5FRMA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz384 (compound 4a)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination
molecule keywords PFV INTEGRASE
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frmA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frmA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frmA03
3LAMA 1KLMA 3TR8A 2EQKA 2Z1GA 4I7FA 5D6WA 2HNYA 3KTQA 1TKTA 1EXQA 1VRTA 1KFSA 1G15A 3NGZA 3LP0A 2PY5A 2KFNA 3KD5E 3WNFA 2ITGA 4JRPA 3LH0A 3DMJA 1KSPA 3PUFA 1TAUA 4DU3A 4PLIA 1ITGA 4AHTA 4Z0UA 1ASVA 3HPOA 3K57A 2EKOA 4DTJA 3HP9A 1J5OA 4C5HA 4CK1A 1VSFA 1VSIA 4BE1A 1HJRA 1QE1A 4UQGA 3O3GA 1RBVA 3ITHA 2A1SA 4E7HA 3HSTB 2M1HA 3QJ6A 1C1BA 2XDPA 3VQ8A 4FL6A 4OVAA 4MFBA 5FRMA 3L2VA 3DOKA 3VQ4A 2WACA 3RTVA 1FK9A 3ZSXA 4E1MA 1IKWA 3C95A 4DTRA 3PO4A 2P5OA 4UC4A 3DLMA 4EP4A 4HUEA 3MAQA 1A5XA 3A2FA 4AHUA 3SUOA 1NKCA 3OYBA 1HYVA 4CHPA 3L2WA 1WNSA 2IS3A 4BDPA 4Z4IA 4CERA 4FLTA 1N6QA 4KREA 2EQMA 2HHXA 1NK8A 2GF7A 3TI0A 3AVHA 3VQCA 5SWMA 2EQUA 2FHDA 2HB5A 2HHWA 2DFEA 4RG2A 1S1TA 3KD1E 3LALA 2CKKA 3L42A 4FLVA 1VRUA 4DFJA 4J2AA 3AV9A 3CM5A 2E6NA 3B6PA 4C8MA 2HNDA 1JLQA 3DYAA 4AHCA 1NKBA 1JLCA 2QQSA 2OPRA 4BD3A 3SV4A 2X4XA 3E01A 3K2PA 1LWEA 2RF2A 3KJVA 1KRPA 1RTHA 5J2PA 4ZTJA 2HNZA 2YNIA 4NCAA 2VWKA 1ASUA 4O5BA 4JS4A 4DTXA 4FZXC 3QIIA 3PX4A 3T3FA 3HO1A 4CESA 4DQSA 4E3SA 1I39A 1ZYQA 2FBVA 1LAWA 1N5YA 3KLGA 2OZSA 2X4YA 1ZBLA 2YRVA 5J39A 2E6LA 2IOCA 3T1AA 4DQPA 1VSDA 4M41A 1NOYA 4DLGA 3IAYA 4N41A 3BDPA 3LGFA 5HRSA 4Q0BA 3CEYA 1J9AA 1GOBA 1VSHA 5C25A 2RI3A 3I0SA 3EY1A 1UA1A 3QEXA 4FYDA 1L3UA 5CY4A 1OZ3A 2L89A 3MXIA 3QERA 1UOCA 4Z4HA 2BIVA 3NF9A 3QO9A 4E0DA 5I42A 1NK5A 5HP1A 4H4MA 3K5MA 5KCHA 1S1VA 2WOMA 3MECA 2BDPA 5KRTA 3VA0A 3ZSWA 1N27A 3E9FA 3K58A 1I3AA 3O8VA 5HBMA 4FM2A 4QW2A 4OLBA 2LTOA 1KVAA 4N47A 2HW3A 4CF9A 3SCXA 3S6WA 3OYAA 1RT7A 5M9OA 4LY7A 3DLKA 1KVBA 3WNEA 2KW4A 2HHSA 4AHRA 2RKIA 3MP1A 1HQUA 1TKXA 1ZBFA 3PMIA 1C1AA 4N4HA 3ZT2A 2PYLA 4NZGA 2RHZA 1C6VA 3SUNA 3K5OA 3SYZA 4CCHA 3ZT3A 2LDMA 3VQAA 3L2QA 4O4GA 1FKPA 4W5TA 5JS1A 1TL1A 3PX6A 1WSEA 1HRHA 4CEOA 4HVJA 4Z4FA 2JGUA 3QLHA 2R5AA 4WE1A 3V1QA 4CIEA 2VWJA 4DS4A 4FW2A 4CEBA 5C24A 4CJWA 4KB0A 2HHVA 2JTFA 2LVMA 3SQ1A 3RR8A 1K6YA 2P1JA 4M3TA 4B8CA 3JSMA 3AA2A 4CJPA 1TK0A 3D0PA 1XI1A 4CHNA 3HL8A 1RT2A 3HM9A 3THVA 4ID5A 4FJNA 1RT6A 2RN2A 5D3GA 1D9FA 3BGRA 2HVIA 3DLRA 4CFAA 4C8OA 3OMGA 3ZSOA 4E19A 3NBPA 3V6DA 4LH5A 3LPUA 1J54A 3O3FA 3QNNA 4IFYA 3SQ0A 4KB1A 1IKXA 1TGOA 3OVNA 4NYNA 4FJGA 1SL1A 4Z4EA 2KQ2A 4EP5A 4FK0A 4ZHRA 2WONA 1TVRA 1U04A 3LDSA 2BUDA 1TV6A 1VSMA 4CF0A 5KGXA 4DMNA 4OLAA 2K3YA 1BIUA 1NK4A 1QSYA 4NS5A 1W9HA 1CLQA 5T7BA 4H4OA 4CJUA 4BDZA 4B9UA 3NCIA 2OYQA 4IUVA 4LD0A 3MEWA 1CXUA 4CF8A 3JYTA 4MQ3A 2MWOA 3DRRA 4KV8A 3NE6A 3SUPA 3OYDA 3DLHA 2Z1IA 5CIUA 4I9LA 5D6XA 2OPQA 4BDYA 4DSJA 2VG7A 2HQXA 2I5JA 4B9XA 2YKNA 1OYXA 5HROA 3OYCA 4GW6A 4CEFA 3RMCA 4CFDA 3EYZA 2G8VA 4CHYA 3C4SA 2DFFA 5C42A 1NJWA 4FJXA 2BANA 2O4IA 3V9ZA 1RNHA 4NCBA 4CFCA 2GBZA 1B92A 3AO4A 4RW4A 3OQ5A 3M8SA 1EP4A 3BDLA 3AA5X 3FEOA 1NJYA 3RMDA 2QQRA 3PFSA 3CG7A 3MP6A 3EZ5A 4FLWA 3QEWA 1IG9A 3KK1A 3HVRA 1GOAA 1C0MA 1LW0A 3RMBA 1RT5A 1TK5A 2LCCA 1Y97A 1NK0A 4FLXA 4B08A 4B9SA 4FXDA 2DIQA 4DS5A 3O4NA 4IG0A 3NNQA 3NGIA 1RBTA 4DU4A 3HVTA 1JLEA 2RJEA 4IURA 1BQNA 2ATQA 3OYJA 5J26A 1BCMA 5K14A 3NTKA 4CEEA 2OA8A 4OVLA 2HHUA 4LD6A 4DFMA 3DRPA 4F8RA 3WNHA 3SUQA 1S1UA 3QKJA 4IUQA 4PQUA 2X35A 1WLJA 1IO2A 3P8HA 4IUPA 4FJ7A 2BGGA 4PUOA 1RDCA 4CHQA 4E7IA 3LPTA 2KTQA 3OYNA 3NTIA 2DAQA 3AVBA 1L3TA 1KCFA 3L3VA 1U48A 4KTQA 1KLNA 4Y1DA 1X9MA 4DQQA 1FXXA 1S1XA 3SQ2A 1BCOA 1JLBA 2OZMA 2F8SA 4IDKA 4DSFA 3PV8A 3KLEA 1YT3A 1BL3A 2Q3SA 2YHAA 3L3UA 4E7KA 3META 1RBUA 4KO0A 4NCGA 4BWMA 4CJQA 4B9LA 4KRFA 4CK2A 4W5NA 3F70A 4IBNA 3RWUA 4KHYA 3V1RA 4CJEA 4OJRA 5E41A 1BI4A 4W5RA 1L3SA 3LP2A 3AO5A 1SKSA 2OPSA 3M9QA 2QK9A 2RHYA 1LW2A 3MO8A 3QESA 1U47A 4CGHA 2MWPA 2G3RA 1Q9XA 4EZ9A 4FLZA 3C6TA 4B9WA 2X4WA 1EX4A 1RBSA 3LZIA 4FLUA 4KAZA 1YTUA 4FJHA 1DLOA 4AILC 3ZT0A 1WAJA 4CGIA 3HPHA 2RHUA 3TARA 2PYJA 4DF4A 4K8XA 2RHXA 3PMTA 3HJFA 3S3MA 1QHTA 2X6SA 3V81A 3TAPA 3VN5A 1WSIA 3GOXA 3F9KA 1SUQA 1HNIA 3DB3A 3LAKA 4CJ4A 3ASKA 1HQEA 3AVNA 2P0KA 3AVAA 4CGGA 3KLHA 4M42A 1OI1A 2W42A 1SSFA 3OS1A 4FVMA 3KKRA 3DLBA 2JLEA 3CFRA 3NH2A 1UAXA 3L8BA 3IRXA 3CFPA 4DTOA 4FJMA 2G8WA 1D5AA 3VQDA 4DSKA 3NGYA 5KH6A 5J2MA 4CJFA 1D9DA 3NF8A 3TAMA 3SI6A 3V9XA 4EDUA 1RBRA 4CJSA 4FK4A 3WNGA 2IC3A 3AO2A 4FJ8A 4FJLA 3FFIA 5C6SA 4CHOA 3AVIA 5KTQA 1RTJA 4W5QA 2Y1IA 1KVCA 2IGIA 4DSLA 3PX0A 4OKKA 4BWJA 1JLFA 1S9GA 3NH0A 1SKWA 3OJUA 4DU1A 3HK2A 2DIGA 4I9QA 3S9HA 3SV3A 4JRQA 1JXEA 3H8ZA 5HRNA 4QQ6A 2VG5A 1L3VA 3OYMA 4FJKA 2DTUA 1IKYA 2KFZA 1TL3A 1LAVA 2PZSA 1ZBUA 4I2PA 2D0BA 4N5SA 4E7JA 3QINA 2ETJA 3NH1A 2G8IA 5J1EA 1JL1A 3L2UA 2IDOA 1S5JA 1S6PA 3AVCA 4CF2A 2QKKA 2LSNA 3UWNA 4RW7A 4HUGA 2XRIA 1JLGA 4QVZA 4A4FA 1SKRA 3IG1A 4HCCA 4K8ZA 1QQCA 4FCYA 3QIPA 3AA4A 3MEAA 1MU2A 3ALYA 2XHBA 4DFKA 3U6FA 3QEPA 4Z4GA 2O4XB 5J2NA 4B3OA 3KIOA 