4BACA

Prototype foamy virus strand transfer complexes on product dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly of Prototype Foamy Virus Strand Transfer Complexes on Product DNA Bypassing Catalysis of Integration.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords INTEGRASE
total genus 82
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bacA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bacA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bacA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bacA03
3O3GA 4CJVA 5KH6A 4CK2A 4X34A 1B9DA 3AO5A 3C95A 3LYIA 3DRRA 2HW3A 4FJ7A 1FXXA 4B9WA 4CJKA 3P1GA 3L2QA 2GUIA 2YNGA 5HLFA 2LVMA 1S1TA 3S3OA 3NNQA 3T3FA 3V4IA 1CLQA 5C24A 2KZZA 2WACA 2LSNA 4N5SA 3RRHA 3O8VA 1ZBFA 4CJ3A 4QQGA 2NUBA 3QEXA 1TK5A 1RT5A 2QK9A 3AVNA 3SI6A 4LH5A 3S3MA 2IAJA 1JXBA 3DI6A 5I3UA 3L42A 2IDOA 4Q0BA 1NK0A 1D8YA 2BKDN 5T7BA 2HHVA 2M16A 4DSJA 2HNYA 1TV6A 2KFZA 1REVA 1S1WA 3WNGA 3ZT0A 3I0RA 3TANA 4M3XA 2DAQA 1H3ZA 4XIUA 3VQQA 2R7YA 4DTUA 1VSHA 4Z4IA 3PFSA 4O55A 2EX3A 3HM9A 1IKVA 2X6SA 4JRQA 3SUNA 3QIOA 3V1QA 4O44A 5J2NA 4CF2A 3MXIA 3HPGA 1XI1A 1D9FA 4C8KA 3MO8A 1J5OA 4BACA 5FDLA 3VQ8A 2E6NA 3ZCMA 3ZSQA 3ZSYA 1D9DA 3KJVA 4FL6A 5CZ2A 4CJWA 4Z4CA 5HRPA 3DM2A 4DQRA 1LV5A 4J2AA 4PY5A 1KCFA 3NHGA 4Q5VA 3VA0A 3DLMA 3UWNA 3IG1A 4DMNA 4DFJA 2XY5A 1SL0A 1TK8A 3ZSXA 2XY8A 1NOYA 4AHCA 2QKKA 3KUFA 2X4WA 3QBYA 4II1A 1YTAA 3MP1A 4N4IA 3MECA 2QKBA 1TKDA 3OYMA 1NK7A 2YNHA 4BE1A 4ID5A 1Y97A 1A5VA 3HO1A 3F9KA 1QTMA 1EP4A 3G0ZA 3M8PA 3NBPA 3SV4A 4DTSA 1HQEA 3UIQA 3ZT3A 1HPZA 1DTTA 4N47A 4UQGA 1I3AA 1TAQA 1WNSA 4Z02A 3DLEA 1C0UA 2D5RA 1N6QA 3QIIA 2IS3A 4I7FA 4CGDA 3LX7A 1X9WA 1C0MA 2M0OA 1BQNA 5DMRA 3Q1JA 3FFIA 1JLEA 3C6UA 1KLNA 4M3UA 1FK9A 4FLTA 4C5EA 1SKRA 4KAZA 4RG2A 4PUOA 3M8SA 2RHYA 4FZYA 1NJWA 2Z1GA 4CE9A 2HQXA 3ASMA 3LWLA 3PMIA 2A1RA 4Z4EA 2HMIA 2OZMA 3PV8A 1IKXA 1BGXT 1WSGA 2XY6A 2KZMA 2R58A 4CEBA 4NCAA 4Y1CA 3HPOA 3V9XA 4DTNA 2EHGA 2L3RA 4M3YA 4OLBA 3ZT1A 3HVTA 4DQPA 4Z4FA 3QKJA 2L89A 2DIGA 3NAEA 1JL2A 4AHVA 4FCYA 2RN2A 5J2QA 4FXDA 3CFRA 3AVFA 3ZT4A 3LGFA 3LLRA 3CM5A 5J2PA 4FJJA 3AVBA 3ISNC 2X6NA 3DOLA 3DLBA 4IUQA 1HJRA 1Z26A 2B6AA 4IKFA 2F8TA 3LGLA 3AVCA 3NDKA 1YT3A 3F73A 4CEQA 2XY7A 5SZTA 3SD4A 1UWBA 3K5LA 2E6LA 3OYBA 1RTHA 4AHSA 3HVRA 4BDPA 4MQ3A 1GOAA 4LH4A 5KE3A 4HUFA 2ZQBA 4N4HA 1NK8A 3VN5A 1L5UA 3UT1A 1T03A 4FW1A 4CHYA 4W5TA 2GFUA 4DS5A 3C94A 4MFBA 3O4QA 1VSIA 3LWMA 1IG9A 4FM1A 2LTOA 3DYAA 3BDPA 4CFBA 3KLIA 4O5BA 4F3OA 3VQCA 1ZBHA 1LW0A 2OPPA 1VSMA 5I42A 1ASWA 3VQ9A 3MXJA 3S6WA 3EZ5A 1R0AA 1U47A 5J1EA 4I2PA 2DTUA 3BDLA 4TSXA 3MEGA 2RHIA 4E1NA 4GMJB 1QHTA 2DFHA 1VK0A 4NYFA 4KTWA 1ASUA 3LP1A 4KO0A 1RTIA 3ZSZA 4FJ5A 4L59A 4KI4A 1VSJA 3PX6A 4B9TA 1L3SA 4KI6A 2LRQA 3ZEHA 1TGOA 2RPIA 4HVJA 4RG8A 4ELUA 5FROA 2HHUA 1T05A 4FJ9A 2EFIA 5HRSA 3QLHA 1TK0A 4EZ9A 4QQDA 2B5JA 3KLHA 1ZBUA 2CKKA 4N41A 1NKBA 3OA6A 2YKMA 1Q9XA 1RI0A 1KFDA 1BHLA 4OGCA 1QSSA 1OZ3A 2IG0A 2RJDA 2F8SA 2VG6A 3AVHA 4CGHA 3QJ6A 3NCIA 3OMCA 1S9EA 4CF9A 3QEIA 1WJRA 4WE1A 4YFUA 2FBYA 3KLGA 3NTIA 4M45A 1RBTA 1KLMA 3OYDA 3CEYA 1GOBA 1TVRA 1WLJA 4IG3A 1X9MA 4E3SA 4I9QA 3D45A 1LW2A 4CEOA 2OPRA 1WSFA 1RTDA 5D6XA 4EP4A 3VQ4A 2KQ2A 3K5OA 2I5JA 1BIZA 4C8OA 3AVJA 1SL1A 4QCLA 2P5OA 2D9TA 3DB3A 2RF2A 2VWJA 2GFAA 3OS0A 1WSEA 3CG7A 4B9VA 1D5AA 5FRNA 2XK0A 4IFYA 5IAYA 3QETA 1NK6A 2P5GA 3LPTA 4CJRA 3HT3A 1JLCA 3HYFA 3LP0A 4EZ6A 1RDDA 1RILA 4CHZA 3ITHA 1K6YA 3NH1A 2DIQA 1J53A 4GW6A 3SV3A 1EETA 4Z4HA 4FJNA 3O4NA 3SZ2A 4KHSA 4CJ4A 1U48A 3FDRA 4B8CA 4W5OA 4LD6A 3V9SA 3WNEA 3C6TA 1RBUA 4M41A 3OYNA 2P0KA 2PQWA 4Z0UA 3ZSOA 4FLUA 3LDSA 2Z1HA 2X4YA 2YKNA 3V9UA 2AJQA 5CYMA 4ZTFA 4BDZA 4BE2A 4DTPA 4IBNA 3K5NA 1U49A 3H6ZA 4QW2A 5CIUA 3H08A 4ICLA 4KV8A 4DS4A 1W0HA 3AVAA 4NYNA 3I8DA 2JGUA 4F8RA 3ZSRA 4CGJA 3MP6A 4K8ZA 3OY9A 4C5HA 1KTQA 4RW8A 2OA8A 3U3YA 3TABA 4OPKA 5CY4A 3C4SA 4W5RA 1N27A 3L2RA 1JLAA 3LP2A 3NGIA 1CXQA 3AA2A 4PA1A 2ITGA 1EX4A 3ULDA 1U04A 2JLEA 1VRTA 3ZT2A 5C6SA 2BIVA 1T8EA 3MEWA 3RR8A 2YHBA 4DWIA 4N76A 2MWPA 3NF7A 1WGSA 4Q5WA 3AVMA 4CEFA 3SYZA 3KD5E 3L2UA 1ZBLA 3SPYA 1QQCA 3RWUA 3OYLA 3KKSA 4FJXA 1A5XA 3RMAA 2O4GA 4DLGA 1KVAA 1RT7A 3OB9A 2HVHA 5CZ1A 3KD1E 3RTVA 2L8DA 4DTMA 3OYJA 4CERA 5D6WA 4IDKA 3ME9A 1XHZA 1HRHA 3NE6A 5HBMA 4A4EA 2G8FA 1BL3A 3PO5A 1JLQA 2VG7A 1HQUA 1I39A 1HYZA 1WN7A 1JXEA 3L8BA 2G8WA 3OYFA 1L3UA 2E6MA 3QINA 3AA3A 4CESA 4E19A 1RT3A 5KTQA 1UOCA 1TL1A 1J54A 3VQ5A 3M8RA 3SUOA 4CFCA 4O0JA 3AA5X 3L3UA 4FLXA 3LH0A 3SQ0A 1CZ9A 3LAKA 1NK5A 3P8HA 3V1RA 5J26A 3MEUA 3DLGA 4CRIA 4K8XA 3M9QA 4FK4A 1ITGA 2PYLA 1BQMA 1MU2A 3NGZA 3OJSA 1RBVA 5HRRA 3KK3A 1YTUA 3NF8A 4DTOA 3PO4A 1TAUA 3OYGA 2O4XB 4CGFA 4CJLA 4HHTA 2O4IA 1KHCA 3V9ZA 4A4FA 3KKRA 1BIUA 3OMGA 4UC4A 4DFMA 4N4GA 2X4XA 1F21A 1RNHA 3KIOA 2FBXA 3LP3A 3QNNA 3RMDA 4KTZA 2P51A 2G3RA 4H4OA 3AVIA 4BWMA 1OYXA 3JSMA 3TI0A 2LCCA 4DQIA 4CK1A 2FBVA 1ZBIA 4E7JA 4NCBA 1JL1A 3VQBA 2X35A 3AVLA 4CJFA 1RT6A 1U4BA 5JS2A 3RR7A 4C8LA 1RDCA 3AVGA 4CJPA 4DSLA 4CJ5A 4HCZA 1QE1A 1YVUA 3AO3A 1BISA 1EKEA 