5FRMA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz384 (compound 4a)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
b'DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frmA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frmA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frmA03
4ICLA 5KE3A 2WOMA 3ZSYA 4XIUA 4Y1DA 5CYQA 4DSIA 3FFIA 4FM2A 2R58A 4DLGA 4DTSA 3C94A 2X4XA 1XC9A 3HL8A 5FROA 5KCHA 2RF2A 2JZ2A 4E7IA 3CFOA 5D6YA 1GOCA 2G8KA 4FLZA 3P8DA 2KZZA 1BGXT 4OKJA 3AO4A 3B6PA 4DTXA 3V9SA 3SUQA 3DOKA 1U4BA 2L8DA 5HROA 2ZD1A 3P1GA 3MEGA 3RRHA 1MHNA 3VA0A 4F3OA 1JKHA 4FJNA 1RCHA 5KGWA 2HHWA 3QLHA 2RJCA 2YHBA 5FDLA 4M3RA 5HRPA 1FKPA 2YNHA 4MQ3A 4QW2A 1D5AA 2HB5A 3OMGA 1ZBLA 3Q1JA 4ELVA 1HPZA 3BDPA 1GOAA 1VSFA 4JLHA 3EZ5A 3LWLA 4Q5WA 3KLGA 3RR7A 3KJVA 4DU3A 2HVHA 4W5OA 3NE6A 1TKTA 3T3FA 3PY8A 2HQEA 4KHNA 3O3GA 4OKEA 2JTFA 3JYTA 2WACA 3NNQA 4F2SA 4HHTA 4L59A 4FK2A 1WNSA 2DTUA 2G8VA 4KPYA 3NFAA 3BDLA 4FJKA 3MEVA 4RW4A 4DMNA 4FLTA 4CJVA 1LWEA 4IURA 1EP4A 3HK2A 4CJTA 4E7KA 4B9SA 3AVHA 4FK4A 1S1TA 4W5QA 1NK5A 3VQPA 4J2AA 2Y1IA 1I39A 1MU2A 1OI1A 4BDPA 4R5PA 3HPGA 4CEBA 4C8LA 3V81A 1XHXA 1S6PA 2JLEA 2GV9A 3ITHA 4CGIA 4OGEA 1JLAA 4DU1A 3SPZA 1TK8A 4FZZA 4CJ5A 4EP5A 1A5WA 1QS4A 4PLLA 3MECA 4E7JA 2JGUA 1QSSA 3G0ZA 4CEEA 4B8CA 4BE2A 4FJXA 3L3UA 3KIOA 3TARA 3VQ8A 4ZTFA 1DLOA 1BQNA 2P1JA 4RG8A 4KI6A 1WGSA 2KFZA 4Z4EA 2BDPA 4Z4CA 1ASWA 1Z26A 1RI0A 4CECA 5FRMA 3EAEA 3KLFA 4HCZA 3CQ8A 2RJEA 1GOBA 3AO3A 4Y1CA 1J9AA 2XRIA 4M3YA 4M41A 1ZBHA 3AVMA 4A4EA 1D8YA 3I0SA 1LV5A 4DSJA 5CYMA 2X6SA 2BANA 4N76A 5KH6A 1VSHA 4C5EA 1HJRA 3VQ4A 3PFSA 3LANA 1BISA 1KVCA 2MWPA 4B9TA 3MEEA 3OS0A 2HNYA 3QINA 3V9WA 3L2VA 2X6NA 4O44A 3MXMA 3EY1A 1X9WA 4CF2A 2Z1JA 1JXEA 3TAEA 4B9UA 4JRPA 2LRQA 2RHXA 2FBXA 4CE9A 4C5HA 1U04A 3DM2A 3ZSRA 4Z4FA 3C95A 3OQ5A 3C6TA 1RDDA 3LALA 4CHPA 4F8RA 3O8VA 4I7FA 4LSNA 5JS2A 1QE1A 4CF8A 4OJRA 4W5TA 4DFPA 4RW8A 2FBVA 4IFVA 3NAEA 4DQRA 4LD6A 1RILA 4F2RA 4DTJA 3AO5A 2RKIA 3VQ5A 3V9XA 2IS3A 3ALYA 3LZIA 3SV3A 1UOCA 4FU6A 2XY6A 4Z4HA 1KFDA 3OS2A 3OYNA 3SQ2A 1N6QA 1LAVA 2EQJA 3CFPA 4FLVA 1JLGA 1RT6A 1JLQA 2EHGA 3META 2VYTA 4FJ9A 2DFHA 1OZ2A 3ZSQA 1REVA 2KQ2A 4I9QA 1CXUA 3LP3A 3AO1A 1CXQA 3KK1A 1X1PA 4C8KA 4CJFA 3AA2A 2XY7A 5HRSA 5CY4A 3KKSA 2KZMA 4H4OA 3PX0A 4FW1A 2YNIA 3QIIA 3L2QA 1KLNA 3PX4A 4BDYA 4OPJA 2LDMA 1SL2A 4NYNA 2HHTA 4FJMA 3A2FA 3MAQA 1VSKA 4M42A 2IAJA 5KRSA 1YTUA 1WJSA 1JXBA 1KSPA 1NOYA 5C25A 1NK6A 4RG2A 3HP6A 3HP9A 1D9FA 4RW7A 3LYIA 4KHQA 1RBUA 3OYFA 1CZ9A 3OYJA 2F5KA 3PMIA 3NF6A 3F9KA 5KGXA 4B9NA 3DRSA 4UC4A 3BGRA 2LVMA 4FLXA 4PQUA 3DLEA 4B08A 3RMAA 4E1MA 1VSJA 2B5JA 4CCHA 4IDKA 5C0MA 2R5MA 5J39A 1S9EA 4O0IA 3FLGA 1RDCA 1H3ZA 3LH0A 4CGJA 4DQPA 4CJQA 4DTMA 2P0KA 2YRVA 3NGIA 1N5YA 3AVBA 1WN7A 3SQ4A 3V1OA 3SV4A 5KI6A 2XY8A 3E9GA 2Z1HA 4KREA 4CK1A 5D3GA 3RMBA 3QIOA 4DQSA 4FXDA 1JLEA 3KLEA 4H4MA 4FZXC 4B3OA 2G8WA 2R7YA 1ZBIA 3HXMA 2QKKA 4ELUA 2VG6A 5HLFA 4W5RA 1SKWA 3ZSXA 4QQGA 1WSJA 2M16A 3VA3A 2KW4A 2F8TA 3OJSA 1U49A 3TAFA 1TV6A 2HHXA 4FJJA 4CESA 1VRTA 4DWIA 3UT1A 3QIPA 4GMJB 2IOCA 3TAQA 3ZCMA 5D6WA 3L42A 3ZT2A 4CEZA 3VQEA 2QXFA 3WNEA 1S6QA 3MO8A 3MEWA 1RTDA 4HTUA 1JLCA 3VQDA 2D0AA 4E0DA 4FLWA 3TAPA 2LSNA 1J54A 2M0OA 1KTQA 3SNNA 3VQAA 4HCCA 4CJ4A 1VK0A 3OYCA 4FZYA 4N4IA 3IS9A 1LW2A 1NJXA 5T7BA 4K8XA 4M45A 4DTNA 4O0JA 3OS1A 4DQQA 4CJRA 4IKFA 1C1CA 4DQIA 4PUOA 2ETJA 2E5QA 4CGHA 1C0MA 2ZE2A 2YHAA 1YTAA 3H08A 4G1QA 2PYJA 3RRGA 1TKZA 4E7LA 3MP1A 3NBPA 1UA0A 2OPRA 2W42A 3SUPA 3CFRA 4N4GA 3L8BA 3LLRA 3WNHA 3LP2A 4KFBA 4IG0A 5HRRA 1VSMA 4PA1A 4AHVA 3QERA 2LCCA 1LAWA 3DMJA 3P5JA 3K59A 3QNOA 2K3XA 4F3TA 2R57A 1SKRA 2RHIA 4RW6A 3SZ2A 3I0RA 1YT3A 3C6UA 3PO5A 2XO7A 4B9LA 3OYMA 4DF8A 2IG0A 2E6NA 3S3OA 2EQMA 2QQSA 1KHCA 4CIGA 1RTJA 2P5OA 3KLIA 1S9GA 1NK4A 4GW6A 2EQKA 1BI4A 1XWLA 2EKOA 3OYGA 2RHYA 3LGFA 1WAFA 4Q0BA 4I2PA 2Y1JA 3DLBA 4BWMA 2R5AA 1X9SA 3HYFA 1TAUA 4FLYA 2X74A 4HCBA 2BGGA 1HQEA 3V9UA 4DTRA 4KTWA 4EDUA 4ELTA 2NUBA 4H8KA 4FCYA 1BIUA 3CEYA 5I42A 3AV9A 1OYXA 1JLBA 3HVTA 3OYIA 1G5VA 1WSHA 1Q8IA 1DTQA 4CHYA 1TKXA 1NK8A 3NTHA 1K6YA 2VWKA 4C8MA 1LW0A 1NKEA 3KD1E 3U3GA 1QSLA 1KFSA 3S3MA 2GF7A 2QK9A 3PV8A 3ZSOA 4TSXA 3PMTA 1SL1A 3V1RA 4EZ6A 2GFAA 3QETA 3V1QA 3QO9A 1VSIA 3TWHA 1Q9XA 4FJHA 2B4JA 4OVAA 2D9TA 1UA1A 1XHZA 4N56A 3AA4A 1C1AA 4PL6A 4O5BA 2O4XA 1WSEA 2Q3SA 5I3UA 4OKKA 4KHWA 3NF7A 2RI5A 3SCXA 3DLRA 2HHUA 1T8EA 3OYKA 4CJSA 4IG3A 2YNGA 4ID1A 2QKBA 5J2QA 5J2PA 4DSLA 3EYZA 2D0BA 3OYDA 2G8FA 4CF1A 4Z0UA 1L5UA 3AA5X 2GFUA 3M8RA 3KK3A 3AVJA 1VRUA 1RT2A 4AILC 1ASVA 4JS4A 4B9MA 2HHSA 4NCBA 3D45A 3S3NA 3KKRA 3VQ9A 2AJQA 3RR8A 4NZGA 4Z4IA 1S1WA 1ASUA 4QCLA 2QQRA 3AVNA 3G10A 4CGFA 3D0PA 3LP0A 3DOLA 3ASMA 3U3YA 2X4WA 3VQBA 1FK9A 4CFDA 4KHUA 4Z4GA 4CJKA 3E01A 3PO4A 5HBMA 2NLUA 4CRIA 3NF8A 1TL1A 4FJGA 2KFNA 1QQCA 2O4GA 3LX7A 3HSTB 4LH4A 1IO2A 1N27A 3M8PA 4CFCA 3DLHA 3CYMA 4CERA 1TGOA 3MXJA 1IH7A 1NK0A 1BHLA 4CFBA 4DFKA 1UWBA 3SUOA 2OPPA 1HYZA 3MP6A 4E1NA 3QJ6A 3IRXA 4GVMA 1NJZA 2PYLA 1FKOA 1L3TA 