5FRMA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz384 (compound 4a)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frmA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frmA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frmA03
2X6SA 4AHTA 1D5AA 3G10A 3SQ2A 2EKOA 3NF9A 3OYGA 1WAFA 1MHNA 4I2QA 4M3UA 4B9WA 5HRNA 2RJFA 4ICLA 2RKIA 3HVRA 4HHTA 4B9VA 3L3UA 3SD4A 1RTDA 2BANA 2LRQA 4B9LA 5C25A 1TKDA 1C1CA 3S3NA 4NYNA 1LWEA 1ASWA 1NJZA 4I9QA 3P5JA 4CFCA 3D45A 3TAEA 1J54A 1WNSA 3K5OA 4DG1A 4RW9A 4CGFA 2RJEA 4KB1A 1TAUA 2HB5A 3HL8A 3PUFA 1N6QA 2KZMA 3DLMA 3OYHA 1HYSA 2F8SA 1ZYQA 5KE3A 1NOZA 2VYTA 4CF2A 1LAVA 4DS4A 3C6TA 1RBRA 3KKSA 4WE1A 1L3UA 4O5BA 2QXFA 3RMDA 1KHCA 4QQGA 4W5OA 4AHSA 3ULDA 4N4IA 4W5NA 5HLFA 4CIEA 3QNOA 3ZSQA 3QESA 2AJQA 4DU3A 1S6PA 1QS4A 1WGSA 3KK3A 3SV4A 3LPTA 1JL2A 4FJ9A 3U3YA 2D0BA 3IG1A 5HRRA 5SZTA 5CY4A 1BIUA 4NCGA 3SPZA 1B9FA 1JXBA 4J2EA 1NK0A 1C1BA 4HUGA 1NK4A 4FJLA 4DF8A 4DFJA 3KLHA 3V1RA 1SSFA 4NCAA 3KLFA 3DM2A 4C5HA 4BWJA 1UAXA 3P83D 3UIQA 3SQ0A 4OLAA 3E01A 4MQ3A 1JLEA 1YTUA 1Q9YA 1NK9A 4C5GA 1GOAA 3B6PA 1WAJA 3QERA 3KD5E 1T7PA 4FM0A 1TL1A 3FEOA 1IH7A 4J2BA 2EFIA 4DQSA 4PL6A 1X9SA 3NE6A 4FJ5A 1KVAA 3SJJA 4O0IA 1EKEA 4K8ZA 2L8DA 1RNHA 4C8NA 2X4XA 4Q5WA 3TR8A 1MU2A 2KZZA 4O0JA 4KHQA 2RI3A 4YFUA 4CF9A 3VQDA 1SL2A 2DIQA 4CGIA 2BE2A 4CHZA 4CJ4A 3MEWA 3OYMA 3NNQA 4G1QA 4DU1A 5FRNA 3LX7A 3OS1A 4DF4A 1VSKA 4OGCA 1NJXA 4DTPA 1S1XA 1NJWA 1HPZA 4EP5A 4OGEA 4DTRA 3T19A 3MEGA 4KFBA 4IUPA 3ZCMA 4EP4A 4CGHA 1NOYA 3DOLA 2IC3A 1TKXA 4IURA 3QIPA 4OLBA 2KW4A 3AA2A 3RR7A 2KFNA 2E4LA 1TGOA 1SL0A 1BL3A 1TKTA 1RDBA 4LY7A 2R7YA 3MXIA 4FW2A 1S1VA 4C8OA 1CXQA 3VQBA 4DSLA 2EHGA 3AO5A 2GUIA 1S6QA 4CGGA 3KTQA 4GW6A 3C95A 1N27A 2D9TA 5DK5A 3NFAA 4CEZA 4FM1A 1RBSA 2P1JA 2RPIA 1LV5A 1XWLA 3O8VA 3CFPA 4CF0A 3NBPA 5SWMA 4CHPA 3LZIA 1G5VA 1EX4A 4DU4A 3ZEHA 3QINA 4DWIA 4A4HA 3CEYA 4HCCA 2GF7A 3TANA 4E19A 3UT1A 4AHCA 4M45A 2YHBA 4Z4HA 2OPSA 3DYAA 4TSXA 4FZXC 2RI2A 3TAFA 4I2PA 1D9FA 4B9TA 2F5KA 3K57A 3LLRA 3LPUA 4DQQA 3ZSXA 4OVAA 3PX4A 2BIVA 1VSEA 4HCZA 4OPJA 4AHRA 3M8RA 4FJHA 4DLGA 3SCXA 1Q9XA 3AVJA 1FXXA 4KKOA 3VA0A 3OS2A 1FKPA 3MP1A 3QEXA 1JLCA 4IG0A 2Z1IA 1RT2A 1A5WA 2Y1IA 3V6DA 2K3YA 1EXQA 3PX6A 1S5JA 1RT6A 3DB4A 1BI4B 1XHZA 3IAYA 4OJRA 4Z4IA 1BIZA 1T05A 5D6XA 3V9WA 2HVHA 3UWNA 5M9OA 1Z25A 4ELVA 1CZ9A 1TKZA 3ISNC 2YRVA 3V9ZA 3O4NA 4NCBA 3I0RA 1VSIA 3O3HA 3AV9A 1OYXA 4GY5A 3RR8A 2RO0A 1U45A 4KTWA 4KHYA 5HP1A 3KK1A 4ID1A 2PYLA 4FJJA 4E0DA 4N41A 4B9SA 4I9LA 3VQQA 1RDCA 4PY5A 4M3XA 5KTQA 4KTQA 4DTJA 1FK9A 2WOMA 4CF1A 2NLUA 5D3GA 4PQUA 3VQCA 4KI4A 1RI0A 2QKKA 4RG8A 2DFEA 3EY1A 1SKWA 2OZMA 1NK5A 2R57A 2DIGA 1XC9A 1GOBA 3V9XA 1WJRA 1KFDA 2RJDA 3SYZA 3KKRA 2X78A 3MXMA 4DQIA 2Z1HA 2ATQA 4B8CA 1F21A 3PY8A 3DLRA 4FJMA 3PFSA 1YTAA 1KRPA 5KH6A 2WONA 3ALYA 3L2WA 5J26A 2IG0A 2PYJA 3QEPA 3VQPA 5C6SA 2E5QA 3OJUA 4AH9A 2B6AA 1L3VA 3P8DA 2NUBA 1RILA 4FU6A 1LWFA 2X74A 4BACA 4CJEA 2ZQBA 1VRTA 2WACA 1VK0A 3HVTA 3RMCA 3VN5A 3MEDA 1C0MA 4BE2A 4CJRA 4Z4CA 2A1RA 4RG2A 1J5OA 1RTIA 4DQRA 3LWLA 4C5IA 2HHWA 4JS4A 1Y97A 2G8UA 1EETA 4FK4A 3LANA 1RBUA 3S3OA 4CIFA 4LSNA 1X1PA 2LSNA 4O55A 1VSJA 5J2MA 5FRMA 5HRPA 3HXMA 2QKBA 4CERA 2M16A 3QO9A 1YT3A 3MECA 1ZBUA 3KJVA 5C0MA 5CYQA 5C42A 2BGGA 4PA1A 4YNQA 1S9EA 1SKSA 1TK0A 4KRFA 1QTMA 5KGXA 2GV9A 3OJSA 4UQGA 4NS5A 3OYDA 3E9FA 4PLLA 2VWKA 1KLMA 4CRIA 1IKXA 1L5UA 4E7JA 3G0ZA 3AVFA 4AHVA 1U48A 1ZBLA 1UOCA 3PNWC 2BDPA 4B9UA 3ZSWA 3NH2A 3MXJA 2DFFA 3MP6A 1QHTA 3TARA 5E41A 3Q1JA 4GVMA 3CYMA 3V4IA 2K3XA 3L2UA 2LTOA 2ZE2A 2FBYA 1JLGA 2XHBA 3RMAA 4KHWA 4AILC 4FJKA 4CJQA 3O3GA 3P8HA 1NKBA 1SKRA 1OZ2A 4KTZA 3LAKA 4N47A 4DTUA 4FJGA 1LAWA 1QE1A 4NZGA 2IGIA 2X6NA 3NDKA 4CFBA 3AVAA 4DFKA 3NTKA 4CJTA 4LD0A 1LWCA 1JLAA 1JL1A 4ZHRA 2YNFA 4F2RA 4DTNA 5D6WA 3SUPA 4C8MA 3NGYA 1QQCA 2LCCA 3OS0A 4BDPA 3OYKA 1BQMA 5FROA 4HUEA 4M3TA 2P5OA 4QQDA 2PQWA 2EQKA 3SQ1A 2IAJA 4J2AA 3DLGA 3U3GA 3BGRA 3KLEA 3MP8A 4KREA 1OZ3A 2R58A 3DLHA 1XHXA 4FZZA 2O4XA 4CK2A 4RW6A 3OYNA 3HJFA 1NK7A 1RBVA 1DLOA 4XIUA 5CZ2A 3AVLA 2W42A 3VQ4A 4PUOA 4N4GA 3HYFA 1W9HA 3K5LA 4E7IA 2Q3SA 4CJWA 3V1OA 2Y1JA 3DOKA 3KLIA 3SZ2A 1KTQA 1RCHA 5KI6A 2P0KA 4CFAA 2R5AA 4LH4A 5I42A 4Z4FA 1WSGA 3I0SA 4CK3A 2F8TA 1WN7A 4OPKA 1RTHA 4B08A 3S9HA 4H4OA 1CLQA 3QEIA 1HQEA 3DLKA 3PX0A 3MEEA 3SQ4A 4PLIA 1KVCA 2HHSA 3HK2A 5CZ1A 5J2QA 2XY5A 3NF8A 5HBMA 4GMJB 3RWUA 2YKNA 4A4EA 5K14A 1UA0A 4OKEA 2XO7A 4FCYA 3KLGA 4X34A 3TAPA 3V9SA 1C0TA 2VG7A 4FK2A 3NHGA 2KTQA 2G8KA 2M0OA 2FC0A 4Q0BA 2R5MA 4CEQA 4CJSA 3HPHA 3T3FA 3VA3A 1TK8A 1RT1A 4W5TA 2FBVA 1L3TA 3S6WA 2G8FA 2BKDN 1REVA 1Q8IA 4FM2A 3V9UA 1N5YA 3LP2A 3DLBA 1ZBHA 4OVLA 3LP1A 1HNIA 2P5GA 4DSJA 1VSDA 3C6UA 3LWMA 2HHVA 4CECA 5I3UA 1KVBA 4DTOA 3LGLA 4JLHA 5JS2A 1YVUA 5J2PA 3LZJA 4HCBA 3QEWA 3AVMA 3CM5A 2E6MA 4FK0A 4A4FA 4LH5A 3ZT0A 4FLVA 4E7HA 4CHQA 3HM9A 1FKOA 1S1WA 3O3FA 4HUFA 4Z0UA 4F4KA 3LAMA 4QAGA 4E7KA 4DTMA 2VG6A 1RT4A 3HT3A 3TAQA 2XDPA 3THVA 3VQAA 1O1WA 2EX3A 3CFRA 3ASKA 3E9GA 2VWJA 1D8YA 