4B9UA 2HHSA 2KFNA 4A4GA 4PL6A 2D0BA 4KREA 5DK5A 3K5MA 3PX4A 1ZYQA 4F4KA 3TARA 4IURA 5J39A 2D0AA 4E7LA 4GY5A 4Y1DA 4CIFA 4ID1A 2RJEA 2XO7A 2BDPA 3FC3A 3SQ1A 3NTKA 4QAGA 5KRTA 4FLYA 3QEVA 3TAEA 4W5NA 4BE0A 1LWEA 2B8AA 2IC3A 3HL8A 4I9LA 3SQ4A 4PWDA 4FYDA 3OVNA 3HJFA 4CK3A 4CGGA 1NK4A 4L8RB 4KB1A 2QXFA 4E89A 1DLOA 3TAMA 5HROA 1NKCA 3AO1A 4CHNA 1LWFA 3NFAA 1C1AA 4EDUA 4FJ8A 1KSPA 3HPHA 3DLKA 1CXUA 3TAFA 1O1WA 4C8NA 4CF1A 2OPQA 2OZSA 2QQRA 3KK2A 1RDAA 2K3XA 3B6PA 3NH2A 3EY1A 4CIGA 3DRPA 4IFVA 4J2DA 3U3GA 2EKOA 3P5JA 3QO9A 2XRIA 1HNIA 1XHXA 4PLLA 1WAJA 1G15A 4ELTA 2G8VA 2DFEA 2FC0A 3HSTB 4JRPA 1EXQA 3SCXA 2KTQA 4N56A 5HP1A 3GOXA 4CJSA 2YNFA 2JTFA 2BGGA 4AHRA 3BGRA 3SUQA 1S5JA 3HK2A 2XHBA 4IUUA 2RI2A 1BI4B 4I2QA 3B6OA 4H4MA 4CHPA 3IAYA 4CHQA 4ZHRA 4CEEA 4LSNA 2EQUA 3OS2A 3VQAA 4AILC 3QEWA 4QVZA 1JLFA 2YHAA 3T19A 4B8AB 4DG1A 1S6PA 1RT1A 4OVLA 2BUDA 4FJKA 2FBTA 4M3WA 4LY7A 4O0IA 1IKWA 3NGYA 4BWJA 4Z4GA 1TKZA 3QEPA 2D0CA 3NTHA 3VQ6A 2RI3A 4H8KA 4FLWA 2YV0X 1SV5A 4KFBA 4NCGA 5HRNA 4DTRA 4DFKA 3S3NA 1HMVA 5FRMA 3LALA 4FU6A 3LZIA 4DSIA 2B4JA 3MEEA 3L2WA 4RW4A 3D0PA 3EAEA 3OS1A 1FKPA 3VQDA 3DOKA 2PZSA 3TAQA 4F3TA 4RW7A 4M3RA 1C1BA 1ASVA 2HQEA 3OYKA 3OQ5A 2DY4A 3AV9A 4EP5A 4C5IA 5J2MA 3DMJA 5EU7A 4HTUA 3MP8A 4CFAA 3V6DA 3PX0A 2Y1JA 2M1HA 2R5MA 3P8DA 3LAMA 1RBRA 4DTJA 1JLBA 3KLFA 2K3YA 4PQUA 1SUQA 3ALYA 2A1SA 4OJRA 2X74A 3O3FA 1NJXA 4CJEA 4QQ6A 4IG0A 2GV9A 5C42A 4OPJA 1JKHA 3NF9A 4W5QA 4CCHA 3SPZA 2HHXA 4DU3A 1IKYA 4NS5A 2VYTA 5KI6A 1C0TA 1FKOA 2W42A 2X78A 2PYJA 1KFSA 3TR8A 2KW4A 2EQMA 2IOCA 2O4XA 5SWMA 3V9WA 4DQSA 1L3TA 4HCCA 4FK2A 3TAPA 3E9GA 5M9OA 3K59A 2PY5A 2QQSA 1GOCA 4JLHA 4E0DA 2G8HA 4F2RA 3WNHA 3LANA 1SSFA 4KKOA 3OYCA 4KTQA 2ETJA 3DLRA 3K57A 2EQJA 4FM2A 4FJLA 2R57A 3OYAA 2ATQA 4IUPA 3MEDA 2RJCA 3NH0A 3RMBA 2HHQA 1QS4A 3VQEA 3O3HA 3V1OA 3E9FA 3MEAA 1WSJA 4DTXA 3RMCA 3PMTA 4B9XA 2WONA 4CFDA 1KRPA 3MAQA 3TAGA 3ASKA 4R5PA 2WOMA 4DU1A 1SKSA 3M8QA 1LWCA 1BCMA 1UAXA 1NKEA 1QSLA 3PY8A 5D3GA 4KRFA 1NK9A 2DFFA 3LPUA 1RBSA 3U6FA 1WJSA 3IS9A 3I0SA 3G10A 3K2PA 4FJIA 1T7PA 1Z25A 3FLGA 3CFOA 2RJFA 1RT4A 4KB0A 4FZZA 1BI4A 4FK0A 1OZ2A 4YNQA 4AHTA 3KLEA 1RTJA 3H8ZA 3HP9A 3SJJA 4FJMA 1VSDA 3QNOA 2G8IA 4DF8A 2YNIA 3L3VA 3JYTA 4FM0A 4A4HA 3CM6A 4C8MA 1Q8IA 2Z1IA 4CEZA 2ZE2A 1HYVA 1TKTA 4LD0A 1NOZA 1HNVA 1KVCA 1VSLA 4CECA 4FLZA 3HXMA 1OI1A 1A5WA 2HNZA 1SKWA 4HUGA 1S6QA 4B9LA 4RW9A 2RO0A 3AVKA 4OGEA 4AH9A 5KGXA 4J2EA 3RRGA 1SL2A 4ZTJA 2Z1JA 3HP6A 4DSKA 2R5AA 3VA3A 3THVA 3OYIA 3AO4A 3NF6A 1IO2A 3SNNA 2HVIA 1C1CA 4HCBA 4JS5A 4OKJA 1NJYA 5C0MA 3QERA 3CFPA 2YRVA 1NJZA 4DSEA 3CYMA 3P83D 5CYQA 3K58A 1J9AA 2OPSA 4DFPA 3S9HA 2E4LA 1S1UA 3LZJA 1X9SA 3OYEA 2E5QA 1B9FA 4F2SA 4LSLA 4KHNA 3V81A 4KHWA 1XWLA 5JS1A 4GVMA 4E7HA 5KE2A 2F5KA 2NLUA 2RHZA 2BE2A 1UA0A 2G8KA 1L3VA 4B08A 3CQ8A 5KCHA 4DSFA 5C25A 1N5YA 2HHTA 4DF4A 5IN1A 5E41A 3QESA 4NZGA 1BCOA 3QIPA 2RHXA 1S1VA 1TL3A 4CF0A 2RHUA 1VRUA 1WSIA 3ZSVA 5KCOA 1S1XA 4CHOA 4DU4A 4E1MA 1XC9A 4FZXC 4FW2A 2VG5A 3PUFA 3A2FA 3T1AA 4OLAA 4FJHA 4CGIA 1RCHA 1CZBA 2HB5A 1MHNA 4CJTA 4C5GA 3MEVA 1JLGA 4B3OA 3FEOA 3META 4FJGA 1VSEA 1RDBA 4CEDA 3OJUA 1QSYA 3KTQA 3PNWC 2ZD1A 3EYZA 4KHYA 3VQPA 4BD3A 4OKKA 4M3TA 2F96A 1B92A 4ELVA 4AHUA 1WSHA 1RT2A 4G1QA 5KGWA 2RI5A 2GF7A 3SUPA 4RW6A 4M3ZA 4PLIA 2JZ2A 3SQ2A 4B9NA 4IUVA 1C6VA 2P1JA 1W9HA 4FVMA 4O4GA 1X1PA 4CJQA 1DTQA 5K14A 2IGIA 3VQ7A 2HNDA 4CJUA 4JS4A 4FLVA 3MXMA 1WAFA 2VWKA 2OYQA 1UA1A 4OKEA 3L2VA 4KHUA 2EQKA 4E7KA 1XNIA 3AO2A 3TWHA 4B9MA 2MWOA 2BANA 1LAWA 4J2BA 2FHDA 5KRSA 1VSFA 2GBZA 2Q3SA 1U45A 3DRSA 4HUEA 2RKIA 3WNFA 1TKXA 3IRXA 2LDMA 2G8UA 3DLHA 1HYSA 1IH7A 2HHWA 3OYHA 1Q9YA 1WJQA 4OVAA 2XDPA 1G5VA 1S9GA 2Y1IA 4IUTA 1KVBA 3E01A 3ZSWA 4KHQA 5D6YA 1LAVA 3AA4A 4DLEA 4CF8A 4DQQA 4B9SA 3F70A 3KK1A 4QOZB 4M42A 4CEAA 4KPYA 4E7IA 1VSKA 4BDYA 4CIEA 3DB4A
chains in the Genus database with same CATH superfamily
4L18B 4LN2A 4CJVA 4CZKA 1NGEA 3MQ0A 4XM3A 3CCMQ 2M87A 2H1KA 3HSFA 1BIBA 1WIEA 3M8FA 3E6MA 2QWRA 2FZCB 1BC7C 2GA1A 2NRZA 1D8YA 2JMAA 5T7BA 1O7LA 4IQJA 2UWMA 2RNAA 3DBHB 1S6LA 1VQLI 5FO5A 3Q9VA 1LPQA 4Z4IA 3OW2S 2X6SA 1VQNN 3ULQB 3DAWA 3MXIA 1XI1A 3LSJA 1OX8A 4FETA 4BACA 4FWMA 4FL6A 4Z4CA 1GVJA 1ZELA 4CA0A 3ML6A 1J6ZA 1NJIO 3BG3A 3BTIA 5HKCA 2QKBA 2MC3A 4M7DB 3R6OA 1ZG3A 5GAMf 1I5LA 4M78G 2EQRA 2KBTA 2NVQJ 4CE9A 4BVPA 5GAOp 2X3WD 3FJPA 3R6MA 2COZA 4MMLA 3HPOA 1YTYA 4AHVA 3CCEN 4M3FA 5GAN7 2EJRA 2EW3A 4CZIA 1M2OA 1SAXA 1NWKA 3ISNC 1M4ZA 1LJ9A 1WSUA 4JBAA 1X3WB 2WSCE 3VODA 3VN5A 1U1TA 3JW4A 2XPVA 4O5BA 1DP7P 4B21A 3ZL7C 2DJQA 2RF0A 1VSMA 4CSWA 4F9OA 3CWSA 4RTXA 2FF3B 1CKBA 2PN6A 3BFMA 1EH7A 5CCAA 2YJEA 2OANA 1Z9CA 1TK0A 1VHXA 5L8RE 1HKTA 2CKKA 1H0MA 4AFZC 1OZ3A 1XMKA 1VQNT 5EZGA 3MAJA 1K8KB 4I9QA 3D45A 1OVQA 4BI8B 1TUYA 4EP4A 2QK0A 3H0GJ 4C8OA 2YXYA 3KBGA 2K86A 3M5RA 5IT9E 2XK0A 2XF6A 3F23A 1RNLA 2E1HA 3TEEA 1LDKB 4KH1B 4J7IA 4IRHA 3AL0C 5BMZA 3IHUA 3S1MJ 4G94A 3QAHA 3ZSOA 4ZTFA 4IBNA 3M6GA 3K5NA 3H08A 3ASOH 1YHQT 1R5GA 3E6BA 3M0QA 3HSEA 2NWMA 3TABA 2DZ9A 2YS9A 1CXQA 2ITGA 2V7FA 