3MEUA 3NGYA 2VG7A 2M1HA 4CJPA 5JS1A 4CEFA 1RT7A 4LD0A 1T05A 1QTMA 3AVGA 4BE1A 4F4KA 2YKMA 3GOXA 1BI4B 4YNQA 1G15A 3SUNA 2HMIA 3UIQA 3AVLA 1F21A 2XK0A 3OB9A 2G8HA 3V4IA 4E3SA 2F96A 4C5GA 3UWNA 4HUEA 4CF9A 3M9QA 3TI0A 4FJIA 3VQ6A 5C6SA 3PX6A 3DB3A 2RHZA 1QSYA 3S9HA 4OGCA 4K8ZA 4OPKA 4LY7A 4DG1A 3HT3A 5J2NA 4OLBA 1RT1A 2DFFA 3ZSZA 3CM5A 3AVCA 5FRNA 3SYZA 2GBZA 2X4YA 4PY5A 3M8QA 3OYLA 3THVA 3SPYA 1A5VA 3LAKA 1VSLA 1TKDA 3ZT1A 3VQ7A 3TANA 4DTOA 2PQWA 1HMVA 4QOZB 1XNIA 1L3UA 4AHRA 1Y97A 3AVFA 1EX4A 1RBRA 2A1SA 4DTUA 1VSDA 3NTIA 4E19A 1KVBA 3O4NA 3OYAA 2Z1GA 4BACA 4AHSA 3OMCA 1W0HA 3QBYA 3MEDA 1S5JA 3OYHA 3LP1A 1NK7A 4FJLA 1KRPA 3K5MA 2D5RA 1S1UA 3SQ0A 4CF0A 5J1EA 2KTQA 3TAGA 4KI4A 4AH9A 1C0UA 2PZSA 1IKYA 3QKJA 4IUUA 2G3RA 4IUTA 1JL2A 1NJYA 1KCFA 2YV0X 3WNGA 2OPQA 2EX3A 2IDOA 3FC3A 1SSFA 3QNNA 4BE0A 1TVRA 3U6FA 3DI6A 1A5XA 3K57A 3QEPA 1FXXA 4CIEA 4CHQA 4M3UA 2DY4A 2EQUA 2RN2A 3PUFA 1NJWA 2OA8A 3SI6A 1SL0A 3RTVA 4DF4A 1Q9YA 4FVMA 4X34A 2RO0A 4IUVA 3VN5A 5SZTA 3QESA 3DRPA 4FW2A 2DAQA 3LGLA 2XY5A 3QEIA 3S6WA 1I3AA 3QEVA 4QVZA 5E41A 2K3YA 3WNFA 4HVJA 4IUPA 4N41A 4PLIA 3H8ZA 3NCIA 1WSIA 4NYFA 3LWMA 1KLMA 3LAMA 2BE2A 4RW9A 1KVAA 3MP8A 2DIGA 1YVUA 1DTTA 3O4QA 2Z1IA 4CEDA 4HUGA 1C6VA 4MFBA 3SJJA 1ZBFA 1BQMA 2G8IA 1XI1A 1C1BA 1ZBUA 1NOZA 1U48A 2VG5A 4NCAA 3VQQA 1NK9A 1HYSA 1S1XA 4KV8A 3ZT0A 3ZEHA 1NKCA 1O1WA 5IN1A 3JSMA 1NKBA 4FL6A 3ZSVA 4CK2A 4JRQA 4LSLA 3F73A 4KTQA 4NS5A 4BD3A 4JS5A 1JL1A 4CIFA 2OPSA 3O3HA 4N47A 3T19A 4IFYA 3K5LA 4DU4A 3AA3A 2HW3A 3TR8A 3RWUA 1RDAA 4I9LA 2X78A 4QQDA 1L3VA 4AHUA 2BUDA 3DRRA 1BL3A 3KTQA 3P83D 1J5OA 1X9MA 4FLUA 4II1A 4E7HA 2YNFA 1IKVA 3LZJA 1RT4A 4CJLA 4CGDA 2OZMA 3NDKA 3K5NA 4CEQA 3ZT3A 3V6DA 1WJRA 4DFMA 2HNZA 4L8RB 2E4LA 4QQ6A 2EFIA 2I5JA 2MWOA 3MXIA 2DIQA 3C4SA 3I8DA 4FK0A 2FHDA 5D6XA 3OYBA 1HRHA 1HNIA 4UQGA 3KD5E 3O3FA 4HUFA 5CZ1A 4E89A 3DYAA 3NHGA 3AO2A 1ITGA 3MEAA 3OJUA 3V9ZA 5HP1A 1BIZA 4LH5A 3E9FA 4YFUA 2E6LA 1R0AA 2BIVA 1U47A 4PWDA 3NH2A 3TAMA 4J2DA 5KE2A 1OZ3A 3ULDA 4DFJA 1B9DA 5DK5A 4B8AB 2FBYA 4J2BA 3K2PA 5KRTA 1TL3A 4O55A 1EKEA 4M3WA 4ID5A 4J2EA 2CKKA 1JLFA 2YKNA 3DLGA 1BCOA 1HQUA 1CZBA 4ZHRA 4M3XA 1EXQA 4KB0A 1TAQA 3LDSA 1D9DA 1RBVA 3L3VA 3K58A 3HVRA 2FC0A 1TK0A 5CZ2A 4FM1A 3IG1A 4M3TA 2PY5A 4CK3A 1ZYQA 2E6MA 3CM6A 5J2MA 1T7PA 1WLJA 4CJ3A 3NGZA 1BCMA 4CJWA 4KHYA 3FEOA 4A4FA 1U45A 1RNHA 4DSEA 3AVIA 4DS4A 1T03A 4CJEA 1VSEA 3OY9A 4WE1A 3ZT4A 4N4HA 2DFEA 2D0CA 4FJ8A 3L2UA 3VQCA 2L89A 1WSFA 3KLHA 3ISNC 4IBNA 4A4GA 1HYVA 2ZQBA 4KKOA 4CGGA 1RDBA 5K14A 3ASKA 1B9FA 4DSKA 5C24A 4CHNA 3OA6A 3KK2A 1B92A 3QEWA 1RT5A 4AHTA 2P5GA 2L3RA 3QEXA 3K5OA 4KRFA 4Z02A 2GUIA 4A4HA 4DSFA 3AVKA 1J53A 3LPUA 1Z25A 2RI3A 3NF9A 4C8NA 2OZSA 2XDPA 3DB4A 3HPOA 4CFAA 3NH1A 3KUFA 2BKDN 2OYQA 1L3SA 4CHOA 3CG7A 2RHUA 3H6ZA 4C5IA 1SV5A 1RTHA 1RTIA 4KO0A 4I2QA 2FBTA 4KHSA 2IC3A 1HNVA 3OYEA 1W9HA 2F8SA 4CEOA 2WONA 2HNDA 4FJ7A 2G8UA 2RI2A 4AHCA 4EZ9A 4KB1A 4CHZA 2ATQA 3F70A 2LTOA 4B9WA 2VWJA 5IAYA 3HM9A 5C42A 3P8HA 4DTPA 4FJ5A 2O4IA 1WAJA 4OLAA 1UAXA 4DS5A 4N5SA 4B9VA 5KCOA 2ITGA 3NH0A 5KTQA 1WSGA 4DLEA 4NCGA 4BWJA 3M8SA 2HVIA 1IG9A 4QAGA 3RMDA 4OVLA 2IGIA 3NTKA 3OVNA 2HQXA 2A1RA 5SWMA 3TABA 1QHTA 1LWCA 4O4GA 2HHVA 5J26A 3T1AA 1WJQA 3ZSWA 5M9OA 3AVAA 4M3ZA 3L2WA 4ZTJA 3FDRA 1LWFA 3SQ1A 1RBTA 3DLMA 1IKWA 4KAZA 3SD4A 2B6AA 5CIUA 1EETA 3DLKA 4C8OA 4W5NA 4BDZA 4EP4A 3HO1A 4IUQA 1TK5A 4CJUA 2XHBA 3HJFA 3B6OA 3IAYA 4B9XA 4GY5A 4KTZA 4CEAA 4FYDA 3LPTA 3PNWC 2RJFA 3HPHA 1C0TA 1RT3A 3RMCA 1SUQA 2P51A 1CLQA 2RJDA 5EU7A 2RPIA 2O4XB 1RBSA 2B8AA 2X35A 3L2RA 5DMRA 1S1VA 5HRNA 3ME9A 2HHQA 1SKSA 1IKXA 4Q5VA 4FM0A
chains in the Genus database with same CATH superfamily
1QHAA 3LMMA 2AXLA 1PP7U 1X75C 4XIUA 1VRLA 2EJ9A 3AT1B 2P84A 2E6ZA 1RR7A 3ZYYX 4FM2A 2WSCE 5B3SH 1RDUA 3C94A 2QM1A 1WHHA 2HI3A 1YFNA 4PHTX 4UNFA 2GNCA 1XC9A 5FROA 5GAMh 3QYHB 4IOAL 4PZJA 5GAOm 3CMET 2JZ2A 4M75C 5M5XJ 4XSZF 4C8QA 4FLZA 3FR0A 5FU6C 5I2MA 4P96A 3AO4A 3B6PA 2DT5A 1LWWA 4DTXA 3LSIA 2YHWA 3UNGC 3SUQA 4GKKK 5HDGA 2OFIA 1S5LC 2M4GA 3PGGA 2FQ4A 4P9FA 1WZ2A 1BK2A 3EHQA 4IFEA 1U4BA 1ZN2A 1NJIO 5HROA 2Q97A 2ZJQF 2E8AA 3P1GA 1X3UA 3FZVA 1A6QA 3DEUA 3VA0A 3TVTA 2A36A 3CW7A 2E2IJ 1RCHA 5KGWA 5LHIA 5BNGA 2CO5A 2UXNA 2XGEA 1M3HA 2QGGA 5D8LB 2QENA 2Y31A 2RJCA 4C0FA 1WUAA 2AA4A 1IG8A 2YHBA 5HRPA 4NXMK 3HGGA 1P9QC 4HVUA 4BEHA 3J81K 2JWKA 4AIHA 4B4CA 2ID6A 3TQNA 2RB6A 1D5AA 2HB5A 2VGMA 4ZYGA 4QT7A 3OMGA 2M7AA 4XQ3A 2B9SA 1EH7A 1LDKB 3BDPA 3BPXA 4M73A 1GOAA 2DA6A 1GCQC 4BGAA 1BBZA 1QQOA 3KLGA 3KJVA 1D1AA 3FXRA 4HQMA 2F9WA 4EJYA 2QDLA 3NE6A 3NFCA 3O08A 1TKTA 1LB2A 3PY8A 1S1NA 2HQEA 4KHNA 1MDUB 4BRNA 4CZEA 3ABUA 4FWLA 1O3TA 5I21A 2W10A 3NNQA 3CJ9A 4HHTA 1VYTA 1NG7A 1R5HA 2LYCA 4UVBA 3HPWA 3H1QA 1E0EA 3ZP5A 2DXCA 3JCMd 1HKCA 1JRIA 4DBHA 4KPYA 3TBIA 3I35A 1Y1VJ 3GTKJ 1VQNT 5A0GA 3AHUA 4AG1C 4GDFA 1LWEA 4IURA 1EP4A 2QQBA 2HNIA 1M1EB 4M7DA 2OANA 1WB9A 1ACIA 2DD5A 4GBQA 3P39A 1V5EA 2KKZA 3AVHA 1S1TA 1WLPB 1FSHA 1YJ9T 3D7SB 3M54A 3S93A 3M8EA 3VQPA 2Y1IA 1FOYA 