4CJTA 2BE2A 4C5IA 1S9EA 4R5PA 3DOLA 1NJXA 4FZYA 4KFBA 2XY5A 4ZTFA 4LSNA 4KI6A 3AVFA 4FLYA 2XO7A 3B6OA 3VQPA 4FW1A 4FJIA 3DM2A 1DTQA 4JS5A 3NTHA 1TAQA 5FDLA 5I3UA 3RMAA 3DLEA 1CXQA 1IH7A 4CJ5A 4B9VA 1VSLA 4Y1CA 1TKDA 3VQ9A 2HHQA 3C94A 5C0MA 3HYFA 4QQGA 2XY6A 1JL2A 3M8RA 3LYIA 4M45A 3NFAA 4BE2A 4DTNA 2YNHA 2G8UA 5CYMA 4C5EA 1WJRA 1RI0A 4F3TA 2FBYA 3V9SA 1HPZA 1LWFA 4DTUA 2XK0A 4CEQA 3ME9A 4M3RA 1CZ9A 2B5JA 4N4IA 3V9WA 4C8NA 3AVLA 3OYKA 4BACA 2GFUA 4E89A 3SPZA 3L2RA 4Q5WA 2P51A 4KHSA 1B9FA 2D5RA 3K5NA 4G1QA 3I8DA 3ZSRA 1TK8A 1A5VA 4M3ZA 4FJ9A 1RT1A 3OMCA 3QEVA 4KI4A 4ICLA 4E1NA 3HXMA 1W0HA 2BKDN 2EHGA 4PWDA 3OY9A 1NKEA 1XWLA 4B9TA 1S1WA 4CEAA 1ZBHA 1YVUA 1WJQA 4HCBA 4EZ6A 3KLFA 3DB4A 3NDKA 1GOCA 4DG1A 1XHXA 3TAQA 4DWIA 2LRQA 3CYMA 5CZ2A 1TKZA 3O4QA 2R7YA 2EQJA 3RR7A 4B9MA 3OYLA 1X9WA 3M8QA 1BHLA 1WN7A 4I2QA 4FM1A 1RDBA 3VQBA 3RRGA 2F8TA 4CK3A 1RT4A 4IG3A 4N56A 5KE3A 3ZSZA 4RW9A 4NYFA 3OB9A 3V1OA 4CJRA 1KHCA 4IUUA 4W5OA 4LSLA 1C1CA 2DY4A 1X1PA 3OYHA 3KK2A 3SZ2A 5IN1A 3OA6A 3FC3A 4FJ5A 4CEDA 2DFHA 2A1RA 4YFUA 1HNVA 1VK0A 3UIQA 4CJLA 1T03A 3ZSQA 2OPPA 5EU7A 3D45A 4C8LA 4QCLA 3HT3A 4DTSA 3E9GA 1ASWA 3MXJA 4BE0A 2RI2A 4CE9A 3P5JA 2YHBA 4CRIA 3RRHA 1L5UA 2XY8A 3PO5A 2O4XA 2KZMA 1VSKA 1JXBA 1WSGA 4CIGA 1X9SA 5HRRA 3KLIA 2Z1HA 4E7LA 4CECA 4OGCA 2KZZA 4QQDA 3MXMA 4KPYA 4HCZA 2RJDA 4PLLA 4Z02A 1IKVA 3KKSA 4DTPA 5DMRA 3U3YA 1WSJA 3ZSYA 2Y1JA 3SQ4A 3VA3A 1EETA 3QIOA 3ZEHA 4AHVA 4C8KA 4DQIA 4J2DA 4L8RB 1HYSA 3NAEA 1RT3A 1QS4A 2RJCA 1REVA 1Z26A 3KUFA 4M3XA 2HQEA 4J2EA 1RTIA 1FKOA 3KK3A 5J2QA 4PY5A 2ZQBA 2PQWA 4B8AB 3Q1JA 2RO0A 4OKJA 3P1GA 4DQRA 4J2BA 3AVGA 2NLUA 3K5LA 3OYEA 3P8DA 4DTMA 4CFBA 3HP6A 5KCOA 4CGFA 4CF1A 1VSEA 1J53A 2FBTA 3AO1A 2R5MA 4JLHA 3PY8A 4F3OA 2EX3A 4FK2A 2AJQA 1A5WA 3V9UA 4KHWA 4QAGA 4M3YA 2GFAA 3LWMA 3LP1A 1QSLA 2RI5A 4KTWA 3VQ5A 2R58A 1VSJA 2F96A 3M8PA 3ULDA 3VQ6A 2FC0A 4CIFA 1BIZA 3G0ZA 3MEGA 2HMIA 2RHIA 2K3XA 2QXFA 4RG8A 1UWBA 3G10A 4HUFA 4O55A 4F2RA 1RDDA 3VQ7A 4FJJA 2G8HA 3IS9A 3LANA 3LGLA 1CZBA 3PNWC 4OPJA 1U4BA 2D0AA 1T8EA 4FZZA 5JS2A 3TAGA 1NK9A 3VQQA 5KRSA 3I0RA 3ZSVA 2YKMA 4CHZA 2FBXA 2E6MA 1BI4B 5D6YA 3DRSA 3AVKA 3V4IA 4Z4CA 4A4EA 3O3HA 3SPYA 2X78A 1NJZA 2YNFA 4KHNA 1XHZA 1EKEA 2QKBA 2R57A 2X74A 5FROA 2L8DA 3U3GA 2VYTA 1RCHA 1H3ZA 4O0JA 2GV9A 1Q8IA 3MP8A 3H08A 5IAYA 3CM6A 3S3NA 2D0CA 1BQMA 3OYGA 2JZ2A 3AVJA 3CFOA 1LWCA 5FRNA 1HMVA 1ZBIA 4CGJA 3OS2A 1U45A 1C0TA 1WSHA 2IAJA 4KHQA 3HPGA 4N76A 2P5GA 3FLGA 1G5VA 1WSFA 4HTUA 4OKEA 1D8YA 4DF8A 1JKHA 1T05A 3OS0A 3OYFA 4N4GA 4AHSA 4DSEA 2B6AA 2IG0A 3LLRA 3LP3A 5HLFA 5CYQA 5KE2A 1YTAA 4Q5VA 1SL2A 2E5QA 4PA1A 4B9NA 4QOZB 3QBYA 1B9DA 2YNGA 3QNOA 4DSIA 4YNQA 2G8KA 4LH4A 4FM0A 5CZ1A 4HHTA 2Z1JA 5SZTA 1JLAA 1KFDA 3QEIA 4F2SA 3EAEA 4TSXA 3TAFA 4KHUA 3NF6A 4RW8A 2RJFA 3H6ZA 3MEUA 1F21A 2L3RA 1RDAA 3TWHA 3QETA 3SJJA 1RTDA 2B4JA 2ZE2A 3S3OA 1NK6A 1OZ2A 1WAFA 2M0OA 3DLGA 4CJVA 3C6UA 5KGWA 1C0UA 2D9TA 2M16A 3K59A 2GUIA 1BGXT 4OGEA 3AA3A 1BISA 4XIUA 1O1WA 4GMJB 3TABA 3TANA 1NOZA 1NK7A 3SD4A 3MEEA 2B8AA 2G8FA 4M3WA 2E4LA 3AO3A 4X34A 3LX7A 4CGDA 1HYZA 1KTQA 3T19A 3F73A 2XY7A 3SNNA 4M3UA 1MHNA 2HVHA 2HHTA 3NF7A 4DFPA 3TAEA 4PL6A 3VQEA 1U49A 3ASMA 4DLEA 1SL0A 1DTTA 2F5KA 4CEZA 3OJSA 3P83D 4IUTA 3ZT1A 3UT1A 4AH9A 2VG6A 5HRPA 4A4HA 2YV0X 3CQ8A 4O0IA 2EFIA 3AVMA 1SV5A 1T7PA 4ELVA 4GY5A 3MEVA 3ZT4A 4ID1A 4F4KA 1Q9YA 4ELTA 4L59A 1RILA 5KI6A 1QSSA 4FU6A 2NUBA 4ELUA 1WJSA 3DI6A 1S6QA 3ISNC 1XNIA 4O44A 3ZCMA 4CJ3A 1R0AA 1UA0A 3FDRA 4KKOA 4IKFA 1WGSA 3LWLA 3NHGA 4KTZA 5DK5A 4H8KA 4IFVA 4A4GA 1Z25A 2RPIA 4RW6A 3MEDA 1XC9A 1LV5A 3OYIA 4C5GA 4II1A 2ZD1A 2O4GA 4GVMA 4CJKA 1QTMA 4OPKA 3LZJA 2X6NA
chains in the Genus database with same CATH superfamily
2E34A 1X6OA 4XLNF 1ITGA 4GV9A 4DQ8A 2EKOA 2BOLA 2VI6A 3HOYJ 2FL7A 3CXCA 3OW2M 4MDBA 4BRKA 3VQ8A 3N97A 2QTVA 4AIAA 3AHUA 2A6EF 2NRWA 4CZGA 2OUMA 1B8IA 4LC9B 2O2OA 4FLTA 4PGHA 5AQHA 4KIBA 3QO3A 1PKTA 4MTEA 3B6PA 1M90U 3OR1C 2OPRA 2YSQA 2PTKA 3JAMO 3SBGA 5HY6A 5AYFA 3ZQCA 2YX4A 4RCCA 2VUMJ 1OX8A 5EX5A 1ZYQA 3CCJA 4RLFA 2BTTA 1LAWA 3HSBA 3H45C 2E6LA 3CF2A 2DLPA 1YI2A 2Q2RA 1LE8B 4HVWA 4YIFA 3MKYB 4WK8F 2DMQA 1ACMB 3K58A 1HW1A 1YRNB 1DQUA 3C7NA 2G9WA 3I55I 4DV4K 4RLQA 1FMVA 2EZKA 4U88A 4B44A 1VQOI 3QP6A 5AIQA 2G8IA 2XIGA 3CETA 1GCQC 4FW2A 3HSRA 3KEYA 3O3KA 4DHYA 2B63J 2AK5A 3ZQ7A 4ATOA 3HC7A 4OMLA 4OIQF 4PJLA 3MN5A 3V6DA 4VUBA 5GAN7 4IFYA 2EYQA 1LPQA 1IKXA 1YTYA 5CVVA 1SC7A 2PVDB 2HDCA 1M90O 1QMCA 1F1BB 4DMNA 1E7OA 1BIUA 1WXUA 4LG0A 5CHIA 3CCSA 4BJTA 3L4QA 2MABA 3ZQIA 2MWOA 3A8GB 5F27A 2AKLA 3OH6A 4F04B 4CYCB 1JXSA 3FFKB 2E1MB 4D0PA 4R55A 3ZETB 2QYOA 3MP6A 3ZL7C 2OTJN 1FBSA 4ZDOA 2P9NB 4B9SA 4V19S 4FO0A 5K14A 1NG7A 2FB7A 3DRPA 4RGUA 4PQUA 1WLJA 5H2FC 4PUOA 3E66A 1Y56A 3NTIA 1YVNA 4LFBK 2D2WA 4DQQA 1AT1B 4MO4A 5CR2A 3WQTA 4D8KA 2E1ZA 1U78A 4NCGA 4M78C 4ESJA 1P7MA 5AN4A 2EBIA 1KFZA 3ZQQA 3ISPA 3BJAA 3MHXA 2QK9A 1VQ6Q 2P5KA 3JCMb 1TWBA 1TNTA 1MJ9A 2OZ6A 2DMTA 4F92B 4AT1B 1SUQA 4DV1K 2P0KA 3ASOH 1SSFA 1TUYA 1HNXK 5L3CA 1HSQA 5GAEP 