M02A 3IH3A 5CIUA 2A68F 3LLRA 4E1NA 3FK7A 2ZPEB 1YW8A 2QA4A 2BKDN 2WACA 3CVTA 3C2GA 4XQ3A 4XLPF 4DNCA 5AR0A 2IG0A 3VQ5A 1BN5A 1UHMA 5B1AH 1FYKA 3J80Z 1MUZA 1TW3A 1S72Q 2VT2A 3VMFB 1M3BA 4KN7X 5GAMd 4G7ZF 3LPUA 3ZETA 4FJ5A 4IZZA 2RI3A 2O8BB 4KICA 4AIKA 1OCPA 2WSCE 1I5OB 4B3OA 3D4VA 3TO6A 3CCRI 2P5LC 3VTHA 2GWRA 4O5BA 4Y1CA 3FC3A 4IUVA 4C8QG 1NK6A 3AG1H 5AZJA 2D5VA 1LWWA 1YO5C 2RHZA 3UDCA 3CO6C 4BHBA 1KD1O 2AS5F 1WOQA 5C42A 1MGQA 3QU3A 1PVEA 1C0MA 1XSXA 3VUBA 1YI2T 1W5CC 1VQ8I 4JD2A 1XX5A 3QYHB 3GBGA 2DOAA 4WF9L 1X6OA 1YW9A 1RT2A 1MBEA 2ASPA 4RAGA 2AO9A 4JYKA 1MV3A 1LPQA 4S04A 2D2WA 4BRKA 2IRFG 2RGVA 4XH4A 2GELA 1KAYA 3HKZA 2YHXA 4KH4A 3P1GA 3OR2C 2DMTA 4YFNF 2IIMA 3KYDB 1RESA 1S22A 1Y57A 3QZ9B 3E19A 4C0FA 1WSUA 1M9SA 2M16A 1AOYA 4IG3A 2QYZA 5GAN6 2FRHA 1X75C 3VQAA 2X48A 3ATUA 2EIFA 1WZOA 3LWMA 4B1XB 1JE8A 1K9MO 2HNZA 1FEXA 2DTOA 3VDXA 2D0NA 2LREA 4DW6A 1FYMA 3ENOA 3DB4A 3M0RA 4HYEA 4FYWB 5HDNA 4A4HA 2CUEA 4IXCA 4MTEA 1YN8A 3I35A 4DF8A 3CCQI 1VYUA 4JI6K 3VOVA 1QCFA 1VK0A 2PQ8A 1YQKA 2YS9A 1YS7A 2I10A 2V52B 3L3UA 1R23A 3CCVN 1E3MA 1YUWA 3VEOA 1Q9XA 1NK3P 1Z05A 2KHMA 1K79A 4AYBA 1VQKI 1GOBA 2I0NA 1KHIA 2QKBA 3F2KA 2DTZA 1VQMN 4FK4A 5GAMe 5LGNA 4AG1C 4CFBA 4L5IA 2IC3A 1O75A 1ORKA 1K78B 1YHQQ 1R1VA 1SKWA 1H88C 3RPUA 1VQ9N 3T9NA 3U1DA 1YITI 3MPUB 5CLSA 3RPQA 4JPBW 2STTA 3HGYA 3A5ZB 1EV7A 5J1YA 1XC3A 2NUZA 2DJZA 4EMSA 2A6HF 1VQNA 3O3GA 2E41A 1Q7YU 3TVTA 3HZ6A 3U1KA 2EYYA 2CH4A 3DLGA 4ZC3A 3CC4I 3EGUA 4F17A 2RKHA 3G1OA 3CI5A 2LKXA 5FROA 1KXPA 4MZTA 2PJRB 3IHUA 1S8NA 4BQQA 2AQFA 4PJOC 3OYJA 1C1CA 3LGFA 3KNTA 2FG0A 5E1XA 3EG0A 3L2VA 3C0BA 3AO2A 1MD0A 4IXAA 3KKSA 1M1GA 2NUBA 4UB6C 2QBYA 5ADXH 4M7AF 2GX9A 1RZ4A 3IS9A 2O01E 1OJLA 1KLMA 1B72A 3P5JA 4DU4A 2MK5A 2K86A 3HHHA 4WCGA 3L2UA 4C8QF 4B9MA 4LH4A 4DBFA 4BXXJ 4JI5K 1OFCX 3M07A 1ZAOA 3DEUA 1UHCA 2DLPA 4CESA 2RB6A 4EJVA 3DRSA 3L0QA 2YUNA 2YSRA 5J26A 2R5YA 2EBPA 1KQSA 3DXMA 2Q0UA 2R7QA 3ZMDA 2EFQA 3JSMA 4JP0A 2Q8KA 3SEZA 4UQGA 1YNZA 2P5OA 1T8IA 3MKWB 1YITA 1QZEA 4ZDLA 3TAGA 1L0OC 4J7IA 1NEGA 1W7PA 3WU0A 2QQ8A 3MAQA 3I59B 5CKTA 4W5QA 1ZTRA 1SSFA 4Y15A 1SMYF 4FZXC 3C6TA 1B8IA 2GOXB 1WI9A 4E7ZA 3FDYA 1LFUP 4LD6A 4TVRA 1MNMC 2HBPA 5HCKA 1KC8O 4OFEA 3D7SB