5FRMA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz384 (compound 4a)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination
molecule keywords PFV INTEGRASE
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frmA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frmA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frmA03
1IG9A 1WSFA 1S1VA 2ZQBA 3ZT4A 4JLHA 4LH5A 3KK3A 1J54A 2L3RA 1KTQA 1O1WA 3QJ6A 3CQ8A 4AHTA 3SV4A 4O0JA 4DS4A 2X78A 4DU3A 4FLVA 3VQ4A 1LWEA 4IUPA 4DTPA 3TABA 4PY5A 5CY4A 3Q1JA 3VQDA 2XY8A 1XI1A 3QBYA 1U45A 3C94A 4M3WA 3PX6A 1NKEA 4FLTA 4RW6A 3NH0A 4DFPA 3O3HA 4AHSA 5DMRA 4FM0A 1DTQA 1RT6A 3ZCMA 3KK2A 4F3TA 4ZHRA 1LW2A 1NK9A 3DI6A 2Z1JA 4C8NA 4E1MA 4NYNA 4NCBA 4YFUA 1QTMA 3AA2A 3EAEA 4A4HA 4GMJB 5CZ1A 5CYMA 5J26A 2DIGA 5CYQA 2HHXA 3KTQA 3DLMA 3ZSZA 3ASKA 1SSFA 4QAGA 4CJKA 1NJWA 1SL2A 1SKWA 5KCHA 2RPIA 3OY9A 2PY5A 4KTQA 1FK9A 4QCLA 3KLEA 4CFBA 5KI6A 3AO4A 1RDBA 2XK0A 1SKSA 4CESA 4BE1A 2R57A 1FKPA 2F5KA 5I3UA 1S1UA 2FBVA 2L89A 4DU4A 3SI6A 2LTOA 1S9GA 3ZT2A 2RHUA 3RR8A 3F9KA 5EU7A 4F8RA 2RJDA 3NGIA 3L2RA 2GFAA 3V1QA 2GV9A 1W9HA 3BGRA 4DSFA 3KKSA 3SCXA 3DOKA 2B5JA 4CF0A 3CEYA 2YHAA 2IG0A 3O4QA 2P51A 3AO2A 2XY6A 1ZBIA 3M9QA 4IUTA 4CCHA 3SNNA 1F21A 2DIQA 1GOAA 4O55A 3V81A 1QSLA 2P5GA 5KTQA 1LWFA 4FJJA 3EYZA 4E7IA 3AVFA 4HCCA 1EETA 4H4OA 4FW1A 2EQMA 2D5RA 3OS1A 4UQGA 1RNHA 1QSSA 2HW3A 3SJJA 3NGZA 3QESA 1WSJA 2XRIA 1BQMA 3L2VA 1A5WA 2E6MA 3AVGA 1RTIA 1S6QA 3HL8A 3NF9A 4I7FA 4ICLA 5FRMA 3C6UA 4II1A 1HQEA 1TVRA 1TGOA 3VQ6A 4JS5A 2WACA 3RMCA 2G8FA 4F4KA 4FJXA 4Z4GA 3I0SA 3S3OA 3WNGA 1B92A 2P0KA 2I5JA 4BWJA 1HJRA 4EP4A 2JZ2A 1G5VA 1ITGA 1C6VA 4KTWA 3DLGA 1QS4A 2EHGA 2OPQA 4NS5A 1TL1A 3VA3A 1RDCA 3V9UA 3LGFA 3E9FA 4A4FA 4Q5WA 2F96A 1ASWA 3AV9A 1BL3A 1RILA 4M3UA 4CGHA 2PYLA 1BIZA 4JRPA 1ZBHA 2L8DA 4ELTA 4E7HA 3L42A 4ZTJA 1SV5A 3DLEA 4CJEA 1I3AA 3LAMA 4OKEA 3HT3A 2QQSA 4AHRA 3HM9A 4FM1A 1ZBUA 2BIVA 4C5EA 4KAZA 3VA0A 2ATQA 3ZSOA 5I42A 3K5LA 4N4HA 1CXQA 1U47A 4B9UA 2D0BA 4QOZB 4HVJA 2LVMA 2BDPA 3AVKA 1LAVA 4O5BA 2KFZA 5JS2A 1RT1A 4M41A 1NOZA 3DLRA 4DTXA 3OYBA 3PO4A 4PUOA 3LP3A 4W5RA 4M3TA 3H8ZA 1IKXA 3DRSA 2OZSA 1ZYQA 3NCIA 2Y1IA 2FBTA 2QK9A 2HVIA 1RT7A 4ID1A 4OGCA 4OPKA 4CHYA 3CG7A 1RTDA 2RHIA 1G15A 3TAMA 5T7BA 3FDRA 1TKTA 2KFNA 4I9QA 4LY7A 1VSHA 2JGUA 1L5UA 3E01A 4G1QA 4B9TA 2O4IA 3DB3A 3SYZA 4DSKA 2EKOA 5HRSA 3K5MA 1C0MA 3NGYA 2A1RA 4CK3A 3AVIA 3U3YA 4KRFA 3QEPA 2HHVA 1Y97A 4CRIA 3LWLA 3HK2A 1RBUA 4M45A 4A4GA 3ZT3A 1WJRA 2BUDA 3HSTB 3LP0A 3NTIA 2RKIA 3DOLA 3VQCA 4AILC 3QERA 2QKBA 2ZD1A 2YNFA 1DLOA 2FC0A 3QEIA 1J53A 2IS3A 4FJ8A 4ID5A 3VQAA 3KLHA 2Z1GA 3LYIA 1H3ZA 3AA5X 3PV8A 4BDYA 3P8HA 1IKWA 1KVBA 3AO3A 3C6TA 1RDAA 2WONA 4OPJA 2B8AA 1U4BA 2PZSA 4BE0A 3HVTA 3QINA 3U3GA 1VSIA 3DLKA 5C0MA 1XNIA 1ZBFA 3FFIA 3CM6A 3MP8A 4FLWA 2O4GA 3SV3A 1VSEA 3LPTA 2D9TA 3VQQA 4FLYA 1BI4A 3L2WA 1HRHA 1OI1A 3O3FA 4DTSA 3NBPA 3F73A 1JLEA 1TKDA 1NOYA 4B08A 4B9VA 3HO1A 4J2DA 4Z4FA 3ZSVA 4OVAA 2GBZA 2XHBA 2HMIA 2KZMA 5KRSA 4CGFA 4PQUA 3MEAA 4LD6A 1KFDA 3GOXA 3AVJA 4E1NA 1KVCA 3VN5A 4HCZA 4J2AA 3PO5A 4PL6A 3MXJA 2K3YA 4IFYA 3P8DA 3V9ZA 4C5IA 5JS1A 4DTRA 1MHNA 1WSHA 1BCOA 3TANA 4PLIA 5HRPA 3RMDA 3KD1E 4FJLA 2BKDN 1RTJA 1RT2A 4CF2A 3VQ9A 1A5XA 3OYMA 2DY4A 4BE2A 3VQ7A 3THVA 3LANA 1UA1A 3OYEA 2Q3SA 1HPZA 3ALYA 3TWHA 2EFIA 3PNWC 5D3GA 3V9WA 2OYQA 4E3SA 2GFUA 1A5VA 3HVRA 4CJPA 3SUNA 4FZXC 3G0ZA 4EP5A 2HHTA 3E9GA 1IKVA 4OGEA 2HNZA 3PX0A 3D0PA 3QEXA 1JKHA 5HROA 4CIGA 4Z4EA 1RT5A 4NCAA 4CJRA 2YKNA 5J2MA 4CJLA 2OA8A 3ZT0A 4HUFA 2XY5A 2GF7A 3V6DA 3QIOA 2DFEA 4KB0A 2IGIA 3QO9A 4CJ3A 4Q0BA 1LW0A 4CF1A 1R0AA 4K8XA 4JS4A 3U6FA 2G8HA 3SZ2A 5DK5A 5HRRA 1KSPA 3K57A 3DLHA 2B6AA 2FBYA 4CEOA 4DU1A 2HB5A 2ITGA 3M8PA 4DQRA 2QQRA 3OB9A 4M3RA 4KB1A 1S6PA 3LZIA 3S6WA 1OYXA 4Z0UA 3OYGA 1RT4A 2D0AA 2R5AA 2X74A 1BHLA 3O4NA 3QIPA 4CEDA 4PA1A 1K6YA 2EX3A 2IAJA 5FDLA 3NHGA 1ASVA 1VSFA 4GW6A 3LWMA 1JXBA 1WLJA 4DQIA 1WSIA 4FJHA 4W5NA 4B8CA 1BIUA 3META 2VG6A 5C24A 4DQSA 2AJQA 3OYJA 1UA0A 2A1SA 1TAQA 1CXUA 1S1XA 5IN1A 1Z26A 4FVMA 4BACA 3MO8A 2YKMA 3L3UA 3VQEA 3HXMA 1HYSA 2ZE2A 3O3GA 4HTUA 2NLUA 4W5OA 3OYFA 2HQXA 1KCFA 3SUOA 4M3YA 2HHQA 2QKKA 2YNHA 3C95A 3L8BA 3F70A 2PYJA 4FJ7A 3V9XA 3NTHA 3PUFA 4FL6A 5C6SA 4OVLA 3HPOA 1NK0A 3H6ZA 4DWIA 1WGSA 2P5OA 1LWCA 3UIQA 1C1CA 1KLMA 2HQEA 1JLQA 3SQ0A 4J2BA 3CFRA 5D6XA 3OYNA 2MWPA 2E6NA 2QXFA 4IBNA 4XIUA 4CFCA 3EZ5A 2HVHA 2X4XA 3ZSQA 3LP2A 2YNGA 5K14A 3HJFA 4KKOA 2X6NA 1B9DA 2Z1IA 2XDPA 1TAUA 2P1JA 3V4IA 3OYLA 1TL3A 3KLGA 4L8RB 2DFHA 4LD0A 3ULDA 4CERA 1TV6A 1XHZA 3OYDA 4I2QA 4CIEA 3B6PA 3OQ5A 3ZEHA 3L2UA 2RHZA 4KTZA 5FROA 4DMNA 2X35A 1JLBA 3I8DA 4AHUA 3MAQA 4FLXA 2LSNA 3LLRA 3PMTA 2ETJA 3HPGA 4Y1CA 5D6WA 3O8VA 1B9FA 3OYKA 4C8MA 4CF8A 1NKBA 2LRQA 1JLFA 3RRGA 1WSEA 3MEDA 4E19A 4NYFA 4CFAA 1UAXA 4OKJA 2G8UA 1C1BA 1WN7A 1WJSA 4IURA 2VYTA 1T7PA 3WNEA 1L3VA 3C4SA 1JL1A 3ASMA 4YNQA 4DLGA 4DTJA 4Z02A 3AA3A 4CEQA 3LZJA 3OYAA 3K59A 3NF8A 4B9SA 3EY1A 1X1PA 1JLGA 1OZ2A 1REVA 1GOBA 2RF2A 2WOMA 3HP9A 3MEGA 