4BACA

Prototype foamy virus strand transfer complexes on product dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Assembly of Prototype Foamy Virus Strand Transfer Complexes on Product DNA Bypassing Catalysis of Integration.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 82
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bacA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bacA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bacA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bacA03
2RF2A 3RRGA 4BDZA 3OMGA 4B8AB 4NYFA 3VQ8A 4FLZA 4KFBA 3T3FA 3EZ5A 4CGIA 2RHUA 1RDCA 1RT3A 1LW2A 5CYMA 4IBNA 1T03A 3DB3A 4QAGA 3QJ6A 4Y1CA 4EP4A 4DSLA 1OYXA 3I0SA 4KV8A 3E01A 2G8FA 4CGJA 1L3TA 1BIUA 1EKEA 1RT6A 4B9TA 3V9WA 4DQQA 4DSKA 3ZSRA 3I8DA 2JLEA 1NJWA 1RBVA 3OYKA 3ZT3A 4F4KA 2BIVA 4BE1A 5J2MA 4FLXA 2RJEA 1T05A 2EQUA 3ITHA 4CGDA 4W5QA 1NK8A 4ZTJA 4M3YA 1W0HA 4FJKA 2X4XA 2B6AA 1RT5A 4CHNA 4UQGA 2OPPA 4B8CA 5KRTA 3VQAA 3DLGA 3SPZA 3SUQA 1G15A 3LWLA 2QXFA 1VSDA 3KLGA 1RBTA 4M3RA 3NBPA 4FZXC 4DLEA 1WAFA 3NH2A 1ZYQA 3MP8A 5D6YA 1IKWA 5SZTA 4FXDA 2IG0A 4CGFA 4MQ3A 4CESA 4CJFA 1RCHA 4CIGA 3MEUA 1N5YA 1QTMA 3ASKA 5HRPA 2HNYA 1BQMA 3VQ6A 1MHNA 1UAXA 4RW7A 3TI0A 3OYGA 4YNQA 1N27A 5D6WA 5SWMA 3FFIA 2LTOA 3DLEA 1KFSA 4KHQA 4DS5A 2R58A 3IS9A 4PA1A 2Q3SA 3LAMA 1TK8A 4GVMA 1IG9A 3NF9A 2B8AA 3V9SA 1KRPA 4OPJA 4QQGA 4M42A 3NAEA 3PX6A 3HP6A 1D8YA 1XHXA 3ZT4A 4BE0A 4N56A 3QEVA 1Q9XA 4E7JA 3AO5A 2P1JA 3HL8A 2XRIA 1HQUA 5JS2A 3M8PA 4HHTA 3GOXA 1RT2A 4MFBA 1VSLA 2HHVA 4CJVA 3O4QA 3TWHA 2YV0X 4M3ZA 3BGRA 2F5KA 2YHBA 3MEWA 3LP1A 4C8KA 2DIQA 4ZTFA 4EDUA 2ZQBA 3KLIA 4PLLA 3WNHA 4OLAA 3V1OA 4DFMA 3LGLA 3LWMA 3TARA 4QVZA 3S9HA 3ZEHA 1NK5A 4CHOA 2NLUA 3NE6A 1WJRA 3AVMA 2RI2A 4KO0A 3VQ5A 3KIOA 1WLJA 1WAJA 5CIUA 1GOCA 3C94A 3AVLA 1C1CA 1S1TA 3JSMA 3U3YA 3HK2A 4CJEA 3NGZA 3ISNC 2HVIA 3LZIA 3MEEA 3AVJA 3F70A 1KTQA 4EZ9A 3EY1A 2Y1JA 4Z0UA 2FBXA 4RG8A 4RW8A 4FW2A 4M45A 4FLTA 1TV6A 3LAKA 3META 1YVUA 4CHQA 4A4HA 3VA0A 1UA1A 4IURA 4FLYA 3QEWA 4RW6A 3ZSZA 3TAPA 3DYAA 3NH1A 3SUOA 1JLCA 1KSPA 2E6LA 3DMJA 2RJDA 3KD5E 4E7KA 4G1QA 1HYVA 4HCBA 1Z26A 4O55A 2DFEA 1NK4A 2LDMA 4E1NA 2F8SA 2LCCA 1GOAA 1XNIA 1O1WA 1Q8IA 2E4LA 3CG7A 3QEPA 3OYIA 4DTUA 3A2FA 3U3GA 4NCGA 3RRHA 1FK9A 2NUBA 1LW0A 1TKTA 4LY7A 3QETA 3M8SA 1LV5A 4DU1A 5I42A 1DLOA 2KZZA 3M8RA 1KHCA 1U04A 4NCAA 2YNIA 3KKSA 2GUIA 4DSIA 4FJMA 4Q5WA 4OLBA 1C0UA 3TR8A 2P5OA 4FM0A 3AVNA 1CLQA 2I5JA 3FC3A 3V1QA 2Z1IA 4C5GA 4I7FA 4IUPA 2HW3A 2HNZA 3RTVA 2ZD1A 1BI4A 4C8NA 5D3GA 3DOKA 4E3SA 1JLGA 4CCHA 4A4FA 3MECA 2QKKA 5J2NA 4F8RA 3MO8A 2RI5A 4OKEA 3CFPA 4II1A 5KE2A 4KKOA 1TAQA 5KE3A 1KVBA 4C8LA 1ZBFA 5HRNA 2B5JA 3DRSA 3LP3A 2P5GA 3AVBA 3TAFA 1FKPA 1JXBA 3SPYA 3HPHA 3QINA 4DTXA 1LWCA 4IDKA 4KHYA 4CF0A 3G0ZA 3MAQA 2XY7A 1L3SA 5IAYA 1MU2A 4LD0A 2GFAA 3O3GA 4FJ8A 5EU7A 3ASMA 3DRPA 4CJSA 4M3TA 5HBMA 3ZSYA 3QLHA 4CK1A 3HO1A 1RTDA 3SJJA 4CE9A 3KTQA 4AHTA 3UWNA 2BKDN 3L2QA 2XO7A 2AJQA 4FZYA 4IUQA 3ALYA 1WSEA 4OPKA 3KLEA 4E19A 2RO0A 4DU3A 4FU6A 4FLWA 3O3HA 3DOLA 3VQCA 2O4GA 4CEAA 1QHTA 1J5OA 2XDPA 3VQQA 4Z4HA 3TANA 4M41A 3CM6A 4CEBA 4FK2A 3ULDA 3P1GA 4J2EA 3MEDA 4QQ6A 1GOBA 3K5NA 2R5MA 5HP1A 4JRPA 3OMCA 2YNFA 3M8QA 4B9NA 2FC0A 4B3OA 3H6ZA 3NTHA 4FJHA 4DU4A 4FLVA 4DFJA 2Z1JA 2G8IA 3K2PA 2K3YA 4QOZB 1WJQA 4E7IA 4CJ3A 1VRTA 5J39A 2YNHA 3U6FA 2EX3A 3QIOA 4J2BA 2FHDA 1D9FA 4LH5A 4HUFA 3OB9A 3SUPA 1BIZA 4BDPA 3L8BA 3I0RA 3MP6A 3WNGA 1IKYA 1WSFA 4CJTA 2RHZA 3JYTA 3K5OA 2MWPA 3S3NA 1F21A 4EZ6A 4B9XA 2HQEA 1ZBLA 4ELTA 3LH0A 3NH0A 4JLHA 4HTUA 4CEOA 1J54A 3UIQA 4FM1A 4DS4A 2F8TA 4LSNA 3EAEA 1KVCA 1TGOA 4OVLA 4FM2A 3DLBA 4LH4A 4N4GA 4DTMA 2XY8A 3LP0A 4A4EA 3LPUA 4DSFA 1NJXA 4CEDA 2X78A 1SV5A 3SQ0A 3HJFA 3ZT2A 3QESA 4CF9A 4DQIA 4IG3A 1U47A 2P51A 3KK1A 1G5VA 5C24A 1U48A 4NS5A 3OS1A 4I9QA 1BISA 4CRIA 2MWOA 3B6PA 5CZ1A 2VYTA 4Z02A 4DTJA 4Z4IA 3RR8A 4CJ5A 3HP9A 4M3UA 2M0OA 4BD3A 2IS3A 3K58A 3NGYA 4UC4A 2BANA 2D0AA 3T1AA 3SCXA 1KCFA 3AVHA 3SNNA 4CFDA 3THVA 3L3VA 1HQEA 3SQ1A 3ZSQA 1HPZA 4GY5A 1FXXA 4HCZA 3HPGA 4CIEA 2HB5A 4ICLA 3AVKA 2E6NA 2XK0A 3VA3A 4KI4A 4PLIA 3G10A 4N4HA 4PL6A 2ATQA 1BHLA 4FJLA 2OPRA 3L2WA 2D9TA 4Q0BA 1A5VA 4DTOA 1HYSA 3TAMA 1TKDA 1WSIA 3PV8A 1U45A 5KRSA 3SQ4A 3LANA 4CJRA 5HRRA 3AA3A 3C4SA 1RT4A 2DFFA 4FJJA 3SI6A 1HNIA 1KFDA 1N6QA 3VQ7A 3QERA 4CJPA 4IFYA 4CFBA 1NKBA 4L59A 2OYQA 1SL0A 3QBYA 5J2QA 3SV3A 1JKHA 2G3RA 4FJXA 2WACA 2RHIA 2ETJA 5KCOA 1QSSA 2IC3A 4RG2A 5KGWA 2Z1GA 4RW9A 3HXMA 1Y97A 3P83D 2D0BA 5FRMA 3NFAA 4CHZA 1SKWA 4QW2A 4KHSA 2RHXA 4L8RB 4FVMA 5J1EA 2WONA 5FDLA 4PWDA 3OYNA 3KKRA 1L3UA 1ASVA 2R57A 1EX4A 2HHQA 3AVFA 1C1BA 1EP4A 4OKKA 4CEEA 3KJVA 2OZMA 2L3RA 1UA0A 4DFKA 1HRHA 2O4XA 1T8EA 2W42A 2VG7A 4CHPA 3RWUA 3NTKA 2EFIA 1OZ2A 3NDKA 2DIGA 4FJGA 3OYDA 4W5OA 5C42A 4CJWA 1BQNA 1ASWA 3NF7A 4CJKA 3H08A 3ZSVA 3QEIA 2XY6A 3L2UA 5FROA 3SYZA 1BL3A 3MXIA 2FBTA 2G8HA 2M1HA 2RHYA 3CM5A 2VWKA 1NK7A 4CF8A 1CXQA 4CEFA 4KPYA 3NTIA 1YT3A 2PQWA 5JS1A 4DTPA 4DSJA 4Z4FA 1SKSA 3LPTA 2ITGA 1RDDA 1EXQA 2KQ2A 3C95A 2HHUA 