3U1KA 1I39A 2R7DA 4OB3B 4JX4A 1OI1A 1GV5A 4M78A 1YLFA 2HZTA 5HS8A 4CEBA 4IOCF 1YE9A 3ITHA 3BR1A 1R5GA 3VERA 2HBKA 2DA7A 1HNXK 4GGGA 4FPBA 3K1NA 3ER0A 1P7IA 3D5SC 2FPDA 4AU7A 3KEYA 2LX9A 4AFSC 3O2PE 3HSBA 1GBQA 3LSPA 3DF8A 3K70D 3WQTA 4D1QA 2HBLA 3G0ZA 4CEEA 4G6DA 4BE2A 3A5NC 2Z9OA 3WTXC 3L3UA 3RYPA 4F91B 1QKXA 1VQLI 1UFFA 3MWPA 2BDPA 1NTCA 2E35A 4Y4RA 3G6EN 4IO9L 4GYGA 3CI5A 4RTZA 5FRMA 1XMQK 4UUVA 1O75A 3OH6A 1YQKA 2RJEA 2ZWHA 1HJDA 4IVNA 2KMUA 5JVGF 4BXFA 2XRIA 4M41A 2OZUA 3VOVA 3CUQC 4IWVA 3BROA 2QA4T 4NLBA 4A4EA 3WHBA 2X6SA 4N9IA 5KH6A 2X1CA 2CV0A 3NWTA 3TGNA 1OYWA 4Z2YA 2P9PA 3CC2N 3N4MA 3IUCA 1J5YA 3AL0C 1D09B 1KVCA 3JXUA 5BPIA 3PT9A 4B9TA 1ENHA 1SKUB 1D3BB 3I3LA 1FIAA 3KZIC 4BL0B 1YX3A 4O44A 3FB9A 2M7BA 4BRIA 3EY1A 4BREA 1X9WA 1KC8R 3JW4A 3NMUA 4JKGB 1JXEA 3EUHA 2EJRA 2ZXIA 4B9UA 3JRIA 2P7CB 1N36K 3H0IA 2RHXA 3GF2A 4D7NA 1XSXA 1F1BB 4Y28E 5JVHL 1Q7YR 3ZSRA 1T44A 4Z4FA 5DV5A 2IS4A 1RDDA 4RAZA 3ENOA 3O8VA 2OQGA 1QVGS 1H0MA 1IBMK 3GTGJ 4CF8A 2O5RA 3CPEA 4DFPA 3MD2A 5EG0B 1LPQA 2FU4A 2HQ5A 3MMVA 2DBKA 5DM7L 4M78E 4LD6A 3MZ8A 1RILA 4F2RA 4FWQA 3IH3A 1YVNA 2IS3A 4FWOA 1IV8A 4GNIA 1QZZA 1MJBA 1UOCA 1A0NB 4FU6A 3L6QA 1BUPA 3CCQT 2NRHA 3VGMA 2HFHA 2XY6A 4EV0A 1KFDA 1IRGA 1OEBA 3OS2A 1MDMB 1RUOA 4IO8A 3OYNA 2R5YA 2EQJA 1XC3A 5DM7R 4ZZLA 1UELB 4FLVA 2XASA 1SS6A 3META 4MQ9F 2NVYJ 2VYTA 3CXCA 3Q9VA 1Q95G 3GX4X 4I9QA 1FC3A 4F92B 4YOWA 1KFZA 3LP3A 3K0SA 2R7TA 3VYGA 1RC9A 5I9EB 1BO5O 4HTLA 4WFAL 4C8KA 3CC7A 4U7DA 4CJFA 4BQNA 4IQJA 4ELZC 1PWTA 2XY7A 3CPWS 5HRSA 5CY4A 3AAPA 3KKSA 2E7WA 1T0FC 5F6FA 1NPPA 3JCMJ 4XIDA 4LG3A 1QRYA 4XM3A 3CJQB 3F8MA 2QWPA 1GLAG 4OPJA 3LA3A 1SL2A 4NYNA 3BP8A 4JKHA 5GAHP 2FQ3A 4XU3A 1VSKA 1YCYA 3G4ST 4JI7K 3SDZA 2G9WA 1K4SA 2HKQB 3FHZA 2OZ6A 4EFHA 1GHCA 5C25A 1NK6A 3QYBA 3WTSC 3HP6A 1FBQA 3ZETA 5AQLA 1W36C 1K4TA 5BN8A 3LYIA 4KHQA 4QWQA 1RBUA 3OYFA 3DXKB 4C3HJ 1OYIA 1HLUA 5KGXA 1X4OA 1M2VB 2GQQA 3RR6A 4XOTA 4OU0A 1HKBA 3O1WA 2EIFA 3BGRA 1OH7A 3CCRI 3A5MC 1IN6A 2GEMA 2V9VA 2L3SA 1TXQA 2PNIA 1JBMA 1H8KA 4E1MA 1VSJA 1ARKA 2K2VA 4CCHA 1NG9A 1IBLK 3V8JA 2EGEA 4HSRA 2JXBA 4IDKA 4CICA 2DD4A 3BQZA 5C0MA 3ABLH 4O0IA 4P5OA 3FLGA 1RDCA 5EEAA 5BR9A 5CLSA 5DTDA 3HHHA 2A69F 3NGIA 1AD5A 1UGVA 4A3MJ 2OTJT 1WN7A 3HZ6A 5AIQA 1QWEA 3LFUA 3Q5FA 1YX5A 2JTEA 3V8LA 1XQPA 5D3GA 3QIOA 4FXDA 2A42A 2QQ8A 1K83J 3S14J 1JLEA 2VV5A 2DXTA 4BS9A 4FZXC 4B3OA 2XAHA 3CESA 4C3JJ 2R7YA 1Q82O 2IA2A 2YUPA 4X62K 1VQOI 2P0PA 2YU9J 3TOBA 1X2KA 3GP8A 4W5RA 3FZMA 2VB6A 3BT9A 5FPDA 2F8TA 1TWAJ 2CH5A 5AQOA 1SD4A 4EMSA 3TW6A 1TV6A 4XRFA 2HHXA 4NDLA 2PJRA 3CJNA 1B8IB 1SRMA 2AZVA 4GMJB 2IOCA 3ZQLA 4XH4A 4M77C 1TW2A 1OYYA 3I55N 1YFHA 2QTDA 3ZT2A 4A54A 1VQ8T 2QXFA 1U8BA 3W6JB 3JCMV 3VS5A 3MO8A 1H92A 5BPLA 1U3OA 2WWYA 1FWZA 5AFUH 2RD1A 4HTUA 4M78D 1G99A 5GPCA 3RKXA 2KVQG 5E3NA 1LFUP 3SWNC 3VQDA 4KH1B 2DYBA 1KTQA 4CCOA 4S04A 1RL2A 2GX9A 3HXLA 1W70A 1VQLN 4BC4A 4HCCA 2HOSA 5CKDA 3A0IX 4MDAA 1YJNN 4LJZF 3OYCA 4FZYA 1WXTA 2JM8A 1PUFB 3IS9A 1Y1WJ 3VTHA 4M78F 2P6TA 3QWLA 2KHOA 4HX4A 5GMKj 3F8CA 4CDGA 3BY7A 4O0JA 1CF7B 4XLHA 1X3MA 4DQQA 1Z7UA 2YHXA 2Y69H 2CQQA 4BR7A 1TYQA 4B3XA 2WAEA 1R9TJ 4LD5A 4JI2K 2E5QA 3L4IA 1YTAA 4D5CA 1UJ8A 1EWRA 3FM5A 1SVOA 2W42A 3SUPA 4KISA 1K8KB 4HWIA 5GANd 4N4GA 4F7ZA 1BR4A 2CH6A 2L4MA 2GM4A 4UUTA 1Q86U 4XMYA 3LP2A 3MEXA 4JZ3A 1TWHJ 1M1KU 4FE7A 4ZYDA 4B1WB 4PA1A 1GT0C 4A2BA 4CYCB 3QERA 3SBGA 1NGJA 1LAWA 4BRKA 4MTDA 2XSDC 1IBKK 2R57A 2K02A 4BRQA 1K73C 4DR5K 3GW2A 4ZDLA 2E6NA 3S3OA 4CI0C 5EGOA 3HRGA 2QQSA 4CIGA 1RTJA 3JTGA 2P5OA 3M58A 1YIJI 1S9GA 1WIEA 3HM5A 1FN7A 2VWBA 2YWWA 2KRFA 2RHYA 1M2OA 1WAFA 3RSNA 4Q0BA 5J3BA 3J7ZO 3TP3A 2HOAA 2CZ1B 1VQMN 3HOYJ 5D4RA 3P9CA 3DKMA 4YDUA 2B86A 2X74A 2Y9YA 1UE9A 3VS0A 2JJ7A 4RS8A 1KJWA 1IDYA 3V9UA 1XGOA 2DETA 2YX6A 2XDBA 3FGUA 2TCTA 3BCBA 3DFGA 2K40A 4I6ZA 2HXOA 4H8KA 1RAHB 2VXDA 2RMOA 4FCYA 3MN7A 2YUQA 2BGCA 1JLBA 3W2VA 4M7YA 1WSHA 1Q8IA 1T0HA 3CD6A 3F8BA 1TKXA 3HTSB 2DL3A 1NK8A 3GBQA 4EIAA 3LWIA 3HEFA 2CS3A 1R0BG 3SAGA 3RCOA 4RCHA 2JT1A 1SL1A 5FW9A 4C0GA 4CO8A 5D4SA 2KP6A 4AUXA 3QHSA 3CPWM 1Q9XA 2E2NA 4HDUA 1P4WA 1ZA2B 2D9TA 1ULYA 4UY8O 2KRHA 5BOXA 2RF0A 4E9EA 3AGKA 4RB1A 3CMAA 3P4IA 4N56A 2GIZA 3R2XC 3CCYA 1J09A 3J80K 1N5ZA 2CGHA 2L9SA 1DU6A 2KXDA 4FWSA 2F4IA 4WTOB 1FOKA 4DV1K 3GFMA 2Q3SA 2BBYA 1DQUA 5ERIA 4KHWA 3NF7A 2RI5A 2F7TA 1YHQI 1XS9A 2MA3A 2FXAA 1ZSZA 3BTJA 4IG3A 2E34A 3SZGA 4DSLA 4IIMA 4LLLA 4JN4A 3OWTA 2BYVE 4DZPA 3EE9A 1POGA 2LSOA 3QICA 4IRHA 1M9SA 3CDLA 4PJLA 1IW7F 3H6EA 2O0YA 3G3ZA 2YCHA 3GF5A 1OCOH 2CW8A 2JHJA 4NL2A 2J6FA 5HODA 4Z6YA 2AJQA 1ZX6A 5GAMe 5DCMA 3CC7Q 1BA0A 2PX9A 4Z4IA 3CCVA 4BEHB 2CSIA 2GA2A 3G10A 4KBOA 4CGFA 3D0PA 2P9IA 5KYYA 2X4WA 3VQBA 1FK9A 2OTLN 4CFDA 3S1NJ 2CU7A 3SBTA 2Z3YA 1ZLMA 2HQAA 2F5DA 4LFUA 2FRYA 1YN8A 2EPFA 2JZYA 3GIBA 4CRIA 3L7WA 2MC3A 1PKSA 2XF7A 3PNYA 1VQ9Q 1VQPI 3M8PA 1IC8A 4CFCA 4LIUA 2E5KA 4PJOG 3SDGA 4CFBA 3SFMA 3SUOA 1YITI 2OPPA 2D0NA 4MLHA 1EV7A 3QJ6A 1VQON 5FLXK 4GVMA 5J6XA 2NUPB 5L3GA 1IGUA 2HBJA 1P7MA 1NJZA 3SAHA 