4BACA

Prototype foamy virus strand transfer complexes on product dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords INTEGRASE
publication title Assembly of Prototype Foamy Virus Strand Transfer Complexes on Product DNA Bypassing Catalysis of Integration.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 82
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bacA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bacA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bacA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bacA03
1UA1A 1KFSA 3LYIA 3OYKA 4KTZA 3DLBA 4FLYA 3IRXA 2IG0A 2P0KA 3PO4A 4AILC 2F8TA 3TAMA 5J2PA 4FW2A 4F8RA 4EP5A 4FU6A 4WE1A 3PV8A 1UA0A 1HJRA 4OKEA 3NAEA 1IH7A 3LLRA 3LALA 1VSDA 3UWNA 4N4GA 1IG9A 4QVZA 3OJUA 3L2RA 3MEVA 1B9DA 4JRQA 3AO2A 4RW4A 5KE3A 3TAEA 4B8AB 1QTMA 4AH9A 4IUQA 4HTUA 3V9ZA 4OVLA 5CYQA 1NK6A 3HVTA 4IURA 1TV6A 1JLGA 1O1WA 1NKCA 1YTUA 3DLEA 3HPGA 3VA0A 3SUQA 2YKMA 4O55A 3HL8A 1LWCA 3KK3A 3AVJA 2HQEA 3TWHA 4BD3A 5M9OA 4J2AA 4C5GA 4BE2A 3KLFA 3OYMA 3QEXA 2NUBA 4B9NA 4CGHA 4CCHA 3I0SA 4X34A 1SV5A 1BHLA 3AVIA 3ZT4A 1S1VA 3OYHA 1ASWA 4KFBA 4UQGA 2X35A 3O3GA 1XC9A 3ZT3A 1RCHA 3VQ5A 2BUDA 1ITGA 3HT3A 1JXBA 4PY5A 5C6SA 3OS2A 2YHAA 3EY1A 3EYZA 4RG8A 1KCFA 2YNGA 3OYNA 2JGUA 1UWBA 5D6XA 3SV3A 1W0HA 3C94A 4OKJA 4KB1A 1SL1A 2OPQA 2GUIA 2LSNA 2LDMA 3SYZA 4N56A 1FKPA 1ZBHA 3L3VA 2Y1IA 4NCGA 3ZSQA 3DMJA 3V1QA 1TL1A 4LY7A 1YVUA 1TKXA 2IGIA 1JLCA 3AA3A 1X9SA 5J39A 3S3OA 4M3ZA 3LAMA 4DFMA 4DSLA 2O4XA 1HMVA 5SWMA 3M8QA 1WSIA 1TK8A 1RT3A 4AHUA 3KJVA 3ZEHA 3SPZA 1XHXA 3LZJA 1RI0A 4FLXA 3QEWA 1UOCA 2FC0A 3ASKA 2E6MA 1T03A 1YTAA 3LANA 3OYIA 3V9XA 3U3GA 2BGGA 5HRSA 2DFFA 4NYNA 1KTQA 3E01A 3KLIA 5KE2A 5HP1A 2L3RA 1T7PA 3O3HA 4I9LA 4DFKA 4YNQA 4M42A 4FJ7A 4CECA 3PX6A 1L3TA 4CJ4A 2PZSA 1RTHA 3VQ8A 4KREA 4B3OA 4C8OA 3LZIA 4CEBA 2HHXA 2Y1JA 3SUPA 4ICLA 3A2FA 3KK2A 5KTQA 3LPUA 1IKWA 1WSFA 4C8KA 4DFJA 3RWUA 5J2MA 4W5OA 1RBRA 1N6QA 1C6VA 2IAJA 5KCHA 3OYBA 4B9LA 1FXXA 5HBMA 2E6NA 2RJCA 3K59A 2IC3A 4Z4IA 4K8XA 4FK2A 3CFOA 1TAUA 2BKDN 3QLHA 1FK9A 2Z1JA 4H8KA 1NK5A 3MEAA 1WJSA 4Q0BA 3OS0A 1DTQA 3HP6A 4HUEA 1N5YA 3V81A 1B92A 4BACA 2OYQA 2QKBA 2X4YA 2YKNA 3ZSXA 3S6WA 3DM2A 1WAJA 2D0CA 2BANA 2RI2A 2G8IA 3AA2A 4PQUA 3PX4A 3CM6A 1XWLA 4AHCA 2FBTA 3NNQA 5DK5A 4Y1CA 1NOZA 1NK8A 3F73A 4W5RA 1VK0A 5DMRA 1JLEA 4CGDA 3QIIA 2D0BA 4CEFA 2QK9A 4JLHA 1D5AA 1U48A 4CJQA 2HHUA 4CEOA 3OYCA 4CE9A 2L8DA 5T7BA 3ZT0A 2F96A 4CK2A 4B9WA 4CK3A 3C6UA 4FXDA 4HCBA 2WONA 4OKKA 2YNFA 3G10A 1SKSA 3MP6A 3LP0A 2RJDA 5HLFA 4FLVA 1C1CA 1LAVA 2HNDA 1C0TA 3V1OA 3LGLA 5CYMA 4NYFA 4IDKA 1HNIA 1RTDA 3FFIA 2K3XA 3CG7A 3HK2A 3OYAA 4PLIA 4CHNA 3PMIA 3LX7A 2M0OA 1HNVA 1LW0A 1QE1A 2HHVA 3P5JA 2FHDA 3P83D 4O0IA 3P8DA 4A4FA 4M3UA 3NH0A 4O44A 1ZBUA 3SNNA 4L59A 3M8PA 1KRPA 2MWOA 4BDZA 2YNIA 1RBVA 3OYDA 1ZBFA 4FM1A 4B8CA 4M3TA 3VQAA 3HPOA 3VQ7A 2D0AA 2EQMA 3SPYA 4DU4A 3ASMA 2DIGA 4KHUA 2P1JA 1ZBLA 3KTQA 3MP1A 2XY6A 3AVNA 4CFCA 1GOCA 4H4OA 1UAXA 4DSKA 4E7KA 4CJWA 1MHNA 3HP9A 2R5MA 2ZD1A 1EX4A 5C24A 3PO5A 2QXFA 2Z1IA 2ZE2A 4GMJB 4DQIA 3NCIA 3FEOA 4CJEA 2XY5A 3NFAA 3O4QA 3VQEA 3DLKA 4PA1A 3DLHA 4FL6A 4AHSA 4FLWA 3HYFA 1T8EA 3MXJA 1SSFA 4F2SA 3O8VA 4AHTA 3LH0A 4FJ5A 2HMIA 2X4XA 3ZSZA 2K3YA 5I3UA 3M8SA 3THVA 3DLGA 1NJZA 4CF2A 5FDLA 4NCAA 2VG5A 3KKRA 1CZBA 1RILA 4CJUA 2VWKA 3MEDA 4DLEA 4C8LA 3SZ2A 1WAFA 2PYLA 4FLUA 4CIGA 4CF9A 2IOCA 4KHWA 2AJQA 2RHUA 1RDBA 4KB0A 3NH2A 3AV9A 4NZGA 4FW1A 1BIZA 3HXMA 4ZTJA 3H08A 4CERA 2YV0X 1KVAA 3E9FA 2KFZA 2VYTA 2BIVA 2KFNA 4E1NA 3K5MA 3UIQA 3G0ZA 4DSJA 4KI4A 1TL3A 3GOXA 4O4GA 3RMAA 2FBVA 1JLQA 1NK7A 4CEQA 5HRNA 1NJYA 3DRPA 1NKEA 4CEZA 3LDSA 5KGXA 1RT4A 1LV5A 3VQCA 3C6TA 4DMNA 1WLJA 3HVRA 1QS4A 3ZT2A 3L2QA 4DTUA 4KHQA 3UT1A 1Y97A 1U04A 1HYZA 2OPPA 1S6QA 4TSXA 1G15A 2GFUA 1XI1A 4N76A 3OYEA 3KLGA 3SUOA 3JSMA 2LVMA 4C8MA 3VQ9A 4E0DA 4M3XA 4F4KA 5FROA 1G5VA 1H3ZA 3AO5A 4Z02A 3OA6A 4F2RA 3QETA 3QEIA 4HCZA 2FBYA 2RN2A 4M3RA 3CYMA 3F9KA 4OLBA 3OVNA 3MEEA 2D5RA 2VG7A 1I39A 3ISNC 4DS5A 4OGEA 4FZYA 3AVAA 1OYXA 2JZ2A 4CEEA 1N27A 1NKBA 4CJVA 3U3YA 3ZSWA 1RTJA 5C0MA 2X6SA 4ZHRA 1BI4B 2HVHA 3RTVA 3CM5A 2RKIA 1S9GA 2XY7A 1YT3A 4FVMA 3OS1A 3CFPA 5IN1A 2KZZA 3VQ6A 4FK4A 3OB9A 3V9WA 4FJJA 1VRTA 3RRGA 4QOZB 2Z1GA 1VSJA 4FCYA 3DOKA 4FM2A 1S1XA 3QIOA 5CIUA 4DG1A 4F3TA 3OY9A 2B6AA 1RBUA 3P8HA 3ITHA 4E19A 3TI0A 1OZ3A 3S3NA 3META 3NF8A 2X74A 5FRMA 2DAQA 2JLEA 3K58A 2HHWA 1TVRA 4KAZA 3WNFA 3C95A 1S9EA 4ELUA 1VSHA 3ULDA 2HW3A 4FM0A 4DQQA 1VRUA 3SD4A 3DOLA 3S3MA 3WNHA 1HYVA 3QERA 2HVIA 4CFDA 4DTMA 4PL6A 1NK0A 3K5OA 4CIEA 1KVBA 2YRVA 4OJRA 4KI6A 1BGXT 3OMGA 2R58A 2KZMA 3OJSA 4E89A 4ID5A 3M9QA 4FJ9A 4CJFA 1RT1A 4Q5WA 2RI3A 4IG3A 2EFIA 3P1GA 1U49A 1OI1A 3AVKA 4HUFA 4DSEA 4KHNA 4OPKA 4BDYA 4OVAA 4CGFA 4IUTA 3QEPA 2GV9A 3ME9A 4GW6A 1WJQA 2WOMA 1JLBA 4FZXC 1J5OA 4OGCA 3AVBA 1JKHA 3AO3A 3HO1A 2ZQBA 4H4MA 2DTUA 3B6PA 4CF8A 3LGFA 4BWJA 1J54A 3QIPA 3CFRA 3EZ5A 2HHSA 3HSTB 3NGYA 3FC3A 1BIUA 1EETA 3KKSA 3K57A 1WSEA 5JS2A 3V9UA 1L3UA 4I9QA 4F3OA 2PYJA 3QKJA 4N4IA 