4BACA

Prototype foamy virus strand transfer complexes on product dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Assembly of Prototype Foamy Virus Strand Transfer Complexes on Product DNA Bypassing Catalysis of Integration.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 82
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bacA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bacA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bacA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bacA03
3BGRA 1KLMA 2HNZA 3HPHA 3SPZA 3OYFA 4IG0A 4G1QA 4KTZA 4BWJA 3AVIA 1RILA 3NGZA 4CJKA 3LZJA 5KE3A 1VSDA 2G8IA 1YTAA 4M3ZA 5KGXA 1EP4A 1GOAA 1ZBLA 3KJVA 4J2BA 2XK0A 3SUPA 4OPJA 3UIQA 1RTJA 5CZ2A 3RWUA 1YT3A 4NYFA 5HLFA 3MP8A 5HBMA 3DLMA 2ATQA 4PY5A 2EHGA 4B9SA 1A5VA 3VA3A 3OYLA 1ASVA 4FCYA 3NBPA 3SJJA 3IS9A 2RJEA 3LX7A 3OYEA 1WJRA 3M8PA 4E7JA 5J2PA 4N4GA 4FZYA 3OYBA 1JL2A 3FLGA 2RJDA 2YV0X 4ZTJA 1IKYA 4DG1A 1QSYA 3NH1A 1LAWA 4CE9A 4IKFA 1RDCA 3LLRA 2Q3SA 5DK5A 1XHXA 4HCBA 1NOZA 1N27A 4BD3A 4M3YA 3SD4A 3KK3A 3L2WA 1RT5A 1HNVA 4O5BA 3MEUA 1JLFA 4DFJA 2B5JA 3SUQA 4DU1A 3M8QA 1NJXA 4Z4CA 2MWPA 1NK9A 1WGSA 2RKIA 4GMJB 1FXXA 1T03A 1RT6A 3HVTA 5JS1A 4CJSA 3QEWA 3META 4FLVA 1WSIA 1HYSA 4Y1CA 1U45A 1VSEA 1HMVA 2G8FA 1CXQA 2D9TA 4C8NA 4DSLA 1TKDA 4A4FA 4CEFA 3OYDA 4CESA 3O3FA 1W9HA 4IBNA 4ZHRA 4B3OA 4KV8A 3ULDA 1B9FA 2LRQA 4CIGA 3SQ2A 1JLEA 2EQKA 4FZXC 3ZCMA 1WLJA 3EAEA 2RN2A 1X9WA 3V9SA 2NUBA 3VN5A 1BCOA 1VSMA 4IFVA 4BE2A 4E89A 1JLCA 4I9QA 4FVMA 4HVJA 3AO3A 1KFDA 3I8DA 2KW4A 3KLHA 4BE0A 5T7BA 1JLGA 1S1VA 4DFMA 4W5OA 4HCCA 1QE1A 3RTVA 3OS1A 1OZ2A 4PUOA 4EP5A 1EXQA 3S3OA 1VRUA 3DB4A 4K8ZA 3VQDA 2GF7A 3ZSQA 4W5TA 4FYDA 1VSIA 2HHXA 1B92A 3QEVA 3E9GA 3VQ8A 1SKWA 1VRTA 1J54A 3K5NA 3OYNA 3LH0A 4O44A 1BI4B 3F9KA 3NDKA 2R5AA 1B9DA 3MEEA 3F73A 1X1PA 3ZT2A 4FJ7A 4CHPA 2R58A 1U4BA 1WSEA 1XC9A 3P83D 3U3YA 2RHXA 2R7YA 5CYQA 2EFIA 4M3UA 4AHVA 3TI0A 2XY7A 2Z1IA 4DLGA 2HQXA 3V81A 1S9GA 4FJLA 4JRPA 4CGFA 4KO0A 3OYAA 4Q5VA 3LP2A 2R5MA 4CJFA 3VQBA 3ZT4A 4GW6A 1TK8A 5D6WA 3LP0A 4N47A 4B8AB 2L3RA 2O4IA 4KKOA 4Z02A 3QINA 1S1TA 3U3GA 3C6TA 4C8OA 4IDKA 4JS5A 2IG0A 4RW7A 2DFEA 4CGJA 1KHCA 4PWDA 2I5JA 3A2FA 3K5MA 4FLTA 4CHYA 2FC0A 3H8ZA 1O1WA 3T1AA 2HHQA 4BDPA 4DWIA 3LDSA 2YNFA 4TSXA 3V1QA 2PY5A 3TABA 1ASUA 1U49A 2RI5A 2GFAA 1IKVA 1NJWA 3DYAA 3S6WA 4OPKA 3SV3A 4KRFA 3TAGA 2G8HA 3B6OA 2OA8A 4DF4A 1XHZA 3TAFA 3AVHA 1UA1A 4FJGA 1KTQA 2OYQA 3DB3A 1DLOA 2Z1HA 4KHWA 2FBVA 3NH0A 3C95A 2ETJA 1LW0A 4OJRA 3AVJA 1UA0A 4FK2A 4DU4A 1NKBA 2F8SA 4E1MA 1KVBA 3MEDA 3DRSA 2F5KA 2L89A 4M3WA 2L8DA 4CF0A 3C6UA 1XNIA 1BGXT 3HK2A 1WSHA 2G8KA 3AVFA 4KFBA 4LD0A 4M3XA 4CFCA 3LPUA 3LZIA 3V9UA 3TAMA 4FJ5A 1WJQA 1NJZA 3T19A 2P5GA 4B9MA 4DQIA 4W5NA 1CZBA 3NF9A 4W5QA 4B9VA 1I3AA 4MFBA 3OMGA 1J5OA 1FKPA 5K14A 3SZ2A 4FJJA 4IFYA 5CZ1A 4KHNA 1BCMA 2DFHA 3PY8A 3O4QA 3K58A 3DRRA 4JRQA 1C1BA 3QETA 3P1GA 4J2AA 3VQQA 4CF1A 4DU3A 2X6NA 4OLBA 4B9LA 1JL1A 4M3RA 4N76A 4Z4FA 4KB1A 3L2RA 3GOXA 1RT7A 4FK4A 3LWMA 1X9SA 3AO2A 3DM2A 4DTRA 2P5OA 2WOMA 1IG9A 2Z1GA 4YNQA 2HHSA 3ZT3A 3IRXA 3CG7A 4M45A 2RHIA 5J26A 4CJPA 3ASMA 3MEVA 4CJ4A 5SZTA 3JYTA 5JS2A 4DTNA 4CK1A 4CIEA 3K59A 3HSTB 4CF8A 3Q1JA 4ICLA 4CJTA 1TVRA 1NK5A 4CEDA 1NK7A 3BDPA 1JKHA 4OVAA 2P51A 3QIIA 4Z4HA 2FHDA 1RBTA 3OYMA 4E7IA 4FJHA 3VQPA 1RTHA 3THVA 4QAGA 3KKSA 1L5UA 4FLXA 2VG6A 4EZ6A 3QEIA 1S9EA 3UT1A 4FJNA 1TAUA 3H08A 1D9DA 4DTOA 4OKJA 3ZSVA 4ID1A 4BDYA 3WNHA 3LANA 4PQUA 3VQ9A 1MU2A 4DSEA 4FJMA 1HJRA 3MXJA 4B8CA 4CK2A 2XDPA 3VQ5A 1R0AA 3OVNA 4HCZA 3KTQA 4CJWA 2HMIA 4FW1A 2D0CA 4MQ3A 1REVA 1Z25A 4QQ6A 2QQRA 4I7FA 4DQRA 3LAKA 3AA5X 1A5WA 1C0TA 1D8YA 5HRPA 3ZT0A 1RT4A 4I2PA 4AHSA 4EP4A 4CK3A 2X74A 4B9UA 3HP9A 3HPOA 2DIGA 4M3TA 3P8DA 1HQUA 1SUQA 4I9LA 4KHYA 4C8LA 4CJRA 2JZ2A 3HL8A 3AVBA 3VQCA 1RNHA 3K5OA 2RI2A 3OYHA 4CGDA 4BE1A 2VWKA 1TL1A 5IN1A 1C6VA 1TK5A 2B4JA 1NKEA 4B9TA 4CEZA 3PFSA 2ZD1A 3CM6A 4FJIA 2HVIA 2QQSA 4XIUA 1RTIA 4O0JA 1U04A 4CFAA 4AH9A 2D0AA 1SKRA 1ZBUA 5HP1A 1L3UA 2PQWA 3QEPA 2IGIA 2K3XA 3ZSOA 4DS4A 2OPRA 1ITGA 1ZYQA 4N4HA 3QNNA 4AHRA 1S1XA 4RW8A 3S9HA 3PO4A 4RW9A 1DTTA 3SUNA 2W42A 2HHUA 3P8HA 1SV5A 2E6LA 3AVLA 3TWHA 3I0SA 1SSFA 2YNHA 3LP1A 4UQGA 2DIQA 3QO9A 1SL1A 2HVHA 3MXIA 5IAYA 4FLWA 1QQCA 2PZSA 3JSMA 4CFBA 1D9FA 4LD6A 2Z1JA 3TAEA 1KVAA 2GV9A 3QNOA 3NAEA 4Y1DA 3K5LA 1J9AA 3LALA 3PMTA 4CF2A 2ZQBA 1RBUA 1NOYA 3QERA 4IURA 1KRPA 3NGYA 4GY5A 3H6ZA 5C6SA 1TKTA 1D5AA 3PX0A 2PYJA 4LH4A 3ZSYA 3I0RA 2RJCA 2YNGA 3MO8A 1TL3A 2RHYA 4NCBA 4X34A 3LPTA 1N5YA 3IAYA 2G8UA 3NTHA 4QQDA 1BIZA 1LWCA 1CLQA 3FEOA 3QIPA 3HJFA 3FDRA 3QEXA 1KCFA 1JLBA 4N41A 4CEAA 1WN7A 1N6QA 3S3NA 4EDUA 2LTOA 3MEGA 4DQSA 1RDBA 3KUFA 3L2VA 2NLUA 2FBTA 3DLRA 3FC3A 3K57A 3D0PA 1HQEA 4Z4EA 2DY4A 4J2DA 3NTIA 3VQ6A 3KKRA 3PV8A 1YVUA 4L8RB 3VQEA 2YKNA 3AO1A 2O4GA 3EY1A 5J2QA 4E7KA 4M41A 3DRPA 1TGOA 3K2PA 1T05A 3LGFA 4Z4IA 4KHSA 1VSLA 4FM0A 5HRRA 1C1AA 4KHUA 3L8BA 1QSLA 2GBZA 1WAJA 4FJXA 5M9OA 3OS0A 4HHTA 2BGGA 1L3VA 1SKSA 3DLEA 4A4GA 4C8MA 3OMCA 3ZEHA 2YNIA 3G0ZA 