2KLAA 1I5LA 3DKMA 4A3DJ 3MJXA 5AQRA 5BPLA 2L7FP 4C9YA 1MUNA 4QQ6A 2L0AA 3HG9A 1IKYA 3Q0WA 2CH4A 1PKSA 1NE8A 3E5QA 1AHJB 2XKOA 3VS7A 4QVZA 2CREA 1MDMA 2O4XB 5HK0A 2I5UA 4XTZA 3SWNC 2O8DA 2W03A 1LOTB 3W6KB 5EXWA 2G8UA 4MEYF 3V9SA 2HSPA 3VRZA 1LWFA 1NJIC 3ME9A 2WSEE 1ZG1A 3FKIJ 1VQ9Q 2TRTA 3JCUC 3U1KA 2C0TA 3NWSA 1N78A 2A41A 3E6CC 3ZX3A 3I55N 2WY7Q 3NDKA 4FWSA 3PO2J 3I0XA 5CQYA 4JI1K 2Z1DA 2O8FA 3CCVN 2A42A 4IQJA 2HZYA 4CYDA 3IL2A 5E1ZB 2KRCA 2R7WA 2O8KA 4N0AA 5HLGA 3CCJT 2M2EA 1VQ4T 1HNVA 1GLAG 4A5NA 1I6XA 2PX9A 4A3CJ 2DRKA 3HT3A 1I4K1 4BXUA 2RI2A 1DU6A 2BY0A 3IWFA 4DW6A 1FTTA 4EA5A 5TGTA 4IRIA 2JMWA 2JUFA 4HCZA 2X6XA 4DTPA 4JI0K 3QWLA 2LCLA 2ZPFB 3CC4A 1ZHIA 5GAOl 4XMYA 2A69F 5I2MA 3DAWA 2DQRA 2ZQBA 2O8EB 2DMPA 1O3RA 2CYZB 4WWCA 1NMDA 1BJZA 2EJRA 5GANj 2JWTA 3VTIA 4HQEA 2E35A 4AVZA 4J9BA 1ONVA 4L9JA 4YFXF 1IXCA 1VSJA 3M0TA 1R5GA 5GANf 2QTDA 4X66K 2HMIA 3MEGA 4WQ4C 2ELKA 1UWBA 5GAOm 2EFPA 4XOPA 2XRLA 4CZFA 3BFMA 3K10A 2DX1A 3H9GA 4M78B 2CH6A 4KHNA 3P38A 4G9YA 1TS9A 2G6FX 2DCEA 4OMPA 3K4JA 2V9KA 3U3GA 1VQ4N 1SANA 2J6KA 3S3NA 2HKOA 1L0OC 1GXIE 2B86A 5AT1B 1G5VA 4MIMA 3CJ9A 2I5WA 4AHSA 2EZLA 1RI9A 4M75G 1YTAA 2PAVA 1VQON 4K0KK 3ZEUA 3BQYA 2PQ8A 4JI6K 1LFUP 4JJNK 1VQ6N 2BXZA 4HCBA 5CKTA 1O3SA 1WAFA 2H09A 3ER0A 1L5UA 4GMJB 2YG9A 2R7OA 1HYZA 3BQZA 2H8RA 4BY9C 3NF7A 3ZR8X 4WFNL 2IPOB 3WTUC 2QDYB 3PSFA 4BR2A 3DI6A 5FKNA 4B8XA 4A6DA 3CMAT 1H8AC 4BR4A 4MDAA 4OPKA 3RMSA 1D5VA 3U9GA 4Z6YA 1EXQA 4F7UA 2EKHA 3L00A 4MLOA 3SAGA 1BBZA 5GMKj 3CJTB 3CC7N 2F9WA 1Q86O 1HSTA 4C2TA 4M6VA 3QJ6A 3DOKA 1WQWA 1OCTC 2IPQX 4XEIA 4DTRA 4YOWA 2DT7B 3PO4A 3E9PA 4AHUA 3SB2A 1ORKA 3L2WA 2HYFA 4M75D 3GVAA 2IS3A 3M07A 2ZF5O 4IEEA 2P9IB 2EQMA 4A5AA 4YOVA 3AVHA 2EQUA 1VQMQ 5CPRB 3VYRB 3GTQJ 4NQWB 3N4MA 2F4IA 2F48A 1YQKA 4KGZB 4OB2B 3CLOA 4PZJA 2R7FA 2HF4A 3S1MJ 1I1SA 3VSKA 3C0BA 1IB8A 2KRFA 3WT0A 1OOTA 5E3OA 1QGPA 5FKKA 3BTJA 3TDUC 2Y4XA 4MO5A 5LRSA 4WFAL 4Y7NJ 3H41A 2ED0A 1Z3XA 2D1XA 5HNHA 4ELZC 1JKPC 1K61A 1KAYA 3M7GA 3HOVJ 4A4KA 3B6CA 4CCHA 2V75A 4W5TA 1TL1A 2YUOA 4CEOA 2ZGYA 1WUAA 2G0EA 5C4JJ 2LFBA 3K1PA 5EEHA 1QQMA 2LDUA 2NVTJ 2OANA 5HLHA 3BGRA 2HVIA 4F93B 4K2EA 4PKCC 5B8HA 3H3VK 3A2KA 1IG8A 1WXBA 1JGGA 2RV8A 1M2VB 1P4XA 1MWMA 1IV8A 1W9HA 5JFRA 1P7JA 2O8FB 2O9SA 3GTMJ 5BPDA 1BYMA 2ECBA 3WTXC 2CZ7B 3SYTA 3BDDA 1VHXA 4Y28E 2L2OA 5GANe 2YKNA 2BE7D 4CFDA 4Z88A 1IHWA 1J59A 2LG4A 2NVXJ 4RW4A 1G2BA 2QQRA 3CG7A 4X6AJ 3ZBDA 1TK5A 1SRLA 1Y97A 3I56N 2E1OA 1RBTA 5HNFA 2Y30A 2K57A 1BQNA 3I33A 5B1BH 2HHUA 3SUQA 2D0OA 1K8AR 2QEXI 3FK6A 1VQLI 2ZKZA 2GLOA 3LQRA 5AQXA 2FG0A 4DEXA 3CC2T 4BVOA 2CQ7A 5DEQA 3KLEA 4PL8A 2YHAA 4CC7A 2O8BA 5K5OA 2ZMEC 4C1NI 2V1NA 1Z1DA 1BU6O 1IBKK 4OJRA 2AHJB 4B6MA 4M77C 4AU7A 4FE7A 2PI0A 3GG4A 2XPUA 1VQ9I 4J9FA 5FLXO 4ZYEA 3TARA 3HPHA 3V8JA 1S3XA 3VUBA 3WGHA 2EVRA 4KRTA 3R4KA 2X6SA 3V81A 1K9MO 3LAKA 1KZHA 1YX3A 4BQZA 1X6GA 1NTCA 1T8IA 3EHQA 3TBIA 1HKTA 2EYYA 3SI6A 3TAMA 1JXOA 3P8BB 1M3CA 4FK4A 2EINH 4QS8A 1SMTA 4RTXA 5J4YA 3MKZA 3FGUA 1TXQA 3BTCA 1TQPA 3CUOA 1RGIA 4M9SA 4CZCA 5GPCA 1N33K 1AA7A 5EG0B 2CG4A 1SKRA 1G3YA 3IG1A 4K8ZA 1FOWA 1MU2A 3THKA 2XHBA 1EA3A 3Q9SA 3KNTA 1NZ9A 1OYWA 5LD2C 1NJXA 1Y0UA 4FLYA 4HG2A 2OTLI 5BRDA 2DD5A 1P8ZA 2J6OA 2CZ1B 3VQ9A 3CD6I 4DV2K 1IXSB 3QYHB 3C12A 5DTDA 4C5EA 4CC4B 4WX9A 5GTHC 1VQKA 2GFUA 4MMLA 2P51A 1B9FA 1I3QJ 1TK8A 4G1QA 2XB5A 2JK3A 3NRVA 2JT1A 1NKEA 1XWLA 4B9TA 4CEAA 3FXUA 4B43A 2YUSA 5CYVA 4LG0B 3JRDA 2KPMA 4EMHA 4AG2C 3J7ZO 3LSMA 3ZX2A 5IYDJ 2QEXA 5FU7C 3OYHA 4JLIA 1QLYA 2KE9A 2DFHA 2V8KA 1P90A 4BR0A 3IDHA 3D45A 4LN2A 2QA4Q 5HRRA 1EWQA 1C0WA 4OGCA 3MXMA 4PLLA 3KKSA 5BR8K 1Z26A 4V2FA 2OU2A 2XB0X 4BU2A 2XVCA 4Y91A 4LF4K 3RQIA 5GMKl 4XN3A 1VSEA 1TTYA 2AJQA 3OA9A 1QCOA 4YOXA 2ZM6K 3WE2A 3WU0A 3GLXA 2EILH 3ULDA 2HU9A 1TYQB 2HSEB 2L9VA 2JW4A 4EV0A 1PNJA 3LGLA 3PNWC 2XKPA 2DJZA 2IBDA 1RLQC 3SAFA 2X78A 3FDYA 1X3ZB 3D5SC 1NKUA 3CZ6A 2L8DA 2IVPA 1EO1A 4ESBA 1H3ZA 3AAQA 1Y1WJ 3EE9A 3RVCA 4OPAA 3MPUB 3EYYA 2OTLT 2JM8A 3LSJA 1C0TA 4B4CA 1DU0A 1ZK8A 1OR7A 4DF8A 3SHWA 4IXCA 3RYRA 2C6YA 3KXTA 4M77D 4LFUA 2A08A 2R5ZB 1TWAJ 3JXUA 1HD3A 3HTSB 5SZTA 4EAHD 2CQQA 2HYGD 3MEUA 3H3ZA 3HRTA 1NK6A 3DLGA 4E7ZA 4JZ3A 3BY5A 3C6UA 1SD5A 2D9TA 4C8OA 1BISA 3M6GA 1UG0A 1CLQA 4LK1F 1S5LC 1LNWA 3ASMA 1B1BA 2WA0A 3UT1A 5J6XA 2VG6A 5HRPA 2BEOA 1KQSS 1ZAOA 3CC2A 1XSXA 3D2FB 3ISNC 1WH7A 4EFHA 1XC9A 1LUJB 3EGXB 3KZYA 2CP5A 2FF6A 3TR8A 2GQVA 1SFKA 3QYGB 2CH5A 4DU3A 4FQGA 4WF2A 4PSWA 5AZIB 1VSFA 3U9ZA 2NYXA 3I56I 2X6OA 3RPQA 4FISA 4RAFA 3DKYA 3RTVA 5K1YA 3C7NB 4EP4A 3A2FA 3AG2H 2F6CA 1JTXA 5AQIA 1B6AA 2B9SA 1WNSA 2OX7A 3CCLQ 2HHXA 1NK8A 5SWMA 4IHVA 2HS5A 4J7FA 2GGRA 1YITI 1I5ZA 5DCMB 5IP6A 1WJBA 3PIOF 1YYVA 2HAXA 1D1AA 2XF7A 2PMHA 1UHCA 3DV8A 4M71A 2EA4A 2HPMA 5E20A 2PVOB 3GF2A 1L3UA 2EV5A 1OEBA 3CDLA 3K1NA 1ATNA 2QEXN 1X2MA 2LX9A 1S1VA 3MECA 3EQLF 5KYUA 2FD5A 5AZJA 5KCMA 5E8GA 4QW2A 3D2FA 2EJFA 1VQPN 3MCPA 4H0YB 1FW6A 3FXOA 1FSHA 5DUIA 2Z9OA 3CJ7A 4NUBA 2CRGA 2RHZA 3PFIA 4QSHA 2OD5A 3VQAA 4O4GA 2QWPA 4LF8K 4BRCA 