4BACA

Prototype foamy virus strand transfer complexes on product dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly of Prototype Foamy Virus Strand Transfer Complexes on Product DNA Bypassing Catalysis of Integration.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords INTEGRASE
total genus 82
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bacA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bacA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bacA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bacA03
4Z4EA 4LY7A 1BHLA 1TK8A 4CJUA 2RJEA 2NLUA 3HYFA 3IG1A 2Y1IA 1D9DA 1CXQA 4OPKA 4YFUA 3NTHA 1BCMA 5D3GA 3PMTA 1K6YA 3OS0A 3QESA 1YT3A 3ZT0A 4DFPA 1KSPA 4CHQA 4I9LA 1REVA 2B4JA 4HVJA 3S6WA 2HVIA 4O0JA 4KB0A 1BGXT 2D0CA 2HVHA 1RDCA 3ZSVA 4FJIA 4KB1A 1NKCA 1NK0A 2IOCA 2VG7A 5KTQA 1U48A 4DQQA 3H6ZA 4PLLA 3P5JA 3EYZA 3C4SA 1JXEA 2KTQA 1GOAA 1I39A 2XDPA 4CF8A 4FZZA 2XY7A 3OMGA 4QVZA 2P51A 3RWUA 2Z1IA 1IG9A 2RHZA 5HROA 1EKEA 4B9NA 5KCHA 4DSJA 2OPRA 1XWLA 1S1WA 4CFDA 3KD5E 2JZ2A 4FJ8A 1A5WA 3OMCA 4QQGA 1HQEA 1ASUA 2OPPA 1HYZA 2ZD1A 2DAQA 1S9EA 3NTKA 3M8QA 2IS3A 2RO0A 1HJRA 1RT1A 5HRRA 4CJLA 4QQ6A 4DQSA 1N5YA 1JLBA 1WJRA 4OPJA 3VQ8A 1L3SA 1RT3A 3HXMA 1L3UA 1BISA 1RDDA 1VSEA 3O3GA 3PO5A 3K5LA 4DU3A 1C1CA 4NCGA 4FK0A 3OS2A 2VG6A 3CQ8A 4M3UA 4BACA 2Z1JA 2LVMA 4PY5A 3V9ZA 3O4QA 4KHNA 4Z4CA 1EXQA 3PX6A 1HMVA 4CF2A 3NF6A 3OYIA 4Z0UA 3PFSA 2E6NA 3RMAA 2A1RA 3NAEA 1JLGA 3KUFA 2Y1JA 3O8VA 3KIOA 3JYTA 1GOCA 1JLEA 4KKOA 3WNGA 4RG2A 4CFCA 4M41A 3L8BA 3RRHA 3I0SA 1VSFA 2WACA 2RHUA 2OZSA 4Z4IA 3OYBA 2CKKA 4I2QA 3QERA 5K14A 1D8YA 3PY8A 2FBYA 3KKSA 4FLZA 4CJ3A 4K8ZA 4ZHRA 4ID5A 1TK0A 3ZT1A 4KTZA 2FHDA 3E01A 3LP1A 5J26A 5DMRA 2L89A 4W5QA 3DLHA 3DOLA 3SUPA 1Z26A 3MEWA 1S1TA 2RN2A 4NCBA 3HJFA 4OGEA 2QKBA 3AA5X 3L2RA 1S9GA 3BDLA 1KVAA 3AVAA 1WLJA 3RR8A 4EZ6A 3K2PA 4KHWA 1H3ZA 4BWMA 3TAEA 3RTVA 3LPTA 2YV0X 4QCLA 3L2UA 3ASKA 2F8SA 2ZQBA 3B6OA 2HHXA 2B6AA 4CEDA 