4OKKA 1DTQA 4PL6A 4CHOA 5FRNA 2XRIA 4CIFA 3SUOA 2OPPA 1UAXA 1OI1A 4DQQA 1XWLA 4Q5WA 1L3SA 2R57A 2PYLA 3RMDA 1X9MA 3OS2A 3KLGA 1T7PA 2ITGA 3TANA 1RT1A 4O4GA 4CGHA 3AVAA 1ZBIA 3LGLA 4B9XA 1KLNA 4CEOA 4OGEA 4W5RA 1EX4A 2EQUA 4E1NA 4CJUA 4DTMA 3QIOA 3AVNA 3LWLA 2K3YA 2LSNA 4YFUA 1UOCA 4FJKA 4QW2A 4QOZB 3CM5A 4CEBA 5KI6A 3L2QA 1TK0A 4N5SA 2OZSA 4QVZA 4BACA 3KLEA 4KHQA 4B9NA 3IG1A 2E4LA 4ELTA 4DSIA 3TR8A 2EKOA 2X6SA 3RMCA 3V6DA 2LCCA 4CEEA 1VK0A 1FKOA 3WNFA 2X4XA 4AHUA 3SI6A 4RG2A 3ME9A 3C94A 4F3OA 1J53A 2KFNA 4OKEA 2JLEA 1HYVA 3PNWC 3RMBA 1OYXA 2JTFA 4B9WA 4CHZA 4BDZA 2F8TA 3HVRA 3NGIA 5KE2A 4CHNA 3MP1A 5HRNA 2QKBA 1BL3A 3O3GA 2RI3A 1NJYA 1Z26A 2Y1JA 3FFIA 1BHLA 3P5JA 2RHZA 3QESA 3PUFA 1KVCA 1GOBA 4M42A 4EZ9A 4DTJA 1S5JA 5KTQA 4H4MA 3PX6A 3KLFA 4ID5A 4C5GA 2IAJA 2M0OA 2P1JA 2YHBA 4O0IA 1BI4A 3HXMA 4JLHA 2BUDA 2EX3A 5C42A 3O4NA 4IUPA 3PMIA 4F8RA 1WSFA 1EKEA 4DFPA 1RTDA 1QSSA 2B8AA 4AILC 2G3RA 4DTPA 1LW2A 1VSKA 3KD1E 5J39A 5CYMA 2HW3A 1LAVA 1S6PA 1ZBFA 3WNEA 3DLHA 4H8KA 5C0MA 3OB9A 5KRTA 3AA2A 3V9XA 4FW2A 2XO7A 4PLIA 1IO2A 5KH6A 1K6YA 3TAPA 1U47A 4CJ3A 3MXMA 1U48A 3NFAA 4QQGA 4LSLA 2RJFA 3HYFA 1WSGA 2A1SA 4KREA 3MP6A 3SYZA 3MAQA 4UC4A 1S1WA 1VSHA 4O55A 3EYZA 2HQEA 4WE1A 3DOLA 4IUUA 2B6AA 2GUIA 1W0HA 4DLEA 3NF7A 1RT3A 1C1CA 5CIUA 1XI1A 4KI6A 1JXBA 3DLBA 1WAFA 1ZBHA 3AO4A 4CFDA 2HNDA 3ZSRA 3SCXA 4CF9A 3ZSZA 2QK9A 3O3HA 2LVMA 1NK8A 1RBRA 2M1HA 4DSFA 1NK4A 3HT3A 3T3FA 1RDAA 1RBSA 2YKMA 4ELUA 3TAQA 4F4KA 4AHTA 5DMRA 1CZ9A 4NZGA 1G15A 3WNGA 2DAQA 5C25A 3HPGA 5SWMA 4FLUA 3NCIA 4K8XA 2DFFA 3DLGA 5J2MA 4CECA 3LAMA 2D0BA 2WACA 4DQPA 2BIVA 2BKDN 5KGWA 1H3ZA 1LV5A 4KTQA 1LWEA 4E7LA 3LYIA 1RI0A 2BANA 2WONA 1LWFA 2HHTA 4QCLA 2E6NA 1QTMA 4L59A 4NYNA 3DMJA 1NKCA 3L3VA 3U6FA 1NK6A 3HM9A 3ITHA 4E19A 4BWMA 4RW4A 4NCAA 4C5EA 1BQNA 1RCHA 3NE6A 3HP6A 3AVKA 1BISA 3EZ5A 3SPYA 2XY8A 3MEAA 3V4IA 1RBVA 1NK0A 4OLAA 4C5HA 1TV6A 2RO0A 3HO1A 4A4EA 3QKJA 2QXFA 2HB5A 4ZTFA 3L42A 4KTWA 1TKZA 2F96A 4KI4A 1SL0A 4CGIA 3D45A 3LP3A 4FL6A 1IKWA 1RT2A 3ALYA 4CGGA 3RRGA 2IS3A 3OYKA 5I42A 4H4OA 5D6XA 1G5VA 4NCGA 4Z0UA 4CJVA 4CRIA 5C24A 4FU6A 3ZT1A 4IG3A 3VQ4A 3ZSXA 2RPIA 1SL2A 3F70A 4DTXA 3S3MA 2HHWA 2RF2A 4KB0A 3NF6A 3ASKA 4II1A 5FRMA 4FXDA 2IC3A 2ZE2A 4KPYA 3VA0A 1T8EA 5J2NA 1HRHA 4F3TA 2VG7A 1UWBA 2E5QA 3DLKA 3ZSWA 3KK1A 2FBXA 1HYZA 1F21A 2EQMA 4J2EA 2KQ2A 3MEWA 2E6MA 2FBYA 2YRVA 3QLHA 4E0DA 3ISNC 4CERA 3DI6A 4FLZA 4FJ8A 4E3SA 4B08A 2HHVA 1IKXA 4PA1A 1BQMA 1A5XA 4DTUA 4HUEA 4OGCA 2O4XB 3CQ8A 3RR8A 3KK2A 3VQAA 2XY5A 2BE2A 2VYTA 4N4IA 2JGUA 2VWJA 5I3UA 4DSJA 3CFOA 5D3GA 4I2QA 1JLQA 3CYMA 1BIUA 5CY4A 3SNNA 1L3TA 2EQJA 5KRSA 4DSKA 1KSPA 2GFUA 3KLIA 4CJ5A 3VQ7A 2KTQA 3M9QA 3V1OA 2KZMA 1FK9A 4DS5A 3PO5A 1Q9YA 1JLAA 3DOKA 1HPZA 3OY9A 4FM2A 3G10A 1C0MA 2VG5A 4IUTA 4KAZA 2IDOA 3QJ6A 4E7HA 1EETA 4RW6A 1KFSA 4AHCA 2HNYA 4IUQA 5FROA 2YHAA 4DFKA 2CKKA 3AV9A 2A1RA 3KD5E 1CXUA 2OPSA 4CEQA 2IOCA 2DTUA 1C0UA 1WJSA 4C5IA 3AA4A 3V9ZA 3RR7A 3OJSA 2X4WA 1GOCA 3SV4A 4HUFA 3MECA 3NF8A 4OVLA 1YTUA 4HTUA 3OYGA 4PLLA 2X78A 2BDPA 4FJ9A 4DF8A 3M8SA 4F2SA 4N56A 2G8WA 4C8KA 2P0KA 3KIOA 2D5RA 5D6YA 4A4HA 4JS4A 2LDMA 4CCHA 3SQ4A 2M16A 4CJEA 3V9WA 2OZMA 2G8VA 3UWNA 4Q0BA 3O8VA 4CJQA 3NTKA 3CFPA 2XHBA 4F2RA 3E01A 5FDLA 3BDLA 4LSNA 2KFZA 5J1EA 4R5PA 3L2UA 3AVGA 4LH5A 3AA3A 4DTSA 1MHNA 1RDDA 4FLYA 3RMAA 3V1RA 4FM1A 3OQ5A 3SQ1A 3AVMA 1Q9XA 4ELVA 2X4YA 3CEYA 4IUVA 1IH7A 3OYIA 1TKXA 4CJLA 3L3UA 4FZZA 2RHUA 5HRSA 4RG8A 5KCOA 1WSJA 1OZ3A 2MWOA 3CFRA 1WNSA 5KCHA 1QHTA 1Y97A 3M8RA 3SQ0A 3OA6A 3RRHA 3NHGA 1I39A 1S1UA 4CHQA 2AJQA 1ASWA 2OPQA 3OYJA 3QBYA 3E9FA 3OYCA 1HNIA 1QS4A 4FK0A 3NNQA 4GVMA 4Z4GA 3NH2A 1S6QA 1VSJA 2X35A 1Q8IA 2O4XA 4HUGA 3AO5A 2KZZA 2Y1IA 5HROA 5E41A 3C4SA 2QKKA 1TAQA 2XY6A 1JXEA 5EU7A 3OJUA 3TARA 3AVCA 1VSFA 4NS5A 3PX4A 4DMNA 3B6PA 4LY7A
chains in the Genus database with same CATH superfamily
1Y8RB 2HBPA 3OBYA 4PJMA 5GMKi 1KLMA 1N36K 2NRRA 4YOVA 3FZLA 1KG3A 4IG0A 4G1QA 3JCMe 3QFPA 1QWFA 2DETA 2QA4N 3QB0A 1BWFO 2QQ8A 4JKCA 4CD1A 1OH6A 1V4TA 1I81A 4B1YB 5BPIA 3F0CA 4FWQA 1I6HJ 2RQTA 4ZC3A 4CJKA 5FB2A 2L4AA 4E7ZA 1VSDA 4BXFA 2LKXA 4MLHA 2E2IJ 2VKEA 1XGNA 5M1NA 1HKBA 1EP4A 3CUOA 3A8OB 2BZYA 4N0AA 4J2BA 2BY2A 3HTSB 2P9KB 2RKHA 3SUPA 2Y75A 4K43A 4A5BA 4PKGA 1RTJA 4ILHA 4R1HA 1VQMN 5CZ2A 5IT9O 3PIOA 3G2BA 4U0WA 3UKGA 3RCOA 2UU9K 2E2HJ 3VFZA 5HLFA 3WGGA 5HKCA 3MP8A 1KAZA 5HBMA 2RQUA 5LMUK 1A5VA 1ASVA 5LMNK 1WEGA 3PL8A 5EZGA 1P7MA 2VPLA 1GXIE 2YCHA 3QWXX 3LX7A 2K9GA 4LDYA 2QW9A 3M3YJ 3OYEA 1WJRA 5F1XA 1LCKA 1D5VA 1OPKA 4FWNA 4BQNA 1XMAA 2K02A 1IKYA 4I7HA 1QSYA 1LAWA 2ZJ2A 4IKFA 4LLLA 3GZ5A 1RDCA 3LLRA 1KXPA 3LWHA 3MEXA 3CC2I 3VYSB 1RIOH 2V51B 2CMPA 3AT1B 1U1SA 1D3BA 2DF6A 3E0JB 4BD3A 4UB8C 1RT5A 2HGCA 4Y15A 3DV8A 1GLJO 4O5BA 4DFJA 1EH7A 3JRFA 4NBQA 1XJWB 2IS1A 3A1PA 3EGDB 2TDXA 4JPBW 4A53A 3CCSI 1I3QJ 4MZMA 2LQKA 2FQ4A 1UHSA 4BY6B 2CZ1B 4BR9A 3FWEA 2MWPA 1NK9A 2VT3A 2BEOA 1QA6A 1QP2A 2ZJQF 1T03A 3F8BA 2X9DA 4C8QD 3HVTA 1HCRA 3VEWA 3QEWA 3AAPA 3I54A 1HBXG 3LSHA 2RNGA 5DUKA 1D1AA 4FLVA 1HYSA 