2A1SA 3SV4A 4C5IA 1WSGA 2KTQA 1R0AA 3LX7A 5KH6A 3DLRA 4IKFA 2RKIA 4N76A 3ME9A 5C25A 4DFPA 4CFCA 4Z4GA 1FKOA 4E0DA 1BCMA 3RMBA 3S6WA 4IG0A 1CZ9A 4DQSA 3PY8A 2G8WA 3Q1JA 1WJSA 2GBZA 3FLGA 5KTQA 4B9VA 4AHVA 1JL2A 3OQ5A 4AHRA 3UT1A 2Z1HA 5FRNA 2HNDA 2G8KA 3RMCA 4ELUA 4AILC 4E7LA 3FDRA 4M3WA 2G8UA 3HPOA 4DG1A 4F3OA 1RBSA 5DK5A 2HHSA 1SSFA 3QO9A 4CEZA 1RTHA 3PX4A 3KK2A 3WNFA 2VG5A 3ZCMA 4IFVA 2HHTA 3LGFA 2PYJA 4HCCA 4CIFA 2CKKA 2X4WA 3RMDA 4BWMA 4C8OA 4ID5A 4BDYA 4CF2A 1C0MA 3VQDA 3QIIA 3VQ9A 4I9LA 4KB1A 3C6UA 1S1XA 3CQ8A 3SZ2A 2D5RA 4FCYA 5HROA 4PUOA 2PY5A 4KB0A 3F9KA 2RJCA 2X35A 4B9UA 3PMTA 4IUTA 3ZT1A 3LP2A 4Z4CA 3PX0A 4O44A 3V9UA 4DLGA 3AA2A 1WGSA 3CFRA 2K3XA 4CGGA 3HT3A 2DAQA 4BWJA 3ZSOA 2E5QA 4B08A 1CXUA 3AV9A 3QEXA 3AVCA 1XI1A 4Z4EA 3B6OA 1U4BA 1LWEA 3C6TA 1HNVA 2QQRA 2PYLA 3MP1A 1IKVA 4DF4A 2XHBA 3OJSA 3VQ4A 5M9OA 2RJFA 4H4MA 2E6MA 1W9HA 2KFZA 1BI4B 5HLFA 4FJ5A 3PNWC 4C5EA 3LALA 4KTQA 1TVRA 4OJRA 2KFNA 3KLHA 1NKEA 2X74A 2P0KA 4W5NA 4CK2A 2BGGA 1NJZA 1X9MA 5CYQA 2EQKA 3QNOA 1JLFA 2XY5A 1IKXA 2B4JA 4CERA 3LLRA 2RN2A 1QSLA 5D6XA 4B9SA 3AO4A 1SUQA 4NYNA 4CF1A 4CECA 1VSFA 1QQCA 2L8DA 1NKCA 1RNHA 3OYLA 3PFSA 3AA5X 4OGCA 1S1UA 3S3MA 4FJ7A 1H3ZA 3F73A 1S6PA 3WNEA 4OVAA 3DM2A 1NOZA 2YHAA 1X9WA 5E41A 4Q5VA 1QE1A 1UOCA 4FK4A 4B9WA 1EETA 3K59A 3BDPA 1RDBA 2YRVA 1B92A 3DLMA 2GV9A 2DFHA 3KUFA 1SL2A 2OPQA 4DF8A 1JLQA 4FYDA 1VSMA 3K5LA 1LWFA 3BDLA 4C5HA 5J26A 5C0MA 4N41A 4DTNA 3K57A 2GF7A 3MEVA 3AO1A 3L2RA 5J2PA 1IO2A 2YKNA 2HHWA 4BE2A 4N4IA 4FZZA 4N47A 3E9FA 4R5PA 4E7HA 2KW4A 3OYCA 4M3XA 2D0CA 3DRRA 4W5TA 4O5BA 2IAJA 4KTZA 4KHUA 3HYFA 2G8VA 3HVRA 4PQUA 3DB4A 4B9LA 1D5AA 4TSXA 4DMNA 4FK0A 1C6VA 3T19A 3H8ZA 3S3OA 4KHWA 4HVJA 3OJUA 3NCIA 1T7PA 1A5WA 4KI6A 4RW4A 3QKJA 2HMIA 3RMAA 1BGXT 3TAEA 4WE1A 3O4NA 4E89A 2QK9A 3KLFA 1JL1A 3V6DA 3P8HA 3PO4A 3OYMA 2ZE2A 1XC9A 2WOMA 4FW1A 1TK5A 4H8KA 4HUEA 4KREA 2M16A 3TAQA 2OZSA 3VQPA 3OVNA 3L42A 1NK6A 1S9GA 4CEQA 1C0TA 1KLNA 2KZMA 2JGUA 2RPIA 1VSHA 1KLMA 5C6SA 1RTIA 3VQEA 3V81A 3V4IA 1VSJA 1BCOA 3SUNA 4OKJA 1VSKA 5I3UA 4QQDA 4Y1DA 4ZHRA 2RI3A 3VN5A 1VSEA 3ZSXA 2BE2A 1K6YA 3DI6A 4I2QA 4KRFA 3OYEA 4A4GA 5KGXA 2HHXA 1WSJA 2QQSA 1S5JA 3K5MA 1J53A 4AHUA 4ELVA 3TABA 3OS0A 3QIPA 3SQ2A 4F2SA 3QNNA 3MXMA 4DTRA 3D0PA 4DWIA 4QCLA 1TAUA 4NCBA 3D45A 1S6QA 2JTFA 3HVTA 2IOCA 1ITGA 1S1WA 3PUFA 1B9DA 1TK0A 4FLUA 3OYHA 1B9FA 2X6NA 4AHSA 1X9SA 3AA4A 1RILA 2EHGA 1YTUA 4IUUA 1ZBHA 2Y1IA 3CEYA 1Q9YA 2OA8A 4O0JA 3LYIA 4OGEA 3OYFA 4DTSA 2BDPA 3HM9A 2X4YA 4J2AA 3KD1E 3P5JA 1OZ3A 1C1AA 2HQXA 4HUGA 3PO5A 4F2RA 1VRUA 2YNGA 2F96A 1DTQA 4AH9A 4JS4A 3L3UA 3PMIA 5DMRA 3OYBA 1UWBA 4KAZA 3E9GA 1SL1A 4X34A 1REVA 4NZGA 3ZSWA 1A5XA 3CFOA 3DLHA 1RTJA 2FBVA 1ASUA 5T7BA 1VK0A 3ZT0A 4CGHA 3OYAA 3IG1A 3LDSA 5HRSA 2GFUA 4FJNA 3IRXA 2X6SA 3V9XA 1DTTA 4AHCA 1WNSA 1TL1A 3DLKA 2A1RA 2R7YA 2O4XB 4JS5A 3HSTB 3AO2A 3MEAA 1IH7A 4BACA 1NOYA 1WN7A 2IDOA 1RT7A 2YKMA 2O4IA 4PY5A 1TKXA 2JZ2A 4CJQA 2R5AA 1RI0A 1TL3A 3NGIA 4EP5A 4CK3A 4IUVA 4DQRA 4YFUA 1HYZA 3V1RA 1I39A 1ZBUA 1L3VA 4O0IA 3KK3A 4KTWA 1RDAA 4K8ZA 4FJIA 4XIUA 3L2VA 4F3TA 1I3AA 2DTUA 4CJLA 3NNQA 2HVHA 1VSIA 4CJ4A 5CY4A 3OYJA 1LAWA 4CFAA 1JLAA 3AVIA 4GW6A 5KCHA 3O8VA 3AO3A 1NK0A 3NF8A 1QSYA 1J9AA 3EYZA 2EQMA 3O3FA 4DQPA 3M9QA 2EQJA 2PZSA 3P8DA 1KVAA 4W5RA 1LAVA 1SKRA 3RR7A 1HJRA 5KI6A 1WSHA 2OPSA 2FBYA 3IAYA 3OA6A 3MEGA 1RBRA 2LSNA 1S1VA 4E1MA 3OY9A 4DSEA 4GMJB 4N5SA 5K14A 3SD4A 1QS4A 3NF6A 3AVAA 4ID1A 3MXJA 3TAGA 1L5UA 2LRQA 1OI1A 1NK9A 3AVGA 4LD6A 5IN1A 1X1PA 2QKBA 1U49A 1RT1A 3NHGA 1HMVA 1JLBA 2VG6A 4H4OA 1D9DA 2EKOA 4LSLA 1JXEA 4K8XA 4O4GA 1JLEA 4FL6A 2VWJA 1ZBIA 4CJUA 4JRQA 2DY4A 1S9EA 4CHYA 1XWLA 4B9MA 1RBUA 1CZBA 2L89A 4KHNA 3OS2A 1YTAA 3LZJA 2LVMA 5CZ2A 4C8MA 3VQBA 3V9ZA 4FJ9A 4J2DA 3FEOA 2IGIA 2BUDA 1XHZA 4I2PA 3CYMA 1TKZA 1NJYA 1Z25A
chains in the Genus database with same CATH superfamily
2Z33A 3ZX2A 2RF2A 2X4HA 2P0QA 2XAQA 1Z1DA 5GADJ 1YW9A 5FKMA 1IF1A 1M90O 5TKYA 3EZ5A 4RB2C 1NM1A 1M2VA 2NOBA 4XEIA 1M5Q1 2VKDA 4I98B 1WBBA 2GBYA 3ENBA 2FPDA 1SVOA 1RT3A 2E65A 4FETA 1V1CA 4N9IA 2LKPA 1IXDA 2VODA 1W6XA 3DB3A 2JSCA 3QJ6A 4Y1CA 4EP4A 3ELKA 2J5OA 1MH4A 4BXXJ 4OU0A 3OA9A 3E01A 1PDNC 2M3AA 3FXUA 2P84A 1GFDA 2ZC2A 1RT6A 4GY2B 3K4LA 4C8QE 3VOVA 3V9WA 2JA2A 2E5ZA 1OCRH 4I6MA 1NJWA 3OYKA 2BIVA 4BE1A 1BA5A 1T05A 2JWKA 4ZTJA 4AQYK 2X4XA 2B6AA 1I50J 3TKYA 2LMDA 2O9LA 4C92F 4IL6C 1QCOA 4UQGA 4M75A 1VYVA 3C18A 1YI2A 1TUDA 3DLGA 3SUQA 3CMAA 2QXFA 3GBTA 2L3SA 4PJJA 3QUIA 4LB5A 4CZZA 1GV2A 4DLEA 2R5ZA 4Y91A 3NH2A 1M1KR 1E3OC 1W2BP 4LGWA 2EH3A 1WGXA 2RN7A 2IG0A 4CGFA 2IGMA 5J1YA 4CJFA 1RCHA 1UGSB 4CIGA 2DYSH 3EHQA 1O3QA 5LEKA 3J7ZI 2ENMA 4IWVA 4J6YA 1ZSGA 3FMSA 2E8AA 3WGHA 1N77A 3OYGA 5BRHA 1N27A 5D6WA 1W7PA 3FFIA 4E9GA 4XLEA 3OW2A 3TL4X 4JKEA 4LN2A 3NVMA 4HV6A 2D1KA 3CCJN 1FT9A 2Q3SA 3EN9A 2DO3A 4AYBN 1R1VA 2FG0A 1MUDA 1TK8A 4GVMA 1HJDA 3V9SA 2LR8A 1NYFA 3H36A 5KPRA 2A28A 1U3EM 4ZGEB 1EO1A 1VQLN 2CV1A 1LNXA 1U84A 4IXCA 2PFUA 1FMVA 2V4JC 1WBDA 3JTGA 5GJWB 2AKLA 2QF7A 5JLHA 1RUNA 4OB3B 2QXLA 1NWKA 