3DLRA 4HHTA 1NOYA 4FLXA 3ITHA 4CF9A 1HNVA 3OYGA 4BDZA 3P8DA 3DLKA 4Q5VA 3DM2A 3NE6A 1RBUA 2VWKA 1TKTA 5KGWA 1DLOA 3DLEA 4CGDA 4E1MA 2D5RA 2YHAA 2XO7A 2XRIA 3CFRA 5J2PA 4OKJA 3NFAA 1EETA 4DTJA 3FLGA 5HLFA 3META 2G8IA 1Z25A 4IG3A 3CM6A 4B9XA 3VQDA 2L8DA 4CJQA 3MXIA 4FJGA 4Z4GA 5FDLA 1RDAA 4O55A 3AVKA 3P83D 4IBNA 5KE2A 4KTWA 1WGSA 3BDPA 2GFUA 3TAPA 2HHVA 4DLGA 3SQ0A 1F21A 2OPSA 4LSLA 2DFEA 1X9MA 3MECA 1BL3A 3DRRA 4M3WA 2DTUA 4BWJA 2PYJA 3VQCA 5HRPA 3E9FA 1SV5A 3ULDA 3ZT4A 4DS4A 4F4KA 4CJWA 4FJNA 2OPQA 2E4LA 4PQUA 3G10A 3VQ7A 3QETA 3L2VA 1KFDA 1TAQA 3SV4A 3AO5A 4B9VA 3NH0A 2RHIA 1HQUA 2RF2A 3NH1A 3V81A 4DWIA 3KD1E 2P1JA 4DQRA 3MEAA 2GUIA 4OGCA 4RW8A 1RDBA 1C0UA 1NKBA 1DTTA 4PL6A 1UWBA 1W9HA 3V1QA 4HUEA 2XK0A 4FM0A 3HP9A 4OLBA 4IDKA 3U3YA 3AVMA 5J2MA 3HO1A 1QSSA 1OYXA 1NK8A 1WJSA 4C5EA 1IKVA 3OJSA 3EZ5A 3V6DA 1B92A 3PUFA 1L3VA 4Y1CA 4CCHA 2G8HA 1QTMA 1MU2A 2X4YA 1WN7A 4CIFA 2MWPA 5D6YA 1LWCA 3G0ZA 2YNHA 4O4GA 1JXBA 4CHPA 3NGIA 5HP1A 1KLNA 2RI2A 4GW6A 4IFYA 1IH7A 3DLBA 4M3XA 4NS5A 4CJSA 3PNWC 3NDKA 3L2WA 2RI5A 4CEZA 4AH9A 1XNIA 2F96A 4CFBA 1XHZA 2EQJA 3T1AA 5D6XA 3E9GA 1HPZA 3OA6A 2FBXA 3QKJA 4NYFA 3OB9A 4CERA 1NJZA 4J2AA 4ICLA 4KV8A 5CYQA 3IS9A 3DMJA 3MEDA 1ZBLA 3M9QA 3D0PA 1L3TA 2P5OA 2FBTA 3NBPA 4PUOA 2HHQA 3L2QA 1NKEA 3UT1A 1C6VA 2FC0A 1R0AA 1BQNA 1KVCA 4LH4A 3K58A 3RR7A 3VQPA 4AHVA 2IGIA 3ZCMA 1ITGA 2I5JA 1C1BA 3LZIA 3ZSZA 4N76A 3SZ2A 3F73A 1SL0A 4Q0BA 3KLEA 1VSJA 4B8CA 3SI6A 2YNGA 3MEEA 3TARA 1SSFA 4BE0A 2EQKA 3LGLA 3AVCA 1TL1A 4FM2A 4DSKA 1CLQA 2X4WA 3F70A 5I42A 2G8UA 4OLAA 4IUVA 3ZT2A 1XI1A 4JRPA 1ASWA 3LALA 2BGGA 3FC3A 4CGJA 3KK2A 3LPUA 3CM5A 4DTPA 2A1SA 2VWJA 5C0MA 3C6TA 2RJFA 4GVMA 4ZTFA 2XY5A 2D0BA 3M8PA 1YTAA 5CZ2A 1RT5A 3V1RA 3TAGA 3PX0A 3SCXA 4DSLA 3KTQA 3LDSA 4DF4A 4DTRA 4PLIA 5CIUA 1TVRA 4NYNA 4CF0A 4C5GA 3ZSXA 1QSLA 4KI6A 2PQWA 3NF7A 4FLTA 2HHTA 4DTMA 3VQEA 4KHYA 5C24A 4XIUA 2JLEA 1QHTA 4CGIA 4DFMA 3QEPA 4FJMA 4N5SA 3VQQA 1NJXA 3IRXA 3I0RA 4LH5A 