1IN4A 2PYLA 1QZYA 4LG0A 1L3TA 2BHZA 5LJ3h 2R7FA 3VYTB 3A8YA 2VG7A 2H09A 2EFQA 2M1HA 2V26A 3F8FA 3QPLA 2EINH 1XQSC 2MI6A 1S3JA 5CVJA 4LD0A 1T05A 1QTMA 2K86A 1KXPA 5FD5A 3CCEI 3KYLA 1JGSA 1RETA 4HG2A 3CBOA 4YFXF 1K8AO 3KYCB 4E9FA 1BI4B 2GBYA 4MDBA 1ZKGA 3SUNA 2A41A 3OTOK 3UIQA 1HNWK 1MW7A 1YJWN 4M78B 3MN5A 1FJGK 2IEKA 3V4IA 4C5GA 4HUEA 2ZXHA 2JK3A 2L9RA 3HRMA 4IHTA 2KSSA 3E9PA 2YSQA 3VQ6A 1AHDP 5C6SA 3PX6A 4CYDA 2F69A 4II2A 3CXCM 3KLNA 4OGCA 4K8ZA 4LY7A 2DK8A 1JXMA 2NRVA 3CLOA 4L5GA 5J2NA 4OLBA 4X1VA 5FRNA 4H5WA 3BR0A 4OMMA 1KQ0A 1R58A 4PFZA 4FSVA 1VQ4T 3OYLA 1MWMA 3CMEA 4J6WA 3SPYA 1WI7A 3EE8A 1A5VA 2KNBB 5E3LA 2WADA 3QU6A 1VSLA 2LC4A 2VOPA 4RTVA 3ZT1A 1NYGA 4BY6C 4DTOA 4MEYF 1UHWA 5D5XB 1HMVA 4WFNL 2B0LA 3FMQA 1Y57A 4OMFB 1CKBA 4FHTA 1N78A 1DT9A 3AVFA 1EX4A 3D5RC 3S1QJ 4IRGA 1YWPA 3ULRB 2A1SA 4DTUA 4E19A 3QZ9B 1ORKA 3LWFA 1KQSS 3LM2A 1Z7LA 5ILSA 3K4BA 2CH4A 3DLLA 3JRDA 1F1ZA 2FNPA 1KRPA 3K5MA 1K9MR 2D5RA 3D2FB 2M9UA 3ZQGA 4CSWA 5AQXA 1W4MA 2L7FP 1KD1U 3SAFA 1YO5C 2CGPA 4KI4A 4X9CA 4WCIA 3UPUA 2XVCA 2FO0A 1P2FA 2O01E 1J3TA 4IDHA 3PFIA 3VYUB 2DM1A 3JCUC 2DEQA 2OBPA 1V54H 2YV0X 4LOCA 3BCAA 1QVGP 3QNNA 4BE0A 1AU7A 3ISPA 1A5XA 2W25A 4CIEA 1X6BA 4OPAA 2JPBA 3QDFA 4M3UA 2YDLA 2EQUA 3FFKB 2RN2A 3THYA 4JI3K 4EM2A 3PUFA 5EEGA 2H1KA 3EFOA 4DF4A 1Q9YA 4FVMA 2W85A 2RO0A 4X34A 1VQNA 3VN5A 4A2UA 4M3GA 3DRPA 5K1YA 2L2OA 2LQ8A 1JUSA 4DYCA 4U0WA 1ABOA 4DA4A 4MZTA 4QVZA 4OAZA 4I99C 2K3YA 2C0OA 2JWTA 2O8EA 4IUPA 2UXDK 4JLGA 1YJ9A 3HTVA 5CAIA 3G71A 3LWMA 1S8NA 3T8RA 3LAMA 2QKMB 5HLGA 1EIFA 1KVAA 3MP8A 1ZGAA 3L4QA 3QBXA 4D8KA 2QVOA 4MNUA 4WQ4A 3K9TA 3SJJA 2XIDA 4KFCA 4ZGDB 2G8IA 4R8HA 1WJBA 1YQRA 4HSTA 2O8DB 4IEEA 4HT8A 4DCHA 3JCMX 1QVPA 2VG5A 1SG5A 3A4CA 2P9KA 1HYSA 3ABKH 2PMUA 4HDVA 1NKCA 4OIOF 2HR3A 2JUCA 4R1HA 3W2WA 1BOTO 2XIGA 3ZMZA 4L6V5 3ZLJA 1Y0NA 1ERDA 4G9ZA 4JRQA 4LSLA 2HF3A 5HK3A 2HVRA 1KG5A 3CC4A 3TDUC 1BW5A 4J8OA 4CIFA 3EG0A 5C4JJ 4ZYEA 4BUPA 1JI8A 1RACB 2L3DA 3K5LA 2OU2A 1CQTA 1IRZA 1UGQB 3AA3A 3E1YA 5KCMA 1U2VB 3THXB 1UFMA 1VUBA 4B22A 5K7HA 1TH7A 4QQDA 2ZXWH 1IXDA 2WC9A 2A07F 2BUDA 3DRRA 2O8FA 5ADXH 1SAXA 1TNTA 2QA4A 1J5OA 1O9SA 2VL8A 1X27A 4FLUA 5DLQE 3MHXA 3TL4X 3R0JA 2M30A 1ON1A 4XORA 3NDKA 2JW4A 1NPRA 3INZA 3V6DA 2A5WA 3RZOJ 2LF8A 2EJGA 3VFZA 2WTUA 2JQ7A 3CMAQ 1DPRA 3DWLE 1AWWA 4PIIA 2AQEA 3OYBA 2RDPA 3U4LA 2V1UA 1SFEA 3CCMQ 3MX2A 1VQPN 1NGBA 3DYAA 3AO2A 2GQVA 3L2CA 3MEAA 3LDOA 5JICA 2BE9B 2Y0SN 2RQWA 2WSEE 3LDNA 3GCMA 2LT1A 4MLOA 4YFUA 4BHBA 3EKUA 2E6LA 5FKMA 1YITN 4HEA2 3RI4A 4JKCA 3HSEA 2BIVA 3IKTA 1PRMC 1I3QJ 4Z88A 3OOPA 3FRNA 2PMZN 2ZJRL 3ULDA 2CV2A 3N05A 3I0WA 2MC4A 3B6CA 1PSFA 1I1SA 1TL3A 3S2WA 3SJMA 2F5TX 1RKWA 3TSQA 4M3WA 1P92A 3J81E 4EJWA 2K79A 4JLIA 3SDBA 4HF2A 1MWKA 1GL5A 1X4PA 3CCQA 3B02A 1J2XA 3A8HB 1TAQA 3VEWA 2ZCWA 1WHJA 2PJRB 2VC0A 1D9DA 2P5VA 3L3VA 2H3EB 3VYRB 2FMYA 1FPQA 4FOEA 1KC8O 4OMZA 2Q31A 3IG1A 1IO6A 5I11A 1JCEA 3CM6A 4PJOA 2WB1A 3MKZA 1T7PA 3L0QA 1F36A 3SZTA 3NGZA 3K4KA 3QWXX 4CJWA 1U5SA 3CCUT 4KHYA 4AIJA 2CW0F 1Q7YO 4EW4A 4BC3A 3AVIA 1LUJB 4CJEA 3IDHA 2XB5A 2F2XA 2O8XA 4M4ZA 3RKQA 5L3EA 3IV5A 2BEOA 4FJ8A 4H0PA 4B43A 1S72Q 2JRMA 3OW2A 4CI6A 1WSFA 2A6AA 4EMGA 5FO5A 3KLHA 3I0XA 2Z2SB 4JI5K 2H27A 4AI4A 1HYVA 2DTRA 2DT7B 4MGRA 5E1XA 1JHHA 4NBQA 1H1VA 4C92G 4ZDOA 3G4SA 5LL6S 2X4JA 3CJBA 3AAQA 1ETQA 1RRQA 3B73A 4AHTA 2CGJA 3ASNH 3KP4A 3J8AA 3I5UA 4XLAA 2GUIA 3BOQA 5DEQA 4N0AC 3LPUA 3JSOA 2KJBA 2VE9A 4MHGA 4C8NA 1PSEA 3LSRA 4CFAA 1VQ6T 4XK8E 4DIQA 2K9SA 2ZJQL 1OKJA 2BKDN 2X3XD 1ETKA 1SFXA 4CHOA 2RHUA 2DBMA 3H6ZA 2CDTA 4NB5A 3BJ6A 4M75E 2JM9A 1D5VA 1RTIA 4KHSA 5GANe 4JKBA 3VDXA 4BRGA 2D0QB 2VOOA 1W9HA 1M3QA 1GLNA 2WONA 3ULEA 3Q0WA 2OI3A 2GTDA 4NQWA 2DA2A 3Q0UA 3JCMW 4C8QC 4CHZA 2JRTA 2DJZA 1YI2I 3ZN1A 1M27C 3HOTA 4F7UE 3P8HA 2OPTA 2G7UA 4MDXA 3QYFA 1FYKA 4OLAA 2O4IA 2P0QA 4DUYK 3CC7I 2OTJA 4DLEA 4BRFA 3M8SA 1XGNA 2IS1A 5C10A 4QAGA 5EZGA 5AFUA 4C2TA 3O6BB 1Y0UA 5EEHA 1GXPA 1NGAA 3ZR8X 3WU2C 2HQRA 1U78A 1LWCA 2HHVA 1QPIA 5J26A 2NVTJ 1WJQA 2YJEA 4I09A 2M8GX 3EGDB 2M34A 1OJLA 3UKRA 4M3ZA 1RZ4A 2I0NA 2FXUA 3CCSI 4L18B 4RB2C 4X1EA 2E64A 1LWFA 1U84A 3SQ1A 5A2QZ 4JD2A 1S22A 1GLJO 5BN9A 2V79A 1GXIE 1D8KA 1CSKA 2DYSH 2B6AA 1EETA 3C12A 2MGQA 5B66C 4C8OA 1VQ8A 3K9JA 3HO1A 4IUQA 4UNOA 1NZ9A 3E6MA 3G2BA 1OPKA 1ABQA 3ZMDA 1HLVA 4CJUA 2XROA 1NGDA 1LMZA 4BB7A 3EH2A 2A6HF 1JCFA 3CCET 3JAMK 4BGBA 4KTZA 1HKGA 1TQPA 3FK6A 5C44J 3HPHA 3RMCA 3MKLA 1LE8B 1VQNQ 1SUQA 2IGOA 3OR2C 4KGVB 2DJNA 1IG7A 3SMSA 3H5AA 3VRZA 3ZEUB 4M9ZA 1R36A 5AT1B 3LAJA 3HM8A 4M7DC 1MUYA 2X35A 1WNLA 1S1VA 4Y17A 5HRNA 2HPIA 3GZ5A 4HNVA 2YXYA 3ME9A 3WXLA 1WI9A 2LLKA 3EUKL 2NLXA 4ICLA 3GTQJ 2WOMA 2L7ZA 4Y1DA 5LLQA 3J7YJ 3GNFB 5CYQA 3FFIA 1TWCJ 2KT1A 3CCLA 2M9HA 1LNWA 4CD1A 2FRWA 3JB9G 4AFUC 4JYKA 3HL8A 1QKWA 3R3LA 2QDYB 3HOVJ 4E7IA 3CFOA 4B47A 4XH1A 1JJ8C 4OKJA 1QP3A 3H9GA 4B3MK 2I8DA 1W1FA 4A5MA 2GUPA 2GXAA 4XN3A 3GFLA 3HYIA 2L8DA 3HKSA 4HOBA 2ZCFB 3PFYA 5ICEA 1BI1A 2YX4A 3OA9A 1H89C 1M1GA 3MEGA 1ETWA 2VJIA 2QI2A 2HEQA 2DPUA 