2O8EA 2YSRA 4M7DF 3GXOA 4CEBA 3LSRA 1YI2T 3SQ1A 1R9TJ 1A36A 3RR8A 1YXQA 3GWZA 4CHNA 2BGCA 2L4AA 3KYDB 3THVA 1FEXA 3V7SA 2UUBK 1MGTA 1XQSC 1LDJA 2FZGB 2AXTC 2JS0A 3J80O 2FZCB 3EFOB 4FK0A 1HKSA 4CD1A 5FKMA 2LYCA 2KNBB 4IUVA 3MEWA 3DRRA 1GLNA 5CIUA 4DSJA 4MZPA 3HM8A 5BPNA 4KITB 1MMGA 2BANA 3WXKA 2VCPA 4IX7A 5IHNA 5D5XB 3SEZA 1IG9A 4BRQA 4X64K 5GAMg 2LCCA 3MN9A 4YHHK 2YJFA 3MZ8A 4DS5A 3FIFA 2QQBA 1VQ6A 2JA7J 1GDTA 2MFZA 2KT8A 4XU0A 2CSQA 1E3HA 1O4XA 1K73C 3BW1A 5HS7A 4DV7K 2BGGA 4ISEA 3VOVA 3L3VA 3QG1A 2CFOA 3VTHA 1WI9A 1J6ZA 1BL3A 4KPYA 1AKHA 5IT9O 2O8DB 2NS0A 2RDPA 4L5IA 1XG1A 1LW2A 3MO8A 2LBFB 1U47A 3K4NA 4IFEA 4ENNA 1GBQA 1E0EA 1ETXA 2FSWA 5DCMA 2A7YA 2PYJA 3P31A 4DF4A 5LMUK 3G1LA 2LTPA 2GNCA 2A3ZA 1LEBA 3E0JB 3TAPA 3H1QA 2KXCA 4CGGA 4NQWA 1F4KA 4FJMA 1GXPA 3VQDA 2W00A 5J2MA 5HLIA 3WODF 1MMSA 2JJ7A 3V9XA 2K40A 4NNJA 2CUFA 4HXJA 1M3BA 2Y1IA 4XTYA 1KVCA 2GCXA 3I59A 5M1QA 3TDZC 2FYKA 3M0RA 3B02A 1H641 2PLYA 2DIGA 1MJBA 3HXLA 2JRTA 1T08B 2JN0A 1TL3A 3CC4N 1ZBUA 2M5WA 3CQTA 2YRCA 4BY7J 1JI8A 3VOEA 1LVKA 1H8KA 3BF1A 4A3MJ 2XRIA 1VQ4I 3I53A 1ZTRA 3I5UA 1O75A 4M77B 5D7UA 4CJTA 2JA2A 4RGSA 4ZTFA 3HDDA 2PNIA 2R7VA 4FJIA 4H5TA 3CCUI 1XPXA 3O9SA 1P4AA 5FJ8J 2HHQA 4BBRJ 1JL2A 3PVQA 5CYMA 4XLCA 3WXIA 3GLLA 3IKTA 2K7AA 4B47A 1W70A 4LB6B 3SPZA 2L7KA 4HNVA 1FTZA 4IPAA 3QDFA 2O6GE 4JDSA 2Y31A 1JEGA 5AQUA 1KD1O 2IVNA 3WE3A 4EIKA 3NEUA 1FT9A 1X9WA 2AQFA 3CCQT 1EH8A 4BQOA 4RW9A 4HRIA 3V1OA 2CW0F 3B6AA 4CO8A 3FC3A 3S14J 2HKQB 3ZSQA 4FSVA 1RRJA 4WTOB 4J7IA 3KLIA 4CECA 3LOCA 3H36A 5LJ3h 1SFEA 2YS9A 5ADXA 3NAEA 5J2QA 3PLAA 3BF3A 4I76A 4DTMA 5CQEA 1JQQA 3V9UA 1Q7YU 2H1KA 2OTLA 1MW7A 4KHWA 2KZGA 4KTWA 2VKHA 1BKBA 3LMMA 3GBQA 4I01A 2FC0A 2AZSA 1BIZA 4OFHA 2K3XA 2CW8A 5LEKA 5CQXA 3M59A 2VPRA 2P0WA 1ATRA 1M4ZA 2P7VB 3AVKA 3FZFA 2YHWA 1U3EM 3VS0A 2YUNA 5JICA 1YX5A 3MKLA 3OYGA 4ETSA 1R5ID 2JZ2A 2XSDC 4CGJA 1WBBA 2VB6A 3ENOA 3R9PA 2NLXA 2RQQA 2ITMA 3FB9A 2DOFA 4C3HJ 2LJ3A 2DNUA 2E60A 1TZLA 3RI4A 1YLFA 3T69A 1T0JA 3HRUA 3OTOK 1Q7YC 2G8KA 4BC2A 4AYBN 1PDNC 4KHUA 2EK5A 5IT9K 2ZWHA 3RR6A 1MBFA 2PU9B 3F21A 2ZE2A 2NUTA 2CS3A 1BGXT 3O8MA 1RUNA 3SD4A 2DTHA 3LX7A 4GXOA 1NLPC 2IS2A 1OCPA 2MK5A 3P83D 4IUTA 4IZ9A 1HNWK 5F1JA 1GLEG 2HCKA 1SV5A 3TO7A 1WJAA 5C44J 1GBRA 2X51A 3P4IA 3LWLA 3ZMDA 3SFIA 1BA0A 5DK5A 3BR6A 1VF9A 5M1PA 2VQGA 4LD9K 4C5GA 2ASOA 1N9RA 4II1A 4OFEA 1X1AA 2X6NA 2NXNB 2FPFA 1RIOH 2RQUA 1TKTA 2HOAA 4KNYA 2ZXWH 2J5OA 4BKXA 4W97A 2VXDA 4YIIA 3CMMA 4DYCA 5J8FA 1SHFA 4BE1A 3HSTB 1U6GA 2E7WA 1SHGA 4B24A 1VUBA 1FK9A 2PUOB 4IHYA 1QW1A 2DE0X 2NRZA 3S41A 1R00A 1HYVA 1HR0K 3CCMI 2VXZA 4AMCA 4FL9A 4OAYA 2CQKA 3S1NJ 2DFEA 1U06A 1Z77A 4KH5A 2ROLA 1JLQA 2X4HA 2AP1A 2O8CA 5FLXK 1P2FA 3G6EI 1GLLO 1ETWA 2YNIA 1QKXA 3GEZA 2PZ1A 3Q5FA 2OZSA 4HLXA 2X4YA 4ENMA 4RB1A 3EKUA 1ZBLA 8ATCB 1E17A 4C92C 4LJZF 5C25A 1J7KA 1XX5A 1UA1A 2NOFA 3MXIA 2XKOC 4ORZA 1WWXA 3MMYB 5KQ8A 4UY8I 3ZSWA 3KFVA 3LA7A 3JTGA 5J40A 4KH0B 3DBRB 3THYB 1IN8A 2A3LA 4WE1A 4CIEA 3SAHA 1ITYA 1AWCA 1ZSGA 4OB0B 1IJJA 4B8CA 4CJPA 4AI4A 5A0DA 3MWTA 1ZKGA 3FR0A 2EA2A 2P0PA 1JKQC 4RUGA 4RM3A 2Q1ZB 2OCEA 2A6TA 1FP2A 5J3BA 1YG2A 1YIJT 4C92F 4XL9A 2FEZA 2EQIA 1VQKQ 2LR8A 2E2QA 1OYXA 3OYCA 4GW6A 2JVHA 4C0GA 4MDXA 1RL2A 2ZCWA 2HDAA 1USTA 3K4KA 3FEOA 5BRFA 2HD0A 4C2MJ 4CZZA 1D8JA 1RT5A 3H0GJ 4F7ZA 1M2OA 2HTJA 4PGGA 3BG3A 5J26A 4P96A 1ZSZA 4N0BA 4A2AA 5TISC 1IGUA 4FJ7A 4KA4A 3QZ5B 1KLNA 3I4NJ 1S1XA 2LJ0A 3MD2A 4FTHA 2EFNA 4XK4A 1NM1A 4W5NA 3F70A 4PCQA 1L3SA 2JSCA 4LXCA 2IJLA 3QESA 4FLZA 3Q0UA 1XGMA 1QVPA 1YJ9T 1O57A 3SBTA 4ZZDA 3AVNA 3R8EA 3KLHA 1BOAA 1O7FA 3T8TA 3CFPA 2PJRA 3PIOL 5IXBA 2FF3B 3R6NA 4FJLA 5C6SA 4W5QA 5EGOA 3CVSA 3VF4A 4Z94A 1SKWA 3NH0A 1W5CC 3SV3A 2XV4S 1D3BB 1I6HJ 2QA4A 1IREB 4YELA 3F72A 4DZJA 3OSGA 4H4KC 2LSNA 3CMEA 2NWMA 3M8FA 3MEAA 4ISGA 2MAMA 5J2NA 3VJPA 1WFXA 3GTLJ 4LSNA 3K1MA 2F1LA 2RD1A 3I58A 1DEJA 3O8HA 1N39A 3C94A 3JAMK 4QQGA 3R2XC 2E4HA 4M45A 3DEUA 4XTVA 1FMKA 1ZYRF 2KMTA 5FU7B 1KD1R 3H5AA 4XLFA 2VVKA 1CZ9A 3A01B 3PSIA 4JK1X 3CCEI 3L2RA 4RMOA 2D5RA 1KD1U 4DR4K 4QVDA 1D3YA 5KK1A 3MWMA 1WHUA 4YG2F 3CF5F 1W0HA 2KVQG 2E5LK 2CUEA 3CXCP 1W36D 1B34A 2LRQA 3UKGA 4B9MA 2DYIA 2MC4A 2YPRA 4D7NA 1GCPA 3VEVA 2XASA 4RS8A 3JSCA 3VSLA 3IFRA 3CPFA 1T03A 1J5EK 2OTJA 2ZPEB 5LL6S 2X6YA 1WJ5A 3FHGA 1T0HA 4PK4A 2XMFA 3WVDB 3FXKA 2O61A 3G6EA 2Z1HA 5TJJA 1OISA 4C92E 2FX0A 2Y1JA 2ZXHA 3WGGA 3QIOA 4L8RB 3OL3A 3UDCA 2NNWA 1N25A 1RTIA 3CCSN 4EVVA 3OYEA 4CZKA 2RQPA 2E3HA 5A2QE 1QQNA 1EV7A 2R5MA 4IIOA 1ZQ3P 1B34B 4YOQA 1U84A 3RSEB 3VQ5A 2R58A 2JMCA 2Q2EA 1JJ2S 2CYYA 5C10A 1T8EA 3I0RA 1M30A 2E6MA 4OIRF 1CKBA 1JKOC 1NJZA 4XTXA 1KAXA 5CKHA 3VETA 1RDWX 2E1CA 2IGOA 2R57A 3CERA 2Z16A 3PFYA 3AG1H 4M7AA 5IAYA 4ZYAA 1N34K 1YIJA 4NO7A 5FRNA 3G3ZA 1MPGA 3A4CA 1YF5L 2ZFUA 3CMYA 3SDGA 3MN6A 1NNEA 2MC3A 3Q7CA 2K9LA 1QQOA 3QEIA 2QGFB 3X28B 1F21A 4B3TK 3JCMg 1V5FA 2CU7A 3BZCA 3IV5A 1C0UA 2M16A 1HDDC 1GRIA 3O1WA 1QNTA 3MEEA 2B8AA 1FN7A 2E2PA 1VYUA 4TVRA 3W2WA 2RVCA 3PM1A 4M75E 2H6CA 2Y48A 2HVQA 2E3IA 3UKUA 4EMKA 