3V9SA 3TAPA 4CEAA 4EZ6A 4DSIA 1CLQA 1VSLA 3MP1A 4FJ9A 1ASUA 1WAFA 1D9DA 1C0UA 4KHWA 5SZTA 3V1RA 3T1AA 5J2PA 3RMAA 1NK8A 2RJCA 2BANA 1OZ3A 5C25A 1U49A 3VQ5A 2RI2A 2CKKA 1BCMA 3AVLA 3HP6A 4E0DA 2XY7A 3QIIA 4KFBA 1VRTA 2KW4A 1SKRA 2VWJA 1U04A 1CZ9A 3OS0A 4B9MA 4KHSA 1D5AA 1RCHA 1S1TA 3SQ2A 5KCOA 1L3TA 4F3OA 4K8ZA 3MEEA 4FLUA 4ZTFA 3VQ8A 3CYMA 4CIFA 2G3RA 2XO7A 3ZSRA 1NJZA 3DRPA 3SQ1A 2G8VA 1YT3A 4ELVA 1WNSA 5CZ2A 4FU6A 4HHTA 5KRTA 2VG7A 1NK6A 4EDUA 3PFSA 4FJKA 4M3ZA 1RDDA 2YHBA 1WJQA 4FM2A 3QEVA 3PX4A 3V1OA 5HP1A 1L3SA 1T8EA 3LAKA 4PLLA 2F8SA 4DSJA 5J1EA 1BI4B 4Z4HA 5KE3A 4O4GA 3TAQA 2LDMA 1VSKA 3DMJA 3K5NA 3QKJA 3DYAA 3AVHA 2BGGA 4NZGA 4E7LA 4UC4A 2MWOA 2E6LA 4R5PA 1KRPA 1RBVA 4B9LA 2G8IA 4FJGA 2HNDA 2K3XA 4E89A 3QNOA 1LV5A 4TSXA 4CEEA 3IAYA 1J9AA 2D0CA 5J39A 4OJRA 1Z25A 3AVBA 4N47A 1T03A 1HNVA 3BDLA 2HHUA 1C0TA 3JYTA 3P83D 3QETA 3MXIA 4H8KA 4CHOA 2RHYA 2EQKA 4CEZA 4RW7A 3HPHA 4IG0A 2YNIA 2R5MA 3IS9A 3LALA 1XC9A 2O4XB 2DAQA 1UOCA 1NKCA 4HUEA 3MXMA 4I2PA 4A4EA 5D6YA 3M8RA 4O0IA 3NFAA 3OJSA 4Z4IA 4AHVA 3TR8A 3KJVA 3T3FA 4X34A 3KLFA 3OYIA 4LSLA 2O4XA 4FK2A 5J2QA 1VSJA 4JRQA 2JTFA 3TAGA 1NK4A 4RW9A 1RBSA 2BE2A 3OMCA 4NCGA 2W42A 4FZYA 3SPZA 4FZZA 3P5JA 3MECA 3M8QA 4DS5A 1TK5A 1SUQA 1L3UA 2RHXA 2R58A 1TKZA 1TK0A 2E5QA 2X4YA 5KH6A 1XWLA 3SQ4A 4IUUA 4KO0A 4N56A 3LX7A 4W5QA 2G8WA 3PY8A 4FK0A 3AO1A 4IUVA 1N27A 4KHNA 4CK2A 4QW2A 3LGLA 4RG2A 3S3NA 3DRRA 1N5YA 4EZ9A 4KREA 2YRVA 4L59A 2KZZA 4B9WA 5IAYA 4QVZA 3VQPA 3KD5E 2RI3A 3TARA 3DB4A 4DF8A 4LH4A 4C8OA 4DSLA 4CJSA 4B3OA 3OYHA 1HYVA 1RTHA 3AVCA 4B9NA 3S9HA 1WSGA 2IOCA 1SL1A 2KTQA 3SPYA 1VK0A 3MEWA 3K5OA 4DFKA 3OS2A 3AVNA 3TAFA 4CJVA 2OPPA 3SD4A 4MQ3A 1FXXA 4CJUA 1J5OA 3FLGA 2RI5A 2OPSA 2HHSA 4E7KA 4N5SA 1RBRA 2F8TA 4RG8A 1HYZA 4KHYA 3NH2A 4CGGA 3ZSXA 1YTAA 1D9FA 3HYFA 4FJIA 4DG1A 1EKEA 3AO5A 3G10A 4CFDA 3TAEA 3RR7A 1HQUA 5FRNA 1IO2A 4AHCA 4FJ5A 3KUFA 3OA6A 3VQBA 5HLFA 1JLCA 4CHNA 3TI0A 3S3MA 1IKYA 4CECA 3PMIA 1EX4A 2VG5A 4IFVA 3RWUA 4AH9A 3RMBA 2DTUA 4CJ4A 3CFOA 2HNYA 2X6SA 3NF7A 4CJWA 3NAEA 4DFMA 1ZBLA 3LP1A 1JXEA 5KGXA 3MP6A 4Y1DA 3FEOA 1KHCA 3NTKA 4QQ6A 5SWMA 1YVUA 4RW8A 4Q5VA 4DSEA 1NK7A 1X9SA 3T19A 3NH1A 1NJYA 4CF9A 5KE2A 4KHQA 3BDPA 3D45A 4IG3A 3WNFA 2IDOA 4FJMA 3KLIA 4BDZA 2DFFA 2RN2A 4C5GA 2VWKA 1KFSA 4KHUA 5M9OA 2FBXA 5E41A 3AVMA 4DTUA 3DM2A 1QQCA 2JLEA 1N6QA 1S1WA 2E4LA 1KLNA 1WAJA 3M8SA 3NF6A 2M16A 3L3VA 5J2NA 3WNHA 1VRUA 1TKXA 4BWMA 1JL2A 3B6OA 1Q8IA 4IDKA 4CGDA 4F2SA 1X9MA 4CE9A 4CHQA 2FHDA 4LSNA 5KGWA 4CGIA 4CJTA 5HRNA 3KK1A 4DLEA 1S9EA 4DFJA 4N76A 3ISNC 4H4MA 3FC3A 4DTNA 4J2EA 2GUIA 5HBMA 4W5TA 2KQ2A 1IH7A 4RW4A 3ITHA 1KVAA 3NE6A 2Y1JA 3LDSA 4PWDA 3OYCA 3NNQA 3RTVA 4FK4A 1JLAA 3AVAA 2OPRA 3RRHA 4M42A 4M3XA 2R7YA 3SUPA 1BGXT 2PQWA 1T05A 1SL0A 4OKKA 4OLBA 3I0RA 4KV8A 4WE1A 3QNNA 1LAWA 4BDPA 4N41A 2Z1HA 1YTUA 4FLZA 1Q9XA 4FXDA 4CK1A 4Z4CA 1D8YA 2IC3A 4KPYA 1X9WA 3H08A 2HHWA 4KI6A 2X4WA 2M0OA 1RI0A 1MU2A 4BD3A 1FKOA 3AA4A 3DLBA 4B9XA 1QHTA 2G8KA 1CZBA 2LCCA 3K58A 4QQDA 4QQGA 3ZT1A 3ZSWA 4FYDA 4CEFA 1HNIA 4DF4A 2NUBA 1Q9YA 4HCBA 1U48A 4FJNA 1UWBA 3OMGA 2M1HA 2RJFA 4CHPA 4CJ5A 1QE1A 1NJXA 4DQQA 4KI4A 4B8AB 1DTTA 4C5HA 1RBTA 3NDKA 3UWNA 5CIUA 1EXQA 3CFPA 3QEWA 4DTOA 1VSMA 3LPUA 4ELUA 3L2QA 3CM5A 3SUQA 2YV0X 3IRXA 2EQJA 4I9LA 4CHZA 4FW2A 1HMVA 3OJUA 1BQNA 4O44A 4IKFA 4N4IA 2B4JA 4DQPA 4E7JA 4MFBA 4C8KA 4CJFA 4N4GA 3UT1A 4CEBA 4C8LA 1TK8A 3JSMA 3P1GA 1GOCA 1RT3A 3MEVA 2RJEA 2EQUA 1VSDA 1XHXA 3A2FA 3ZSYA 2OZMA 3LH0A 1S5JA 2RO0A 1EP4A 1BISA 1I39A 3MEUA 3QLHA 4GVMA 1C1AA 1W0HA 4F2RA 4FCYA 4OLAA 4GY5A 3KIOA 3KKRA 4HUGA 3ME9A 3OVNA 1NK5A 4CGJA 1QSYA 3IG1A 3K2PA 4CJQA 4DTMA 5C42A 4IUQA
chains in the Genus database with same CATH superfamily
3J7YJ 1YUWA 4OIOF 3BE3A 4J9BA 3TABA 4PY5A 3LSMA 4F93B 3O4WA 1MH4A 1XDSA 4Y52J 2HZYA 4B9QA 3JTGA 1RT6A 1KEAA 4B3XA 1QTMA 1W36C 3SAGA 3GF2A 3ZSZA 3ASKA 3ZQQA 1NJWA 1YIJN 4CFBA 1VQLI 3THWB 3GNFB 2G9WA 3CEYA 1UB4A 3G71T 4ASNA 5KPTA 4C8QD 4O55A 4LFBK 2ZFUA 4LOCA 4H4OA 2D5RA 4U0YA 5E1WA 4MMKA 1LOTB 3SJJA 4BQLA 2CRGA 1RTIA 3WODF 4JS5A 3G2BA 3ZMZA 2A3SA 1TUYA 1UHCA 3J80O 4J9DA 5LHHA 1X1AA 5CHZA 3VA3A 3LQRA 2XF7A 2PYLA 1ARKA 1XUPO 4FWQA 4BC5A 2IA2A 2QQSA 1LFBA 3C0BA 4Y28E 1QWFA 2D0PA 3SFIA 2D0BA 1N8RC 2J7IA 3I64A 4HDVA 3DLRA 1XCVA 3CQZJ 1O9SA 2VONA 2Y1IA 4M77E 4EA5A 2A5WA 1PNJA 1NGGA 2A6TA 2C6YA 4CZCA 3E9LA 4YG2F 3UNGC 3OSSC 1M30A 4B44A 2FEZA 4NBQA 3NGYA 1Y97A 4F3QA 1JB0E 4I2OA 3RMQA 1NYFA 3I58A 5IWAK 1GBQA 1TT0A 4BE0A 3EGXB 3SMPA 4WCEL 3FFIA 3WTZA 3X24B 3NBPA 2KZMA 4OVAA 1J09A 2HYFA 1QWEA 1PC0A 2ICWG 4FWMA 3D2EB 1KONA 1RDUA 3P8BB 3DTKA 3GDQA 4BE2A 1I1GA 3UKUA 1UA1A 1KG5A 2GOMA 1SMYF 4FE4A 1DP3A 1N39A 1IKVA 2KNBB 1RT5A 4PJNA 3BDUA 2E36A 3F72A 2IGIA 3QO9A 2PZ1A 3TO9A 2IIRA 3BTIA 1T3LA 3E9PA 1LKXA 1YJ9I 3OYGA 4JX6A 4A57A 2R5AA 2X74A 3HKSA 4RTVA 1ASVA 4DQSA 4BQNA 2UUAK 3EH1A 3MZYA 1XNQK 2HQXA 4NQWB 5JR3A 3GX4X 2ZCFB 3BLYA 3CCSN 1WGSA 1U84A 4JK9A 1A35A 4A93J 5LJ3f 3ESWB 3LP2A 3T7ZA 4HDUA 1ZLKA 3MJXA 3SYTA 3O9UA 5GAMf 4OMOA 5AQGA 1SFKA 