4LD9K 3F5TA 2KHMA 2HHWA 1QZ6A 2FA5A 2QLZA 5F27A 5KPTA 2OV7A 3QOEA 3VGKA 2TRTA 3UA6A 3JRCA 3M0TA 1R77A 4M75D 2ECBA 1AWCA 5EX5A 1MMSA 4QW2A 3S2HJ 2CQKA 4LF9K 2QA4Q 3VSLA 1OU8A 3G1OA 2R7UA 1AWOA 1B9NA 3BY6A 3R8EA 1VSFA 4JLHA 3EZ5A 3RR7A 1BA5A 4FWMA 2EZHA 2RAEA 4L0ZB 4CVNE 4DU3A 2ECZA 2DVJA 2ICWG 1PVSA 2BXYA 2YHYA 4RAFA 4M75F 3T3FA 1EJ9A 2QW9A 3O3GA 3H3UA 3QRFF 4OKEA 2FSNA 3EUHC 4F2SA 3L09A 1VQKQ 4L59A 1OMIA 2EFWA 4YPRA 1Y56A 3R6OA 3UKUB 2L7MP 2VKHA 2L5QA 2GQIA 2G8VA 1MIJA 4F7UF 4J01A 3A2KA 3IH4A 1NH3A 3RIRA 3FKIJ 4FLTA 4YELA 4C0ZA 2NNWA 4CJTA 5H1SQ 3F21A 1GFCA 3MN6A 3O8HA 1Q81C 4E6KG 1DKGD 2DZCA 3ULQB 2HDAA 1D3YA 4JQFA 1SFOJ 3D2EA 1JXSA 4FK4A 1SANA 3PIPA 2RN7A 1MSFC 1MBFA 2LG4A 3ZMSA 5FLMJ 4WCEL 4U0YA 3CCQQ 2K5LA 1KQJA 5AQYA 1RAGB 4OGEA 2IXSA 5IYDJ 3MQ0A 4LDWA 1MPGA 3M4OJ 1JLAA 4CZIA 1Z9ZA 4AVPA 4DU1A 5FPNA 1HKQA 2D8JA 5AQNA 4CJ5A 4EP5A 3DLLL 1BC7C 2QWQA 5FD6A 3B6AA 3R9PA 3MECA 1SFUA 1QSSA 4B8CA 3DLAA 4FJXA 3R6MA 2KQWA 3TARA 5M3MJ 4ZTFA 4PL7A 3E9OA 3FX3A 3RKWA 2ETHA 5K5RA 3I33A 4BG9A 3VGLA 3I71A 4Z4EA 3RESA 3NHNA 1K73U 1Z26A 1NLOC 3CD6I 1RI0A 3SWNA 1XC5A 5EG2A 4CZCA 4HCZA 2NOLA 5D6EA 1GOBA 1ZLKA 5L8RE 1MH4A 2VJJA 4RUGA 1MGTA 5A2QO 1J9AA 3F0CA 2BW3A 3ZGKA 5DCFA 4XKVA 2CYYA 4XR6A 2VQGA 4C92A 3CC7N 2DO3A 4FT8A 2ENMA 4RB0A 1GDTA 1Z6TA 2M0MA 2DK5A 2L3PA 2W6KA 3M6GA 3G4SQ 5IT9Z 5M1PA 3I55T 1OH8A 3BFMA 1T39A 1KGSA 1PU7A 1M90C 2DTZA 4MTEA 5IP6A 3CMAI 1G8XA 5CVUA 5A0LA 3VQ4A 6AT1B 1BISA 1NWKA 2J4RA 1YW9A 3HSCA 4UB8C 3DPLC 3OS0A 1IUYA 2RE2A 4J9IA 3V9WA 2XAUA 3MXMA 3RERA 1VQ9N 4YFKF 3BG6A 3QPHA 3KTUA 4CF2A 2Z1JA 4FO0A 2X1DA 3KXTA 1W6XA 4YG2F 4QIWN 1LVKA 4I6MA 3TAEA 4OF1A 5L3DA 3PIOA 3VEZA 1TC3C 2CT4A 2LRQA 4XOPA 4JJDA 4FVUA 4FWNA 2RQQA 5HVQC 1FYLA 4JHDB 4EJVA 1I07A 1AWJA 3EG3A 3LALA 1WOQA 4F8RA 1C6VX 2HYJA 3O9TA 3GWZA 1O13A 4DEYA 3A0BC 4EPCA 2W82A 1QE1A 3Q7CA 1PUEE 2FRHA 4W5TA 4DOVA 4M7AG 1YUWA 3E0JB 5AQJA 2FBVA 2OTJQ 4IFVA 3NAEA 4A12A 4CA0A 3CCVI 4EATA 2MK5A 3GTOJ 4K41A 4B3RK 1ZHIA 3OS5A 5IT9K 5HCKA 3WTYC 1WDXA 3V9XA 3KVGA 2AHJB 3LZIA 4HYEA 3SV3A 2P9KB 4BH9A 4Z4HA 1IRFA 5GP9A 3CCJT 3KP6A 3S2DJ 3QP5A 1LAVA 4OIPF 4LLNA 2DJQA 3NWSA 4CH7A 2EWSA 1FOWA 3ZCOA 4MZMA 4MDWA 1VQ4A 1FMVA 4I7HA 1YQLA 4YPHA 4M77E 2LNHB 5IYBJ 1EBMA 1OVYA 1ZH5A 2COBA 4LK0F 1SVLA 2RM4A 3WTWC 2NNYA 1YRNB 3COAC 3ZSQA 3MKDA 1REVA 2P9SA 3OW2M 2X1EA 1CXUA 4XLEA 2BY0A 1N3CA 1WHLA 2PMHA 4CBXA 3RMSA 2X6YA 3EGXA 2PVGB 2KRNA 3AA2A 3HBTA 4YHHK 1VQ8Q 2AXTC 2KZMA 5HK0A 4QPQA 2KE9A 1VQMT 1WGXA 1NG6A 1V3FA 4H4OA 3T1BA 3L1AA 5CCAA 4DV5K 3P9KA 1JQQA 4WX9A 3CO6C 2O9LA 3RUXA 4BDYA 2XICA 2Z5UA 1AVZC 1Z6RA 3FZHA 3O8MA 3H3ZA 4F52A 1JGGA 2HHTA 4FJMA 3A2FA 3O9UA 2VKEA 5KRSA 5AZJA 3J80E 1WJSA 2FJ1A 3OSVA 2F48A 2ZJPF 3ZL7C 2EKHA 4MQVA 4RW7A 4PK4A 3BG7A 4LFCK 5DYMA 4CC4B 1P8ZA 3PNVA 1M4ZA 3S8PA 2RKHA 5GAN6 2CZ0B 5A0DA 1CZ9A 2F5KA 4I98B 2ID3A 2EWNA 1WEIA 4M75B 4MLEA 1DIZA 3HUGA 4H5TA 4B9NA 5JLFA 5FU6B 4IL6C 3BTIA 3DRSA 4UC4A 2XDVA 1N77A 1E7OA 2P9NA 3I0TA 4FLXA 3LQRA 3QOPA 1XGMA 5C15A 4B08A 4A3JJ 1YI2T 3CMEI 1B1BA 4F7UB 4C3IJ 1FMWA 5J39A 1FY7A 4XAXB 4LFAK 1W36D 4LF8K 3GTJJ 2D0PA 1OISA 2YG9A 4CGJA 2ED0A 1AKHB 4DQPA 5IHKA 2EYQA 1QCNA 1K9MO 4XKBA 2E2OA 2WA0A 5HNFA 5CQGA 2DA1A 5GAMj 2P5KA 3I4NJ 5KI6A 5AQTA 2NUTB 3E9GA 4CK1A 4EA4A 2VCPA 1RUWA 2FSJA 3GTPJ 2MPXC 3RMBA 2RVCA 3CLQA 1FSEA 1LVAA 3GVAA 2ZXJA 3TO6A 3CBMA 3KLEA 4KGZB 4J8FA 2QXLA 3C2HA 2LT4A 1JKPC 2QKKA 1SKWA 3CCST 2Q8KA 4BROA 2VBXA 4QQGA 5ADXA 5KYUA 1N9RA 4YDUC 3OR1C 4JYAK 4AM6A 4K43A 1SD6A 5FLXE 3G7ZA 4BQOA 4DBRA 1E3OC 3OH9A 1W2BP 4IQ4A 1Y39A 2O9SA 3QIPA 3N5NX 1PDNC 5BMZA 5F1XA 3TAQA 1M8VA 1OFCX 1PKTA 1HKSA 4CEZA 1K76A 4FTHA 4Z94A 3HOXJ 4FX0A 4U87A 3MEWA 4IHXA 1MSEC 2VT2A 1JLCA 3F6VA 3F6OA 2D1VA 2HSEB 4E0DA 3G1JA 4PGHA 1QVTA 4PJNA 5JVTA 4FLWA 4XSXF 1JTXA 1SAZA 2LSNA 4DW6A 1BA1A 3VQAA 2MD0A 4BRMA 1QU3A 2Y0MA 4F55A 4A5BA 1VQNI 5KYWA 3CQXA 2J7IA 2DKGA 4U67L 3E5QA 2EFPA 2YX7A 1NJXA 4I02A 3RJPA 2R7XA 4M77D 2ZPHB 1GUUA 4LN2A 5EF6A 3TTCA 2YU3A 4C0DC 1DJ7B 3MPUB 4V2FA 4B6MA 2GWJA 1YJ9I 1W2BA 2KKOA 3G71I 4I0BA 2D4WA 4VUBA 3EQLF 4PUOA 4MEXF 3VF6A 2DE0X 2Y48A 1FYMA 1GLDG 4A59A 4E7LA 2E1OA 1J6ZA 4BVPA 1X2QA 1UA0A 2FG0A 1ESVA 3PUBA 3CFRA 1ZSZC 1R0CB 3K0LA 4M77F 4DBFA 4LLGF 2B7EA 4IG0A 3CMAN 1WYXA 4Y15A 1YJWT 3BG5A 4XU1A 2EW3A 4A53A 3VJPA 4AHVA 2LCCA 4JK7A 5DLOA 4DJAA 2VIXA 2CZ7B 3CCMN 3K59A 3QNOA 1UGPB 2K3XA 4F3TA 2VE8A 1NM7A 2RHIA 4RW6A 1YT3A 3CC4I 3C6UA 4KNYA 2XO7A 4DF8A 3KP3A 1SZ2A 5HLTA 2R7ZJ 2Y4XA 3H5NA 2K7AA 1UHMA 2ZMEA 3CUQB 3M8JA 3GTLJ 2W48A 3W0LA 1LCUA 2X85A 3BE3A 3REAB 2EQKA 1ATSA 3AARA 1FYNA 1HYOA 2EKOA 2XGDA 3G25A 3A01B 4I2PA 3AL0B 1N39A 4JD2B 4BWMA 1J75A 2K9LA 3HYFA 4XU2A 2XHKA 1TAUA 4GVEA 2W00A 2VASA 4KIFA 2E12A 5F2RA 1HKTA 1NJIC 4HCBA 2CGLA 4PL8A 4DTRA 2OJED 3I59A 3MKWB 2WY8Q 2CZ6B 3ZRGA 2NUBA 2K6DA 2NVUB 2PTKA 2KEAA 3CCUA 3BWGA 3DBHB 5CVIA 3BTLA 5I42A 3T5XA 3AV9A 1BWFO 2GCXA 3KETA 1ZA1B 4GRIA 1JHFA 1RESA 2G7HA 1PD0A 1TS9A 4DHYA 2AT1B 3NTHA 2VWKA 2MCNA 2W24A 4KBMB 3Q3SA 2R92J 1NKEA 1WQWA 1KFSA 5GAN3 