2YHXA 3O9RA 3HHGA 4KKOA 1IRFA 4H8KA 3OW2P 3LSKA 3CJRB 3H5NA 2BW3A 1KLMA 4M78G 1OKRA 1KFSA 2L9NA 3JRBA 2X4JA 5C3EJ 4UVCA 3E19A 3LH0A 3DMJA 1IRXA 1BW6A 5J1UA 4I0BA 1IF1A 2QM3A 3HPOA 3SJHA 1RBVA 5LFAA 3RZOJ 4MFBA 3WG7H 1SQKA 1YW9A 2M7AA 1QBJA 3FXMA 2IVWA 1S8NA 4M6XA 5A0GA 4RM2A 3O9UA 1FC3A 4B3XA 4AWXB 2CV0A 3AFHA 3EG2A 1S1TA 1S7EA 1I0CA 1KU9A 2P9NA 2PJRB 4CZLA 2X4XA 4IDHA 3FMSA 2W24A 2UXNA 1KG6A 4KMFA 1UHFA 1CSKA 4JRKA 4EMGA 1A0NB 2M1BA 4LUDA 1X75C 4M9ZA 2QWNA 2YDLA 1VQLA 2XI9A 1W2BA 4JHDB 4NLCA 3GIBA 1YJNQ 1WEFA 2GAUA 2VOPA 1MH3A 2WAQA 2LKXA 1AKHB 4CVNE 2FQ3A 1ETQA 1BOTO 1NK5A 2QSGX 4H4MA 3VA0A 1XC5A 2JWLA 2VQHA 2LTOA 4N47A 3K9JA 3SCXA 5M9OA 4M78D 1KVBA 4LG3A 2RKIA 3K9KA 3S8PA 1C6VA 2DPPB 4YOTA 2DA9A 1FKPA 1UCRA 1HLUA 2EIJH 2HHVA 3VRYA 2ELJA 4LDVA 1TK0A 1MJAA 3THWB 3GE1A 1NK3P 3VEYA 4CFAA 2J5PA 4KT5C 4KN4X 4NOYA 1VQNT 4EJOA 3N5NX 3E5XA 4BRAA 3OMYA 4EP5A 1BK2A 2VKEA 2ADUA 1ZN2A 3GFMA 4LOCA 4JKFA 4H4OA 3J81Z 1E3OC 3OL4A 1PU7A 4LD0A 5JVGF 2FA5A 3OYDA 2EWSA 4I9LA 1JJ6C 3DLLF 1BU1A 1T3SA 1VQ7N 1VQPA 3E7LA 3N0UA 2KXDA 3J7ZI 4XOTA 3ERED 4NCBA 2GBZA 3HOTA 1SVOA 4Y13A 1J0RA 3KK1A 2YLBA 1C0MA 4FXDA 4FLXA 1D09B 2YCHA 2LSOA 3HVTA 2VBWA 2LC2A 4F8RA 1ZBSA 1IO2A 2E20A 4M3GA 4BC5A 3LPTA 3OYNA 3R1XA 3CMAQ 1YJWT 4IDKA 4DSFA 4RAZA 1YT3A 3VS1A 4CK2A 2RC4A 4H03B 4K42A 1HW5A 4FHTA 3CMEI 1YHQI 4NB4A 3JCMJ 3K69A 4BC4A 1B72A 4M74A 2MWPA 4AG1C 3C6TA 3KWIA 2X4WA 3ZT0A 2QGUA 1WAJA 4FWQA 3TGNA 1IGQA 3M56A 4B1RA 4OMZA 1R1TA 1WNLA 2H6BA 4A3EJ 1V1CA 1TWFJ 1OI1A 2W42A 1MNDA 5GAEJ 3DLBA 1D8KA 4Z2YA 3EFOA 2HTSA 2LD5A 2O8CB 1WBDA 4EDUA 1KU7A 2KRMA 3AO2A 1BDGA 2GTJA 4DSLA 4BWJA 3QBWA 1TW3A 2AA4A 4DU1A 3O2PE 2FLOA 2M30A 3S9HA 4JRQA 4MZMA 1XDSA 1K8AO 3IWZA 4PKIA 2RNJA 3HGGA 3D0SA 4NXMK 5KYWA 1VQ7I 2ZO4A 4M75C 2KQWA 3U6FA 5GPAA 2RF0A 3OS5A 3K2ZA 4BXXJ 2KAFA 4RAYA 3G4ST 3CF5L 1BM9A 1EZZB 2VC1A 2P9UB 3EGXA 1DJ7B 1MNMC 3RQ4A 4LDWA 3J7YP 4A57A 3U8XA 2LF7A 1R77A 5FO5A 5CCAA 1UFMA 4XU1A 3JRZA 2LT1A 4F3TA 4JI5K 5AQGA 3LH5A 1K9MU 1H89C 2XU8A 5M3FJ 3J81O 3K5NA 2MPXC 3TU4K 4CA0A 1PUEE 3OMCA 4ICLA 1Q81O 2EHGA 4FX0A 4PWDA 3NVKA 4FWPA 4GV3A 1NPPA 4O6JA 3FZLA 1VQ8T 3UR3C 1KA8A 1VQLQ 1NBEB 4E9HA 3VENA 4FM1A 1XQPA 4CK3A 2IXSA 4JJDA 1W2BP 1B7TA 1JCFA 4IG3A 1PSEA 3KX2A 1WPYA 3OB9A 4ZNXA 3KK2A 4J9DA 3L1AA 1U8RA 2P9KA 3JCMe 3O8GA 3FE1A 1KG1A 3G1MA 3CCMA 3H5RA 3H9JA 2BVMA 1MDMB 2O4XA 2V1DA 3M4GA 4C8QF 1W1WE 3CCYA 5B1AH 4X0GA 3VA3A 1EETA 1XMOK 4EM0B 2HZTA 4ILHA 2D0QB 1NEBA 2JA8J 1BR1A 4ZGEB 1HW2A 4OMYA 1BUPA 4CGFA 2MGQA 3OOPA 3BPVA 2KK4A 2GFAA 3LWMA 4D9JA 2DTOA 4M7DE 4PDKA 2X0LA 2RHIA 3CP2A 2OTLN 2GQQA 3VQ7A 4OPJA 2L2PA 4PIIA 3V4IA 2F4VK 3LWIA 1XHZA 2QKBA 3OW2A 3HPWA 4YFKF 1RCHA 1QVGA 1KC8C 5K7HA 1X69A 1Q86R 4XNFA 1M1GA 4YEJA 2P8TA 3OS2A 4OF1A 5DV5A 4JPBW 1D8YA 5CKDA 3CWTA 1OCZH 4B09A 3LP3A 4BQLA 4GGGA 2CUDA 2Z33A 2E6ZA 4QOZB 1ZA2B 1FWZA 3QNOA 4LH4A 2A0FB 1OCOH 4B1ZA 3BE3A 3H6ZA 3TWHA 1WYXA 4EA4A 4PJNA 1JCGA 4Y52J 4M3WA 2KTQA 4X34A 5E26A 1KTQA 4MHGA 2EB7A 2F5KA 3CQ8A 1F9NA 3FF5A 1JJ8C 1T56A 2Q0OA 3V7RA 4G7HF 3J7AY 1RILA 1Q7YR 1PUFA 1UA0A 3F8MA 2W10A 3HM5A 4A4GA 4B9VA 1R1UA 3P9CA 5DM7F 4RGRA 3SWNB 1NPRA 2DL3A 3NARA 1ZXOA 1Z0XA 1VRTA 2HKXA 3LP0A 2CP6A 2NOEA 2LBFA 4XKBA 2CH4W 3VMFB 1XCBA 4ELYC 1VQMI 3HBLA 4CK1A 1VSIA 3DQVC 4F17A 2VV5A 1C0GA 1WQ2A 1KG5A 3KFWX 4MMKA 4E6RA 2P5OA 4UC4A 5JVHL 3DLMA 4QVCA 2KDOA 2PEXA 2K27A 4IIMA 1NU0A 3VYSB 4ZN3A 4DOZA 4AIHA 2EFWA 4PJOA 3K2PA 2EZHA 3J7AP 2O8XA 4ZTJA 2EGCA 3HO1A 2F9TA 5GAOn 3WTYC 2LRDA 1BI1A 1RAGB 1WHGA 3J81K 4JK7A 3CDIA 3HL2A 1GLCG 2KJCA 1VNDA 2RPNA 5DLQE 4H5WA 2QWWA 5H20A 3NF9A 3K5MA 3WEEB 4HT8A 1UG2A 5HS9A 1I3AA 2Q31A 4O3MA 5ECAA 4L5GA 1V3FA 4CF9A 1MDUB 2BBYA 2QTXA 4I6MA 3I5RA 1TKXA 3PMIA 1OYYA 1T0FA 3G1OA 3SUNA 3GTGJ 3EYIA 1ZX6A 2QWOA 1W6XA 2JGUA 2OAUA 2OYQA 2JTFA 5IP7J 1ZA1B 3HM9A 5CKEA 1RT6A 4MDWA 4CCKA 4GLKA 4ZGDB 1TW2A 2JHNA 5CO7A 3JAME 1TGOA 1DUXC 1ZBXA 1R4MB 3G71I 4BYYA 1YWOA 2QASA 3ULEA 2E1MC 4IHTA 2D8HA 4KDPA 1Y0NA 3WTVC 1CXUA 2DTRA 3QSUA 2I5JA 2WBNA 2CWEA 5CR4A 2G8VA 2HL3A 2DFFA 4GRIA 1YJWA 3M53A 1NJYA 1ZLJA 3QAHA 4M78A 3QPHA 2F2EA 4LMYA 4CZMA 3CD6T 2E70A 3O4NA 3TEEA 4L5EA 3CMAI 2NNYA 1Q1HA 1SD7A 3OYJA 1BC7C 4OVLA 2DK8A 1S1UA 4JI8K 1IAWA 3P8HA 3CQZJ 4XLEA 1KCFA 1U48A 1G3WA 2E19A 3PV8A 3FHZA 1XMAA 3J80E 1MV0B 5E41A 1BI4A 1MIJA 2KISA 4JAXA 1TWHJ 3LL7A 3RDVA 3LW5E 4DUYK 3MDQA 4CGHA 2G3RA 5FWBA 1RBSA 3CC2N 2XICA 2A5YB 4DOWA 4FM4B 3A5NC 2RHXA 5IOYA 2JT4A 2B7EA 3VN5A 3QBXA 2H3EB 3N05A 2YR2A 1S29A 2JLEA 2VPLA 1M2VA 2VKNA 2QXLA 3WNGA 1P92A 2FBIA 2CP7A 5AQJA 3JCMX 3FFIA 3TO6A 1BA1A 1YJNN 4G7OF 3DU6A 4BUPA 1LAVA 3ZQGA 2K85A 1JB0E 3QINA 2VJ4A 1A35A 1T98A 4RBOA 3L2UA 1I1GA 5JI6A 3MWPA 3LWFA 2MCNA 1X3WB 1QVFM 3RMQA 2BY2A 1GLFO 1W4MA 1YE9A 3TP0A 4B3OA 3DOLA 4M9XA 4KI6A 3K70D 1YW7A 4D5CA 2EIMH 4E9FA 1TAQA 2ZPGB 2KIUA 2DEQA 2HSTA 3LYIA 2YHYA 1C0FA 3ZMVA 2BZYA 3O4WA 2OTLQ 1VQ6I 1PRMC 2EYXA 4CEQA 2YX7A 4QIWN 4CGZA 4BACA 4E89A 4Q5WA 3CCRT 2LQNA 4KI4A 1Q95G 3EZWA 5EG2A 4LD5A 3KLFA 4S05A 3G0QA 3DB4A 5EOYA 1GVDA 4XLHA 