1D1CA 2EFWA 3VEZA 4LD0A 4KN4X 3DLLL 3S17J 3EHRA 2FU4A 4MFDA 5GAOq 3L2UA 2AQFA 1X3ZB 2C0TA 2NUTB 2HQHA 4YPRA 4Y13A 2WSEE 1NJIC 1C1BA 1GFCA 1OCOH 4UVBA 3HSCA 3E2UA 4DTJA 4B9SA 3V9SA 4AFZC 4XORA 2CZ1B 3HP9A 2HEQA 3MP1A 4CBXA 2P9SA 1NK8A 3DWLE 5L3FA 3ZYYX 1YJWT 1T56A 3QPHA 2L9VA 1NGAA 3T9NA 2JNGA 1LWYA 5KYYB 3ULRB 1YHQA 1YITN 3CWUA 4LITA 2G3RA 2HSEB 5GADJ 2FZGB 4A0ZA 2HFHA 4IWVA 2YG8A 3CC2Q 3KEOA 5BS6A 1N8RO 2E5ZA 3CPWA 2IAIA 3FZFA 3WU2C 1S5LC 2L9SA 4R5PA 4M77F 4OFAA 5GMKj 2M51A 3BP8A 1KG7A 2YHTA 3QETA 2VKDA 5IPAA 2PMHA 2LR8A 3KLFA 2O4XA 5DM7L 5LLQA 4RM3A 4J9IA 3GBGA 3SK3A 3MECA 2WAQN 1B9MA 3NARA 2OBPA 3A03A 4YFKF 1QQMA 4F9OA 5EX5A 4IUVA 3ID6A 2P5KA 4RG2A 4CW7B 2R7QA 4Q4ZF 1W7AA 3DB4A 2H8HA 1N32K 3GFJA 3CLQA 2F9TA 3AGRA 2F1LA 5B5EC 3IQLA 3S9HA 1QQNA 2OPPA 3SD4A 1FTZA 2D1XA 4M7DA 2LY1A 3O8HA 2R7VA 4E7KA 4ISGA 4BBSJ 4B47A 3S41A 4M6YA 1FOXA 1KAXA 3IRRA 4DG1A 4BRPA 1FEXA 1HQUA 3UATA 2DEUA 2D8HA 1Q82R 2GOXB 3IKVA 4RCHA 3A8YA 3BG5A 2BXZA 1YI2Q 3FIWA 4RW8A 3LA3A 4B43A 4FJMA 4BDZA 4AIJA 1FYMA 2LFBA 1S1WA 3K2ZA 1WAJA 5ILVA 2IGOA 4FWKA 1IDZA 1QVFS 2X9HA 1KFZA 1VQ7T 2OTJI 1K8KB 1VQNI 2TDXA 4EM1A 3CUQC 1AD5A 4RW4A 3OYCA 3RI4A 2KQWA 3BY5A 4NHJA 4C2UA 2LG4A 3FZMA 1KQ8A 3IAM2 1XS9A 2EWNA 3WEEB 5GAN8 3W0LA 2QSFX 2O31A 3CCLI 2XHIA 1IC8A 1T0FA 2LQ8A 3L4IA 1HNIA 1UGSB 2YR2A 1NGNA 5ECAA 2VOPA 1D8JA 4KI4A 4XOPA 3NHNA 5D7UA 2JZYA 3OH6A 3C65A 2EIJH 3FR0A 3RQ4A 1V4TA 3FHFA 6PAXA 3CCLQ 3A2FA 1YJWN 1DPRA 1X2MA 4AUXA 1Q1HA 4A63B 1QSYA 3AG4H 4ZYHA 3ZQCA 1WSFA 2ECCA 4RUGA 2KZGA 4OOIA 2X78A 1X19A 1Z7UA 4M75G 4A3GJ 3TSZA 3NH0A 4EEFG 1VIFA 4AHSA 5F0XA 5DMRA 2HYGD 4NYNA 1KD1U 3EAEA 4GMJB 5J4VA 3VS4A 1S9HA 2RPIA 3THXA 1GV5A 3WXLA 2HBLA 1MJBA 1S22A 1S72A 3EGXA 4CD1A 3S1MJ 5AQFA 2B5JA 1QZYA 3M9QA 3I55A 1GOAA 1QVFP 1WDXA 2HKNA 2KT0A 5C2DA 3JW4A 1MBGA 4HAMA 2CDTA 4BR4A 3OWTA 1PHTA 1QSSA 1A5WA 3OBYA 3VB2A 3NF9A 4M3TA 4A2AA 2HKOA 2V7FA 2LQNA 1HJRA 4JK7A 2QK0A 3DXMB 1ITGA 2B86A 3E9FA 3JRGA 4A4FA 4M3UA 1BA0A 4XU2A 4RAGA 2HDWA 1UHFA 2A36A 3HT3A 2HL5C 3VA0A 2ATQA 2M7BA 2AP1A 3ZSOA 1U2VB 3CC4I 5EOYA 4A6EA 4NL2A 1NOZA 3CCMN 1OPLA 3JSCA 2W40A 3Q3SA 3JCMd 2O8BB 3CG7A 5IHIA 1W5CC 2A42A 1Q95G 1TKTA 4I9QA 5J6XA 1KQSS 3K69A 4YIFA 5EEGA 2XD0A 2F9WA 1YITQ 2D6FA 2I7PA 2E3IA 5ADXH 2IW5A 3GG4A 4A3DJ 3CCMI 2VQCA 3FX3A 5FU6B 4C0GA 3ZXSA 1K9MU 3I9V2 4XLAA 5C3EJ 4KISA 1JBMA 3J81K 4B24A 3H1CA 1JXMA 3UKRA 2IGNA 2O4GA 2HVSA 2PVOB 1IV8A 2LREA 2NS8A 3HSFA 3WU1B 2IT0A 4PQUA 2FO0A 1NLOC 1NU0A 4A3BJ 4C8QG 2BKDN 3BF3A 4A3IJ 3VQ9A 1ZHFA 3E6MA 2EIFA 5EGOB 3T5XA 4LF5K 3QG1A 1J59A 2L54A 2GNCA 2ZBKA 3CCUQ 2LDUA 2DA1A 5M3MJ 4IOAL 1WJEA 4NCAA 1Z77A 2DFEA 4B4CA 3SJHA 1YF5L 4DOVA 4ZC3A 1YCYA 3RBBB 3DXKB 4CSWA 4P55A 5L3GA 1M1EB 3OB9A 4KB1A 3O4NA 2MSYA 3QIPA 1YQRA 2JPSA 2XVCA 4J6WA 1SQKA 3OIQA 4GW6A 2E1OA 5C24A 4H0PA 3P9CA 3BR5A 1YG2A 1SAZA 1M1KC 3ZQGA 4OO1J 1Q7YU 2PYJA 1ETWA 4FL6A 3H6ZA 1B59A 1RACB 2HQEA 3CCET 3TGNA 3EZ5A 5AQNA 4CICA 1VHXA 4JRIA 3PNTA 2G0EA 3ULDA 3JRBA 1XHZA 3OYDA 3BR6A 4IOAF 1JT6A 2X4HA 1XMAA 2OCEA 2ZSHB 1Z05A 1VQ9N 1HJOA 4X9CA 3CBMA 2TRTA 2ZPGB 4ZJZA 1X75C 3EY1A 3TAPA 3VV0A 4FO0A 4ANJA 2DO7A 8AT1B 3M57A 1GFDA 1UG2A 5CJ9A 5IP6A 3CF5F 4M6XA 2VUMJ 2LC4A 4AVPA 2ZWHA 3EPZA 2XAHA 4LF7K 3BY7A 3CCQA 1WNLA 3S8PA 4EDUA 3Q9SA 2ZXJA 4UB8C 1AWWA 1YJWQ 3ZEUB 4OP0A 4DSJA 4LUEA 3AVHA 2CYZB 4JI8K 4FYXB 2Q1NA 2JHNA 2ITMA 4IHYA 1VQMA 2QBYB 3MCZA 2D0CA 5J39A 3H3ZA 1WKMA 1ZBSA 3JB9F 2YJEA 1H9GA 1KGSA 2MFZA 3K6GA 1YWPA 4P5OA 1ZG5A 1ERDA 2O4XB 3CC2T 1NKCA 3D5RC 1M5Q1 4KT5C 2KDZA 3CLOA 1FNNA 3VDXA 4LSLA 4MDBA 4FK2A 3RSEB 1FT9A 4NL3A 4D7NA 3I5SA 2O9VA 1RKTA 2CT4A 3JCMe 1R1VA 3QJYA 3BJAA 4RBOA 3AO1A 2EJRA 5HODA 4BBRJ 3LDPA 3LSRA 3DEEA 2E2QA 3VW4A 2QAZA 3E1SA 2AKKA 4MLOA 2EFOA 2IVMA 3PQJA 3ATVA 3GTQJ 1CKAA 3NEUA 3F5TA 5BREA 1XQSC 4Q5SF 4CGGA 3KYCB 1YTAA 1P7IA 3G10A 1Z9ZA 2W25A 3WTUC 4A3EJ 2HS5A 2X4JA 2DTUA 4KT6A 3CCRN 1EV7A 4CUGA 2A5YB 3JAME 1T0HA 4Y1DA 4FL9A 3E6BA 2VPRA 1JE8A 5CYVA 4JLIA 2KAFA 3DBHB 4ZYGA 1HW2A 4FT4A 4QT7A 3DM2A 1KLNA 2OI3A 2E4LA 3VS0A 3L3VA 3CCVI 5BPDA 1Q8IA 2MC3A 1VQ5A 2W48A 3GMEA 1O3RA 3KXTA 4RTFD 4W5TA 1KVAA 1VQ6I 1ZSGA 2JVGA 1TUDA 4AI5A 1B72A 2GIVA 2R7ZJ 5C4JJ 3NAUA 3RKXA 1K79A 2K79A 1AWXA 3MMVA 2KP6A 2HWVA 2Q2RA 4XTYA 4Y4RA 3K58A 4KA4A 2LNBA 2NUBA 3H3OB 5BPNA 1IUYA 3EE8A 4ZYEA 2CW7A 4B8AB 3NDKA 4BQQA 3K70D 3WE3A 4N0AA 1QVGP 4I09A 1JRIA 5AZJA 1YJ9N 3BJOA 2K4BA 5HOOA 3LH0A 1HLUA 3KIOA 4BY7J 1MSEC 1KA8A 1U5TC 3I71A 2CQXA 4O0JA 4BRHA 2R5YA 5BRFA 4WK8F 3T69A 3A8LB 4OF1A 5FLXO 4X66K 2E7XA 4RW6A 4FM0A 2MBFA 3J7AF 3QWXX 4E1MA 4BVPA 2MMPA 3H35A 4B1ZA 3REOA 3G25A 3MQ0A 3CCJI 4O3MA 2JTEA 2M0MA 1NG9A 3JCMb 2QWOA 2RJDA 2VQHA 3D7EO 1BIAA 5FPMA 4VUBA 4UB6C 1QSLA 2V75A 3CUQA 3TTFA 4BREA 5GPCA 2DTIA 2E8AA 2AK5A 4F4KA 3O9SA 3VETA 4ZN1A 1O57A 1QLYA 4D9JA 3X2QH 4HG2A 2DA2A 1J5YA 4GYIA 4W5NA 5J4YA 3KYLA 2DE0X 3EFOA 1RETA 3K5LA 4QIWN 2LY9A 2RV8A 3G3ZA 4QOZB 5GANg 1UJ8A 2SRCA 2XAQA 3H5NA 3L09A 1OU9A 1RT7A 4M7DC 4IEEA 3FDRA 3M54A 2PTKA 1BJAA 3DBRB 5GAMh 1JU5C 2L0KA 1YJWA 3QEPA 