2E20A 4N56A 3ASOH 2OJED 4E7JA 3AO5A 4IHYA 3I56T 3BT9A 3HL8A 3EFRA 3M8PA 5JVTA 2OCCH 3HRUA 5CE3A 3EH1A 4CJVA 1PM3A 3H41A 4ENNA 1GLLO 1Q86R 3IAS2 2MW8A 1WI3A 2YHBA 1YW7A 1UFFA 2ZQBA 1ORPA 1MJAA 4UNFA 1LCKA 4WQ5A 2DPUA 2F4MB 4KISA 2FMLA 1T2KA 2HZDA 2V9VA 4DFMA 4M9ZA 1MNMC 5LJVA 4EJWA 4CZGA 3M4OJ 5AZJB 3D2EA 3M3ZA 2JRTA 3LFUA 2NLUA 1ITYA 2QQ8A 1IO6A 1IJJA 5GTIC 3CF2A 1WJRA 2L0KA 2FSNA 3VB2A 3G1MA 3FRNA 2RI2A 3VQ5A 1B72A 4AIDA 3K1MA 3TTDA 2IEKA 1WAJA 5C15A 2O8DB 2LBFA 4B3AA 3PTAA 1GOCA 3C94A 4RCBA 1FX7A 3VMFB 4LF9K 5TISC 3AL0B 4RS8A 1GXIE 3ISNC 5D5WB 4OIOF 5KNLA 1WJCA 2HDAA 4F92B 1QP3A 4ZYEA 3CC4I 4PKHA 1DGRM 3P31A 4M45A 2R3SA 4CW7B 1TV6A 3P38A 1YVUA 2LD5A 4B44A 4HT8A 5DV5A 2ASPA 1I6XA 4IEIA 4RW6A 2E7WA 4UV9A 3W2WA 3CC2I 3CMET 3J7AF 3I35A 3G6EQ 3BE3A 3CCMI 5F0XA 4EJYA 2A3SA 4UB8C 2VBYA 4Y33A 5J6XA 3TO9A 2E6LA 1ETYA 4CC2A 2W04A 4E7KA 2RB6A 4HCBA 1NM7A 1ZBXA 1P92A 2ME6A 4M7AG 2LDMA 3PSIA 2XPWA 1TUGB 2LCCA 1KQ1A 1O1WA 1Q8IA 2E4LA 1IB8A 1CGPA 3MHXA 2K9GA 2PJRB 1P4XA 2VLAA 4K2EA 2Y4YA 4BRAA 1UFMA 1GVDA 1YOVB 4KUDK 1LW0A 5H20A 2LNVA 1TKTA 2HYGD 2QEXT 1HKBA 2CS3A 1VQMQ 2DOAA 2UV1A 4DU1A 3PO2J 3FXKA 4BI4A 1NE8A 5FPNA 4NL2A 4NCAA 1U1TA 1TNTA 2PLYA 2HXIA 2GUIA 4IJAA 2NS8A 4U88A 4ABZA 5EGOA 1M1KU 3T1BA 5JI6A 2OTJQ 2NLXA 3PIPL 3QODA 3H3OB 1CLQA 3MN2A 3PFIA 2YT6A 4LFUA 5TKWA 3WU0A 5CVJA 2M8EA 3V1QA 2KBTA 2QGFB 3N5BB 1GLCG 4Z88A 4IUPA 1VQ7I 3H3UA 2ZD1A 3WG9A 3R1XA 4K43A 2KRMA 4M7AC 4LLNA 2HD0A 3B73A 1X3ZB 4E3SA 2YS9A 5KN8A 5EY4A 2OJ2A 4KH0B 4AFZC 3MECA 3HSCA 1QVFA 1U6ZA 4F8RA 3MFKA 4NHJA 4XR6A 4KICA 2KR3A 4J9CA 5LJ3j 5FU6C 1TWAJ 2ISZA 3M8EA 2P5GA 3AVBA 4PJOG 4WQ4C 1JXBA 4MEXF 4B22A 3KBGA 1I1SA 1LWCA 4JAXA 5BMZA 1UZCA 2YHWA 3MK6A 2I2LA 2XY7A 1VQ6Q 5IAYA 4MIMA 2XROA 2DXCA 1PU7A 1R8OB 5EU7A 1M1KC 4QKUA 2I5WA 4V2SA 1G3WA 3P9IA 3S16J 2MK5A 2DTRA 3CJ7A 4CK1A 4HSRA 3RCOA 1XMAA 4M3EA 4L3QA 4YOUA 2DQLA 3SJJA 1Q86U 2NRRA 3O6BB 2XB0X 4DR5K 4A5NA 1KU2A 2P4TA 3JRAA 2XO7A 4FZYA 5KYYB 2EILH 5HDNA 4F91B 2K2VA 4DB3A 2JW4A 4IUQA 2FL7A 3H0HA 3THWA 4PJOC 1HU0A 1VFCA 4PJMA 4MDBA 1YRNB 4XSXF 1HKGA 4FLWA 2EWSA 3DOLA 1QHTA 1YJ9A 4UVCA 4A0YA 3H92A 3GZ6A 5LHGA 5LRSA 1O75A 2E2PA 4BUGA 3CM6A 3D5SC 3ULDA 3GTPJ 1YJNI 4DBFA 3MEDA 1GOBA 4YOVA 3JAMO 4QVCA 2R5MA 3CI5A 5HP1A 4JRPA 4HKEA 4M71A 2YNFA 3E9OA 2CW7A 3EUKL 1TUCA 3B6CA 4ISFA 2NS7A 4P9UA 1N3CA 3VETA 2Z1JA 1LFPA 5GAMg 3B8AX 2QVOA 3A01B 1ZH5A 2CS7A 1Q86C 2LNBA 3CVSA 1VRTA 1IGNA 1S1NA 2STTA 3MKLA 2X1EA 2EX3A 3OOUA 2V9PA 3O5BA 4M7AD 1VQ9I 3IRRA 4HUFA 1WNLA 3OB9A 3SUPA 2PMUA 1I6HJ 5IT9K 3M1FA 4J9IA 4BDPA 3FMQA 3MKDA 4X65K 3QRFF 2EZLA 4KIFA 3BPXA 3I0RA 4ESJA 1WSFA 1WUAA 5L3BA 5FLVA 4CJTA 3CO7C 1LE8A 3H9GA 2DBMA 2YSRA 4X1EA 2DFIA 3CCUQ 2OFKA 4RTVA 3O08A 2KT1A 1IN4A 4BRDA 3GFIA 2Q0RA 2FOKA 4B1RA 3UIQA 4FM1A 1XD7A 3GZNB 3THYB 2D1HA 2X6WA 3DLBA 2M02A 5EEGA 2XY8A 1GLNA 3LP0A 3CQXA 3VPRA 2C0OA 4CCOA 4PHTX 3EGDB 3MWPA 1NJXA 4C92G 2PI0A 1SV5A 3HJFA 5M1NA 3I55T 3TSPA 3VGKA 4BC5A 3QESA 2CV0A 4IG3A 1YHQA 2DDBA 3UKRA 3PLAA 5C24A 4JZ4A 1GLEG 1R5HA 3DPTA 2EINH 2MWOA 1IBKK 2BTTA 4DTJA 2JN0A 3E9PA 1GHCA 3KFWX 2EIKH 4FWRA 2QWPA 4AG1C 5DLQE 3NGYA 4PJOD 1KCFA 3AVHA 1ZKGA 2NRTA 3SNNA 4JKDA 4KNYA 3O9TA 1KQ8A 3OTOK 3SQ1A 4CYCA 5IH2A 1ZGJA 2VQEK 1HPZA 2F69A 2GX9A 1FXXA 2F6CA 3HPGA 5EYRA 2DMNA 2JA8J 4J9EA 3I56N 4B43A 1U3OA 3PL8A 4HNVA 4BREA 3HOUJ 3IDHA 1X4OA 4N4NB 4C92C 4KI4A 4M6VA 2ATQA 5CKEA 2E2IJ 1WHMA 1ZTRA 4F7UF 5JHFA 3CCET 2K9NA 3HOZJ 3DAWA 1A5VA 2MC3A 1NBWA 3TAMA 3PT9A 5AIQA 4ITVA 5KQDA 1LCUA 5GAOq 2CUZA 1QHHD 1RT4A 4AC0A 1P6RA 4FJJA 4XTZA 3SI6A 1Q1HA 4B1YB 4EHUA 2ZBKA 5J4YA 3QERA 2NVTJ 1VF9A 5F1XA 4CFBA 2A61A 2E41A 2DL3A 4D8DA 2OYQA 1BW6A 2NOGA 3ENHA 4I6MB 1KG3A 2EFWA 1AWOA 2Q0OA 1BM9A 3JCMc 4JPBW 1JXSA 3RKQA 2RHIA 2ETJA 1KQSM 1QSSA 1NH3A 5IYBJ 2WA0A 2UUZA 3CO6C 4M75B 2Z1GA 3L9FA 1S72I 3M4GA 2LK2A 5EZGA 2JTVA 4XNFA 3NFAA 4IHWA 1K8KB 1AA7A 3TCJA 2R5ZB 2RHXA 1Q7YR 3EKSA 3CJ9A 1XMQK 2D5VA 3MN7A 1T0JA 3B6AA 3CMEN 1SAZA 3GDQA 4KN7X 4FWQA 4MDAA 1A04A 1ASVA 1WJAA 4WXHA 2VJ5A 2KK4A 1UHWA 1LWVA 3LDPA 3DEWA 2IVWA 4GO1A 2VQLA 5KYWA 4BG9A 2OZMA 2L3RA 3Q0VA 1FMKA 3QDKA 1W7PB 3N05A 1SF9A 3RWUA 1P9QC 3ML6A 1Z91A 3S1MJ 3NTKA 3CC4T 1VQKQ 4IRGA 3NDKA 4MQVA 3OYDA 4W5OA 3HBTA 2Z1DA 1BQNA 2ZXIA 3CF5F 4CJKA 1OX9A 2XY6A 3SYZA 5FROA 1ZN2A 2G8HA 2M1HA 1HC8A 3PJRA 1NK7A 2ID3A 3Q7BA 4CF8A 2QUFA 4J9HA 1OISA 2CGPA 3CCMT 4F7ZA 2QEXN 4KPYA 3PFYA 1YT3A 5ED4A 4XLHA 4DTPA 2ZPIB 4CZFA 4Z4FA 2F4VK 1RDDA 4ZDLA 1BI0A 1O7LA 3JAMZ 1SVLA 4LDUA 1K4TA 1N34K 5A2QK 3C95A 2VC8A 2HHUA 4M77A 3LAPA 3JCMb 1OQYA 1WSGA 1YYVA 1N9SA 5M3FJ 2P4RA 1R0AA 4L5JA 3WXLA 3G71A 3DLRA 2IS6A 3JRBA 3ID6A 5C25A 4DFPA 4D9JA 4L0YB 1CKAA 1SFKA 1YQMA 1HW1A 3FK6A 2UXXA 2IP2A 4RCHA 3D2EB 3PY8A 2G8WA 5BNGA 1WJSA 3CJNA 4M7YA 1IN7A 3OQ5A 1I81A 1XTDA 3BW1A 2PFBA 2HNDA 4RB3C 2HQ5A 3W0LA 3DKMA 3RMCA 4ELUA 4CD1A 3SEQA 1B72B 5B3SH 1GFCA 3HTRA 1UHMA 4A3LJ 2LBFB 3FDRA 4XONA 1TBXA 4EPCA 3HXLA 1M1GA 4M3WA 2G8UA 4ZJZA 2GLOA 1VQ7T 2QTVA 2P9PA 4BJ5C 3B02A 4A5MA 2P9UA 1IV8A 3SFMA 4YFKF 2ZKZA 4DV1K 5DK5A 3SHWA 3R8EA 