4CESA 3SQ4A 2M16A 2BIVA 4M45A 2RHXA 2KQ2A 3S3NA 1TAUA 4NZGA 2ZE2A 4RG8A 4WE1A 1LWFA 1IKWA 4B3OA 5JS1A 3LANA 1LWEA 1FXXA 1WSGA 4OJRA 1C0MA 2YKMA 1XHXA 1TKZA 2G8VA 3M8RA 1G15A 2BANA 3TR8A 4MQ3A 2X4XA 2HNYA 3HVTA 5KRTA 1VSHA 1UA1A 4BDYA 4FK4A 1J54A 2EHGA 4KHUA 1WSIA 1NK9A 4CJ4A 4J2EA 1RILA 4BD3A 5EU7A 2XY6A 2R7YA 3HPGA 4CIEA 2VYTA 4CEAA 4CK3A 4B9MA 4HCCA 4E7HA 1C0TA 3HPHA 3AA3A 3THVA 4ELUA 3UIQA 2M1HA 4BE1A 3L42A 3LYIA 1D5AA 3AO1A 1LAWA 1EX4A 1WSFA 4H4OA 1KLMA 3FFIA 1A5VA 2D9TA 2K3YA 3OYNA 4N4GA 4QW2A 3D45A 4CEEA 3FEOA 5J2QA 1Q9XA 4KO0A 2O4XA 1A5XA 1J9AA 3BGRA 1QE1A 2YKNA 3F9KA 1FKPA 2QXFA 3VQ9A 3TAMA 2R58A 3NHGA 2PZSA 4FW1A 4FLVA 3LH0A 4FK2A 4CEFA 4JRQA 3V9XA 4FJKA 2KZMA 1CZBA 1HRHA 4JLHA 4RW4A 4CEOA 3CEYA 3ZSRA 4UC4A 4F3OA 4CJTA 4E89A 4FLUA 4FW2A 2R5MA 3CFPA 1JLAA 4CK2A 1YTUA 1D9FA 1IKYA 2EQUA 4I9QA 4W5OA 1N6QA 4AHSA 3MP8A 4AHTA 2G8WA 4N47A 5KI6A 1X1PA 4A4FA 3UWNA 3KKRA 2LSNA 2IG0A 3AVHA 1TK5A 4A4HA 4GY5A 4B08A 1JKHA 3NH2A 1OZ3A 5T7BA 1SKWA 4C8LA 3OYLA 1OI1A 2P0KA 3H08A 4O0IA 4RW9A 3KK3A 4DSEA 4E0DA 2E6LA 4CHYA 2DFHA 3K5NA 3AVFA 4BDPA 1I3AA 4ELTA 1Q9YA 1TGOA 2RPIA 1RTHA 4PA1A 2RKIA 2F5KA 1TL3A 3KLFA 4KPYA 4CEQA 3EAEA 3QO9A 4M3TA 1JL1A 1Y97A 4E3SA 1O1WA 4Z4HA 5C42A 4FJ7A 3HVRA 1KRPA 1UOCA 3LAKA 3NF8A 3QJ6A 4DTOA 1JLCA 4QOZB 5IAYA 3OY9A 1WAJA 2NUBA 3C6UA 3VA3A 4IKFA 3VQ4A 3TAFA 5SZTA 3H8ZA 4Y1DA 2G8FA 1VK0A 2XHBA 3HPOA 3S3MA 2MWOA 3S9HA 3HT3A 3O3HA 2HB5A 4C8MA 3DB3A 2ITGA 2YRVA 3NF9A 4K8XA 4CRIA 2D0AA 4II1A 2DY4A 3JSMA 4DF8A 4DTXA 2X35A 4W5RA 3RRGA 4TSXA 3SUNA 2BKDN 3C95A 4DQIA 4E7JA 4IURA 1RT6A 1T8EA 2HNDA 4B8AB 4F3TA 4FLYA 2GV9A 2AJQA 1SKRA 4DFKA 2ETJA 4CGGA 4H4MA 3I8DA 1BI4B 3SV3A 5IN1A 4OKKA 4N41A 3LX7A 3AA4A 1BIZA 1KTQA 4DSIA 4L59A 1IKXA 2DIGA 3HK2A 2O4XB 5E41A 2O4GA 1CXUA 1J5OA 4RW6A 3AVLA 3SQ2A 4YNQA 3OJUA 1EP4A 3TAQA 4CJ5A 2E5QA 3U6FA 4FJ9A 4EP5A 4C5HA 3PMIA 3NCIA 1C1AA 1JL2A 3MEVA 1LW2A 5SWMA 3QNOA 1NK5A 2QKKA 2HHWA 2JGUA 3AA2A 2ATQA 4FM1A 1GOBA 2Q3SA 