2P51A 3QLHA 4CESA 3L2RA 4C8LA 3K2PA 5J1EA 2LDMA 1Z26A 3OQ5A 4FZYA 1QSLA 1I3AA 2DY4A 2E6LA 3C94A 4BDZA 2B8AA 4IUUA 3SUQA 3SI6A 2DTUA 2MWPA 3S3MA 3NTHA 2HHQA 1LW2A 3VQ6A 4FLTA 1L3SA 4IBNA 1T03A 3P1GA 3OYIA 3FC3A 2XY7A 4FL6A 4E1MA 2HHXA 3ZT2A 3AVCA 4DSKA 3CQ8A 5KCHA 3PV8A 3MAQA 4FJNA 5J39A 3ASMA 1JLBA 1X9MA 3K5MA 1XNIA 1B9DA 2PY5A 1RBTA 3O4QA 1UWBA 4ZTJA 2IS3A 3KD1E 4E89A 4ELTA 3FLGA 1UA1A 4IUQA 1HRHA 4RW7A 4CJUA 3AA4A 3QIIA 3AVBA 3HP6A 2RHUA 2Z1GA 3JSMA 4Z4EA 1KSPA 1TV6A 4M3ZA 4CJVA 4O4GA 5HROA 3CG7A 3DRPA 4KPYA 4E3SA 1S1TA 4FYDA 3ZSRA 4B3OA 3QEVA 4DQPA 5KRTA 2PZSA 3H8ZA 1IO2A 5KRSA 2JLEA 3FDRA 1B92A 1JLQA 2D5RA 3M8PA 3OYEA 2DAQA 1RT5A 3SUOA 3AVGA 3VQ9A 2FBTA 1JLFA 2YHAA 2RHIA 1A5VA 4KB0A 4JRQA 4RW4A 3U6FA 2RHXA 4BE0A 4CE9A 4H8KA 4CJFA 2RHZA 4RW8A 3AVNA 1BGXT 1NK6A 1GOCA 2GFAA 1CZBA 3NH1A 4KV8A 4DSFA 4IUVA 1LW0A 4FLWA 3IS9A 3TABA 5C24A 4FXDA 3ZSZA 1HNVA 1TK5A 1CXUA 5KCOA 1K6YA 2RN2A 5FDLA 1TVRA 3PMTA 3DLEA 2G8VA 4I7FA 1S1UA 4CEOA 1A5XA 4W5RA 2O4IA 4CCHA 4CEFA 4FLZA 2RI5A 4M42A 3OA6A 2OYQA 4IFYA 3K5NA 3M8SA 2GBZA 3JYTA 3WNHA 1TAQA 1RDDA 2YKMA 1I39A 1EP4A 3VQEA 2HMIA 4CGJA 4FLYA 4Q5VA 4B9NA 1RT3A 1HYVA 2LVMA 3SPYA 1U49A 2QQRA 4DTXA 2KFZA 3ZSYA 3WNFA 3OY9A 1SV5A 3NTIA 1QSSA 3I8DA 4KHNA 4DLEA 4J2DA 2L89A 2XRIA 2X4YA 3LDSA 3TWHA 4IDKA 3OYBA 1WJSA 4DSEA 2B5JA 3PO5A 3QNNA 3ZT3A 1VSLA 3RRGA 1KLNA 4QOZB 3AA3A 4BD3A 2IDOA 4PWDA 3AVIA 3EAEA 3AVKA 3BDPA 2YNHA 4B8AB 4DSIA 1SL1A 1NKCA 2HHUA 4O44A 2FHDA 3QIOA 1BI4A 3LP0A 4N5SA 3KIOA 1ITGA 4L8RB 4F3TA 1VSFA 1WJQA 4N56A 1WSFA 3SV3A 4DS5A 3HPOA 3HP9A 4A4GA 3LYIA 2YNGA 4HVJA 4N76A 4FJXA 3HSTB 1TL3A 3VQ8A 4LSLA 3ZSVA 3L8BA 2E6NA 1IG9A 2EQUA 4C5EA 1JXEA 4AHUA 2XY6A 4BE1A 3AVHA 3QJ6A 4BDYA 4CHYA 3LH0A 3MEVA 2IOCA 1ZBFA 4CJKA 2JTFA 3DB3A 2G8HA 4FVMA 1DTQA 4CEEA 1W0HA 3QBYA 2OPPA 2XY8A 1X9WA 3OYFA 4CGDA 2I5JA 3IRXA 2HW3A 3CM6A 2MWOA 3NF7A 2VG5A 4ELUA 3KUFA 1VRUA 3OMCA 4L59A 1S9GA 4KI6A 3DI6A 4JS5A 1C6VA 1HQUA 3L2VA 3ITHA 3NGZA 4QQ6A 4Y1DA 4LD6A 3AO1A 1R0AA 4EDUA 1NKEA 3AO2A 3NGIA 4K8XA 1JKHA 4CHNA 3RRHA 3TAGA 5J2NA 1WSEA 3WNEA 3LP3A 2HQEA 1H3ZA 2RJCA 1G15A 1IKYA 4JRPA 2BUDA 2O4GA 1U4BA 2GFUA 4CJ3A 3KK2A 1KFSA 1XI1A 3F70A 3L2QA 3FFIA 4IUTA 3M8QA 4H4MA 4Z4GA 4M3RA 4IKFA 2A1SA 2G8WA 4EZ6A 4KHSA 2X35A 3HO1A 3LALA 4BWMA 4IG3A 5D6YA 3ZT4A 3DRSA 3GOXA 4C8KA 3RTVA 4QCLA 5JS1A 3ZT1A 4CEAA 1WSJA 3TAMA 2HNYA 4B9MA 3RMBA 5HRSA 1C0UA 2L3RA 2ETJA 2EQJA 4QW2A 5CYMA 4KO0A 2RF2A 1BQNA 3V1QA 4KAZA 2D0CA 3A2FA 1WSHA 4CEDA 3ME9A 1SUQA 4DFPA 5T7BA 2G8IA 4IFVA 3D0PA 4FJIA 3DRRA 3QKJA 1U04A 1IKWA 4CFDA 4DMNA 4HTUA 2ITGA 2Z1JA 2RHYA 4B9XA 2YV0X 2QK9A 1HJRA 4CJLA 3NCIA 3OYCA 3V81A 2EQMA 3MO8A 1J53A 2CKKA 4UC4A 5EU7A 2OA8A 3OYJA 4E1NA 4CJPA 2KQ2A 2HQXA 2G3RA 3VQ5A 3TI0A 1RTJA 4ID5A 1KCFA 2HHTA 2XK0A 2X4WA 4R5PA 4ZTFA 1WSIA 1IKVA 3MEAA 1BCOA 1D9DA 4W5QA 1WLJA 4CEBA 3L3VA 4FLXA 3CFOA 1T8EA 2HVIA 1BISA 3META 3B6OA 3SNNA 3HPGA 1HYZA 3EYZA 4KHUA 5IAYA 4QVZA 4CHOA 4CK1A 3LGFA 3WNGA 3OYLA 4CIGA 1ZBIA 3M9QA 4FLUA 1VSHA 2JGUA 1C1AA 4FJ7A 4E7LA 3OMGA 2JZ2A 2OPRA 3OB9A 2FBXA 4CF8A 1U47A 3AO4A 3T1AA 1VSMA 3C4SA 4M3WA 2O4XB 1J9AA 2B4JA 3F73A 4CJ5A 4F2SA 3ZSOA 3PO4A 4OKKA 2HNDA 2DFHA 4EZ9A 5KE2A 3F9KA 5KGWA 1ASUA 1HMVA 1NK8A 3OVNA 3K59A 4MFBA 2F96A 1RDAA 4M3YA 4F3OA 1NJYA 5DMRA 4DTSA 3MEUA 2ZD1A 3L42A 3OYAA 3VQ7A 3NF6A 3AO3A 2HNZA 3BDLA 3SUNA 3NH0A 3AA5X 2YNIA 3K58A 4F8RA 1BCMA 1DTTA 4FJ8A 4Z02A 3QETA 1QSYA 4II1A 2OZSA 4NYFA 4OKJA 5CIUA 1RT7A 4N4HA 3H6ZA 2QQSA 1ASVA 2M1HA 3PMIA 3NAEA 4M41A 1BHLA 2D0AA 2OPQA 5IN1A 3EZ5A 3H08A 4FW1A 4Y1CA 1OI1A 4DFMA 3DMJA
chains in the Genus database with same CATH superfamily
1JXSA 3SZPA 1QVGP 3CCRT 4CSWA 2VT3A 4BRLA 1RDUA 4M3UA 1IBLK 4B9WA 2RKIA 3HVRA 2VVKA 1XQPA 1TYQB 4JKBA 1VYTA 2XAFA 1LJOA 3E6DA 2H6CA 4DR1K 3THYB 1TKDA 4ZGDB 3E1SA 4JZ3A 4AG2C 4NYNA 1N78A 4MFDA 4BRDA 1V4SA 2DVJA 1VA7A 1NJZA 4FSSA 1GLAG 4I9QA 1IXCA 4XH1A 3P5JA 1T6DA 3D45A 3A4CA 1M90C 1J09A 2E71A 4DR3K 2ZSIB 2M7AA 2NRZA 4CGFA 1WJ5A 2AKKA 2CT4A 2HB5A 4LLGF 2HEQA 2OAWA 1XQSC 5IYCJ 1P92A 4CXFA 3PUFA 1N6QA 3ZQIA 1KQ9A 5KE3A 4LUEA 1Y96A 1LAVA 2ZBKA 3EDPA 4DS4A 4WE1A 3VF2A 4ASNA 3QOEA 1MNMC 2QXFA 4QQGA 4IIOA 3MN9A 4F3QA 4JD2A 4AHSA 2DA7A 1ZBSA 4H5VA 3LDNA 1DGKN 1IXDA 1OVQA 3E5QA 2BTFA 3RI4A 3QNOA 1QVFP 1ZKGA 3ZSQA 4IO9F 2LF8A 2AJQA 3PIPF 1S6PA 1PU8A 4UY8O 1TXQA 2NOHA 1UHMA 1W70A 1KU2A 2Z9OA 1Y0UA 3CQZJ 3RKYA 3U3YA 1VQLQ 5KYUA 1D5YA 2DM1A 2D0BA 2YUNA 1ESVA 3CCRA 3QRFF 1DU0A 4U0VA 1BIUA 2DMTA 3SPZA 5FGMA 1NMDA 2EZHA 4BEHB 3VGMA 4UVCA 3M0RA 1SSFA 3OW2A 2E5LK 3DM2A 4XH5A 2NUTA 2BY0A 3SMPA 5D4RA 2XAJA 5TRDA 4EJUA 5K5RA 1NLOC 1BG3A 4A12A 3F9MA 4HX7A 1ZBJA 1SVOA 4B1YB 1NK9A 1IZ1A 4PDKA 4MLEA 3OBYA 2V1DA 4PFOA 4C30A 5GAOn 3DWLE 1GOAA 3B6PA 3FXLA 1KXPA 1VQ6Q 2P9LB 4NO7A 2YUQA 5E8GA 4CZKA 1C0WA 1V5FA 4J2BA 3DLAA 4DQSA 1IV0A 1D09B 1QCFA 3MZYA 5IHKA 4FT2A 3X2QH 1QVUA 4M7XA 4UXNA 2DMQA 2M87A 5LJ3d 1TZLA 3TU4K 3QFUA 3BJAA 4PJLA 3Q0VA 4K8ZA 2L8DA 3FZVA 5GANj 3OH9A 3SDZA 3OSFA 4O0JA 4ESBA 4YFUA 4P9UA 1YJNQ 1SL2A 