1S29A 2HL3A 2BXYA 2LT1A 1ZYRF 4GV6A 4A2UA 4PHTX 1GLNA 3TDZC 1H3ZA 1VQ8N 3QINA 5EZGA 3SAHA 2CO5A 3FXUA 2LF8A 4IPAA 1HRHA 1JLEA 3DBLB 1KO9A 4M3BA 5DD4A 2M3AA 5D8KB 2OTLI 2I10A 3FZHA 5FLMJ 4XN0A 2QWMA 1YP5A 5HRPA 3BEXA 5M1PA 3RPUA 3HOVJ 2DY4A 3OYMA 4OPHA 3TW6A 3ER0A 2Z3YA 2HHTA 3VERA 4RTXA 4HTLA 4KIFA 2OA8A 2RQRA 3CJTB 1VQ4A 3W6VA 2HB5A 2QQRA 1P6RA 4PJMA 2RQVA 3S6WA 2D5VA 1KQ0A 2ZMEB 1BIUA 2L2PA 1UA0A 4E7SA 2ZE2A 3ZMDA 1FX7A 3CCEA 3SUOA 3Q0UA 4PJOF 2YNHA 1PD1A 1NK0A 2V1DA 4K2EA 3K0LA 3M8EA 4XK4A 2R7SA 2HVHA 1LWWA 4EA4A 2VKEA 4QKUA 2EZHA 2X6NA 2QTVA 2XDPA 5LFAA 3QPSA 5M1OA 4EJTA 1EQYA 2K86A 3KP2A 4RAYA 2HU9A 2EIKH 3HPGA 4DGWB 3MEDA 5AQIA 4NYFA 4M78D 2CGKA 3L1AA 1YW9A 3QUIA 1JLGA 2WOMA 3R0AA 4RGXA 2KROA 3OV8A 1WI7A 4DYQA 3A98A 5LJ5e 2E1HA 1U49A 4BC2A 1SFUA 4E0DA 1VRTA 2KW4A 2IVNA 1YIJT 3I4NJ 3JREA 4K11A 3IH3A 4JUVA 1ULYA 3O8GA 4KHSA 4V19S 3EO3A 1PKSA 2CWEA 2YSRA 2F8SA 3BC8A 3ZRGA 4JKFA 2JRMA 4BRNA 1TWHJ 3IMXA 4NZGA 3A8MB 5EGOA 1YIOA 3CMAA 4L9NA 3GTMJ 4IG0A 2R5MA 2QA4I 2KR3A 4HUEA 3CP8A 3LFKA 3F6OA 3K4NA 1QW1A 3OJSA 3OYIA 5J3LA 2AXLA 1BKBA 3FM5A 3I55Q 4NCGA 4M78A 3H0FA 3CMAI 4HW0A 4CCNA 3M07A 1D3BA 1S72Q 2MGQA 2YHYA 3DRRA 4M7DF 1N8RU 3CQYA 4M77D 3GZ5A 3OYHA 1M8VA 3CMAN 4YOTA 4EGZA 4CJUA 3SDGA 2ZGWA 3JRFA 3NWTA 3PIOL 5HK0A 4M6VA 1EKEA 3JCMc 2FEIA 3EUKL 1E3HA 3PMIA 4BUPA 1XCBA 1ZBLA 2RK1A 3M4YA 2HDAA 1YAGA 4EQQA 3CHWA 5JHUA 4DA4A 5SWMA 2FBKA 3NGPA 3A4CA 2EB7A 4CF9A 3JCUC 5C0YA 4C0ZA 1Y56A 1AU7A 1IN4A 4LNPA 4MMLA 1UFMA 1OQKA 3QDFA 5BN8A 4M77C 2ETHA 5MLCQ 4PJJA 2OAUA 5HRNA 5HNFA 2LJ0A 3RPUD 4B09A 5LEKA 1RAIB 2KQ2A 3THKA 4M77G 3VS6A 1PKTA 4U0WA 3RRHA 1BGXT 4OKKA 2GXBA 3QPLA 4KPYA 3HSRA 2QQ9A 2NNNA 3LOCA 4CO8A 4QQDA 1P2FA 4UVCA 1OX8A 1KD1O 4C8QA 2DFIA 1EH8A 3KZBA 3FXJA 3CWAA 2K27A 3CMEQ 2PAVA 5DV5A 1HA8A 4GVMA 4F2RA 3HM5A 4GY5A 1E3MA 2FOKA 1YITI 1QZZA 3OVNA 4M9XA 3IG1A 1PP7U 1ETVA 1V76A 1ZBIA 4AT1B 2ISYA 4GYGA 3CQ8A 3DXMA 2DFUA 4YOQA 1LWEA 1SKUB 4MO5A 3C94A 3RDVA 2NS0A 3URGA 3DP7A 4XKWA 4YHHK 1XD7A 3J7AY 1Q7YC 1R23A 3P31A 1YJNN 3CCVT 3O8MA 4GBQA 4C8QB 3SWNB 4CJKA 4TV7A 4QAGA 1JKOC 4F92B 1BA5A 4M78C 3FSPA 2M4GA 1OCPA 1HX1A 5TKWA 2LY2A 3H0HA 3QU3A 2LTOA 3A8GB 3ATUA 3G4SN 2R7FA 4A4KA 5LJWA 1W9HA 2DXBA 3O5BA 1IO6A 3QDRB 5F1XA 1KC8C 1YJNI 5FKNA 4PJOB 1W7PD 3GUDA 1VTNC 5I11A 4KULA 2NVUB 4BJ5C 5FKLA 5DY9A 3N5NX 1Z6TA 5FRMA 1TGOA 1XTDA 3S3OA 3WNGA 4B23A 1M1GA 1QVGM 3WGGA 1C6VA 2O9SA 4KTWA 3CDHA 4M78E 4PJLA 1LNWA 3HOZJ 4JRPA 4JX4A 3CFRA 1YI2N 3F9MA 5I42A 1RR8C 1Z21A 3BQYA 4XU1A 2QGUA 3D7SB 4J83A 3NCIA 3VYTB 4ESJA 4OGCA 2NRXA 1X3MA 1XGMA 2B0LA 3M0SA 3GTKJ 5CHIA 5LJ3g 2VC1A 1M3CA 1SRMA 4RGRA 4M7DD 4MGRA 1RADB 2VOOA 2LKXA 1U6ZA 2FD5A 2GX9A 3VOVA 1R58A 1NM7A 4M75F 2QWLA 1DLOA 1KVBA 1RDAA 2PMUA 3DTEA 1OH6A 1LCKA 3VJPA 1BI4A 3CIPA 1ETKA 3NPFA 3F73A 3VYSB 3OOUA 4LD9K 4J2DA 2K3BA 4L5GA 3LSPA 4PL6A 1IW7F 1P4WA 1NLVA 1I81A 1MHNA 4PLIA 3KBGA 3RMDA 1VQKN 1UG0A 1UMQA 3CCST 3LANA 1O3SA 3OYEA 2PJRB 3ALYA 4LD5A 2IS4A 4A3FJ 4CCLA 1HD3A 4OB0B 1ORNA 3G0ZA 1LOJA 2FQ3A 2VKHA 3D0PA 2V8IA 1ZR2A 1YJWI 2A5XA 1A04A 3MWMA 2XGXA 2QKMB 4K8XA 3CQXA 1OULA 2G8HA 2Q0UA 2DT5A 3O9TA 4HRIA 1WEGA 2ZFWA 2FBYA 4CEOA 3I59A 4HV6A 3PL8A 4FWNA 5GTIC 2L3PA 2ESHA 1NGEA 1RT4A 1OCTC 3JB9G 2DODA 4BS9A 4A5AA 1JXBA 2BHYA 4B8CA 2VG6A 2GXAA 4KGXB 1NKUA 2H09A 2PN6A 3I55N 3ZCOA 1SRLA 2P5LC 4FJ7A 4X6AJ 5KYNA 1LFPA 3VMFB 2DPPB 1JLQA 2LQWA 2BVMA 2X4XA 2JT4A 4CC3A 2DTOA 1TL3A 1R22A 2DFHA 2W00A 1H1VA 3U4LA 5AZIA 3OQ5A 4KTZA 5FROA 5A2QZ 2YCHA 3I59B 3RRGA 1UE9A 2K57A 1UAXA 1DEJA 3TP3A 2R5YB 4JJCA 1L3VA 2W4SA 3CO7C 1J6ZA 1H8KA 2X6XA 4YNQA 4P96A 1X1PA 4RLQA 1JJ6C 4JI2K 4A2BA 3M56A 4RGUA 3TMOA 2EYWA 2D1KA 1WH7A 2CV1A 1U04A 3BF1A 2IGMA 1ZN2A 2LVSA 5AQTA 5GAOp 2VG7A 4M3ZA 1WHMA 3EUHA 1RDDA 2NVQJ 2IS2A 3OL4A 3J81E 1X6OA 2BVLA 2CUDA 4Z4HA 4LJZF 2DN0A 3VESA 4H03B 5JVGF 5K5OA 2FB7A 2L4AA 1I5ZA 2MYSA 2KK4A 4ISFA 1T03A 1VQ9A 2KPMA 4HQMA 3BUZB 3P83D 3UDCA 2X1DA 2F48A 3MXMA 4I2PA 5C10A 4Z4IA 1W97L 4CYDA 3EKSA 2NOBA 2ASPA 3K4CA 3CCUT 1GV2A 5HLGA 4JYKA 3FK7A 3WEEA 4JZ3A 4Z2YA 2W6KA 1SEMA 1HR0K 2CZ0B 1W6XA 3HDDA 2AZSA 3TQ7P 4PJ0C 3FXQA 3WXIA 4QVZA 3VQPA 2DM1A 1F43A 4HT8A 3DEUA 3QODA 2ZPBB 4UY8I 1O13A 1LFUP 2AO9A 3RSNA 3JCMP 3T0YA 1J5OA 4BY9C 2JW4A 5BRHA 3QPTA 2DRMA 3EH2A 1RBRA 2LTPA 2BEOA 1BDGA 4AHCA 1B6AA 1K4US 1JJ2A 2EGAA 4A6DA 2VG5A 1P7JA 3GPLA 3GTPJ 3NTKA 3DXJF 3M55A 1VAZA 1NH3A 3TBIA 3EZWA 3AVMA 3X25B 3ZQHA 5CKDA 1KXPA 5GAOr 4XRMA 2BYVE 1Y39A 4J7FA 1X9MA 1STZA 3P38A 1QQOA 4LSNA 3KK1A 2W85A 1SVMA 3MZ8A 3FC3A 3CF5L 2XSDC 2Y1JA 1D4XA 5IHKA 2OJ2A 3JB9I 1S7OA 4M3XA 2R7YA 2O6GE 4H0VB 2YSQA 5CVJA 4IHTA 1TOVA 2IC3A 2L7FP 1N9RA 2DBKA 2M0OA 1TUGB 2Y9ZA 1MU2A 1FKOA 4B9XA 2G8KA 4EJYA 1JXOA 1BL0A 1Y71A 3ZT1A 4CEFA 2FRHA 1VQLA 4CYCB 4FJNA 4CVNE 4EJUA 2A6AA 2DYSH 4C5HA 1QCNA 3CFPA 3VPRA 4RKUE 4EATA 2XIDA 3JSPA 2P9LA 2B4JA 4CEBA 1I50J 2DOFA 2RJEA 4XLPF 1MD0A 3WQTA 4MQ9F 1UHWA 3LWIA 4CJQA 3MAJA 2IVPA 4H5VA 3VF4A 3VRZA 2YXYA 2DRKA 2EBPA 1YW7A 4LDVA 1IBLK 2UV1A 1BBYA 2DT7B 2NLXA 5KPRA 4BI4A 1WBBA 1BWFO 