4JX4A 1J2XA 1IGUA 1RTHA 5CQXA 3PX4A 3NHNA 3FK7A 1SFUA 2VG5A 3IP4B 3QYHB 4B47A 1G4DA 4C3JJ 4CCJA 1HKSA 1HDPA 2CG4A 4CIFA 2W84A 2X4WA 2KFDA 2ZJPF 4BWMA 1S3JA 3SDZA 1AD5A 1Y6IA 2K6DA 2FU4A 3QPHA 4C8OA 1IJWC 1W4SA 3G25A 1T08B 2O8XA 4OINF 4QSHA 3QIIA 5GMKm 1Q82C 3QU6A 2JM8A 3SZ2A 5HROA 1MDUB 2RVCA 4KB0A 4AIJA 3F9KA 3K0LA 3E2UA 5HL7L 2CP6A 2STWA 4C92E 5EDNA 4IUTA 4ZN3A 3R6NA 2LP5A 2OU2A 3GLXA 3PX0A 1WPKA 1ACMB 4Y4RA 1Y0NA 1EA3A 1YJWT 1WGSA 1YFNA 3CFRA 2RQVA 3LWIA 3HT3A 3FXRA 1LEAA 5HLTA 3AG4H 1Q1VA 1NG6A 8AT1B 1M3HA 4B08A 5BR9A 1DT9A 3M1CA 1U4BA 1LWEA 4IHXA 1Q7YU 4W97A 5EGOB 1HNVA 3ZMUA 5FKKA 3RSEB 3N97A 1PJRA 3GE1A 4PNOA 3MP1A 3HRTA 5BN9A 5TJJA 1SKUB 4DF4A 3BF3A 4A6EA 2BZXA 3ZCOA 2LX7A 1SZ2A 1X27A 2RJFA 4YHHK 3M7GA 1B3QA 3SYTA 1W9HA 2KFZA 3LQRA 2PMZA 2FMYA 3GL1A 1YJNT 3PNWC 3LALA 2FZKB 4R79A 1TVRA 5AQKA 1KG6A 4GBQA 2NS0A 1QZZA 5C44J 2CQNA 2D45A 2P0KA 4CK2A 2BGGA 1VQOQ 5E26A 1XNRK 2LH9A 5GMKe 1JLFA 1VAZA 1IKXA 1BA1A 1X1CA 4CERA 3LLRA 3VS7A 5D6XA 3TU5A 2DLLA 2GTJA 1SUQA 1VQ9T 3F0CA 3GTMJ 3BC8A 4CECA 1VSFA 3GPLA 1QQCA 2JA7J 5LJ3d 1RNHA 4JP0A 3LCNA 3I55N 3L1AA 1Q7YC 1HD3A 2JA6J 2ZF5O 2XKOC 1JU5C 1S6PA 2MLKA 2DYRH 4J9GA 4OVAA 3DM2A 2QA4A 3AL0C 4WFNL 2Y0SA 1UOCA 4LIUA 4LK1F 3H1CA 3WTZA 4JJDA 4R1HA 1XQOA 2FNPA 2YRVA 4PFPA 2HL3A 1B92A 2KY9A 3DLMA 4LG3A 3VOEA 3GG4A 1NGNA 2Y90A 2DFHA 2CSQA 5F08A 4YTLA 2VBXA 3THWB 4HEA2 2F5EA 2FRWA 2XRNA 5ICCA 1KQJA 3SEZA 3K9JA 1WI9A 4FYDA 3K5LA 4DHYA 3BDLA 3VEOA 1NJIR 2BY0A 2CH6A 4M4ZA 3MEVA 1RC9A 2EGEA 4M78A 4EQQA 2VUMJ 2HHWA 1N6AA 5AIPA 3DLAA 1REPC 4N4IA 3GW2A 1TYQA 3UKGA 3T0YA 1LVKA 4CICA 1KG1A 4E9HA 3HFNA 5E84A 3LW5E 4M3XA 5FLXE 3O5ZA 1H89C 3DRRA 4W5TA 2ZPHB 4BHPA 2GNCA 2XSJC 1AEYA 3OW2P 2DBKA 1AOYA 3QYGB 1K83J 3OL3A 5AQSA 2G8VA 1WOQA 2DPNA 1FBUA 4B9LA 2ZWHA 4LITA 3T19A 3X24B 3CCEA 3H8ZA 3S3OA 3GLLA 1WSUA 2OF7A 1YUWA 2DDAA 5A0DA 4F7UG 4CUGA 3NWTA 3EG3A 3TAEA 5DCMA 2JA5J 3I4MJ 4E89A 4A2AA 3CCJQ 3KLFA 3V6DA 4H03B 1IXCA 1S7OA 2FPFA 3WTYC 2LSOA 5ICGA 2AO9A 3PO4A 4J9BA 3C0CA 4KULA 4CZMA 1X1DA 2TCTA 2A6HF 1LE8B 2ZO4A 1VQLQ 4HUEA 4XKWA 3CXCM 3PUBA 1NU0A 3RDVA 3G1JA 1TQIA 4LJZF 4OMZA 1T0FA 2RM4A 3LSJA 4H0TB 2PX9A 2VGNA 3SFZA 1YP5A 1S9GA 4CEQA 1OPLA 2ITMA 1KLNA 1TQMA 2XC7A 3TSWA 2FLOA 1NLVA 1ZR2A 5GAOl 2KAFA 3LWFA 2M8GX 2TDXA 4I01A 1M2OA 1I0CA 4HV5A 1WEIA 3VYTB 4XRMA 1SS6A 3H9NA 2HDCA 2MF2A 4EA5A 4AUXA 2RKHA 3UKRB 1E3MA 2NVXJ 3A5MC 3DBRB 3CC4N 4BQQA 1S72T 1KJWA 1S5LC 2ACJA 4ZHRA 1ZLMA 3C7JA 3MN5A 1VSEA 2YJFA 1ZK8A 4ZYAA 2QG9B 5JFRA 4KRFA 1K4SA 3OYEA 1QA6A 2CDTA 2YLCA 1SHFA 5LLQA 1S5JA 2HNIA 3CF5L 3IFRA 2CQKA 3CCMN 4CYCB 3F23A 3RTRA 3QIPA 3U8XA 3SQ2A 4F2SA 2ROLA 3ZGKA 3QP5A 3BY7A 3LA7A 5DPKA 3QXEB 4FWSA 2OANA 3OIQA 3DU5A 1JJ6C 4UVAA 1RFQA 2H3GX 2CQ7A 2Y75A 2JTFA 2JMCA 1LFUP 3QPSA 5HS9A 2KT8A 3GTKJ 3K9TA 4HQEA 1JEGA 1T3SA 4BR9A 4I76A 1UCRA 3P9CA 3HOXJ 3CPWM 1S1WA 1B9DA 5GAEJ 3OBYA 2WB1N 3ZQIA 4WCEL 4BJTA 1U06A 3OYHA 1LEBA 2E88A 3K4CA 2HMAA 1Y56A 2QGGA 3TEDA 2EHGA 4DV6K 1HQCA 2JN6A 4BR4A 1ZBHA 1QP2A 1QVGM 1Q9YA 1RL2A 2CV2A 4GVEA 1IAWA 4OGEA 2XUBA 2EWNA 1RAHB 4XKBA 1SSHA 2M0YA 2RV8A 3DWLA 4IEEA 2BDPA 3FISA 4KH5A 2QYOA 4L9NA 3A5NC 3H3NO 2E1CA 5CO7A 3KD1E 4CC3A 2GQQA 4A62A 4Q5SF 4RCCA 1JJ8C 3PO5A 1J75A 3S14J 1VQ7N 2J6FA 1DTQA 4JS4A 1NJIU 2X1CA 3O80A 1G3YA 5GAMj 3E9GA 2L5QA 3WHBA 2FNAA 1JUSA 3CVTA 3CXCA 3BG9A 3EQLF 3DLHA 2HL5C 2VQFK 4D0PA 5T7BA 1ZSZA 1VK0A 1WQ2A 1FW6A 2EVRA 4AFSC 4P96A 4NC6A 1VQ4A 1XPXA 4CGHA 3OYAA 2LY1A 3EYYA 3FSPA 2XSDC 2PUOB 5AQTA 2GIZA 1WWXA 4JKHA 5GANg 1QVFP 4XLNF 2GFUA 2GTDA 4FJNA 3V8LA 3C2BA 4WXCA 2FX0A 5GAHJ 2KI7A 2ZJPL 2GA2A 5KYWB 1ZXOA 1O9SA 5GMKh 3HSTB 1VA7A 3HKZN 3W3DA 1IH7A 3WTUC 3MN6A 4BACA 4CD3A 2NUPA 2ZFUA 3IHUA 1VQ5T 1WN7A 2IDOA 4EHTA 4PY5A 1TKXA 3CCRA 1XB4A 2F1LA 2MD5A 2JZ2A 2R5AA 2HSEB 4ENJA 1YNZA 3IWZA 3CD6T 2EGCA 4YFUA 2IJLA 3J7ZO 5BRDA 1UG2A 1YJWN 1NJIC 3P4IA 3DTEA 1X9JA 1I39A 1ZBUA 2LQWA 3CLQA 1ZUKA 4KTWA 2HTJA 4UUVA 4XIUA 3L2VA 2IA2A 3NWSA 2NVQJ 1K73O 4BQNA 2E4HA 4LDXA 2HBMA 1VSIA 2D2WA 5D4SA 2ELKA 4FVUA 4MTEA 3MKZA 3RR6A 5MLCQ 1YJWA 4NNJA 5M1QA 4A0XA 3K7AJ 1N5ZA 3K0SA 3EH2A 4FPBA 4CSWA 4KYWA 1NK0A 1QCNA 5HLGA 1J9AA 4DQ8A 3EYZA 2FA5A 4AM7A 2XICA 3CJ1A 1YJNN 1QVPA 2K57A 3EG1A 3ASNH 1VQNA 4A3BJ 5KYNA 2Y30A 3VJPA 4BI8B 1O3RA 3SAGA 3HJEA 4JYAK 2BZ8A 1LAVA 1HJRA 1LUJB 2KDOA 1BWFO 2EPFA 2P5KA 3IAYA 2LQKA 3OY9A 3CJAA 2GM4A 4DSEA 2COBA 4FISA 4II3A 1QS4A 1VQ9N 5EJCA 3NF6A 1LDJA 1WH7A 3DKYA 2ICWG 3CCVA 4JYKA 1ODDA 5DY9A 2P9PB 2P9UB 4MLHA 3AVGA 1E7OA 2XKPA 3R6SA 4K42A 5GADP 3A1PA 2P4WA 2A07F 3ZQ7A 1ZA2B 1RT1A 2LYCA 1XC3A 1VQ8T 5H1SQ 4LSLA 1HYOA 1JBMA 4JI5K 4O4GA 1JLEA 2V1QA 4FL6A 4BRKA 2V8IA 4JRQA 1LFBA 2JNGA 2HWVA 3BG3A 3BDUA 1RRQA 2FE3A 2ED1A 4CZIA 1VHXA 3KNTA 1W2BM 1TQPA 1YTAA 2DE0X 2K4BA 1BBYA 1YS6A 5M5XJ 5CZ2A 1NGHA 2HZYA 2WFBA 3FEOA 1XHZA 3CYMA 1NJYA 3QSUA 1R77A 1IGQA 3F9MA 3KFVA 4JOMA 2DA4A 2KISA 4NYFA 1J9IA 3AG3H 4FLZA 2IGOA 3FM5A 1BC7C 3HOVJ 4KH1B 5KYXA 3N4QA 2RHUA 3QFPA 2ZNYA 5LJWA 2A7YA 4M7DB 3M4YA 1D09B 3QMLA 4IBNA 1RAGB 3PIPA 1T03A 1U0JA 2IVPA 1OYXA 4ENMA 1Y07A 