2GF7A 1I6HJ 1YNZA 2COWA 2QK9A 3ZSOA 4HV6A 4TSXA 1FBSA 5IOZA 3WXMB 3BZCA 3QPSA 3PMTA 3V1RA 1E3HA 2GFAA 3QETA 3V1QA 1XSDA 4GV6A 4HRIA 2JOYA 4WFBL 4D9JA 2IIMA 1VSIA 5C3EJ 3C1DA 3JRHA 4I2OA 4EJTA 1NHAA 3PNTA 2XGCA 3TWHA 2FF6A 1S72N 4IOAF 4JJCA 3U2RA 3M0PA 1WEFA 4OVAA 2DK3A 2L0AA 4KT5C 1UGRB 3UR3C 1UA1A 4LUDA 3MN9A 3G1LA 1XHZA 3QFPA 4DEXA 2JPCA 5JLWA 1VQ6A 3J7AY 4UVCA 3GZ6A 1MV3A 2O4XA 1WSEA 3IP4B 2V6EA 3OHRA 3CCQI 3F8NA 3M4YA 1KG6A 1YG2A 4C2UA 4HX7A 3FMRA 2EYZA 3OYKA 5M1QA 2IVOA 2W0ZA 4X6AJ 4HBLA 3C2BA 1NBWA 4NUBA 2KRSA 5J2PA 3X28B 1ZBSA 5CR2A 3EYZA 2VONA 4CGZA 1B34B 2WV0A 1LPLA 3AA5X 2NWMA 2EV5A 2E19A 1VRUA 3JSPA 1RI7A 2MOXA 4HF0A 2EVRA 2XDDA 2HOTA 3S3NA 3FLCO 3RR8A 3JCMP 5DPKA 2JA7J 1ASUA 2W1OA 2QQRA 3LSJA 2O7OA 2Z33A 3U3YA 1OV3A 1AHJB 3KHYA 3EYYA 1R1VA 3IMXA 4EMKA 1R6RA 3MZYA 3P31A 2ME6A 4CJKA 1OOTA 3E01A 4NLCA 1GBRA 4P55A 2PFBA 4FJGA 2KFNA 2L01A 3BEXA 3G4SI 4YIFA 2O4GA 3LX7A 4U7BA 4MZPA 2K3BA 1R7JA 2VI6A 1TW3A 2FVUA 4ZNXA 1IH7A 1NK0A 5KK1A 1BHLA 1WA7A 4DFKA 1I1GA 5GAN8 1MJ9A 2C0IA 3TO9A 1TUCA 4E1NA 2V6CA 4BAYA 1FLIA 1IN5A 2V8JA 3FIFA 2HBPA 3MEUA 3NGYA 3CCRQ 1BU1A 3FIWA 1OH5A 2YRDA 3CCEA 3EKSA 1JJ2P 3UE5A 3DEEA 3WVDB 2KIMA 1TTHB 5DD8A 5JS1A 3H3VK 4O5FA 4DYQA 5GAMf 4LF7K 5D6FA 3AVGA 2P6SA 1T95A 4F4KA 5FFXA 4ABZA 4Y7NJ 3W2AA 5K7FA 4ESJA 4E70A 3GOXA 3LFKA 2BUPA 1G15A 3WTTC 4JDSA 4BJ6C 1KAZA 4B1RA 5GAGJ 3CCVT 3RPUD 4G6QA 1F21A 1T6DA 1FW6A 2OTJI 1O57A 4EHUA 2DNUA 2P81A 3NQOA 2H1LA 1F5TA 4E3SA 3UWNA 1Q86R 2RQTA 3LL7A 3TI0A 4P1WA 4FJIA 2ELKA 1VQNN 3BDUA 3DB3A 1M1KR 4HSBA 4WQ4C 4QTRA 2JVHA 1IXSB 2QQ9A 2HU9A 4OPKA 4IO9F 1VQOQ 2VQFK 4DG1A 1I5LA 1QA6A 3KYDB 3WEEA 3KCCA 1RAAB 2O3FA 3HBLA 2CUFA 3SYZA 5JLXA 4M77B 4MO7A 4PY5A 2QG9B 1JJ2A 4KT0E 3KWGA 3THVA 1VQ5T 4GLKA 1XNQK 1E17A 4J9FA 1P90A 2NRAC 2DN0A 4FASD 3QODA 1TKDA 2K9QA 2P9UA 2YI1A 3TANA 4R55A 3LSTA 2NS0A 3SWNB 1B7TA 4H0YB 2PQWA 2P4WA 1L3UA 4EGYA 3R60A 2DMUA 5EYRA 1W5CC 1RBRA 3QYGB 3P38A 3O5BA 3J7ZI 4KN7X 3NTIA 5C2DA 1ZQ3P 1KVBA 1I6XA 2KIFA 3H41A 2VPLA 4GV3A 3E9LA 3REOA 2IGMA 4BACA 4OWRB 4BBSJ 1BDGA 1Q1VA 3F2KA 4YIRX 4ZH4F 3QBYA 2ZM6K 3VWBA 3UKGA 1GLEG 1NK7A 2PUKB 1S1UA 3FXLA 2GWRA 4CF0A 5F1RA 2KTQA 1N9SA 3TAGA 2IIRA 2RREA 4N0AA 1IAWA 1C0UA 2M87A 3QKJA 2HZYA 2QSFX 1ODDA 1BR1A 3VF4A 3ABMH 2G3RA 3JTHA 3CPFA 1NJYA 2R5ZB 2D8HA 2UUBK 1X6GA 2IDOA 1WI3A 2QA4N 5C12A 3I56I 2DMOA 3DI6A 3QEPA 3CJRB 2EZIA 2E4HA 5CKEA 3CCLI 1Y07A 4CHQA 1NLVA 5GANj 3C65A 2UUCK 3ZQHA 5L23A 4AG2C 3SI6A 3RTVA 2HPMA 4L9TA 1ZYRF 4LB5A 4UY8I 1YTYA 3QESA 2COMA 1BB9A 2ZGWA 5KPZA 3QEIA 4JI0K 4A3CJ 4DR2K 3S6WA 1VQKN 1ZLJA 3CZ6A 2LNBA 2Q2EA 2K5IA 3WNFA 2XRNA 3T0YA 1BOAA 3C0BA 5GMKm 3VB2A 4N41A 4PLIA 1XCVA 4IXCA 1YIJQ 2BY2A 1A04A 3DAWA 1DTTA 3QO3A 2ESNA 4HUGA 3M9AA 1JT0A 1WWXA 2E5NA 3A98A 3Q9SA 2V51B 2LKXA 1A6IA 2QBYB 3IHOA 1ZBUA 3VYHB 3THWA 3T8TA 1NK9A 3GBTA 3VPRA 3GMEA 2L7KA 3ZX3A 1O1WA 1MBEA 4PJOC 5KPRA 1NKBA 4FL6A 2ECCA 5HKCA 1TUUA 3CCQN 4KTQA 4NS5A 4H4KC 5CHIA 3JCMh 2Q1NA 5H2FC 3CCUQ 1ATRA 1BOBA 2EGAA 1OX9A 4C1NI 3O8GA 2W03A 2E88A 3JAME 2OPSA 3O3HA 3F3XA 3OL4A 1Q82C 4M6VA 2HW3A 2BE5F 4OIRF 5GPAA 3ZXSA 3RWUA 1RDAA 3P9IA 2O8CB 5J8FA 2WB1N 3BG9A 2DFUA 2X78A 1N25A 3RQIA 1ZRDA 3CJ7A 1KQ9A 4QVDA 3KTQA 5J3LA 1BW6A 2W84A 5TKYA 2M4KA 4DBQA 4A3DJ 3I55A 1V55H 1UG0A 3H9QA 1RT4A 4CGDA 3D1NI 2OZMA 4RLFA 3HDDA 4CEQA 3GBGA 3ZT3A 2FPEA 1WJRA 3G71T 4IIOA 2QEXI 1DUXC 4DFMA 4L8RB 2E4LA 4QQ6A 2GWKA 3H45C 3MX5A 3C4SA 1VQ6Q 2CS7A 1SC7A 1WBBA 2MLKA 2P9NB 3TTFA 1HNIA 5GAN4 3G4SN 1YHQQ 5CZ1A 2LCLA 2I10A 1MBGA 4E89A 1VIFA 3S41A 1YCSB 3QB0A 3OJUA 4C8QE 1LOTB 5HP1A 2CG4A 2LJ1A 2ESHA 2CUZA 4BRCA 4OMQA 1U47A 5J4YA 4ETSA 5CQEA 2Q1ZB 3CC4T 1ZUKA 4J2DA 3A02A 5M5YJ 5AONA 2V7YA 4EAHD 2DA9A 4J2BA 3ZFJA 3K2PA 3ZPLA 4A62A 2ITMA 3E97A 1O7FA 1OR7A 2CKKA 4X64K 1Q81U 3L9FA 3TP0A 4UUSA 3IH7A 2JN6A 1XB4A 3DLGA 1UHSA 2UU9K 3A03A 3CF5F 2RGVA 2O8BB 2ELJA 2FBHA 1U5TA 2H8HA 4KB0A 3CCJA 2VBYA 2GTOA 4BR9A 1TWFJ 2OTJN 1VQPQ 4K2EA 2FC0A 5TRDA 5AZIA 1TK0A 5CZ2A 2HQHA 3PVQA 3J7AF 4M3TA 1UTIA 3FWEA 2VXZA 2FE3A 2HDCA 2E6MA 5E3OA 3HOWJ 2L54A 4ISEA 1T6SA 2XKOA 1YITQ 3CJTB 2L9VA 2PLYA 2YUSA 5IY5H 1I94K 2E1HA 2DBBA 2HVSA 4A4FA 5KYNA 1U45A 1K6OA 3QPTA 4M9XA 1VSEA 2XHCA 5C2FA 1JT6A 4DV2K 3W6VA 4AWXB 2DFEA 3CO7C 1VQMA 2Q0UA 1ZR2A 1FEXA 3EG2A 1KD1R 4IZ9A 1YIOA 5DUIA 2L89A 3CCEQ 1JTYA 4A4GA 3E6DA 2ZQBA 5ICCA 4M7DE 4CGGA 4TVRA 3LW5E 5C24A 1VQ8N 2F2EA 2IW5A 2LNVA 5AQVA 4B1VA 3OA6A 5FWCA 5GJVB 1NU0A 3KK2A 5LJ3j 1RT5A 1ILYA 2DLPA 3QEXA 2XG8D 2RH2A 4M3EA 2UWMA 2ADUA 4B8XA 2I7PA 1RIOH 5KAFC 4A4HA 3W3CA 3VESA 4J7IA 4ORZA 1Z25A 1OPLA 2CP7A 3DB4A 1SRLA 4KA4A 2NOEA 4IPAA 4DR4K 3NH1A 2IP2A 2EAYA 2PJPA 4XRSG 1M90U 1X1DA 3CG7A 5E26A 2N8GA 1WHKA 2LCSA 2FLOA 2DAOA 3BPVA 1TUGB 4V2SA 1SV5A 5JR3A 5H6QA 2KI7A 4BY6B 2O6GE 3R1XA 4ZJZA 4XTVA 2HBWA 2FBTA 3LAPA 2IC3A 1HNVA 4JRKA 1K78B 4AYBA 4Z8AA 4CEOA 2HNDA 4FJ7A 1VQ4I 1OULA 1YI2A 3TSZA 1C0GA 2G8UA 5LJ5g 4KB1A 3QUIA 4B9WA 1NLPC 4B44A 3VUZA 1MMAA 4ZDPA 1ZRFA 1KHIA 1KU2A 3VS6A 1UAXA 2EYYA 3LNQA 1JKQC 5KCOA 2SEMA 3NH0A 5KTQA 