1G83A 2MBFA 4RMNA 5HNFA 2ELHA 5FRNA 5KK1A 1KQ8A 1R77A 2QEXN 2A36A 3I55N 3OS1A 2EJ9A 3BTIA 4IHSA 4DTPA 1WEGA 2J06A 5JLWA 1HPZA 2NLXA 1GFDA 3DEUA 3CHWA 4RWTA 4OGEA 3FXUA 4N9IA 3IL2A 1J6ZA 3BF1A 4H0PA 2G7HA 4KFBA 4L5JA 1M1KR 4P9FA 1TT0A 1A0NB 1DQUA 2O8CB 2IC3A 1TKXA 4FYXB 4RGXA 3QIPA 2KW4A 2XPVA 5FFZA 3CUQA 3HDDA 4F7UA 3F6OA 2FMLA 4HSBA 2GTDA 2DK3A 2A08A 2DK5A 4XBFA 3UPUA 2F9WA 2EV0A 5HNHA 2CP0A 1QZ6A 4C1NK 4BHBA 4G12A 3AO5A 3H0HA 4CGGA 2DERA 1MJAA 5HKCA 3GZ6A 1VQNQ 2KRMA 3NFAA 2E1NA 4C8QG 3JCMW 2SRCA 2FO0A 4L0ZB 2NVUB 3AARA 2OTLQ 2ZKZA 2BW3A 4U87A 4HQMA 1KG7A 4JI1K 1VQ9Q 5SWMA 2MMPA 2MD5A 2RKHA 1MMGA 1ZG3A 4QS9A 4FSXA 3LDOA 1XMKA 2EIJH 2FD5A 2A6EF 2PUOB 4J9FA 4BY7J 1TOVA 4CZEA 2VT2A 4BYYA 3CEYA 3FZMA 3I4NJ 3ZQ7A 4AHCA 1ATSA 4EMSA 4M45A 3LSGA 2WAQN 2P5LC 2NOZA 1FOYA 4LDUA 3CMAQ 5ADXH 2OPSA 2HS5A 3FLCO 2LQWA 4FZXC 2VGMA 3UKGA 1PD0A 3CCJQ 3HUGA 4EATA 2DXUA 2O6GE 5GMKe 4OF1A 2DT7B 4BHCA 4CICA 1F9NA 4OVAA 1NWKA 2F4VK 2BHZA 2E41A 4A0YA 4BUGA 1VSEA 4AHRA 2K9LA 3M8RA 2BY1A 2CU7A 2OTJT 2JA5J 3JV3A 3SCXA 5KPTA 1WIEA 1VQMN 4KKOA 2GEMA 3TSQA 4JKGB 4GLMA 2VC8A 4HT9A 4JN4A 4LIVA 4ME7A 1JLCA 4FL9A 4I01A 1U2VA 5KAFC 5FO5A 1RT2A 1GLFO 3EFRA 2CUZA 1Z9ZA 2L7KA 4XKBA 2Y1IA 2WTUA 4LXCA 2K3YA 1EXQA 3PX6A 1S5JA 2J4RA 2TDXA 4PJOC 1PUFA 1BI4B 2W4SA 2NOBA 3EG9A 3RMQA 3IAYA 3NMZC 5E3LA 2GQIA 4Z4IA 5J4VA 3F0CA 4HNUA 1JT0A 5L3FA 3EGXA 5KQDA 4B3MK 5LBQA 2KQRA 1Z25A 3QPSA 3MEXA 2YU3A 4KDPA 1CZ9A 1TKZA 4ATOA 5KN8A 3AL0C 1RR8C 3V9ZA 1Q81U 3BPVA 3C6HA 1VSIA 3H0IA 4HW0A 4OB0B 1QRYA 3AV9A 1OYXA 1M30A 3J81Z 1TG0A 1UZCA 3KK1A 4EMGA 1R36A 4PL7A 4B9SA 3KZBA 2Z2SB 3RUXA 2ECBA 4HF1A 4M6VA 1Y1WJ 1FIAA 2JA8J 4ZYGA 5GPAA 4CF1A 2NLUA 5D3GA 2Y2ZA 1I5LA 4KI4A 1I81A 2R7TA 3ZQGA 1BL0A 2DL3A 2R57A 5F27A 1W2BM 1GOBA 4ENJA 3L6QA 2Y90A 1JBMA 1TP4A 3J7YJ 4JK1X 2GZWA 3K4MA 5EXWA 2COBA 3TDZC 4P5OA 2KLOA 3KZIC 4TVRA 4BGDA 1O9SA 2ZWHA 2BZXA 2V9KA 2K3BA 2ZC2A 1ZRFA 4B1VA 1KQSP 4FJMA 1SC7A 4AMCA 2WONA 1KD1O 1SVMA 1TC3C 3M1EA 5J26A 2M45A 2H1LA 4ZDLA 1PNJA 4MQ9F 1W5TA 3P8DA 2NUBA 2K9GA 2K6DA 1JCFA 3SBTA 2HOEA 3GNFB 2Y4XA 3JCMg 1Y57A 5AFUH 3HKSA 1E3HA 1NK2P 1IJWC 4GFBA 3K2AA 1LCKA 5CKFA 1JUSA 3VN5A 4MTEA 3PVQA 3JCMe 2Y75A 4CCNA 1I0CA 2X85A 3I64A 1JB0E 1VQ5T 4J9IA 2A1RA 1X75C 1J5OA 3FJPA 4DQRA 3CCEN 4XR6A 2XF5A 1HDPA 1OMIA 1TU0B 2UXDK 3PIOA 4GY2B 2P7CB 1K73O 2G8UA 2DRMA 2EFQA 1VQLI 2ROTA 1HKQA 4FX4A 5A2QE 2DTIA 4JRIA 1YJWT 1LVKA 3C0CA 2BZTA 2L2OA 5CQGA 1Y6IA 3LOCA 4XMYA 3TREA 1TWHJ 4CERA 3I0WA 1E3PA 2QWLA 3KJVA 5C0MA 4B1RA 5C42A 3J81K 1S9EA 1ZSZA 2GV9A 4MLHA 4BRCA 1HR0K 3FRNA 1P7MA 4NS5A 3IH3A 2MI6A 4IOAL 3HPWA 2E70A 4PLLA 4LIUA 1KLMA 4CRIA 3G6EI 1L5UA 3KP4A 3G0ZA 3NPFA 2WAFA 1HKGA 2IPOB 1UOCA 2K86A 4XTUA 3PNWC 3M4YA 3ZSWA 3OIPA 1JJ8C 4JLGA 3HB9A 4BJ6C 3TARA 2VWFA 1U1TA 2K3XA 3L2UA 2JM9A 3R1XA 3DBLB 1B6AA 4RTUA 2V8KA 3K4JA 3QWLA 4BVPA 4KHWA 3V7RA 1FSEA 4I2OA 1NKBA 1SKRA 1OZ2A 3ATVA 1M90R 4U7DA 1G4DA 4AFUC 4KTZA 1Y0NA 1BOBA 1U5SA 4N47A 3EUKL 3OW2M 3O5BA 4BXUA 2YSQA 1VQ5A 5K1YA 3HTVA 4DFKA 2ID3A 1M3BA 1JL1A 5DM7L 4RTWA 3MN2A 3A8HB 5DM6F 1VQ8I 2P0PA 1P4WA 1PCXA 1YJWA 3NGYA 4E7ZA 2BTTA 4CZFA 3ZBDA 1BQMA 3ZQLA 3FM3A 4HUEA 2YWWA 1F5TA 1SEUA 5J47A 2EGEA 5J40A 2EQKA 3SQ1A 4C0ZA 4ELYC 4AD9A 3RZOJ 4A3JJ 1HC8A 4YELA 1ENHA 1GL5A 3U3GA 4KREA 3JRGA 2R58A 3M55A 2V9PA 1UHCA 3H3ZA 3OR1C 4CK2A 2CS7A 4FWNA 2YSRA 3OYNA 3G1JA 5F6FA 1FTTA 4PHTX 3M5RA 1DLOA 4XIUA 2RREA 2Z0WA 4KH6A 5GMKl 3VRYA 4OIPF 4PUOA 2WAEA 5KPZA 1WCMJ 2XSDC 2M0MA 1ERDA 3HYFA 3F10A 1DP3A 2VOOA 2RQQA 4FOIA 4DW6A 3W2VA 4CJWA 5CKHA 2EJRA 2Y1JA 1KTQA 2ZXWH 2C6YA 1VQNI 1M1GA 1N36K 3HRTA 4CFAA 2R5AA 2Q8KA 2XAQA 2X3XD 2P6TA 3BR5A 4C92C 3KP5A 4XLPF 3CC2T 3PIOL 3AG4H 4O5FA 5AR0A 4MTDA 4CK3A 3OL4A 2F8TA 4FWMA 4OPKA 1HW1A 2VYPA 4LF7K 4C0FA 5B8HA 3PX0A 1HQEA 3MEEA 3O4WA 1B8IA 1ORPA 1LFPA 5F08A 3HK2A 5DUIA 5CZ1A 2XICA 2XY5A 3PM1A 2JRMA 3NF8A 2VUMJ 4PKIA 5HBMA 4J19A 4FETA 4GMJB 3RQ4A 5TGTA 3VUBA 2YKNA 2E20A 1UA0A 4ENNA 3JB9H 4IXAA 3IKTA 3HOXJ 3CC7I 2XO7A 1UG0A 2ZSHB 5F1RA 3CMAI 2HXOA 3KLGA 4X34A 2Z33A 1LE8A 2P7VB 4MQVA 2M9UA 4BREA 3VYRB 3I0XA 4YFXF 4CEQA 2LP0A 3HPHA 4PJOE 4CD1A 1M3CA 4G6TB 4CUGA 2LSOA 1RT1A 2VJ4A 1BN5A 2KYBA 1TLHB 3U1KA 3CDHA 3IDHA 2GWRA 1SAXA 4PSXA 4Y7NJ 4FIBA 3CPEA 1Y8QB 1PP7U 1R6RA 1N5YA 2P9KB 1MDMA 4OVLA 1A36A 3L00A 2KE9A 2P5GA 3I5SA 3R3LA 1VSDA 1REPC 4CECA 5I11A 1BR1A 2V4JC 4B1WB 3S8PA 4XONA 5AN4A 4HTLA 1BM9A 2CH5A 5J2PA 2P81A 1YJ9Q 1U84A 1WPYA 2ZJPL 3QEWA 1SF9A 1BIBA 4NC8A 3H5RA 5ED4A 4PJOF 1QVGS 1WUAA 4ZGJB 4YPRA 1N3CA 2VODA 3SWNB 2FLOA 2QTXA 3JCMJ 1S1WA 1F43A 3O3FA 3CC2A 4L5GA 4Z0UA 5IH2A 4QAGA 1FOWA 4E7KA 4GKKK 1BU6O 3CC4T 1GLNA 2P9UA 3WU2C 3I53A 5LJ3e 2LYCA 2QBYA 1TW3A 1VQ6T 1ZUKA 2EX3A 3CFRA 2Q36A 1X4PA 3ZYYX 1YN8A 4XLFA 2VC1A 4MMLA 1X1CA 3H3UA 3G7ZA 1OPKA 3S1RJ 4F91B 1ZSGA 1YP5A 2CGLA 3EKUA 2LDMA 3ZOBA 1T44A 3OQ5A 3GP8A 4P96A 1OV3A 4M7DA 1H641 4AVZA 4BDZA 2B8AA 3P9KA 5GAOp 2A0FB 1YJNT 4AIDA 2EZKA 4RB0A 3VQ6A 3GTGJ 5CQXA 2EFWA 3OYIA 2E6ZA 3EQLF 4M9SA 3LDQA 3VWBA 2GXBA 5ICCA 3LMMA 3WGHA 