1MNEA 3TO6A 1JJ2P 3PVQA 1DTQA 3CWTA 1ACMB 4Y92A 3JSOA 5CZ1A 5CYMA 2DIGA 1B8IB 3KTQA 2VN2A 1SSFA 4QVDA 3G71I 3OY9A 2W03A 1WBDA 1SKSA 1NGFA 1S9GA 1PSEA 5LHIA 4ESFA 3V1QA 2GV9A 1RI9A 2YHAA 4BR2A 2OTLT 4I01A 2MH2A 3WE2A 3V81A 4IOCF 2EGEA 1OPCA 3EG2A 1J0RA 1NGCA 3EG3A 3JB9D 4LB5A 4Y33A 5D5VB 1WSJA 1V54H 5C44J 1OMIA 5J8FA 3G73A 1MJ9A 5EC7A 2G8FA 1E2XA 2VUBA 2Y69H 2JN0A 1M2OA 1JT0A 3VYUB 4XN3A 3VSKA 4ELTA 2F5CA 4ZTJA 1I3AA 3GTOJ 4AHRA 2BIVA 2RHKA 5AQJA 1QKWA 4ZYAA 2I0NA 3SAFA 1WHKA 1QVTA 4AFSC 1IKXA 2O8DA 3PVLA 1YXQA 3MWPA 4YOUA 2FUG2 4WYBA 4DR3K 2DMQA 1IG7A 4DNCA 4AI4A 2M9UA 3AARA 2DDAA 1PJRA 2IXSA 1IREB 4M45A 2K9GA 3GVAA 4AVZA 3GCMA 5AIQA 3RVCA 1OISA 2ZJQF 3G4SA 3KLHA 3EHQA 3ULQB 2ECZA 1TT5B 1U4BA 5C0MA 3WUHA 1UGPB 4PFZA 4FLYA 1VQNA 3MN5A 3S93A 2VQEK 4B08A 5CVVA 5CKHA 5LY3A 5GAGJ 2F2WA 4E1NA 1V4RA 4M3DA 3PSIA 3SWNA 4LC9B 1ZLJA 3GO5A 1EFNA 2M2EA 4CF2A 2HVRA 2X1CA 4DYCA 4FASD 1NBWA 2KJBA 1P90A 1JO8A 1NK2P 1BC8C 4IHSA 1IZ6A 1YOVB 1W2BP 1FOWA 5HROA 2JA2A 4Z4EA 5IOYA 1VQNT 4CJRA 1U3EM 3VF6A 1VQ5Q 3K10A 2GF7A 2JS2A 4KB0A 4WFNL 4XLFA 3K2AA 1Y8QB 4C3JJ 2ITGA 1VQOT 4Z0UA 5KCMA 4WF2A 2PLYA 2B63J 2LMJA 1VSFA 1XTAA 4G9YA 4I0AA 1Z26A 5C2FA 3FMSA 1FPQA 1BI1A 3CTAA 5CR2A 3KE2A 1MUYA 4KH0B 1HXDA 1KG3A 3CMAQ 1LUJB 2Z16A 4D5CA 3LNQA 2O9LA 4G12A 1SFOJ 2PEXA 2MWPA 4XNFA 4M75C 4ELYC 2DMOA 1IDYA 4I6MB 1K73U 1KU7A 2P81A 3OYLA 3JRZA 3KLGA 4NNJA 4M7DG 2F2VA 1RDWX 3LM9A 3ZPLA 4YORA 5E8GA 3D2FA 4MLEA 2L4MA 4EM0B 2LRQA 2E70A 1FMKA 4RS8A 2E60A 3VSLA 1WJSA 2VYTA 5H6QA 3ISPA 4XSXF 4DEXA 3LZJA 1R0CB 4DZJA 1FJLA 4I76A 1TNSA 5AQRA 2PUKB 1RAFB 3T1AA 1OZ3A 1IRFA 4JI5K 5GMKl 4BG8A 4KFBA 2XSJC 3GF5A 4XKBA 4P9FA 2KIFA 2P0QA 5CQGA 2EPFA 3ZSRA 4DR2K 1LJ9A 4A5NA 1NK6A 1K61A 4CHUA 2XKOA 3PX4A 4I0BA 2A28A 3PO2J 3DMJA 4AC0A 2WWYA 3OSVA 2E19A 4E7LA 1LPLA 1GCQC 2XAJA 1HKBA 4OAZA 4I6ZA 4JN4A 4E89A 4P9UA 4YOWA 1FIAA 2VVKA 3TTCA 1NK3P 4E7ZA 4JI4K 5C4XJ 4GY2B 3ZLJA 3EDPA 1FY7A 2OTJA 4BVOA 2GQIA 3LDOA 1Z7LA 1VSJA 2JTFA 1E3PA 2BE2A 4U7DA 1KG2A 1LQ1A 2CGJA 2M0CA 5GAN4 4XRSG 1IGQA 1ESVA 3CMEI 2BZYA 1WSUA 4L59A 2AHQA 4M3FA 2V1QA 5GMKe 3Q5FA 1RTHA 2YHXA 3UR3C 1FYLA 4XTUA 1P8ZA 3RCOA 3MN6A 5AZJB 2XV4S 2YPRA 1KHIA 1J2XA 2UXBK 1VQKI 2DD5A 1LWVA 1JCFA 2D0OA 1OOTA 2XMFA 3KUFA 3ZQLA 4C92G 3VQBA 1IKYA 3OOPA 4KDPA 3REBB 4IFVA 1X2NA 3MP6A 4R56A 1GLFO 1LE8A 1K8AR 1NJYA 4O5FA 1TUCA 4IG3A 1UHMA 2DFFA 3GTJJ 5DEQA 5LHGA 1JTYA 2UUZA 3G6ET 3WNHA 3S6IA 1TS9A 4CGDA 4EHUA 4M7DE 4XRFA 3R9PA 2RPNA 1Y1VJ 1RRJA 3M0RA 4R55A 2AT1B 3MPUB 4J2EA 3QFPA 1R8OB 4RDUA 1MNDA 2DPNA 1VQLT 1JLAA 3OTOK 1B7TA 1T05A 2DBMA 5LJ5g 2JMAA 2K5FA 4NQWA 3DLLA 2PG4A 1IXCA 2NOFA 4XOTA 2QA4Q 1YIJQ 3WTVC 2M34A 3L9FA 2KJCA 4Z89A 3T1HK 1VQ8Q 5J47A 4JRKA 1Z91A 3QOEA 4PIIA 2AXTC 3CM5A 4J9CA 2JM9A 4CHZA 3IRXA 2CUZA 5K1YA 1K8AC 2KRSA 4C8LA 1MSFC 1VSDA 1M2VB 4JZ4A 1MDMB 1EP4A 3HZJA 3MEUA 1NMNA 3EL2A 4BRGA 5TKYA 4YOVA 2F4IA 1S72T 4PGHA 3TSPA 2KXDA 1KU9A 5C42A 3BY6A 1BI2A 4JLHA 4LH5A 2L3RA 1O1WA 5CKFA 4D8KA 1HKCA 3VGLA 4DV7K 4FLTA 4M78F 2JVVA 3BJ6A 2AIRB 3DI6A 4A0XA 4GFBA 4YFUA 3IWFA 2A3LA 3HHTB 4LG0B 3CETA 2JMWA 4RTTA 2R57A 5I3UA 2L89A 1PD0A 3U8XA 2FJ1A 2B9SA 3DOKA 4ON0A 2HVQA 4FIBA 2L3QA 1LWFA 3QICA 4RTUA 1O4XA 4BJ6C 4ELZC 4U88A 1KQSA 3DLAA 1SAUA 3S32A 1W4SA 3F2KA 1KIKA 2KZVA 3H92A 1JKPC 3IDHA 1HQEA 2P7VB 3LWFA 1E6HA 1PRLC 2FRYA 4AM6A 2Y2ZA 1B92A 3A0IX 3T1YK 1LEBA 4EP4A 1YW8A 2GQVA 3LGFA 5EXWA 2F96A 1NGIA 1YE9A 2W7NA 1BIZA 3N97A 5FO5A 4OINF 4CZJA 3AFHA 4DHYA 2CYYA 4DTXA 1Q81O 2FA5A 3MN9A 2MIOA 2HVIA 3DTIA 5I22A 4UXNA 4LIVA 3OIOA 3HEFA 1GLJO 1G15A 4IF4A 2M8GX 1KQ2A 2JGUA 2O4IA 3RZDJ 3ABTA 3ONQA 2ZO4A 1QZ6A 4K25A 3F0CA 1QNTA 1G2BA 5LRSA 4CRIA 5KPZA 3UKRB 3U9DA 4A4GA 2Q1ZB 1HDDC 3HSTB 4DK9A 2GXGA 3SEQA 1KAYA 2QKBA 3I55T 2KDSA 3C6TA 4HPQA 1W7PB 2STWA 1XC5A 2I2LA 3L2WA 1OI1A 4X65K 2AHJB 4HVVA 1Y0UA 2B7EA 1DDNA 3ZSVA 1ZQ1A 3WHCA 2D0QB 4GV3A 1YJ9A 4HCZA 4DR6K 4C5IA 4J01A 2PI0A 2FVUA 1JTXA 1PU7A 2LF7A 4AYBA 4E3SA 1A5VA 3HVRA 3L1PA 4OGEA 1JCGA 1MH3A 4OU0A 5F08A 4X9DA 3ZT0A 2COBA 2CUFA 2KRNA 1D1AA 1H0MA 1A6QA 3WHBA 3RYRA 2O8EB 4JYAK 5GAMe 1Y0MA 1X4PA 2D0AA 1IJWC 2YRDA 4B6MA 2V52B 3META 1HU0A 1OKJA 4FVMA 2IJLA 3VQEA 3MO8A 3TCJA 5GAMg 2FE3A 3CMMA 4IRIA 4CYCA 3D5SC 1Q1VA 2LJ3A 2VXDA 4ZZDA 1YCSB 1W70A 4J2BA 2FF6A 3WTTC 4JQFA 2BW3A 4I02A 4QS8A 3ZSQA 4BR9A 1K8AO 3HJFA 4KKOA 2W82A 1MMGA 4GCVA 1NYGA 5D5WB 3M7GA 2F5TX 1DKGD 2PJPA 3THYA 3O1BA 3KNTA 1OVYA 4LG3A 2KQRA 1XJWB 2XU8A 3O8VA 2JHJA 1JLFA 3OHRA 4QTRA 4OPAA 2HDCA 2GWKA 3CMET 5LJ5d 4DLGA 1XNRK 3J7YP 1OZ2A 3CXCA 5IXBA 3IH7A 3N4MA 2YLCA 2HBJA 2UUBK 3CZ6A 2H3GX 4ZGEB 1BJZA 3KZZA 4RB3C 1Q81R 5E18F 1EH6A 1I07A 1QBJA 4B9MA 3RERA 5CKEA 4QSHA 4F04B 4BHCA 1YT3A 2E2JJ 3V8JA 2DMNA 1ORPA 2KKOA 4FM2A 3QEVA 4Q47A 2ZF5O 4KH6A 1SEUA 4ZNXA 1M27C 4N0AC 2MWOA 2K4YA 1ZUYA 4EJVA 5ICCA 3ENOA 4OX9K 1J9AA 2HQNA 4CCJA 1OPKA 3CDIA 4OJRA 3GTLJ 1X4OA 2ELHA 2QDLA 3L6QA 5FB2A 1M1KU 4LF8K 3HFOA 4DOZA 4KRTA 1B9NA 1MUDA 5C15A 2DTRA 2UZKA 1MGTA 1LEAA 2W42A 1JGSA 5JLXA 2DBBA 4W5QA 4IO8A 1QO0D 2QA4T 2FXUA 