1Q8IA 1KVBA 1HNIA 2YNIA 4CJEA 4CIGA 3ZT3A 4CJVA 4E19A 3K57A 1XC9A 2L3RA 4CGFA 5J1EA 4Z4FA 4B9WA 2R57A 4CHNA 2KFNA 4B9SA 1J53A 2HNZA 1RTIA 4H8KA 4FZYA 4KREA 4NCAA 4HCZA 2IAJA 1RTJA 4DSFA 4B9UA 4KTQA 3QEIA 3DOKA 1N27A 4EDUA 4HCBA 4CK1A 3OYJA 4QAGA 3V4IA 4CFAA 1RNHA 4OVAA 2VG5A 1MHNA 3ISNC 2IDOA 3DLMA 4IFVA 2LTOA 4FYDA 1HYSA 4E7IA 3ZSYA 4DQPA 3VQ6A 1BCOA 4CF1A 2X74A 4DMNA 1ASVA 3OYEA 3NNQA 3HM9A 2W42A 4J2DA 2KZZA 2XY8A 4E7KA 4N56A 1KFSA 2EQMA 4OVLA 1BQMA 1UAXA 3RMCA 4FU6A 3VQAA 2JTFA 2RJCA 1RCHA 4A4EA 3K5OA 3V9SA 1NOZA 3QIIA 1FK9A 4OKEA 1NK7A 1WSJA 3C94A 1NJWA 4R5PA 4FJ5A 2HW3A 3TWHA 5C6SA 2DFFA 3VN5A 4FCYA 3AVGA 3AVIA 4E1NA 4HUFA 1U4BA 3T19A 4F8RA 1VSDA 1VSKA 3LGFA 3V9WA 1RBVA 4BE2A 1VRUA 1WSEA 4DTNA 4QQDA 3MXMA 1WJQA 4IUUA 3QEXA 1T7PA 3KLIA 4O44A 1JLQA 3LLRA 4CJPA 3OQ5A 2BE2A 2EKOA 3ALYA 4AHRA 3MAQA 5J2NA 1TKDA 4KHSA 2QK9A 2R5AA 3SJJA 1KCFA 4HUGA 2X6SA 5HRNA 3T3FA 3AVJA 4LD0A 3SPYA 3LZJA 3O3FA 2PYLA 3OYAA 2P5GA 3PO4A 4M42A 3HP6A 5FRMA 2EFIA 1VSLA 4KFBA 4RW7A 4CGHA 3EY1A 4LSNA 3PV8A 2QQRA 1NK6A 4FZXC 4PWDA 4B9TA 2X78A 4Z02A 3VA0A 3SQ1A 1WAFA 1X9WA 2QQSA 3FDRA 3MEUA 4IUQA 1S6QA 5CYMA 3MP6A 3ME9A 5D6WA 4C5IA 1CZ9A 3QIOA 3QLHA 3KLGA 3PX4A 3DRSA 1NK4A 1KHCA 3AVBA 1T05A 4C8KA 3OYKA 4B9LA 3WNHA 1ZBUA 4DU1A 3S3OA 3LP0A 4CJRA 1RT4A 5KCOA 3OYCA 4HTUA 1QQCA 4M3YA 3TANA 1B9DA 4DU4A 3CFOA 4N4IA 4X34A 1S1UA 1UA0A 1L5UA 1G5VA 3VQBA 5KE3A 3SPZA 4L8RB 4ZTJA 3AO2A 1LAVA 5J39A 2GF7A 1WNSA 4FL6A 3LP2A 3KJVA 3SUQA 1LV5A 3NGYA 3V9UA 2F8TA 3U3GA 5HBMA 4O5BA 4EP4A 2G8KA 1BIUA 3ZSOA 1SUQA 2KW4A 2RJDA 2G3RA 3MO8A 3B6PA 1S1XA 3ZSWA 3TABA 1U45A 3M8SA 1LW0A 4W5NA 3HSTB 1ZYQA 3MP1A 1FKOA 2WONA 4CJFA 4FJJA 3P1GA 1OZ2A 3HL8A 4FVMA 2E6MA 5KRSA 4C8NA 1T03A 1TV6A 5FRNA 4AHCA 2OYQA 4M3ZA 4M3RA 1ZBFA 3Q1JA 2B8AA 1WSHA 3L3VA 3IAYA 5KGXA 1RBSA 2LRQA 1RT7A 2Z1GA 4IG0A 4KAZA 3MEGA 2O4IA 1VSMA 3DLGA 3CG7A 4CECA 4CHOA 4DG1A 1SL1A 5CZ1A 3TI0A 4FJLA 3QBYA 4FXDA 3DB4A 1BI4A 1HYVA 5C25A 2GBZA 5JS2A 3WNEA 