1QVFS 2ENMA 1U8BA 1RAGB 4DSKA 4F16A 5KCHA 3FWEA 2EFNA 2DMOA 1YI2Q 1WHKA 2A41A 2E1MC 1D5VA 4FJNA 2DAOA 1VYUA 5J39A 2KISA 8AT1B 2RQTA 1ZH5A 3F3XA 1X9MA 1SG5A 5E84A 1RBTA 1ZQ1A 2ZXJA 1KD1U 2IS3A 5FPNA 1ZGAA 5GAN5 2DE0X 4BY6B 2DOAA 2XKOA 4UNOA 4JAXA 5E79C 3TO6A 1UA1A 5GTIC 4R55A 3LSIA 1ORKA 1HU0A 4IUQA 3FZKA 2R3SA 4FE7A 3CC4A 4CJUA 1E17A 3P7NA 2ZMEA 2A6HF 3K4BA 4CCOA 2Z1GA 1O13A 4LF8K 1XCVA 1VQ6A 4M77E 1T3VA 4C92D 2WTEA 1FSHA 3S1QJ 1JO8A 2KDOA 4F92B 1WQWA 1TV6A 1N33K 3LCNA 1Q86O 2JPCA 2DJNA 3ABLH 1KIKA 1FYMA 4EIKA 1T3SA 4E3SA 3DLLL 1H3HA 4FVUA 2GTOA 4DQPA 2ZJRL 5KRTA 2OTLT 2COZA 1AZGB 5ICFA 1VQ9T 2VBYA 2KP6A 1JLQA 2E1MB 4LB5A 1X6BA 4WXHA 3VQ9A 4IHVA 1JLFA 1YJNA 4DR4K 3G6EN 2UXCK 2ZM6K 2Q1NA 4RW4A 4C3IJ 4OO1J 1XMXA 4JI5K 5FKNA 2J6FA 3CCLQ 4YOUA 4II3A 4RW8A 3AVNA 1U3OA 3C0BA 1T0JA 2XIDA 3CJRB 4QIWN 1E3OC 1BBZA 3OHRA 3G71I 2GFAA 3CCQI 4HAMA 3D5RC 3CCJT 1ZK8A 1VQ7A 4L3QA 4FWSA 3WHCA 4DEYA 2YT6A 4M78C 2OI3A 2IS2A 3KZZA 5KCOA 1V54H 4J7IA 4VUBA 3QICA 1WHMA 3SFMA 1TVRA 3PMTA 5I2SA 2RA2A 2JJ9A 3ZRGA 1UJ8A 1S1UA 2I2LA 4EAHD 1NBWA 3EFSA 2FX0A 1W1WE 1LCUA 3WEEB 4FLZA 5C15A 1FLIA 1OU8A 3REBB 4HYEA 1VQ8N 4HA8A 2NS8A 1N32K 4IFYA 3K5NA 3M8SA 2W7NA 2O01E 1IBKK 2ZJ2A 4M7AC 1QQOA 1AOJA 3I35A 2IT0A 4IRIA 3VQEA 2OTLA 3CPWS 2LCLA 2QWWA 4BUPA 1RT3A 1H89C 2XDDA 1X2QA 3EFOB 4BB7A 5E8IA 1VQ9A 2XGDA 5F64A 1EA3A 3HHTB 1OFCX 3CXCP 2LQ8A 3CCSQ 4JI3K 1QSSA 1WJEA 1I5OB 3FMRA 4JOMA 1YFHA 3D6RA 2V1RA 2Z1DA 4KT5C 5HL7L 4DLEA 3EKSA 2XRIA 4M78B 2GAUA 3PLAA 1M27C 4IDKA 2RQUA 4CH7A 3OYBA 4EA4A 2EZLA 4RMOA 1WJSA 2B5JA 4KRTA 4J8FA 3PO5A 1KD1C 4XLEA 2JQ7A 3DQVC 2E2HJ 5HLHA 5CR2A 3CCJA 4GYIA 2ATCB 1KLNA 2UYTA 3DWLA 3MN6A 3DPTA 2DA1A 3GUDA 4LK1F 2YNHA 3O6WA 4B8AB 1XGSA 4D7MA 1MV0B 4YFNF 4C92F 4V2SA 4OINF 1NKCA 3CCUT 2ME0A 5J3BA 2FSNA 2FVUA 1KG5A 4DNCA 1ITGA 4XEIA 2Q31A 4JJBA 3VENA 5CVRA 1K73C 1VQKT 2LP5A 3DTEA 1P6RA 2GOXB 2ZCFB 2YNGA 3FXMA 1Q81R 3HSTB 1TL3A 3VQ8A 3CC7N 3HZJA 3CVTA 4ORZA 5BR9A 4A3IJ 2DL4A 2E6NA 3UNGC 3M9AA 1OH6A 1WH5A 1JXEA 3C2GA 3MCAB 4AHUA 2XUBA 2VKNA 1R0BG 1U9NA 5A0GA 3GBQA 2ZF5O 1YRNB 4NLCA 2ZAEA 5IY5H 1XQOA 4IHYA 2LRDA 1PP8F 1DTQA 1Z6TA 3QBYA 2MCNA 2EIMH 4BR2A 1YIJQ 2KBTA 1WZOA 4CGDA 2I5JA 4N0AA 4J8OA 3GL1A 4KYWA 3THWA 2MH9A 3K6GA 2VG5A 4IO9L 4ELUA 3KUFA 5CLSA 1FBSA 1YE9A 1X3WB 4IDHA 3PIPL 4KI6A 1S9GA 4L5EA 4FX0A 1C6VA 3D2FA 1JKRC 1YJ9I 2DQRA 4FO0A 2YUOA 2D1XA 3RJPA 5GAHJ 4LD6A 1JKQC 1R9TJ 5J8FA 1BI3A 1BI0A 2I7NA 2QTVA 3U21A 2IS1A 1K9AA 1M1FA 3RRHA 5LRSA 4BQOA 1WSEA 3WNEA 2E2IJ 4FWPA 2G9WA 2HQEA 1MMDA 4E9FA 1G15A 3CCUA 2XF7A 2ZNYA 4HG2A 2GFUA 5DCFA 2FZGB 2E65A 1QMCA 1Q95G 3KK2A 2BY3A 3HSCA 3F70A 1V1CA 2RGVA 1VQKA 2RQRA 4M78D 3A8YA 1YLFA 2E2OA 5LHIA 4BR4A 2NYSA 2G8WA 2X35A 2GA1A 3LALA 1RDWX 3VF4A 2D45A 4CZHA 1RPWA 4M72A 3Q0UA 3ZT4A 2L3QA 3WT0A 3GOXA 4C8KA 2P5KA 2QQAA 1HUXA 3ZT1A 1JCGA 3TAMA 3HRUA 2ZGWA 5J4YA 1OX9A 5HRSA 1JT6A 1XS9A 4FHTA 1R49A 1KO9A 2VLAA 2BE9B 4K43A 2ETJA 2EWNA 4KIBA 4EQQA 5L3BA 5CKBA 5GAN4 4IEIA 4M7AD 2RF2A 2UUCK 2HKXA 4KAZA 2B9SA 3A2FA 1EZZB 1NG6A 3BPXA 2FBHA 3ME9A 2E2PA 4DFPA 3LSTA 2PBIA 4PJ0C 2YU9J 1U78A 1W97L 2P9IA 2PJPA 5E17F 4HTUA 2FB7A 4WFAL 2KRSA 2Z1JA 1G99A 4YTLA 4M3GA 3IUCA 4UUSB 3MO8A 2BE7D 2CUEA 3WTUC 3H9GA 3I58A 4J9CA 4YEJA 4ESJA 4UC4A 5EU7A 4F93B 3R0AA 3TEDA 3F0ZA 3RMSA 4CZLA 1Z1DA 3FMQA 2VQGA 3RKXA 2HQXA 3FDYA 2G3RA 1P2FA 3TI0A 2RQWA 4BC5A 1YQAA 2L4MA 2H8HA 1OOTA 2X4WA 5KYUB 2L0AA 1WSIA 2R92J 1TWFJ 1WLJA 4FSVA 2CSOA 4M75B 4V2GA 3E9LA 3META 1AA7A 3BWGA 1GXPA 3HPGA 1NU0A 4J9HA 3LQQA 4AU7A 1MV3A 5EG2A 2E34A 3HRSA 1FC3A 3OS5A 2CGPA 3VODA 2DA6A 1KQ2A 3LNQA 3RNJA 1Q86U 1G3SA 4CIGA 3IHUA 1K7AA 1VSHA 1TWAJ 3CJQB 5EEHA 1IRZA 2CRGA 4FJ7A 3JTHA 5JVGF 4G7OF 2VXZA 3VYHB 1I94K 3G3ZA 4BL0B 4CC4B 4CF8A 3ABTA 2IGOA 5BMZA 1X69A 3K7AJ 1OISA 1Y8RB 1U47A 3CCLI 5ICEA 5M5YJ 2O31A 2KRFA 3KP2A 4M3WA 2ELKA 2O4XB 3GX4X 1J9AA 2B4JA 2BH1A 1K78B 1XMOK 3G71N 2E3IA 5CVVA 4F2SA 4BI8B 3CUQC 5KYWB 3W6KB 2DETA 5FWCA 1Z91A 4BG9A 4EZ9A 2O8FB 3T9NA 2IGKA 5KGWA 1NK8A 2F96A 2EYZA 4F3OA 1I1SA 4JUVA 1Z6RA 5DMRA 4M78F 2KHOA 4WCIA 3CQXA 3FKJA 3ZMDA 3BLYA 2KGTA 2LCSA 2PG4A 3C2BA 3TPQA 2W82A 1W5SA 3BDLA 3GTKJ 4YFKF 1H8KA 4H0VB 3VOVA 4I6MA 1JXMA 3GVAA 4CBUA 3M8FA 5F0HA 3QPTA 1TL8A 3E66A 1AHDP 3QODA 3U23A 1DIZA 2NAZA 3RSEA 3A0BC 4II1A 4Y13A 5DUKA 1YAGA 4U0YA 5JFRA 3VETA 4ENMA 3J8AA 2EK5A 4M7AF 4AM7A 5HK3A 2V7YA 4NYFA 4OKJA 3UR3C 4M9ZA 3GE1A 5FPEA 2H94A 2DZ9A 2YHWA 1FZPB 3H6ZA 4JKAA 3NAEA 4C8QA 1BHLA 2D0AA 2OPQA 3L4QA 1JUPA 5GAOq 1V4RA 3CUQB 2GLOA 2ABKA 2MLGA 3IRQA 3BEXA 3EZ5A 1ATRA 1OI1A 1M8MA 3DMJA 5HDKA 2PU9B 1GUUA 1IN8A 5H6RA 4HSTA 1SRLA 3SQ2A 1WAFA 3UE5A 3K70C 1MHNA 3M07A 2HDDA 2LMJA 1V5GA 3FBNB 2IRFG 2RJFA 1P7JA 4HHTA 3L3UA 3SD4A 1RTDA 1UFFA 3FZFA 5FD6A 2ZNZA 2EQRA 5CKEA 5C25A 3FMSA 3JRDA 2CSQA 4B3RK 2EINH 1LWEA 1ASWA 3CCMT 3VYUB 1X58A 3G1LA 5I21A 1W7AA 1J54A 4A3BJ 3JSPA 2AS5F 1WNSA 2FBIA 3P4IA 3G4SI 3VTIA 2Q2EA 3T0YA 4A3DJ 1YHQQ 5L23A 4ANJA 4IPAA 3J7AY 1LWWA 4E1JA 2MH2A 1XQHA 4BRFA 2RN7A 4ZYHA 3WTTC 2KZMA 3HSBA 