1I3AA 1WSGA 2XDPA 1RDAA 4FZZA 2XK0A 3DRRA 4QAGA 2P5OA 3OMCA 2G8VA 4M3YA 3LPTA 3L2UA 3TAPA 2KQ2A 1VSIA 2QQSA 1EKEA 3V6DA 1IKXA 4IUPA 1Q8IA 1LAWA 3ZT1A 3AA5X 1Z26A 1EP4A 4DTJA 4J2EA 3EAEA 2HQXA 1GOAA 3QBYA 5KGWA 3LWLA 3KLHA 3H8ZA 4DTPA 3MECA 4BWMA 1ASUA 4LH4A 4DF4A 1RT2A 2I5JA 3LAKA 5KRTA 4FYDA 2A1RA 4CGGA 3BDLA 5J2QA 4DWIA 3RRHA 3VQBA 1TKDA 2RJEA 5I42A 3V9SA 3C4SA 4DF8A 2G3RA 1RT5A 4E3SA 1HRHA 1RDCA 4CFBA 1A5WA 1CXQA 2G8HA 1B9FA 4I7FA 4CHPA 5C25A 1RBSA 4BE0A 1SKWA 3TAQA 4DSIA 3L3UA 4E7HA 4LSNA 1J53A 4A4GA 4M3WA 3T1AA 1IO2A 1SUQA 3DLMA 1RBTA 3IAYA 2A1SA 4I2PA 1LWEA 3O3FA 4YFUA 4Z4FA 4FJXA 4LD6A 4Y1DA 3QINA 4CHQA 4IG0A 4DTOA 2B8AA 4E7JA 2RHYA 1JLFA 1S1TA 3T19A 4Z4GA 3NTHA 4A4EA 1TGOA 4BE1A 3SUNA 3LWMA 2XRIA 3PUFA 1SKRA 2O4IA 3I0RA 4PUOA 1NJWA 1TK0A 1IKVA 4CF1A 3K5LA 1RDDA 5HRPA 1S1UA 3KD1E 1XNIA 1L3VA 4Q5VA 4II1A 1CXUA 4KRFA 2ETJA 3VQPA 2BDPA 3L2VA 4I2QA 2Z1HA 5J1EA 4IKFA 3PMTA 2F8SA 4M45A 1QSSA 3U6FA 1R0AA 4CHZA 1X9WA 1RT6A 4KHSA 3MXMA 3D45A 3KLEA 4C5EA 4RW7A 2X4WA 1QSLA 3NTKA 4N4HA 4BDPA 3PNWC 5HROA 4GVMA 1BL3A 3I8DA 1BI4A 4DQRA 3L2WA 1VSLA 1F21A 2G8KA 4NCBA 4K8ZA 1ZYQA 1U45A 3PFSA 5KI6A 3SQ1A 4EZ9A 2P51A 1Q9YA 1WNSA 4CJRA 5KH6A 3SJJA 4RG2A 3RMCA 1L3SA 2O4GA 1VSFA 3HPHA 3NF9A 1Q9XA 4CJ5A 4KKOA 2IS3A 1LW2A 2E5QA 1TK5A 3VN5A 4PWDA 3PY8A 1HQEA 3T3FA 3ALYA 3L42A 3AVLA 4DTRA 1SL0A 2LRQA 3MEWA 3HJFA 3ZSYA 1C0UA 2RF2A 2IDOA 3VA3A 3BDPA 4R5PA 3AVFA 3OYFA 2QQRA 1C1AA 4W5TA 3QNNA 4C5HA 1RT7A 4B9TA 2HNYA 1KLMA 2BE2A 4FJ8A 1RNHA 4KPYA 4QW2A 5HRRA 2HNZA 3WNEA 4W5NA 4XIUA 2MWPA 1TKTA 2X78A 4RW6A 1WSJA 4JS5A 1HPZA 3D0PA 3SV4A 3MXIA 1KFDA 2VWJA 4KTWA 5EU7A 4DLGA 4IFVA 1VSEA 5C42A 4FJKA 4CJ3A 4FJGA 2RHIA 3DRSA 1T05A 4FJNA 5D6YA 4A4HA 3K2PA 1SL2A 1EXQA 3SQ2A 2B4JA 3AA4A 4Z4CA 4EZ6A 3LP1A 4CEAA 5SZTA 3NDKA 1NOYA 3KK1A 4Z0UA 4DU1A 3FLGA 3K5NA 4CJKA 4IBNA 3ZSOA 2EQJA 2HB5A 2YNHA 1S6PA 3TAFA 4CGJA 3QJ6A 5K14A 4CJTA 3RMBA 3NF6A 2RI5A 2EQUA 1HQUA 2DFHA 3OYLA 4RW9A 1J9AA 5CZ2A 1NK4A 1ZBIA 1WJRA 4GY5A 2P5GA 2RHZA 3AO4A 4CEDA 5CZ1A 2WACA 1CZ9A 4MFBA 1JXEA 3KD5E 1QHTA 1TAQA 3QNOA 3VQDA 1VSKA 3NGIA 5D6WA 3CEYA 2R7YA 1D9FA 4M41A 1REVA 3NGZA 2DIQA 1GOBA 2HHTA 2M16A 2RPIA 1BCMA 4N41A 4ELTA 2F5KA 2LCCA 1WSHA 4QQ6A 3SI6A 4FJMA 5JS1A 3LP3A 4N47A 4ELVA 3FDRA 2NLUA 1KLNA 1RTIA 3H6ZA 3B6OA 4MQ3A 4E7IA 1JLAA 1CLQA 4OLAA 4CJSA 4O5BA 1HYSA 1C0MA 4NS5A 3MP8A 1X9MA 4JRPA 3NF7A 3AVMA 3AVHA 3MO8A 1Z25A 3VQ4A 1L5UA 2GBZA 2KW4A 2HHQA 3TANA 4KTQA 3QESA 3DLRA 3WNGA 3MEGA 3ZCMA 3DI6A 2B5JA 4LD0A 1A5XA 2FBXA 4CHOA 1QSYA 3DB3A 1BQMA 4CJPA 4EP4A 1U4BA 3AO1A 1U47A 3E9GA 1TKZA 5D3GA 2OZSA 4JS4A 4IUVA 4DS4A 4QQDA 2R5AA 2L89A 3IS9A 3MAQA 4N5SA 4E1MA 5CY4A 2CKKA 3QEVA 1S5JA 4C5IA 3NE6A 5KCOA 4CESA 2YHBA 3AVGA 2XO7A 4Z4EA 2VG6A 3OYGA 2O4XB 4DQSA 2LTOA 4QCLA 2KTQA 4EDUA 4CF0A 2OZMA 1WGSA 4B9MA 2W42A 3NHGA 3JYTA 3NH1A 4FJLA 1BISA 4O0JA 5IAYA 2OPSA 3DYAA 4DU3A 4DSFA 4IFYA 3RR8A 4LH5A 3O4NA 3MEUA 3TABA 4AHRA 2DFEA 1NK9A 4B08A 4DQPA 4L8RB 2E6LA 4C8NA 4AHVA 2G8UA 2RJFA 2DY4A 4B9XA 2QKKA 2XY8A 1KSPA 2ATQA 2OA8A 2G8FA 3TAGA 4FLTA 3KIOA 1D9DA 5FRNA 2E4LA 3OQ5A 2RO0A 4DTNA 4CFAA 1ASVA 1OZ2A 3V1RA 4FJHA 4CHYA 2PY5A 2X6NA 4B9SA 3TR8A 2JTFA 3LP2A 2PQWA 3KUFA 2ITGA 4HCCA 1NJXA 2EKOA 4UC4A 3OYJA 4CRIA 1KHCA 1JL1A 4LSLA 3IG1A 3S9HA 4ZTFA 3ZSVA 3CQ8A 3AVCA 4Z4HA 5E41A 4DFPA 1C1BA 3SQ0A 1XHZA 4DTXA 4HUGA 2RHXA 3HM9A 1QQCA 3SQ4A 1KVCA 4E7LA 2OPRA 4CJLA 1FKOA 1VSMA 4IUUA 4CK1A 2Q3SA 2D9TA 1DTTA 4KHYA 1D8YA 2EX3A 1MU2A 5KRSA 4G1QA 1W9HA 1X1PA 4ID1A 4B9VA 4FJIA 1IKYA 3NBPA 2EQKA 3NTIA 2XHBA 2EHGA 3RR7A 4B9UA 3ZSRA 4FLZA 2GF7A 2GFAA 4HVJA 3F70A 4KO0A 1BQNA 3TARA 1A5VA 4OPJA 4QQGA 3M8RA 4J2DA 2R57A 3DB4A 1DLOA 2M1HA 4RW8A 4CIFA 4PLLA 3Q1JA 4DTSA 3V4IA 3SCXA 1JL2A 5J2NA 4HHTA 1LWFA 3VQQA 4KV8A 2G8WA 3L8BA 4J2BA 3RMDA 3QO9A 4W5QA 4CGIA 5J26A 1K6YA 1S1WA 1WN7A 3PX0A 4FK0A 3BGRA 1BCOA
chains in the Genus database with same CATH superfamily
1NJIC 1M1KC 1HCRA 4IJNA 4ZZDA 4HDUA 3U23A 4O5VA 4UB6C 2EYZA 5JHUA 1KD1U 2SEMA 1MMGA 1YW8A 2CP3A 4LDVA 4RB1A 1GXQA 3K4LA 1T95A 2R7RA 1G8XA 2EJFA 3CO6C 4XN0A 2F8TA 5J2PA 1RESA 4MGRA 4F8RA 1QO0D 4WE1A 3PV8A 1ZH5A 1ARKA 1UA0A 4FE4A 2K9QA 4H5NA 3MKYB 2L7KA 1VSDA 1YUWA 4HPQA 3EFOB 3UWNA 2KRSA 2RB6A 4LDXA 1OH6A 3AGRA 1B9DA 3AO2A 5E26A 3HUGA 4RW4A 1KG1A 3BC8A 3CD6T 2ZXJA 1NWKA 4IUQA 2EGEA 3TPQA 4AM6A 1VI0A 4OVLA 1I8FA 3QBXA 2GWRA 3AARA 3KZZA 1UELB 1TV6A 2STWA 3DF8A 2N8GA 1Z05A 3HPGA 3G1OA 3VA0A 3ZN0A 1YITT 4LGWA 2JPCA 3AY9A 2OUMA 5GAN8 3R6SA 4C5GA 3KLFA 5FPNA 3ASNH 1PD0A 5TJJA 1ZUYA 1J0RA 4M7DB 5GADP 2NOJB 4EW0A 4B3MK 3MKWB 1B34B 3JRBA 4BY9C 5IP9J 4CGHA 4KULA 1SV5A 4IDHA 1IUFA 4MO4A 3CBOA 3K6GA 2Z16A 5GAOp 2P9LA 3WXKA 3ZT3A 1VQNN 3DKXA 1QP2A 1RCHA 5LJ3j 2ASOA 3HZJA 3TP0A 5FLVA 3BR3A 3VQ5A 1DP7P 3NEUA 2KIUA 2W4SA 4I6MA 2Y9YA 2L4AA 1ITGA 3A1YA 5M1FA 3HT3A 2JMWA 1ZLMA 1KSWA 3EY1A 3EYZA 3JAMO 2M7BA 1NGFA 1KCFA 4EJOA 3PNVA 2LJ3A 2PBIA 3C94A 4OKJA 2ZNZA 3I59B 2LC2A 3SYZA 4C8QC 2WBNA 3INZA 3SJHA 1Y8RB 1ZBHA 4PL7A 5H2FC 3EHRA 4LY7A 5F0XA 2WAQN 2IGIA 3Q3SA 3I71A 1X9SA 2Y69H 3A8GB 3I55N 