2HQEA 4IUPA 2EX3A 3ZSQA 1U49A 4Q5WA 3QIPA 4J2BA 3OS1A 4JS5A 4KHQA 2RHYA 4E7LA 4LD6A 3O4NA 1SL2A 3RMBA 3MXJA 4DLEA 1VRTA 3NGZA 2HMIA 3ZEHA 1IO2A 4N4HA 4CJKA 2RI3A 4FJHA 3OVNA 4JS4A 3QNNA 4KRFA 5FROA 1RT2A 1YVUA 5DK5A 5KH6A 3GOXA 1W0HA 3ASMA 3LAMA 4DS5A 3P8HA 3RMDA 5CY4A 2PY5A 4ID1A 1U04A 1S6PA 3QEWA 1QS4A 4MFBA 3DI6A 3L3UA 4CEBA 2IC3A 3DRPA 3K5MA 1RTDA 5M9OA 3A2FA 2BDPA 2OA8A 4ELVA 5I3UA 1RBRA 2LCCA 3AO4A 2HQXA 2DIQA 4AHUA 4FJXA 3NTIA 2FBVA 3OYMA 4FLWA 3KLHA 3OYFA 3LP3A 4F2SA 4A4GA 2HHSA 2X6NA 2YHBA 3SD4A 4DTSA 3QEVA 3SNNA 1NJYA 2YNFA 4C8OA 1X9SA 1ZBIA 4UQGA 1VSIA 4IUTA 2M0OA 1S1VA 4DTUA 3OYDA 3AVNA 3AO3A 3CYMA 3SYZA 2LDMA 4G1QA 3SUOA 1QSYA 1RBTA 4F2RA 4CE9A 3OYHA 4I2PA 3LWLA 2HHUA 3AV9A 4DFJA 1TKXA 4W5TA 2OZMA 3QINA 2B5JA 3KK1A 3LWMA 4I7FA 5HRSA 2Z1HA 3DYAA 2WOMA 2K3XA 1JLFA 3K59A 4GMJB 4CHZA 4EZ9A 4KI4A 1ZBHA 1DTQA 3V1OA 1U47A 1SKSA 2BUDA 4AILC 2KFZA 1B9FA 3WNFA 2GFAA 1RI0A 1S5JA 3VQ5A
chains in the Genus database with same CATH superfamily
4B3TK 1D9DA 2P9KA 2IXSA 1NYGA 2A3ZA 2FU4A 1RAIB 1H1VA 1JEGA 1QWEA 1KSPA 4CHQA 3S6WA 4XLHA 4I7HA 3LA3A 3KFWX 4PGHA 3F22A 2IS2A 1FOKA 3VB2A 2AQEA 4LUDA 1BG3A 3NTKA 2WAEA 1YJWI 4FYWB 2ZXJA 4AD9A 4FK2A 2KQRA 2Z1JA 4HX7A 2ZKZA 1IGNA 2LD5A 3V9ZA 2QF7A 4IOXA 2DO7A 4MNUA 3HYIA 4RCBA 1O3TA 2CV1A 4FETA 2OZSA 4ZZDA 5LD2C 3KKSA 4BRIA 1P7MA 2CV2A 1TSFA 1M90R 3UKRB 1NPPA 3A5ZB 5M1OA 1WLJA 3RR8A 3M0TA 4M72A 3DKMA 4DBFA 6AT1B 1VQ4A 4FLXA 4JI7K 1GLCG 2LLKA 2VPRA 3QYBA 2Y69H 3E66A 2AHJB 4D8DA 3FE1A 5L23A 5J2PA 4DTJA 4UV9A 4Z6YA 3OH6A 4Z4GA 1RDAA 2CRGA 1F21A 3JXUA 2ZCWA 2HOSA 3J81E 2K9LA 1MH3A 1ZH5A 1IRFA 3G1JA 3LCNA 1KGSA 3OW2P 2M34A 1OCOH 2HDAA 2RQWA 1T33A 4B3AA 2W40A 2DODA 2FPDA 3NVKA 2GIVA 3LSIA 4BBSJ 4AI5A 1LWCA 3CCJI 4NS5A 2RI5A 1XHZA 4ELZC 1G3YA 4JRKA 2COMA 1YNZA 4KV8A 3PIOA 3UKRA 1ZBLA 1IN6A 3NBPA 1Y8RB 1X19A 2LR8A 3RSNA 1BQNA 1ITGA 3ZR8X 3M5AA 1C1BA 2DK5A 1OJLA 2VXDA 2MMPA 4IIMA 4UY8O 1NG9A 3THXB 4DSKA 4OLAA 2NOHA 3NRVA 1T38A 