1VQKA 1VSEA 2NOBA 1CXQA 3LDOA 3UKUA 2R5YA 4A4FA 2KT0A 4CESA 1JBMA 1BW6A 1UHMA 1X3WB 3SHFA 4I01A 1Q81R 2A08A 2M3AA 3LCNA 3T9NA 2VC8A 4FZXC 1KQ8A 1IB8A 3V9SA 2L7ZA 2IA2A 2AKKA 4WXDA 3KZBA 2RQRA 1N39A 1RL2A 1VSMA 4C3HJ 5FPMA 1LWWA 1QVGA 3S93A 1K0SA 1ZGJA 2V4JC 3CMAI 3H5NA 2O9LA 4B4CA 2PQ8A 1K9MR 2KW4A 2FVUA 3E3VA 3EHRA 4EJTA 5GPCA 4W5OA 5B8HA 2ID6A 1OVYA 2O8DA 3K1NA 3OS1A 4RMNA 4DJAA 1EXQA 3IC7A 4EP5A 1EIFA 3S3OA 1IUYA 4M7DC 3P39A 3VQDA 5DEQA 3RESA 1E3HA 2CQNA 2VC1A 3ZSQA 4PHTX 1UJ0A 1JJ2S 2FSNA 3N5BB 4YELA 1ABOA 4LD9K 2KLAA 3CCUQ 3WTSC 2FO0A 2QSFX 3K70D 3LH0A 1G4DA 4GO1A 2FPFA 3F9KA 3NDKA 4JRIA 4CXFA 2R5AA 1MGTA 3MEEA 4D7NA 2C6YA 1MWKA 3H45C 3X20B 3SMPA 2DA7A 1DDNA 1YJ9T 4XM3A 4CHPA 2FB7A 3OA9A 4A54A 5AQQA 3U3YA 1YXQA 1YI2A 1IBLK 2QA4A 3PQJA 2EFIA 4M3UA 2DMNA 4DR5K 4V2FA 2P9KA 3A8YA 2E5ZA 4RTWA 1YITA 4F7UE 3V81A 3P9KA 1S9GA 2YHYA 2VL8A 4JRPA 2LP0A 3LP2A 1RESA 2M51A 3ZT4A 3IKMA 1I0CA 3QHSA 1XQHA 5FLXK 1VZ0A 4IOCF 2ITMA 2J06A 3QPLA 3DPTA 4ILGB 4B8AB 3EL2A 3U3GA 3HRSA 4CW7B 4C8OA 3CCVQ 5GAMe 3K70C 4IDKA 1VQ9T 1IREB 2IG0A 4LF5K 4RW7A 4KN4X 3DJCA 2ZXHA 4JOMA 1XQOA 3DQVC 2I5JA 3K5MA 1M2OA 3DLAA 3H5RA 1SRMA 4DV0K 1D0YA 3I8BA 3GVAA 2OUMA 4P1WA 4RB1A 1O1WA 3T1AA 3F8NA 4LDXA 2AXTC 2X1DA 5LJ5h 4BDPA 3CCJQ 4CSWA 1TQPA 1BR2A 2XASA 4KIBA 1PG5B 3R4KA 4ESFA 2FNAA 2AHQA 1UJYA 1QGPA 1IKVA 3EGDA 1NJWA 4PJOC 1YOVB 3S6WA 4XORA 1PU6A 4OPKA 3SV3A 4KRFA 2X6YA 4DIQA 3S14J 2H8HA 1KQ1A 3B6OA 4ILJA 1UA1A 1I6XA 5M1QA 4FJGA 4CBXA 3HTVA 4RBOA 3BEXA 2FXUA 2NNYA 4G7HF 3HKSA 4Y92A 4BRLA 3I9V2 2ZKZA 3RJPA 1X43A 3F5TA 1FTZA 4KHWA 2FBVA 4AF1A 1XSXA 3C95A 3HHGA 2VONA 3AVJA 1HJOA 4H0PA 1K73C 4BC3A 1AKHB 4AIHA 3CJBA 3G6EQ 4GCVA 1V55H 5ICCA 2R7ZJ 2W84A 4HLYA 4CZJA 1M8MA 1ORPA 4M72A 1ZRCA 3WVDB 4M3WA 2KIQA 2L8DA 1M90R 1KQSS 1O13A 3C6UA 2A28A 4KBOA 1VQMT 3AVFA 3KP2A 4LD0A 2LK2A 2A40A 4OIOF 3V9UA 3VYUB 2M1BA 3FIFA 1ZSGA 1GXQA 4OMQA 3OW2A 2E7WA 4BXUA 1RLQC 1WJQA 4QIWN 2KJBA 2DA9A 3QWLA 4RGUA 3T19A 2JM9A 4B9MA 4DQIA 3AHUA 3KEOA 3TREA 4XTUA 1I3AA 4MFBA 3C2HA 3ZQQA 2MABA 1EV7A 3RUXA 1Q86C 2GNCA 3SZ2A 5IP7J 4FJJA 1BJZA 3HSCA 4KHNA 1HNXK 4DB3A 1BCMA 4HX7A 4PJOF 2SEMA 1NG2A 3FHFA 2ZGWA 5LHIA 1Q81U 4JRQA 4J2AA 4JKFA 5F2RA 2HSTA 2JSPA 2E36A 1G2HA 4BQZA 4DU3A 4B9LA 5H6QA 4Q47A 1B3QA 3CCLN 5I9EB 2DL5A 1GLBG 3HG9A 2LVSA 5F08A 2WC9A 2XROA 2Y4XA 3C12A 4AM6A 4QPQA 3U9ZA 2DCEA 3CMEN 3ER0A 3X24B 2NVYJ 4CJ7A 4DTRA 4A59A 3C7JA 1E6HA 2HYFA 1NJIO 3HGGA 2HHSA 4Y28E 5C4JJ 1Y0MA 4CJPA 3DXMB 3Q9SA 5HNHA 1UEBA 3KWIA 4RTZA 4CIEA 2PBIA 4CCLA 2E70A 3Q1JA 2LF8A 4C0DB 2ZMEC 4BQAA 3FB9A 3CJTB 3BDPA 3M5RA 4LUDA 2IXSA 3R6NA 1YAGA 3FM5A 3O8GA 2P51A 2CQQA 4EA4A 3K9TA 1VQLQ 5ILSA 4XKVA 5LGTA 3THVA 6PAXA 3HOUJ 4HYEA 2AS5F 3TDUC 1GT0C 5JICA 1PP8F 4EZ6A 3ZL7C 4Y91A 1S9EA 2VJJA 4M3EA 2VBXA 2E7XA 3QOEA 1Z9CA 2V6EA 4IEJA 2NVXJ 2KDZA 5HK3A 4BDYA 3LANA 3CC2A 1M9SA 1T2KA 3VF6A 1I4K1 4DSEA 1WLPB 1ENHA 2EIMH 1XGOA 2VQCA 4B8CA 3H3UA 3ZMTA 3G71T 2I2LA 2XAUA 3H92A 5CE3A 4PNOA 4CJWA 3CCSA 4FW1A 3W2WA 2R0QC 1P6RA 3KLOA 5CKDA 3DKWA 3BROA 1AVZC 4ISFA 2O01E 4BJ5C 4E9GA 1Z25A 5D5XB 2PUOB 1RAGB 3RBBB 2ZFUA 1D8YA 3CDIA 1RT4A 3CXCP 3A0BC 3GWZA 1ZREA 3HOTA 4CK3A 2EZIA 3HP9A 2JA8J 2R7OA 1NGFA 3HOXJ 1HQUA 3H9GA 3F6OA 1WXUA 4PGHA 1AKHA 3E2UA 1XCBA 3F8MA 3E1YA 3SZPA 1ZG1A 5HNFA 3CCEI 2YXYA 1U6GA 4CGDA 4CBUA 1QPIA 3AGKA 2MF2A 1VOMA 4YHHK 4CEZA 1D1CA 3AG3H 3CM6A 4JN4A 2NRAC 2XHIA 2QQSA 1T33A 4M7AA 4PSWA 4EFHA 1YS7A 2UV1A 3FJ5A 4ESRA 2Z2SB 3CMAA 3GX4X 2XRNA 4RKUE 3PUBA 1L3UA 2F2VA 2PQWA 4EQQA 5ELZA 1IRFA 3QOPA 2UXBK 2OPRA 4N4HA 3HZJA 2MK5A 3IHOA 3RKQA 4AHRA 4AQYK 3NMZC 1IHVA 3PO4A 1RABB 1M90U 2LH9A 1VQ5I 3H0IA 2D1VA 5ILUA 1X3UA 3PIPL 3SUNA 4KH5A 4Z88A 3T0YA 1VQKQ 2GA1A 4JI6K 2AQEA 1SL1A 3I4NJ 2EZLA 2MC4A 4JX5A 5M3MJ 1U3EM 2PZSA 3JSMA 2H94A 2E88A 2Q1NA 1D9FA 4ZDOA 4RCBA 4YG2F 4B3MK 2LJ1A 1PSEA 3QNOA 4Y1DA 1SVOA 1X2MA 2G9WA 4C8QG 5C12A 3LALA 3PMTA 4JI4K 3CCLA 1KRPA 2DL7A 1TT5B 3PNTA 4CC2A 4GY5A 1UGRB 3H6ZA 1N3AA 5AQHA 2E64A 3FXLA 2KMUA 3DXMA 4A4KA 2YNGA 1VQOI 3MO8A 2W1OA 4E6RA 4NXNK 2FX0A 3LQRA 5F1JA 4A3EJ 4IFEA 1A36A 2JPCA 1LWCA 3HJFA 3FDRA 1DEJA 3G0QA 1JLBA 4LE9A 1RRJA 1ZSZB 1G3SA 3D2FA 5AFUA 1VQ8I 2LTOA 3MEGA 1RDBA 3KUFA 5H20A 4J8OA 3L2VA 3QWYA 4L5IA 2NLUA 2FBTA 4YRVA 3FC3A 2JZYA 4BR7A 1S72N 1J75A 3CESA 2P0PA 4Z4EA 2DY4A 2ZCFB 1K4TA 3ABTA 1KG2A 3KKRA 2DILA 3Q7CA 1FOXA 2FQ3A 1MW7A 1OQKA 3JB9G 5K5OA 2I5WA 1KJWA 4M77A 2IGNA 3VQEA 1YI2Q 1WGXA 3U1KA 2W6LA 3T69A 5JHFA 3IKTA 3PIPA 3VS5A 4NLBA 1RAHB 2YKNA 3AO1A 1YJWI 4XH4A 4KGZB 1Q82C 5BN9A 1VHXA 2PJRB 4H5TA 1BC8C 3LOCA 1USSA 4L6V5 1YITQ 4FWLA 1T05A 1U8RA 1T38A 4EW0A 2D0PA 4J7IA 1OKJA 3H9QA 5DM7R 2HBMA 3A02A 4LOCA 4FM0A 4LN2A 4HX4A 2E6ZA 4KHUA 2HQAA 1HLVA 4BRDA 2DA4A 4XU0A 1WAJA 4GKJK 4FJXA 3OS0A 1J9IA 3DLLL 5CQYA 1KU3A 2NAZA 4AM7A 5BNGA 1OV3A 1K4SA 5GJVB 1T6SA 3DLEA 3CMET 2IS2A 3FE1A 4JBAA 1HW5A 3OMCA 1S3XA 1I94K 2E34A 2KROA 2YNIA 3CCUT 4ESJA 1DTQA 1FWZA 3HKZN 5FRNA 2XRIA 4Y13A 1OISA 3LL7A 1WPYA 1YX3A 2JXBA 4BYYA 3RMDA 2HI3A 3M0PA 1X9MA 1R36A 5LJ5e 1R1UA 2IGOA 4S0HB 1TLHB 4RS8A 