3H5AA 3JB9F 5SWMA 5K7ZA 1IXRC 3D5RC 3M8QA 3IUOA 1TK8A 1C0WA 1RT3A 3MN6A 4JNEA 3LZJA 4MFDA 4FYVB 2FC0A 2DD5A 1FOWA 5LL6S 1T0FA 3L0QA 4DV3K 3G6EN 3V9XA 1WKMA 2R7OA 3CUQA 4O3MA 3H45C 4E9FA 2YDLA 2YUNA 3PT9A 2VJJA 5KE2A 5CCAA 1T7PA 1Y96B 4AFUC 4DFKA 4YNQA 4LD5A 3I54A 1PKSA 1JE8A 4CECA 4HT9A 2M02A 1L3TA 3NAUA 2VJ4A 1TG0A 5GPAA 4KREA 3FM3A 3LA7A 2HHXA 1GLNA 3SUPA 1VQ7Q 2ZPFB 3KK2A 5AQUA 1VQKI 3BJ6A 2OI3A 1XQPA 1IKWA 4C8KA 2MMPA 4D1QA 5GAN2 2DMOA 3QP6A 2JA8J 1K79A 1SMTA 1ZGAA 2GXAA 4KMUX 3Q7CA 2K5IA 1A31A 3HBLA 4I98B 1FXXA 1M1FA 4JUVA 3VPZA 3L7WA 4ZDLA 2RJCA 4KUDK 3O5ZA 3QBWA 4OP0A 3CQXA 2X1EA 4F91B 2JA2A 3CFOA 5DLQE 4XBFA 1XPXA 2BKDN 4G6TB 3F8MA 1NK5A 4FIBA 4M75F 1XX5A 4C0GA 1HKTA 3EL2A 1DTQA 4JI6K 3O9RA 4KA4A 4BACA 1XC3A 3DKMA 3KWIA 3ZSXA 1D0YA 4A5BA 4QSHA 2D0CA 1M3HA 2V8IA 1R5ID 2RI2A 3GE1A 3I8BA 1UGSB 3PX4A 1XWLA 1CKAA 5DK5A 4Y1CA 5J1RA 1NOZA 2FRHA 1Y64A 3CMAT 3F73A 1NK8A 4QKUA 1KD1R 2ELHA 1JLEA 4IIMA 3QIIA 2AKKA 1S6LA 4HCKA 2KXDA 2P5LC 3A8OB 3QJYA 3BDDA 4GKKK 2A5YB 3SFMA 2P9UB 2R3SA 2HBMA 3QQAA 3RSNA 2L8DA 5ADXH 5T7BA 2F96A 4CK2A 3E9LA 4FXDA 2ZPBB 3EG1A 1WPYA 3LSJA 2D8HA 4JD2B 3N97A 1V3FA 3HM5A 3IHUA 5AQHA 1SKSA 2RJDA 2VBYA 5HLFA 2D1HA 2IIMA 3EG2A 5DCMA 4PJMA 5HLGA 3MKDA 4NDLA 5CVJA 4RMOA 4JKHA 3V1OA 3LGLA 3A98A 5FU6B 3H1VX 4QVDA 4DV5K 1VUBA 2HTSA 2HGCA 2VODA 1HNIA 3A0IX 2K3XA 5GAN7 1FBSA 3OYAA 4PLIA 2KROA 4M3GA 2WY8Q 1VQKA 3VOEA 1ZRCA 3SDBA 1MIJA 5H6RA 2M0OA 3J7AF 3MCZA 4BJTA 1JGSA 3L6QA 2F9TA 2FSKA 1Y7XA 4O0IA 4M6XA 1IZ6A 3Q9VA 5AQWA 1ZBUA 4RTFD 3M4GA 1HSJA 3FMRA 2G7UA 3ERED 2QXLA 1R0BG 4B21A 4BDZA 5D6FA 4PNOA 2ZJPL 1QW1A 1WHLA 1DEJA 2ZO4A 1V5GA 2BGCA 4OF1A 1HW5A 3OYDA 4ZC3A 4B8CA 3EUHC 4M3TA 2CV2A 5A2QO 3S14J 1JTYA 2EQMA 2VXDA 2STTA 3SPYA 1YI2T 4DU4A 2L0AA 2DIGA 2R7DA 3H1CA 3O8HA 3T0YA 5AQJA 4LN2A 2MIOA 2PBDA 4PZJA 2FBIA 4C30A 1LPLA 3RTRA 1NU0A 1KAYA 1BJZA 4CHUA 4JKGA 5KN9A 1WQ2A 3HP9A 3FXMA 2PJPA 3E6DA 4WFAL 4AG1C 3HTUA 4FETA 2A3SA 4DQIA 2XAQA 2DJNA 2VE8A 1SF9A 4M75C 3E6MA 4C92G 3O4QA 3MMYB 3CJRB 4PJOD 3LFKA 4RA2A 1IGNA 4BC5A 5EEGA 1IN4A 2W41A 1WI9A 4M3DA 2FXUA 5HS7A 3DLLF 4WF2A 2OTJI 4FLWA 1T8EA 2RM4A 2L9VA 1G59A 3E66A 2GGRA 3CWAA 1HPMA 3FZMA 3LH0A 2HMIA 4RAFA 4L5IA 2G6FX 4JV5K 3K4NA 2LTPA 1FOXA 4PJ0C 4BYYA 3DLGA 1NJZA 4NLCA 1FYMA 4CF2A 4NO7A 1YJWQ 3H0DA 1R7JA 1OR7A 2QLZA 3S1MJ 5GAOm 1RILA 1TWBA 4H0OA 4CZKA 1HOMA 5HK3A 4C8LA 3P9KA 1BOBA 5M1PA 2MD5A 5J1UA 3S2DJ 4CF9A 3P31A 1EZZB 1AA7A 4KHWA 2XG8D 4M3FA 1YWOA 1NGEA 5EF6A 1V54H 4ISFA 1BIZA 3HHTB 2LP0A 5KPZA 2DO3A 1N6AA 4R0KA 4EPCA 4QIWN 4YPHA 2DMQA 2VKVA 3E1YA 2V51B 2VL8A 3DV8A 3EYIA 2FXAA 4KH6A 2DW4A 4G7HF 2CUZA 2E1YA 2EQRA 3RJPA 4O4GA 3CCJQ 2D0QB 3PGGA 2XRLA 2HNHA 1NKEA 4CEZA 2GA2A 1TWHJ 4MEXF 2J6FA 4OPAA 5LJ5h 3M1EA 4PKGA 4PJOE 4HLYA 2KK4A 3K10A 2VJIA 3S1NJ 3L2QA 5DM6L 4KHQA 3HOWJ 5AZIB 1RKTA 2M87A 1ZRFA 4E47A 1LPQA 1Y97A 2SRCA 1U04A 2X51A 2NYXA 1MDUB 4B1RA 2A6TA 4TSXA 4N76A 2PMHA 3HC7A 1WJFA 1Z9QA 2BY3A 3MZ8A 3GZ6A 3SHWA 2LVMA 1MSFC 4E0DA 1XC5A 1NZ9A 5AN4A 4F4KA 4E7SA 3REBB 1TWAJ 3I0XA 4JJDA 3WU1B 2L3QA 3GZ5A 5E84A 4WYBA 4Z02A 2A41A 2LP5A 3QETA 2OTJA 4HCZA 2CRGA 2FBYA 1Y57A 4NB5A 2P9SA 3FHNA 2AP1A 3F9KA 4JJBA 4PDKA 4GDFA 3MEEA 1DP3A 1YE9A 2HQ5A 2D5RA 2JJ9A 4I6ZA 4BRFA 1Z7UA 4QVCA 3WXIA 3BTIA 1U2VA 1PRMC 4M6VA 5BPLA 3C7NA 2XGCA 1HLVA 4CEEA 1N27A 3CCEN 3A4CA 4CJVA 3VMFB 2KAFA 3ZQLA 4XN3A 1TTHB 2K40A 4W97A 2W03A 2CGJA 4O8UA 4KGVB 1YCYA 1BI4B 4KUMA 4W1UA 4JI1K 4JI0K 3PVQA 4ZYDA 3O5BA 4FVMA 1D5VA 4P9UA 1WIEA 3D2FB 2DT5A 3SB2A 4PJLA 5GJWB 5J3BA 2EA2A 3RRGA 3ZCOA 1VSJA 3HOSA 4BHBA 1Q1VA 1GLFO 4FCYA 3DOKA 3DBLB 5AQKA 3BY6A 5H6QA 1E4GT 1H89C 5KYXA 2VPLA 1Z67A 1HQCA 4WCGA 4CC2A 3HHHA 5CQXA 2JSPA 4LG0B 4MO7A 3OY9A 2B6AA 3G4SI 1RBUA 3P8HA 3M0TA 2H6BA 2HI3A 2VLAA 4OIQF 4H0VB 4JZ4A 3NF8A 4I7HA 2VKEA 3G1MA 3DPUA 5BR8K 3WNFA 1ZELA 3VS3A 1S9EA 3G2BA 4A0YA 3S3MA 1FC3A 3JCMh 4BRAA 3AAPA 4DTMA 1NK0A 1MBKA 1KVBA 1VQ7T 2VC8A 2E2HJ 4E4HA 3VESA 2KZMA 3OJSA 3L2ZA 2YI1A 4E89A 1UECA 2DA6A 4OFEA 4BRPA 2QENA 2EYWA 3J80Z 2W10A 1KQJA 1OH5A 2JRMA 4BJ5C 3GCMA 4NUBA 4KT6A 2JM8A 1U49A 3Q0UA 1QCOA 1VQKN 2NVXJ 2OANA 1AHJB 3WHBA 3GYHX 5E8GA 4OMMA 2IS6A 2DA3A 2IXSA 2XIGA 4IUTA 3P9IA 4B23A 2VC0A 2LC4A 1WJQA 4UUSA 4GKJK 3CCSQ 4U87A 4P5OA 1FJLA 3AO3A 2ZQBA 3MZHA 4HBLA 2A42A 4H4MA 5IYBJ 1IN8A 1MBJA 5D5XB 2DL7A 2DTUA 4ESRA 4QPOA 5CHZA 4L9VA 1ZR2A 4PJOF 3QZ5B 1PUFA 4EMHA 3ZQFA 5AQOA 3FKIJ 3HSTB 1MMNA 2KRFA 1X2MA 2EBPA 3O8GA 5BNGA 5DUKA 4F7UA 3GTKJ 3V9UA 1QZ6A 4FX0A 2PG4A 3CP8A 1Q86U 3ZYYX 2ABLA 4M78E 4N4IA 2LCSA 1WSGA 5ILVA 3G4SA 4BAYA 1DPRA 1IN7A 1VQPQ 3L00A 3R0AA 3P39A 2BVMA 1ZA1B 1HF0A 2CP2A 4QAGA 1SD6A 3EG3A 4XLHA 2HKNA 3JRIA 4HV5A 1KQ1A 3OMCA 1OULA 4M77B 3I4NJ 4XH5A 4B48A 1H1VA 2HVQA 4M3YA 3TBIA 4CUGA 5IT9O 3D5SC 1Q82U 2XRNA 2DF6A 2CZ1B 4IRIA 4CZIA 1KHIA 2QQSA 4JI5K 1VQ4Q 3GFMA 2HCKA 4Q48A 2FUG2 4IUPA 3DP7A 2E35A 2FZGB 4DR6K 3ZT1A 2F48A 5GP9A 2P5KA 2BOLA 1Z26A 1TBXA 4BRMA 1T8IA 4C0ZA 2E10A 5JVGL 4ENJA 3J80K 2L54A 2W6LA 3BY5A 1RI9A 2VOOA 2NOEA 1K0XA 3QBYA 3LWLA 3KLHA 3SAFA 2FRYA 3GTJJ 4D7MA 4LH4A 