1M2VA 2BGGA 3H0GJ 1Q86C 4FL9A 5IHIA 3TAGA 3CPEA 3JRAA 1PRLC 3TSUA 4DF4A 3BG6A 3TEDA 4CZIA 2DMTA 2UV1A 3QEPA 3BQYA 1AKHA 3CCUN 1IXRC 1Z9CA 1QU3A 1UG1A 5I9EB 2NS8A 1XHXA 3GFJA 4B1WB 2KRFA 1T6DA 3CERA 2EHGA 2L7KA 4RDUA 4XLNF 4D1QA 3NARA 3O2PE 4M3DA 1R8OB 1G59A 5BREA 3MZYA 1Z9QA 2HVRA 1D3BA 4YY3K 1WH5A 2QEXT 1AWCA 4RCCA 3FFIA 3BGRA 2ISYA 2R58A 4JOMA 1KC8U 3VYSB 2IPQX 1KD1U 4CK2A 2KPMA 3JAMZ 1HA8A 2EQUA 4J9IA 1BR4A 1ZSGA 4AHTA 2G8WA 2GWRA 1FC3A 4K42A 2KE9A 2BVMA 1G2HA 4HVWA 2WAQA 1Q9YA 4GO1A 2RKIA 5IYDJ 3TSQA 5AJ3K 1KU9A 1REPC 3V7CA 2QTVA 4QVCA 2LDUA 4DZJA 3Q5FA 3BG3A 2FUG2 2BY0A 4Y1DA 1UB9A 1UHMA 4DBHA 3ULRB 2D0AA 2L02A 2BV6A 2FA5A 3EFSA 3O8GA 2NS0A 2DETA 1VQMN 2L2OA 5DD4A 5JHUA 4M9XA 2DBBA 3FM5A 1X2NA 3M58A 1U6ZA 1TH7A 3TREA 1CXUA 3SQ2A 1K83J 1MSFC 3PMIA 1NK5A 3MEVA 3K4NA 4OO1J 2ATQA 2Q3SA 1ORNA 4XTWA 3K57A 3OW2M 4IOCF 2J05A 4L18B 2HNZA 2M51A 4NQWA 4R8HA 1RTJA 1EH7A 3QEIA 2AS5F 3DOKA 3CP8A 3J7AP 3INZA 1T0HA 2ZXWH 3MCAB 1HW2A 3DU5A 2VG5A 1XCVA 3VS5A 4FE4A 5FKLA 3GTGJ 4WXDA 1SVMA 3H6EA 2EQMA 3JCMb 2RQQA 4A4EA 3V9SA 2E35A 4A3MJ 1FK9A 2FNAA 2HW3A 5C6SA 4JX4A 2O31A 4HUFA 1JJ2A 4QS9A 3QEXA 2EJRA 3KLIA 3EE8A 3LZJA 1NEBA 3F2KA 4RW7A 3HKSA 2X78A 4I98B 3AAQA 2BTFA 1N8RR 3PX4A 1A31A 4JRIA 1LQ1A 4X62K 3LP0A 2LQ8A 1OU9A 2K5CA 4OINF 4LJZF 2WV1A 1B9DA 3WTVC 1NG2A 3FZHA 2HNHA 2HOTA 3SPZA 3U21A 2A3SA 3MX2A 1TL8A 4FL6A 4EP4A 3ZSOA 3U9ZA 3MO8A 5D5WB 4EHUA 2O8CB 2XICA 1TUCA 3GP8A 1WQ2A 2HQAA 4BC5A 4HEA2 1KHIA 2W24A 4IG0A 3DLGA 4DG1A 1FEXA 1N34K 1XB4A 1WXBA 4E7LA 2LJ0A 1ZUUA 1OFCX 1IO2A 2X4JA 5LJ5h 1I1JA 3H3VK 3GOXA 3P8HA 3MK6A 4MFBA 3DFGA 1WWXA 2EH3A 1UHFA 4IHWA 4J7FA 2W1OA 1VA7A 3O8MA 4B1XB 3JV3A 3AVNA 3JCMW 5H20A 3LWLA 4M7DB 3UKUB 2XVCA 5HRSA 2XIGA 4GMJB 4C8QB 1RRQA 3BJ6A 1LJOA 1FTTA 1RAGB 2GTDA 3IRQA 3ZYYX 2DDAA 4KMFA 2NLUA 4HOBA 2H27A 2Y1IA 5L3EA 4WF2A 4LDYA 1K6YA 4F3QA 1YRNA 1YT3A 5HS7A 5L3GA 1HBXG 2HVIA 3K1NA 4QTRA 3ZSVA 2FF6A 1VOMA 1VQ7N 3H6ZA 1LCKA 3C4SA 2PJRB 3J81Z 2F5FA 