3ZEUA 1J6ZA 2HBPA 2O9SA 2HHHK 3BG7A 1JTYA 2QI2A 3VV0A 4F3QA 5L3FA 5BPNA 3QAHA 3MQ0A 1WJFA 4CJ7A 2LY2A 1M3CA 3ZSRA 4AVZA 5B1AH 2MOXA 4G6TB 2FVUA 3QOPA 2RJEA 4HLXA 2EQUA 3ITHA 1ZARA 3WTTC 5HVQC 2VUBA 1JHHA 4M3YA 5ELZA 4BYYA 1RT5A 4CHNA 4AWXB 3FFKB 2DMQA 3KEQA 5KRTA 4WQ5C 2RE2A 4MDWA 2PVDB 2M2EA 3WHCA 2JWTA 1V3FA 1VSDA 3I56Q 3LH5A 3EUHA 1TWBA 3KLGA 4LC9B 3LA2A 2F5VA 1WAFA 2HBLA 1ZYQA 3MP8A 5D6YA 5AN4A 4DW6A 5SZTA 2XIDA 1FTTA 2E5NA 1VYTA 4JKCA 1JJ2M 5HLHA 1RI9A 1ATNA 5ERIA 1A5JA 1VIEA 3H0IA 3S1RJ 2JUCA 3MEUA 4BR2A 5LL6Z 3R60A 1BOBA 5HRPA 2HNYA 1NGGA 2B9SA 1M3BA 1MHNA 4RW7A 4DYRA 4RAYA 5SWMA 4D8KA 1S72N 1PSEA 2LTOA 3DLEA 5CHZA 5K5OA 4Q47A 2WWYA 1TXQA 1HJOA 1N36K 4DS5A 1YI2I 4M77F 4BC3A 3IS9A 3ATUA 3CMAI 4KT6A 1ETVA 3LAMA 2JOYA 1IG9A 2V1XA 4DYCA 3VEWA 3WTXC 3DBLB 1PNJA 3MVPA 5JVHL 3NAEA 2YHTA 4Z94A 3A0IX 3HP6A 3PIOA 2Q2RA 2K5IA 1ESVA 1P59A 1U5TA 5HS8A 5FKOA 3VEXA 2ZJ2A 3FMRA 3X25B 2YUNA 3CIPA 1TYQB 2ZFWA 1X69A 4F55A 2HHVA 2BUPA 2D8JA 3O4QA 2LF7A 2L9NA 2YV0X 4F04B 4C8KA 2DIQA 4PLLA 1RZ4A 3CMEQ 1JKPC 2ESNA 3A98A 5LMNK 4OLAA 3V1OA 4XBFA 4QT7A 2P5VA 2CFXA 1JE8A 2EYZA 4E2FB 1WPYA 3LWMA 3FXOA 1X75C 4P5OA 4QVZA 1MWKA 3REBB 2PU9B 1ZUUA 4B24A 1IUFA 1NK5A 3OIPA 3CWUA 2GWRA 5DCMB 3F72A 2W7NA 3KYCB 5M5YJ 4DR7K 1BI2A 4FYVB 1HW2A 5BR8K 3RZOJ 1O4XA 1Z21A 1OH5A 3D6RA 2ETHA 1S1TA 1NTCA 4G12A 4B1UB 3JSMA 3U3YA 1H9GA 3FDYA 3CJBA 3RVCA 1VZ0A 1HLVA 2Q31A 2H09A 3I59A 1V5FA 3LZIA 4LLLA 5HODA 5IYDJ 3U1KA 2QEXQ 3ZMDA 4RAFA 2B63J 4EZ9A 3EY1A 2ESHA 1ARKA 3TW6A 4NB4A 1T56A 4RG8A 1GXPA 1WFWA 1MBEA 2KZVA 4BY6B 2W6LA 4LFAK 2ECBA 2DL8A 4M75E 2X3XD 3CC7A 4AU7A 4JKFA 4CHQA 2X4JA 3TPQA 2YRDA 2PEXA 5LJ3h 3VA0A 2M34A 2NOIA 4M3FA 2MSYA 3VENA 3QEWA 2CP0A 2HTSA 3ZSZA 4RUGA 1PUFA 4EMGA 5M3MJ 2AHJB 4A54A 4RBOA 3NH1A 1JJ2A 3AKZA 5FKNA 1FYMA 4J9FA 5KK1A 3BG5A 1UMQA 2RJDA 4BHBA 4LD9K 3S15J 1R0CB 2MPXC 4BVOA 3K4KA 4MMLA 3FIWA 3EDPA 1HYVA 2KDZA 1FSHA 1Z26A 4O55A 2L7ZA 4FYXB 1VQ5N 3K1NA 4XLAA 4E1NA 3CMYA 2FSJA 1EFNA 1XNIA 5JVGF 3L2ZA 3HGYA 3CQZJ 3CG7A 1T6DA 1WHKA 3QEPA 5K7HA 1S8NA 4G9ZA 2XI9A 1BIBA 1UJYA 3A2FA 3GBQA 1YIJA 3M59A 4NCGA 1FK9A 1M1KO 4JK7A 1YITA 2NUBA 2QZ8A 4OF1A 1M3AA 3CLOA 4WK8F 4KRTA 4OFAA 1T44A 4LY7A 4NC8A 4UOBA 2XHKA 5JLXA 5I42A 1M3QA 2F9WA 1KHCA 3OSFA 1U04A 2XGDA 3CD6A 2YNIA 4E70A 3KKSA 1X6OA 3WUHA 2HMPA 5CVUA 2DYIA 2LG4A 4Q5WA 4DV0K 1C0UA 1KHIA 2A5WA 3IKVA 1SD6A 2HQHA 4C5GA 2YX6A 3HSBA 4Q48A 2HW3A 1T6SA 2QDLA 3JAME 2EQIA 1ETKA 3LL3A 2FBKA 3H9QA 5LBQA 4A4FA 4XICA 2V7ZA 3L2CA 5B8HA 5GAN8 4OKEA 4C8QA 2DJQA 3SEMA 1EQYA 3CWTA 2ED0A 1TAQA 2YU3A 5KE3A 3F5TA 1AHDP 1ZBFA 1W4MA 3DRSA 4X9CA 4X64K 2IS4A 1OVYA 3BJAA 3BZ6A 2YI1A 1YCYA 2E19A 1ZHFA 4YOQA 3SPYA 3WEEA 4BBRJ 2RQWA 4ESBA 2CZ1B 4IDKA 3JB9D 2P8TA 4HT9A 4CF0A 3HSEA 3G0ZA 2KEAA 5D8LB 2H8HA 4MMKA 1Q86O 5F04A 3UDCA 3I4NJ 4FJ8A 3HUGA 3C3WA 2DI3A 3ASMA 3DRPA 1VQ8N 1MV3A 1KIKA 1ZSZB 4M78F 3N5NX 3IUCA 3KVGA 3LOCA 1KC8R 4IDHA 1UHCA 2DA5A 4HX4A 3QYFA 4LOCA 2PMHA 4CE9A 3KTQA 4AHTA 5GAMd 2VV5A 3C6AA 4GKJK 3I33A 3L2QA 5F2RA 1QVTA 4G7HF 2BHZA 2M7AA 4XU1A 5M5WJ 1F43A 2R7VA 1RABB 4JKAA 1K9MO 2PVGB 4E19A 5GAN4 3HRMA 2RO0A 3GTQJ 2Z16A 4BNCA 3MKYB 4OMPA 2NUPB 3I58A 2PUKB 3O3HA 4YELA 2O4GA 3WU1B 1DEJA 1PVSA 2XDPA 2Z5UA 4DQ2A 2UUBK 1F1ZA 4FK2A 1I1GA 4DBRA 5LFAA 4J2EA 3FBNB 4OMMA 4FT4A 3OMCA 3GIBA 4B9NA 2L0AA 2FC0A 1BK2A 2BXYA 2NYXA 1HR0K 1B9MA 4B3OA 5LHHA 3D2FA 1V4SA 2VL8A 5H6RA 2G8IA 3I55Q 1DGKN 1S7EA 3CCLA 3P8BB 4QOZB 5D7UA 5LHIA 3TQ7P 3FHGA 4S04A 4X62K 5J39A 4KMUX 1G83A 2FHDA 4EMKA 4LH5A 2NVYJ 1BIZA 4A3GJ 2E35A 3G7ZA 3QPLA 2H1LA 4B3SK 2R7QA 3MP6A 1IKYA 4X9DA 2RHZA 5AONA 3QYBA 2QGUA 2CSOA 1F21A 4A5AA 4IRIA 2RPNA 4B9XA 4JI6K 2EJRA 3IQLA 1QCFA 2WY8Q 4JLHA 4HTUA 4CEOA 3A8HB 3VWBA 3JTHA 2EZHA 4R0KA 3KLNA 4HOBA 3EFOA 1TGOA 4MLEA 3VW4A 4P9FA 3ENOA 4LH4A 1E4FT 2BZTA 3OV8A 3QG1A 2EJGA 3CCSA 2JHJA 5JR3A 2P7VB 2R4GA 5E18F 5H2FC 3D7SB 2CH0A 3ZT2A 3OW2S 2OZ6A 1RUOA 2O8KA 4E6RA 4CF9A 1U47A 1OJLA 3KK1A 1IN6A 5FPMA 1BOTO 1JXMA 2KROA 4LDWA 3T8RA 2YSQA 4JK8A 4ILHA 2UXBK 4M7AB 4DV7K 3JCMQ 1BISA 4FYYB 4Z02A 5C2FA 3JRHA 1MMDA 3E9LA 4IPAA 2V26A 1PVEA 3SCXA 3ESWB 4S0HB 2WAQN 4P55A 2FPEA 4CFDA 3THVA 3L3VA 1UJ8A 1HQEA 4JEPA 2JMAA 4JHDA 2FD5A 3E6CC 4OAYA 1RUWA 4BXFA 3VTHA 3EZWA 3L6QA 4ICLA 4ESFA 2E6NA 4M77G 1YHQI 1Q81O 3V7RA 4EGZA 4PLIA 3WQUA 1T98A 5AQVA 4LMYA 5CCAA 1YI2T 1ZC6A 2BE7D 2RH2A 5GANj 2O8EA 2OPRA 3CMAT 1T8IA 1UG1A 2F5FA 1Z9ZA 4HG2A 5KYXB 2D9TA 3VEVA 1WEGA 1HYSA 3JRIA 4LIVA 5F6FA 2QYZA 1ATRA 4XKVA 3SQ4A 3LANA 3SBGA 1HKTA 4BC4A 3SWNC 3NMUA 3FZMA 1SFXA 2DFFA 3RSNA 3ZEUB 2OQRA 4AM6A 1KC8U 3G4SA 1QPIA 2ZPEB 1HNIA 1PRMC 1KFDA 3VQ7A 1D3YA 1GUUA 4DGWB 3BOQA 1TTYA 3CC4Q 1QZ5A 1R4NB 1NKBA 2KIMA 4PJOB 3QHSA 4RLFA 4Z89A 4PGGA 2D4WA 4G6DA 2G3RA 4C0GA 1Z7UA 4H5TA 4FJXA 2CGHA 2O88A 2NZTA 1X2QA 4M77C 2IS2A 1NZ9A 4XN3A 1HX1A 1NYGA 4RG2A 3EHRA 3FKIJ 5E8IA 4HLYA 5KGWA 3CCMQ 4ANJA 4RW9A 3HXMA 3J8AA 1BYMA 5IT9O 4JN4A 1Y0UA 4XLCA 5FLXO 1D5YA 1SKWA 1BDGA 2Z3YA 4BROA 5EOYA 2H6BA 2E2HJ 2H1KA 3CC2A 3OYNA 1QVUA 3KKRA 2E3IA 1V55H 2R57A 3OR2C 4OX9K 1JT0A 4EMHA 