1RFQA 4FYDA 2ACJA 1X75C 2E5ZA 2RJEA 3LSHA 5I42A 4FT8A 3TVTA 3HGGA 1IRXA 3QPSA 1RT5A 3K69A 2ZCFB 4JRIA 3EETA 2DODA 2D1XA 3HFOA 2E7XA 4AUXA 3VS7A 4LF7K 4GXOA 3U9ZA 2VQEK 1B9FA 5LJWA 4CHPA 1M1GA 1WHJA 4RGSA 1SKWA 3A8LB 2V75A 1Q7YC 4BRCA 4LSNA 4A4GA 4IZZA 1MA9B 4M3WA 1TUUA 2V9PA 1IO2A 1SUQA 3DLMA 1ENHA 1HKCA 4BGAA 3IAYA 4U7BA 2A1SA 2D8JA 5JLFA 3O3FA 1XB4A 4YFUA 4Z4FA 4GBQA 4CHQA 1GRIA 3TTCA 5LJ5d 2RHYA 2L0KA 1LWVA 1JLFA 1WFWA 3A8MB 2O9VA 3NTHA 4A4EA 1TGOA 1J5YA 4DR3K 3FX3A 1ABQA 4PJOC 2R7VA 1SKRA 2K9GA 2P9PA 1USSA 3ZLJA 3ZN1A 3VS2A 4JQFA 2HDCA 3C65A 3KP7A 5B5EC 4CF1A 2PUKB 5HRPA 1XMXA 2QKLB 2H8HA 2OTJN 5GAOq 5GTHC 4NC8A 4AI4A 5ICCA 2FZKB 3E1SA 1YJWT 4DR1K 5CYVA 5E1ZB 2XPWA 1LUJB 1HJOA 1VQNQ 3A5OC 3RZDJ 3LCNA 5FFZA 3JAMZ 4B4CA 4IKFA 3ID6A 2O9SA 2E1MC 4KHSA 2DFUA 3LSKA 2V8JA 3RMSA 3CMAI 3NTKA 4D8DA 1O3SA 4I09A 1BL3A 4KH5A 3BCAA 1P6RA 3M8FA 1B1BA 1E6HA 3OIQA 4GRIA 3F0ZA 4NCBA 1LJ9A 4IHSA 1U45A 2VXEA 3VYSB 1TT5B 5KI6A 3CCJT 1IJWC 3SQ1A 2COWA 1PNJA 1YFNA 1WNSA 2P9KB 2IPOB 4WX9A 3EEQA 1V5FA 3Q7BA 3PIOF 2R7QA 4B1XB 2P6TA 4MDAA 1T6SA 2L9RA 4A3JJ 1ZQ3P 4OMLA 1NMNA 4CJ5A 1U5TC 1G3YA 5LJ3f 1K73U 1UGVA 1S8NA 2JUCA 5KNLA 3TMOA 1TK5A 1UFFA 2RVCA 3AHUA 1P7MA 3WTVC 1JJ2A 1JKRC 2ZJQF 4V2SA 1NTCA 3T3FA 3L42A 3AVLA 2W85A 2DPUA 2ESHA 2EFWA 3ZSYA 3KWGA 8ATCB 4JBAA 4J9FA 3G6EQ 2ZJRL 3VA3A 3AVFA 4KHPK 2FYKA 3OYFA 4EVIA 3OH9A 4XLFA 2QQRA 2HKQB 3JRHA 4AU7A 2WA0A 5J4VA 4C5HA 2P81A 3R4KA 2QSHX 1RT7A 4B9TA 2NUZA 3U1KA 1KO9A 5IPAA 1UGPB 3A8HB 2HNYA 1VQMI 2MBFA 4IXCA 4J7FA 1ABOA 5LEKA 1Z7LA 2RGVA 3OIPA 4L0ZB 4OB0B 4IQJA 3M0RA 4KPYA 3OSSC 5D8LB 1TKTA 4JKEA 4ETSA 2RDPA 5KYWB 2X78A 3E6BA 4DIQA 3CCVI 2C06A 4I01A 2CYYA 3BT9A 1Q86R 1I50J 4WCIA 3BR0A 1YP5A 2EJGA 3THWB 3WG7H 5EU7A 1WI7A 4FJKA 3TL4X 4R1HA 4CJ3A 2AQFA 3S15J 4HQMA 4HKEA 3JCMJ 2KQWA 4A4HA 4CYDA 1JEGA 2EKHA 2NAZA 2RD1A 3M1FA 5JR3A 1Q82R 2UXNA 1USTA 5EZHA 4A3BJ 4XORA 5J3LA 3HTVA 2YSQA 3KK1A 5BR9A 2DJIA 1WYXA 3EN9A 4CJKA 2LH9A 2Z1DA 1GL5A 3ZSOA 2EQJA 2YUQA 3HSFA 1XUPO 2BHZA 4GVEA 1SD5A 2JUFA 3G4SN 5K14A 2ZSIB 3OYLA 4M6YA 1E2XA 1WJRA 2CQ7A 2Q1NA 3AO4A 2K2MA 2QI2A 4BY6C 3I64A 1JXEA 2C0TA 2HHHK 1BW6A 1HKGA 4EJYA 5D6WA 1WHUA 3QP5A 2K3BA 2R7YA 1GCQC 2PQ8A 2GQQA 2NOIA 5CR4A 2MC3A 2DIQA 2OV7A 1MPGA 4U0WA 2M16A 3IH2A 1IDZA 1BCMA 4ELTA 2FA5A 3WTUC 2JMAA 1SHGA 4EM2A 4B6MA 3CJ1A 4OB3B 2HEOA 4OMOA 3RKXA 1FTZA 2NLUA 3B6OA 4MQ3A 4CJSA 1VQMA 1GLEG 4O5BA 1IRFA 2VN2A 2A36A 4XEIA 1ATSA 2RF0A 1X9MA 4JRPA 2R7WA 3MO8A 3CCST 3CCVA 1L5UA 2E2NA 5C2FA 3HHGA 2GBZA 3N4QA 2FEZA 2DOFA 3SJMA 1QA6A 2DM1A 3DLRA 1NG6A 3MEGA 2NVUB 4BBSJ 2JT4A 5FLXO 1CF7B 4FWSA 4IHXA 3ZCMA 1TYQA 4YDUC 4XR6A 5BRFA 5ECAA 4J6XA 1TW3A 2E36A 2B5JA 5A2QZ 4I6MB 2FBXA 4E9GA 3DB3A 1QSYA 1UAAA 4BRNA 5LLQA 4CJPA 2Y0MA 2LVSA 4FQGA 2HZYA 2W24A 2Y30A 3H9GA 4HXJA 5EG0B 3C1DA 1YOVB 4Z88A 1VQPT 3HRUA 1R59O 4X66K 1S5LC 1S5JA 4H0PA 2X4HA 1R9TJ 4CESA 3BTJA 3K70D 1QGPA 3HIFA 5FKLA 1F1BB 1VQLN 2O8BA 5GANg 2F2VA 2QWNA 3AVGA 1Y0NA 1E0EA 2YG9A 3EG0A 1I1GA 4DQSA 6AT1B 1VQ4T 2AZSA 2LTOA 4HEA2 2B7EA 1X2KA 1IC8A 4EIKA 3AFHA 4A69C 2JVVA 3ECHA 3HKZA 3K0LA 2DYBA 3K4JA 4BR7A 4XOPA 4FO0A 5FW9A 2QQ9A 1I1JA 2Y4YA 3M0QA 3JYTA 4M7AA 1IG7A 1PC0A 2MGQA 1BISA 5IAYA 1PP7U 3HRTA 4IFYA 3CUQB 4BL0B 3IWZA 1YX5A 2E1OA 4LH5A 2A68F 4CC7A 4D5CA 3O4NA 4KFCA 3IKMA 2DZCA 3TABA 2ED1A 1ZSZC 4A2UA 4UY8I 2JW4A 2DEUA 1X1DA 4LNPA 1NK9A 2E70A 1K73R 3UKUA 1NGHA 5D4SA 2VCPA 2XUBA 2CQQA 3P9CA 5LJ3e 5AZJA 2A07F 5IHKA 3O8MA 1KSPA 1QVGS 4JP0A 4A3MJ 3TAGA 4DUZK 3KIOA 3VJPA 1D9DA 1S9HA 5FRNA 1BA1A 2E4LA 3GPLA 2Q2EA 3CLQA 1A36A 3VFZA 5GAOl 1HA8A 3V1RA 3AT1B 2O8FA 2PY5A 3ZGKA 5F1JA 2I10A 4B9SA 2BZTA 4A5NA 3O9TA 4U88A 1DU0A 1YJNI 3LP2A 3TP3A 3JS6A 2OPTA 3J80E 2NS0A 2DBMA 1YW9A 3VS4A 3LH5A 1W7PA 4DK9A 5KCMA 2EFOA 2YX6A 2A3LA 3T1BA 1JL1A 4XK8E 4LSLA 3IG1A 3S9HA 4ZTFA 2YXYA 3CQ8A 5GADJ 3SQ0A 4YTLA 5B66C 3MEXA 4AMCA 4DTXA 4IHWA 2EAYA 3EFRA 3DKWA 2G9WA 2LX7A 5D5UB 2WTEA 2EWNA 2KP6A 3TEDA 2WAFA 3QRFF 1ZUUA 4CJLA 1VSMA 4DBFA 4WCEL 1NH3A 1J9IA 2Q8KA 1DTTA 5K5RA 5K5OA 3RUXA 1TSFA 1D8YA 1C0GA 1N33K 1MNEA 4LFUA 1X1PA 2IGNA 4ID1A 1X3ZB 3HOYJ 2WY7Q 4B9VA 3CW7A 2WBMA 1IKYA 3NBPA 1TNSA 3Q5FA 1VQNT 3NTIA 2M4KA 3RR7A 4B9UA 1FY7A 2NOGA 3WE2A 3ZR8X 3FJ5A 3KP3A 1YIJI 4HVJA 2IVPA 2DFIA 1OCOH 2LR8A 1XTAA 3GWZA 4X62K 2Y48A 4QQGA 3M8RA 1K83J 4J9HA 1TQMA 1KONA 2M1HA 4PSWA 4M7DA 4XQ3A 4RW8A 4PLLA 1LDKB 3Q1JA 1R4MB 2L3DA 1MUYA 2HDAA 3VS0A 1UTIA 1LWFA 2W40A 3BJOA 3KBGA 2QM3A 1Z9CA 5C12A 3ZXSA 3JCMW 1PM3A 3VKIA 3CCEQ 2YHYA 1X1CA 2HU9A 1BC7C 2P7VB 3RMDA 4CGIA 2UUAK 4JJCA 5J26A 5KK1A 2UXDK 4F7UG 3PX0A 2KLAA 2ZJPF 1ZUKA 1PU7A 2NRAC 4BBRJ 1I3QJ 3PIPA 4UHTA 2B63J 4NNJA 1SHFA 2BE7D 4DV4K 2WUSA 2UXBK 4LF4K 1GV5A 7AT1B 4FWMA 4KTZA 4CZZA 2L3SA 3BFMA 1I94K 4ATOA 2LDUA 2Z99A 4GV9A 1YJNA 1NM1A 4LMYA 1LQ1A 3LSRA 3PO4A 3CJQB 4AILC 2J5OA 2ED0A 4FU6A 1DU6A 1D3BA 3NAEA 4KT0E 4RB2C 3LLRA 1OPCA 3G6ET 5FWBA 2CQXA 3OYYA 1M1EB 4C23A 1RGIA 3NMZC 3L2RA 3QWXX 4JRQA 2IGMA 5ADXA 5KE3A 2QQBA 4JHDA 3TAEA 4WQ4C 5M1OA 1AZGB 4G6DA 1QTMA 1XSVA 4DA4A 1ZKGA 5TGTA 2LY1A 2YG8A 4JKGB 