2JM8A 1T7PA 3CJNA 4CGHA 5J40A 5LJ3d 3H3OB 4M73A 2R7UA 1NGHA 1MBJA 1KLNA 4OGEA 2JTMA 2DU9A 4OU0A 3WE2A 5K7HA 3L7WA 5GAN4 4E1NA 2MH2A 2EFOA 4BUGA 5M5XJ 4H03B 4CJUA 4DTMA 3VS1A 3THWB 2D6FA 3N4PA 4FL9A 4UUSB 2LSNA 4YFUA 3I33A 1WHUA 3M1CA 4ENMA 2OTLN 2A5XA 5H1SQ 4I98B 2OZ6A 1H9TA 2KDOA 2QGUA 5KI6A 2F1LA 2V7ZA 2EIFA 2KJCA 4TVRA 4KISA 4IQ4A 3C6AA 3EUHC 1MNEA 2KIFA 1W5SA 3AG2H 2RHKA 3CCVT 4BY7J 1PNJA 3DWLA 3U8XA 1X2NA 3I5RA 4AC0A 3TR8A 1KGSA 3HOZJ 4PIIA 4KHPK 2WB1N 3E9PA 5M5YJ 3K0LA 4RG2A 3C94A 2WTEA 2MBFA 1IBKK 2QDYB 1HYVA 1FSHA 2RAEA 3CCJT 5A2QE 1JKOC 2JTFA 2F2WA 3QG1A 2JMCA 4CHZA 1M1KO 1VUBA 2FBHA 1T95A 1E17A 4FWPA 3H9JA 2RI3A 1R49A 1NJYA 4AMCA 1OPCA 3NQOA 5DV5A 3A01B 3VUBA 2ME6A 2XDBA 3PUFA 2PBDA 4RTTA 1HUXA 1IJJA 3J81K 3CCQN 1S1NA 1S5JA 5EG0B 1ZSZA 4OMZA 1KQSA 4YFXF 4C5GA 2M0OA 2P1JA 2YHBA 2Q2EB 4FOEA 4CZFA 1RETA 2NOIA 3HXMA 4JLHA 5AQGA 1FSEA 2ED1A 2P81A 1LCUA 1UGQB 3CLOA 1ZX6A 1VQNI 2MMPA 4LMYA 3G6ET 2J6OA 4F8RA 5DM7L 4KIGA 5GJWB 1N8RC 2VKDA 1G3WA 4D9JA 3MDQA 2CV0A 2LZ6B 3TU4K 2CP7A 3HSBA 1KD1O 4O8KA 4YOUA 3VDXA 5GAGJ 5J39A 2P9LA 5EOYA 4Q48A 2KYBA 1S72A 5ED4A 1ZG5A 3DLHA 5C0MA 4HDUA 3OB9A 1DT9A 4HSTA 4IOXA 2PJRA 3BZ6A 2G7UA 3O8MA 1BI2A 4FW2A 1U2VB 2MD5A 1ZA1B 3H3VK 1VIFA 4JI0K 2XAFA 5EEHA 3F6VA 1QVFA 5CQXA 3I5UA 4IEIA 2EWNA 1T3LA 1BA1A 4DV5K 4JI1K 1WI9A 2LT4A 3HYFA 2JK3A 2W57A 1MKMA 5J3BA 5AQVA 3MP6A 1ETKA 5KYWB 1SAXA 4ZYEA 2P4WA 3MAQA 1S1WA 4AG2C 3EYZA 2GBQA 1XDSA 3RPUA 5MLCQ 4PFPA 4C8QB 5DUIA 2B6AA 1KSWA 3Q0UA 3VF4A 2KPMA 1W0HA 1UFMA 2V8IA 1C1CA 2W48A 4QS7A 1XI1A 2O8FB 1JKPC 1JXBA 4L9JA 3CC2Q 3DLBA 3CCEA 4PZJA 1M2VB 2E2NA 2IA1A 2A5WA 2BVLA 2UXCK 5GANf 4DSFA 1NK4A 4GV3A 3G7ZA 2QWOA 2SRCA 1NKUA 5FKLA 2VI6A 3BCBA 2DQRA 1RDAA 3CCSQ 1RBSA 5CR4A 4E9HA 3CWAA 4EVVA 3TAQA 4F4KA 3ZX3A 5DMRA 5AYFA 1ZAOA 2V1UA 4KFCA 2UUBK 2FEZA 2QSGX 2M30A 4FLUA 3NCIA 4MFEA 4O5VA 5CHZA 3THWA 4K8XA 2DFFA 4UUSA 1VQ7I 1BA0A 1PP7U 1V76A 3DF8A 3G4SN 4KUDK 2LCSA 2ZJPL 4ETSA 2CP6A 5K7ZA 2QF7A 3M57A 4XTZA 2K40A 4M77E 2WAQN 2OTLA 2XPUA 1BIBA 4MTEA 1Q18A 2NNWA 4M75G 3DMJA 4YOYA 2L9VA 2HKNA 2EQIA 3L3VA 3TGNA 2B9SA 1BOTO 1NK6A 2FEIA 4G7ZF 4A3GJ 4ZDPA 1JTYA 3HYIA 2OV7A 4RTFD 2ZC2A 4IOCL 4RW4A 3OOPA 3NE6A 5K5QA 3TO6A 4A5AA 1TUUA 2CG4A 1BISA 2A07F 4RM3A 1OCTC 2VOOA 1HR0K 3RSEB 4LF9K 1VQOA 1QZ6A 4KMUX 3D7EO 3CMAQ 4B1WB 2EZKA 2ZO4A 3D6RA 4JKEA 4PDKA 1NK0A 2CQ7A 1WVRA 2X0LA 2EYYA 2HXIA 2IA0A 2O31A 2F69A 4JKBA 5CR2A 3BTLA 4ZTFA 3L42A 1IO6A 2EPFA 3QO3A 4N4OB 4IOAL 5E3OA 2DO7A 3HL2A 1R5GA 2F96A 4KI4A 5GAMd 2CUFA 3A01A 2DNUA 3ABUA 4YOTA 4CGIA 1ILYA 1RT2A 2LC2A 4CGGA 2OFKA 3WHBA 4DOZA 3OYKA 2DO3A 4Y7NJ 3DEEA 4JLIA 3SLCA 4FVUA 4H4OA 5D6XA 1Q86R 1W97L 1EWQA 4XLCA 4GGGA 4CJVA 4H5VA 5C24A 4FU6A 3GUDA 4ENNA 4ESBA 4CCNA 1KHIA 5KYUB 4IG3A 1JXSA 4ASNA 4I76A 3DXKA 2PMHA 1EH8A 4PUSA 4B09A 5AQXA 2PI0A 3LSMA 2C0IA 2RREA 3S2HJ 1SL2A 4DTXA 3CHWA 1UG0A 1TOVA 1E0EA 1D1BA 5A0DA 1YJWA 1GCQC 3FGUA 1MMAA 4CDGA 4II1A 1QVGM 5HS9A 3J80O 2DZ9A 3VA0A 4ON0A 5BPLA 5EF6A 2R7VA 5J2NA 5E1ZB 4JK1X 2EBIA 4D7MA 3DWLE 3DFGA 2JT4A 4BG9A 2R7FA 2BY3A 2NOZA 3U21A 1HYZA 4N0BA 3LSRA 5KYWA 4OIQF 2WWYA 2QM1A 2QSHX 3DEWA 2KKOA 2FBYA 2QZ8A 2BY0A 4C8QA 2LKPA 3UDCA 2RGVA 2NVTJ 1LWYA 1L3LA 1BQMA 1X6GA 2VJ5A 5KNLA 2Y0MA 2B63J 3BZKA 4M3FA 2O4XB 3CQ8A 1IG8A 4OX9K 3CP2A 4KNYA 3KK2A 5FJ8J 2F4MB 2W04A 4LK1F 5L3DA 2VYTA 4QS9A 2VWJA 1VRLA 4KT6A 4X65K 5D3GA 4BQLA 1LFUP 3VYGA 3GFLA 4JK7A 3MZ8A 4HNVA 1ZQ1A 2P7VB 3ML6A 1QHGA 1KONA 2JWKA 1X4OA 4C30A 5H2FC 5KRSA 2QEXN 1KSPA 1LE8B 4G6QA 3CJ9A 3VQ7A 3W3DA 3M9QA 2DFUA 3PO5A 2XIDA 4KDPA 2P6SA 3QP6A 1FIAA 1NZ9A 2GXAA 3PSIA 4WQ5C 3HOWJ 2G6FX 2HNHA 3PTAA 3JCMJ 4E70A 2ZMEB 4C9YA 3FJPA 4IUTA 5LJVA 2LF7A 4XKWA 3JRBA 2DTOA 5LEKA 1EETA 4H0XB 2DTRA 1D8JA 2D45A 2XSDC 1KFSA 5IYDJ 8AT1B 4IUQA 3HIFA 2YHAA 2FUG2 1J5YA 2DA2A 2D0NA 4F92B 1NTCA 5HDNA 2A1RA 1S9HA 3M0QA 1VQ4I 3E5XA 4CEQA 3FDYA 1SZ2A 2RN7A 3ERED 4HT9A 1TYQB 3E66A 2MG4A 1W2BP 4AYBA 2AA4A 2DPUA 4XAXB 1YI2T 3EH2A 2L02A 1TUDA 1APLC 3NF8A 3RSEA 3ZFJA 3OW2P 2WV1A 2X78A 4PFZA 2DA6A 5HS8A 4F2SA 2V7YA 4RCCA 3EUKL 1JUMA 3RKXA 2OTJI 1WCMJ 4YEJA 1RI7A 5D6YA 2QK0A 2M02A 2RVCA 2LDMA 1ZKGA 2R7DA 1RAFB 2H56A 2J6KA 4AIJA 2OZMA 4XIDA 4Q0BA 3O8VA 4EA5A 3NTKA 2XHBA 2E2OA 2YG9A 2DYSH 3U4LA 1FOWA 2X6WA 3LW5E 1X1CA 3MMVA 1VQNA 3OS5A 2GQVA 4EJUA 4LSNA 4RAZA 3MAJA 1ACIA 1ATNA 1JCEA 5KYUA 5J1EA 1NGDA 3CPWA 2EBPA 3IAS2 3RMAA 1GUUA 3EG2A 2O88A 3GIBA 3U9DA 1QHAA 2KISA 3M0UA 3OW2M 3BT9A 2PUKB 1JQQA 3V4GA 3CO6C 4IIOA 1ATRA 5C2DA 5I2MA 4FWKA 1CF7B 2YI1A 2VQFK 3T8TA 3OYIA 1Z3XA 5D8LB 3L3UA 4UNFA 2HL5C 2OU2A 1M1KR 3TQ7P 1LDKB 2RH2A 3EYIA 1VQPN 2MWOA 1X19A 2BGCA 5HS7A 2K79A 3CPEA 1C6VX 2CW0F 5KVRA 1KU2A 2JUFA 4ORZA 3SQ0A 3OA6A 2E3IA 2ZAEA 4CICA 2YSQA 2A6EF 2NOGA 2MCNA 2B86A 3MMYB 3QBYA 2EILH 3E9FA 4B1UB 1HNIA 2MYSA 4II2A 1WSUA 3TTCA 4XH1A 4Z4GA 3FMRA 1Y64A 2L3QA 4KH0B 4G94A 2V26A 1Q8IA 2O4XA 3AO5A 2Y1IA 2E35A 1JXOA 4JKGB 4H5WA 1LDDA 4LDUA 2QKKA 1LPQA 4H0YB 2F48A 2E71A 3SMSA 1K8AO 2XY6A 3A2KA 2KIMA 1KD1R 4FWRA 5ADXH 1K79A 3QDRB 3TARA 4ME7A 1BDGA 4IZ9A 4HCKA 2VUMJ 