1KC8C 3E19A 1C1BA 1N9RA 2RQTA 4OKKA 4XOPA 3QBWA 1UA0A 4DFKA 1RDUA 2O4XA 2HVQA 2VG7A 3IH7A 2K7LA 1H8KA 3CCQA 3ZYYX 4FJGA 3GMEA 2P9KB 5C42A 4LD5A 3ZFJA 1W1FA 4RWTA 1X2NA 1FLIA 1ASWA 4EM2A 3RBBB 1X6BA 2LC4A 5CQYA 3ABUA 3QEIA 3L2UA 5CKDA 1G99A 3CXCP 2FBTA 5F27A 2RHYA 2K9SA 2VWKA 3KYDB 5K5RA 3IH2A 5JVGL 2DF6A 2BVLA 1CXQA 2VJ4A 3NTIA 1NK2P 3H9JA 1VQ7Q 1Z05A 2XPUA 2IBDA 5CVVA 3SDBA 3RQ4A 5DM6F 1U5TB 4OO1J 1EXQA 1EH7A 1KAZA 3FR0A 2ISYA 1WHHA 1Q82O 2KTQA 1SAUA 3JW4A 1QLYA 4XLFA 2VBZA 2G7UA 3JCMV 3LX7A 1ZUYA 3A8LB 3BDDA 3DCFA 1JXOA 4IKFA 3E1SA 2RKIA 4N76A 5EX5A 4IFEA 1E4GT 1NK3P 1K0SA 4Z4GA 4E0DA 3EE9A 5CQGA 5DM7F 1BCMA 2XGEA 4DQSA 3O2PE 6AT1B 4DYQA 2GBZA 3Q3SA 1OU9A 1Z9CA 3FZVA 2L2OA 4B3RK 5A0LA 4Y7NJ 4OIPF 4AHRA 4JNEA 3UT1A 1FN7A 4C1NI 4EFHA 1MUYA 2Z0WA 3HSFA 4YY3K 5GAMe 4M77D 5IXBA 3GTLJ 5I21A 3VRYA 1QO0D 3H3ZA 2OTLA 2CFOA 2RD1A 3MPUB 1AZGB 1EWRA 1BR4A 4E6KG 3CUQA 1O13A 4JKGA 4V19S 1LNWA 3K4NA 1ZGAA 4DG1A 3G71I 3I59B 3WVEB 4F3OA 5J3LA 1WCMJ 4ATOA 4B1VA 2HHSA 5ILUA 1X4PA 1ETWA 4Y13A 2IGNA 4A5BA 5LGNA 2L54A 4YDUA 4XLPF 3MCPA 1RESA 1WRJA 1TT0A 4F9OA 2HHTA 4A63B 3LSIA 3LGFA 4N9HA 1FNNA 1NHAA 2Z2SB 1KQ0A 3JB9J 3M57A 1PUFB 4BC2A 3TO6A 4ID5A 3UPUA 1C0MA 3VS5A 3M9AA 4JI0K 3DKWA 1L3LA 1UB4A 3LSKA 1UEBA 3C6UA 1IBLK 2F4IA 1IHVA 3CQ8A 1YJNQ 3ABMH 4FCYA 2PY5A 5J4VA 1NBEB 4M78G 2KIQA 2HVRA 2RJCA 3LA3A 4F93B 2Y31A 3IMXA 3LP2A 2VCPA 4Z4CA 1RIOH 4A57A 3ERED 2NOFA 4O44A 1Q7YO 3K70D 2DQRA 2O8CB 4DLGA 1VQ9Q 4ISEA 1MBKA 2K4YA 2E1HA 3M56A 4NQWB 1H641 3ZSOA 3MCZA 2CUEA 3F0ZA 3QEXA 3HBLA 1XI1A 3WGGA 2HNHA 4A3IJ 5K7ZA 2L02A 2QQRA 3LDLA 3WXIA 2O8BA 2IA0A 1UJ0A 3BR3A 2XHBA 1YVNA 3VQ4A 2GTOA 4M78C 2L4MA 1AU7A 3LFKA 2EIJH 3CJQB 3A2KA 4XH4A 2EB7A 5HLFA 2PVOB 5A2QO 5BPLA 4OJRA 5ICEA 2C0TA 1LB2A 2W57A 3OW2M 3AAFA 3U1DA 3S2HJ 4A3FJ 2JPBA 4ILJA 3GBGA 1B6AA 4B3TK 2NWMA 4YORA 4M3DA 2BGCA 4IXAA 5K7FA 4ZYGA 1YF5L 3HHTB 2C06A 4UUSB 3BZKA 1QSLA 4PKGA 4HW0A 5DLOA 4B9SA 3WEEB 4IHVA 1ZBJA 2CZ0B 4RB1A 4BBSJ 2ELHA 5IT9Z 1IBMK 1YJ9T 4BU2A 2PNIA 1Z7LA 5AJ3K 2FQ3A 2CYYA 1NKCA 5F0FA 3OYLA 4J5YA 1RDWX 3PFSA 2CUBA 1H92A 3S3MA 2D0PA 1HF0A 4FJ7A 1R6RA 2DX1A 2PBIA 3T8TA 3DXMA 1QE1A 3VS6A 4B9WA 1ZR4A 3RIRA 4FWKA 3HPWA 3HM8A 1D4XA 4DOWA 3C0BA 3ZMSA 3QWXX 5DM7R 1T0FC 2LRDA 1VQPA 2GCXA 1KG4A 4BY6C 2GV9A 3PQJA 2EPDA 4UUTA 3KUFA 3J81K 3F22A 1SL2A 2VI6A 4YG2F 3GZ5A 3O3KA 4JD2B 3AG1H 2Q2EA 5I22A 4C5HA 3SB2A 3KXTA 2F7TA 2DFUA 4N41A 1QQOA 4DTNA 3JRFA 1WZOA 3L2RA 3T9NA 5J2PA 5GTHC 5CK9A 4OB2B 4M9SA 3OWTA 3S17J 1YI2N 1U9NA 1XQPA 3L00A 2E2QA 2VKVA 3CMAN 5FU7C 2HOTA 5CVRA 4DBQA 4GXOA 4PIIA 3MJXA 3I55I 4KHUA 2JSPA 1D8JA 3HVRA 1PU6A 2BY2A 2QWRA 2ZSIB 2AZSA 3DB4A 3JCMW 1RADB 4TSXA 4J8OA 1CZAN 1PUEE 3D2FB 2HZTA 5H6QA 4DMNA 1O57A 1V4RA 5FD5A 2KRNA 3CCUT 4M7DE 3DBHB 4KHWA 3OJUA 4M78D 4MGRA 1G59A 3PO3J 3NCIA 1OU8A 4FL9A 1S72Q 1A5WA 1OCCH 4ZYDA 4OMFB 1YHQT 4KI6A 2HMIA 2FXUA 2XHIA 1U9OA 5AQFA 2XAJA 3RMAA 4EMKB 1BN5A 3BQYA 1WFXA 3DPUA 2CSIA 3ZMVA 3NFCA 4FTHA 1JL1A 1Y96A 3NAUA 5C10A 3J80K 1JO8A 3U9DA 3OYMA 3C7NA 1XC9A 1N3AA 1YBYA 4GGGA 1TK5A 2LJ0A 3FXQA 1J3TA 2YHYA 3ZN1A 5AZIA 2M0MA 3ABKH 4XU0A 3ABLH 4PL8A 4OB1B 1RLQC 2DEUA 4CCLA 4V2GA 5GAOn 2E1MB 2O01E 3VQPA 1P7MA 2XF6A 3P39A 4BR5A 4LUEA 2XIGA 1SAXA 3CCEI 1PKSA 4EIAA 2VT3A 3RERA 1SC7A 3DTKA 3EFOB 1W36D 1E6GA 4DV4K 1JCEA 2K85A 1YQKA 1FZPB 1FJLA 4L6V5 5C6SA 5CHIA 5DUKA 1V5GA 5J8CA 3JSPA 4M74A 2E1ZA 5GAEP 4ZYHA 3D1NI 4DK9A 1V4TA 2F2WA 3GTJJ 2ZM6K 3EYIA 4FASD 5I3UA 2JJ7A 1B1BA 3F6OA 2CZ7B 5GAMh 1Y57A 3A03A 2RI3A 5AQJA 4YRVA 2P9IA 1QBJA 4F17A 1ZELA 2DBBA 5IP6A 2VQGA 2W41A 2BE5F 4I2QA 1ZSZC 3R6MA 1WSJA 4BQAA 2QENA 4IIOA 3VODA 2DTIA 1PG5B 3TOAA 3I4PA 4ELVA 2Q36A 2KIFA 1H3HA 1Z77A 5IHNA 1QVFM 4JHDB 2AIRB 2CT4A 2XAHA 3QJYA 4J00A 4MO4A 5F0HA 2A6EF 2EYYA 3HYIA 4DWIA 2EIMH 4NCBA 1BC8C 2LZ6B 1JJ2P 2TRTA 1OKJA 3ROUA 4C8QF 2MD0A 3HVTA 3VESA 4L0ZB 5DM6L 3WTVC 2OAUA 4BB7A 1I94K 1F9NA 1R71A 1TK0A 2QKMB 4GV3A 1K9MR 1B9FA 4XQ3A 3JCMd 1X9SA 1R5ID 2D1VA 3ULEB 4MTDA 4XTWA 2ZMEA 1TWFJ 4KA4A 1JCGA 1E6HA 4PSWA 4IUUA 1EIFA 1M1FA 5GANd 2Y1IA 4UNOA 3A0BC 2W82A 2OA8A 4BQZA 1SD5A 3ZN0A 2FYKA 2GELA 3LYIA 5DM7L 5A2QZ 4CVNE 5GAHP 4JJNK 2H8WA 4LG0A 2K5CA 3ISPA 3OYFA 4A61A 1NJIO 5GAOp 2XMFA 1VQ5Q 3MKWB 5LGUA 1QHGA 4CA0A 4EEFG 1KQSS 4ILGB 4NUBA 1C1AA 3E1YA 4NDLA 3C1DA 4F16A 1UTIA 1VRUA 2YNGA 2F96A 1T95A 2L3DA 4AH9A 3L3UA 4F14A 1PYVA 3PMIA 3OYBA 1UWBA 3HTVA 2BHYA 4AMCA 2DPDA 3EG9A 4N4OB 4PJNA 1GT0C 1XQHA 4KAZA 2ZXJA 1REVA 3Q0UA 4AIKA 3CFOA 5F1RA 4QS7A 2HQNA 1B59A 3SHFA 3G6EA 1IZ6A 2EBPA 2NRZA 1R0BG 1N33K 4QTRA 3DLLF 2A69F 2V75A 3BQZA 2OA4A 4XU2A 2HOSA 5HRSA 2K7AA 3PM1A 2VVKA 2X6SA 1FBQA 1GCQA 3R2XC 1SFOJ 1WNSA 4KFCA 4HVWA 2EFNA 4QLCU 3VYRB 3G71T 3TU4K 2A1RA 2R7YA 2DA9A 1SPKA 2O4XB 4KJZA 4B48A 1A0NB 3RESA 1IRGA 2GXAA 4WCIA 3O9SA 4O5VA 2ZPFB 2A5XA 1YN8A 2MH2A 2O4IA 4ENKA 1YXQA 4EVIA 3FIFA 1GLDG 2ASOA 4E9EA 2F2EA 1XN7A 4I0AA 2X85A 4EP5A 4MDXA 2BOLA 1VQ4I 1VQMA 4C0DC 5L3GA 1Y7XA 5TGTA 2M87A 1HYZA 3V1RA 4YOTA 3JSOA 3I0TA 1R1TA 1EV7A 5KPZA 3CP2A 3JCUC 1YWPA 3LSPA 3D7EO 4FJIA 3M0RA 4K8ZA 