4A69C 3JCMf 1WJAA 5IT9K 2FX0A 2QM3A 3F21A 2OPSA 1IAWA 1VQPN 2HGCA 2A69F 2E1CA 3OA6A 4AFUC 3S3MA 3FB9A 4FOIA 3SEZA 3BR3A 4CJWA 2NOEA 4D1QA 4A3JJ 1R0BG 2DZ9A 2P9UA 4BEHA 1YVUA 2H1LA 2LJ1A 3E3VA 4PZJA 5KE2A 9ANTA 2LD5A 3WNFA 1MKMA 1N6QA 3LA2A 3BZCA 2QEXT 4F2SA 3BTLA 3C3WA 2J6KA 4IDHA 4N76A 1FP1D 2F7TA 4DV0K 4DTNA 4JKGB 1IH7A 3I33A 4C9YA 3NNQA 3HXLA 1K1ZA 1JHHA 4OLBA 5AQUA 3C6AA 2QXLA 4ZGJB 4CK1A 4HYEA 2W6LA 4S0HB 1XG7A 3S1NJ 1TU0B 4M77B 5KVRA 1ZKGA 2JG6A 1R1UA 4XTVA 4H0XB 5HS9A 5FD6A 2ACJA 4V19K 1NJXA 2R3SA 2QWNA 2QWQA 2VIXA 1AZEA 1M1KR 3HGGA 1RBTA 3O08A 4AM3A 2MLKA 2JN6A 2QZ8A 1HSTA 4DUYK 4E7JA 2AA4A 4UV9A 1JUPA 4YIIA 3F8CA 1R59O 2VGNA 1OEBA 3PE0A 4HUGA 2IVWA 2Q2EB 4CJ7A 3SMSA 4ABZA 1YVNA 4BRMA 4AHTA 4DF8A 2UWMA 2IS1A 1M2VA 3N05A 2KRMA 4M3WA 2RA2A 4LFUA 3K4MA 1FBUA 5I21A 3KK2A 4NUBA 3CPWM 3CC4N 4C8NA 1W1FA 2VASA 2XPUA 4L5JA 3VRYA 1SKWA 5KCHA 4CD3A 3KLEA 2XK0A 3QMLA 1HPMA 1YNZA 3SI6A 5EU7A 4IJAA 2YUNA 1M3BA 4F16A 3O9QA 3SCXA 2FXAA 3A1YA 4FQGA 1BO5O 2CU7A 2OQRA 5GAHP 4WQ4A 4FW1A 3ZN0A 4EVIA 4B3RK 2HW3A 3INZA 4DJAA 1VQ7A 5H20A 1VQ5I 2KEAA 2O8XA 2L01A 3RMCA 4Y0WA 3AKZA 5LRRA 2JZ2A 3VS1A 5EYRA 2EHGA 1TL1A 3QWLA 3AV9A 5GANd 2QUFA 1T3VA 3KP4A 1U47A 4AWXB 2DJQA 3N5BB 2HPMA 2KFZA 5GTHC 3V8KA 4PUOA 1DUXC 2EVRA 4W5RA 2OFIA 2HQAA 2FBTA 2QK9A 4OPKA 3ZQFA 5KK1A 4CHYA 3LM2A 4B9TA 1N77A 4HX8A 2DD4A 4B48A 4IHWA 1M90R 1HCRA 3CD6T 3LDNA 3U23A 3CJNA 3VQAA 3MKZA 2KRHA 1ZH5A 2PZSA 4UUSB 4HF2A 1VSIA 1ZBFA 1QHHD 2D9TA 3VQQA 1M3AA 3M1CA 1Q86R 1TKDA 3PJRA 1FP2A 3MEAA 3ABUA 5BPMA 2F4OB 1QZEA 4J2AA 3IL2A 2PUOB 1PYVA 1MMSA 1WSHA 1CGPA 4BC4A 3F0ZA 1AHJB 3OR2C 3IHUA 1I6HJ 2AKLA 3QAHA 3PNWC 3WTWC 4DUZK 1OR7A 2GFUA 2Q2EA 2K4JA 2PU9B 4KUIA 2DW4A 2F6CA 2OTLQ 4MQVA 2YKNA 3CCRA 3IUOA 3WTYC 2DQRA 4CF1A 2E10A 2RNGA 4HQEA 5D8LB 4CBWA 1KAZA 2LCLA 3JB9J 3ZETB 2QASA 4N9IA 2K9QA 3TOBA 4RCBA 1BHLA 2PNIA 2EX3A 1WSIA 4Y3OA 3F23A 2AJQA 3HXMA 4ISEA 4HXJA 1C1CA 2NUTA 3BR2A 4JP0A 3OYNA 3ECHA 2QXFA 3L2ZA 1EWRA 2YNGA 5GP9A 2DXIA 3A5MC 1B9DA 1EBMA 3NQOA 4BC3A 1ZGWA 4FWLA 3ULEB 4LIUA 5AT1B 2W0ZA 3VF2A 1EWQA 1B1BA 3HPWA 3ML6A 4KICA 4N9HA 4MDAA 4TVRA 2O2OA 4A3LJ 4B22A 3ENBA 3K59A 4J6YA 1REVA 4OWRB 2DPDA 1ASUA 2PMZN 2M4KA 4D0PA 3E9OA 2R0QC 3I56N 1ZK8A 3LMMA 1DU0A 3JV3A 3GW2A 1SKRA 1BOBA 3J7ZO 1D5AA 3SQ2A 3JXUA 1RLPC 3DRPA 4CZEA 3GFIA 4Y17A 1FMWA 3HTUA 1M1KO 4PJOE 4BRCA 2DA7A 2E34A 1X9JA 4B9LA 1X27A 3FRNA 2BZXA 3AVBA 1S72I 2HHUA 2L3DA 3MXIA 1R4NB 5HK3A 3SQNA 5M3FJ 3IS9A 1XC9A 4XQFA 4ITVA 2V8KA 1ZG3A 5CE3A 2KBTA 4E9GA 1VNDA 4CZIA 2ZJRL 2QKLB 4HLXA 4EW4A 2DKGA 3QBXA 4KN7X 2JJ7A 2O0YA 2QG9B 3OA9A 2X4YA 4N56A 4LGWA 1WB9A 4KHNA 1IXSB 3JAMK 1N5YA 4ILJA 2EBIA 2KZZA 1UJ0A 1R77A 5B3SH 5BR9A 2K85A 4H4KC 2NUPB 4B3OA 1VQOQ 1WZ2A 1V29B 2EILH 4DFKA 3EUHC 1VQKA 4M7AB 2ELKA 1NG7A 4XQ3A 3UE5A 3I35A 2NVXJ 4ILHA 3RR7A 2ZSIB 2NVTJ 4YOXA 5BOXA 3CMAT 2NZTA 4A3MJ 3TI0A 3FKIJ 2QYZA 4NB5A 4RGSA 3RMBA 4CJ4A 2L9RA 2X6SA 2A40A 3NH1A 4Z6YA 3KCCA 4KHQA 1RFQA 4BGDA 3QHSA 5GAOn 4JBAA 4RTYA 2RN2A 2FPDA 1NMDA 3JCMV 2FBXA 5E17F 3I54A 2JLEA 3LFUA 3JRCA 5BMZA 1R5HA 1HQCA 5I2MA 3WT0A 3VEOA 5E1XA 4CJTA 1KG6A 2KE9A 3ISNC 5M5XJ 1B3QA 2DA6A 1VQMT 1H89C 1YN8A 4PWDA 3SUPA 3VEVA 1YQAA 1NJIR 4M77A 2QEXQ 4YOYA 2CSIA 4DV6K 1HKGA 3C2GA 1CZBA 3WG9A 3BCAA 4DF4A 3HUGA 3CCMA 3CI5A 2RJFA 2R7RA 5LL6Z 1S7EA 3CC4Q 2K02A 2E3HA 3M8FA 1R6RA 1EXQA 2VV5A 1YITT 1TNTA 1BQNA 2Z0WA 4IKFA 4PKIA 5AQHA 1QHAA 5J40A 3V8LA 5B1AH 2H3EB 1ATNA 5A2QO 1YFNA 2LBFB 3L4QA 2O61A 1TLHB 1N25A 2X85A 2DK3A 1SFXA 1Y64A 2XGCA 2HBWA 2CP5A 4DYRA 1VYTA 1S1VA 3CCMQ 4PSXA 4G7OF 2CUBA 3TAFA 3QJ6A 3CC7Q 5FKMA 2GLOA 4XTXA 4BI3A 2LZ6B 1CSKA 4F52A 1VQKQ 4DFPA 2RVCA 2H56A 2HMAA 3AY9A 2EFNA 4NCBA 2J5PA 2XAGA 5J26A 2XF5A 2BE9B 1K0XA 5KHDA 3AO4A 1GVJA 4DU4A 2A37A 3KX2A 3F9KA 4OB3B 3NGIA 3KLNA 5M5YJ 4BU2A 3KKSA 3BG3A 1LCUA 3EYZA 1ILYA 3LWHA 1PRMC 1AKHA 1TW3A 5F04A 1IB8A 2MD5A 4IEJA 3NGZA 2YI1A 5BN9A 5EG0B 1S6QA 5FW9A 3VODA 4JD2B 2PFUA 3I0SA 1N9SA 4WFBL 1GL5A 2I5JA 1IV0A 4PSWA 1N3CA 5CCAA 4OFEA 1K9MR 3ZX2A 4CJEA 4M3EA 3LAMA 2A6EF 4OKEA 4RLFA 4KAZA 3CCQN 4L9JA 2KMUA 3E1YA 2LVMA 1M8MA 3EG9A 3CPWP 4BRAA 2Q97A 3H8ZA 1WHJA 3B73A 1FWZA 3OSGA 1T8IA 1RTDA 1O3TA 2DVEA 5T7BA 4DV1K 2O8DB 4M7AA 4LY7A 3DCFA 3E01A 1N36K 2P6TA 1UZCA 3ABKH 2A1RA 1C0WA 5DM7R 2GGRA 1KD1C 2QTDA 4E1JA 3R0JA 5DYMA 1IN7A 2CW0F 2FSKA 3E5UA 5CR4A 3PV8A 2PQ8A 2E1NA 2CQQA 4ILGB 1IBMK 3DJCA 3WTXC 1X3UA 3F8MA 3EE9A 2PX9A 4E6KG 3DEWA 3JS6A 4C92D 2XHBA 3DWLA 4CBUA 2E5LK 3EGDA 3CWSA 1KC8U 1BCOA 3CO6C 3H41A 3OIPA 5JVTA 4IIOA 2RNJA 5LJ3j 3I5RA 4IOCL 3PNYA 3JCMh 2EFIA 3IFRA 3MCPA 2JRTA 1ZC6A 5CKTA 5KYWA 4EP5A 4MIMA 2BBYA 2WV1A 1HKSA 2NNYA 2ID6A 1LW0A 2M1BA 5LMUK 1N78A 2LH9A 3UF4A 3K4BA 3M3ZA 1KG1A 2G7HA 4PA1A 1X3NA 4JKCA 1Z0XA 5M1QA 2KVQG 5DLOA 3OYJA 1HYOA 2YUSA 1CXUA 2P84A 2DL5A 4C2MJ 3WG7H 2LBFA 7AT1B 3CCJN 3F3XA 1UTIA 2VBZA 3D2EA 2BE7D 4CI6A 1TBXA 4A12A 4BKXA 1TAUA 4F91B 4M7AG 2DA9A 1A6IA 2X35A 3K4KA 3LLRA 5FLXE 3CD6A 2P9KA 4CA0A 4FETA 2DA4A 5FPNA 3S2HJ 2DO3A 1PUEE 4KIBA 2G8UA 1WN7A 3KHYA 1YQLA 4CEQA 