4FT4A 3RSEA 3JAMZ 2MF2A 1ZUKA 2ESHA 1RT4A 3BDUA 1IBMK 3E6BA 1KHCA 4JQFA 2D1HA 2A07F 1S72A 3CCST 5IH2A 4A63B 2ASMA 4LF7K 3LM2A 4MQVA 5GIPA 1LWYA 1GFCA 3GCMA 4CICA 2KZZA 4E7LA 4RCHA 1VQ5N 5FB2A 3ZSYA 4M3FA 2VXFA 5FPEA 1RT3A 3KUFA 1KU3A 4B8AB 4DQRA 2NLUA 4AUXA 2ZMEB 1GUUA 3HP6A 4A53A 4C92D 5KCOA 4F3OA 4HSTA 3D7SB 2LJ1A 1KC8U 2ZXIA 2JA5J 3WVEB 1XG7A 3OOUA 1B8IB 4Z89A 5AQSA 1O3QA 1I5OB 3VEOA 2KIFA 3OGDA 1U4BA 2CO5A 3NMUA 4LUEA 2LOOA 5D6YA 3O3HA 3P9IA 2RB6A 2J05A 2NUTB 2XG8D 5FROA 2ID3A 5GAN5 4XH4A 3OWTA 5F0CA 3GW2A 4HZFA 1HNZK 1N3AA 5F0HA 2R7ZJ 2GBQA 4N76A 4CI0C 3D5RC 1JJ2M 1JKHA 3JV3A 3VS6A 5AQNA 4MLHA 2YNGA 5CZ1A 1BN5A 3JSOA 2RJFA 2L3RA 2LQ8A 2FMYA 2ME0A 2A36A 2L9SA 1NK7A 1QVUA 4II3A 1QCNA 1M8VA 3KTUA 3T19A 4GYGA 4IZZA 2UXDK 3ZT4A 4F4KA 5CVUA 1EH6A 2NUBA 3ZCMA 1UDLA 1R0AA 2ZSIB 1NGCA 4KTZA 1JBMA 3CUQB 3OYIA 2A61A 2XDVA 5BRHA 2O4GA 1QTMA 4H5RA 2A37A 2Z1GA 2DFIA 3T8RA 1K1ZA 4UUVA 3NGZA 2KFNA 2YI1A 1XMKA 2L9RA 3VFZA 4KT0E 1ASVA 3K57A 4H0PA 3BT9A 1HJRA 1ENHA 2DBKA 1DT9A 2XDPA 3Q3SA 5BN9A 3KLOA 1PUFB 1T6DA 1BG3A 3M8JA 5GJWB 3HBTA 1A5XA 1NK2P 1IG7A 1YJWQ 4KREA 1TLHB 1ZHFA 3TI0A 2LF8A 5L3GA 1FJLA 3L42A 3OYYA 4C8MA 2HNDA 4BNCA 3THWA 2R92J 2DA2A 3TW7A 4KH4A 3SV4A 2PMZN 1FMWA 1ASUA 4O5BA 2CGKA 3QIIA 1I39A 2Z99A 5KYXB 3KLGA 1S7OA 2AO9A 5B5EC 1ETOA 3AG3H 4EQQA 2DODA 4I7HA 3BG5A 3B8AX 5IXFA 5KRTA 3E9FA 3O8VA 4B3MK 1N9SA 5ICCA 1UJYA 3DLKA 2LMDA 4OO1J 2HNIA 2PYLA 1HBXG 3PQKA 4M7DD 1HKCA 5MLCQ 1RAAB 4CZJA 2XRNA 3V42A 2EJ9A 2KRNA 5E1WA 3FXQA 2RN2A 5DS9A 1D9FA 3ZSOA 1YI2N 3KP4A 2QLZA 1OPKA 1S6LA 2BUDA 1U5SA 2MH2A 3HOSA 3NCIA 3OHRA 3SUPA 2IP2A 4MQ3A 2R7DA 1GLBG 4DR1K 2VG7A 3I56Q 1QZ6A 1M3QA 3THXB 3VGMA 4R56A 4M3EA 3S93A 1EP4A 3CCEA 3VPZA 1YS6A 3I64A 2Z2SB 4JI4K 1XQOA 2E36A 1GOAA 4PFOA 1VQNA 4M7AF 4QPQA 2DN0A 2ZBKA 2YRDA 4JKDA 2WV0A 3MZHA 2LKSA 5LJ3d 1RC9A 1K6OA 2JHJA 1RADB 4D7MA 1XMXA 4HAMA 2O9LA 2CGPA 3AVBA 3MK6A 2E1HA 4E9GA 3PIPL 1UTIA 3HFOA 1QWEA 2Q3SA 4BWMA 4CJQA 2OV7A 4HCKA 3RWUA 3M0PA 4JKGB 4JLGA 2QA4T 5IT9E 2Y4YA 2V9VA 3M9QA 4M72A 3TKYA 2QYZA 4RCBA 2R5YA 1H9GA 3E6DA 1EX4A 3LZIA 3M0UA 1SEUA 5IOZA 3PMTA 3URGA 2NNNA 2O31A 3HKZA 3TTDA 1XGSA 2L3SA 2NS8A 4PSXA 5CAIA 3JCMQ 3CFRA 2DA1A 1TP4A 1YHQQ 3L8BA 5F6FA 4A12A 1RETA 4BJ6C 5F2RA 1YOVB 3KPHA 1YJ9N 2UU9K 4LF6K 1QVTA 1GVJA 2OC6A 3D2EA 2W4SA 3HK2A 4I9QA 4BGAA 5DM7L 4XLPF 3PTAA 3G4SN 2R93J 4N5SA 2XGDA 2GM4A 4KYWA 1G3TA 2IDOA 3AVCA 4OWRB 2CUJA 1XOVA 1QHGA 4CYCA 4Z4GA 4L0ZB 3C18A 3KIOA 1IV6A 1ULYA 2DQLA 5DD8A 3IUOA 5GADJ 4KFBA 2MIOA 3AVFA 4FW1A 1DTQA 3QWXX 1KXPA 2RE2A 2CH0A 4KICA 4H5NA 1ETYA 1OYIA 3T1HK 2JPSA 1Q82O 5LGTA 2WV1A 4R8HA 5GMKh 3I55A 3R3LA 4QS9A 4GY2B 3ZN1A 1XDUA 4FJ9A 3HXMA 1UHWA 1I94K 4ZYGA 4EJVA 6PAXA 2VT3A 4JKHA 2QWMA 1YHQT 3CCVQ 5KE3A 2QW9A 2A6HF 4EHUA 4A54A 3WHBA 4U87A 3CJAA 5KPZA 2IAIA 4C8LA 1VIEA 2E64A 4DTSA 1IW7F 4RB2C 2JPCA 2DETA 2KZMA 3G71A 1TC3C 2IRFG 5GAMj 2DDBA 4OMOA 1P6RA 2NUPB 1RAEB 3F2KA 1ON1A 4Z8AA 3VPRA 1QS4A 4J9CA 4M3XA 2RO0A 1DGRM 1SG5A 3P8DA 1I8FA 1OVYA 5L3FA 1VAZA 1PHTA 3MFKA 4PJOF 3GNGA 3I5SA 1G99A 2CGLA 4YDUA 3REAB 1MGQA 2QXFA 4H0TB 3TPQA 1RDDA 4N9HA 3O08A 3BC8A 2VGNA 2Q2EB 3L7WA 3HB9A 4CHZA 4C2UA 4UHTA 4A4EA 5FD5A 2YNFA 1EKEA 1HLVA 2XGEA 4A62A 5GAMf 3H08A 1WEIA 3QOPA 2IIMA 1BQMA 3CFOA 1K7AA 2OPTA 1ZBIA 2HVSA 3TQ7P 2OAWA 4BHCA 1H92A 3ZYYX 2P5GA 1YITT 1XB4A 3A1PA 1TH7A 3R6SA 4G8XA 3SDZA 2CT4A 3TAFA 3EETA 4J9HA 4RW8A 3A8YA 4L9TA 1RTDA 1XJWB 2CGHA 5KGWA 1W7PB 2X3WD 3AO3A 2XY7A 2O3FA 2R5YB 1TWCJ 2HVHA 2P9IA 3TAEA 3DXJF 4CEZA 3OJSA 3N4QA 1XGOA 4O0IA 1T7PA 3NMZC 2VQEK 1Q9YA 4BG8A 1XNIA 2QQAA 4IKFA 5EYRA 5BNGA 3NHGA 4IFVA 4FYYB 3LZJA 1T44A 4NL2A 4XM3A 4YORA 2H3JA 3A01A 2PY5A 1Y8RB 3I55Q 5FD6A 2KEAA 1KSPA 5IP9J 3EE8A 5AZIA 2VQCA 4OB3B 4KJZA 4JZ4A 2DA4A 4BQNA 2QGGA 2D0PA 4BQQA 1U8BA 2TCTA 4HNUA 3MZYA 2HBKA 5JVGL 3L2VA 2QWLA 2YJEA 2FEIA 1ERDA 5D4RA 4AFQC 3PNVA 4ENJA 4DV6K 1TOVA 1JUMA 5DM6F 2GF7A 1VYTA 3VQCA 4I6ZA 4WF9L 1K9AA 2E6NA 1NKBA 4A2UA 4BD3A 4OAZA 1YW8A 3QDRB 2V4JC 1TUGB 2QEXT 3T3FA 4JOMA 5KYYB 2YRVA 4DQPA 2OTJI 4XBFA 3LGFA 1DGWY 4C8QD 1VSHA 2GOMA 4WYBA 2I2LA 2L89A 2NRAC 3QERA 4Z4HA 3KETA 2FBKA 4OPHA 4M75A 2WOMA 2JN6A 3W2VA 3MKDA 3VUZA 4XICA 2MSYA 3D5LA 2DVJA 5TKWA 1JU5C 4AHRA 1ZBFA 4YTLA 3ERMA 4C8QB 2IA0A 3WG9A 4BC3A 2GBYA 1X1BA 2Y0SA 2E5KA 1LPLA 2KY9A 2DXCA 5C24A 1QPIA 4E6KG 1FX7A 3A03A 3JTHA 4GV6A 1AEYA 4F14A 1M8MA 1ZUUA 2I7PA 3GPLA 3H35A 1R22A 3SQ0A 4KB1A 1HOMA 1D3BA 3FXRA 1R23A 2Q36A 1ZARA 1YFHA 3DTEA 1VSMA 1RUOA 3CPWM 3NFCA 5JR3A 4CF8A 3CDHA 2R7QA 3DLHA 2Y69H 3I0TA 1TL8A 3DPTA 1R59O 3EYZA 3EEQA 3OBYA 1ABQA 3G4SI 3THXA 2WB1N 4PJOG 3AO4A 5JVTA 3M8SA 1UHMA 3AA5X 2BTFA 2OFIA 2A5XA 3HVRA 4HQMA 3RMBA 4LIUA 3EHRA 1YJ9I 1BR4A 2RJEA 1AWWA 2OA8A 2XGCA 4DFMA 1BI2A 4LFAK 4ZYHA 3C6HA 3A98A 2X35A 4XAXB 3SHFA 1C6VX 2KT0A 4KO0A 1LB2A 4AM3A 2JM9A 1EJ9A 4IEJA 4BRLA 4A0ZA 1M9SA 4AC0A 2RAEA 2LY1A 2HWVA 3KP7A 1R0CB 1LWWA 2YWWA 2XROA 5ED4A 3KBGA 3EN9A 4FLUA 1KU2A 3PNTA 4AILC 2R7UA 3Q9VA 4CGIA 4K8XA 2JQ7A 2WTEA 1ON2A 2R3SA 5DYMA 1HNIA 1U2VA 3FXLA 4M7DB 