1MNEA 2OTJA 4QVDA 4A2UA 2A37A 1D0YA 3J7AP 4A93J 2DTUA 3SAFA 2ABLA 3H0FA 2K4JA 4CJ4A 1V76A 2ATCB 1W97L 5CY4A 3M55A 3OYJA 4F7UB 1LAWA 4WYBA 1VQ8Q 1XGSA 4WX9A 3AVIA 3GCMA 3NF8A 3RMSA 2BW3A 4BY7J 3CCRI 3KEOA 2RK2A 2PZSA 5B5EC 5KQ8A 4A6DA 4Y28E 3UB5A 1KVAA 1Q81R 1DJ7B 2RA2A 3OSSC 1HPMA 1IG7A 1NGBA 4NXNK 1SKRA 3RR7A 2HSTA 4HWIA 3SDGA 5IOYA 2OPSA 4K25A 4I7HA 3OA6A 3MEGA 2NRHA 4E1MA 1ENHA 1OR7A 2DILA 4CZCA 1VQ6A 3FHNA 4R56A 3ZMTA 5K14A 1YJWI 3SD4A 2AHQA 3N0UA 9ANTA 1PD1A 1HLUA 1LWYA 4Y92A 1YJ9N 3CUQB 4JKGB 1R1UA 3DWLE 3R9PA 1DIZA 4ID1A 1YX3A 1C0WA 2DNUA 3TAGA 1DKGD 3GFMA 2XVCA 5BPDA 5LL6S 3DFGA 4LF6K 2JJ9A 3SJMA 5EG2A 1HMVA 1JLBA 4C2TA 1D9DA 5TRDA 3L0QA 5HNHA 5LGTA 3MAJA 4K8XA 3X2QH 3PIOL 1EJ9A 1K9MU 3MX5A 2E2OA 4QPQA 3MMVA 2D0OA 5DDGA 4H5WA 3EG2A 4KT0E 4D6WA 2XASA 2R7UA 2DY4A 1S9EA 3EUHC 2HR3A 1XWLA 3MZYA 2COZA 4BRLA 3HM5A 4B9MA 1CZBA 3CCVI 3M0QA 4J01A 1U1SA 4RTYA 4A3KJ 4J2DA 5E1ZB 2DA1A 2IGIA 4JJBA 4I2PA 3QQAA 4BDZA 3OMGA 4B8AB 2A5YB 1FYLA 2JS2A 5IHKA 1LPQA 1W5SA 4KFBA 4XH1A 3T3FA 4FHTA 4L9VA 3KETA 3X28B 2FJ1A 1RDCA 1FY7A 1SQKA 4KGVB 1ON2A 1Q95G 2UXDK 1LW2A 5JHUA 5CYMA 1BO5O 2DERA 3QB0A 1I3QJ 1U8BA 4HNUA 1NKUA 3MWTA 1WYXA 4JDSA 2G8FA 1K9MC 4FT8A 4CGJA 1L3TA 3KP7A 3U23A 1YHQN 2O8BB 1SD4A 4DUZK 3EE8A 4M7XA 1U5TC 3O9UA 3OBWA 4DSKA 3EETA 1OOTA 2QA4T 3VYUB 3I5UA 3H5RA 1K9AA 3J7YP 1QHAA 2DXUA 3CCUA 5I9EB 1B8IA 5J2MA 3O1WA 1U6GA 4FLXA 2KQWA 2FF3B 4TV7A 3BR1A 4CGDA 4W5QA 1NK8A 1QMCA 3OMYA 4MQ9F 4PKIA 1Q82R 4QIWN 3E3VA 2X9HA 2K9QA 4BGAA 2PG4A 4BXUA 1IRFA 1G15A 3LWLA 2R7FA 3URGA 2HSPA 1RAAB 4XAXB 1W1WE 1C6VX 1RBTA 4M3RA 3FJPA 3QOEA 1Q18A 2RNJA 2LT4A 2VXZA 4JLGA 2VPRA 4FXDA 1TG0A 3CWAA 1BW5A 3BWGA 4DOZA 4MZTA 2G7HA 1HDDC 3PQKA 1N5YA 4G8XA 5AQPA 2W0ZA 1BQMA 1N78A 3G73A 1UAXA 2IIRA 4YNQA 2M30A 2YCHA 1ZQ3P 5LD2C 2EV5A 4RA2A 2KL4A 3I9QA 4HDUA 5FLMJ 3CTAA 4OWRB 4RMNA 2LKXA 1M2VB 4PA1A 3LDQA 4ESRA 4BRQA 2KMTA 3JCMe 4M7AE 3K4MA 1HXDA 2LREA 4N0BA 2KXCA 1KRPA 2OQGA 2DTZA 1Q81U 1Y64A 2CGLA 4OPJA 4G7OF 2E2JJ 1FIAA 3VS4A 3PX6A 4IZZA 5GANe 1T33A 3K4JA 4NOYA 2Q2EB 1XHXA 3ZT4A 4BE0A 5EEHA 5J8FA 4CHUA 3BG6A 2YXYA 1Q9XA 2XRIA 4YOYA 2EBIA 1NEBA 5BREA 3COAC 4FWPA 4WFBL 2HI3A 5E3NA 1XX5A 3GOXA 1Y39A 3WE2A 5GAMf 4RGRA 3SZPA 3O8MA 4MFBA 1VSLA 3EPZA 2L9SA 1JTXA 1IN8A 1N32K 3V8JA 4EW0A 2HBWA 1JCFA 3BGRA 2QLZA 5CKTA 2EZKA 3WNHA 3WG7H 4S05A 5J40A 2BE9B 3LSTA 1AOJA 3GFJA 3HB9A 2DAOA 4XTUA 3VEPA 2DTOA 3TARA 3L09A 5HDKA 3QDFA 4C8QG 4JX6A 3SAHA 1MMSA 1RAFB 5E8GA 2JWLA 4JI1K 2P9SA 5DD8A 2L2PA 1ZG3A 2DW4A 4MO7A 3AVMA 1Q81C 2YX4A 2JMWA 5GPCA 3V7SA 2VPLA 1ZLJA 2I7NA 2E70A 2P5LC 3WXMB 1DGWY 3FHZA 2JG6A 3C7NB 5CIUA 4YPRA 3LNQA 2UXCK 4PJOE 1D1BA 5KCMA 2NRWA 2L4AA 2UXNA 3CXCS 5JLFA 3HK2A 4GLKA 3U2RA 5CKFA 5AZIB 3NGZA 5GINA 2MABA 4CBWA 3MEEA 4C3IJ 3F70A 2R7OA 2J5PA 2VYPA 2ZCWA 2Y1JA 3I64A 2FBXA 1XMXA 3VF4A 4O5FA 5M1OA 3BF1A 3SWNA 3I0WA 4FE7A 4BRPA 1PC0A 2XGXA 4A4HA 5LJ5g 2K40A 2EA2A 1UA1A 1E2XA 3TBIA 1RACB 4P5NA 4IURA 2E12A 4VUBA 4C8QC 2Q0UA 2ECZA 4AIAA 2QWNA 1KD1O 2LT1A 2J4RA 5GIPA 2XF7A 3SUOA 1VQKA 1JLCA 4GNIA 1HKQA 3JRZA 3G71N 2I5UA 1NGEA 4RTTA 3DMJA 1ZREA 4FT2A 1XG1A 1ZAOA 4JZ3A 2PJPA 1IDYA 1NGIA 4G1QA 1ABOA 1NLOC 1S6LA 2KLOA 2DFEA 1NK4A 1OEBA 2R92J 2QDYB 3ZP5A 4MO5A 3AGRA 2Y0MA 2ZXWH 2EJ9A 3X20B 2CQQA 3OYIA 3CC7I 1ORNA 2CUJA 2RHKA 3U3GA 3PNTA 1KFZA 5AFUA 3G3ZA 3TDZC 1Y1WJ 2NRVA 1Q82U 3SJHA 4EAHD 4OMNA 2K3PA 3A8OB 4K11A 3QETA 4GYGA 2ROTA 1LV5A 3LDOA 4RB0A 2RQUA 1TC3C 4FJMA 4LDYA 4G9YA 3CPWS 1EBMA 1SMTA 3TR8A 3GNFB 2I5JA 1UECA 3FM3A 4WFAL 1HK9A 1VQ4T 4JQFA 3SMSA 2YPRA 4I7FA 1YIOA 2ZMEB 4OAZA 4C8NA 1YIJI 1QVGS 3DXJF 5D3GA 2AT1B 1B4AA 2JT1A 1YITI 1MUNA 4XH5A 1PCXA 3DOKA 5IYCJ 2DA7A 2W40A 1VQ5I 4GFBA 1DU6A 3MO8A 3DQVC 3H5NA 3CFPA 3I0XA 2K5LA 3FB9A 2HCKA 4LG0B 2D0QB 4II1A 1A36A 1R49A 3O9RA 5KE2A 4KKOA 2RQQA 2ECCA 3CD6I 3I71A 1XTAA 5HRNA 2B5JA 2HU9A 4FOEA 5FPEA 1FKPA 5HK0A 3IHOA 3CCRT 2V51B 4U0VA 4JI8K 1N39A 1QWEA 2GXBA 2QQ9A 3RMQA 3MAQA 4EMKC 4EA4A 4LD0A 2OZUA 3EG9B 3O3GA 3Q9VA 2Y48A 3EGXA 5IPAA 3O1BA 4M3TA 5HBMA 1MKMA 3CHWA 3ZSYA 4L5EA 4C8QD 4RGXA 3HO1A 1Y71A 5D6FA 1HA8A 5GAN5 2WBMA 2E1MC 2DJIA 2DXTA 2HFHA 3UWNA 3R3LA 2VT2A 4FWMA 3O8GA 2AJQA 2FBHA 2QW9A 4H5VA 1MA9B 4ELYC 3ALYA 1WZ2A 3WT0A 3S1NJ 1WSEA 3ZL7C 2PMZN 3IRQA 4X66K 4OPKA 4HA8A 3NARA 1VQNT 4C9YA 4DA4A 4DU3A 4EJUA 2VXFA 1K78A 1H0MA 1VNDA 1DPUA 4ETSA 4CEAA 1ZA1B 4CZHA 1J5OA 4RM3A 1XS9A 3W6KB 3VQQA 4EVVA 4Z4HA 4KGZB 3VS2A 3TANA 4A3MJ 3HHHA 4HPQA 3F8NA 2WY7Q 3P1GA 1LOJA 1HUXA 3K5NA 1TH7A 1Y0MA 2CP3A 1MBFA 2L7MP 2EYWA 5BPMA 3JREA 3M8QA 1VQ8I 1TOVA 3QYEA 3CCVT 1N75A 3HDDA 3NTHA 4FJHA 4DU4A 1X6GA 1BIAA 2W1OA 4OB0B 3K2PA 4E1JA 1T3LA 5AQGA 4JI7K 4CJ3A 4E7IA 2DO7A 3I5RA 3JCMh 2YDLA 4DKWA 3U6FA 2BXZA 4MZPA 4KBMB 3AHUA 2QA4N 4J2BA 2BW3B 1D9FA 2JQ7A 2Y0SN 2M9HA 4GRIA 5JICA 3HIFA 2E6ZA 5E1WA 5GANh 1VQOA 3HL2A 3K10A 4FWLA 4ZZLA 5GMKl 3RKXA 3Q5FA 5B1BH 3EKUA 3K5OA 1RKWA 3S3NA 3A1YA 1QZ6A 2XAFA 2M9UA 5KN9A 3C6HA 2HQEA 5BN8A 1ZBLA 4H0EA 4ELTA 3LH0A 2ZPBB 1J54A 3TP0A 3REAB 4H5NA 1K8AR 4KUIA 1P7JA 3CCLI 2F8TA 2D0NA 2DCEA 2DZ9A 1KVCA 