4M77A 1VQ4N 2OF7A 3A5NC 5CKHA 1MZBA 3AGRA 3DEUA 4KBMB 5JMVA 2P6TA 1A5XA 1VQMQ 3JCMP 2R7FA 2CZ0B 1I50J 3OBWA 5FW9A 1GV5A 1YJWT 1ORNA 2ZC2A 3L3UA 3VGMA 1R58A 3V1RA 5I9EB 1OISA 3WXJA 1N77A 3NGZA 1FEXA 2IBDA 5E3MA 2CSQA 4RAFA 3THYA 1WB9A 1RFQA 3EKSA 3VB2A 4KUIA 1AKHA 2FBVA 2AQEA 2BXYA 2YI1A 2M0CA 4HCZA 5M1KA 4A4GA 3W6KB 5GADJ 2DXTA 3BQYA 1AWXA 4PKCC 2E1NA 1OFCX 4JJBA 3JAMZ 2HPIA 1AHJB 3M7GA 1WHMA 3VS7A 2LT4A 3CCSA 4FJ8A 5HDKA 1O1WA 3EG3A 3HHGA 3JCMf 2JW4A 3I71A 3R60A 2CUEA 2B86A 2EPDA 4OFEA 3FLCO 4N56A 1U0JA 3ZQ7A 3THXB 4BC5A 4ME7A 1HLVA 3VUBA 2E88A 5IOZA 2E2PA 1QHHD 4CEEA 4LSNA 3J81Z 3QEWA 1S6PA 1EFNA 3CQXA 2VKVA 3M1CA 2YT6A 2KP6A 4BWJA 3VQ6A 3N05A 5I11A 1W2BM 2JHJA 5EG0B 5TKWA 3ZX3A 1WH5A 3MP8A 3PX0A 1RBRA 1IN4A 2DA3A 2A1SA 4NB4A 2QF7A 1Q18A 4OPJA 2EA2A 4JQFA 2L02A 2MFZA 3HRSA 3FXOA 5KHDA 2IOCA 3BDDA 2ZM6K 4DQSA 5GAN3 5M9OA 2NUTA 3UA6A 3WNHA 3IMXA 1WJAA 2R7ZJ 2L4AA 4B3MK 2CP3A 2VUBA 4B48A 3GFLA 2HYGD 1QKXA 2XG8D 1BI3A 3ZQFA 4DU1A 4CI0C 4C8QE 1G3WA 3IH4A 3G10A 2ETHA 3G6ET 3A5LC 2XV4S 2CV0A 1HJOA 1PHTA 1VSDA 4A4HA 2RB6A 4A3IJ 4FLZA 1SKWA 4F92B 1S6QA 4B9LA 2DODA 1UGPB 3JRGA 1SL2A 4BS9A 2FOKA 3OS5A 3EQLF 1NJZA 3MX5A 3MDQA 1PJRA 2VJJA 2BE2A 1MKMA 2QA4Q 4BRKA 4XRFA 4NZGA 5E20A 4D8KA 5CKBA 1PNJA 1BR4A 4UVBA 2LF7A 2H6BA 4DZPA 1RUWA 3CPFA 1W5TA 3H9GA 4YPHA 4M3ZA 2GF7A 4PLIA 2JZ2A 2YHTA 3K4CA 2K5LA 3SAFA 1WAFA 1UA1A 2E70A 4AYBA 1TWGJ 1AZEA 1NGNA 4HDVA 2IGNA 4HUEA 1HYSA 4FWOA 1HKBA 1IH7A 1UMQA 3A01A 1G5VA 4IFEA 2QDYB 1SAUA 2A5YB 2XPWA 3DRRA 3QXEB 2EZHA 1ON2A 2HBLA 4YEJA 2C0OA 1YIJI 2WACA 5GPCA 3O8VA 5EF6A 4FIBA 3CCSQ 4BQQA 2XGCA 5GAOn 5CHIA 4DSJA 2Q0RA 2E10A 3MWPA 4OB1B 2O31A 1JE8A 1VQKI 3PLAA 3QIOA 3V1QA 4M7AC 1JBMA 2K79A 5KYXA 1HU0A 3BUZB 2Z99A 3O8MA 3MZHA 2K2MA 3FJ5A 4Q5VA 3VA0A 1T2KA 3B6AA 2K9GA 2GXAA 5M5XJ 2CH4A 5J4YA 4C92A 4DR7K 1JJ6C 4M75B 1NK7A 2BY0A 2COBA 3CWAA 1N3AA 3QB0A 2HVSA 3RKQA 5FPDA 4C8QC 5AQIA 1L0OC 3J80O 1C0MA 1RDUA 5DMRA 3UKUA 4PUOA 1ZARA 1RUOA 1D0ZA 5IXFA 2ESHA 2L3RA 4A6EA 1RPWA 3PGGA 2QKLB 3K4NA 4FXDA 4H0VB 2XAFA 3DOLA 3P38A 2DL5A 4CVNE 4MQ3A 1GOAA 5AQNA 2AP1A 2CJJA 1XMOK 2W10A 1B34A 1B72B 1ZBHA 1LW0A 3RZDJ 4YOUA 1JO8A 3EZ5A 2PZ1A 3OOPA 1PUFB 4Y7NJ 1VK0A 1WLPB 3EG0A 2GXBA 3E9PA 2JS0A 4ELUA 4RG8A 3BEXA 5HRSA 2OTLI 4H0XB 1V5EA 2B5JA 3SZTA 1NKBA 3OA6A 4IOAL 3TSUA 2LQWA 4OGCA 5KPTA 3OMCA 2P9PA 4IG3A 3OYDA 1X9MA 4UVCA 1GLEG 1ETQA 4ZDLA 3GTKJ 2BZYA 3CCLA 1VQNI 1K79A 2ZPEB 1OCTC 3O5BA 4HQEA 2P81A 2CH6A 1HX1A 4EHUA 4DBRA 4CJRA 1YI2N 3N4QA 5I21A 2J06A 3BF3A 1TWAJ 4MTEA 1K4SA 3LDSA 1C6VX 5CYMA 2EIKH 1FLIA 1YNZA 3AVAA 2NOJB 4QT7A 1S1NA 4C5HA 1H9GA 1VQ9I 4N9HA 2VT3A 1EX4A 2UUZA 2W25A 2XIGA 4XRSG 4PIIA 2QWMA 5IYDJ 4M7AE 2LY9A 4GDFA 1YS6A 4EAHD 2PFUA 2WUSA 2QEXI 1MWKA 4XK8E 3NE6A 1X1AA 5M1NA 1WHJA 1WN7A 4IX7A 2XIDA 1V5GA 3S6IA 1HQUA 4Y0WA 1ZLKA 2YR2A 4H5TA 4CFCA 1Q7YU 1HKGA 3ATVA 2HKQB 4MO7A 2PYLA 1BOBA 5CVIA 1J09A 2EKHA 2E35A 1KHCA 2E7WA 5K7ZA 2X4XA 2XI9A 3FM5A 2CW7A 3ATUA 1P59A 4DQIA 3RQIA 1UHWA 1RDCA 4B9UA 3MKWB 2KFNA 4ITVA 3GDQA 2YDLA 3MD2A 2XO7A 2C0IA 1TP4A 5KRTA 4BE0A 1LWEA 4FYDA 1HXDA 4LLNA 2O8XA 3V7SA 4YHHK 2WB1A 2QXFA 1OH8A 2UYTA 2W82A 3OIQA 2CREA 4LNPA 3CJQB 3UNGC 5F0FA 1RGIA 5DYMA 1PUEE 4YTLA 2MD0A 4IFVA 1F36A 3JCMV 1E2XA 4M6YA 4PLLA 1XHXA 2QUFA 2K6DA 3HTVA 4RBOA 1VQMN 4F04B 3PUBA 2YU9J 2ZGYA 4JI0K 1MMNA 5DCMB 1IV6A 2YHAA 4FJKA 5ADXA 2RQRA 2K27A 2LRDA 2D0CA 1WWXA 1ENHA 3LALA 4RW4A 3EUHC 1FW6A 2D5VA 3O9UA 4M77G 3AV9A 1ILYA 5EU7A 3WE2A 2AA4A 3TCJA 4CFAA 1UFMA 1N78A 3G6EQ 1YJNN 2O03A 4M7AG 1JKHA 2EYYA 3LDOA 1UJYA 2VYTA 4BUPA 1WHGA 5LJ5d 2FOWA 1KD1C 3HSBA 3OBYA 4JLHA 3LANA 4M72A 4HLXA 4FJLA 1NGHA 4KFCA 2BEOA 2I7PA 1HA8A 2EAYA 3TW7A 3ASKA 1O3SA 2RQPA 3U6FA 2LNHB 1Z25A 3FLGA 1BI4A 2VBZA 3KPHA 1QGPA 4HW0A 5E3LA 1MW7A 4BKXA 4EEFG 2NOFA 2XF7A 1JEGA 4C8MA 3D7SB 3CQTA 1X3UA 4XORA 1RR8C 5F1RA 2ZZDA 2XSDC 4LOCA 5IP7J 3TGNA 4DNCA 3AO4A 3CERA 1C1CA 4HCBA 4HNTA 3P9IA 1Q9XA 3QERA 2JMCA 1I81A 2E4LA 3LZJA 3S9HA 1FJGK 1N34K 2HZDA 2EBPA 4MGRA 4AFSC 1PUFA 2RHZA 4TV7A 3SDGA 1PCXA 2RK2A 1TL3A 9ATCB 3SK3A 4EA4A 5GAHJ 3A2FA 4CGIA 1A35A 2QEXT 4ISFA 1RC9A 4KHYA 4BD3A 4M3TA 4D7MA 3FZVA 1WSHA 3O6BB 1C6VA 3VW4A 1AA7A 5A0DA 1VNDA 2HHHK 2VWKA 4YIIA 2LJ0A 4E7KA 4UY8O 1FTTA 4YOXA 2DPNA 1T6SA 1K61A 3JR9A 3KP4A 2Y1IA 1M90R 1LVKA 3A1PA 1IBMK 3KK1A 3DI6A 1VQLT 4HYEA 3IQLA 5KH6A 4K43A 2ZNZA 4LF9K 4F52A 3W2AA 2LYCA 1CLQA 2CWEA 1HNZK 1RT5A 3GP8A 1I3QJ 4FT8A 1AWOA 4BRIA 1TV6A 4XU1A 3WNGA 4W1UA 4R1HA 2O7OA 1HUXA 3MMYB 1VF9A 4BRAA 3RIRA 1YJWN 4RUGA 4ILJA 3ZQGA 3VQ8A 5FKLA 1ATSA 1R00A 4CJWA 2P4TA 2CGLA 3CXCM 2CV2A 4KA4A 1BKBA 1YBYA 3QBYA 3O80A 2BW3A 1K0XA 4M9SA 3OYMA 4NB5A 4KN4X 5AQWA 1M3CA 1YCSB 4ILGB 4AT1B 2DZCA 1C0UA 2D5RA 2H1LA 1VQOI 1FYLA 2KVQG 3DKMA 4I7FA 4B1XB 1MSFC 1KQJA 1DT9A 4KAZA 3C6HA 2XAUA 4WCIA 3TP3A 1X1CA 4XKWA 1T0FA 3SAGA 3QDKA 4M3YA 1SVMA 3OW2P 1D1BA 3QKJA 3CCJQ 5F27A 3KLNA 2CU7A 4FCYA 5J1RA 1X1DA 1N33K 1W70A 3CBOA 2XUBA 1Z7LA 1J9IA 3DLBA 1JJ8C 5SZTA 2DT7B 1OYWA 4AHSA 1W1WE 4DYCA 4Z89A 4CZHA 4W5TA 4AMCA 2GM4A 4MFBA 4XMYA 4Y33A 3G6EI 5E8GA 