1RR7A 4XK4A 3B6PA 4BI8B 1KEAA 1LDJA 2PMZA 1LE8A 4MNUA 1VQ7A 2L2OA 5GAOr 3SDZA 1QQNA 3LWFA 3OYFA 5LLQA 1I1GA 1QQJA 2CH4A 3WU2C 1RAIB 4L18B 2Y0SN 1A0NB 4PL7A 4M3DA 5LJ5g 2LY9A 2DEQA 3NGZA 2ZMEA 5KE3A 2G8IA 1YTAA 1M1FA 3QDKA 3EFRA 1BUPA 4XTXA 4C92D 3KJVA 3GNGA 2XK0A 1SD5A 1S5LC 2IVOA 2QXLA 4NQWA 3KEYA 3CCEQ 4OPJA 2QCOA 3UIQA 1KG6A 3RWUA 2A69F 2CZ6B 3BJ6A 1FYKA 2KRCA 1UMQA 6AT1B 4BRMA 2HQNA 1R23A 1ITYA 4B3SK 1YW7A 2ATQA 3BLYA 3P9CA 1OH5A 5DD4A 4KH4A 1X27A 2H6CA 4B9SA 3D5SC 3VA3A 2EYZA 4CC3A 3OYLA 1EQYA 3HHHA 2ZPFB 5C0YA 4X62K 1WHLA 1LPLA 3SJJA 4FWOA 2LSOA 2WSFE 4MLEA 3E5UA 2XGEA 2QWNA 1U78A 5JR3A 3S2WA 1PVEA 1RAEB 2EYWA 3JRZA 4C8QE 4CHUA 3R1XA 2IPQX 2IEKA 3H6EA 1VTNC 2KI7A 2ZGZA 1VQ5Q 2NS7A 3CC7N 4HQEA 1JTXA 2BVMA 4Y4RA 3KE2A 1SANA 1N27A 1WNLA 4W1UA 3SD4A 2VYPA 3KK3A 2HOEA 4D5FA 3ZQFA 4AI4A 3CTAA 3MEUA 1SMYF 2M9UA 4I99C 3GYHX 5KPTA 2E1YA 3S41A 3SZGA 3G1MA 1YVNA 4JZ4A 3M8QA 1USTA 3VW4A 3F22A 3TO7A 2P84A 1NJXA 4Z4CA 4A5MA 2K7AA 2QEXT 5AQJA 2DXIA 3I5SA 4OMOA 1UB4A 1D09B 3S2DJ 3Q9VA 1S8NA 3ZMDA 1SMTA 1VQOQ 1NBEB 4BRNA 4CJSA 2O2OA 4P9UA 3L2CA 3EUAA 3CCST 1CF7A 3GTQJ 1X1BA 1C0FA 2Z0WA 4BI4A 1WSIA 1SEUA 3GCMA 2IBDA 1DU0A 2COWA 2G8FA 2D9TA 5FKOA 4C8NA 1QP3A 1XX5A 3L1PA 1UGVA 1TKDA 1AWXA 1OCZH 1TP4A 2CZ0B 4BH9A 3OYDA 1MBFA 3IH7A 3LFUA 1YIJN 4B3OA 1NG7A 3IAM2 4XN0A 2DD5A 1ORKA 3F8FA 3T5XA 3B02A 1NYFA 3I56I 3UF4A 1X9WA 1VYUA 4OMMA 1MJBA 2Z9OA 2HVQA 2NUBA 3K4LA 4IJAA 3MCZA 3VN5A 4PCQA 4BVPA 1DKGD 5J6XA 2EINH 3JCMb 4C92F 5JVGF 4AWXB 4E89A 1M1KU 4FVMA 2L9SA 3AO3A 4FSVA 4BRAA 1ETQA 3H9NA 4A0YA 1Z9QA 4IRGA 3KLHA 4BE0A 4J9IA 1YJWQ 3SDGA 1JLGA 1S1VA 3HBTA 1S22A 4DFMA 1UJ8A 4PSXA 3TL4X 5HLIA 4OIPF 5CKFA 1TU0B 2P9SA 4DKWA 3E6DA 3OBWA 3KFVA 2O8KA 3BP8A 1O57A 4K8ZA 2OANA 2GF7A 4GYIA 4DV2K 1FP2A 3CMAT 5DD8A 1ARKA 1DGRM 5GAGP 1JUPA 1UELB 2IPOB 5FGMA 4B3XA 5CKTA 4XU3A 1BOAA 3QEVA 3JSCA 3E9GA 5KAIC 1J54A 4O44A 1LJ9A 3KZYA 1BU6O 2JVHA 1B9DA 2QWMA 2DL3A 4GXOA 3ZT2A 1U4BA 3M1EA 4X64K 2K9SA 1KD1U 3J7ZO 1X2KA 2IGMA 1ON1A 5AIPA 2CGLA 4WF9L 2RQWA 1YN8A 4PKIA 4HT8A 1VQ4A 2Y0SA 4AHVA 4WQ4C 2Z1IA 4BC5A 2DPNA 2HQXA 2HQ5A 3THYA 4CYDA 4ZDLA 2MA3A 2EB7A 3EFOB 2YJEA 1Y0UA 1QLYA 2A05A 4KO0A 2Y69H 3OYAA 4Q5VA 5BPMA 1WI3A 4CJFA 4YTLA 3VQBA 4JNEA 2I5UA 2GOMA 2ISYA 3LAPA 1MBGA 5FLXZ 5D6WA 3LP0A 4N47A 4Y52J 1VQPT 1YJNI 4BVOA 1NHAA 3QAHA 1ZTRA 4KKOA 4Z02A 4A63B 3MN6A 3QINA 3EZWA 4C1NI 3O9SA 2CH5A 4HEA2 1DQUA 2OTJA 2IAIA 4JS5A 1UCRA 2EGAA 2FF6A 5ADXA 4FPAA 3VRZA 4CA0A 3A2FA 3NHNA 4WYBA 2W41A 1IV8A 2HOAA 4JYKA 4OB3B 2RF0A 2FC0A 1QZZA 4UUTA 3CC4N 3CVTA 2LREA 3LDSA 3GEZA 4G12A 3CI5A 3CC7A 4XN3A 1VQ5N 1PDNC 2WFBA 3TABA 3VYTB 1ASUA 2XHKA 2D4WA 2RI5A 2RM4A 4U88A 3JR9A 2PN6A 5K7FA 4X6AJ 1XPXA 3GTJJ 5M1PA 2G8HA 2FRHA 5GMKm 4PJLA 5E1WA 4X1EA 1U9OA 2OA8A 1XHZA 3PO3J 1E7OA 2ZPGB 1OFCX 3WGHA 1YHQN 1KTQA 1IXRC 2Y9ZA 2NRZA 1N32K 4FSXA 3DB3A 4RLFA 1ZXOA 4OMFB 4XLNF 3SBTA 2EW3A 4OJRA 2M9HA 3SJHA 2F8SA 1NPRA 2GZWA 4F7UG 3DRSA 2V9VA 2F5KA 3OTOK 2L89A 2LP5A 3QICA 1GVDA 2NWMA 5GMKh 5E26A 1NLVA 3BR6A 4FOIA 1NMNA 2LR8A 5GAOm 1WSHA 5FFXA 3A1YA 5F64A 3EGUA 4KFBA 1K9AA 3IUCA 4M3XA 2EK5A 2DOAA 4E1JA 4P96A 1VQNQ 4FWMA 2F5VA 2ASMA 4FJ5A 1HW2A 1K7AA 1VQ8N 3HOSA 2CUBA 2NLXA 3JRIA 3QP5A 4W5NA 2K57A 3KLNA 4W5QA 4CZIA 2W00A 3EUHA 1HW1A 3O3KA 1FKPA 4L5EA 2L2PA 2JN0A 2O8CA 2GELA 3HI0A 3WTZA 5IT9K 2Z99A 2DFHA 1W0TA 3O4QA 3K58A 5TRDA 1KG7A 4R0KA 3P1GA 4C0ZA 5M5WJ 3LM2A 4DR4K 1ABQA 3BG7A 1XC3A 2QTDA 2HEOA 2UXNA 1QVFP 1XQSC 1XUPO 1WFWA 1ZLMA 3G3ZA 5KN9A 3CQZJ 1KQSM 2EWSA 4FK4A 1TH7A 1STZA 2YJFA 4CZMA 1HJDA 4IJNA 2P5OA 5LEJA 2WOMA 1IG9A 2Z1GA 2QQAA 4XONA 4YNQA 4CZCA 4B21A 4M45A 3IRRA 2RHIA 5J26A 3ASMA 4BXXJ 3CCMN 1YIOA 5SZTA 3AL0B 1X01A 5JS2A 4DTNA 4OPAA 3K59A 2YUNA 3FISA 4CF8A 1IV0A 4RGXA 4OAZA 2X51A 2EA2A 3EFOA 2RC4A 5AQFA 1X6OA 1NK7A 5DS9A 1JKHA 3JAME 4OVAA 1NWKA 1AA7A 1T0JA 3QIIA 2DXTA 3H0HA 1QKWA 3M8FA 1RBTA 1QBJA 5HL7L 2FNPA 1X2QA 1C0GA 1S29A 2E20A 2HTSA 1QVFM 3MK6A 3K69A 4A12A 2VG6A 3EO3A 2Y90A 5J1YA 1VQ7Q 1O3SA 1TAUA 3HDDA 1PUFB 3ZQLA 2COYA 4G7OF 1U5TB 4M7AD 3FSPA 3L9FA 1FMKA 3KX2A 4XSZF 2VUBA 4XTYA 3MZYA 4XQ3A 3WNHA 4KH1B 4PQUA 2LX9A 1AEYA 1TT0A 3H1CA 1NGCA 2V9PA 3W2AA 2ECBA 2GAUA 1UECA 1X4PA 2FZKB 3DBLB 2F2XA 1AOYA 1KC8O 3UATA 2M7BA 4CK2A 3OVNA 1FP1D 4HCZA 4BRPA 3SZTA 2DL8A 3JCMP 3ZLJA 4FETA 4CI0C 1G83A 5DM6F 1RI9A 3K4CA 2A6TA 1SPKA 1HKCA 2ABKA 2GQIA 1KG1A 4DNCA 2D2WA 1REVA 4KN7X 3DTIA 1OMIA 4AT1B 1VQLI 1J0RA 3SB2A 1VF9A 4LXCA 1A5WA 1C0TA 3JS6A 1R77A 5HRPA 4M3GA 5C10A 3ULEB 1QU3A 1KK7A 1TWFJ 4C2TA 4AHSA 4EP4A 2DZCA 4C92G 4B9UA 4JI7K 2Q1ZB 3HPOA 2H3GX 1WHJA 2M34A 5J1UA 1HOMA 3CD6N 1YHQA 4C8LA 2ASPA 2KHMA 2WC2A 3VQCA 1RNHA 4NC8A 1CGPA 3K5OA 2RI2A 4K0KK 2Z1DA 3SBGA 3CCRI 3BY5A 2VWKA 3F10A 2ECZA 3I56A 1NKEA 4X1VA 5C2FA 4A62A 2WAFA 2H09A 2HVIA 4VUBA 3MN7A 3ROUA 3EG3A 4JKAA 3J7ZI 4F3QA 2D0AA 4AFSC 1SKRA 3O8HA 2PZ1A 2FRYA 4LGWA 1Q7YC 3CCET 3CXCA 4EV0A 2Z16A 4MHGA 3N05A 3QQAA 1MGQA 4DS4A 1GHCA 3P8BB 1ITGA 3M7GA 1QVGS 4BRQA 1ETWA 1XTAA 1QVPA 4RW9A 1DTTA 1YWPA 3UA6A 2JRTA 1T08B 3RDVA 2W42A 1BB9A 1O3TA 