5EEAA 4DBRA 1X1AA 3FHNA 2F8SA 2HBKA 1YI2T 3C7NA 4ZH4F 3GBGA 2FPEA 1YTYA 4BXXJ 9ANTA 2VYTA 1X3UA 4Y15A 1WJBA 4DBFA 1LVAA 2B86A 1HNWK 3C6TA 3HOYJ 3KKSA 3HUGB 2R93J 1UGVA 2MGQA 2EGAA 2A05A 4QKUA 1WKMA 3ATUA 4W5OA 3HG9A 1LEAA 3ULDA 5AQQA 4KIFA 4FWOA 4Z94A 4W5NA 3S17J 5HLFA 2QF7A 3WTSC 3BQZA 4CIEA 2V1XA 2O8DB 2F69A 3QESA 3GWZA 4YRVA 1TS9A 1WGSA 1VQOQ 1RADB 3KK3A 3SV4A 1T08B 2X6XA 3WTZA 1NKUA 4XQFA 4FJ9A 4I0AA 3RKWA 4C0GA 3N0UA 5GP9A 1BOTO 5CY4A 4G6QA 2R7FA 3RDIA 2QM1A 2BGCA 4J2EA 3O80A 3DKWA 1HD3A 3RPUA 3QYGB 3A1YA 1YWPA 3J81E 1NK4A 2XKPA 5M1QA 4E2FB 1S72I 4A69C 4DF8A 1OKJA 2R7RA 3KLHA 4EMKA 1GRIA 2B7EA 2JA2A 2E1HA 1VQ7I 2KAFA 3UIQA 3EGXB 2NUPB 4EJOA 2QI2A 2LREA 3TL4X 1MDUB 3CCMA 1JLEA 5GADJ 1IJJA 2KIMA 3TVTA 1MIJA 2ESNA 4BJTA 5ELZA 2ZPIB 1VQ5N 1KD1R 3RERA 5LL6Z 2K57A 1KAYA 1NTCA 1WAJA 4FASD 5JICA 1Q7YO 1WDXA 5AQGA 4RLQA 5LLQA 4BRMA 5CJ9A 3FEOA 3E9OA 5BNGA 3QP5A 2EPDA 1YI2A 3O2PE 1AT1B 2VPRA 5ILSA 4ZZLA 3NE6A 3VEWA 3A2KA 3ZN1A 2HKQB 4H03B 2YHYA 3CVSA 3RDVA 3CJBA 2GBQA 3HGGA 4DHYA 2DL7A 2H3GX 3N4MA 1R5HA 3CJ7A 3FXOA 2KZZA 4KHQA 4IZZA 3EG2A 4HEA2 2DIQA 2HD0A 3DXMA 2BE2A 4CHZA 3I59A 4CJ4A 4ZN1A 2DA3A 2FPDA 4F14A 1PRLC 3BR1A 1LNWA 3BJOA 3O1BA 1OPCA 5GAGP 1XG1A 1ZSZC 5LMNK 2P6SA 1BWFO 1E3MA 4DTRA 3JCMP 4OMFB 1X3ZB 5LHGA 1EO1A 2EFPA 2RH2A 1E6HA 5DCMA 3BR0A 2C06A 4CGHA 1W36C 4DBQA 3I56I 4FWQA 3MKWB 5DM6L 3KLNA 1U3EM 2DF6A 3RR7A 3CBMA 1BKBA 2CV2A 3CCST 3JCMV 3JW4A 5F04A 1BL3A 2JK3A 2YUPA 2R7YA 4FW2A 2COMA 4JKFA 5EG0B 2ZXIA 4F17A 4UVAA 2QDLA 2VPLA 2W6LA 3VQBA 2EHGA 1XNRK 1SD4A 2CZ7B 2GUIA 1S6QA 3HJEA 1W7PA 1G3YA 1IUFA 3C95A 1KC8O 3BY7A 2D9TA 5DK5A 1USSA 4JZ4A 1ZGJA 3CO7C 1SHGA 4LFCK 2E1CA 3TTFA 1UECA 3O8VA 3LL7A 1V4TA 2HQHA 3NBPA 2RQPA 4CHPA 1LEBA 1G5VA 2OPTA 3PSIA 3NARA 3M59A 2PJRA 1EX4A 2ACJA 1UELB 2EBPA 3ZEHA 3JRFA 2I10A 3QINA 4YIRX 3EGDB 3ZGKA 3G0QA 3DV8A 4HCCA 3MD2A 2GF7A 1CSKA 1X1DA 3M8EA 4E4HA 4E19A 3UT1A 2X6OA 2HI3A 1D8JA 3ZETA 5FJ8J 4C92G 4YOTA 4A2UA 2AXLA 3DYAA 3W6JB 2DQLA 2JSCA 2K85A 2F5KA 1R1UA 5FKMA 2DU9A 1IREB 3LLRA 3GEZA 2G6FX 4MLOA 1XPXA 3CWUA 4F7UF 3LPUA 4DQQA 1AWXA 3ZSXA 4FISA 3J80Z 2IVWA 4HCZA 3CCSA 4BNCA 1IUYA 3M5AA 2CUFA 1T33A 3CC2N 3VTHA 1Q9XA 4D6WA 3HRMA 1YIJT 2IXSA 3VA0A 3QP6A 3OS2A 1A6QA 1OU9A 3MP1A 2R4GA 1QVGA 3ZP5A 3QEXA 4ZYEA 1K76A 4AIKA 2CUDA 3CXCS 3JCMb 4EJWA 4OB2B 2GCXA 3NQOA 3I71A 5CPRB 3CCVI 3ZMVA 1KHIA 1NG2A 2VUBA 3S32A 1RT6A 3DB4A 2EIFA 4YOWA 4B1UB 1PU6A 2QEXQ 3I55Q 2NVTJ 5AZIB 3FX3A 4OJRA 1NG9A 4M77A 3HL2A 4ZJZA 3CF2A 3R6OA 5KYYA 4ESRA 3L1PA 2K40A 2ECZA 4H5RA 5D6XA 4A3CJ 5F1JA 4YOXA 5GANg 1LDKB 3UWNA 2KEAA 3WTXC 4HNTA 2YRVA 2TRTA 3O4NA 5AT1B 4NCBA 1FYNA 5GANe 3LSJA 1VTNC 3C6AA 1SD5A 1H8AC 5KN9A 4KITB 3RR8A 2RO0A 3MN7A 3WGIA 1SFKA 3H45C 4FJJA 2ED0A 4N41A 3LDLA 4DYCA 2VJ5A 3VQQA 1D1AA 3VUZA 1Z67A 1RDCA 4LE9A 3CPFA 4B21A 2LY9A 1FK9A 4XH4A 1YCSB 2K02A 2ADUA 1JRIA 2HBLA 3GTQJ 1XG7A 3CDLA 2R7QA 5GAN7 2QKKA 4RG8A 4LDVA 3EY1A 5GAOm 2NOLA 4BVOA 3J7AO 1WJRA 1QVFA 1KFDA 4Y92A 5M5WJ 2UXBK 2RJDA 2VJJA 3CETA 3MXMA 2CP7A 4DQIA 3G4SN 3PY8A 2XF6A 4WXCA 5M3FJ 1D0ZA 1TWGJ 3DLRA 1W36D 4BY1J 4OIRF 1RKTA 4D5CA 3CC4N 4N0BA 3PFSA 3ZX0A 1I6HJ 2KROA 2NNNA 3ALYA 3GLLA 4HWIA 4EJYA 1B3QA 5J3LA 3J80K 3VQPA 1ZR2A 1K4TA 3OJUA 5E3NA 4JI8K 4AH9A 4AM3A 5IPAA 5JI6A 1RILA 1OKRA 4FU6A 1LWFA 3W3CA 2HF4A 4BACA 2KNBB 2WSCE 4DUZK 4KGVB 3B6CA 2DX1A 1LPQA 3NWSA 3M0SA 1VK0A 3HVTA 3RMCA 5TKWA 4BQLA 2WV1A 2H8WA 1OPLA 2EV5A 3MEDA 2QQ8A 4BE2A 3ZCOA 4KH5A 1NM7A 3CLQA 5EZGA 4PJNA 1FBQA 4XAXB 2A3LA 2QWPA 4C5IA 2HHWA 1VI0A 1VUBA 3C2HA 3QDKA 1Y97A 2GXGA 2F4OB 1MDMB 1EETA 4FK4A 3LANA 2HDWA 3CF5F 4PZJA 5A2QO 1D4XA 4M7DC 3Q0WA 4CIFA 4LSNA 3F8FA 4XOPA 4H0TB 1VQMQ 4O55A 2ISZA 2LFBA 2HFHA 5J2MA 1BW6A 1EWQA 1R00A 5CVIA 1OCZH 2DPDA 3D7SB 2QKBA 1S72N 4S04A 2M16A 1TQMA 1S7OA 3QO9A 3VS0A 3J80O 1UUEA 1AD5A 5CYQA 3KETA 4XRFA 2BGGA 5CK9A 4YNQA 5EGOA 2CFXA 1VQ7N 4AIAA 5KGXA 3KLOA 4M3FA 3OYDA 1S9HA 5JLFA 1OJLA 5BQTA 2ZJQF 1N5ZA 1IKXA 3A01B 2CG4A 4L6V5 4E7JA 3GZ5A 3S1NJ 1I8FA 3MHXA 2JVVA 2LJ1A 1HSJA 4CO8A 1N6AA 4B9UA 2N8GA 3ZXSA 3AAFA 4EEFG 2DOEA 3VB2A 4LF5K 1TBXA 1QHTA 1TH7A 2KXCA 1HLVA 4A93J 2A3SA 2LG4A 3LFUA 5ERIA 3VS3A 2FBYA 3ABMH 3ABUA 2RN8A 2AP1A 3SBGA 2DLLA 5JVHL 1JLGA 2XKOC 4JDSA 2WWYA 3JTGA 1WZ2A 1CF7B 4CBWA 2H3EB 2FA5A 4JX5A 2M3AA 4FJKA 2V6EA 4CCMA 4BU2A 1Q7YU 4LDWA 1IZ6A 2ZMEC 4RDUA 4QT7A 3PIOF 2GM4A 3LM2A 1LAWA 1QE1A 3VYSB 5FKKA 3PQJA 1PDNC 2IGIA 2XAUA 4PFZA 2PN6A 3CWTA 3AVAA 2QTDA 5D5VB 3CD6I 3ZL7C 1GLJO 2AKLA 1P90A 4CJTA 3H3NO 1LWCA 1JLAA 3ID6A 3BT9A 4K2EA 2K7AA 1Q86R 5EDNA 5CO7A 4PKGA 3ZFJA 3NAUA 4BQQA 1KGSA 4B1XB 4CW7B 1YS7A 1QBJA 4WQ5A 1R8OB 1LB2A 4M78G 3OYKA 4PSWA 3MKZA 2WSEE 1D0YA 1WYXA 1IV6A 2P5OA 4QQDA 4A6DA 3L2CA 1DP7P 4J2AA 3I56N 3ZMTA 1BI2A 1USTA 3KLEA 5AYFA 4JBAA 1BDGA 2F5FA 1XHXA 4FZZA 3T69A 2AO9A 4L18B 3MMVA 1J5YA 1RR7A 3EYYA 4CYCA 4DIQA 2CGHA 2ZMEB 2JUFA 4M7AG 5E26A 4YY3K 3DXKB 2WBMA 3JRHA 3R8EA 3VQ4A 2HVRA 4N4GA 4MMKA 1U8RA 1Z05A 4J9EA 1K0XA 2JM8A 1R4MB 2QA4A 2L2PA 4E7IA 2JMAA 1MMSA 3MCZA 3CCEQ 2Q3SA 