1ASWA 4A5AA 1YJNI 1ETYA 4HSTA 1ZR4A 4KI4A 1SD6A 4XTUA 3CJNA 3SXYA 2KGTA 1GLFO 5GAN8 3BW1A 1T05A 3TTCA 3KZYA 1QWFA 2XDVA 1IXRC 4JUVA 4EZ9A 1HK9A 1QZ6A 4AM7A 3WTYC 2NRTA 3EUAA 3JTGA 2V1XA 4J9FA 3Q7BA 1WQWA 4JYAK 1G8XA 4C9YA 1HCRA 2P0PA 4JZ3A 1ATNA 3HT3A 1NPRA 5CE3A 3WTXC 2VE9A 5H2FC 1R59O 4Z0UA 3H3ZA 3SBTA 3IC7A 2HKOA 3V9UA 1TH7A 4BE2A 2YHYA 4CYCB 1W36D 5KNLA 1RDWX 1ZQ1A 3BG5A 4GRIA 4WQ5C 2MAMA 2ZGZA 5IXBA 2ME6A 3C65A 2JLEA 1UUEA 1D4XA 1QVUA 1LWWA 2WAQN 4KRTA 2K85A 1QQCA 1SHGA 4A0ZA 1E17A 3MX2A 2QWQA 1TYQB 1M1KC 1W7PB 3OYJA 1KQ8A 1WVRA 1R4MB 2BTTA 3BE3A 2VI6A 5JHFA 5IYBJ 1YG2A 3C6AA 5GTHC 2R0QC 2KLAA 3L9FA 4M7DA 2P9UA 3KYCB 2A6AA 2VQHA 2MSYA 4IO9F 3NF8A 4DTOA 1Y8RB 3LCNA 3PNVA 5HLGA 4JJCA 3C7NA 2WAFA 3FX3A 2KDOA 2KHMA 3OL3A 1EA3A 1IRGA 2GQIA 5JS2A 1QE1A 3AO3A 4KGXB 3K10A 5GAMj 1KU2A 1SD5A 2LTPA 2Y30A 1XMXA 4PKGA 3CCEA 1WI9A 3H45C 4Y1DA 4C23A 2BDPA 3FKJA 1HQCA 4XOTA 1DGWY 2YUNA 4UOBA 5FPEA 5IPAA 3G4SI 3JAMO 2NNWA 1LWFA 3BR3A 3TAFA 4U0VA 1Y96A 2RQVA 4C8NA 2OPQA 1UE9A 1ACMB 1RDAA 5E84A 3O6WA 2LFBA 1KGSA 2KRNA 1YHQN 1FP2A 2Y0SN 4BRGA 1Q81O 4WYBA 2R3SA 1HDDC 4CH7A 4A3LJ 2QTDA 1XNRK 3L0QA 3BF1A 4XR6A 2GA2A 4ZHRA 3OS2A 4YOQA 1R1UA 2KSSA 4A0XA 3DPUA 2M8GX 4RS8A 3NGYA 5GANh 1TKZA 3V8JA 2P7CB 3CCEI 2W85A 3F6OA 5TGTA 1NHAA 3MEEA 3CPWS 4P5OA 4ILHA 5KCMA 4ZYGA 3DMJA 2CUBA 2VOPA 1YVNA 1KLNA 2EYWA 1O9SA 1R6RA 3JCMd 2QTVA 1M5Q1 3CCUQ 4GO1A 2JTVA 3LSTA 2EQMA 5L3DA 3LSPA 3D2EA 4GLMA 5KK1A 4E0DA 1NG2A 2DE0X 1LFUP 1P7IA 4CYDA 3CCUN 3T8RA 1S72T 3K57A 3ERED 2ATQA 1WRJA 3RSEA 3MEDA 2RJCA 4WWCA 1YIJT 3PIOF 1BA0A 3E9FA 5AFUH 5E8IA 1BCMA 1EWRA 5D3GA 4X0GA 1E0EA 4KRFA 4CUGA 1U5SA 4M77B 3ZMTA 5DDGA 3PIOA 3L3VA 4FOIA 2AS5F 4AIKA 2K4JA 3G71I 1MDMB 4ZTJA 3CCQA 2R5AA 2MIOA 2IIRA 3MN6A 3L4IA 1NYGA 3CFPA 1UG2A 3KLOA 3AFHA 2DL4A 2F5KA 1L3VA 5CLSA 4B3SK 4IEEA 3QESA 2P0QA 3QIPA 4OMOA 4CF0A 1WSIA 4FZXC 3ZQIA 3TO6A 2I2LA 5FU6C 4Z4EA 3DKYA 1FSHA 1PU7A 4B1ZA 3G6EN 1KYWA 3M9AA 3QSUA 3A03A 3TEDA 4MO4A 3BG7A 2XAJA 4EV0A 2DT5A 5BQTA 1Q81C 1W9HA 5K14A 2IGIA 3MXMA 2ITMA 3H1QA 1Z67A 3DRSA 3QBXA 2KIQA 4EM2A 3LAPA 3ZSWA 5FLXZ 4DLEA 1M8MA 3A98A 3X26B 4M42A 1R4NB 4TVRA 3U9GA 1SRLA 4JI3K 3E5XA 3S3OA 1W36C 2L9VA 4E6RA 1ZBFA 4BRNA 1TK5A 1ULYA 1S3JA 1W7AA 1WJEA 5LMNK 3S3MA 2D4WA 1B7TA 4PJNA 2EB7A 1YUWA 1FOWA 4M3BA 1MJAA 3RUXA 5K5RA 1GFCA 1KZHA 3PFSA 3NVMA 5FKKA 5DY9A 1X1BA 4DUZK 1D9DA 3LNQA 5EVZA 1KCFA 4PGGA 4IHVA 3ESWB 3UWNA 2JHNA 2NOIA 1TLHB 1YTAA 4II1A 1VQ5A 2O8DB 1FNNA 4N4IA 4CZCA 3URGA 3C1DA 1RAHB 1Q95G 2OTLN 3HO1A 3SV4A 5LMUK 5AQLA 1WNSA 2O61A 3CF5F 3QPTA 1BQNA 2V4JC 1KAZA 4RG2A 2NVTJ 3GBQA 2DI3A 3AAFA 1MBEA 4LK0F 1MUNA 1Z6RA 3U9ZA 1WSGA 2XY6A 4BL0B 4RLFA 2RAEA 2HQNA 2HXOA 2L89A 1NG7A 1IUFA 5AQHA 2XROA 4OF1A 4JJNK 1UGRB 2GX9A 3CCEQ 4IUQA 2YJFA 4A0YA 4MTDA 4U87A 1VQ9A 3FXLA 3TMOA 1RTHA 5EEAA 4XRMA 1BW5A 1OCZH 1P7JA 2XRNA 1K76A 3SWNC 3FXMA 2HDWA 1P8ZA 5EG2A 1G3YA 3VQ9A 3LH5A 3EL2A 1R0AA 4AIDA 3BDLA 1K1ZA 4E9GA 4XKVA 3T0YA 3PX6A 5K5OA 2E64A 1JJ2M 3VYRB 4BH9A 4A12A 1I94K 1ZBSA 1T0HA 3G71Q 2KFDA 3ABTA 2FBYA 1XTDA 3GTLJ 4NOYA 4C1NI 2CZ6B 3LL3A 5D6XA 5E3OA 1UHFA 3WTSC 5HS8A 3G4SQ 3DPTA 1ZSZB 4RDUA 1AWCA 1MBFA 1G59A 1TOVA 3L00A 4M75C 3CMEQ 4H5VA 4CJ4A 4B8CA 4OPAA 1HW1A 4LD6A 4M41A 4RGUA 1NBEB 1YI2Q 1P2FA 4RB0A 5DUKA 3J7AY 3I5UA 4ICLA 1GRIA 3ZSRA 3MP6A 2RQTA 4W5RA 3L2RA 1BJAA 2P9IA 1E4FT 4IPAA 4O3MA 4DV7K 1NGJA 3GIBA 1BC8C 2P0WA 3HOVJ 2VCPA 4XTVA 5EEGA 2K4BA 3THKA 3ZMDA 3H5AA 3FMRA 4M7DC 1JGSA 3ZETA 3A8GB 2P5VA 3L8BA 2DMQA 3IH3A 3KP3A 3I56T 5F0HA 4M3EA 3A2KA 4ANJA 3N4PA 1Q7YO 3EGDA 3VYHB 4IXAA 1MUDA 5GJVB 5LJ5e 1MU2A 2ZPIB 1TTYA 2O4XB 4HHTA 1FN7A 1W1FA 1M3BA 2O01E 2MF2A 2Y90A 2VJ4A 3GZ6A 4BWMA 2WAQA 1I1GA 2NYXA 1V1CA 4CD1A 2SEMA 4CK1A 4KMFA 1ATRA 3G6EA 3RR7A 2Z1DA 3FHFA 3CCVT 2LD5A 5J39A 3SQ1A 5I2MA 3TAEA 2W57A 3D7EO 2OCCH 5HVQC 4I9LA 1WXBA 2OPTA 1NKCA 4LUEA 3HOZJ 2ZO4A 2HYJA 3KZBA 4EJTA 5CR4A 1UJ0A 4CF1A 2OZSA 1Z9ZA 5LJ3g 1N8RU 1Y8QB 5J40A 1OULA 1ZQ3P 2K3XA 2R5YA 3FHNA 3W3DA 1U5TC 4AI4A 3D2FB 1WAJA 2LBFA 1G15A 4KH0B 1YFHA 2DD5A 1VIFA 5F08A 4J6WA 3TSQA 4A4KA 5BPNA 2RD1A 2GUPA 1Z91A 1X2QA 2GTJA 3R8EA 4AWXB 1ZTRA 4P5NA 1O75A 1E7OA 2KR3A 2RHKA 4Z4GA 2OJ2A 2DYRH 4M78E 2H3EB 2YV0X 3S3NA 1NE8A 4BBRJ 4XRSA 4P9UA 4BREA 1DKGD 1WI7A 4AUXA 2IRFG 1JLBA 4M75E 3NHNA 2VODA 3KNTA 2VBYA 2Y31A 1IKYA 4JLIA 3CQZJ 3QRFF 2KW4A 4AQYK 1A5JA 4YG2F 3VERA 2JM8A 3ZMUA 4FM2A 3L4QA 5BNGA 1OCPA 1VQ4Q 2HQHA 4RB2C 1HKQA 3H3OB 2F5CA 2EV6A 2DFFA 1ZBJA 3LOCA 2R7XA 3CP2A 4FWQA 5DM6L 3A0HC 2FSWA 1RTJA 1F1ZA 5GAOl 1UTIA 1KQ9A 4UVAA 5AQOA 4FWSA 3UR3C 3CCRA 2DA9A 3WEEB 4J19A 5DTDA 1EF4A 1YAGA 4OKJA 3UKRB 5AIQA 4F2SA 1E3MA 1S1UA 2M7BA 3RKXA 4XN3A 1I1SA 3I55Q 1PYVA 4O6JA 3WTWC 5IN1A 3HHHA 4FLYA 1S1XA 3LDLA 4XNFA 2LP5A 2OTJA 3M0TA 3WU1B 1YXQA 1O3TA 1SD7A 4J00A 2XICA 1U9NA 2E36A 3JCMb 1XOVA 2HNDA 3BPXA 3NQOA 1ZREA 5LJ5h 4Y52J 1USTA 2CGHA 2ASOA 1ZK8A 4YIRX 4IHSA 2H27A 3E01A 3D2EB 2ID3A 3DTKA 1LAVA 1JUSA 2IPOB 5AQZA 3UKUB 4JD2B 3NH2A 3GTQJ 3O3GA 1B9DA 4ZYDA 1E3PA 1RI9A 3CCQQ 2EFNA 3BTCA 4H5WA 3EH1A 4M78C 3C7JA 5KYWA 