1PUEE 1I39A 1U9NA 2ECBA 1GRIA 1IG9A 2RHZA 5IWAK 4UXNA 2GBQA 3SHWA 5I3UA 3LDLA 4RAGA 1Y6IA 3QDKA 4QQ6A 1N33K 2P0QA 2ED0A 1BI0A 5LEKA 2QWPA 2GBYA 2DYRH 4Z0UA 2ZC2A 3C0BA 3TO6A 3CD6A 2FE3A 1N3AA 4CSWA 1VHXA 4BR0A 4HQEA 2EW3A 3RVCA 4XICA 1U84A 3LP1A 3THYB 3S17J 3SUPA 1K6OA 1S72A 2ZMEB 1H3ZA 2HVSA 3M0PA 4EIAA 3PNVA 4RTTA 5JFRA 3E9OA 1QVGP 3JCMh 4XTYA 2QG9B 3L09A 4E1MA 2D5RA 5AQZA 3CFRA 1EFNA 5M1FA 3MXIA 3OOPA 4FWNA 1YF5L 4OFEA 3TAPA 2DFEA 4UVBA 1D8JA 2QWMA 2DJIA 1KU7A 5IPAA 3U1DA 2D5VA 1W0TA 1IDYA 1TAQA 3JB9D 3K70C 1FSHA 1YJWQ 1HQCA 1NKBA 1FBUA 1JGGA 5LHGA 3NHNA 3CJRB 1HXDA 1TQPA 1ZLMA 2DPPB 5ILSA 4A4KA 4XN0A 4M3XA 1CF7A 3G2BA 1KIKA 1QWFA 4RTWA 5KYNA 2FC0A 1UAAA 1VQ5I 3CCVQ 2DNUA 4IRGA 3KLEA 1MUNA 2YNGA 2CW7A 2X4WA 1H3HA 2ROLA 2L9RA 3UDCA 2A1SA 4RLFA 3IL2A 3V1RA 2AA4A 1N39A 1K9AA 3SWNA 5FD5A 3A5MC 2PQWA 1R71A 2ADUA 1FTZA 1QA6A 2BEOA 4LH5A 2M16A 1AWXA 1IJJA 1U1SA 3VS4A 1BI3A 5AFUH 3M8RA 4BDYA 4KHUA 1VUBA 2E10A 2DEUA 4ON0A 3MPUB 3FLCO 4B1RA 3WODF 4HCCA 4R56A 4HT8A 4WCEL 4JDSA 4KIGA 2HHSA 3JCMJ 2Q2EA 3FEOA 1MDMA 3GUDA 4XIDA 3VQ9A 4RA2A 1J2XA 1GLEG 4GLKA 3ZETA 5FW9A 4F3OA 3UE5A 4FLUA 1BA1A 4IZZA 2CH4A 3EG1A 4ESFA 5M1NA 1D9FA 3GWZA 1FLIA 1TG0A 1P6RA 3I8BA 4RTFD 2E3HA 4A4FA 3KKRA 2LSNA 4RTXA 4A4HA 1I5OB 2D1XA 5F04A 4B08A 2OAUA 3DBLB 4CCOA 5LJVA 1NLOC 1T39A 2XAFA 3G4SQ 1YN8A 4XAXB 3O3KA 4DTOA 3OY9A 5DYMA 4B1UB 4WK8F 3HT3A 2UUAK 5BNGA 2DY4A 4II1A 4QS8A 4I2OA 1AA7A 4M78D 2HXOA 5FWBA 4XH1A 2WY8Q 2XKPA 3I53A 3TW6A 2Y30A 4HRIA 2NVUB 3I8DA 2ICWG 5IOZA 3FZLA 2M02A 3ZN0A 1K73R 5C12A 3SQNA 3NPFA 3DLLL 3BC8A 2LQWA 2P9LA 3F3XA 4WXCA 3D0PA 5CKHA 4E19A 3CUQC 4CGFA 1W4SA 4BI8B 2IJLA 1QMCA 4KREA 1QZ5A 3BUZB 4IFVA 1BR2A 4AFZC 4E7IA 2YLCA 4MDXA 2UZKA 2KZZA 1KAXA 5HLIA 3G71T 2PU9B 1WHJA 4XRFA 1BQMA 4DYQA 4J00A 2VKEA 2A3LA 4IFEA 3ZQHA 1ZARA 5I11A 3E6BA 1WSJA 4Z88A 3VN5A 2JSPA 5FB2A 3V42A 4FASD 1HC8A 2PJPA 3R3LA 3SJJA 5EGOA 3T3FA 2RC4A 2BY2A 2M2EA 5BS6A 4U88A 4Y4RA 4AFUC 2VQEK 2LC4A 2LYCA 