3M0SA 5ADXH 3KKRA 2ED1A 3MMVA 5FLXZ 3CO7C 1D9DA 1QVFP 1SAUA 4V2GA 1RBRA 3CCRI 4ANJA 2RQWA 4Y15A 3CCLI 3COAC 3I0WA 1QVGM 3QRFF 5AFUH 4IXAA 1N36K 5IT9Z 1A04A 1JXEA 2HNHA 1V4RA 3ABMH 4E7JA 1H3HA 4NB5A 2DPDA 1W7PD 3EUAA 3OH9A 1TBXA 2CUBA 2P0QA 1K73U 1U5TB 3M55A 2JWKA 5JHFA 2DL5A 4JK9A 5H6RA 2DA7A 2XY5A 3QFPA 2FPDA 3NTHA 2K79A 5FDLA 3CJQB 4CJ5A 3FZMA 1W2BS 2GXBA 3EPZA 2XIDA 2V7ZA 3QDKA 5JLWA 1UG1A 4M7YA 2NOBA 3PL8A 5FLVA 1RLPC 1W0UA 3RKXA 2RQTA 4BRPA 3GF5A 4M63C 2KMUA 5GAN2 3RUXA 2IVOA 1ARKA 1UGRB 2LCSA 3LDOA 4WXCA 2EQJA 3CCJI 2EPFA 2HHHK 2XAUA 3IRRA 3E5UA 2GTDA 4NYFA 2DY4A 4HWIA 2H8WA 1K8AU 5E3MA 4RTWA 3OA6A 3M5AA 5E3LA 4RKUE 1RAIB 1AHDP 3QWYA 4QCLA 1N8RO 4LLGF 4HVVA 1PU6A 2EQRA 3BOQA 4LLLA 3PJRA 1VSKA 3DTIA 5DUKA 3S15J 1DGKN 3DBHB 5LJ3e 4FOEA 3K9TA 1IKVA 5DMRA 3S17J 1KONA 1HYSA 3QYFA 2RJCA 1W0TA 2DJIA 2E5ZA 1LJ9A 1FP1D 1NMNA 2EX3A 1S72T 3RKWA 5HK3A 4M75B 4KULA 1NYGA 1PVEA 5E84A 3VESA 1YP5A 3VS2A 4RG8A 3CC7I 1EFNA 1JO8A 3J81E 2G8HA 3HHHA 3CCMQ 2VKDA 1NM7A 1DDNA 5K5RA 3E3VA 4FWLA 1G3SA 1X4PA 2DTZA 4CCLA 1VQ5A 4ITVA 3HPGA 1WSFA 1P9QC 1PD1A 2K7LA 3JCMd 3LSTA 3EUHC 4C92B 3E97A 4Y3OA 4KUIA 4ZZLA 1UB4A 5L3EA 5LGNA 1P59A 3X2QH 5F04A 2B4JA 3BROA 4HLYA 2HBJA 3ZN0A 2SEMA 4OGEA 5CVRA 1O1WA 2G8FA 4IOAF 2V6EA 4CGDA 4HX7A 2ISYA 1AVZC 3SWNA 2DTUA 2LY2A 4ELVA 3G7ZA 1WSUA 1TT5B 4ZDPA 3BCAA 1LV5A 1UECA 5AR0A 2VKVA 4F91B 2DKGA 1MMAA 4CHUA 1X1CA 2HQRA 2QAZA 4HV5A 5ILVA 5GINA 4A2BA 4AFSC 4AM6A 5EZGA 1QP2A 1ZRDA 3PT9A 4PUSA 3T7ZA 3X24B 5AQKA 4KMUX 1JT0A 4UQGA 3O3GA 1T33A 1I27A 4OVAA 2LQKA 4XR6A 2WACA 4E1MA 4E7SA 5AQWA 4C92A 3SUOA 1U2VB 3CC7T 4M77G 3UKUB 5IYBJ 1NGAA 4RG2A 1MUZA 4AHCA 2IT0A 3K70C 5DPKA 1LWEA 2RF2A 4NCAA 1AOJA 4B21A 1ACIA 3ZLJA 2WSFE 1Z9ZA 1O3TA 1NOYA 1WCMJ 4BR5A 3CQYA 2IEKA 3R6OA 3I0SA 2HQAA 1K8KB 3EY1A 5CHZA 3NPFA 5BQTA 1UMQA 1IHVA 2J4RA 4C8QC 4E0DA 4BGDA 2BDPA 4JYAK 2GQIA 4OLBA 1QZ5A 3TTFA 4UB6C 3LCNA 1LVAA 4DKWA 1R7JA 3H0HA 3WNEA 1AU7A 1VA7A 4M7DC 1AZEA 1O7LA 1K0SA 1Z67A 1H1VA 4I98B 1WSEA 4HVJA 3MAJA 4CJWA 4Y92A 2P1JA 3GTOJ 2K9NA 3D0PA 4EJZA 4A0XA 1PSFA 3U4LA 5I9EB 4L9VA 2L7ZA 2ELHA 1OVQA 4Q5SF 3CBPA 1WEGA 1I1JA 1WI7A 2V52B 1TV6A 1LKXA 1K83J 4FE4A 2CSIA 3VYUB 4XH5A 5T7BA 1OH5A 3W6VA 5M5XJ 4XH1A 4KV8A 2P9LB 1GFDA 3SZPA 1ORPA 1LFBA 4L3QA 1D5YA 2E71A 1RNHA 3ATUA 5AQFA 3PFSA 2VIXA 2MOXA 4Y17A 2P6SA 4M75F 3WHCA 4R79A 4GNIA 1YJWN 2RNAA 3NNQA 3I9QA 3KP3A 1JLEA 3SK3A 4CEEA 3VKIA 4M7XA 3I3LA 1B59A 4IF4A 4IUPA 4J8OA 4A59A 2LQWA 4KGXB 1XSDA 2OZMA 3DLAA 3EG3A 3L3UA 1ZSZB 4UNFA 4KRFA 3CCET 4IBNA 5HOOA 2P81A 2QBYA 2Z3YA 4PHTX 3LP2A 1EBMA 4LDXA 3GBGA 4EW4A 4S04A 2WAQN 1VQ7T 1DLOA 2KFDA 1QHTA 3LQQA 1OPLA 3T0YA 3DB3A 3F5TA 3FM5A 2EBPA 4CJ4A 3CHWA 4M3DA 2D6FA 1TNSA 3C6AA 2RK2A 1H0MA 2G8WA 3AAFA 1D5AA 2KRHA 4FJ8A 4CHOA 5GMKi 3PX0A 1J2XA 2HMPA 3BJ6A 4BRMA 1OJLA 1VQ9A 2VG5A 2GA2A 2KFZA 1QA6A 2XAGA 3C0CA 2DPNA 1FBQA 4CF2A 4XRSG 4RW7A 1KGSA 2HR3A 3X25B 2K3FA 4FCYA 1WA7A 3QIPA 4DFKA 5CK9A 1TSFA 4ILGB 4R5PA 4B22A 4JS5A 4PFZA 4LB5A 4G94A 5J1RA 3JB9J 1A6QA 1XUPO 1TKDA 3HUGA 3ESWB 3CCVA 3NFAA 4DTNA 4YFNF 3ZFJA 4GKJK 4BL0B 1MNEA 4EW0A 2O0YA 3HSFA 4IHWA 4DTUA 4M3RA 1E4GT 4M77F 3V9WA 2CUZA 4C8NA 2KJBA 3OYKA 3ENBA 4RTVA 4M3ZA 2UYTA 1ZG5A 1YUWA 1U0JA 4JI3K 3M1EA 2KKZA 3RPUA 1TKZA 2R7YA 4J9GA 4X1VA 2K9SA 4I2QA 4BAYA 1X43A 4N9IA 2CZ0B 1K73R 3H9QA 1Z9CA 2NRVA 4XKVA 3FHFA 2FRWA 1YFNA 4HPQA 5EU7A 1M5Q1 4BE0A 4CE9A 2O7OA 2YHBA 1WDXA 3PO5A 2KIMA 2X1EA 2O88A 1BL0A 2RQRA 4DQIA 1JKRC 2QQ8A 2QSHX 2CP0A 4PY5A 1WGXA 4OKJA 2QQ9A 2X1DA 4QTRA 2I10A 4JLHA 4XU2A 2RHKA 4JKCA 2EH3A 1T95A 1SPKA 2COZA 3DXKA 3IKVA 2ZJRL 4BRGA 3TSQA 3WU2C 4M77A 1Q82R 2HBLA 4FJJA 4V19K 3S2WA 5KRSA 4BJ5C 2C06A 1VQMA 2M7BA 5GANg 3SPYA 3TSWA 4Y4RA 3JCMW 3P9KA 1G59A 3IHOA 2FMLA 5E8IA 2GA1A 4M78F 4I99C 1LDKB 4HNTA 1WSHA 1DP7P 4WCGA 3CCRA 4HTUA 4OKEA 2P4RA 1T05A 5KAIC 1YJNI 4HBLA 4XRMA 2WBMA 2JNGA 2XHKA 2VJJA 5AQOA 3AT1B 4DSIA 1IDZA 3B73A 5CVJA 3CCQQ 4M7AC 3QXEB 5K5QA 3QETA 1OZ2A 2JPBA 4D5FA 1KJWA 3TSZA 2VYPA 4C0DC 1DTTA 1BC8C 1F43A 3AVMA 4C3IJ 1E6HA 1YCYA 1KG2A 4CJ3A 1SEMA 1MV3A 1OU8A 4GYIA 3F22A 5FLMJ 2KDZA 4RTTA 2ISZA 4CSWA 4U7DA 5BMZA 2NYSA 2ZAEA 5D6WA 3QJYA 1U6ZA 1YAGA 2WC9A 1G15A 1RABB 1X58A 1STZA 1OV3A 4JRPA 5HS8A 2W40A 2ZGZA 4AHTA 1IBLK 8AT1B 3UNGC 2E2NA 1QE1A 2COBA 2FF4A 2PFUA 1NG9A 4EMKC 4H0XB 1N75A 2ETHA 4F3QA 2CSOA 3TQNA 3ZSXA 4BB7A 1NLVA 3FBNB 3AY9A 5EC7A 1T38A 5AQTA 2HPIA 5AQMA 4CHPA 2FOKA 5HCKA 1DPUA 1AD5A 5BPMA 1XN7A 2Y0SN 1VQ9T 1VRUA 3QPLA 2ECZA 1UZCA 1KRPA 1RESA 3CWSA 2XF5A 1R5HA 2NOLA 4WXDA 2JXBA 3FISA 3K6GA 3O5ZA 1X01A 3J8AA 2KKOA 5DD4A 2BIVA 2ECCA 4I09A 4LDYA 1HJOA 1RZ4A 2FO0A 2ZJQL 3RBBB 3KP6A 2HHSA 1ZLKA 1YI2I 3VB2A 1HQUA 1IUFA 4Q47A 2GEMA 4X1EA 2JTVA 1PC0A 4CH7A 4AVPA 1RAHB 2KDSA 3QLHA 2KL4A 2STWA 4OU0A 3S16J 1HUXA 1RT2A 4MZTA 4IHXA 4FX4A 3F10A 4EJYA 3LPUA 2P9LA 2F2XA 1UJ0A 4QWQA 2NRTA 4Z4EA 1QZZA 2KQ2A 3O6BB 3EO3A 4ZHRA 1HX1A 1YS7A 2P9SB 4OLAA 2GWRA 1QP3A 4XTUA 3G6EQ 3WXMB 3JYTA 2LVSA 5LMNK 3Q0VA 3KYLA 5D6XA 1KD1C 3FSPA 3VS5A 2VONA 3VGKA 2M0MA 1YJ9Q 