1J2XA 2IAJA 4A2AA 4OIQF 5J3LA 4Z8AA 4QS7A 3A0IX 2HHVA 3GX4X 1S1WA 2QA4N 3QHSA 1VQKQ 1ETOA 2VXZA 1V4TA 1RL2A 3BPVA 5DPKA 3BP8A 4JRIA 1I5OB 4ISEA 2HGCA 2HL5C 1JB0E 5J47A 2XRLA 3FZLA 3FRNA 3HZ6A 4BE1A 1WHKA 5B3SH 3M8PA 3S16J 1OU9A 3UE5A 1QHGA 1TAQA 3DLEA 1X3MA 4GYIA 2E1CA 2VC0A 2DXBA 2W0ZA 3CBPA 3TDZC 1H88C 5AQVA 1SKRA 1MMSA 4KHPK 3PMIA 1KG4A 2HYFA 4M75F 4FYWB 2AZVA 3X25B 3EPZA 4EMGA 4A53A 4S05A 2ZMEA 4L9TA 3E3VA 4MDXA 2OTJT 1MGTA 1QVTA 3C2GA 1SS6A 4XLFA 2CDTA 5FKNA 4NC8A 2B6AA 4X62K 1ESVA 2E6LA 1ZRCA 1L5UA 1O13A 1T03A 2YHWA 5E17F 4WQ5A 1T56A 5BRDA 1VQ6I 5I2SA 2BOLA 4RAGA 1SQKA 1QHTA 3I9V2 2F5DA 2DFHA 4DQ2A 4U67L 2X4JA 1RTIA 3ZSZA 2X9HA 5EYRA 4BHPA 2HKXA 4KI6A 5FROA 3ELKA 1WFXA 1KC8C 2YKMA 4DV4K 1WHHA 1Z6TA 4N0AA 1YJ9T 2MH2A 3CVTA 4YFUA 2LC2A 8ATCB 2CH0A 3H0DA 3HM5A 3D4VA 1IDZA 4XLHA 3CCLN 4JAXA 2QWOA 3DB3A 4PNOA 1NZ9A 4IFYA 5IAYA 3WVEB 3QETA 1EETA 4JLGA 3O4NA 1X58A 2KI7A 3FDRA 2KZZA 2HEQA 3A5ZB 2M9UA 1IG8A 1A31A 2L3SA 2AJQA 3JCMe 4DS4A 4BU2A 2J5PA 1DUXC 4HPQA 2GQQA 1LNWA 3FBIB 1U04A 4WXCA 4Q4ZF 3JRBA 1YITT 1KK7A 5AZJB 4CEFA 3AVMA 1ZBLA 3KKSA 4J8OA 1NJIR 3D1NI 1U8RA 3EKUA 5CZ1A 4RTTA 1YHQI 2DT6A 1HRHA 2HQ5A 2EFQA 1XQOA 3OYFA 3I55T 3J7AO 3SUOA 1CZ9A 3AG2H 2A6HF 1N3CA 3F9MA 3MEUA 3A5MC 4CRIA 3LL7A 5HRRA 3I55I 1WXUA 2ECBA 2O4IA 3KKRA 4G7OF 1BIUA 2FBXA 4CCJA 2HNHA 4H4OA 4WQ4C 4E7JA 1HD3A 1MSEC 1U4BA 1RT6A 2Z16A 4CC7A 3DP7A 4DUYK 3IKVA 1MWMA 3FM3A 3TARA 4HXJA 1M90O 4DEYA 3FZHA 3CMEN 2JTMA 2HOTA 2JSCA 4DV1K 2AHJB 3PQKA 4JKCA 1Y56A 4X9CA 2QQAA 2FXUA 2WTEA 3DLKA 2QGFB 4K11A 3K1NA 5CK9A 2EKOA 3I56A 5AQFA 3I35A 3KCCA 1NGCA 2DOAA 4O5VA 3CC2A 4LITA 1B4AA 3IAS2 4EVVA 1BI4B 4F16A 3ID6A 3IUOA 4CZJA 4HDUA 2A0FB 3O08A 5GAGJ 1UGVA 3OSVA 3CIPA 2E1MC 3FZKA 4LDXA 3WQUA 3ZPLA 1Y0UA 1LKXA 1TWCJ 3G1LA 5LJ3e 4KUMA 5FRMA 1G2BA 1M3QA 5GAOr 3DOKA 2HEOA 4XKCA 1T38A 1MUZA 2YX4A 5CVJA 1LE8A 2NOEA 3V6DA 3KLFA 3KHYA 2NUZA 4M73A 1B9MA 3CCRT 1C0TA 2Z3YA 5SWMA 4OX9K 4WK8F 2VL8A 4YORA 4P1WA 3L1PA 4LDYA 4PFZA 1UHSA 3MEAA 2E8AA 3P9CA 3OSGA 2XHKA 4IZZA 2WOMA 1JU5C 4XLEA 5GAMd 2Q31A 3QDFA 4KB0A 4QPOA 3S1RJ 1OZ2A 1TQIA 1WYXA 4AHTA 3HP9A 3CMAA 3KK7A 1POGA 4EFHA 5TJJA 3HOTA 4RGRA 2E2NA 1VSLA 4NQWA 4HUGA 3VEZA 2X3XD 1GXIE 1O4XA 3QWXX 3NF6A 1VQ6N 1MH4A 2KRFA 2LQNA 2P6SA 2ZF5O 3LSGA 2A5XA 2LY2A 3CESA 2BZ8A 5AFUA 3REBB 3ECHA 4E7HA 1VQ6Q 1LWVA 1MBGA 1VRLA 2RHUA 3ZSVA 3CXCS 4JK8A 5GAHP 3H35A 3T1AA 3K4KA 1MHNA 1QSYA 3PNWC 1P4AA 4AHUA 1RT2A 5KGWA 1TQMA 3SQ2A 2MYSA 5LL6Z 1K9AA 2DKGA 5AQXA 4O4GA 1R36A 2ED1A 2J05A 2JWLA 1XNIA 1OYIA 3UKGA 3AARA 3GNGA 4WF2A 5KRSA 3DJCA 2KYMA 1MV0B 1AOJA 2EA4A 4KPYA 4M77E 3DB4A 1YI2I 1LFBA 2HZTA 2OQGA 4N4NB 2O6GE 4LB6B 2LVMA 4EGZA 3FXUA 3V4IA 1ZX6A 4N5SA 4X65K 3QEXA 1MBKA 4JN4A 5FKOA 4BJTA 3HBLA 2H8RA 3PFYA 5JR3A 2GELA 1E4GT 4UV9A 1OQYA 4ESJA 5HRPA 4PY5A 5B1BH 2ELJA 4M6VA 4B22A 1NGBA 4DV0K 2JWKA 4HA8A 2EJ9A 1HDPA 2E3HA 5J3BA 5GAGP 2AXTC 5A2QZ 1HPZA 1I3AA 2IS3A 4KJZA 1JLEA 3OW2A 3M53A 4O8KA 3C2HA 1TUCA 1Q82U 1NJWA 4CZGA 4OIRF 2EIFA 2WB1N 1JJ2P 1N8RR 3LAJA 2BY1A 1K73U 4Y1CA 5FWCA 1OU8A 3M3ZA 1USSA 4EJWA 2OAWA 2JZYA 2OA4A 2RN2A 2UXBK 4BUGA 2E1YA 4KIBA 4KICA 3CUQB 3TO7A 1WJCA 1Q81R 4CEQA 3DKXA 2NZTA 1YHQQ 3OYBA 1X69A 4FJ9A 5F64A 3RI4A 2HMPA 3SJMA 4CYCA 3I56I 3U9DA 2SRCA 4CBUA 3GFIA 3QPSA 4KO0A 3ZYYX 1MJ9A 3DFGA 4EJUA 4M7AF 2QQ9A 1DQUA 1OJLA 5BOXA 1VYTA 1YQAA 4RTVA 4ELYC 4BXUA 1X01A 2UZKA 4DBQA 4YFKF 1GOBA 2VBWA 2K2VA 1VQKA 1TU0B 4XEIA 4ZN1A 4BB7A 1YJ9I 3AVJA 2V1RA 2KQWA 1IGQA 1NK6A 2AXLA 2GNCA 1ZH5A 4S0HB 2DIQA 2DBBA 3CW7A 1WQ2A 5BN8A 1PRLC 4MLEA 1UZCA 4DTPA 1U49A 4QW2A 3QOPA 4OU0A 4CGJA 4FSSA 3G71T 4AC0A 3GNFB 4JK9A 4A5NA 3TQNA 1E6HA 4M7DE 3RPUA 2H56A 1VQKN 2BHYA 5BRHA 3NF7A 1RETA 4Z94A 1QZZA 2ZJQF 4L9NA 5FLMJ 5KYUA 2XVCA 1IRFA 1QU3A 3EFSA 1FBUA 3GMEA 2R93J 4ZDPA 1WXTA 5HBMA 4BGAA 5EGOB 2E6MA 4B3AA 3L2CA 1LCUA 4FLXA 2O8DA 1WKMA 2QG9B 5DUIA 2CUZA 1BK2A 1W0UA 4IRIA 4AYBN 3PSIA 2DX1A 3KEQA 4CGFA 4CJLA 3J7YP 4HCKA 2JPCA 4UC4A 4E70A 3R9PA 3O9TA 3QNNA 2MLGA 1E3HA 1K78A 3G0QA 2VYPA 1LFPA 2RE2A 2KKOA 3IKTA 4BJ6C 4XK4A 2KT1A 3ZBDA 4PL6A 3IRRA 3W2WA 5AYFA 3M4OJ 4F7UA 4L0ZB 1RACB 1UCRA 5IYCJ 4LJZF 2M30A 1LEAA 2BV6A 4BHCA 4E89A 1DEJA 2KIMA 4ON0A 3AO1A 4IZ9A 4XH4A 5H1SQ 2EILH 2QQRA 3KK2A 3BZCA 2QSGX 2QWNA 4PKIA 3EG9A 2XRIA 3BY5A 1EXQA 2CS7A 4HEA2 3S1QJ 1K73C 4RM2A 2BVMA 4F7UG 2HOEA 4Z2YA 3VQAA 3UDCA 5BN9A 2PBDA 3QEPA 3DPLC 2QGGA 1U2WA 4H8KA 3QJYA 3CCMA 3AY9A 3H3NO 2B4JA 1PRMC 1PG5B 2A69F 1ASVA 4XQ3A 5IY5H 2DEUA 4EP5A 5J2MA 1GBRA 5TRDA 2Z0WA 4YELA 4HCCA 2M1HA 2R5MA 2OCEA 4MO5A 2CP5A 1HKCA 3S2DJ 3SPZA 2DN0A 2IA0A 4A3JJ 1MH3A 3AKZA 4UNOA 1IJJA 2X78A 3LA3A 2V1DA 2O4XA 4ESBA 1ZBXA 1GOCA 1ETWA 3HRTA 1SSFA 2ETJA 5AQPA 3OYAA 3VEPA 4R79A 3QYBA 4JI2K 5GIOA 3ABKH 2YUPA 2L2OA 4YNQA 2IS2A 3H8ZA 2EV0A 4FM0A 5ILSA 2V79A 1TKTA 2L2PA 2NVXJ 4RW9A 1I27A 3AVKA 3HP6A 3BY7A 3PNYA 1ORKA 5C0MA 3UF4A 4A59A 3CYMA 3P83D 5H6RA 3TDUC 5M5YJ 3EGDB 1IJWC 2G8KA 3T1YK 4DSFA 2WY7Q 1S1VA 4H5NA 3GCMA 1W2BS 2XKPA 4BQAA 4J83A 4G6QA 2BBYA 1XSDA 1D5YA 4JV5K 1VSEA 3EH2A 3KP5A 1MMDA 2E6ZA 3TP0A 3GF2A 