5LJ5j 2HWVA 1H641 2NRVA 1RL2A 3HDDA 4WTOB 3IAS2 1NKCA 2Y31A 4OB1B 4NHJA 5B1AH 2CUBA 1E4FT 1VQMN 3AVJA 5JVTA 3DTIA 5K5QA 4HNTA 1YIJA 2JS2A 1PD1A 1X2NA 3QDKA 4N0AC 9ANTA 3OYMA 2DXIA 1MH3A 2RPNA 1M1KO 1FT9A 3HSCA 3CF5L 4B9NA 4BRQA 4CCHA 1H88C 3CCVN 1VQKQ 3JTGA 3W3DA 1ASWA 4YHHK 3R1XA 2HYFA 3O3GA 1W36D 4CXFA 4JK7A 3CCLI 2R92J 4Q5SF 5CKBA 4XRFA 2K7LA 1K0SA 1WRJA 1QVGP 4KIFA 5LL6Z 5JMVA 5L3EA 1T56A 4V19K 4OFAA 3VB2A 2NUPA 3WUHA 2XKOC 5F04A 2X3WD 4XLCA 4IIOA 4J9EA 4EA5A 1IGUA 1LVAA 5C6SA 2YJFA 4FWRA 2L01A 2F4IA 2QEXI 3RDIA 4RG8A 3U9GA 4JK1X 5E79C 2CP5A 4N9IA 1YJWI 3D7EO 3OW2A 2XC7A 2OCCH 1SL1A 4M3EA 3QPLA 3WVDB 3I56I 1RAIB 2YHXA 4B1VA 4N56A 2EA4A 3IQLA 1FKPA 3F21A 3L3VA 3CF2A 3GVAA 2RQTA 1V55H 1WSUA 1OCZH 1TL1A 2M30A 4J9DA 1YVUA 2O0YA 2DTHA 1B6AA 3AA3A 2QDLA 2JQ7A 5J39A 3S3OA 3LAMA 2O4XA 4BG9A 2HEQA 2I2LA 2HFHA 2HOAA 2X1DA 2JA5J 4NXNK 3CJAA 4JX5A 2X6YA 2JTMA 2FEIA 1KC8C 3SPZA 1XHXA 4NL2A 3UDCA 1BYMA 3CCJI 2DA1A 4E70A 3ASKA 5CVUA 1KYWA 2E6MA 1YTAA 4J9CA 3LANA 1QP3A 4WXHA 2IRFG 2L5QA 4N0BA 3OW2S 3VEVA 1F43A 5L3GA 4XU0A 1ZK8A 3JSPA 3UF4A 2R7XA 1K61A 5GMKl 4YG2F 3O3HA 2ZFWA 4JX6A 2DXUA 1QLYA 2IBDA 2VBXA 2VONA 3J81O 3PX6A 3WGHA 3CI5A 2PZSA 4XLEA 2JUGA 2P9SB 4B3OA 3LZIA 1FTTA 2JMCA 2KMTA 1G3SA 2Y1JA 2DXCA 5I22A 5KTQA 4OX9K 3CCLA 5A0DA 2K9LA 1U2VB 3CCQI 2DRMA 1M90C 4M77D 1JXSA 4AM3A 4LD9K 1WSFA 4Z89A 3ZEUB 1D1AA 3KVGA 1NYFA 2AXTC 1QHHD 1M8MA 2DA5A 1DT9A 3OSVA 4ON0A 5JVHL 1KK7A 2Q97A 2QEXA 4YOUA 3K2ZA 2BH1A 3OYBA 2ZZDA 4PKHA 5HBMA 1GVJA 3GTGJ 2DMNA 2LY2A 3DBHB 3M3ZA 3K59A 5FU6C 2GOMA 2V7ZA 2AT1B 3K70C 2QTXA 3I56A 3CC7I 1TAUA 3E9OA 3GF5A 1FK9A 1RKWA 5KYXB 2D45A 5F08A 3MEAA 5EZGA 1WJSA 1PWTA 4XTVA 4D0PA 3OS0A 4UVCA 4CI6A 2F5FA 4HUEA 2VOPA 1N5YA 3V81A 2LT1A 1B92A 2OYQA 2QKBA 2XIDA 5ICFA 4X9DA 2YKNA 4JYKA 3VS1A 2CMPA 4HQEA 3DM2A 1WAJA 4Y92A 4C92D 3IV5A 2DTOA 3J7AP 1RI7A 1J5EK 4UV9A 3WT0A 2G8IA 3AA2A 2E60A 3QPHA 5ERIA 2QQ8A 4OMQA 4LF9K 4HSBA 2GWJA 3IKTA 2MI6A 5DMRA 2OTJQ 3FB9A 3CJ7A 3URGA 4CGDA 1R1VA 1WHKA 1YTYA 3ZMUA 5CO7A 1NEBA 3I0WA 1XGSA 1FSEA 2F2XA 1KXPA 3E5XA 1D5AA 5JLHA 2VPRA 4HVUA 1FYNA 4LB5A 1IBLK 1V5EA 4ZGEB 1JTXA 3L09A 5BPDA 3GLLA 3WQTA 3M0SA 3C6UA 3PFYA 4ZGJB 4HCBA 2MG4A 1TUYA 2WONA 3E0JB 1SRMA 2IEKA 4OKKA 4L3QA 5L23A 4RWTA 5FKKA 2O8DA 2HSEB 2KY9A 4Y17A 3FSPA 2BBYA 1TW2A 4FLVA 4L9JA 1C1CA 2NVYJ 3FXJA 1C0TA 4KN7X 4FWLA 2W00A 1BB9A 3CXCA 1ZRDA 1BW5A 2GXGA 3DPLC 2JVHA 3J7AY 3MD2A 1RTDA 1Z6TA 3QDFA 3CCQA 3IDHA 2EIFA 3PMIA 3LX7A 1WH7A 1P92A 2L9NA 1YJNN 3CC2I 4BR5A 4QLCU 5C3EJ 1PRLC 4UUSB 1H8AC 4GV6A 2E2PA 4PUSA 1WQWA 1FMWA 3M8PA 3CVSA 1TWCJ 1KRPA 2YPRA 2MWOA 4S0HB 4PJOA 3C12A 5LHIA 1LCKA 2YNIA 1VYVA 4C92E 3PJRA 3HOVJ 2L7FP 4OAZA 1PUFB 3BJAA 3CC7A 1Y6IA 1RRQA 5M3FJ 4F7UB 2FL7A 4PJNA 3F5TA 2GX9A 5A2QE 3CXCS 2KR3A 1FIPA 2Y2ZA 2DD4A 2R0QC 1PJRA 4M74A 4H4OA 1UAXA 4DSKA 2NNYA 1V76A 2DDAA 1X43A 2ZD1A 3UB5A 1NGGA 2WAEA 1QVUA 3R2XC 3I5UA 1YIJN 3EG9A 1TT0A 3NCIA 3FIWA 5AQYA 1Q86O 2OBPA 4E7ZA 2VVKA 3DLKA 5GMKi 1RC9A 5KAFC 2YUSA 3LNQA 3DLHA 1MJ9A 1M3QA 2ECCA 1MJAA 1U9NA 2F5TX 1T39A 3MXJA 4F2SA 3O8VA 3X28B 5D4RA 3OV8A 4FJ5A 2DVJA 2C6YA 2ZBKA 3RERA 2RK1A 2X4XA 4ZGDB 2ZJ2A 2YRDA 3T69A 1XSXA 1Q82O 3WTTC 2CWEA 3FMQA 5FDLA 3COAC 2DA9A 4S05A 2NZTA 4RDUA 1SEUA 4XKWA 3MZYA 5GANe 4LJZF 3SZ2A 1IUYA 3PSFA 3BQYA 1LNXA 2HQAA 3T7ZA 2PYLA 1SAXA 1KAXA 3CC2A 2VC1A 1GLBG 2WB1A 2AJQA 4JN4A 2RHUA 5E8IA 2K4JA 5LY3A 2HDWA 4NZGA 1Z9ZA 4ESJA 3D2FA 4LG3A 4IOCF 3E9FA 5I2MA 2KFZA 1K9MO 1T0HA 3G4SQ 3FXRA 1UB4A 2BIVA 3MCAB 4HNUA 4G9YA 2KFNA 4M7AG 3VSLA 5GAOr 4EJVA 3RBBB 3G0ZA 3UIQA 4DSJA 1K7AA 4BY7J 3GOXA 5KQDA 1VQOA 1MGTA 1NK7A 1XJWB 1D09B 4HNVA 4CEQA 2WC2A 4DBQA 3EH1A 3M58A 2E2OA 5KGXA 2R7TA 3R61A 4F52A 1U5SA 3BF3A 1I5ZA 4DMNA 3RPUD 5IHNA 2RKHA 4DTUA 2DYRH 1FMVA 4RTVA 4IRHA 4PCQA 1HKBA 4CYCA 4MTEA 2Z2SB 3T8TA 3WTXC 2OPPA 1VQKT 4J5YA 2A6AA 4XLAA 2GFUA 2W82A 3QODA 2MH2A 4TVRA 4JEPA 3KLGA 1BI0A 3JSMA 3SUOA 1N78A 3CERA 3F8CA 2P5VA 3CDHA 3H3UA 1Q95G 5FLXZ 4BJ6C 2PJRA 1D5YA 3M59A 2QG9B 4CGZA 1W36C 2DMUA 2RN2A 2EZKA 3CCLN 5BOXA 2YU3A 3TOBA 3CYMA 3OVNA 2M0MA 3TDZC 5LJ5g 2JOYA 3D2EA 3CPFA 2VG7A 4D6WA 5EJCA 3EE8A 2QQAA 1BDGA 3DQVC 4OGEA 2DMTA 1OYXA 4UY8O 3RZOJ 1YVNA 1R5HA 1MGQA 4DOVA 1NKBA 3R0JA 4X1VA 2QEXN 1JKOC 3TKYA 4C92F 1H9GA 1UCRA 4J00A 3FJPA 4LLLA 3P4IA 4M78A 1YT3A 1SS6A 4C0DC 4QS8A 3I56N 3CQZJ 3OS1A 3M55A 3M07A 3CFPA 4FX4A 2KZZA 1WX6A 1RLQC 2FVUA 2ESWA 1UE9A 4Z2YA 1VQLQ 3ISPA 1YYVA 1T0JA 3FXQA 3K4KA 1IN5A 1HX1A 2DLLA 5HDKA 4F3TA 3G1JA 2ZGZA 3CQTA 4M7DG 3CPWA 3QWYA 2J05A 3ITHA 4NOYA 1MD0A 1OZ3A 3S3NA 4LITA 2QGGA 2X74A 5BREA 1QPMA 4IOAL 1S72I 1UHFA 2JLEA 1ZLKA 3K58A 1DGRM 2COMA 1TVRA 4U67L 1BR1A 3I55I 1VSHA 2HW3A 4FM0A 2DPNA 1K73O 2AZVA 4DQQA 4BY1J 1MBFA 1BI2A 3VPRA 2HVIA 4CFDA 4PL6A 1XG1A 1KIKA 1GLCG 4GV3A 1EO1A 3F22A 2JTVA 3ABKH 1WDXA 1TLHB 1GFCA 1BGXT 2CH6A 1IXCA 5J47A 2COZA 1XSDA 1N8RC 2FMYA 4XLNF 4EM1A 3QB0A 3K1MA 5C10A 1I07A 2DYIA 3SWNC 4YFKF 3CIPA 2X4JA 4CJFA 3LAPA 1XCVA 3REAB 2ZGYA 3EUKL 2QWWA 2RI3A 4HWIA 2E5KA 3E2UA 2E2IJ 4CI0C 4C8QB 3U8XA 4M77C 1X1BA 3CCQN 3M54A 