1SV5A 4NL2A 3LP1A 4UQGA 3ZGKA 4JZ3A 2HVHA 3E6MA 1Z77A 2JS2A 4H5RA 3MKWB 3I55N 4FLWA 1B9NA 3VS7A 1SS6A 1JRIA 1P4AA 1VQ5T 4YFNF 1MUNA 3T8RA 1KVAA 2GV9A 3NAEA 4LLGF 3K5LA 1ZRFA 5AQPA 2HZYA 4RWTA 1SFOJ 4HLXA 3QERA 4IURA 5L23A 5C6SA 1K9MO 1NGGA 1OQYA 2IVNA 2V79A 3ESWB 1TL3A 5AQWA 2HKQB 1LVAA 1N5YA 3IAYA 2CDTA 1MUZA 3NTHA 4HSRA 1BIZA 2X1CA 1TWHJ 3FZFA 3AG4H 3FEOA 3R6SA 1YJ9I 4N41A 1YJNA 1XC5A 1RADB 1N6QA 4MO4A 4YIFA 4L9VA 1BL0A 3ZMVA 1VQOT 1RLPC 3OIPA 1VQKI 1YQMA 2HBLA 2ED0A 1LNWA 2VBYA 2DTZA 3SWNC 1GCQA 3TBIA 1PUFA 3K57A 1W70A 2GTOA 3NFCA 2J7IA 5EY4A 1Y07A 2QQBA 3GO5A 3I0TA 3NTIA 4F91B 5FU7C 4IHWA 1VQ8T 3GL1A 1PRLC 2VQHA 1HA8A 1YVUA 2Y9YA 4NB5A 1ODDA 2A42A 1YFHA 2W85A 2NOEA 1W1WE 5AQOA 1VQ4Q 2O4GA 5J2QA 4MDXA 1VQ6A 5J4YA 5J8CA 2L4MA 4U67L 1FZPB 3KTUA 4M41A 3GF2A 2RQVA 2ZPHB 4LG0B 5K5RA 5A2QO 3VPRA 4CZEA 4KHSA 4BL0B 2NRTA 4DYQA 3ZMSA 4DBFA 2LX7A 3L8BA 1YJWT 1QSLA 4HKEA 3S1NJ 3REAB 1HSQA 5M9OA 4DUZK 2JHNA 1JUSA 3QSUA 4HHTA 3M07A 3ULEA 1WJEA 2F9WA 2OTJQ 1BK2A 2KKZA 4OFHA 4C8MA 2FZGB 3SK3A 3T1BA 1FJLA 4IHVA 3KYCB 3BTCA 3K2ZA 2OPPA 4P5NA 3TDZC 1XWLA 1WA7A 2HMPA 2R57A 2PYLA 3OH6A 5B1BH 3OS2A 2QA4I 1QWEA 1RZ4A 2F9TA 2G0EA 3TKYA 4BR0A 4MDAA 3K1PA 2KY9A 3TANA 1W2BS 4O4GA 2KP6A 3O1BA 2E60A 3AVAA 4WQ5A 2DA5A 4V19S 3V8KA 2L0AA 4B9XA 1EX4A 2EQUA 3J80E 2BXZA 2ETHA 2KL4A 3QYHB 2A3ZA 3GDQA 3OW2S 3LWLA 1UOCA 1W5CC 3C1DA 1VQMI 4QOZB 2GTDA 1IBMK 4F17A 4DV7K 4CEBA 4J9EA 4HBLA 4UB6C 1TK0A 1GLCG 3IMXA 2HDAA 1FN7A 2C0OA 4BBRJ 2OZSA 1YQAA 2E1OA 2DJNA 5ICGA 1Z91A 2UXXA 2RMOA 4B9NA 8ATCB 2CJJA 1T0FC 1M90O 1U1TA 4HA8A 1WRJA 3HRUA 4ELTA 1R1TA 1YG2A 4OMLA 1RRQA 1Y96B 5GMKe 5IH2A 2X6SA 3W6JB 3LDPA 1K76A 3CMYA 3RKYA 2O9VA 1B59A 3F3XA 3SI6A 5C4XJ 4F3OA 2ZJRL 2KFNA 2JLEA 1DPRA 4KYWA 3RMBA 3PNWC 5ICFA 4F04B 3BG6A 1AWCA 2EIJH 3RPUD 4BDZA 3GZ6A 5FKKA 1GLNA 4C92B 2DKGA 3G25A 5KE2A 4CHNA 3CPWM 4AD9A 3CCYA 4KT5C 2UXDK 2QKBA 3WEEA 1G3TA 4HG2A 3PVLA 3OIOA 2X6XA 3GMEA 2DXBA 4E4HA 1KVCA 4LK0F 1GOBA 4E9EA 1V5EA 2ABLA 4OINF 5KTQA 3J81Z 3KVGA 4GYGA 3PIOL 4BEHA 3KLFA 1Y7XA 4ID5A 3UR3C 2HHHK 4O0IA 1BI4A 1ZUUA 5ILVA 4J9GA 2V75A 2BUDA 4DA4A 5EDNA 3CWUA 5DCMA 4K11A 1D4XA 3FX3A 1VQ9N 5C42A 3PMIA 3A0IX 1AOJA 2FF3B 1NG6A 5BRFA 4BGDA 3BPXA 3RZDJ 5E1XA 3A5OC 1NM1A 2CP5A 1ETYA 2G3RA 3MZHA 1KYZA 5CYMA 1H9GA 2HW3A 1ZBFA 2KXCA 4ZGDB 4RTXA 1VQNT 4A57A 4LD5A 2XO7A 1OR7C 2CUJA 5KH6A 1U47A 2YX7A 1YNZA 4LFCK 3MXMA 4XL9A 1F1BB 4F52A 4QQGA 3O9UA 1WJ5A 5C44J 4LSLA 1KAYA 9ANTA 3L0QA 2A1SA 3FIWA 4KREA 3TQNA 2PMUA 2DFIA 1Y57A 3HM8A 3SYZA 3JB9J 3CQXA 1K83J 2E1NA 4BR2A 4ZZLA 3I55T 3MVPA 1UUEA 5GAN7 2GUIA 1ZR2A 3FLCO 4O5FA 2K5IA 2P7CB 1M1GA 1RT3A 1TW3A 3H5AA 2E41A 2K2VA 3F9MA 2EGCA 1W1FA 3WUHA 2A36A 3EG1A 4Y3OA 2K9MA 2ZM6K 1WAFA 2ECCA 3CCRA 3DKYA 3NEUA 5LJ5j 3ZSRA 5AQNA 2EV5A 3SCXA 3BR1A 3R8EA 3CF5F 2QK9A 3ZSZA 4BRHA 4GFBA 2CQXA 2LVMA 3MWPA 4BR5A 3O3HA 1NK8A 2RK2A 5LJ3f 4UHTA 1LEBA 1KC8R 3MKLA 1WHMA 3HT3A 3HSEA 3DBRB 4J7FA 1UDLA 4IXAA 1TWBA 4C0GA 3AAFA 2K4YA 3TW7A 2GWKA 4LITA 3HXLA 2DMUA 3TP0A 4DK9A 4M7AG 5LL6Z 2DJQA 3JCMf 1T3SA 2WACA 2BKDN 5KGWA 4HF1A 5IXFA 2OX7A 2KNBB 1RI0A 2BANA 1R4MB 3WXJA 5B1AH 4QCLA 5LHGA 1HLUA 4CH7A 4AUXA 2FBIA 4W97A 1QTMA 3NRVA 1R5ID 4IL6C 1IDZA 1VYTA 3ASOH 2L3DA 3U6FA 3BTJA 4HX8A 3ZQIA 1Y96A 1YE9A 4E19A 1WFXA 3I56Q 2F4OB 4I02A 3OYYA 4BWMA 5E17F 3VEXA 4C5EA 1BQNA 1UGSB 1R7JA 3HP6A 2QDLA 3FXQA 4EJYA 2RQPA 4PJ0C 4EHTA 5J47A 5GAOp 5F04A 3FMQA 1TSFA 4OLAA 3FF5A 4C5HA 1TV6A 3VPZA 2DLLA 4C92A 2PEXA 1RUWA 5IP9J 4WCGA 2QXFA 3QKJA 1YJ9A 3HTRA 4KTWA 2M7AA 3EDPA 5CVRA 1JB0E 1U6ZA 1SL0A 2ELKA 4P55A 3JRAA 4M7DD 3F21A 3D45A 4FL6A 4ZH4F 1GDTA 1IC8A 3RRGA 5E8GA 2IS3A 3CPFA 2L7MP 5DYMA 2QLZA 1MMDA 1G5VA 2F4IA 2W40A 3DTEA 4DOWA 5J1RA 5GANg 1JCFA 1N77A 3WODF 5LJWA 2ID3A 4HDVA 4BRGA 1GLDG 2RPIA 1ETXA 2OJED 3ASNH 4LUEA 5KQDA 4JJNK 4EM1A 4IHTA 3S3MA 4DBRA 2CV1A 3R6MA 3KFWX 4IF4A 1WQWA 3AAQA 3U1DA 3NF6A 5JLWA 1VQ9A 3G71N 3H0DA 5FRMA 3D7SB 4FXDA 2EPDA 2KIUA 4M77G 4FT2A 1MV0B 2QWQA 3CZ6A 1JE8A 1JJ2P 4LF7K 1B1BA 5AQKA 3DLKA 1P9QC 1YJNQ 3MWMA 1RRSA 1R4NB 1M3BA 3ZSWA 3FK7A 2GIVA 2F5FA 1ZRDA 2XC7A 2KXDA 3BR0A 2MPXC 1D0ZA 4J2EA 4A5NA 2O8BB 3CQYA 2KQ2A 2UUZA 1OJLA 2GXGA 2LC4A 4JQFA 4IRIA 3OL3A 3ISNC 1MJAA 3Q7BA 5D7UA 5EEAA 1Z21A 1VFCA 1HDPA 4FJ8A 4B08A 2HHVA 4IX7A 1YBYA 4XLHA 4OGCA 2JJ9A 5JLHA 3I59B 1O9SA 2XAQA 2OFIA 4K25A 2LMDA 2BE2A 3AG1H 1E6GA 9ATCB 2JGUA 3BJAA 1EWRA 3CCLI 1MDUB 5I3UA 4DSJA 3CFOA 2V6CA 4CC4B 2EAYA 4I2QA 2FOKA 3I0WA 2KZVA 2JA7J 3LFKA 3CYMA 1NU0A 2CYYA 3CMEI 3GTPJ 2DOEA 3O4WA 3GOIA 5ICEA 2FLOA 1L3TA 5HLHA 2E1MC 4PJOD 3WHCA 3QU3A 3K4JA 3S32A 3ZYYX 4DSKA 3GFMA 2GFUA 1MPGA 3CF2A 2KZMA 1RAAB 3NGPA 1FK9A 1VQMA 3T1HK 3M56A 3VEZA 1O7FA 1Q9YA 2YLCA 2L7FP 2XF6A 1JLAA 5IWAK 1HPZA 4FM2A 4WQ4A 2NS8A 3O9QA 4KUMA 1C0MA 3ZRGA 2VG5A 3OSGA 4JP0A 4KAZA 1NGBA 1TBXA 1ZC6A 2EH3A 2IDOA 1W7AA 4E7HA 4B43A 4M7DF 1KC8U 4RW6A 3O9RA 3ERMA 4IRHA 2FF4A 3E9LA 4DFKA 1QVTA 2CKKA 3ZQGA 4CGZA 2X4HA 4A0ZA 3LA3A 2YUQA 1CXUA 3DU6A 2OPSA 2BW3A 2IOCA 2CQKA 3KCCA 5FFZA 2KRNA 3VGMA 4UUVA 2AT1B 1C0UA 5FPDA 3TTDA 4D8KA 