5IP9J 1RESA 5CQEA 3CMAN 1X1PA 4BQOA 1HR0K 2M45A 4OKEA 2RNGA 2V9KA 4HV5A 4B9MA 3S1NJ 2BANA 3N4MA 2JOYA 5CKTA 2QTXA 3FHGA 4OB2B 4CCOA 3ID8A 3IRXA 1Q9YA 1VTNC 8AT1B 4H0YB 1HLUA 4A3EJ 4CIEA 2PVGB 2FVUA 2NYSA 5ICEA 3L2QA 4RMNA 2GEMA 3NNQA 1FOXA 4IHTA 2YRCA 2JUGA 3RKWA 2Q2EA 4DYQA 4F7UE 1R7JA 4IIMA 1BR1A 3X28B 2WC2A 1WPKA 2WWYA 5LJ3h 5C44J 2HXIA 4LIVA 4EA5A 5AQGA 2JK3A 2XHIA 4F17A 4N0AC 4ZNXA 4EPCA 4EMKA 3OIPA 3CCVI 4F55A 2ZPGB 4M7DD 5FDLA 3IH7A 3NFCA 2HFHA 1V76A 3CC7Q 2ZKZA 1SL0A 2XY5A 3ZSXA 4BVOA 3OMYA 1A36A 3M5AA 4AI5A 4MLHA 1EP4A 3A8LB 1KAXA 1KQSM 2DTRA 3KE2A 1HC8A 4LMYA 1NMDA 3WTTC 4DYRA 1DU0A 1PP8F 2VUMJ 3R0JA 1YX5A 2I8DA 5LHIA 2NVUB 2GXGA 3HTSB 3LW5E 2EYZA 2DIGA 1JL2A 2A42A 4QKUA 4PJOD 2VPRA 3ZT4A 4C0ZA 3MN5A 3GO5A 2X6NA 2EFWA 2PMHA 3V7CA 3CO7C 1APLC 1BB9A 4CHYA 3JCMQ 1IG9A 2KQRA 3VGKA 3KLIA 4ZZDA 3OYYA 4OMYA 2WA0A 3JTHA 5J1EA 4MZTA 5EZHA 4KTWA 2OC6A 2E5LK 3CCJI 2Z9OA 2GWKA 2JNGA 3M0PA 2A3ZA 4M6XA 2OFKA 2DTZA 5GAN5 2ZXWH 3CDLA 4MFEA 1OR7C 5HS9A 4CF9A 4EJYA 5D6EA 4B44A 4WQ4A 5FKMA 1KO9A 4BI3A 4AFUC 1AWJA 1Y1WJ 4W97A 3FKIJ 1UHMA 2DA7A 2RH2A 2UU9K 1JLCA 3DXJF 2COYA 4EZ6A 3BZ6A 4BRDA 4QVDA 2JA8J 5LRRA 1M2VB 3A8OB 2DCEA 2HQRA 1IHWA 4A69C 4DEXA 2QVOA 4BHBA 3P4IA 3CVSA 4K8ZA 4RB1A 5CQYA 2RPNA 1RABB 3VS6A 2MLKA 3ZT2A 1T0FC 1AU7A 4C3JJ 2KHOA 4X1VA 1RT7A 1WUAA 1W7PA 5DLOA 4DTMA 4E6KG 2WSFE 2Q1NA 4IDKA 1XHZA 3D2FA 2PLYA 3LM2A 2HL3A 3LA7A 1LJOA 1RT3A 1IV8A 3VQ5A 4LFCK 2A61A 3CPWM 3SJHA 4EJZA 4CDGA 3FHZA 4M7AA 4ETSA 2LQKA 2LX7A 4B23A 3V8LA 1BQMA 2EINH 2M0YA 1AOYA 4H0OA 4KH5A 4LF5K 3S41A 4DFMA 4N4GA 3CPWA 1F21A 1I07A 1RNHA 1JUPA 5DV5A 3CC7T 2G3RA 2E60A 4HSRA 2EPFA 5KQDA 2O5RA 1FSEA 2EGAA 3VQBA 2DTIA 1ORPA 1Q86O 4ENKA 5DK5A 2CW8A 4F4KA 3CC7I 2CQQA 2XAQA 2ZBKA 2ZMEB 2DETA 4W5NA 1WJFA 3WODF 3DWLA 2HWVA 1BI1A 3TVTA 3J8AA 3HJFA 3LFKA 5GAMe 2VXEA 3HOWJ 5LHHA 2PX9A 3PVLA 1C0GA 2A40A 2V6EA 4CW7B 5M5WJ 2P4WA 3HSTB 3DKWA 2YNFA 5KN8A 3SUQA 3C12A 4Q48A 2VXFA 2ASMA 1QNTA 2RI2A 4HLYA 3DLAA 2GLOA 3JAMK 3OH9A 2EQUA 1IZ1A 3T19A 1RT1A 1XQPA 3FK7A 1IKWA 2HOAA 4RMOA 3WGHA 2VWBA 2R7UA 2MI6A 2ECZA 4EJOA 2HQEA 1BIAA 1QHAA 1ACIA 3F0ZA 4L5JA 1HSJA 2M9HA 2AHQA 4CCHA 1QRYA 3UATA 5KI6A 4RTYA 5BREA 4BY6C 4ZC3A 4YOTA 5LD2C 4FK2A 2X1EA 1U3OA 4XU2A 3CCLI 1E6GA 3H5RA 2R57A 2KJBA 3ZCOA 1KRPA 3ULRB 1WJDA 4R5PA 3CMEA 3K2PA 2K02A 3KETA 2JJ9A 4E1JA 1D0XA 2RA2A 4FJMA 2P4RA 3I33A 3CMAT 2ZE2A 2CGKA 2F9TA 1UAAA 2HNZA 4AF1A 1YITQ 3QYFA 5LJ3f 2CH5A 2DDAA 3S93A 3E0JB 2IVOA 3O2PE 1LOJA 1H92A 4BYYA 5LJVA 2EGEA 2OPSA 1BG3A 2E5QA 4OMFB 2VPLA 5TKYA 1U9OA 5C25A 4PUSA 2MD5A 4PSWA 1GBQA 4DV6K 5KCOA 1M27C 4FW2A 4DR5K 5C3EJ 1LPLA 3FSPA 4ENNA 4CD3A 1I0CA 1RDBA 4H03B 2KAFA 4LXCA 4Y4RA 5KYXB 1BO5O 3SUPA 2QZ8A 5HLHA 1RKTA 2P1JA 4FVMA 3CF2A 4JS4A 2M1BA 3G4SN 5HNFA 3AO2A 3O1WA 3J81E 4M77C 3MEXA 4PDKA 2RKIA 2CP0A 4YOVA 2LDMA 3T1HK 4JX6A 2G7HA 1Q82O 5IHIA 1M1EB 1JCEA 2DMTA 4IUTA 2DMUA 2ME0A 2YWWA 1MIJA 4BQNA 1GDTA 5GANg 1A6QA 2CP6A 3AA4A 5A2QE 4X34A 3LYIA 1FXXA 4B9WA 4M78B 3BOQA 4PGHA 2HBPA 2VKDA 2E1MB 2X85A 2Y75A 1VQ4T 1FIPA 4WX9A 4CCLA 5I3UA 2HOSA 2L3QA 2HBJA 5D5VB 3HGGA 2D1XA 4DCHA 3I0RA 4NQWB 1K4TA 5D7UA 1YIJA 3V7RA 2DK3A 1ZSGA 3HPGA 2VKEA 2JS2A 1Y0NA 5K1YA 4C8KA 3ZCMA 1KQ1A 4FYXB 1A04A 4MDWA 4DMNA 2QKKA 2IA1A 1IV0A 2DERA 2DMOA 4YDUC 1ZKGA 1GV2A 3CCUI 2QWWA 3F9KA 5HOOA 4B4CA 1SFEA 4N47A 3E1SA 3X24B 4GV3A 4GV6A 3HTUA 1IBKK 3I56Q 2LMDA 1VQ7Q 5EEHA 2KNBB 2MOXA 1PVEA 1TW3A 2X1CA 3QDRB 2BHZA 2EYXA 2OZMA 2R58A 1X6OA 3RVCA 4CEBA 3HDDA 1Q7YC 2C6YA 3SQNA 3HVTA 1AEYA 2FEIA 2LOOA 1QQMA 3AVFA 3E19A 2P9SB 5J2PA 2VLAA 4DR1K 3KP6A 4V2SA 2F8TA 2EQIA 3K5LA 4PJOB 1YFNA 1T3SA 2NUPA 3N5BB 4FW1A 4OWRB 2ESWA 3VYGA 1KYZA 1EJ9A 1GFDA 2Q97A 3ZQQA 1H8AC 2MABA 3SAHA 4B6MA 3P8BB 3MEGA 2IIMA 2LX9A 1ZA1B 4C92B 5C12A 1GLBG 2Q1ZB 3ZEHA 4HVJA 2E1OA 1D8KA 3HSRA 4RKUE 1VQ5I 4CC3A 3NMZC 3KLHA 4H0TB 2NS8A 2TCTA 1BBYA 1I6HJ 2HS5A 2IG0A 2RJDA 1K78B 4B1RA 3QJ6A 4HSBA 1S72A 3I5SA 4KIFA 3CD6I 1QMCA 5CKFA 2KQ2A 1BIZA 1ZG5A 1SL1A 2RF2A 2GFAA 2HSTA 1R1TA 2ACJA 3VV0A 5KYYB 2P5GA 1TZLA 3O8HA 4CHZA 4CC2A 1K6YA 1YITI 2LKXA 5F04A 2K5IA 1IN7A 3EE8A 2CT3A 3C6TA 1RBUA 4FLUA 1H3HA 2Z1HA 1W4MA 4J9HA 2QASA 2FBKA 3CF5L 2GIVA 4GFBA 4NYNA 4E9HA 5A0LA 3MKLA 4RW8A 2OA8A 3LP2A 1Q86U 3MEWA 2KY9A 4QPQA 4QLCU 3L2UA 1ETXA 3IH2A 2XGXA 3SPYA 3I3LA 1LDJA 3QOEA 3ZQHA 4XU0A 3OB9A 1K6OA 3CZ6A 3H6EA 2LK2A 2JXBA 4KGVB 3H5NA 2CT4A 2P9PB 1JXEA 2ELKA 5KTQA 3M8EA 1TL1A 4B1WB 3SQ0A 3MWTA 2KISA 2P84A 1JUMA 3M1FA 4BBSJ 3WXLA 2K7AA 4DHYA 2K5FA 4KT0E 3GEZA 3KP7A 3CCLQ 5FB2A 2DK8A 1QPIA 1DJ7B 2F4OB 1SHFA 5F0CA 3LM9A 1OYXA 2QCOA 1OPLA 4MMKA 3ENOA 1SEUA 1GLNA 3JB9D 4PJOC 1WEFA 5IH2A 5IT3A 3FC3A 4BRFA 2HD0A 2OTJN 1GLLO 4CGGA 1TT0A 2DA2A 5DD8A 1NK4A 3ZMVA 3JS6A 3TAMA 3KYLA 4Y91A 4JKFA 1YJNT 1CXUA 3VS5A 1Q1VA 3MWMA 3F3XA 2QYZA 3A02A 1SVOA 2XHCA 1NLOC 3QO9A 2G8VA 4LG0B 3CUOA 3CC2N 3HK2A 2X9DA 2XHBA 4CZZA 4DV2K 3ZR8X 4H4MA 3IAYA 1RAIB 3JCMc 3ZN0A 1HBXG 4DG1A 3RMQA 2M0MA 1YRNB 2QI2A 3EG1A 1SC7A 2B7EA 1KFZA 4LE9A 2LP0A 2VC8A 4M7YA 2F2EA 4BGDA 1NEGA 5GTIC 4BR7A 4CZEA 1SUQA 3O3FA 