3CPWS 3Q0WA 3AVKA 2X1CA 4DSEA 2R7UA 3K2AA 4ILHA 4KHNA 4OPKA 2QWMA 1AU7A 4OVAA 4CGFA 3QEPA 3JCMg 3LWHA 2JA6J 3I33A 3RNJA 1YLFA 1XMQK 2OQGA 1FYLA 2B0LA 2DZ9A 2L9SA 1PSFA 5AFUH 3ZMDA 4BVPA 4OGCA 5HCKA 4XOTA 2M51A 2XICA 3HO1A 1RAHB 4RGRA 3L4QA 1VA7A 2VV5A 3NWSA 4XTXA 2X48A 4LDWA 3CC7N 3TO9A 1X69A 3PFIA 3EZ5A 4M9XA 3NGYA 1JXMA 1EETA 4ILJA 3K57A 5JS2A 3CZ6A 1U8BA 1YXQA 4CZJA 1L3UA 2F69A 5EGOA 4C92C 2A0FB 2OTJT 4B3AA 4BHPA 5B1BH 4FHTA 2VGNA 4BR2A 1B59A 1LFBA 3K4BA 4L5EA 2W1OA 3ONQA 2XDPA 3U21A 1P2FA 4FZZA 4PL8A 2LRDA 2HQNA 2XK0A 3OW2M 3KFVA 4AFQC 4UUTA 3A5NC 4OO1J 1VRLA 4BHCA 2JSCA 4U0YA 3H3VK 1S72A 2M9UA 4FOEA 2DT6A 2G8VA 2M4GA 2V7FA 3I55A 3C2BA 2VQLA 2GLOA 5AQQA 5DV5A 4MEYF 3P38A 2XAJA 4BRHA 4II3A 1X19A 4IZ9A 1XCBA 1KGSA 2C0OA 2ZGWA 5B3SH 4DB3A 1EWRA 3M6GA 4HDVA 2ZC2A 5HNHA 4CJ7A 3S16J 3FZKA 4BQLA 2KHMA 3VEPA 4YELA 3WTSC 5GMKh 1EP4A 4WFNL 4J2EA 1JJ2P 4EAHD 4N4NB 3S2WA 2EGAA 3G71A 2HQXA 2VGMA 2A08A 3JR9A 4JI8K 4YIFA 4QTRA 1HC8A 2O01E 2MK5A 5LRRA 1DUXC 1YO5C 3O2PE 1RT2A 2A1RA 2EILH 2QYZA 2KQRA 3RRHA 2FBHA 2WFBA 2O7OA 3CC2N 2XI9A 3EUAA 1TYQB 2XKPA 2WB1N 2NNWA 2E88A 5DPKA 4F04B 1GBRA 3SDGA 3VRYA 1TC3C 2VBZA 4BG8A 1WWXA 4DF8A 4M71A 3JRDA 3RDVA 2X9HA 4E3SA 5FKOA 2RE2A 4BQZA 2EK5A 3KZIC 2G8HA 4LLGF 2G7HA 1U8RA 2HBLA 5C25A 1OVQA 2P9KA 1RBSA 5AQZA 1VQON 2XAHA 4CZEA 5IWAK 2UU9K 2XV4S 1R1UA 3BG3A 4JPBW 4BC2A 4DCHA 3V7RA 3LW5E 3VDXA 3AL0B 3ZL7C 5EX5A 2RK2A 2O8BB 3FE1A 1LWEA 2VKNA 1UG2A 2NVTJ 4F3QA 3OH6A 4IO9F 2M0CA 3KEYA 1LB2A 3HTRA 3LWFA 1K9AA 5CKEA 2VASA 4ENNA 1S1TA 4H03B 3ZX2A 3SUNA 1VQMQ 3IMXA 1Q1HA 3PUFA 3OOUA 2O4IA 2DBBA 3I0RA 4PUOA 4AT1B 3THXA 1IKVA 3PM1A 1AEYA 4CBUA 2G0EA 1S1UA 4FE7A 2O03A 3CCVQ 1XNIA 2Q2RA 1L3VA 4B1UB 3VGLA 1FEXA 2DXBA 2JXBA 2HXOA 1K8AU 1XMOK 2W25A 4AF1A 1R36A 1X3WB 2OTLI 2FBKA 1T33A 4IHVA 3VQPA 1X3MA 5J1EA 2A28A 1N32K 1G3WA 1VNDA 4DNCA 1YQRA 5KYWA 3UKUB 3PMTA 2QWLA 2WV1A 1R0AA 4CHZA 2ID6A 2RNGA 4CBWA 4BQNA 3D45A 4DYRA 1N77A 1EF4A 1U06A 2KBTA 2X4WA 1QSLA 3GP8A 3VF4A 4WXDA 3PNWC 1Q7YO 5ELZA 3G4ST 3OIOA 3T1YK 3CWSA 4WQ4A 2Q2EB 3L9FA 3FISA 4I2OA 3L2WA 1F21A 3L2CA 2O8FB 1ETVA 3LM9A 1EH7A 1KEAA 2DEQA 3FGUA 2P51A 3GFIA 5JLWA 1Y71A 3A02A 3TSQA 2BXZA 3SJJA 1D1CA 1W7PB 1QHGA 4BKXA 3CXCM 2MW8A 4DZJA 1SANA 3CC4I 4CO8A 3CMEA 3I3LA 3IAM2 2DXTA 3ER0A 3HPHA 3NF9A 2F7TA 1Q9XA 4L5JA 3M1CA 1GXIE 2F6CA 2KPMA 2QWRA 5AQGA 2LT4A 2E5QA 3VN5A 4WXCA 2D2WA 4DHYA 2F1LA 3QYFA 2YJEA 1HQEA 3VV0A 1TUCA 4K43A 1LNWA 3MEWA 2XPVA 2R5ZA 2LQNA 4RTUA 2DPPB 3THYA 2IDOA 3J81Z 1WQ7A 4R5PA 4A3GJ 3VOVA 4M75E 5GAGP 3CCUI 4CA0A 3B6CA 1C1AA 3TEEA 3FBNB 4DV1K 1QVFP 1O3QA 4B3TK 4FPBA 3H5NA 3QNNA 1OV3A 1OJLA 2R4GA 3A03A 3V4GA 1JKQC 3FLCO 1KLMA 2XDBA 2BY0A 1Q81U 3GEZA 4FVUA 3PQKA 3JB9H 3CMMA 2ITMA 4GNIA 4XIUA 2MWPA 1TP4A 3MJXA 2OTLA 1C6VX 4C3JJ 2R5YA 4RW6A 2E2QA 1OLTA 3OR1C 1XQOA 1LE8B 4HOBA 3SV4A 1MZBA 3H6EA 1X1AA 3GBGA 1E3OC 3UA6A 1O75A 2P4RA 3ZQ7A 3M0UA 2A5WA 5F64A 3WG9A 2QWPA 3WTYC 4JAXA 1CF7A 1XMAA 1RRSA 5GANd 4OAYA 2R93J 2RNJA 1ZR4A 2PI0A 4H4KC 2QBYA 3VYTB 4R55A 1KQSS 3K0SA 1O7FA 5ICEA 1SL2A 1EXQA 3SQ2A 1RRJA 2Q0RA 3CCEI 3HXLA 4EZ6A 1NG9A 3LP1A 1RNLA 2OFKA 1J3TA 4Z0UA 4DU1A 4DYCA 4L9TA 1M2VA 3ZMVA 3WHCA 5EG0A 4RTZA 1B9MA 5J4YA 2HB5A 1PP8F 1D3BB 1S6PA 3MPUB 3TAFA 2A5XA 4Z6YA 3CC4A 3QJ6A 5EG2A 1G6NA 2JK3A 3S32A 4CJTA 3KHYA 4Z94A 4MHGA 4RW9A 2O8EA 5CZ2A 1NK4A 2LNVA 1S72N 4DOWA 4EEFG 4RTTA 2DETA 2P5GA 4JHDB 4IQ4A 6PAXA 1ZG5A 1TAQA 1QHTA 2DMPA 3QNOA 3KD5E 3VQDA 3AKZA 1FX7A 1JU5C 3H9NA 2HBKA 1O3TA 3CEYA 3MX2A 5D7UA 3NGZA 4IJAA 2W7NA 3UR3C 3TU5A 4BH9A 2RPIA 4ZN3A 5KAIC 3LAJA 1S7EA 1QQNA 2E1CA 4A3LJ 3LSTA 3CCUA 2YT6A 2ZPIB 2OF7A 3LP3A 3M8JA 1VQ9I 3GX4X 4YRVA 2GIVA 1WB9A 1TQIA 1SC7A 3GNFB 1KLNA 1P90A 3G71N 2X6XA 3TDUC 1FMKA 4XM3A 2RMOA 2JWTA 1GLDG 4PKIA 2E12A 2M8EA 4OMYA 2NOLA 4XU2A 1NKUA 5F6FA 3VQ4A 2NRWA 3MVPA 3QYBA 2KW4A 1YQAA 2HHQA 3QESA 4KBMB 3SXYA 4EVVA 2RHKA 1T0FC 1A6IA 3DU5A 1YJNQ 3PE0A 4F16A 1WJAA 4A93J 1JUPA 2HNIA 1M27C 3CUQC 4EATA 4B43A 2NUPB 3RYPA 3DI6A 2V8KA 1MBEA 4KITB 5GAEP 3O9SA 1AHDP 5FWCA 4LD0A 1BC8C 3PVLA 4CHOA 5BRHA 1MDMA 4PIIA 5FLXE 1BQMA 2RQRA 2DYSH 1U47A 5DCFA 2HQHA 5D3GA 1UGRB 1U78A 3CCEA 3TREA 4QQDA 2R5AA 2BY2A 3IP4B 1IV0A 4HVVA 1E3MA 4HRIA 1K8AR 4XTYA 3PIPL 5FJ8J 1AKHA 2MOXA 5EEAA 1DDNA 2FF3B 1KJWA 5IY5H 4EGYA 5GAMh 2QW9A 4NBQA 3UKRA 4MZMA 1QRYA 2HMAA 2VG6A 1MW7A 4KN4X 3W3CA 3OYGA 1YWPA 4FPAA 2O4XB 1RUWA 5J8FA 4ZN1A 4UB8C 4YOYA 1YIJQ 2ADUA 4CF0A 1X6OA 1RR8C 5LJ5e 4RM3A 3BR2A 2QA4I 4LFBK 3LDOA 1VHXA 2HOSA 2EINH 3A8YA 3H35A 2I5WA 4JI4K 3RYRA 3BTLA 2L02A 4YFNF 2BTTA 4FJLA 2IT0A 4XAXB 3KTUA 1VQ9A 3MAJA 2FF4A 3CPWM 5GAHP 5GIPA 4M78G 4KGZB 4UV8A 1JCEA 1XQHA 1WJCA 1ETQA 5AQRA 3H3OB 1NBEB 5LHGA 4MDWA 3ZX3A 3VYUB 2GEMA 2G8UA 2DY4A 2CREA 2FG0A 4B9XA 2QKKA 3DLLL 4ESBA 4XKVA 1XN7A 3CHWA 4DQ2A 1Y07A 1W2BP 2G8FA 1BOTO 4ZDPA 3FHZA 3WEEB 4FT2A 3GBQA 3PNTA 4FLTA 1M5Q1 1KQ2A 3V8LA 1SSHA 2BHYA 3OQ5A 2CUJA 2QAZA 4DTNA 1KQSP 4K25A 4CFAA 5GPCA 1OZ2A 4FT4A 5I2SA 1NEGA 2IVWA 4FJHA 2KT8A 2X6NA 3X24B 1S7OA 2PVOB 5FU7C 2PQWA 4BR4A 5AONA 5M5WJ 2MA3A 1Y39A 1Y1WJ 