2XHCA 2R0QC 4FTHA 3LWFA 2K7LA 1MH4A 3DOKA 3KLIA 3M57A 2E3HA 4X0GA 1RCHA 1NGBA 3LH5A 2VJIA 3BDDA 2LH9A 1TUYA 3KFWX 3JXUA 5I42A 5DDGA 2COYA 2HHHK 1Q82O 4CZMA 1FWZA 3I0SA 1UGPB 2Q1ZB 5H6QA 1KC8U 1SAZA 3KYCB 4V2FA 1RTHA 4B08A 5GIPA 1YHQT 1CLQA 3QEIA 3DLKA 4WFBL 4S05A 3H1VX 3KP3A 1IDYA 4LNPA 1KVCA 1JGSA 2CQXA 5J2QA 4BR5A 2JOYA 2A40A 3ZMZA 1K8KA 1NLPC 2XHKA 1PSFA 1RL2A 4JJNK 1J7KA 4OKEA 2NRTA 4GLKA 1JJ2M 2IVOA 3SAGA 3OR2C 2A37A 3TAPA 3V9SA 4S0HB 2VG7A 4B44A 1WEIA 3DKMA 2AHJB 1R0CB 2KJBA 4ZYDA 2KTQA 2DJZA 2M0OA 2QXLA 2FC0A 2KJCA 1Z77A 2HOSA 1RAEB 1Y7XA 4M7DD 1K4SA 2K2MA 2MPXC 2E5KA 1Z9QA 3ABKH 5DD8A 4W5TA 2FBVA 1L3TA 1VFCA 1GT0C 3AG3H 1JE8A 1VQOT 2G8FA 5M5XJ 2BKDN 1QA6A 1Q8IA 3OOUA 1TYQA 2O88A 2HQNA 5LGUA 3V9UA 2A61A 1B34B 3LP2A 1VQ4T 4KFCA 1FPQA 3KE2A 4A3LJ 4C2UA 3CCUN 2XVCA 3O9QA 5GAEJ 3LP1A 3JCMX 5LEKA 4XTVA 4DSJA 1LOJA 3CESA 4DTOA 3LGLA 3TBIA 3CCVN 1HQCA 3S1MJ 1VQKN 1F1ZA 4HCBA 5CE3A 4WQ4A 5DLQE 2PBDA 4A57A 1G59A 3S41A 2QEXI 1X3NA 4A4FA 3BCBA 3IAM2 2DTOA 3IKVA 4HOBA 4CHQA 3HM9A 2DLPA 4O8KA 5TISC 2IJLA 5KPRA 3E5XA 4BAYA 1G3WA 3B02A 2AK5A 3LA2A 1SANA 4DTMA 2ME6A 1YHQA 1ZUUA 3C12A 5ADXA 3HT3A 1KU7A 4OMPA 4JKEA 2XDPA 3THVA 3VQAA 1YQMA 4LG0B 2XHIA 2DL5A 5L3GA 1C0FA 4WF2A 2VWJA 1D8YA 3PTAA 1BK2A 1RUWA 2GTJA 2NRWA 1F1BB 2BE5F 5J1EA 2ZGYA 3BCAA 2DI3A 5FPMA 3A98A 4C23A 2CUBA 4IFEA 1I3AA 2CO5A 4DA4A 2E6LA 3K69A 1X9JA 1XB4A 4IUUA 4N0AC 4ZYAA 2YPRA 3M53A 1O3SA 2DTUA 1VQOA 4XRSA 3LL3A 2O7OA 4BEHA 5LJ5d 3OL3A 3S3MA 3EE8A 1K9MO 2HHQA 4CC3A 4FLTA 4IBNA 4K25A 1VQ4A 2K3PA 4FL6A 2CV1A 5CCAA 3T8RA 1NJIO 4M6YA 2ZB9A 2HYFA 3P39A 2K9SA 3UA6A 3CQ8A 3Q5FA 2JNGA 4QS8A 1EJ9A 2MW8A 1JJ6C 1JLBA 3O1WA 3OOPA 1KC8C 4AFSC 1XNIA 4IOCF 2CREA 1UWBA 1T6SA 3KD1E 4BY9C 2CW0F 1F4KA 2P9LA 1YF5L 5I2MA 2FXUA 1PJRA 4XOTA 4D1QA 3LW5E 1HKSA 3S6IA 1HRHA 3AGKA 3HC7A 3AA4A 1QVFM 3BZ6A 1WBBA 5KYXA 1PC0A 2VE8A 3TSUA 5IT3A 4BRGA 3ULRB 1RNLA 4Z4EA 1KSPA 3GDQA 2K3FA 2YS9A 3CQTA 2HQ5A 2EYXA 1R7JA 4M7DF 3G1OA 4M3ZA 3L2ZA 3TOBA 4CC2A 3THXB 1VQMI 4J9BA 3DRPA 5AQWA 1Y1VJ 3ZSRA 1MD0A 4JI0K 4E6KG 4Y17A 2YXYA 2PAVA 1IC8A 4DR6K 2JWTA 4RAGA 2D5RA 3OYEA 2D8JA 1RT5A 4N4NB 2V26A 3AVGA 4HRIA 3MCPA 2FBTA 2YHAA 3F8BA 5AQKA 2RHIA 3VS2A 1A5VA 4KB0A 4JRQA 1X3MA 3U6FA 1Y39A 1LQ1A 4CE9A 4H8KA 1U9OA 2A5WA 4R0KA 3SQNA 4U88A 4CJFA 2RHZA 1WXTA 5AFUA 2QUFA 4BRPA 4JEPA 1KEAA 2CP5A 1GOCA 3RQIA 5AQJA 2VXDA 3QFPA 2AT1B 5JVGL 4P1WA 4DSFA 1QQNA 2COWA 1KAXA 1U6ZA 3D0SA 2L7FP 3EUAA 1SVLA 4XICA 4YHHK 3R0JA 1TK5A 1NGNA 1K6YA 2RN2A 5BPNA 2G8VA 1LOTB 5AQHA 1UEBA 2QCOA 2EYQA 4CEOA 2P4WA 4H0OA 1SHFA 4W5RA 3EYIA 3H3OB 3HOVJ 3CD6N 2VQEK 4F7UG 4UB6C 2CSIA 2O4IA 1S3JA 4CCHA 4CEFA 2RI5A 2Y31A 4Y4RA 3CO6C 1I5ZA 1MNDA 3OA6A 3ZMUA 4M3EA 2OYQA 1GV2A 1QZYA 1I27A 4IIMA 2YG9A 9ATCB 3ZEUB 2HL5C 1QCOA 1HDDC 2YKMA 3I55T 1KQJA 5DY9A 1HJOA 4CGJA 4FLYA 1UFMA 1HYVA 2Z16A 2FEZA 4AF1A 4KHPK 2LVMA 4I09A 5FD5A 3SPYA 1OEBA 1RABB 1U49A 2QQRA 1UDLA 2VV5A 2DODA 4DTXA 2W85A 3BOQA 3VV0A 3WNFA 4WX9A 2R7SA 1PVEA 2CUJA 2O8EA 1DGWY 1FYLA 1Y07A 5FW9A 3FM5A 4J2DA 4AIJA 1KA8A 2X4YA 3C3WA 3P9CA 1I1JA 3CPWM 4JK8A 1VZ0A 5CVUA 3QNNA 3ECOA 1T56A 2P9PB 3CCEI 2QVOA 4AQYK 3SFZA 3A02A 3RRGA 3Q3SA 3DBRB 3AA3A 4PWDA 3WE2A 1TNTA 3EAEA 2I0NA 1QW1A 4ISGA 1FNNA 3IH4A 4C9YA 1SFOJ 2IIRA 2E60A 2W40A 3HOUJ 1UG1A 2OX7A 1YVNA 2FHDA 3BFMA 1BI4A 4N5SA 3GO5A 1R71A 2K27A 4F3TA 3KEQA 1VSFA 1KG3A 4LFBK 3QSUA 3VYGA 1Q82U 3M0PA 3HPOA 3G6EQ 1OX8A 4A4GA 4N9HA 3BJ6A 4A5MA 4L9TA 3JRZA 3A8MB 4M75E 2FF6A 5AQXA 4C8QC 1NNEA 2L01A 2BZYA 2P4RA 3L8BA 1WHHA 4IQJA 4HVVA 3UATA 1NH3A 4B24A 3LWHA 4RB3C 2XY6A 4AYBA 3JCMc 3QJ6A 3LH0A 3L9FA 4CJKA 4EJVA 2X1EA 3EO3A 2G8HA 4BRHA 5AONA 3PNTA 1UJYA 2VGNA 5FU7C 3MAJA 1W0HA 2OPPA 4UY8I 3CCMN 2E4HA 3CWAA 4GBQA 3WHBA 4KH1B 1ZR4A 4I6MB 2ETHA 3CM6A 5LGNA 2FRYA 4E9GA 2MWOA 3NF7A 2KK4A 4PGGA 3MQ0A 2HNHA 4RTYA 4EW4A 3OMCA 1YW8A 2F2EA 5M1OA 3RSEB 3ITHA 2PFUA 4QQ6A 5M1NA 3K0SA 2V8JA 3AO1A 1VQ8Q 1VQPT 3QAHA 4EDUA 4RAZA 1NKEA 2DPNA 3NGIA 5IP9J 2NOJB 1TQPA 4K8XA 4CHNA 2IGMA 2HYJA 3V8KA 1L0OC 3BF3A 1J2XA 4V19S 2MK5A 1H3ZA 5FPDA 3CWSA 5CHIA 1P8ZA 2Y69H 5B5EC 1FTZA 2AQFA 4JRPA 1IKYA 2BUDA 5IOZA 5FU6C 2O8XA 1ZA1B 5K7FA 2DTZA 1KFSA 3JAMZ 3L2QA 4RA2A 3M8QA 4H4MA 2QYOA 2O03A 5LL6S 4IKFA 1RGIA 1O57A 3M0UA 4QVDA 1NGJA 1WFWA 5D6YA 3L4IA 3ZLJA 5JS1A 2MLKA 4CEAA 1FW6A 1WSJA 3W2WA 3DPUA 1WQ7A 2WAQA 4UV9A 4RKUE 4B23A 4F7ZA 1OH7A 1NEGA 1HOMA 2OUMA 2EQJA 1P4AA 2CV0A 3MFKA 3K1PA 5CYMA 3MK6A 4E7SA 2R7UA 5KCMA 3IC7A 2QWOA 2J7IA 2H56A 1E7OA 4CEDA 4B22A 3EG3A 5T7BA 4X1EA 4Y52J 1NG7A 2JTVA 2O0YA 2LY1A 2L7ZA 4IFVA 1SRMA 3DRRA 1KAZA 5J8CA 1IKWA 3PNYA 1ZYRF 2VBZA 4NNJA 1YX3A 1BO5O 3D5LA 2LNVA 3NHNA 1K9MU 2RHYA 4B9XA 2A42A 3F5TA 2QA4I 2ASPA 3JCMQ 3UA7A 5BPMA 1HJRA 4CJLA 1W6XA 2W25A 1BR4A 3OYCA 1RI9A 4W97A 3H92A 1M3HA 1NJIU 1VQPA 4BRNA 3BTLA 3DJCA 3LWIA 2ZCWA 2VI6A 3CC7Q 2OA8A 3BUZB 1JHFA 4FT4A 4E1NA 1Q82C 4CJPA 1RAAB 5EEGA 2UZKA 2QWRA 1Q7YR 4J6WA 4D9JA 2KDSA 4R5PA 4ZTFA 3DCFA 3GTJJ 1XTDA 1IKVA 2MG4A 1BCOA 1D9DA 2V79A 3PNVA 2VC0A 4FLXA 3MDQA 2FXAA 