2PUKB 4CZLA 5AQTA 4CJEA 5C42A 1M1FA 1M1KR 1D09B 1DGKN 1KFSA 3HGYA 3TBIA 3HZJA 5AN4A 3K59A 2PY5A 1QZEA 4B1YB 2O8BB 3OYCA 4BRPA 1DP3A 4MNUA 1EZZB 2KRMA 1YE9A 2WONA 1IW7F 2LMJA 4NL3A 3CCRQ 4XLCA 3PY8A 4M3GA 1LWCA 1CF7A 1B59A 5FFZA 1WJSA 3CC4T 1XNQK 1VQKT 4BY9C 4IL6C 2COWA 3LDNA 2O8EA 5JLHA 2FXAA 1N36K 2FSJA 3VUZA 1U5TA 4CECA 3ZP5A 4A3BJ 1KSWA 4OGEA 5CVVA 1WPYA 2IS4A 3VA3A 3FE1A 4M75G 3SB2A 2E5NA 3H9JA 4BROA 4JI1K 4DSEA 1VQNQ 1JI8A 4KHWA 1VQ4I 1NJIU 5JS1A 1IREB 4FQGA 2E2IJ 3CD6N 2K3BA 4RLQA 1KQSA 5CVRA 2LNVA 2EZIA 4JI8K 1NTCA 1XC9A 1YQLA 4A54A 2QBYB 1A6IA 3TQ7P 3ABMH 3MEVA 4B3OA 3K2ZA 3CCLT 3KTQA 3IWFA 3N0UA 2PEXA 4HF1A 4G7ZF 2X51A 4XKBA 1GLAG 1FZPB 5HCKA 2EQKA 3TWHA 3TO9A 2FJ1A 5D8KB 3H41A 2D0PA 2GAUA 3BROA 3LQRA 2QEXQ 5KYYA 2VKNA 1NPPA 3OR2C 4IO8A 3MZYA 3EHRA 2QM1A 1KVBA 1Y39A 5D5UB 4BR4A 4DQQA 1R0CB 2DJNA 3ERMA 4MFDA 1KU7A 3IAM2 1S1TA 1U3EM 1D3BA 1VQMA 3BT9A 2QK9A 3DBRB 3ONQA 4LH5A 3AAQA 1YITN 1OMIA 1QVGS 2FG0A 2ISYA 2O9SA 3ZOBA 2DAQA 3JCMh 2W7NA 4BY7J 1RLQC 4DTUA 3HOSA 1VSHA 2Y69H 3U8XA 1IKVA 2XKOC 4DW6A 1D9FA 1B72A 1CZAN 1T39A 1VQ6T 3KJVA 3D5SC 1YOVB 4DFJA 3ZLJA 1TK8A 3MECA 1GCQC 3DWLE 2BXZA 4E7ZA 2VXDA 4BC3A 4XOPA 3PNTA 3G0ZA 2MCNA 1BI0A 3FXJA 3OSFA 3CJAA 5KYNA 1PSFA 4CCKA 4Z02A 3F8MA 1VZ0A 3K0SA 3FFIA 4C5EA 4JK7A 5EDNA 5F6FA 3CCQI 2O0YA 1GLJO 2QEXN 3H0FA 5C4XJ 3CUQC 4A6DA 3CM5A 4Q5SF 4L5IA 2VE8A 3PT9A 3VKIA 1Z26A 1VYVA 5GINA 4U7BA 3AVCA 2KRSA 3M4YA 1UWBA 1NGAA 2R7RA 3K9JA 4ENJA 1WZOA 3AAPA 1L3LA 3HL2A 1LEBA 4EQQA 1JXMA 3LWMA 4JYKA 4V19K 4M77F 4XAXB 3QG1A 3RZOJ 3QICA 1BYMA 1U47A 3MKZA 4D9JA 2OTJI 2E19A 2RHIA 1J75A 5HNHA 1VUBA 4JEPA 3J7YJ 1L3SA 1MGQA 2JRTA 3WTUC 5KYUB 1KFDA 3JRCA 3M56A 4EMKB 1M1KO 4HX4A 2X6XA 2LCLA 1PD0A 4B3RK 4J9CA 3PO3J 4M45A 2PMZN 1XX5A 4IOCL 4CEOA 4J5YA 4RTUA 1WSFA 3W6VA 2NRRA 4LFBK 4K0KK 4LC9B 2JN0A 2J6KA 2BZXA 1Q81U 3OA9A 3BWGA 4I6MB 5E3NA 1TTHB 3B02A 2XAGA 3CMAI 5DEQA 4ZYEA 3LP0A 2G9WA 3F8CA 3SV3A 4Z4HA 1ABQA 1U48A 1Z77A 2RV8A 4C3HJ 3OYNA 7AT1B 1XSXA 2V1UA 5L23A 1Z1DA 5CIUA 3I8DA 1WFWA 2IA2A 3T1BA 2V1NA 4A62A 2GIZA 1T95A 2PG4A 2JVHA 3E5UA 3LWIA 1NNEA 1D1AA 4BC4A 3SYZA 3PIPA 4IO9L 4U88A 2KDSA 3GUDA 1GCQA 5C2FA 2Y4XA 4M71A 3KEYA 2IT0A 3SWNB 3C18A 1UELB 5IP6A 2W24A 1VQ9T 2ZJPL 3Q0VA 1QVFA 1G99A 2FNPA 3ROUA 1NLVA 3K9TA 4MLOA 3F0CA 2CZ1B 5J26A 1BUPA 4FK4A 3M9QA 3GXOA 1BJZA 1JT0A 5F1XA 3PO4A 1W6XA 4KT6A 3RMSA 3X2QH 3DXMA 4HNUA 1N8RO 2Y0MA 3MVPA 2WV0A 1VQ5T 2EVRA 1Q82C 1ZBIA 1JL1A 2FLOA 3AVLA 1VQ7A 1N9SA 2DTHA 3RPQA 5K5QA 4ZH4F 3CBMA 4JKEA 4LDUA 4PWDA 2TDXA 3SQ4A 1NGIA 3TL4X 1N6AA 4L8RB 1LQ1A 5DM7L 3IP4B 5HROA 2DO7A 2QAZA 4QTRA 2DL7A 2BGCA 1KSPA 2PVOB 4EIAA 4BRMA 1M2VA 1TYQA 1W5SA 4C92E 5HS7A 2A36A 5M1PA 1JCFA 3LWHA 3UB5A 3SCXA 1Y57A 2AKLA 1D3BB 3JSCA 3BGRA 2COMA 1HF0A 5K7HA 1BA1A 2MH9A 4M78D 5FU7C 3RTRA 2DYIA 3I55A 4AILC 2QXLA 3GW2A 4XH1A 3ZN1A 2R5ZB 3NTHA 4DTNA 4LF6K 4FLWA 2Y9YA 3RPUD 2CH4W 3CC4A 4NCGA 2K7LA 2DEQA 4L9JA 2IVMA 2JQ7A 3DXKA 1S72I 2DY4A 3F8NA 2H8HA 4LLLA 4C0FA 1VQPN 2ZSIB 3P8DA 3F22A 5GJWB 4OIPF 5LJ3j 4M7DG 4PFOA 3HRMA 1J3TA 1LB2A 4IXCA 4IHYA 4FT2A 4ELZC 4OINF 4OB0B 1YYVA 2W42A 5LEJA 4JI7K 4HOBA 4M75D 1NG9A 4B3TK 1O3QA 3VGLA 2RDPA 1UB4A 4BQZA 1Z0XA 5K7FA 5ECAA 3GL1A 4PKHA 4IJNA 1VQ7I 3NH0A 4IEIA 3M55A 2HAXA 2X6WA 1KXPA 3RMCA 3SZGA 4MQ9F 3CXCP 3H3UA 2F5TX 4DV3K 1Y64A 1V5FA 1UJ8A 2ZJQL 3QNOA 1VYUA 3JYTA 5GMKi 1KONA 4CEZA 1NGGA 3ZEUA 3QBWA 2DLPA 2E1ZA 6AT1B 2MC4A 1YHQA 4LG0A 4PJOF 3JB9H 1PP7U 4KHNA 1B9FA 3V81A 1XGOA 3J80E 4M3WA 2Y9ZA 2GOXB 4A63B 2NXNB 1Z3YA 4DU4A 4HRIA 2R7OA 4PJ0C 3WUHA 3CCUA 1RI7A 3HFNA 4B47A 3META 2FMLA 4CEDA 2HVRA 4OMZA 2R7SA 2F96A 4KIGA 5EX5A 1LWYA 2ENMA 1O3RA 4IUVA 1R77A 2HKNA 1M90C 5LJ3d 4C92G 2ADUA 1KQSS 1VSFA 1S29A 1IF1A 2A05A 3OL4A 3X20B 3Q3SA 2XDPA 3ASNH 5CHZA 3HG9A 2D0QB 4I2PA 3CC2Q 4JD2A 2QKMB 5FGMA 2CQ7A 1JHHA 2BE7D 4K2EA 1P4WA 3P1GA 1GXQA 3CC4Q 1QQNA 5A2QO 4DR6K 1BM9A 1D3YA 4CBXA 3KZIC 1RIOH 1NK0A 4Y17A 2HR3A 5AQMA 4ZDOA 3M4GA 1X9JA 2ECCA 2HMAA 2DLLA 1XGSA 4O55A 1DU6A 2ZAEA 3CCVQ 4CF2A 4JKGB 4WTOB 3ZSYA 5GMKe 3E1YA 4XTYA 3R0AA 2XMFA 2EFPA 2HPMA 1R1VA 3FZMA 4D7NA 1NH3A 5JLWA 4M75A 5LL6S 2JA2A 3QMLA 3NBPA 3C2BA 2KRHA 3SMPA 2OYQA 2W1OA 1BA5A 1N6QA 3QIIA 4N4OB 3LX7A 1QVFM 2F5EA 2O8CA 2HSEB 2E2QA 3ASMA 2FEZA 4JP0A 3TKYA 3RQ4A 2JA6J 4Q47A 2KXDA 5AIPA 2FF4A 4AIHA 3FIFA 1VQ7T 3I59A 3NDKA 1YT3A 3IV5A 3L2ZA 1GCPA 3SD4A 2PJRB 2DA1A 2ZQBA 3IRQA 5GADP 4FM1A 3A8HB 1YI2T 3VQCA 3CCSN 4G9ZA 4NHJA 4C30A 1ZHIA 2V26A 4NC7A 4JNEA 4I98B 1TGOA 2GTOA 5H6QA 3H46O 4OOIA 3AG1H 1MNMC 2D1HA 1LCKA 4YY3K 4J01A 3JXUA 1DPUA 3CI5A 2GCXA 3THWA 2J4RA 4X64K 4KBOA 1WSEA 4I99C 4B9VA 1D5AA 3SBGA 2OTLT 4D1QA 1G3TA 3RR6A 3NH1A 3KEOA 1CQTA 3GTGJ 1J53A 3RERA 3LSKA 4FJNA 4KHSA 4J7FA 4QS9A 4GVEA 3UPUA 2DMNA 3T5XA 1VQPI 2J6FA 4UB6C 4YIFA 4FWLA 1YJWI 3SLCA 3U3YA 1VQOA 4PA1A 3AA2A 1HNXK 1B6AA 3RNJA 3CCET 1VRTA 4AVPA 1WBBA 1MMGA 1GXPA 5CVUA 4DLGA 1IN5A 3CTAA 2PVDB 4HVUA 4C2TA 2R5YB 3HKZN 1VQON 1RKWA 1AVZC 1JLQA 5JI6A 2IAIA 3CCST 2XY7A 2FRHA 4DOWA 3NMUA 5D5XB 3AA5X 3WTZA 5FLXK 3LH0A 3QPLA 2XDBA 3CD6T 