3RR6A 3ZETA 3KUFA 1OOTA 2HYJA 3CMEN 3F8FA 1KG3A 1MKMA 3U9DA 1VZ0A 1FNNA 1B4AA 1NJXA 4M77G 3M0PA 1XD7A 4EM0B 2COBA 1BL0A 1KHCA 2NRRA 2LZ6B 1EH6A 3ZSVA 3SFZA 3WGIA 4Z4HA 5E41A 4DFPA 2DAOA 3ABLH 1VQMT 1QQCA 5KQ8A 1GLLO 5H1SQ 2KIQA 2OPRA 4E7LA 1FKOA 4CK1A 3JB9J 3HB9A 3OS5A 3TQNA 3K9KA 4KHYA 2EX3A 3A5LC 1V4RA 3CCVT 3BZ6A 1IHVA 3WTZA 1TH7A 5CAIA 5KRSA 4G1QA 2DU9A 1NK2P 1QNTA 1J59A 1FBUA 3BCBA 4MQVA 2DBKA 1NJIU 1M1KU 4G8XA 2F5DA 4FJIA 1BU6O 2RQPA 2QA4A 3Q9SA 1NLOC 2D1VA 2JG6A 2GF7A 2GFAA 1D4XA 2DTZA 4M7YA 1QHAA 2Z0WA 3F70A 1I27A 4BR0A 3HRMA 5LBQA 3JCMe 1W1WE 4OPJA 2OZ6A 2OTLN 4J2DA 4EMSA 3CCLQ 3ELKA 4C1NK 2DA2A 5HL7L 3TSPA 3LA3A 4DTSA 1REPC 3PLAA 1OYYA 1JL2A 3VODA 4WFBL 4KV8A 4A0ZA 3RPQA 2O8DB 5L3DA 3DXKB 2QVOA 4I0BA 3H1QA 4MDBA 2RH2A 4EJZA 3I35A 5GIOA 2EW3A 4FSSA 2CSIA 3NRVA 3QO9A 2QEXQ 1D8KA 1I81A 2XAFA 1WN7A 1PG5B 3H36A 5IYDJ 4CD1A 4XH1A 1UA1A 3S41A 1KFSA 1RDUA 4OOIA 1G2HA 1UEBA 4D9JA 3VYGA 2TRTA 3OL4A 3BQZA 1QVPA 3EGXA 3EZWA 1B9NA 3LYIA 3I56Q 2IS1A 2V26A 3OYKA 1U6ZA 1IG8A 3EKSA 3DLBA 3L1PA 5FB2A 3IRXA 4GO1A 3X2QH 1K4SA 3VEXA 3RQ4A 4K0KK 5ICGA 4PJOB 3CC4N 2QYOA 4BQAA 3EFSA 1FIAA 4FW2A 4EP5A 3VEOA 2JT1A 4HLXA 1W4MA 3I4PA 2UXCK 2CUDA 1HJRA 4OKEA 1SAZA 3QPTA 1OR7C 2GTOA 2HBWA 4PFPA 3VTHA 5D5VB 3AG3H 4N4GA 1F9NA 1IG9A 2F4VK 1M2OA 4DEXA 3OL3A 5AQPA 3OJUA 2CSQA 3MEVA 2PFUA 1ITYA 3SBGA 1OU8A 3BP8A 2PVDB 3T1HK 1T3LA 4B1WB 4CC3A 4RAYA 4HTUA 3HVTA 1L3LA 4KH1B 2P84A 4EMKA 3CCUN 1KD1C 4MMKA 1QPIA 3HSBA 3DLEA 2GQVA 1F4KA 3EG9B 5KYNA 2VWFA 4O55A 1K6OA 1LWCA 4B44A 3H92A 5AQLA 1JHFA 1JHHA 2HQEA 3TWHA 2XB5A 5M9OA 1YFHA 4J2AA 4K2EA 1ZYRF 4RMNA 4BE2A 4JKFA 2JWKA 1YG2A 3A1PA 4A2BA 3FK7A 4YEJA 5C4XJ 1L0OC 4MLEA 3EPZA 4X34A 5BRDA 3CCQQ 1ZSGA 2EBIA 2OC6A 1BHLA 2O8KA 3ZT4A 1OQKA 3OYHA 2BUPA 4UQGA 4PHTX 4E2FB 1MMAA 2X35A 1UJYA 2D0NA 3M4YA 2K79A 3BOQA 4UVAA 1LCUA 3OWTA 3F23A 4RB0A 4BRKA 1HR0K 2ID3A 3TTDA 1KG5A 3X26B 3A0BC 2EJRA 1HDPA 3ZEUA 3G3ZA 1JXBA 4PY5A 3DFGA 2YU9J 4PJJA 2YHAA 2K5LA 2CW0F 3N4PA 4CCNA 4EJTA 3CC7Q 5AQSA 2YS9A 1DQUA 4JK8A 4MFEA 3OYNA 2JPSA 3MQ0A 1ORKA 2JGUA 3TGNA 3SV3A 1R4NB 2CH0A 4YORA 5EDNA 2XHKA 4KB1A 1W97L 1HW2A 4HF1A 3C0CA 2LSNA 2LDMA 2ISYA 1OCPA 4IVNA 1TNTA 2KVQG 1D8JA 1ZA2B 3P7NA 2KT0A 4NCGA 3SAHA 3ZSQA 2XSJC 3DMJA 2RN7A 4I02A 3EYYA 4F7UF 1IO6A 1MBHA 3GTLJ 5K7FA 5GAMd 5E18F 2CG4A 4UVBA 1YRNA 4MQ9F 3SWNA 1BA0A 1T3SA 4DFMA 5JI6A 2XHIA 1HMVA 5K1YA 5TKYA 2VXZA 5AR0A 3FMSA 2Q1ZB 2HVRA 3KJVA 1QZZA 4FLXA 3SHFA 4AFZC 1UOCA 2CT3A 1N9SA 1QU3A 2K85A 3EGDB 3M5RA 4R79A 4BRGA 5JHFA 4CYCB 1VQ9N 2EV6A 1VQ8I 5HS9A 3OYIA 1LJOA 1WFXA 2FX0A 5H20A 2H3GX 2DFFA 1R58A 4XSXF 3B8AX 1KTQA 3HRGA 2EGCA 5HP1A 3O3KA 5EEHA 1RAGB 5TRDA 4I9LA 4IXAA 2PJRB 1YJNT 4M42A 2FZCB 3SAGA 1WOQA 3O9UA 1SVMA 4CJ4A 1NM7A 1T08B 3VQ8A 3FHFA 4C8OA 3BE3A 2PUOB 4DOZA 1RAEB 3JCMQ 3FK6A 4BRIA 3D2EB 4ICLA 3CC2Q 1KYZA 3RESA 3D0SA 3LPUA 4UXNA 4HYEA 1N36K 1JT0A 5HNFA 2BV6A 1W70A 3RWUA 2VKHA 1VQ6I 1I6XA 4RLFA 3LFUA 3BROA 2F9WA 4W5OA 1M1KR 2MYSA 5GANj 1N6QA 2H8RA 4E6RA 3KLNA 3N5BB 2P8TA 2F2WA 3W2VA 1YJ9I 2QWOA 1UHWA 3QFUA 3KZBA 4E6KG 4XTZA 1VQOQ 1XTDA 4M78B 3F8BA 1WBBA 2KZVA 2DERA 2FQ3A 3O08A 2IC3A 4Z4IA 5J8CA 1I0CA 3BR1A 4RAZA 1QCFA 1YIJT 4IOXA 1LVKA 4H8KA 3F3XA 5TISC 1WUAA 4Q0BA 5E3OA 3HP6A 2KGTA 4BQOA 1R6RA 1OMIA 2H56A 2EZHA 2DX1A 1W0UA 1M3CA 2X4YA 3HYIA 1T44A 4UNFA 4G7OF 3ABTA 2ABKA 4M9ZA 2V79A 3BUZB 2KDOA 4GLMA 2ZPHB 1OKRA 4EGZA 1VQLI 2QA4N 1MUZA 2K3PA 1WZOA 3KYDB 1KAZA 3K9TA 2FBTA 1R8OB 2HF3A 1ZAOA 1B7TA 2YX4A 3MWMA 2CYZB 4MLHA 2D0BA 1FOYA 3TQ7P 1YBYA 1VQ8A 3OOPA 2LX9A 3A5ZB 4N9HA 5GMKm 2ZMEA 4M4ZA 4E9EA 4CJQA 1U48A 1Z3YA 1M90O 2HHUA 1YX3A 2CW7A 2A61A 3OYCA 2OQRA 3JCMX 2P0PA 2EIJH 2I7PA 3ZT0A 2J4RA 1WXBA 4IO8A 1YQLA 2I7NA 2YNFA 3A01A 3G10A 3VS6A 4CCLA 3LP0A 1RR7A 4B3SK 5GMKj 2HNDA 2Y0SA 3A2KA 4XRSA 3I5SA 2AA4A 4A57A 3RSEA 1I4K1 4DZPA 5AQTA 2MABA 1FLIA 2CO5A 3FFIA 4BEHB 1HKQA 3HK2A 4CZHA 1H8KA 5GJVB 3J80O 1ESVA 4B47A 1HNVA 1VQ6A 2HHVA 2E8AA 1K9MU 2D0OA 2ZPEB 4M7AD 3I53A 1CQTA 4M3UA 3NH0A 2GA1A 3KETA 4O44A 1NG7A 2E34A 3PUBA 1OCTC 3SNNA 3FXLA 1S1NA 3VYHB 3VYRB 4L6V5 5CQEA 1YJ9A 3FZVA 4YIRX 3ZX0A 4RM2A 1U1TA 2CP0A 3CESA 3ZMTA 1ZBSA 1AD5A 4MNUA 4A5AA 4FTHA 1RBVA 2P9IA 3QHSA 2HD0A 3WE3A 2VE9A 4Y28E 2OCEA 3VQAA 1YW7A 3G1LA 4CCJA 3R6NA 2O31A 3HPWA 3ASMA 3BY7A 3ZPLA 2ISZA 4V2GA 3ZMZA 5EGOB 5LGTA 1NK3P 1ZBLA 2DDBA 2XY6A 3BTCA 2OJED 4EJWA 4KMFA 4ENMA 4J6YA 4GLKA 3VEZA 1GOCA 3ESWB 4XTWA 1PHTA 4E7KA 4CJWA 1MHNA 4ORZA 3CCLT 1VQLA 3M57A 4LF5K 3PO5A 1W5SA 2FMLA 3OR2C 2Z1IA 2V1DA 3FEOA 4CJEA 3QMLA 2J6KA 3JCMb 1NGIA 1W7PD 5KPTA 2ZJQL 3VQEA 2IVOA 1JJ8C 2GTJA 1YF5L 2DCEA 1NBWA 2QEXT 2AQEA 2ZWHA 2PMUA 1DGWY 4OB2B 4AHSA 1BO5O 3EKUA 3ML6A 3HYFA 1SSFA 4F55A 1S3JA 5AFUA 1WVRA 3CUOA 5C44J 1X3NA 1YCSB 5F1RA 4XTUA 2D1KA 3ZSZA 3I56T 1PUEE 2QUFA 3IFRA 4M7AE 5CR2A 3KK7A 3SZPA 5I3UA 2XMFA 4ISEA 3THVA 2PX9A 2ETHA 1IDYA 2IVNA 2VG5A 4LF8K 4CBXA 1NGDA 1MMSA 3KKRA 2ME0A 4Y3OA 3O1BA 2IGOA 1WEGA 3PO3J 2VWKA 4DLEA 3RPUA 1NGJA 5HDGA 3GUDA 4E1JA 1K4TA 1WJEA 4FLUA 5ILUA 2FNPA 1ZGJA 1K76A 4MZTA 4CD3A 3V42A 2JN6A 4J9GA 