4U0VA 1BI3A 4J9DA 5GMKe 4BWJA 2K5CA 4PNOA 1TP4A 4W97A 3RMDA 5GAEJ 2P9LB 2E1MC 2XC7A 4OVLA 4XEIA 4FPAA 3OVNA 4J9HA 4BGDA 2HHHK 1QHTA 4Q4ZF 3CCSA 2UUZA 3VODA 2O9VA 1TT0A 2IJLA 4C8QD 5AQMA 3AVAA 5BS6A 3F9MA 2WV1A 1FT9A 1PP8F 1DGKN 4JI1K 2IS6A 2V8KA 3GLXA 4H0EA 4LDUA 4DV4K 2LTPA 1APLC 3RBBB 5GANf 1OH6A 1WJAA 3EHRA 4ON0A 1D0ZA 1YAGA 5CIUA 1WFWA 3CDIA 3DLKA 1IGNA 1I81A 4G9YA 4C8QF 1QHGA 4KUIA 1TK5A 1ZG3A 4CCMA 1N8RU 3HJFA 4JI6K 4WF2A 1I8FA 4A61A 4ZYHA 3ASOH 2B63J 3UF4A 3JB9I 3PO3J 3SEMA 1QVFP 5E1WA 5FKLA 1RAEB 3PNWC 4PJ0C 2LBFB 2QF7A 3KEQA 2RJFA 5HDNA 4DQ8A 3CQZJ 3IAS2 3IKMA 1Z21A 3N97A 3A1PA 2H94A 4I76A 4B3SK 4JKAA 1OCCH 1V76A 1VQ9T 1O3RA 2O4XB 2B8AA 1WHGA 4IJAA 2ZKZA 5B8HA 1XTAA 4PKIA 1IKXA 1JJ2M 4Q5VA 1G59A 3ZQCA 1TOVA 5J1RA 3MCZA 1W97L 1WQ7A 3ZSYA 1YXQA 3EYIA 5EXWA 4WQ5A 4DSIA 1K8AC 4H0VB 2V1RA 4CCLA 2DL7A 4CZZA 2H56A 5C0YA 1WKMA 1EO1A 2DJIA 2QUFA 1USSA 1O4XA 1B72B 2RK1A 1YJWA 1D3BA 3I58A 5FKKA 5KCHA 1PD1A 1QVFA 4M7DD 4FSSA 2G8KA 2KZZA 4JKGA 3K9KA 1BM9A 1SF9A 2WBMA 3JS6A 4N9HA 3V9SA 3BF1A 2JVVA 2GELA 3RSEB 2CSQA 1HOMA 4JJNK 4B3TK 2QWMA 2WUSA 3NRVA 3DXMB 5JLHA 2ZD1A 2OJ2A 4FOIA 4MFDA 4HLXA 5HY6A 1BYMA 4JX6A 1G3SA 3M8FA 2J6OA 3BR6A 3DKYA 1TL8A 5AQGA 5BR8K 4W1UA 2VWFA 3URGA 4FJNA 4M7DF 3I4MJ 1YBYA 1ZTRA 2EV0A 2ZB9A 5AQRA 3C18A 2ESWA 3CXCS 5FDLA 1O7LA 1FKPA 1B4AA 1RAIB 2QASA 4C92C 5EG0A 4BVOA 4MQ3A 1UMQA 2IRFG 2FOWA 4EQQA 5IHIA 1ZBLA 1TBXA 2A6EF 3I4PA 1ETYA 3Q1JA 4CC2A 5GMKi 4ELVA 3GFJA 5E20A 5GANh 1MNDA 4D0PA 4LFBK 5EY4A 3ZQFA 1VQ7T 1UJYA 1MDMA 3KLOA 2LVSA 2PN6A 4C1NK 3I56T 2VN2A 2R7WA 4A3IJ 2TDXA 4DUZK 1GCPA 3CCLT 4L9VA 2JTFA 2WACA 2ZPEB 2DTIA 1PNJA 3EG9B 4FK2A 2D45A 2HYGD 3X24B 4CC3A 2VYPA 2DTUA 3H36A 1MGQA 3NFAA 4AT1B 4OFAA 5M1FA 3MEVA 1T98A 3IFRA 4DMNA 2ROLA 2HDDA 4ISGA 3NVMA 3HKZA 5LJ5d 3WUHA 2K2MA 3DCFA 4D5FA 3BW1A 3A1YA 4B9SA 3WTVC 1N33K 2EA2A 2VXFA 5IXBA 5LRRA 1NK5A 5J4VA 5KQ8A 4R5PA 2L9NA 3HPGA 3HRSA 2DL4A 3V81A 1LWVA 3E1SA 2E2JJ 1S6PA 1QBJA 4L3QA 4CGIA 5E17F 2XB0X 3FBNB 2NVXJ 3CCJQ 1ZBXA 1TK8A 2ZGYA 2E70A 5CKFA 3KFVA 3DXKA 1B9MA 1A5WA 3W3DA 4ITVA 1QQJA 1M2VA 4E7JA 5AR0A 3F22A 2JGUA 2ZJPL 3CCUI 2NOGA 2CP5A 1SSHA 5LJWA 3KIOA 1LJOA 1DLOA 3VS1A 1BQNA 2P1JA 2G6FX 4RCCA 2KFZA 2E2QA 3M56A 1I5ZA 5AQQA 5BRHA 4Z4CA 5CPRB 3I9V2 1VOMA 1ASWA 5F0HA 2COYA 4CECA 5LJ3f 3EAEA 5F0XA 2AZSA 4A57A 1UG1A 4A2AA 5K5QA 4LDYA 4KN4X 4XTZA 2X4HA 2E1YA 4BU2A 4M78G 3RDIA 1N8RO 2COZA 3UB5A 1YP5A 3OV8A 3C7NB 1ZBHA 1R00A 3CVTA 3TQ7P 2D5VA 2LC2A 1D8YA 4DSJA 5L3BA 4H5RA 2QEXT 5CYMA 3S1RJ 2BANA 4DR1K 1VSHA 4E47A 2KQRA 3BQYA 4C5EA 4HLYA 4XBFA 4GV9A 4G6TB 5KAIC 5K7ZA 1HJRA 1S7AA 3PFSA 1NJIU 2HTSA 2DOEA 3CP8A 2MWPA 2XF5A 2XAFA 3MEEA 1VQ6I 2R4GA 1LEBA 5GAMg 5HS9A 1T3SA 2KRCA 1U9NA 2JT4A 2V8IA 2X6NA 3F10A 1BJZA 3WGHA 2IPOB 4CUGA 4C8QB 3VF2A 5FU7C 3LCNA 4RTXA 4JJBA 4OB1B 3J7AP 2GOMA 1B8IA 2LF7A 2CGKA 2XHIA 3OYYA 2FBXA 1B07A 3VS7A 2FOKA 4CE9A 4JKFA 4RTYA 3EUAA 4L0YB 4C5HA 4EM0B 3RPQA 5I22A 1XQHA 4DR3K 1XX5A 3ECOA 1YI2Q 2KMTA 5DUKA 3IQLA 4E7SA 5GAOq 5JS2A 5J1UA 3TREA 1EZZB 3CCRN 4OJRA 3HOZJ 4IHYA 2HD0A 4AFZC 1NNEA 4RW8A 1S9HA 4DQRA 3GDQA 2ZPGB 1DP3A 1X2NA 2CJJA 2EIKH 1F43A 2J5PA 4DTJA 2VKDA 4OMYA 4OOIA 2RKIA 3FK7A 1KYZA 1PUFA 1OQYA 4E7ZA 4OB0B 2V9PA 2M0YA 4OMLA 2GOXB 3D7EO 2PMZA 4EW0A 3CCMT 1ZREA 1N6QA 2LH9A 4M71A 3CCSQ 3DBLB 4C30A 1X3ZB 3CFPA 4IHVA 3PO2J 3VEXA 1VQ5A 4FE4A 1JLGA 1RT6A 1JLQA 2EHGA 3V7RA 4D8DA 4FJ9A 1VIEA 3G6EI 1SEUA 2VGNA 1OZ2A 2K9GA 2JS2A 3ZN0A 2V4JC 4O8KA 1K8KA 3CWUA 1CXQA 3KK1A 1X1PA 2BVLA 1TG0A 5IOYA 2KPMA 4NNJA 4KH6A 4BJ5C 3VU3C 2KR3A 2OCEA 2HKXA 4CYCA 2BZYA 3HHTB 1MUZA 1J9IA 1K1ZA 1KC8C 3JCMe 2GA1A 4M7DB 3QIIA 4AMCA 2LJ0A 5LGTA 2CYZB 4KIBA 4CC7A 2LDMA 1OCPA 1QCFA 1Q86O 4ANJA 3CC2I 2CW7A 2YJFA 3MAQA 1M1KO 1ETOA 1Q7YC 1YTUA 2HOEA 3LSKA 1NOYA 2JSPA 3PTAA 4QS7A 3KE2A 2KK4A 3HP9A 1OQKA 2HNHA 2OAWA 1BI2A 4KMFA 1VNDA 4N4OB 1IRXA 1A5JA 4G7OF 1W7PA 5KYXA 3WG7H 1KQ1A 3QJYA 1HW5A 3OYJA 4JP0A 3L1PA 3F9KA 1WHMA 1JKOC 1DGRM 1KZHA 4DOZA 4UXNA 3CDHA 3OOUA 2IVNA 2NOBA 3FBIB 1S72T 2LVMA 4PQUA 3DLEA 2DODA 1X1BA 3ZQ7A 2OF7A 4A5AA 3RMAA 2B5JA 1IXCA 1YQAA 2JPSA 2R5MA 1S9EA 1KG3A 3LH0A 3O9QA 1G3TA 2QGFB 1LCKA 1CGPA 1Y7XA 2P0KA 3VS4A 1N5YA 5L3CA 4E4HA 2ZBKA 3PQKA 2FBKA 4BRAA 3SXYA 3SQ4A 2CH4W 2ZMEC 1XMOK 2ZZDA 5AQIA 1N34K 4P5NA 4FT4A 2Z1HA 3J81Z 4BC5A 2L3QA 3B8AX 3ROUA 3A8OB 1VYUA 2WSFE 4KRTA 1ZARA 2Y30A 2P9PB 3T7ZA 4FM4B 1YYVA 3BZ6A 1ZBIA 3HXMA 4D7MA 5LFAA 1T56A 1YIJN 1QHHD 2I2LA 2M16A 3VA3A 3IL2A 1XCBA 3DU5A 1HUXA 3ENBA 1U49A 5LL6Z 1BR2A 3D6RA 2FB7A 1Y96A 3RZDJ 1K73R 2FPFA 2L0KA 1ZBJA 2KLAA 5EOYA 3BJOA 4BR2A 1B3QA 1Y71A 1XSVA 3N0UA 3IAM2 2E36A 5IXFA 4NC8A 1JJ6C 4B1ZA 3VQEA 4RKUE 5GAMd 4YRVA 1I50J 1AOJA 4NC6A 4OMOA 4BUGA 2UYTA 2Z99A 4HCKA 4WXCA 4F16A 2RV8A 4LIVA 1EWQA 2K27A 4BHCA 3CCUN 2DPDA 1RDWX 1D0YA 2QKLB 3BR2A 5AQKA 1WQ2A 4CJ4A 2O8KA 1VK0A 4DR6K 3ELKA 2MD5A 4N4IA 3WODF 3FXUA 4OP0A 3T1YK 4ENNA 2EYWA 3PJRA 1KU7A 2OUMA 4K8XA 3KPHA 5GINA 4M45A 4DTNA 3OS1A 3ZOBA 2R5YB 4M7AC 1IV0A 1BKBA 2YLCA 2YPRA 1QVGA 2ETJA 4CD3A 4CGHA 3S6IA 