4FOEA 2DXIA 4GKJK 2P9UB 4DV5K 1DPRA 2DK5A 2CP7A 3KK3A 1UEBA 3FMQA 3GBGA 1GLCG 3JRAA 3E6DA 3RMDA 4FM4B 2F4VK 1YW9A 2EIMH 3JSMA 4R8HA 4NCBA 3WXKA 4OP0A 2HHSA 1FYKA 3WU2C 3NTKA 5EJCA 2B8AA 2IC3A 5F1JA 4CK3A 3MHXA 4LF8K 2O8EB 5J8CA 1ZN2A 1Z9QA 3HPHA 5IHNA 2DBKA 1VQ6A 2ROTA 5J8FA 1OOTA 1UHCA 4A3CJ 4PL8A 2YG9A 4FPAA 3IDHA 3KXTA 3K2AA 3U4LA 2V9VA 4UUSB 1K8AO 4FE4A 3VTHA 2ZSHB 3ULEA 2DA4A 1U6ZA 4CHPA 2KROA 3JB9I 4GXOA 4LUDA 1YWPA 2MK5A 3THYB 1IHVA 1XMAA 1KQ2A 4WF9L 1SV5A 4KFBA 1VA7A 1KG1A 2WBNA 4WFNL 3OS1A 4NNJA 1YIJN 1IUYA 2FBIA 1OCOH 3BJAA 5JVTA 4PQUA 1FIAA 3QPHA 2W40A 2OZ6A 4W5QA 4DU3A 2IXSA 1FKOA 1TS9A 1NLPC 2GGRA 1V55H 1JKPC 1MNEA 4KKOA 2JT4A 3DLRA 4A3FJ 2EQJA 4KH6A 4PL7A 5IWAK 2R7WA 3NVKA 3CDHA 1FOYA 3MAQA 5DD4A 1F43A 2ZPFB 2E2JJ 4JRKA 2IPQX 4ZGJB 1T08B 1YQKA 2YNIA 1IN6A 2OAUA 1Q8IA 1D1CA 1F1BB 2Z2SB 1KVCA 2CQXA 3R2XC 2PJRA 2EWSA 1T0JA 3E7LA 4NDLA 1MV3A 3GFJA 3THVA 3WVDB 1QPMA 3OYIA 2E65A 4DGWB 1ZUUA 2HVIA 3JCMX 2LC4A 1NJYA 5CYQA 4BY6B 2W04A 2FB7A 1XC3A 5E41A 1N25A 5KQ8A 3HOXJ 2MMPA 4E1MA 3QO3A 4C92D 3PUFA 2ZJPF 4OLAA 2V7YA 3OV8A 3R6SA 1TQPA 1I4K1 1K73R 1MMAA 2A6TA 3BR6A 1QQJA 2EH3A 3TU5A 4IHWA 2YCHA 3GOIA 1K8AC 2B0LA 1YIOA 4RTWA 3F8BA 1LAWA 4QS8A 1I8FA 4GKKK 3A4CA 1M8VA 4OPHA 3WXMB 2HHWA 3E2UA 1ON1A 3KYDB 2CO5A 3F70A 4RCHA 3MKDA 2W84A 2WTUA 5E1ZB 3AO5A 3C0CA 1P90A 2LBFB 2D1VA 1HW2A 3F8FA 1YI2A 2GUIA 5HLFA 2V7ZA 4HTLA 5M1FA 4LF7K 2CYZB 3RSNA 4O5FA 2DM1A 5C24A 1KD1R 2LSNA 3HEFA 3I64A 3CLQA 2I7NA 1ZXOA 2P9SA 1V4SA 1JXSA 4I6ZA 4DR4K 2E3IA 2PBIA 1A0NB 2F9WA 4XTZA 1REVA 1U6GA 4EHTA 4J9IA 3MN2A 4M3XA 2ZJ2A 1H3ZA 2ESNA 3VQQA 3ZEUB 3CC7A 1F4KA 2NUPB 4DR2K 1VQOT 1Y07A 1TC3C 5AZIA 1TXQA 2E6NA 3BLYA 1E3OC 1T6CA 3DLMA 3IG1A 4B9QA 1LVAA 4AHCA 1R22A 1W0TA 1UGSB 2WY8Q 1X6BA 2RN7A 1A5VA 4B1UB 3VETA 2JWTA 3LSIA 2ISZA 3FXRA 4Y28E 2DXCA 4M7XA 3GF5A 1ZUYA 5DM6F 1VFCA 4NXNK 4A3KJ 3C6UA 4M3UA 2A3SA 3ABUA 3GTMJ 2A1RA 4A93J 3B73A 4BG8A 2OTJQ 3DV8A 5LJ5g 3D5RC 1CF7B 1MUYA 3HRGA 1K73O 3TREA 2K9NA 1TWFJ 4X6AJ 4YOYA 1ZR2A 3CCYA 2M02A 3BC8A 4M4ZA 2GWRA 4PJOE 3HVRA 3O8GA 3AHUA 3IUCA 3DU6A 3SWNA 4JX4A 1OPKA 3C94A 5L3BA 3JB9F 3INZA 1K9MO 2F4MB 2CUJA 1QW1A 4CFBA 4F3OA 2ZXIA 3ULEB 3T69A 4U7DA 4NUBA 1NM7A 2CFXA 2F5FA 3PJRA 1QVFP 2ATCB 4MZPA 2LRQA 2HCKA 3K70C 1EWQA 1VQ5Q 4S04A 2CW0F 1PDNC 3I4MJ 4N41A 3WTVC 1SFKA 3AT1B 1BHLA 2VG6A 1AT1B 3CWUA 2HDDA 1TVRA 3K9KA 3VWBA 3JSPA 1PSEA 1LW2A 3G71A 2A41A 3CJ1A 1ZSZA 2IS6A 2FL7A 2QW9A 3I53A 4DB3A 3SZ2A 5B1AH 4W5OA 2PQWA 1S8NA 5M1OA 4C2MJ 4ZYHA 2P5LC 4KV8A 1B34B 1I1JA 4F8RA 4IEJA 1KTQA 1JTXA 4OFHA 4L6V5 5GANd 3WQTA 3ULDA 1XC5A 2YHBA 2MWPA 4Q5WA 3HJEA 2RMOA 4XQFA 4C0GA 3RTVA 5FJ8J 2LKPA 1BL3A 3CWTA 1QQOA 2Z5UA 2VG7A 3CCMI 1HYZA 4AG2C 4HWIA 3P31A 2E7XA 1BW6A 1J54A 2CGPA 1YIJQ 3FMSA 4AM3A 1NK5A 2DL3A 2IW5A 4K8XA 1SRMA 1XG7A 3O5ZA 1TNTA 3LSMA 4LGWA 4I01A 5J1YA 1B1BA 3C7NB 4KTZA 1OLTA 4II3A 1ZGWA 3GTOJ 2DTOA 1RRQA 2X35A 1Y0MA 1EKEA 5LBQA 5LEKA 2J6OA 2CRGA 3K6GA 3L7WA 4GY5A 4ID1A 4XICA 2HI3A 5IT9K 3TSPA 4I6MA 2VQLA 3ZQCA 1SD4A 1M9SA 1QKWA 2LNBA 3OR1C 5BPIA 1DLOA 4BR0A 4J6YA 2DQRA 2DMPA 4AG1C 4CHNA 2OBPA 4PJOA 1WJ5A 1S7OA 5E26A 2H3GX 3B6PA 1TT5B 2KT8A 3K69A 3P5JA 3L1AA 1QVFS 3M0RA 1TWHJ 4HZFA 3QQAA 1SFOJ 2P5KA 5HP1A 3N5NX 4EW0A 5ICCA 2XGEA 3K4JA 2DL8A 1X2KA 3C0BA 2WAEA 4CHQA 2L0AA 1JCGA 2BY2A 3AGKA 4M7DF 3EFOB 1U2VB 2BUDA 4XL9A 4A3DJ 1Z3XA 1YJ9A 2DPUA 2KK4A 3TTDA 2PZSA 3EAEA 3LSHA 5A0GA 4LFUA 1FKPA 2BTFA 3QP6A 1OV3A 2Y1JA 1IRZA 4FWNA 1NJXA 3WG9A 3VS2A 3G4SA 2HHXA 2KRCA 3NF9A 2ZFWA 3EDPA 3J7AF 2FUG2 2Q2RA 3LA2A 1K9MU 2M8EA 3E9LA 4FE7A 3I56N 3M57A 3CJCA 4JJDA 2XGDA 1ARKA 4KTQA 3CJTB 3G1JA 4IUPA 4IJAA 2P9LB 2K9QA 1FWZA 2X1DA 1G6NA 2O9VA 3EUHA 4Y3OA 4LFAK 4DJAA 3PTAA 1QSLA 1M90U 4I09A 2KPMA 4F91B 2DQLA 4RA2A 2CP2A 1UECA 1GVDA 3ER0A 4CCMA 3CFOA 2RJFA 4PCQA 3G3ZA 1QZYA 3KLEA 3SJJA 1U84A 3LSRA 3KX2A 4RCBA 2Q8KA 5IOYA 1VQPT 1EO1A 3HXMA 1OI1A 4AH9A 5KGXA 4H0PA 3SHFA 1R49A 1IO2A 2YRVA 2KT0A 4PHTX 2HTJA 2M5WA 2ZJRF 1NGFA 2P9NA 2NLUA 4CI6A 1UA0A 5KCHA 4DF4A 3HTRA 1VRUA 3RDIA 2QSHX 1STZA 5C4JJ 2VG5A 1V54H 1RCHA 4RWTA 2A37A 2HDAA 3CJRB 3OJUA 3I9QA 2NS0A 3SZPA 1H8KA 3V42A 4I7HA 2O8FA 1ZAOA 4HF2A 4A3MJ 4D5FA 2IVNA 2K57A 1WI3A 4E2FB 3VS1A 3MJXA 1R5HA 2YUQA 1S9HA 4P55A 2B63J 2EGCA 2QWLA 3ECOA 2FHDA 2FU4A 1J0RA 3WNFA 1MPGA 1WJQA 4KNYA 1LDDA 4XLAA 4KHQA 2RKHA 2PUOB 2RQUA 3OOUA 4A3GJ 4BDYA 4GCVA 4CK2A 3M58A 2Q0UA 5E79C 4F93B 5M3FJ 5J6XA 9ANTA 1KG2A 2M34A 1BL0A 2Q2EB 1HOMA 3PSFA 2NUBA 4MDAA 3JCMW 1I5ZA 4Q0BA 5KVRA 3FBNB 4D5CA 3O4WA 5JVGF 4DR3K 2ZGWA 1YRNA 4UHTA 2FA5A 2L3DA 1KC8O 2DU9A 3G7ZA 4XIUA 1VQ4A 3VEVA 2D0NA 3SUNA 4UY8I 3CCVA 4RB3C 2PAVA 3DM2A 4AU7A 1NOYA 1SEMA 3MK6A 3KUFA 1X75C 2X4HA 4CGZA 2KZGA 1AZGB 1IXSB 5GANe 2NNNA 1NU0A 4K42A 5GIPA 4OMPA 5CKDA 1X9WA 2M0OA 3G1MA 4E9EA 4X1EA 5FD6A 4FLTA 2IJLA 2E4HA 4RTZA 3M8SA 3A5OC 2HQXA 1X2MA 2ZFUA 1QWEA 1NG6A 3OW2M 3GE1A 3CCUT 2UUCK 4Z4FA 1ZG1A 2M4KA 2RQQA 3ABLH 2QSFX 1IGUA 3LLRA 2FBHA 4AM6A 2VN2A 3MN9A 1P6RA 5KAFC 2NVYJ 4BRLA 5TISC 2W6KA 1FP1D 1HJRA 4IKFA 2KKZA 1W7PD 3F73A 2CSOA 2NAZA 3UT1A 3E6CC