5JFRA 3CCRQ 4BAYA 5SZTA 1K7AA 1SANA 3OMYA 1SZ2A 1WVRA 4M75E 5TISC 4BHBA 1X1BA 4NC8A 5B66C 1WXUA 3OS0A 4X62K 5JLHA 5AJ3K 3P7NA 5L3DA 4FU6A 1ZA2B 3M9AA 3CCRI 1YFHA 2Z9OA 3BG7A 3V1OA 4PLLA 1QPIA 3TAQA 5F1RA 2WBNA 5L23A 1VSKA 3QKJA 4UC4A 4EIKA 2PJRA 3GLLA 3LSIA 4MZTA 1Y8RB 2MK5A 3CCVN 4FWSA 4DQ8A 4HSBA 5B1BH 3G4SQ 1LDDA 1K73O 3JCMW 1K8KA 4ZDOA 2ZZDA 4AHVA 3Q7BA 1V5FA 2EFQA 4UNFA 1E17A 3M8QA 1SUQA 4G7HF 1WH5A 4KO0A 3EYIA 2XF6A 4QW2A 5EJCA 3S3NA 2DYIA 1H88C 1X43A 3BZKA 3O80A 1A5JA 1WPYA 3CCEI 2RI3A 3TARA 1FBQA 3WVDB 2ID3A 2XAUA 2ED1A 1QP2A 3AVCA 4B9NA 1U5TA 5DM7F 1UECA 3KEYA 1WSGA 1IN5A 2E1MC 3B6AA 4MQ3A 4NOYA 5KYXB 1T39A 2RI5A 1JXSA 4B1WB 4JJBA 3NH2A 3HYFA 2E4HA 4JI3K 2NOGA 2WTUA 4DR7K 4HBLA 4FJ5A 5HLFA 2H8WA 3ABMH 4AH9A 3U1KA 4AF1A 1JXEA 3V42A 1AKHB 4XH4A 1GXQA 3AG1H 4BROA 1VQ9Q 1D0YA 3CC7T 2IRFG 5IH2A 4EV0A 1OU8A 1KFSA 5M9OA 2JA7J 2XG8D 5EG0A 5J2NA 4DFJA 2HYJA 3TSWA 2CH0A 3OW2A 3ID8A 1PU8A 1VQ9I 2D4WA 1WXBA 2KGTA 3MVPA 1IN8A 5E26A 3CUQB 3TOAA 1FTTA 2Z1HA 2VBXA 1YTUA 1ZAOA 3FZKA 1OYYA 4ENMA 1NHAA 2CQ7A 4JJDA 3HI0A 2O8CB 1MUNA 1Y7XA 3ZSWA 3ZMUA 1U48A 3M3YJ 2ENMA 1NGDA 2VYPA 5HY6A 3I4MJ 1K9MC 3UWNA 3Q0WA 3LPUA 3LSJA 2EYQA 2YV0X 3TVTA 4O44A 1WIEA 4EAHD 3G0QA 4LK1F 1IGNA 1KG4A 1GOCA 1S5JA 1C1AA 1W0HA 3HSEA 3G1MA 3CUOA 1PUFB 4XL9A 1SS6A 2EJ9A 3SV4A 2QWRA 5AQXA 3OW2M 4Y15A 5CY4A 1BA1A 3CJ9A 2FL7A 3O3HA 3FHZA 1EJ9A 1NK9A 4XLNF 4LLNA 1FYNA 5C12A 2D2WA 4KYWA 2MOXA 3FMRA 3DLMA 1T3SA 5ADXA 2PY5A 1PG5B 1RDBA 2QA4N 5I2SA 4K43A 2K3PA 1OLTA 1E6GA 4LE9A 2DK8A 4H5RA 5B8HA 4CCHA 3D0SA 5HNHA 1R1TA 4BNCA 1DJ7B 3OS1A 3SBGA 3SEMA 4A53A 4AG2C 2ZC2A 1HKTA 3K1MA 1KU3A 2XDBA 2XROA 2ASOA 4WXHA 1FOKA 4KFCA 1WFXA 3SZGA 3VFZA 1JKRC 1W2BA 3HB9A 3WGHA 1ZBXA 1ZBHA 2OTJN 2P9SB 4E7HA 3L42A 2PVDB 4ZH4F 3HBLA 1S7AA 2K5CA 1X3WB 3SFMA 3WXMB 4O5BA 3KPHA 1X01A 3OYBA 2NNWA 1D5YA 3LP3A 3DRSA 2OZSA 1ZYQA 2QEXA 2RM4A 3H5RA 1VQMQ 1QCOA 2EV6A 1BYMA 3HUGB 2W41A 4NDLA 1JGGA 2RH2A 2BTFA 3DOLA 4PCQA 4QPQA 2FRWA 4AU7A 3T8RA 2IS3A 1UELB 5BPLA 1U06A 1J3TA 3KK7A 3HOYJ 4OPJA 1S3JA 5HLIA 2O8FB 4FLWA 4AD9A 2CQNA 1ZELA 2K9NA 1R9TJ 2HMIA 4CGFA 1UDLA 4MO4A 4YEJA 2ABKA 3MXJA 5GANj 2M0YA 3WU0A 2I7NA 1IG8A 5GAGP 4FPBA 1DIZA 5HS8A 1A5XA 1Q7YR 3ZMSA 2YS9A 3FK6A 5JHFA 1UAAA 2HOTA 3HG9A 2L02A 5ED4A 5J2MA 4HUFA 1E4FT 1AOYA 3H6EA 5LJ5f 2K2VA 5DK5A 3GLXA 1DQUA 4WCIA 1I6XA 1QKXA 4CEDA 1T6CA 1K6YA 5F0HA 5FDLA 3LWMA 1FLIA 3M0PA 1OYIA 4PL7A 3BR0A 4IXCA 2HHQA 2QKKA 4KBOA 3NTHA 4EMKC 5A2QK 4F7UF 2P5OA 2BZ8A 4MDWA 2CH6A 5GAHJ 5GIPA 3QBWA 1NTCA 1K4TA 1TSFA 4L8RB 1NPPA 4YRVA 3C7NB 1X1CA 3MMYB 1FSEA 2VLAA 3EEQA 4AIHA 5J8CA 2K9LA 5D6WA 4HF1A 2ZB9A 3S2DJ 3OBWA 3OYAA 3BROA 1ZBJA 2P7CB 3JRAA 3GBTA 2YUOA 2VQFK 3A1PA 5HLTA 3OSFA 1VQ6T 5EF6A 4MO7A 3UKGA 2V1XA 5GAN6 1D5VA 5CQEA 4ZTFA 2X0LA 2ZMEC 3SDBA 3ZX3A 1WNSA 1RLQC 3J7AP 1UGQB 3HL2A 3R1XA 3KFWX 3H0DA 1XGNA 3SJMA 1UGRB 2VL8A 4O4GA 3HYIA 1YITA 2A7YA 2RC4A 2K3XA 3TW7A 2YRCA 4XTZA 1GDTA 1TL8A 3O6WA 1BOTO 4ZDLA 3JYTA 2RHYA 4UNOA 2NYSA 2HBMA 3CC2I 1RUWA 4X34A 4LDXA 1U1TA 4JRQA 1V4SA 3M53A 1YRNB 1ETYA 2R58A 3FLCO 3SQ4A 3LX7A 4MEYF 3JAMO 2CV2A 4WXDA 1YJ9T 1KYZA 1ENHA 3B02A 4IFEA 4FT2A 2IOCA 1NEBA 4FISA 4LMYA 2X1EA 1PM3A 5CPRB 5GANh 1B4AA 1ZQ3P 4KHYA 3ZSXA 4CZLA 2KRFA 5GANe 2IPOB 5FLXK 2FOWA 5LGNA 1RKWA 4HX7A 3CFOA 3NAEA 2UUCK 3LAJA 1VQNQ 2P9PA 3E6CC 1X9SA 3T19A 1WHHA 3A5NC 1WJ5A 3H3UA 2QW9A 1T0FC 4KHUA 5IT9Z 2OF7A 3QFUA 3FXOA 3TU4K 1Q81U 2VE9A 2ISZA 4BRQA 3EQLF 1X2KA 2W10A 4D6WA 9ATCB 1YI2I 5LJVA 2KDOA 3S1QJ 2ZJ2A 2C06A 4XEIA 2PQWA 2KMTA 4WE1A 1LAWA 3OH9A 2RB6A 4NC6A 5TRDA 1M9SA 2QVOA 1Q9XA 3CBPA 5AQYA 4KI6A 2MPXC 4BD3A 3AA4A 3A0BC 2L3SA 4BGAA 3OMGA 3GIBA 1LDKB 3BOQA 2H8RA 2GBQA 4CJFA 3O5ZA 2GTDA 1VOMA 4DTPA 1RI7A 3ZSYA 2NAZA 3I56T 4JDSA 1I39A 3I9QA 1ZGJA 2WONA 2HCKA 1SHFA 1WA7A 4XU0A 3CERA 4OFHA 2PVGB 4GRIA 5GAN7 1NKEA 1TYQA 5AQSA 1TW2A 4MTDA 2YX4A 2IIMA 5JI6A 1SG5A 2OTLA 2GA2A 5BNGA 4A4HA 5FLVA 1UHSA 2OV7A 2WB1A 1HSQA 1Y07A 4QCLA 1FK9A 2R5ZB 3MHXA 2WFBA 4CESA 1BI3A 5K5RA 3RR8A 2RHUA 2MD0A 3I53A 5GJVB 4E70A 3U2RA 3M1EA 4E9HA 4DSFA 4WQ5A 3SNNA 1ETXA 2DIQA 1F21A 2P5GA 4BR0A 1F4KA 5DUKA 2H27A 3AVFA 2FMYA 2EQMA 2JM8A 2XB0X 4ATOA 1IUFA 1BQMA 2FNAA 4KGZB 3TDUC 3GL1A 2VJJA 3HL8A 1VQPI 3C6UA 2FSWA 2FBIA 3R6SA 4YPHA 2DPUA 4E6RA 3G1OA 1ABQA 4J5YA 1NWKA 1LVAA 4NLCA 1BW6A 4YELA 1TWBA 1NJIU 4C1NK 3CCEN 1K83J 4CCMA 1BUPA 4HVJA 3B6CA 4R0KA 1VQPQ 4M41A 4HEA2 1VQ4N 1NG6A 2OJED 3J7AO 3X28B 2PBDA 3VS2A 2K6DA 1C0MA 5BPIA 4RA2A 2XIGA 2JA5J 1AZGB 3J81O 4E9EA 2RKIA 4FWPA 4AILC 3QERA 1IHWA 1XN7A 2FBHA 2FC0A 3K4LA 2JXBA 3N0UA 2Z1GA 3VUBA 2JWTA 2HZTA 5K5QA 1IRGA 3DLKA 3FFKB 2NRVA 3LPTA 1ZTRA 1UG1A 3CCSQ 3THWA 5LGTA 1P59A 5L8RE 4HNUA 4IZ9A 3V7RA 2GBZA 1KFDA 3N4PA 3GOXA 1QU3A 3AVJA 2D1HA 3UPUA 3PO5A 2NRTA 2BTTA 2P4TA 3VEYA 5FFXA 4BHPA 4RB0A 3BT9A 3CJ7A 2NUZA 4FTHA 5AQPA 3BDDA 3H9NA 2RKHA 2OYQA 3ELKA 1Y1WJ 2QBYA 4ZN3A 4CJPA 4FZXC 1XMXA 2HNZA 1MMAA 2ZXHA 4LDYA 1ZHIA 1WHGA 2GIZA 4JS4A 2Y90A 1KSPA 1F1ZA 1R5ID 1S6PA 1XMQK 1R49A 4UHTA 3DKMA 2IGKA 2BHZA 1T6SA 2VE8A 