3LA2A 3H08A 2EZKA 4CXFA 4XKWA 3CHWA 2PYJA 1QVFM 4C9YA 3JB9H 2DF6A 1TKZA 2JHNA 3CPWP 3NBPA 4XLFA 2K3FA 2ASPA 2OPRA 2PBIA 2XU8A 1U0JA 1Z67A 1KONA 1UG2A 1IN7A 1OPCA 4JV5K 1U9OA 3L8BA 2IBDA 3LLRA 4KFBA 1VSMA 4Y0WA 1VQ6N 1FJLA 2NUPA 5B5EC 1YHQN 4X9DA 3K4MA 3P5JA 6PAXA 1NGFA 5E18F 4M72A 2LK2A 1SKRA 3EL2A 1AEYA 3SZ2A 3A8GB 2JG6A 3PO5A 4B9LA 3OYMA 2DLLA 3G73A 3CD6Q 3EPZA 5IP9J 5HS7A 1OKRA 3HSFA 2DILA 2STWA 2LREA 2AK5A 2JA8J 1NK4A 3I53A 4GW6A 3VETA 1BI4A 1XWLA 5CQYA 3ZETB 4EMKC 5AQUA 4S05A 3OYGA 1R23A 3D0SA 1WPKA 3H0GJ 1HR0K 3N5BB 3CPWA 1RABB 4F14A 2R5AA 4LXCA 2RN8A 4NB4A 2A40A 1X9SA 1G2HA 3MMYB 2ABKA 4FLYA 4M3DA 4KGXB 2I5UA 3WVEB 3I55I 1HQEA 3E5UA 1AA7A 4EDUA 4ELTA 1K79A 3JRBA 3FHFA 4BKXA 3S16J 3T9NA 4HV5A 2D1XA 2QWNA 5CHZA 1JEGA 1X3WB 2DA4A 4CZHA 1ZR4A 3T69A 3KP7A 5DM6F 4Y91A 3ML6A 1G5VA 1YF5L 1DTQA 4CHYA 4AM3A 3M0SA 3BJAA 1YJNI 5KN8A 2DA5A 5K5OA 3KD1E 3U3GA 1UEBA 1QSLA 3S3MA 1BN5A 2O03A 1LOJA 1OVQA 1UECA 1Q82U 3PV8A 4OO1J 4B1XB 1Z77A 3GL1A 4EZ6A 5GADJ 3H9JA 1NEGA 2MBFA 5LMNK 4QS8A 3NARA 4CZLA 2BE7D 2B4JA 3PQJA 4BXUA 3M5AA 3E2UA 1HSQA 4RDUA 2ATCB 3CCVQ 4A6DA 3CCEN 4DYRA 1U6ZA 4KH5A 1U2WA 3AA4A 1MJAA 3GG4A 2E10A 1C1AA 3D2FA 2MIOA 3M0RA 2XKPA 2R7OA 2ME0A 1N6AA 3RKYA 4O5BA 5HLHA 2PU9B 4HAMA 4OKKA 4MO4A 1PM3A 2K4JA 5L3FA 3SCXA 3DLRA 4YTLA 3CCJI 2LMJA 3OMYA 4ID1A 2MF2A 2QKBA 1XUPO 5J2QA 3ESWB 2XI9A 1VQKT 3GPLA 4Q5SF 3IUOA 4MFEA 1TTYA 2M3AA 3OYDA 3OIOA 2E2PA 1QZEA 1HQCA 2IA0A 4RGSA 2QTXA 4CF1A 4Z0UA 1L5UA 2Z0WA 2FD5A 3DTIA 5C4XJ 2HL5C 1VQ5Q 1KD1O 2V7FA 5TJJA 3J81O 2RQVA 3CXCP 4M74A 1R59O 2KYBA 4PCQA 2D6FA 3Q0VA 4JS4A 4B9MA 2HHSA 4NCBA 3PE0A 5EZHA 1Z3YA 1TZLA 3KKRA 3VQ9A 1W7PD 1J7KA 4LITA 4NZGA 1U1SA 4LE9A 2XAQA 3RDVA 3U9ZA 4EJZA 4YOVA 4QCLA 1E4GT 1VQMI 3AVNA 3LP0A 3X26B 3FJ5A 3DOLA 2DCEA 3ASMA 2GXGA 1VTNC 3G0QA 4FWKA 3WE2A 3QSUA 1F9NA 4Z4GA 4RGUA 3TEDA 1LQ1A 3PO4A 1WHUA 1KIKA 1TYQB 5HBMA 2NLUA 5GANg 3NF8A 1TL1A 3TSUA 2DT6A 3K7AJ 3R4KA 1QQCA 2GGRA 3EFRA 4LH4A 4ZGJB 3DLHA 2HGCA 4EVVA 3MXJA 1PC0A 2CQNA 2EB7A 3V4GA 1TQIA 2KJCA 1UWBA 2O8DA 2FL7A 3MP6A 2DYRH 1WJEA 2A3ZA 2A61A 4H0OA 2NXNB 1LEAA 3C7JA 2ROTA 4ASNA 2ZPFB 2ACJA 3BTCA 1MH3A 5FLVA 3NEUA 5D7UA 2VQEK 2I7NA 4BQAA 2K85A 3CMEQ 1QMCA 5EGOB 1RT7A 4KHPK 3U9GA 1RFQA 3VKIA 2A28A 4YOTA 3MK6A 4N0BA 1SAUA 4AIKA 2ZSHB 4YNQA 1U2VA 3THXA 3DLLF 2STTA 1VQ9A 5LJ5e 5LHGA 1I4K1 2P4RA 5KN9A 4XNFA 3OB9A 2FF3B 2G8HA 3BZKA 1NK2P 2KRMA 2F96A 2A3LA 3SFIA 4YORA 1ZGJA 5GAN5 3KNTA 4J9CA 1J0RA 2PAVA 3CBPA 4IZZA 3QYEA 1QSYA 3S9HA 5JHFA 5H6RA 3FXMA 1FIPA 2NAZA 3HT3A 1R1TA 4XKCA 1F4KA 1FOXA 4PJOE 2DU9A 3K69A 2HDWA 1L0OC 1QVUA 1X2MA 2PQ8A 3HRUA 5KHDA 3AVCA 3CM5A 4BYYA 1ETVA 3H92A 2GBZA 4OPHA 4QKUA 1Z9QA 2JUGA 3G6ET 3KZZA 3SLCA 4CCKA 4RGRA 2PG4A 3JRZA 4M6YA 3LAKA 5H20A 4NC7A 1H641 5IP7J 3JCMc 1KU3A 4KULA 2M02A 3THKA 3DU6A 4PJMA 4QOZB 2OTLI 1R4MB 2F4MB 4BRPA 3QAHA 5LY3A 3CWSA 1WBDA 2LX7A 1HSTA 4RTUA 1GVJA 5TGTA 1XMXA 4IOCL 2F1LA 1DGWY 3OYAA 3F72A 3U9DA 2Z1GA 1UJ0A 1NMDA 3CC2T 4AHSA 1V29B 5HL7L 1HNZK 1K61A 4C0DB 3T1HK 2VKVA 2GTJA 4FJLA 2QGUA 1TUDA 3SQ0A 5J1EA 3V7CA 3ID8A 1KG1A 2FZGB 3CMYA 3PM1A 4AH9A 2Y4YA 2PZSA 2HTJA 4HXJA 1YJ9Q 1ZSZB 1VQ7A 4IUUA 3G71Q 4ZN3A 2BV6A 1VZ0A 1JL2A 3OW2S 1T08B 3I56A 1KCFA 2F6CA 3M5RA 3WNGA 1RGIA 3VTIA 2GLOA 2DA3A 4RB3C 2EX3A 3CWAA 3V8KA 3E3VA 5A2QK 4Y52J 3U6FA 3KEOA 5JVGL 2XPWA 3K2AA 3K57A 3N4QA 1KG2A 4WCGA 2KDOA 3TSWA 4AD9A 2A05A 2EPDA 3QMLA 3CF5L 2PEXA 2DY4A 5DCMB 2DMTA 2X9HA 1NJWA 2OA8A 1YJWI 1SL0A 3RVCA 4L9JA 1M30A 8AT1B 4IUVA 1HU0A 5SZTA 3MVPA 2P9IB 1KAXA 4RLQA 1T0JA 2DAQA 1WJCA 1IHVA 3LGLA 5KYYB 3CC4Q 2XY5A 2BH1A 3H0DA 5LHHA 1I3AA 3QEVA 5E41A 2LJ3A 4E1JA 2O61A 4HVJA 1HF0A 2V1QA 2V1XA 4II3A 3Q7BA 1WSIA 4NYFA 1OR7C 1KLMA 9ANTA 2BE2A 2ELHA 2DOFA 1YVUA 3O4QA 2Z1IA 4I01A 3KBGA 4CEDA 4MFBA 3U1DA 1BQMA 5D5VB 4IF4A 1U5TC 5ILUA 1XI1A 1C1BA 3GTMJ 2XV4S 4HT9A 1NOZA 3HRTA 3WU0A 1EH8A 1QW1A 2NOIA 4NCAA 3VQQA 3QDRB 2WAQA 3NGPA 1K8AU 1K9MC 3CERA 3ZEHA 2JTVA 5F0FA 5GIOA 4LG0B 1XDSA 3VSKA 2DI3A 5IN1A 2E41A 5KNLA 1H3HA 3UATA 2IS2A 3CJ1A 5LJ3g 2XKOC 3VENA 4CK2A 3F73A 2F4VK 2Z1DA 4BD3A 2ZSIB 4JS5A 2HEOA 3CCJN 1JKRC 4OFEA 3EH1A 2ZC2A 4RBOA 4RWTA 4N47A 2RA2A 1N32K 4IFYA 4L9NA 4J6XA 2NNNA 3CMMA 4K0KK 2E60A 3TR8A 3K6GA 4PFPA 2H6CA 4KT6A 3A5ZB 2VPRA 3L2ZA 1L3VA 2A08A 4AHUA 3C3WA 1T6CA 4J6YA 4MMKA 3FF5A 4KUDK 4KICA 1HXDA 4PJOD 1QVGM 1X9MA 4II1A 5KYXB 1W7PB 4E7HA 2KBTA 1IKVA 2QEXA 3J80Z 4HNUA 2EJFA 2VKNA 2HNZA 2DQRA 4Q48A 2DRKA 4Y33A 2EFIA 2I5JA 3JREA 3HGYA 1G3WA 2D0OA 2UXXA 3SEQA 2DIQA 4LF5K 3GO5A 5FB2A 3EGDA 4A0XA 2FHDA 4PJOF 4UQGA 3O3FA 4HUFA 1QPMA 2CMPA 1ZUYA 2AQFA 4MMLA 2BTTA 1KQSP 3V9ZA 4BRHA 2JTMA 4C2MJ 4LH5A 3E9FA 4XL9A 3HB9A 3ERMA 2LP0A 1VHXA 1R0AA 2OAUA 4PKHA 4PWDA 3A5OC 2MABA 3NH2A 3FHNA 1ORNA 5GAOr 2DXIA 2VBZA 4B9QA 2NRRA 5DK5A 4B8AB 2PVDB 3O80A 1UAAA 2YLBA 1YQMA 2HMAA 4YOYA 2CP2A 4OAYA 4O55A 1EKEA 1IV6A 1P4AA 4AYBN 4J2EA 2EGCA 3LSMA 1YI2N 1JLFA 4GYIA 4DV6K 2ZO4A 1X6OA 1HC8A 1Z3XA 4O8UA 1LE8A 2ZNYA 4HZFA 3ZEUA 1CZBA 2C6YA 4M3XA 1EXQA 1Y96B 1ZUUA 5E3MA 3CCMA 2BTF