2K86A 3QYEA 3GG4A 4IVNA 3RR7A 4I6ZA 4OO1J 1Y8QB 2V1DA 3SV4A 3MECA 1YFNA 1ZUKA 3RYRA 3FMSA 2E10A 3OYGA 4PLLA 2NS0A 5GAMf 2CS3A 3M8SA 2DLPA 5JLFA 2DT6A 2VQGA 5M1KA 4AI5A 3X2QH 1SFKA 4CCJA 3ZX0A 5CVUA 4QVCA 3KK7A 4BGAA 4J9BA 1EH6A 4V2GA 5EXWA 2A41A 4EGZA 4JEPA 4CCHA 1ZGAA 2M16A 3KNTA 3V9WA 2V7FA 2DJZA 3UWNA 2EGEA 4B24A 2K27A 4EW4A 1P59A 4LFUA 2CUEA 2DTHA 4FYVB 2ZGYA 3GPLA 4AU7A 1W2BA 5FDLA 1XSDA 4R5PA 3AVGA 4M7AB 1LMZA 4EJVA 5JVTA 3FHZA 3C3WA 5GAN5 1NYGA 2N8GA 1FMVA 1A31A 3K10A 3AVMA 5AFUH 1Q9XA 2X4YA 3CEYA 4IUVA 1Q81C 3SFMA 3WXIA 1XMOK 3BPVA 4FZZA 2P5VA 5DPKA 2HL3A 3A8GB 2RHUA 4DQ2A 2OAWA 1EF4A 2DERA 4F93B 4RG8A 4XH5A 3MN9A 3MWTA 1QCOA 4NUBA 4B3TK 3RYPA 3QDFA 3G71A 1K8KB 4L3QA 4AM3A 1R8OB 4MLOA 2QGFB 3I4MJ 1WNSA 1QVFS 2BXYA 3RIRA 3IV5A 1Y97A 4YPHA 2K85A 2O8BA 4CHQA 1GV2A 2DJIA 3LDQA 3RDIA 2AJQA 2OPQA 4EMKB 1B7TA 3OYCA 1QS4A 4FK0A 1K9MU 2XB5A 2HQRA 1BKBA 2LJ3A 3HTUA 1S6QA 1VSJA 1HKSA 3I59A 3CCUN 2YHWA 2FPEA 2KZZA 4ELYC 4C92E 1KQ2A 3NWSA 2BYVE 3VWBA 4MZTA 2QWWA 1R0CB 3CMMA 2XDDA 3OJUA 3ZN1A 4XMYA 1IRGA 3LSKA 3VMFB 3AVCA 1VSFA 3PX4A 5L3BA 1Q1HA 1N33K 3BR3A 4KJZA 2W82A 3BFMA 5IHKA 3BGRA 2DOFA 3D2FB 3HPHA 3SPZA 5M1OA 4RB2C 4M7YA 1FMWA 4R8HA 3NVKA 4BWJA 1L0OC 2Q97A 2V1RA 1W5TA 3OHRA 1RILA 4A0XA 1LJOA 1JHFA 3CDHA 2DD4A 1J5EK 1ETVA 3LZJA 2DPDA 1TUGB 2WUSA 2K6DA 1NGAA 1O3QA 4M3ZA 5FLXE 1GOAA 3X28B 2QYOA 1ZBLA 3KP5A 3U23A 2E3HA 4GV6A 3IRQA 4M77B 3CCVN 3CCRQ 1D0XA 3COAC 4UV9A 1YT3A 4A3CJ 3MKYB 1YP5A 2P9PA 1YF5L 5D5VB 3CQTA 4JD2B 3FXUA 3SWNB 1XD7A 3DLMA 3LSTA 1M3HA 5BRHA 4KITB 1S72I 4BRIA 2CUDA 3K4KA 3N4QA 2EHGA 3RPQA 1G59A 4L9NA 4FCYA 3NBPA 4DCHA 1M3CA 2RJEA 5AQYA 1U5SA 5C15A 3CCJN 3UA7A 2O0YA 3VGKA 3M8PA 3GE1A 2CUZA 3WQUA 3KP6A 3AFHA 4FZYA 4J5YA 2LNHB 5K1YA 1MD0A 4XU1A 3ABMH 1JL2A 3FLGA 2RJDA 2YR2A 1OH7A 4ZTJA 4DG1A 4CE9A 2IP2A 4DZJA 1XHXA 4EHUA 1NOZA 2NUZA 2H1KA 3L2WA 2QKLB 1OULA 1YQKA 4F14A 1AU7A 1TNTA 2B5JA 5BMZA 3V7SA 1K73O 3PNYA 4DU1A 3HEFA 4FO0A 4A2AA 3FK6A 3M9AA 3G6EN 2FPDA 1WGSA 3U2RA 1NBWA 2P0WA 2IIRA 4GMJB 2KLOA 4E7SA 1TC3C 3CWSA 2FYKA 2OQGA 3GFJA 3K7AJ 1XGMA 1JGGA 2KE9A 3HFNA 3CXCM 1IF1A 3BF1A 2AKLA 2UZKA 1XS9A 1Y1WJ 2LBFB 1O75A 1K1ZA 4FSSA 2KAFA 1KFZA 1YJ9Q 3K9JA 2FD5A 1SVMA 1LQ1A 3FBNB 1SKUB 1HNWK 2X3XD 4C0DC 4CEFA 1LEAA 1Q86O 3R9PA 4HNUA 2NXNB 1K8KA 4KH6A 3O3FA 1WHKA 1ATSA 2FG0A 3G1OA 3WTXC 2JOYA 4CCKA 4ZHRA 2BHYA 1OH8A 4KV8A 3KWGA 3ULDA 1B9FA 2E5NA 2CRGA 3SQ2A 1XMKA 2OTLI 2EQKA 1NLPC 2P9IB 1F1ZA 1WLJA 1ULYA 4ZYGA 1V29B 1PRMC 1K78B 2PVDB 4EMKA 1BCOA 4EMSA 2M45A 4JX4A 3JW4A 1MIJA 4LLNA 1YQLA 4BE2A 1BR4A 4C0FA 2MLKA 1JLCA 4I9QA 1PCXA 2I7NA 3ZQCA 4M9SA 1KFDA 4U0VA 3I8DA 1XMXA 5I21A 3QBWA 4FASD 3I56T 1MBHA 4HVUA 4M7DG 3CMEA 2QENA 2LYCA 4HZFA 3QFUA 3RTVA 1WEFA 2XU8A 4PUOA 3EGXB 3HOYJ 2XSJC 2OI3A 3O08A 1QCFA 4FYDA 3LSJA 2HHXA 1PM3A 1B92A 3A8LB 2RK1A 1GCPA 4DQ8A 3LDNA 4G9YA 5GTIC 3VQ8A 1SKWA 1VRTA 3OL4A 2QWPA 4YDUC 3OYNA 1MNMC 4JHDB 2EJRA 1G2BA 3SDBA 1IN4A 3S1QJ 4XQFA 1RKTA 4J9CA 1HSTA 1I07A 1V1CA 3HRMA 2K5CA 3A8MB 3RQ4A 2E4HA 4FJ7A 2LJ0A 2YSRA 1WSEA 1XC9A 1U9NA 1VQLN 1X3ZB 3P83D 4BHBA 1QO0D 2JT1A 3N0UA 2R7YA 3CCQI 4P5OA 3R2XC 3B6CA 2XY7A 1C0WA 3GLLA 1AWJA 5DCFA 2P9LB 5J4VA 1F43A 2QA4Q 3KZZA 4JD2A 2DMTA 4GW6A 1TK8A 3SWNA 3QYFA 3LA7A 3A0HC 4FE7A 2VGNA 3PT9A 3FZMA 1ZG3A 2KQRA 3GXOA 3CCVA 2PAVA 3DP7A 2W24A 3JRHA 2O4IA 4LDVA 4EMGA 2C0TA 2OAZA 2CSOA 3M6GA 2E1ZA 3C6TA 4DUYK 1VQMQ 1KYWA 1Y1VJ 4C1NK 1W7PD 2R7TA 1N25A 3IWZA 1IRZA 4DOVA 3PIPF 4IHXA 4IZZA 4PWDA 3WTVC 2QWRA 2BTFA 2WY8Q 1X1DA 2JG6A 1YJNT 2L3PA 2RNAA 3CCJA 5CHIA 3BUZB 4KRTA 3HSRA 1BI0A 4YFKF 5E20A 2YU9J 3RSNA 3H8ZA 2E65A 2D8HA 4DR1K 3IKVA 4DWIA 4M9XA 4NL3A 4PJOG 4PFOA 4TSXA 4RTUA 2KRSA 4A3MJ 1U49A 3MJXA 3PO2J 3MHXA 4FYYB 2GFAA 3KXTA 5CPRB 3TAGA 5AR0A 5IYBJ 2QG9B 3JTGA 3HZ6A 4HPQA 1WX6A 2PTKA 3ZCOA 3R60A 3TAFA 3AVHA 5CVVA 1JO8A 1RDWX 3CPWS 3JAMO 3RTRA 3WU1B 2V1XA 2VJ4A 1SQKA 1DLOA 3HRTA 5FLVA 1IXCA 3NH0A 4XRMA 3RKWA 1LW0A 2LTPA 2LBFA 4EJOA 2H6BA 1K4US 4FK2A 4DU4A 1NKBA 3JCMd 1XGSA 3JCMc 3URGA 4WK8F 3C2GA 4G6TB 1ZA2B 3EYYA 4XTVA 3EG9B 2E5KA 1V5FA 4J9HA 3CF5L 5ERIA 2HDDA 4ZYDA 2EFWA 4CF0A 3TCJA 3HK2A 2DA1A 2JMAA 5LJ5f 3G4SI 3JXUA 4B1RA 1WBBA 3K1MA 4CFCA 4A69C 4BKXA 3BCAA 1B8IA 2P9IA 3SHWA 2YUSA 3BG9A 2BZXA 2Y4YA 2MSYA 4DZPA 5FLMJ 1K78A 1VQKN 1SF9A 4YIIA 5KN8A 4BRFA 4EAHD 1CZBA 1ZR4A 2WTUA 3T7ZA 4B9VA 1PYVA 1TXQA 4JK9A 2F4VK 1T0FA 3F23A 2EKHA 5FU6C 5IT9Z 1SSHA 3DRRA 3EGXA 5D4SA 3QETA 3VQQA 2M87A 4CF1A 4BY1J 1TWAJ 1Z9ZA 2K7LA 1GFCA 4OLBA 2D0OA 1JL1A 4JJCA 1O4XA 3DLLF 4Z4FA 4DV1K 1G6NA 4JHDA 4D0PA 3ZR8X 3VESA 2DVEA 3L2RA 4CZZA 3GOXA 4S04A 2HBKA 1X9SA 4M7AE 4A3KJ 3DXKB 3LSPA 2IIMA 3I58A 3ZT3A 3CG7A 2HKXA 1HQCA 3MEVA 5AQZA 3LM9A 4CJ4A 3TVTA 4MIMA 5E18F 1MV3A 4CK1A 2ZJQL 2E2PA 3ABLH 4ICLA 3FR0A 4A93J 4D6WA 4UY8I 1Z7LA 2XG8D 5BR8K 5BR9A 1J2XA 4Z4HA 2B7EA 4E7IA 3VQPA 1RTHA 4BC2A 3ID6A 1Q82O 1YI2N 1L5UA 4A3JJ 4FLXA 2BHZA 2DK3A 3UT1A 1YUWA 4FJNA 3H08A 5AONA 4LF4K 1D9DA 4DTOA 1YITN 4ID1A 3D1NI 3N5NX 1MMGA 3WGIA 2XICA 4J8FA 3VQ9A 3LWIA 1OR7A 2RD1A 2Q0OA 3MXJA 1E3OC 4LFBK 4ZYHA 5F0HA 