2EW3A 5F08A 5HKCA 1R4NB 3A5ZB 4KN7X 2R4GA 2OJ2A 4XK8E 4LK0F 1LMZA 2FQ4A 4J6XA 4L0YB 2ZNZA 1LW0A 1RPWA 3PE0A 3G25A 3KP5A 2K4JA 1AOYA 4IURA 2C0OA 3LSIA 1M3HA 3TP3A 1VQ7A 2KSSA 1R0BG 3H6EA 3DTKA 2ACJA 3DXMB 4B1YB 2UXCK 1VQOQ 1N8RU 4RTUA 1W4SA 3SQ2A 1JLBA 4AM7A 1ZBJA 4FVUA 1QHAA 1X9JA 3CCJQ 3BCBA 3VS3A 4FWNA 4W5RA 1WIEA 1SS6A 2F7TA 5ICFA 2WTUA 3EFRA 4WQ4A 3F8BA 5LJ5d 2LNVA 4BEHB 1SF9A 1A5JA 4RTYA 2YUPA 2RA2A 4RB0A 5M1NA 1UJ8A 2RMOA 2ABKA 2VC0A 2AZVA 4K41A 3BR2A 5DM7R 1OLTA 4EGYA 4A3GJ 2AT1B 3VWBA 2Q97A 4BY6C 3QYBA 1MSFC 3G71N 4BREA 1JLFA 1SKUB 4M7AE 4RGXA 2I0NA 2WUSA 2D0BA 2EPDA 2EWNA 4CBXA 3UATA 2W7NA 1QZYA 1S5JA 4BEHA 2FNPA 4HUGA 4P5OA 4UUSB 4O8UA 4LGWA 3KEQA 1WB9A 1S9EA 2UUZA 3HSEA 4N4OB 3CCEQ 2KI7A 4JEPA 3RIRA 2BV6A 3FZVA 2D8JA 5IWAK 2ATCB 4EIAA 1OH8A 5AZJB 1Z7LA 1LDDA 3CCRN 1SVLA 4DUZK 2R7TA 1Q81R 1PWTA 4AIDA 1XQHA 2CFXA 3QEVA 5EZHA 2H3GX 2UV1A 4HSBA 2JVGA 2M02A 1KC8R 4WCIA 1XGNA 2M0YA 1BB9A 3ABTA 3RR7A 1U5TC 5GTIC 1WN7A 1RFQA 3N4PA 4JJCA 1X1PA 1HKGA 2HXOA 3BY7A 4G7ZF 1FZPB 2BXYA 3UIQA 1VOMA 3P5JA 1UB9A 3FKJA 2PMUA 4Z02A 4J6YA 4JD2B 2DERA 3SQ4A 3BZKA 1PVSA 3CESA 4J2DA 3DXKB 2HQEA 3A8HB 1VQMT 2PQWA 4JK8A 4BRFA 1KC8O 3FJ5A 2FBTA 2VJ5A 3CCRQ 5C2FA 2XAJA 3VU3C 1IV0A 2DJNA 1QSLA 9ATCB 5JLHA 1SFXA 4BHPA 1KIKA 4J19A 4A93J 1A31A 1K79A 4IJNA 4BRIA 3C3WA 5GAN4 5JS2A 2NOGA 5FPMA 1ZG3A 5EGOB 4C1NK 5AQQA 2VYTA 3CWUA 3U21A 2O01E 4ESRA 3ZX0A 1MKMA 1U45A 5CKFA 4HSRA 2RREA 1YBYA 1WHHA 4KHPK 1QQJA 4C8QE 2DI3A 2DOAA 3LLRA 4Q5VA 2J7IA 1Y8QB 1B9NA 1B9DA 2M0CA 2VGMA 2IGMA 3TOAA 2K9QA 3LDNA 2QSFX 1YQLA 4BY6B 4MGRA 1P7IA 3ZQFA 3NF6A 1RDAA 2P4TA 3HOWJ 2IW5A 1D0YA 3F6VA 1BWFO 3JCMV 3TANA 5I22A 1ORNA 4B3AA 3JCMf 1VQ9N 1U9OA 4F52A 4DTXA 4A4HA 2Q0RA 3LAPA 3KLNA 3E2UA 1TYQA 4ID1A 4ELTA 1MBHA 2COYA 4K43A 3FDRA 2GIZA 3KCCA 2XDBA 3K0LA 3MEDA 3K4BA 1O13A 2X3XD 2IGKA 3VV0A 1XCVA 2L4MA 1N3CA 2XPVA 2EQKA 3G4SA 1Y57A 4K25A 2L0KA 3LSHA 1I50J 3OV8A 2P6TA 4L6V5 4DTJA 1J5OA 3CC4Q 1MMDA 3TO9A 2MD5A 1KO9A 2V8JA 1E3PA 2L5QA 2DT5A 1UELB 3CMAA 5E79C 5FRMA 5F0XA 1XMQK 1Q81C 5KNLA 1RUWA 3OR2C 2ZXJA 3IHUA 1NGDA 2L54A 2YXYA 1XSVA 4BDPA 4Z4IA 4CERA 2ESNA 3HUGB 2FHDA 3KD1E 5F1RA 3G2BA 1K78B 2DA5A 4CCOA 2OF7A 1JLCA 4E47A 3TREA 1K0XA 5KN8A 3CMEN 4E3SA 2FZKB 3D1NI 1T0FC 3JRFA 4RWTA 3FBIB 3IQLA 5AQZA 2UUCK 3BDPA 5HRSA 2Q8KA 5LHHA 3EUKL 3DP7A 3TEDA 1ABOA 5I42A 3RRGA 3KZBA 2LKPA 3V7CA 3ZMTA 2F2VA 1KG7A 4HF1A 4ABZA 2IIRA 4PJJA 4KISA 1JHFA 2DILA 5HDGA 3ZT2A 4XLAA 4PFPA 3K5OA 3PX6A 1X1DA 1YJ9A 2RN8A 4A5MA 4R0KA 1HRHA 4DS4A 4UUTA 2VWJA 3O1BA 3REBB 4C0ZA 3GTKJ 1B4AA 4M6YA 1EQYA 5BPIA 3NBPA 1BO5O 4UVAA 1SL1A 3X26B 4HEA2 1VQNI 1WQ7A 1Z6TA 1PM3A 4A3JJ 3R0AA 1B07A 4CJUA 3UE5A 5M5YJ 2OTJT 2EGEA 2DA3A 3U23A 4NHJA 1LNXA 4B9XA 5HROA 1KQSP 2DMOA 4CHYA 4UV8A 1WHMA 3V9ZA 1UGSB 2D5VA 2ZPIB 1LCKA 4H0VB 3QEWA 3QB0A 2KRSA 4IG0A 4XRFA 1KQSA 3GP8A 2V51B 4CZIA 2WAFA 3S1RJ 2W82A 1MBKA 4JKAA 2DRMA 2M45A 2F8SA 2HOEA 4CUGA 2BE9B 5KYWB 5KYYA 2A3SA 3JRAA 2M4KA 3C2HA 4YIRX 5ILSA 4FJHA 1PP7U 3HJFA 1VQNQ 2DD4A 3WXJA 1W7AA 3QP5A 2QF7A 2VASA 4DTOA 5GAN3 3GZ6A 4ZN1A 2QDLA 3NGYA 4DQ2A 3IH2A 4CJSA 2MMPA 4LLNA 1OR7C 5KTQA 3AVIA 4DYRA 2PVGB 4LE9A 3L09A 3CO6C 5HRNA 3OYMA 2NUPA 2O03A 3LNQA 3EUHA 5AQPA 1FYLA 2ETJA 3QICA 1FYKA 4J9IA 1B3QA 4HCCA 1QQCA 3GZNB 2V1UA 1BA5A 4I2OA 1YIJQ 2ZJQF 3A5LC 5E18F 4O5VA 1HJDA 1TTHB 3B6OA 3QMLA 3EDPA 2K5CA 1GV2A 2K02A 4MLEA 4DJAA 1APLC 2ZPBB 4Y1CA 1DPRA 4IOXA 5J4VA 4CC2A 2RGVA 1IXDA 1RI0A 2FBYA 4PKHA 2CS7A 3RJPA 3EH1A 1CF7B 3WGIA 3RYPA 2WSCE 2M51A 3WUHA 4O5FA 1RDUA 4ENKA 4DBFA 4R1HA 3GFJA 2XDDA 3ULEB 1TQMA 4Y33A 3CYMA 2QA4I 1RKTA 3M8QA 2HZDA 4GBQA 1W1FA 1V76A 1RDBA 1FNNA 1EIFA 4LITA 4IL6C 5GAMd 4JYKA 1ODDA 1VQ5Q 2E7XA 3NQOA 5IN1A 3J80K 1RR8C 1VQLN 1UGPB 1ZELA 5A0LA 3E9GA 2KQRA 2A6AA 1IUYA 2XAFA 1DKGD 1JJ2A 2P9PA 5D4SA 2K2MA 1HCRA 1JXBA 4CIGA 4JX4A 3SFMA 2LC4A 1K73O 3FZHA 2UXBK 3U3YA 3QU3A 4C8KA 5BN8A 1MBGA 1Q82C 3D2EB 3OSSC 4PKGA 4J2EA 1ZRCA 2GXAA 3FK7A 2LNBA 4DR5K 1IN6A 4QS7A 2OZUA 1RRQA 4HVUA 2NS7A 1MUYA 2EYWA 2RI5A 1WHJA 2KBTA 2JZYA 3QQAA 5EEGA 4FYVB 4BI4A 3V8KA 2ZGWA 2HL5C 4M3BA 4XKCA 3MN2A 2AIRB 3REOA 1LOJA 4FZZA 3ZSVA 2JJ9A 4P9UA 3G73A 3U9DA 1VQ4Q 4HW0A 2GV9A 5LJ5g 1WJDA 1ZGJA 5LBQA 2QEXQ 3E9LA 3ID6A 3CBMA 3SXYA 1BI3A 2FRYA 4IOAL 3CPEA 4EVIA 4WQ5A 1VQPQ 3ZPLA 1Q18A 4KT6A 5CYQA 3MEXA 3ZXSA 4PA1A 4B9NA 4G9ZA 4JBAA 3M58A 2BE5F 2DMUA 2H94A 2F5DA 1JLAA 1JTYA 3QPTA 3DLLL 3SJJA 2KHOA 2HFHA 3CXCM 3IAS2 4G12A 1WJEA 2K5IA 3JSPA 2LP5A 2F4MB 3AA3A 4P55A 1Q82U 1JE8A 2N8GA 2ENMA 3SNNA 2HHTA 1SL0A 4DLEA 1Q1VA 1A6IA 3HGYA 3ZMUA 1WJSA 3GZ5A 1S6QA 2PG4A 2E2IJ 1WGSA 5DDGA 2DYSH 1Z25A 5BOXA 3EH2A 4KH6A 4BI3A 4X65K 2P5LC 1S72I 2JA6J 3IMXA 3BR0A 2QCOA 2EFQA 3TW6A 4A0YA 3HZ6A 2VN2A 2UWMA 4MTDA 1ZREA 4C5HA 4JKBA 1TWGJ 3K4LA 4LDUA 3F6OA 1VQKT 3DLLA 4FL6A 3V8LA 5LLQA 3ULQB 5GAGJ 2YG8A 3O9QA 3F8CA 4M7AD 3M57A 4FLVA 4EM1A 1QPMA 2CW7A 1VTNC 4NC6A 2IVMA 3SEMA 4IRHA 2LH9A 2HNZA 4L18B 2VWKA 3GBTA 4CESA 2DM1A 2FBVA 1YJNA 1N5YA 3T1AA 4QLCU 5B66C 4M41A 3IAYA 2TDXA 2Y90A 2B0LA 5IYCJ 1GOBA