1GXIE 4JI4K 1BUPA 2PTKA 4HLYA 4BRIA 1J0RA 3KXTA 5CR4A 1EH7A 3OWTA 5KQ8A 1QZEA 3KWIA 1DPRA 5D5UB 3EHRA 3S15J 1LKXA 3JAMK 2ZFUA 4J9GA 3OYLA 1ZBIA 2R5YB 3M9QA 4NQWA 2QKMB 2EA2A 3ZQFA 3Q9VA 2JGUA 5FLXZ 4GDFA 1C1AA 3CMEI 1XGOA 4GCVA 3BY6A 1FT9A 3OMGA 1D1CA 2LLKA 2JT1A 3X20B 3S93A 2XDBA 2R7VA 4DV6K 2VXEA 1SAUA 3R9PA 4EHUA 4WFNL 3CIPA 2CGKA 1NK3P 5DLOA 4CJ5A 1BBYA 2P9SB 1JTYA 2NVYJ 1NGGA 2GELA 2RC4A 3PO4A 4OKKA 2HNDA 1UGSB 2QSFX 2DFHA 3AKZA 2AZVA 4GKJK 4C1NI 3PVLA 1PRMC 4HX4A 5FKOA 3C65A 4MFBA 1NLVA 1RDAA 3CXCA 2HVQA 1LNXA 1QWEA 5HCKA 2XRLA 3M7GA 1GHCA 3RSNA 1HLUA 3L42A 4O3MA 3JAMO 4BQNA 3VQ7A 2PMZA 3IRRA 2LC2A 1NGIA 3CI5A 3BE3A 3SUNA 3NH0A 1OQYA 3AA5X 4RGSA 3K58A 5D8KB 4PJOB 1KC8R 4C2TA 3J7ZO 3G2BA 3T5XA 1XSXA 2OTJA 2CQQA 5DS9A 3QETA 2O9LA 1IN4A 1RACB 3MX5A 1ACIA 2DT6A 5AQNA 1X2NA 1JU5C 2JN6A 2OA4A 2JVHA 4MO5A 1ON2A 3KCCA 1QU3A 3E6MA 1ASVA 3AL0B 5GAMf 4WK8F 4DKWA 4B3XA 4M41A 3M6GA 2O2OA 1BJZA 5IN1A 1DGRM 2K79A 2FRHA 5LMUK 2EV6A 3J7AF 2EILH 2KIUA 4FW1A 2E2QA 4CD3A 1VOMA 2JMCA 2NRVA 2X6SA 1D5AA 1H88C 3G10A 2EKOA 3OYGA 2V51B 2QSHX 2ED1A 2A6AA 1R5GA 4QLCU 1NJIC 3DPLC 4EVVA 4I2QA 3LA7A 4RGRA 1WA7A 4B9VA 5FLXK 1QP3A 1T6CA 3SAFA 2BANA 2LRQA 4FPAA 5F2RA 1UB4A 4B9LA 2HXIA 2CP2A 3ROUA 2P9KA 1C1CA 1MJ9A 4JP0A 4ESFA 2BXYA 5HOOA 5EC7A 4M63C 4C8QE 2UU9K 4I76A 4G9YA 3VS4A 2PJRB 2OFKA 3TAEA 5J6XA 3K5OA 4DG1A 4AVPA 3N5BB 1B9MA 3IH7A 4KB1A 2EWSA 1TAUA 3J80E 4BC3A 1EQYA 4AG1C 3SWNA 2WUSA 3DLMA 4M77C 3S14J 1ZYQA 3GF2A 4EFHA 3H6EA 3C7JA 4CF2A 2FSJA 4A3KJ 1I07A 3FHZA 4KH4A 2DBBA 3CMMA 1VYVA 4C8QF 1L3UA 3ECHA 1YITT 1XD7A 5C3EJ 1XDUA 2FL7A 4O5BA 5LGTA 1KHCA 2LX9A 4B4CA 4RM2A 3HOSA 4RTFD 2E36A 3VPZA 5FLXO 3FISA 3G71Q 3BC8A 3CCQQ 3TW7A 2IVNA 4UUTA 4DU3A 3H3VK 1HA8A 1D3YA 5GTHC 1L3LA 3LPTA 3KX2A 3S2WA 1XMAA 5FWBA 1JL2A 2KRHA 3TKYA 4A6EA 4A3GJ 1B07A 1Q81C 5LD2C 1FMVA 3JRAA 4LUDA 5SZTA 4NCGA 2A3ZA 1MMAA 1B9FA 4PJOD 3CJ1A 3EEQA 1C1BA 1ZBXA 4YIIA 3J81O 4HUGA 4MFEA 3VEXA 1KSWA 2VQFK 4DFJA 1KU9A 3CF5L 2IA2A 4M77B 3KLFA 2XROA 1DT9A 1FYKA 3E01A 4M7DG 4MQ3A 3B73A 4IVNA 1YUWA 1WHJA 3GNGA 2NXNB 4C5GA 4M74A 1M4ZA 3IWZA 4AFQC 2JHNA 3A0IX 2OZUA 3IUOA 3KD5E 1T7PA 2ELJA 3LSPA 5EYRA 4M4ZA 4FM0A 2NWMA 1IH7A 5EX5A 3ERED 2EFIA 2ZJQL 2R7DA 1V5EA 2KL4A 1XNQK 2XRNA 1W7PD 2E35A 4HDUA 1ZLMA 4KH0B 3VKIA 2LF7A 1YITA 1JKPC 4MNUA 3HI0A 3CJTB 4C8NA 2X4XA 2Y4YA 2VIXA 2WY8Q 4Q5WA 3TR8A 3DBHB 3H0FA 3SEZA 2NOGA 4XLAA 2RI3A 2E1OA 1IBMK 3VQDA 5GAEP 2KVQG 4UVBA 4B8XA 3MZ8A 3MEWA 3OYMA 2ZPBB 4G1QA 1HW2A 2KIQA 4RB1A 1NHAA 3FFKB 3RZDJ 3LX7A 4DF4A 4OGCA 1NJXA 3TGNA 1MJBA 1UG2A 4JQFA 4NBQA 5BOXA 2DBMA 2CW7A 4RS8A 4EM0B 3NVKA 1D0XA 1MZBA 2W6KA 4Q5SF 2QA4N 3JCUC 5E1ZB 5M1FA 3ZCMA 3OSSC 2I5UA 4OMLA 3A1PA 5E3MA 4IURA 2DJIA 3CCRI 3OSGA 1XGNA 2GWKA 2E4LA 3U4LA 3QOPA 2F2XA 1HKCA 1YNZA 1SL0A 4A61A 3V7CA 1TKTA 4LY7A 3MXIA 3WU0A 1GLDG 1S1VA 4JX4A 3SJHA 1IHWA 2W10A 3JRIA 2DO7A 1BU1A 3VRZA 3QB0A 2DVEA 3H36A 3QJYA 1CXQA 4DQ8A 3VW4A 2O8KA 2VCPA 3D2EA 4GW6A 4GYGA 3WQUA 4DB3A 4FM1A 4OPHA 5B3SH 2RPIA 1LV5A 1VQLT 4C92B 2M7BA 2KLAA 3HFNA 3BR2A 4GV3A 2DXIA 1WEFA 1S22A 4M77D 3Q9SA 2D1HA 2AA4A 2RMOA 1H0MA 2YHXA 4FT8A 4WQ5C 3CMEN 4DU4A 3VS5A 5LJ5f 4DWIA 2V75A 3K2ZA 4A4HA 2CT3A 2MC3A 4IHXA 2JHJA 3HSEA 3TANA 2Q0UA 2A6TA 2EFOA 3EFOA 1M2VB 3G6ET 2K4JA 4H5NA 4O6JA 5LJ3g 2YHBA 1RKWA 3FZHA 4LG3A 2WB1N 2LKPA 4TSXA 1VQ5Q 4M6XA 2RI2A 3TAFA 1D9FA 1FJLA 1JEGA 2WA0A 3K57A 3AGRA 3HHHA 3B6AA 1YBYA 2FSKA 3O5ZA 3BQYA 1K8AO 1XN7A 3DKYA 4ZNXA 4R1HA 3GW2A 3WTYC 3PX4A 2MD0A 4DV5K 3JCMd 3H35A 3PGGA 2DYBA 4DLGA 2HWVA 5D6FA 3AVJA 4RUGA 4LLNA 3OGDA 1KK7A 4J83A 3QWXX 5GIOA 4FQGA 5LHHA 1K1ZA 5AQOA 2PI0A 3KWGA 5AZJA 4RB2C 4BR9A 3V6DA 2L9SA 3SAHA 2JUCA 3UKRA 2GXAA 1VQLA 1XHZA 4BQAA 1UE9A 3JR9A 3DTKA 3QXEB 1XSDA 3UKUB 1VQ8T 1BIZA 3ZQHA 1Q82R 4XRMA 1A04A 3FXJA 4BC4A 1C6VX 1IGUA 2X9DA 3R4KA 4IZ9A 3QHSA 3LSKA 1BA5A 1JJ2P 2HVHA 1GBQA 5M9OA 1SMYF 2YJEA 4EGZA 2LMDA 3M4OJ 4IL6C 3I0RA 3O3HA 4CYCB 3VS6A 1VQON 3SDBA 4XN3A 4C2MJ 3B8AX 4KTWA 3EH1A 5HP1A 3ESWB 4ID1A 3KTUA 3G6EA 3MKLA 2LBFB 1Z0XA 1VQ4N 4CI6A 1NBEB 2LJ0A 1YS6A 5KTQA 4KTQA 1H9GA 1YRNA 1E2XA 3DAWA 2WOMA 1ZARA 3VQCA 1YOVB 4Y28E 1RI0A 1KFZA 3D4VA 4LF6K 2OZMA 1NK5A 1XC9A 1O75A 2MFZA 4D7NA 3V9XA 4HNVA 3M1CA 3W0LA 3WXMB 1VQPI 3H0DA 2E64A 1R59O 3JB9J 3H1QA 1WLPB 1VQNT 4HV5A 5IP6A 2X78A 1Q1HA 1D3BA 1ETOA 3E97A 4NC6A 4XU3A 3AY9A 4XKWA 4FOEA 5AQUA 5TKYA 4WQ4C 1QNTA 2CZ0B 4JLIA 1YTAA 5KH6A 1TQIA 1K8KB 2FSWA 3L2WA 5GAMj 2IG0A 4KULA 1N9SA 1NGDA 2PYJA 3F8CA 2EBIA 4Y33A 3QEPA 4M77F 5C6SA 2HAXA 3AT1B 3HFOA 2CDTA 2HBWA 1ZLJA 4AWXB 3AFHA 4LD9K 2I7PA 2A5XA 4JKDA 3E7LA 4CJEA 5GJVB 5KAIC 2ZQBA 4HKEA 1VQ8A 2HEOA 1QKXA 4JJDA 4J5YA 3CC7T 3TTCA 2K5LA 3MVPA 3CMAT 3G1MA 5E20A 3TMOA 2RQVA 3T1YK 4Z4CA 2ECCA 4CJ7A 1ITYA 2A5YB 4RG2A 5GAOl 1UGRB 3WXKA 5IXBA 3LWLA 2I8DA 1SPKA 2F1LA 4JS4A 3I8BA 2EZIA 5CKDA 4IOCL 2NUZA 3S3OA 2PX9A 4NL2A 3THKA 3CC2Q 2LSNA 5FRMA 5HRPA 1BOAA 4CCJA 2YX7A 3EETA 3ML6A 3RPQA 2DDAA 3GBTA 1YT3A 1MUZA 1V3FA 1ZBUA 3MECA 1NMNA 4FYYB 4PA1A 1SKSA 1LJ9A 1QTMA 1S6LA 3OJSA 