4Q4ZF 4M7DB 1R5HA 4HXJA 3FXKA 1IXSB 4KICA 1S3JA 4M4ZA 3VQ5A 1HNZK 3CJCA 3KTQA 1H88C 4CCMA 3JTHA 3V8LA 4PKCC 5B5EC 1QQOA 2D0CA 1UB9A 1D3YA 1U3OA 2BBYA 3H1QA 2DRMA 1NLOC 4BUPA 4ZN1A 5LD2C 3HKZA 5LGUA 4QQ6A 5LFAA 2QQRA 2R93J 1QHHD 3CUQC 1XB4A 1BG3A 4I7FA 3ATUA 1ZK8A 2PNIA 4DQRA 3AA5X 2BE9B 1ZBJA 3V42A 2ESWA 4LB6B 2HTJA 1GVJA 2HS5A 4I2PA 5H6RA 2V8KA 1KZHA 4XTWA 3CJRB 4WX9A 4RB3C 2KGTA 2X9HA 2CP2A 2DIGA 3RMQA 2NVUB 4RA2A 1SD4A 1SUQA 4AFQC 4I9LA 3R0JA 3MCAB 4JX6A 2ZCWA 1VQLT 1U0JA 2JZ2A 1BIAA 2QEXI 2E1MB 4H0VB 2RQQA 3QPHA 1N9RA 4ZZDA 2GTJA 4HF2A 7AT1B 3EG9A 4LB5A 2R7WA 2GEMA 4B23A 3TEEA 1JKQC 5IN1A 1QZ5A 3WTWC 4JDSA 4B9TA 4F16A 4XLPF 2IS4A 1PSFA 3ENHA 5DM7F 2CP3A 4FJIA 2Y31A 4QT7A 4CFAA 4NC6A 2O61A 2FL7A 3NARA 5FPEA 3LL3A 1K73R 5HP1A 3TOBA 3CCRT 1YO5C 2NRHA 1Z3YA 1SD7A 1T0HA 2KEAA 2Y48A 2X48A 4CZHA 4XKBA 4LDWA 2WB1A 1S1XA 3S9HA 3TEDA 2LLKA 1Q95G 4GBQA 3P8HA 2KVQG 2O8XA 4AFUC 3TWHA 1ZLJA 3I0SA 1BN5A 2YNHA 4PJOB 4L9TA 3BW1A 5CKEA 3MXIA 2D1XA 3PLAA 3EH1A 3BC8A 1QQCA 3C6HA 4H5NA 4CFBA 5CQEA 2L01A 4J9DA 5E84A 1XN7A 3GFIA 2LY1A 3TAEA 1EZZB 2FMYA 4HNTA 1BO5O 2Q2RA 1PJRA 5IYCJ 4AVPA 5BPDA 2KYMA 1XOVA 4QSHA 3CCQA 4CF2A 4ABZA 2ZQBA 4CZGA 1VIEA 1RBUA 1TS9A 4F9OA 1NOYA 5GANj 2LT1A 2JUCA 3NGYA 2BZTA 2HAXA 2A6HF 4LJZF 1IN5A 1TKTA 3PX0A 4C8QC 2PLYA 2ZNZA 4LH4A 3J81E 1FLIA 2MGQA 2ZPEB 3GTLJ 2RJCA 1HKGA 3CCLQ 3JB9D 4NCBA 3WG9A 1BR1A 5GAOq 2JNGA 3LPTA 1QQIA 1N8RO 2E1CA 2DW4A 3CMEQ 3QIPA 3QEXA 1KCFA 4U7BA 1IUFA 2FSWA 2YUOA 1WN7A 4BROA 3S3NA 4RAGA 4EDUA 3FFKB 4PGGA 1NJIC 4DQSA 4N4NB 3EPZA 4A6DA 3PFYA 2VIXA 4RMOA 1V5GA 3LQQA 2ZJPF 2ZSHB 2AIRB 1XNQK 3DLRA 1DIZA 4IO9F 3L00A 2DTIA 3IH2A 2LNBA 2NVQJ 4E2FB 2XPVA 4FHTA 3SAFA 4J2DA 3FXMA 1I5OB 1VQKT 4MTDA 2K9NA 1VQPI 4CD3A 4L8RB 3ECHA 2XD0A 3IFRA 4M7DA 1FBUA 4I2OA 2MW8A 5GP9A 3EY1A 4F55A 2VN2A 1YX5A 3KYLA 3L4QA 1TGOA 4BHCA 2PFUA 3VEPA 1IGNA 5BQTA 2NRVA 3KHYA 3UE5A 2HSEB 3VENA 5AQIA 2JHJA 3CC2N 1GLEG 5L3FA 1UZCA 5HRRA 4C8QF 3D5LA 5D5UB 2NUTB 1QNTA 4I09A 1WBDA 4ZYAA 3NVMA 1SKSA 4IOAF 2JA6J 1TL8A 4A3DJ 1SEMA 3FXRA 3TP3A 3CCSN 3FZHA 3CJ1A 3SQNA 5L3CA 1IG7A 4ENKA 3G0ZA 4OKKA 2CO5A 1TQIA 2PJPA 4PL6A 4CHOA 2HDWA 1W0UA 4CIFA 3SUOA 3GBGA 1SRLA 3QZ5B 4DEYA 1UAXA 4BR4A 4DQQA 3PE0A 4Q5WA 5FWBA 1L3SA 2L3SA 3G4SA 4NQWB 2KQWA 4YOXA 3KLGA 5AZJB 2AP1A 4C3JJ 1ZBIA 4QPOA 4EVIA 2WAQA 4BQOA 3VTHA 5C3EJ 1ORNA 1UG1A 4XRSG 1I1SA 2K3YA 2QA4T 3N97A 1I5LA 3JB9F 3SAGA 4FE4A 2R7QA 1YITT 1WJBA 2IVMA 2DN0A 3M54A 3JRGA 4BACA 4M9ZA 2FSJA 3GTOJ 4KHQA 4IIMA 1ZLKA 3CMAN 3OR2C 4RGSA 2E4LA 2TCTA 4PJOA 1K73U 1FBSA 3QU6A 3TW6A 1U06A 1SHGA 4KGVB 2RN8A 3W3CA 3V6DA 2LCCA 2KFDA 3WNFA 5M3FJ 1LFPA 2X4XA 1Z6RA 2K3BA 3ME9A 3S1MJ 3CC7I 3G1LA 5CQGA 2WBNA 1W2BM 3ZETB 1H8KA 3BOQA 5AT1B 1OYXA 4B9WA 5IOZA 3KZIC 3B8AX 2ZPBB 2F8TA 2XHCA 1EJ9A 4XBFA 1IN8A 1WJDA 3MP1A 5HRNA 3CJQB 2FXAA 1BL3A 2WAEA 2Y1JA 1BBYA 3FFIA 4CBWA 2E2JJ 4U0YA 2RHZA 2CFOA 3QESA 4UNOA 1Q86U 3J7YJ 4M42A 5GAN3 1PKSA 3OOUA 2YS9A 5GIOA 2CZ7B 2NOLA 4H4MA 3K4BA 1EFNA 2VWBA 3FZVA 1SAUA 1WH7A 2RV8A 4V2SA 3BE3A 1Y0NA 5L8RE 3BY7A 2RNJA 4P9FA 2EX3A 3I9QA 1QQMA 4IUPA 2H1LA 5F0FA 1OYYA 1EKEA 4U87A 2P9UB 1RTDA 3WXMB 2P0QA 2DQLA 2COZA 1Q1VA 4C2UA 4V19K 5LGNA 3HPWA 2B8AA 4AILC 1S7OA 5GANh 4II3A 3AGRA 1M1EB 4DTPA 1VSKA 3DEUA 2VCPA 1S6PA 3Q5FA 1YIJI 5EEGA 1N6AA 5KRTA 3REBB 3V9XA 3REOA 3DCFA 2J4RA 3ENOA 4OAYA 2UUCK 2P9SB 2OC6A 2J5OA 4CJ3A 1S72Q 3WXKA 3KEQA 3NFAA 1VNDA 1T56A 5HDGA 3NWTA 3V7RA 2RJFA 2YHXA 1WSGA 2PVOB 2W7NA 2VXEA 4CO8A 1S7AA 3BQZA 4UC4A 1VSHA 4O55A 3HUGB 2NUTA 3H0FA 3DOLA 1Q82R 4IUUA 1XG7A 2XI9A 1WUAA 2QEXA 1U2WA 5CIUA 2CW7A 4KI6A 2HZDA 1W6XA 1W36D 1XNRK 4X9CA 2STTA 3AO4A 5FKNA 4YY3K 2HNDA 2YG8A 4B9QA 3FHGA 1D8KA 1P2FA 3THYB 1RBRA 4M74A 4M75D 2AZSA 1T6DA 1FJGK 5AZJA 4M78D 1XQPA 2OCCH 5AQRA 2YKMA 1D5YA 3D5RC 4AHTA 2DYRH 1KQ0A 4NZGA 3WNGA 3IDHA 2DAQA 2JTEA 2VKHA 1HDDC 3DLGA 2HKOA 4JKHA 5J2MA 2W10A 3CXCS 4CECA 3VKIA 3ECOA 4GDFA 2D0BA 3BTIA 4DQPA 4O8UA 4J9FA 4HSBA 2I8DA 2LNVA 1LV5A 1KA8A 4DV4K 1DUXC 2CGPA 3ZBDA 3MN5A 3LYIA 2WONA 2K5FA 3CO7C 1LWFA 2HHTA 4LC9B 1T44A 1XTDA 2HZTA 2LQNA 5CKBA 4M7DE 1W36C 4L59A 2D1KA 2WBMA 3H0GJ 5GMKj 2XV4S 3OGDA 1NKCA 2P8TA 3JCMQ 3HM9A 2FA5A 3GZNB 1WKMA 2OTLQ 4M75C 2R7RA 1R6RA 2LRDA 3EN9A 2CYZB 4M78C 4NCAA 1WQ2A 3SPYA 3CC2T 2XY8A 5DLQE 3ZETA 1WHHA 1RBVA 2EV6A 4B48A 4JUVA 1IAWA 3CC4I 3I64A 1X6BA 3HO1A 3K9KA 2RB6A 4A4EA 4M63C 1BI3A 1WHGA 2P6TA 3F8CA 5GAHJ 3SEZA 1WXTA 3QUIA 5A2QK 1SVLA 3RR6A 4UVCA 2TRTA 1LVKA 2M0YA 1IKWA 2VXFA 2G7HA 3LA2A 1IJWC 4BRCA 2YUPA 3A8HB 5I42A 2YWWA 2JUGA 4Z0UA 1YHQI 4CRIA 5LJ3g 1NH3A 3ZT1A 1M1KC 3VQ4A 2BUPA 3QBXA 1G3YA 3GTMJ 2KSSA 4E9FA 3ZSXA 1W7PB 1VQPA 4YOWA 2DBMA 1FC3A 3SEMA 1R1VA 1ONVA 2P9UA 3WXLA 5LJ5d 2I0NA 2FOWA 3CCQQ 2RF2A 4DYRA 4KB0A 4A3LJ 1GL5A 1X1AA 3NMUA 1AZEA 2Z33A 2CFXA 3JCMg 4M75F 4D8DA 2O8CB 4KPYA 4YOQA 1CSKA 4M78F 4BREA 2DI3A 1H89C 1GXPA 5IY5H 3I53A 2HXOA 1MWMA 3EETA 1IZ1A 3TSPA 1HRHA 4F3TA 2ZZDA 3CLQA 5F1RA 2LD5A 1UWBA 3GNFB 1FEXA 1N8RR 4PJOE 1V54H 2E5QA 2HR3A 3RERA 1GV5A 1F21A 2D1HA 4FIBA 3JAMZ 1KD1C 2EQMA 4Q5SF 2KK4A