4OVLA 4BQLA 2NAZA 3F10A 4N4GA 1YI2Q 4HCKA 3ECHA 3CMAQ 4LLGF 4DSFA 3KTUA 1RGIA 4CEDA 3JSCA 1WJEA 5AQZA 2L7KA 4IRHA 2BVMA 4HF1A 4UY8O 4DQIA 3RZDJ 1QQNA 1R59O 1W0TA 4X1VA 3F6VA 3OS1A 1R22A 4J6WA 5IT9E 1BBZA 3HRGA 2I10A 3CCEN 1OH7A 4LK0F 1BKBA 1P8ZA 2XD0A 4CJ5A 3X26B 3RR8A 1D8KA 4M3UA 1K8KA 5IXFA 5KAIC 3T1AA 1YCSB 3EUAA 2K9MA 1W2BS 1TW3A 3BTLA 5AQYA 1FWZA 4DR3K 3HOSA 3KP5A 2X1DA 2W4SA 3GUDA 4GKKK 1K61A 2HS5A 3CCSI 1S29A 3GXOA 2JPCA 1SVMA 1W7AA 2HEOA 1YTYA 3GTGJ 3VA3A 2FZGB 3G10A 3FXMA 3EL2A 4N4HA 3RKYA 4PL6A 2M51A 1BHLA 4FJLA 1KC8O 4Y52J 3L2WA 2H3JA 2P6SA 3R0JA 4DTOA 1TKDA 1WSIA 3PV8A 1U45A 5CPRB 5KRSA 2LP0A 3I54A 5HRRA 1SHGA 3CBMA 3QBXA 3C4SA 4YOWA 4CZJA 4KBOA 1YG2A 5AQNA 4XSZF 5ILVA 3CCJA 4BVPA 1IZ1A 2JUFA 2DPPB 4AYBA 3JB9H 1F36A 4IFYA 4L18B 2M4KA 2BV6A 4L59A 4UV8A 5L3CA 1SL0A 4KIBA 5CKBA 3FZFA 1PRLC 1OX8A 3SV3A 1JKHA 5HNFA 1VQLA 1B8IB 1GV5A 2RQRA 2UUAK 2A3ZA 2V1UA 4B1WB 5KCOA 2HF3A 4NO7A 2ZGWA 3L4IA 5LRRA 1STZA 5CVIA 2R7DA 1SEMA 4CC7A 2EAYA 4UVBA 2P81A 4PDKA 4GYIA 4OFEA 4CHZA 3BTJA 3G4SI 2COYA 4QW2A 4KHSA 1C0FA 4L8RB 1JJ2S 3KHYA 5J1EA 1IUYA 3KX2A 3JB9F 3GNGA 1WJDA 3SK3A 1APLC 2WONA 4PWDA 1D1AA 5EVZA 5D6EA 2GWJA 3C65A 5I2SA 5AQLA 1XSXA 1J09A 2P7CB 1EX4A 5K5QA 4LNPA 3AVFA 1EP4A 2IW5A 4PL7A 2F5CA 3CUQC 4BHCA 4YPHA 2DKGA 1T8EA 3A5OC 5HKCA 2NOJB 5CR2A 4MZMA 1SEUA 2EFIA 3P7NA 1IV6A 1OZ2A 3LSHA 1JKQC 2DIGA 2EW3A 2VJIA 1GL5A 2HBJA 3M6GA 4CJWA 3NF7A 1X2MA 2F5TX 2DTHA 1AZEA 2JVVA 1KQ2A 1H1VA 3JR9A 2IVNA 3ZSVA 4KIGA 4YIFA 4YDUC 4KGXB 1M1EB 1BL3A 5GAGJ 5FWBA 3MXIA 1IHWA 3CM5A 1ONVA 2JT4A 5C2DA 3FBIB 1F5TA 2JPSA 5CLSA 2RNAA 3SMPA 4CEFA 2VQCA 4ZN1A 3KZZA 2PQWA 3LMMA 2ZPGB 2V7FA 1K8AU 4NB5A 3LPTA 2ITGA 1O3SA 4CCMA 5J1UA 4Y3OA 3QPTA 2KQ2A 4XRSG 1R23A 3CCQI 3H6EA 3SV4A 1QWFA 4HSTA 4C5IA 2GOMA 3CDLA 3RJPA 2EKHA 1VQ4N 5DTDA 1HSTA 2DT5A 3CC7T 2H94A 2W10A 2FXAA 1EH6A 4KDPA 1VTNC 2EZIA 4A69C 3SZTA 2MFZA 1FKOA 3RMBA 3S6WA 4IG0A 3WGIA 2GOXB 1TS9A 3JCMg 4L5GA 2DK8A 3Q1JA 3FZKA 1R4MB 4BS9A 5LEJA 3FLGA 3W6JB 2QSHX 3C12A 3PGGA 1WVRA 4CI6A 1JL2A 1LOTB 2M1BA 1IRXA 2P9SB 2HPMA 2Z1HA 1X01A 5FRNA 4CBXA 2G8KA 4Y0WA 3ZLJA 2AS5F 3VS1A 4H0XB 3RSEA 4FSXA 1K0XA 4AILC 1RAIB 3CCRN 2Y2ZA 4BH9A 2V7YA 4ZNXA 4PJLA 2DMOA 5L8RE 2LMJA 3O6WA 3HPOA 1IC8A 2FOWA 1YIJT 1RBSA 1K8AC 5A2QE 4LF4K 1YITT 2E1OA 4CEZA 3OR1C 3RDIA 1KAYA 2JK3A 4XK8E 3ZCMA 2LFBA 5F64A 1B07A 2CP7A 3SWNB 3U9GA 3A5LC 3E6DA 4WCGA 2QTDA 5C0YA 2HYJA 1P7IA 1MUZA 5HCKA 3WE3A 2AKKA 4CF2A 1TNSA 2OTLI 3FLCO 3VQDA 3VEZA 4KITB 2M5WA 4KB1A 2XU8A 1XQSC 1K79A 2HVSA 1N8RR 5K1YA 1MH3A 2O9VA 4PUOA 2FZCB 3WXJA 1VQNN 1MBHA 4LE9A 3Q0WA 5CYVA 3GF5A 3F3XA 2AXLA 4M77B 1B7TA 2X35A 4DZJA 3F8MA 3HKSA 2E64A 4RTXA 5IY5H 3E6MA 2FSWA 2K79A 4L9JA 3VERA 3ZT1A 1RR8C 5GJVB 3NPFA 4PSXA 3V9UA 1WHGA 1WH5A 1OPKA 1PP7U 2HGCA 1I8FA 1YJ9Q 2DL4A 2GA1A 2E1YA 2K3XA 2CW0F 4CGGA 2W6KA 2QCOA 3CCVN 2DAQA 3AV9A 1BU1A 4IIMA 2B86A 3C6TA 4ME7A 4D1QA 3MWMA 2A41A 1YAGA 3WXKA 2P0WA 4LXCA 1TU0B 2LOOA 1NNEA 2X6YA 5IT3A 2KNBB 3QWYA 4ZDPA 1T6CA 3OJSA 4EM0B 1KYWA 2XG8D 4F7UE 2GZWA 4H4MA 2E6MA 3HGGA 2F2VA 5E79C 4C5EA 4KTQA 4Q4ZF 4BR0A 2MYSA 1AKHA 4KH4A 1X43A 4FYWB 2AXTC 1QRYA 2KFNA 3CCYA 2C6YA 3KWGA 3KLHA 3D5LA 5EC7A 3BROA 1NJZA 1X9MA 2EQKA 2XY5A 3KZYA 1OH6A 2ZJQF 2E60A 4FX0A 1TSFA 3ONQA 1MBGA 2B4JA 3RI4A 1D0ZA 2LDUA 3MMYB 1T39A 4JI3K 3JCMf 4NYNA 2BTFA 4CF1A 4HTLA 2YUOA 3GF2A 4CDGA 3UATA 1Z6RA 2K3BA 4XMYA 2LVSA 5GANf 3AA5X 4Z2YA 5KHDA 4OGCA 1M8MA 3EGXB 3VKIA 2CZ6B 5FLXK 1KGSA 3J7AY 4QS8A 4C2MJ 1H3ZA 3CPFA 3F73A 3WNEA 2J6OA 3AAPA 3ZQCA 3KP4A 1NOZA 4RMOA 3ZQQA 2YHAA 4A3JJ 1TZLA 4N0AA 1X9WA 5E41A 2WUSA 2QASA 3K2AA 5GAN7 4FK4A 1QNTA 2O2OA 3CCLT 4V2FA 1EETA 3K59A 1YHQQ 3BDPA 2DOFA 4PFZA 1WKMA 2DXBA 1RDBA 2DA6A 3SLCA 1MNDA 3H45C 4H0YB 1TP4A 2XAUA 4G7ZF 4CZLA 4NL3A 2HQAA 2NOHA 2QQAA 2QAZA 2OPQA 4DF8A 4TVRA 2D6FA 4UXNA 1IG8A 1ZLKA 2FEZA 1T3VA 5J26A 4CZEA 3TSQA 1XSDA 1GBQA 5C0MA 2GF7A 1K78B 1JT6A 3QU3A 4UB6C 1H9TA 1KD1R 4J83A 1VYUA 5LJ5j 4FZZA 4N47A 3LAJA 1NGDA 4R55A 3HZJA 1CF7A 4AI5A 4E7HA 4IQJA 1KU3A 3TQNA 5L3DA 1X3UA 3F2KA 3ECOA 4JJCA 2D0CA 4O5BA 2IAJA 1FOYA 3FKJA 2NOZA 3HYFA 2HOEA 3D4VA 3BTCA 1VQPI 5EXWA 3KP2A 4FK0A 3AY9A 4HF0A 3CCST 3BUZB 3Q7CA 4DR6K 4RAZA 3UA7A 4D7NA 4HVJA 4RKUE 4NC7A 3OH6A 1HKCA 3IKMA 4K41A 2KKZA 1MPGA 2DLPA 5M1PA 1BU6O 3PNYA 1RNLA 5AFUH 1T0HA 2KYBA 4RTFD 2QK9A 3VYGA 3P8HA 1ACIA 2YX7A 1N8RU 2ZE2A 2CMPA 1AWJA 4FW1A 2WOMA 1RPWA 4R8HA 1IV0A 3MN9A 3I3LA 3AFHA 3I56A 3JCMJ 2AP1A 3LSGA 3J7YJ 4KREA 2UU9K 4PCQA 5KVRA 5FPDA 5BOXA 1DDNA 1G6NA 2RK1A 2R0QC 2F2XA 2ZMEC 3MZHA 1EWQA 2AQEA 2MMPA 1I5LA 5HDGA 2FF4A 2WTEA 2XGCA 1M8VA 4B3XA 3L42A 2E7XA 1B9NA 1P90A 5CQEA 1XGNA 2B7EA 2JGUA 4K0KK 2RPIA 1VSHA 1V5EA 2ZJRF 3C2GA 1KLMA 1MSEC 1RTIA 2ID6A 3I9V2 1ZRCA 1BCOA 4M78B 3DKXA 1FOWA 3VYHB 3EO3A 2R7XA 1PSFA 2MIOA 4HNTA 4OKJA 1VSKA 3MD2A 1LDDA 3I53A 2LNHB 4LF5K 2JTEA 4QQDA 4U67L 1RAEB 3HRSA 3OOPA 2IT0A 1F1BB 3VN5A 4PFOA 1NGJA 2KRCA 3G4ST 3ZSXA 3VSLA 3JB9G 2L3PA 2RNGA 3A8MB 2EYQA 1N8RC 1KQ9A 4A4GA 2ZNZA 3HEFA 1MGQA 2VWFA 3CDIA 2DYBA 2EFOA 1FOXA 3HC7A 4H0OA 5AQRA