2Q0RA 1K9MR 5KYNA 3KZYA 3GFJA 1VQNA 4CDGA 1GCPA 1IHVA 3P31A 3AVFA 5D5XB 2NVXJ 3WXJA 1BIAA 1W4SA 1NJIR 2BVLA 2YX6A 5GAOr 5LY3A 2BDPA 3NH2A 4UUSA 1MUNA 4RTZA 2P9NB 1VIEA 5DV5A 3CYMA 2DFUA 3V4IA 1S3XA 3L09A 1RAHB 1I6XA 1S5LC 1YFNA 1GVJA 4JHDB 1B72B 4LITA 2MAMA 5GJWB 1MA9B 2XHBA 3RMAA 1R5ID 1POGA 2V1NA 2OTJI 3SZGA 1SSHA 3O3GA 3P8HA 2MABA 4G6DA 3T1HK 3TW6A 4XLCA 3LAKA 3CC7A 1R58A 2HQRA 3M8JA 3U1DA 1X4OA 3CMAA 4DTUA 4FJGA 1J3TA 1AWWA 2QASA 1GV5A 4M75A 3IQLA 4CCLA 2X6NA 3NDKA 3K4KA 4CFBA 1IN7A 3OV8A 2FQ4A 2CGJA 1U1SA 3NTKA 4K42A 5GINA 4LD0A 2GA2A 2GIZA 3O9TA 3IH2A 3KNTA 2GWJA 4DTNA 3SUPA 3DXJF 1HXDA 2OANA 1RAFB 4C8MA 1R23A 1WB9A 4M7AB 3O3KA 2LCCA 5K5QA 1DEJA 3G4SQ 3FGUA 5FROA 3F2KA 3M3YJ 3V42A 4Q4ZF 2KY9A 4M3TA 3CC4Q 1ZLKA 4FYVB 2IAJA 3E3VA 1NYFA 5GAMh 1BYMA 5KVRA 1P59A 3DLGA 4DR5K 3BGRA 3X24B 3A8OB 1OZ3A 2RV8A 3L7WA 3CCRN 1NGHA 3QDFA 2O4XA 4XQ3A 4RW6A 1K78A 4XU1A 2HZTA 4P55A 1NK7A 5KNLA 5KHDA 1WJAA 5CZ2A 3L1AA 5KYWA 5KYXB 5HLGA 2O8FA 1RRQA 4ZGEB 2OC6A 3FIFA 1LDDA 1W9HA 3OIQA 3NMUA 2BEOA 2Q0OA 2HVSA 3V1OA 3A5OC 5ECAA 3SZ2A 4PK4A 2V1QA 2DO3A 5KI6A 5FLMJ 2AXTC 5DD4A 2P0KA 5I9EB 4LH4A 1FP1D 1E0EA 1MUDA 2XG8D 4Z4FA 2KKOA 1R1TA 3MJXA 1WSGA 5HLIA 2HMAA 4BXFA 1WN7A 4Q47A 1S72Q 3IV5A 1YW7A 4AYBN 3S9HA 4H4OA 4R79A 1KZHA 4BGAA 4Z6YA 1VHXA 5GMKi 3I0TA 4PLIA 1VQ7Q 3VEOA 3GFMA 2HHSA 2XMFA 1AWJA 5BPDA 2EB7A 3HOTA 2DTRA 1WI7A 2YLBA 3HTRA 3GTPJ 3CP2A 2LNBA 1QQJA 5K14A 3WG7H 3K4LA 4UV8A 4FCYA 3V8JA 5DTDA 2X6YA 4FK2A 1VQ5I 2G8KA 4BROA 4DZJA 3LSMA 3KFVA 5DYMA 3CPWP 4CJSA 2CP3A 2KPMA 3G71T 3T3FA 3CCQT 4BQZA 4CHUA 1R22A 4PJMA 3OTOK 3PQKA 3S6WA 4A63B 1K79A 1YJWI 5CQYA 1REVA 1IDZA 3CJ9A 1KQSS 4B1ZA 2VKDA 2CYYA 4N4OB 3V8LA 1WNLA 4FM2A 3X26B 2EA4A 3F23A 1ZBHA 1K8AU 1B1BA 1IF1A 3CJNA 1HNIA 4FPBA 2IA0A 3LWMA 1RIOH 2HHVA 3ISPA 2DJQA 2CJJA 5I3UA 5GAN8 2VB6A 5JS2A 2LK2A 2QZ8A 4EIAA 2KIFA 3LZJA 1U2WA 2EYYA 1AHJB 5GAN6 3AVMA 1GCQA 4WF9L 5IT9Z 2E6MA 5LJ5j 4FK0A 1I1GA 1O7LA 1X6GA 4E7HA 3VU3C 1ABQA 1YITI 4C3HJ 4GV6A 4HV6A 1KG4A 1QP2A 4A3EJ 1Y96B 3GG4A 2FRWA 2O8EB 2VG6A 1SFEA 2D5VA 3I56Q 1RT4A 1BC7C 3URGA 3TAQA 3CUOA 1GLLO 4JD2B 1U0JA 3ASKA 2RE2A 3MMYB 1S7EA 4KBOA 3P38A 3IFRA 2QWNA 3SHWA 2OCEA 2O8DA 2HL3A 1MBGA 2DCEA 2KDZA 4XLHA 3QLHA 1WVRA 3L2RA 4BHPA 2CZ6B 3WODF 3K2PA 3NGPA 1G8XA 3IMXA 5DPKA 3I54A 4YIFA 4NC7A 4FZYA 1FEXA 4KGZB 5GANh 2DY4A 1HSQA 2G7UA 2DD5A 3G71A 4HPQA 4FWRA 4HVWA 3CCQA 4Y0WA 3SI6A 4NHJA 1VQPN 2JXBA 2MWPA 2B63J 5CKTA 3NTHA 2GQQA 1OVYA 4BS9A 3J7YP 2UUAK 1AKHA 3EE9A 1N75A 3FC3A 4KIGA 5JMVA 4E1MA 2NUTB 2K5FA 2VASA 2D8HA 2HHXA 1QHHD 1TSFA 1XGMA 2V52B 1OR7A 2P5VA 2ROLA 2NUPA 3HIFA 1IN6A 4XU0A 1E4FT 1SZ2A 4XK4A 1EV7A 3PV8A 5HODA 2DEQA 2HOAA 3MAQA 3FF5A 4PFPA 2XGEA 1IRXA 4YPHA 4X64K 1MSEC 3ERMA 4D8DA 3QO3A 1B9DA 5C2FA 3VOEA 1O4XA 2RHKA 4ZTJA 2CW8A 4G7HF 1OH8A 3FLGA 1PVSA 4X9CA 4M71A 2OJ2A 4RW7A 4IHTA 3QIIA 3V4GA 2HBPA 5IT9K 4NDLA 3HP6A 2YRDA 2RHUA 1NGEA 2P8TA 2PFBA 3KYLA 5GAN3 5F0XA 3P8BB 2RAEA 1WQ2A 3H0GJ 3FK7A 3QU3A 4O4GA 4CJVA 4E9HA 5HROA 3CC2I 1UHWA 3ENOA 2LVSA 3JAME 3ZX2A 1S1TA 2X1CA 4G9ZA 3CCUQ 2BHYA 3H8ZA 2D4WA 1IO2A 5KRSA 2JLEA 3VEVA 1B92A 3CCVQ 2FMYA 3NVMA 3RIRA 3EPZA 4GXOA 1VQKQ 2DAQA 3SUOA 1NYGA 3BG6A 1YJ9T 1K8AC 3R60A 5JHFA 3M58A 1JXOA 4OAZA 3NFCA 2Y30A 5LJ5h 2KKZA 5H1SQ 4DV7K 2RHXA 4JI2K 4OFAA 3VEPA 4CA0A 1HKTA 1GVDA 3FXKA 2FEIA 2PMZN 1BGXT 3E6CC 3WQTA 5DEQA 5IT9O 3T7ZA 1M1EB 2DMNA 2MYSA 4F7UB 4XK8E 2H3JA 1R1VA 2M2EA 4PJOG 2XAHA 3HBLA 1CZBA 2OTJN 4IOXA 5EG0A 3CZ6A 3I3LA 2KMTA 1MWKA 1V55H 4DJAA 4NUBA 3LM9A 2JUGA 4E6RA 2E2JJ 1PM3A 1LPLA 5C24A 4FXDA 2ZPGB 4DK9A 2X6WA 4BKXA 5FDLA 1IGQA 2RB6A 4NOYA 4AT1B 4I7FA 4ISEA 5IYBJ 3ULEA 1NEBA 2IA1A 4QPOA 2BW3B 5JR3A 3IHOA 3P9IA 5L3CA 2X48A 2BBYA 3FK6A 2M4KA 3AG1H 5CVJA 3INZA 2ICWG 4B6MA 1N25A 2HMPA 2OU2A 4DOVA 3H46O 3WNHA 1TAQA 2NS0A 2RK2A 3E2UA 2YR2A 3EUHA 1I39A 1KQ1A 2NRHA 4EM2A 2HMIA 3CC4I 1LMZA 3A8GB 2HCKA 3EGDA 3I9QA 1AVZC 4Q5VA 3TOAA 1K61A 1VQ6I 2Z99A 1RLPC 2DD4A 4HVUA 1YJ9A 3VDXA 2J6OA 3ZSYA 1QKWA 3C18A 2VKEA 2BOLA 1SV5A 3NTIA 2UXXA 1Q86C 1ZUYA 2V1UA 3I8DA 4F52A 3E6BA 2QYZA 3X25B 2PMHA 2NRRA 4GO1A 4TV7A 4KHNA 1GXQA 4KMFA 1T39A 2L89A 4O8UA 3I4PA 5FLXE 3TWHA 2L0KA 2DBKA 4YORA 1MGTA 1JKOC 2YG8A 7AT1B 1WJFA 5LEJA 1NE8A 3VSKA 1VSLA 2CZ1B 1YJNI 1W2BP 4BD3A 2IDOA 3K1NA 5EY4A 2MC4A 2HDCA 3AVIA 2KT0A 3BDPA 1U2VB 3RKQA 2Y9YA 2EVRA 1WJCA 4IEJA 1RRSA 1YQRA 1WX6A 1S1NA 4DSIA 1X6OA 1SL1A 2STWA 2HHUA 4NQWB 5AQMA 2H27A 4O44A 1PUFB 2QGFB 4XTXA 2DXBA 3QIOA 3WXIA 1IG8A 5LRRA 1YQLA 3EG9B 3LP0A 3D7EO 2VN2A 1MH3A 5AIPA 2L5QA 3PO2J 1WJQA 5AZIA 3JB9D 2C0OA 4DS5A 4L5IA 2NRXA 3GPLA 3QYBA 1WI3A 1OH5A 4N76A 4DCHA 2P84A 4FJXA 5HS9A 2IW5A 4BI4A 2K5IA 4OB3B 2Y48A 1MMNA 3V7SA 2NVQJ 1IG9A 3CCLT 5C12A 1NGCA 4LJZF 2OBPA 2EQUA 3FXQA 1TWBA 3ER0A 1U5TA 4BE1A 4OFHA 3M0QA 1EIFA 5D5WB 4BDYA 1WWXA 2NYXA 2IOCA 4DQ2A 4M77G 3K9KA 1MBHA 4YDUA 1YJWN 4CEEA 1EF4A 4K0KK 2XY8A 3FIWA 2W48A 4A0XA 3IRXA 4C0DC 2HW3A 1JJ2S 4ELZC 2OTLI 4RTVA 3I4MJ 1MBJA 3FZLA 1WOQA 1VRUA 4L59A 1VQ9I 3DI6A 4JS5A 4F55A 2YHTA 1