3JCMV 2IOCA 2LFBA 5TKWA 1RDBA 3NH2A 3QSUA 4FW1A 2IJLA 2DL5A 3M53A 4M7DD 4ZTJA 2KJCA 2P6SA 3H08A 4CERA 2YV0X 5M3MJ 3RQIA 2CH5A 4E1NA 3I9V2 2CS3A 3IHOA 3VUBA 3BR6A 2ATCB 1IN6A 1RUOA 3GNGA 2HR3A 1ETWA 3X20B 3RMAA 4BXFA 2NS8A 4Y52J 2FBVA 1JLQA 4YPRA 1S72Q 1PCXA 2RQUA 2VUBA 3M4OJ 3F2KA 5HRNA 2GUPA 1NGAA 2LSOA 5EVZA 4RTYA 3I55Q 3G7ZA 2AKLA 1IB8A 1LV5A 5DD4A 1PKTA 1OYWA 3C6TA 1WLJA 1J6ZA 4JLGA 3HVRA 1P8ZA 2KXCA 5BN9A 3WVEB 2VQHA 4HSTA 3FM5A 4V19S 3UT1A 2ROTA 3TSZA 2GAUA 1Z77A 4X65K 2IA2A 3CCQT 1HYZA 5KPRA 1S6QA 1E3HA 1C0FA 3HM8A 1V29B 2YCHA 3HOUJ 3J7ZO 2YUOA 3G71Q 3OYEA 2IGKA 3TO6A 3QOEA 3THXB 3HBTA 1TWFJ 4C8MA 3VQ9A 2VKDA 4M3XA 2DO7A 3JCMd 2HBJA 3M9AA 5FROA 4OWRB 4G12A 1G5VA 1H3ZA 2KRNA 1WEIA 3AO5A 2QGFB 4F2RA 5DD8A 5EXWA 3QEIA 2XAUA 2L7ZA 1UUEA 3Q0VA 2LF8A 1D0XA 4OLBA 1AT1B 2JM9A 4DUYK 4A3FJ 2CZ0B 2WSCE 2HOTA 1WCMJ 4KIBA 3CCRI 3H3ZA 3CC7T 4C8QA 1HDDC 3JAMK 3IRQA 3ISNC 3AVAA 2XB0X 1K8AO 1FJGK 2JZ2A 4Q47A 4M7DE 2IVMA 3N05A 1J09A 1TL8A 1RTJA 2P9NA 5C0MA 2X6SA 4DGWB 3BPXA 3BG5A 1GFDA 3ZFJA 2CP6A 4HTLA 4LXCA 1YHQI 2O6GE 2HVHA 4ABZA 2RKIA 1S9GA 2XY7A 2JRTA 3MCPA 3NPFA 1KZHA 5IN1A 2HKOA 1MWKA 3OB9A 2J06A 3V9WA 1VRTA 2IIRA 4A6DA 2LLKA 2Z1GA 3CLOA 3MX5A 1VAZA 2DK3A 2WV0A 4FM2A 4H0EA 3J7YP 1S1XA 4DYQA 3QIOA 3FFKB 1P59A 1G4DA 5GTIC 4Z8AA 1OEBA 3WODF 4DG1A 3QZ9B 1IV6A 2MF2A 1R71A 1T6DA 2CUFA 3JCMc 4C3IJ 3JB9I 3A0HC 1MUDA 4E19A 3TI0A 1Y1VJ 4DJAA 4A3CJ 1HXDA 1MUNA 5FRMA 4ZDOA 4XH4A 1NLPC 2R5ZB 4L9NA 1VQ8N 3C95A 3THYB 3MWPA 1K9MR 2V1UA 1V4SA 3F9MA 3J8AA 1VRUA 3SD4A 4DV7K 3DOLA 3WNHA 1HYVA 4KBOA 1KG7A 4WK8F 3K5OA 3OBYA 4M7AF 3GTMJ 1JJ6C 4II2A 3KZYA 2YRVA 4KGXB 1OKJA 4KI6A 1KQ8A 3CC2T 3OMGA 3JV3A 3OA9A 3H5RA 2X85A 3R8EA 4ID5A 4CCKA 3M9QA 3MKLA 4FJ9A 1JUSA 3C2HA 1H0MA 3IL2A 4ISGA 3GW2A 2Y0SN 4EMGA 4A53A 2M1BA 4Q5WA 4XU3A 4IG3A 2GELA 2R5YB 3BG9A 3P1GA 1QMCA 4PK4A 5BS6A 1VQOT 3CCRA 3JRZA 1RPWA 3W6VA 2OAUA 1VQ6N 1Q81O 4AIKA 1SEMA 2E71A 4BDYA 3ME9A 4YOWA 1YJ9N 4RGXA 3RKWA 1R23A 2WOMA 2QBYB 3GOIA 5LMUK 3N0UA 3CMEQ 3ZQQA 4NQWA 2EYQA 1QQIA 1J5OA 2QSFX 1YHQA 4CCMA 4FWOA 5I21A 3G73A 3GMEA 4RTXA 2JJ7A 3KP5A 4DQ8A 1UJ0A 1W4SA 1M2VB 2V6CA 2V9KA 2UUCK 3LL3A 2HHSA 3FC3A 1GT0C 1E17A 1TUGB 3ULRB 4BS9A 3FKJA 1WSEA 5D5WB 5F0FA 1LKXA 4I9QA 2IS2A 1TWGJ 2PYJA 5GAMj 5AQIA 4ZYAA 3WQUA 3QKJA 4HX4A 2O8EB 3HJEA 3BZCA 3W2WA 1SAUA 3CCMI 3EE9A 1ZTRA 1N8RO 1QVGA 1VQ5I 3VEYA 1PSEA 3RKYA 2CGPA 1CKBA 2DQRA 1P7JA 1UG1A 2KISA 2D4WA 2CJJA 2NUTA 1STZA 2OTLQ 2Y90A 1F5TA 3AL0C 3JRGA 4OINF 4E9HA 4ESFA 1IKXA 1WJ5A 4K42A 1ZG3A 1G3TA 2ZXIA 3AA5X 4M7DF 4CZFA 1JKPC 3HTSB 5C15A 1BI1A 4DTJA 3ENHA 4CDGA 1QKXA 1Q7YU 1Q86C 4FASD 3JSCA 3SZTA 2ICWG 2E3IA 4DTPA 5CKTA 4RTWA 1N9RA 1ASUA 3KXTA 4X6AJ 3EUHA 1Y8QB 3BDUA 3CJTB 2I5JA 4B09A 3LAKA 4CGGA 1SPKA 3HSEA 4DBHA 4CSWA 1SMYF 3E9PA 5J2QA 4DWIA 4M7AC 2LQWA 2DOAA 4EIAA 3PIPF 3RMQA 1JXOA 4FWPA 5CVVA 1T2KA 3C4SA 2PNIA 4BI8B 2L4MA 1Q82C 3NQOA 1MDMB 2F4MB 5A2QK 3CC4Q 2LKPA 3E5UA 1NYGA 2L2PA 5GAGJ 1A5WA 1CXQA 1ON2A 2NRZA 4I7FA 2JS0A 2E1ZA 3ENBA 1JRIA 4BE0A 4FISA 3HG9A 2HSTA 3HSRA 2EV0A 3NARA 3L3UA 4DSIA 4M75A 1AKHB 1LDDA 3GG4A 2K4BA 1KA8A 5CLSA 1SFKA 3VSKA 4ZJZA 2Q0OA 1RBTA 1QZ5A 1P4XA 4I2PA 3UKRB 4YOXA 2UXXA 5DTDA 1A6QA 2O3FA 2BW3A 4MO5A 5L8RE 4FJXA 4LD6A 4Y1DA 3QINA 3CCUQ 4IG0A 1K9MC 2WTUA 1SD4A 1SG5A 1B3QA 3KEOA 3CCMA 3TW7A 2ECZA 1WH5A 5LFAA 4OFHA 1VQ5A 3SBTA 3IWFA 4L0YB 3MK6A 3TU4K 1J75A 2OJ2A 1HLUA 2A6HF 4XKBA 3FXKA 1TK0A 2HZTA 1S3XA 4MDXA 3CJNA 2FD5A 3K5LA 3NHNA 1BIAA 2MSYA 2EPDA 1POGA 3O4WA 4II1A 1SKUB 2CU7A 2OU2A 3QYEA 1CXUA 3VRZA 2QZ8A 2ETJA 2KEAA 5MLCQ 3GTPJ 2ASPA 5FPMA 5IP6A 3L2VA 4I2QA 2Z1HA 1D1BA 3WXMB 2XGDA 4F17A 1QSSA 3GFLA 3L1AA 3U6FA 2VQCA 3VU3C 3T9NA 2JZYA 1LE8A 1X9WA 4HF0A 3MXMA 4MMLA 2PAVA 1ON1A 4J19A 1OH8A 4RW7A 1W5TA 3IH4A 4IHYA 4BDPA 1T3VA 4GVMA 1OH7A 3I8DA 1W5CC 2EB7A 2H1LA 5BPNA 2E5NA 2VYPA 2G8KA 4M7DC 1UHCA 1ZYQA 4XKCA 2DJQA 3ZQIA 1IAWA 3NWTA 5CKFA 1BKBA 1S72T 1OCCH 3KP6A 2VT2A 1UGQB 4EZ9A 3UPUA 4WQ5C 3I55T 1ORNA 2KIMA 3ZETB 5IT3A 1KU3A 5KH6A 1WGXA 3M3YJ 1VIFA 4RG2A 2FJ1A 4L5GA 4H5RA 1L3SA 1VSFA 1AOYA 5E1WA 3MHXA 3DLAA 3K9JA 2KRMA 1WI3A 2VT3A 4AD9A 2QASA 4MZPA 4DR2K 2W57A 1OQYA 2M45A 2FPDA 2O5RA 1T98A 4JKDA 4ANJA 1SFXA 2ELKA 1N3AA 4ZNXA 4PWDA 3TOAA 3G71T 1H92A 1DGKN 2V1RA 3ALYA 4A4KA 1E7OA 3KP2A 1VQ9Q 4H0YB 3KCCA 2JVGA 4XRSG 1C0UA 2RF2A 4FWNA 3V8JA 1Z3XA 3FWEA 3BDPA 3CETA 5KN8A 5GAEJ 3EQLF 2E5LK 4LB6B 4YOTA 4B24A 3WXLA 4W5TA 4K11A 2LQKA 1DJ7B 3X25B 1B8IA 4PGGA 4JK9A 2K9SA 3DLLA 4LUDA 1IBMK 2BE2A 4FJ8A 1OPLA 1TZLA 1NJIO 2V9VA 3H0HA 4QW2A 1K73C 1Y0MA 1IJJA 5HRRA 3WNEA 4W5NA 3DEWA 3CCRN 4BROA 2W48A 1WHGA 3U4LA 3V8KA 2DTIA 4HW0A 5M1KA 1HPZA 3D0PA 1FYKA 3MXIA 4EV0A 5KYUA 1KFDA 2NRXA 4JZ3A 5K7HA 1ZBXA 2VWJA 4OMNA 4FSVA 2EJ9A 4O6JA 5C42A 5DEQA 5LRSA 1KU2A 5CQGA 3FZFA 2K5CA 1YHQN 3F8NA 5E1XA 1ZHFA 3EGXB 1ZREA 5D6YA 1NG2A 3K2PA 2CV0A 5FLMJ 2IAIA 3PSIA 2B4JA 4XRMA 3AA4A 2I5UA 4Z4CA 4Y91A 5IXFA 4CEAA 1ERDA 4U0VA 1ONVA 2DK8A 3NDKA 2GOXB 1NOYA 2I0NA 4QWQA 1J7KA 3CJCA 2FO0A 4ME7A 3AG4H 5LJ3g 4WF9L 1WHHA 3AAQA 2CH4W 3K5NA 3JAME 2YUPA 2W6KA