3OGDA 3KP3A 1TAQA 1KC8O 3I3LA 5GAEJ 3OYFA 4JX5A 5IOZA 1I3QJ 1Y96B 3L8BA 1T44A 2GQQA 3PUFA 1CLQA 1S3XA 2VJ4A 1EF4A 3FMQA 1YLFA 2IPQX 4LB6B 2UYTA 2JUFA 2NOLA 1YQMA 2VQLA 2P1JA 3F22A 2ABLA 4CC7A 1XMOK 2GTJA 2LYCA 1VQ4T 2RHZA 3B6PA 5LJ3d 1UFFA 2JT1A 4MDXA 4AHUA 2OX7A 3PMTA 4PGGA 2NRHA 1HUXA 1GUUA 1BB9A 3CCQT 1KD1R 2WSFE 5GAOl 2CQKA 3K1PA 4I99C 2NOIA 2Q0RA 2HBKA 2WC9A 1VSLA 2YX7A 1QVFM 4HF0A 3VQ5A 4K41A 3UKUB 3U9ZA 3QYHB 1CZ9A 4D8DA 1RCHA 1S1TA 4K8ZA 1K9MO 3TL4X 3FM3A 2YHBA 3M6GA 5F0FA 3R6OA 1BI4B 2LDMA 2DL8A 2DXCA 2BGGA 2CZ7B 4WTOB 2HNDA 3QYBA 4BRKA 4N47A 5A0GA 2DNUA 1BG3A 3GP8A 2MABA 1G2HA 1K8AU 1SD4A 1RAGB 1YX5A 1S8NA 4A0YA 2EW3A 3E0JB 3RIRA 2GWJA 2DA5A 5K7HA 1HOMA 1RRQA 3DQVC 2FF4A 4CK2A 2H6BA 4BRLA 2YRVA 1VA7A 4IHXA 4M7AF 4B9WA 4E2FB 2KIUA 3H45C 4C8OA 2YUQA 2JJ9A 1SL1A 1AWJA 1K78A 1JEGA 3AVNA 4JKHA 1JHFA 1K4SA 1ATSA 1Z67A 4DBHA 2Z99A 2BZTA 3CXCP 3IP4B 3CJ1A 1N3AA 1U78A 1H3HA 1HDPA 4C92F 2ZGYA 5AQLA 2M45A 1DGRM 1NK7A 4Q5VA 4DSEA 2GBYA 1GLAG 3D45A 3WTSC 2J6FA 3H0IA 1S1NA 1XSDA 1P92A 1QQCA 1I4K1 1X69A 4CZFA 2IA0A 1JL2A 3B6OA 1ZUKA 2I8DA 2CP2A 3W2VA 2DOEA 2O3FA 4DR5K 1MBHA 4H5WA 2CUEA 5HBMA 4NXMK 2L2OA 1R36A 1XQOA 3LDSA 4FK4A 2HR3A 5DS9A 4LLLA 3O2PE 3QNNA 2O8CA 3C6HA 2PMZA 2JTMA 4CXFA 1JJ2S 3L0QA 3ZMVA 4FYDA 4H0OA 1OV3A 3CJCA 2QF7A 2M1HA 5AQOA 2ZKZA 4CJ5A 1IRXA 2KYBA 3GFLA 4JI6K 2QQ8A 3TSUA 3BZ6A 1WCMJ 5D5UB 3QEWA 3NVMA 1TZLA 4N4IA 5I9EB 1VQMI 1Q82O 3JTHA 2O5RA 1GCPA 5J3BA 4EJWA 2VXEA 3KKRA 3ME9A 2ATCB 1NJIO 4B1RA 2DILA 4U0VA 1NEGA 1IG9A 5GJWB 2OZUA 2ZQBA 1AT1B 4DS4A 1KTQA 4KMUX 1M3QA 3Q1JA 2EV5A 2DTZA 2Y0MA 3HHHA 3KZIC 2ME6A 2V51B 3ZCMA 1LW2A 3FGUA 3FHNA 2MCNA 5GAOm 1USSA 1WUAA 4Q48A 2HZDA 2H6CA 4AYBN 1RZ4A 3KTUA 1OFCX 4J8OA 4M7YA 2R7UA 5F0CA 5JVGL 2F4VK 3HFNA 4J00A 4O8KA 4LLGF 4F7UB 4E7IA 2LRDA 1EETA 2LKSA 4UQGA 1Z6RA 3QESA 2JVHA 4KMFA 3CC2N 5LBQA 5M5WJ 1QZ5A 3H46O 4LXCA 5JMVA 2FMLA 1TVRA 4FJXA 4PL8A 3VYHB 2L7KA 1QP3A 2P0KA 4BWJA 2X3XD 4BGBA 3RKQA 3OS5A 3ECOA 1W36D 1RILA 2COZA 4CZZA 1U5TB 2FSJA 4BRFA 3TAGA 4I7HA 2RQTA 1H8AC 2VT3A 4FM1A 2Y0SN 2Y4YA 5ICGA 2OQGA 3K4JA 4F17A 1GXIE 3PO4A 2KI7A 5FPEA 4EGYA 4KGVB 4BRDA 3HGYA 2VCPA 4ID1A 3PTAA 4G94A 2VKVA 5DD8A 2LNVA 3H3VK 3IH4A 3AGKA 4G1QA 4PUSA 1IF1A 4NB4A 4KRFA 3LWLA 1I5OB 2WUSA 4QS9A 2HQRA 3TPQA 2QGFB 5KN8A 3S16J 4A3KJ 1FYKA 1KK7A 2D8JA 4BDYA 4PJOC 5IYCJ 3MP8A 1I27A 4DIQA 1NOYA 3Q7CA 4B9VA 4HNTA 4M78B 1KYWA 4EMSA 1VQLQ 2LNHB 2DXUA 2G7UA 2Q0OA 4FE7A 2L7ZA 2CREA 3DPLC 3CCQQ 4FJLA 2DMTA 1U5SA 2HXOA 2V7YA 2PBIA 2Q3SA 3AT1B 1HPZA 3MDQA 4FYYB 1O75A 3E9GA 4AIKA 1VQ8T 2E2HJ 1JKHA 3HKZA 1TWAJ 4ETSA 3QIOA 2ZMEA 1ZRCA 1YS7A 2DL4A 5HRRA 1BC7C 3K57A 4IQ4A 3P9IA 3M8PA 2W04A 3D6RA 3A8OB 3F8FA 1KZHA 1BU1A 4BR5A 3RJPA 1TG0A 4KUMA 4DV4K 5GIOA 4Z8AA 2A1SA 2QWPA 4HTUA 1QVGS 3BWGA 4IX7A 3GNGA 3AL0C 3DPUA 4GV9A 1LWCA 4YY3K 3EUAA 3UIQA 3I56I 4XIUA 4IBNA 1G3TA 4YDUA 1G3SA 1TQIA 3SXYA 3IC7A 4M9SA 2NWMA 4BQAA 4LK0F 1K9AA 1M3HA 1RRSA 2CW8A 2P8TA 5D5XB 5AONA 3AL0B 2EGCA 4M75A 1HBXG 2LX9A 4KNYA 1NGHA 4CF8A 4DB3A 4C8MA 3OYKA 4WXCA 1N5ZA 3AA3A 3NF8A 1C0GA 3U9GA 2LLKA 4CEAA 2M02A 5HS7A 3EYYA 3F8NA 1QVGA 3FHGA 1OKRA 4KJZA 2ZGZA 2EAYA 3RMAA 1DGWY 2FZCB 3M4OJ 2RJCA 3M59A 5C25A 3RMSA 2XPWA 1PU6A 4GLMA 4RCCA 2YT6A 5KCOA 4DEYA 1ZLMA 4NO7A 1ZSZC 4HZFA 5CZ2A 3PFSA 5F64A 4WWCA 2V6CA 1U8BA 3CC4A 4FX4A 5DCFA 1JQQA 4MZPA 3FZLA 1A0NB 3I55I 2H3JA 5ERIA 2NRZA 2NOHA 3OW2P 2GAUA 2V8JA 1LV5A 1U1SA 2P9KB 2UXDK 3CXCM 1PVEA 1M90O 1MMNA 3SWNC 4CHOA 2DVJA 1OVQA 1VUBA 1WQ2A 2YNIA 2DU9A 1VQLN 5BQTA 2VODA 5E3OA 3M1FA 3NFAA 4FWRA 4IOXA 3X26B 2EA2A 1KQ9A 2A08A 4M7AD 1YS6A 2J5OA 1TK5A 3G6EN 2EIMH 5EG2A 2WV0A 3VTHA 2R93J 3PFYA 4L0YB 2BUPA 1F36A 1KU2A 3HRMA 1V5GA 3RPQA 1B34B 1VQOA 2X6YA 4N4NB 4ZDPA 4M74A 3AAPA 4XAXB 1Q82C 3OS2A 4BYYA 2F2EA 1L3LA 1P4XA 1UEBA 3A0HC 2YWWA 1SVOA 1FSHA 5KYXA 4XKVA 4C8QE 2O8BA 4AMCA 5FRNA 2XI9A 1LE8B 5A2QE 3RESA 3H36A 1VF9A 4RAZA 2KLAA 1D1BA 2P9NA 3FEOA 3ZBDA 3T8TA 2CGPA 4DV3K 3CMEA 4JEPA 2CT3A 1BK2A 2XUBA 2WAFA 2R4GA 2P9LB 5HL7L 5J1UA 4CHQA 4HKEA 4C0FA 4CGIA 1U9OA 4XSZF 3QXEB 1FJGK 2I5UA 3CCLA 5FU7C 4BDPA 4FLZA 2V79A 2OAZA 5E79C 2BH1A 2YX6A 3HTSB 4IXAA 4XRSA 2QSGX 2FNPA 2CGHA 5M1KA 1QE1A 1IXDA 3SZTA 5BRDA 1DTTA 5CIUA 2OUMA 3F10A 3S1RJ 2F4MB 4MFBA 1YTYA 3MCAB 1TK8A 3JSMA 2OZMA 1XHXA 3DXKA 1FN7A 3QLHA 1VQ5N 3R61A 1FOYA 2CGLA 3FE1A 2HI3A 4YIRX 3FF5A 4IUQA 4OIRF 2KIMA 3SB2A 1SL0A 5DCMB 3QBYA 5DTDA 2QGGA 3GOIA 2YJFA 2GTOA 1ON1A 2CG4A 1YWOA 4AG1C 4ZHRA 2V9VA 3CMYA 2WAQA 3CCSI 2ELJA 2XASA 2CFOA 3KP7A 1FKPA 3K9TA 1S1UA 3CC7I 2Y30A 3ZT2A 5FFZA 2V9KA 3L2RA 3BGRA 1YJNA 2IG0A 1TP4A 2XY6A 4RM2A 3ZX0A 1P4AA 5AQQA 3EFSA 3PIPL 3VEWA 5AQKA 3P9KA 5AZIB 3CJRB 1YRNA 3LDQA 1TWCJ 1W5SA 3L2VA 3LSTA 2KFDA 4BY6B 2R7DA 2O8EA 5CQYA 4X0GA 2FLOA 4NC7A 4CDGA 1G5VA 4M7DB 1RDCA 2JWKA 1YJNQ 1K73C 3U21A 3KWIA 3CXCS 2IA1A 3C2HA 2Y75A 1VQNN 4A5MA 3CJAA 1ZBUA 5AQZA 2NUPA 1CXQA 1VRLA 1RGIA 1WLPB 4G6QA 2IS6A 5KN9A 2EYXA 4H5TA 4BJTA 4H5NA 5BR8K 4MEXF 1AA7A 3RTRA 4NXNK 3MEXA 3FBIB 2YG9A 2KFNA 1VSHA 2Y0SA 3OR1C 1LPQA 2VBYA