3KLGA 3ME9A 1U5TC 2CUDA 2XSJC 5GAOl 1KQ9A 1F5TA 2JZYA 2AXLA 1DUXC 4G6QA 2Y4YA 2W04A 4HAMA 4CW7B 1IZ1A 4GFBA 2K3FA 1G5VA 3VQBA 1N78A 3LP2A 3NGYA 1SAXA 2O8FA 2Q0RA 1VQ7I 1OH6A 2L7ZA 4H5WA 5JMVA 1OZ2A 4OWRB 5HODA 5JVGF 3TEEA 2O4IA 3F9MA 5MLCQ 4C9YA 3DPLC 5CVUA 2P9IB 1KQSP 4BGAA 3R6OA 3QBYA 3JB9F 2HCKA 3C6HA 3O9TA 3DXKB 2MI6A 4C0DC 2DK3A 4LD6A 3ZCOA 1MSEC 3QNNA 3GTPJ 5EZGA 4DS5A 3WGHA 2QK0A 3QEWA 3VSKA 3P38A 2WSCE 4ELVA 1HKTA 2NUTB 2DIQA 1BW6A 3FXOA 4FLWA 4FOEA 1YQRA 3SD4A 4PKIA 4LDXA 3AO3A 3BZKA 4PUSA 2M7BA 3HUGA 3BPXA 3DYAA 3QOEA 3R61A 3N5BB 4M77B 3WNFA 4IF4A 1MBEA 1S5JA 2OTLA 4Z4EA 2D0PA 4FT8A 1TK8A 1P9QC 1V54H 3N97A 1XMQK 1QZEA 5J40A 2MAMA 1OCCH 2RQUA 4I9LA 4IOCL 1M1EB 4JQFA 4BRDA 3P7NA 1P92A 2F2VA 2JT1A 1IXSB 4FZZA 4QVZA 1QP3A 5M5YJ 1NE8A 4QQGA 1JU5C 3M8QA 2RO0A 1YW7A 3KXTA 4XSXF 2KHMA 2ZGYA 3K5LA 2O8EB 4AWXB 2R7RA 1XG7A 2VJJA 5CK9A 2JUFA 3KP6A 2A1RA 1WSUA 4HLXA 4M7AD 1IG7A 3EG0A 1TUDA 3VEXA 4F16A 4EJOA 2JA2A 1V3FA 4YRVA 5AQVA 3A5LC 4AVZA 4LUEA 3FWEA 3SZGA 2ZMEA 4F55A 3HSBA 5J26A 3FHNA 4ESRA 1K8KB 3EO3A 4K41A 5TISC 1U1TA 2NXNB 1VQ5A 3CC7A 1VI0A 3CMEN 1YI2N 3ITHA 2FSNA 3IRRA 1DIZA 2DXCA 4ZN1A 2ZZDA 3THXA 1DLOA 2EA2A 1UG2A 1WXTA 4CCKA 1X9JA 1U8BA 3EYIA 2XRIA 1QVFA 2ME6A 5E79C 1UFFA 1EETA 1Z25A 4E7SA 1IRXA 4ZGEB 3P83D 5ELZA 2XKOA 2NUZA 5F0XA 3SAHA 1S72N 4PKGA 2LTPA 3ULDA 4RM2A 4MTEA 3QETA 3L2VA 3GW2A 4HX8A 3SV4A 4CXFA 3WTUC 4ISGA 1Q86O 2E5LK 4E6KG 2QWOA 3V81A 1RDBA 1K73C 3MN2A 2LP0A 4IDHA 4C5EA 4PGGA 4Y1CA 4C0DB 1ZX6A 2B7EA 4CHPA 4O4GA 3DLBA 3CCRQ 3IMXA 2FLOA 2ZPGB 1OMIA 3EN9A 4NYFA 1NJZA 5K5RA 3CCRN 2ECCA 2DLPA 3DTEA 3UT1A 2FL7A 1R0AA 3DF8A 3K58A 2NRHA 4AHVA 2GELA 5ICGA 2KRNA 2P9KB 3TARA 1M5Q1 2QA4A 3AVCA 2G8UA 3UNGC 2W25A 3E7LA 1XI1A 4MEXF 2O9VA 4AF1A 2QEXQ 2VWJA 4XKVA 1HDPA 3TDZC 4M3FA 5BRDA 2ABLA 4FSXA 1YHQT 4GVEA 4PL7A 3NF7A 1VIFA 3CXCM 2L3DA 4FJMA 1VQOA 1YYVA 4WE1A 1A0NB 2P6TA 3M54A 1IGUA 2ATCB 2BANA 3TR8A 4I6MB 4JK8A 1D8KA 3HC7A 1DQUA 4K43A 3VS3A 2HBKA 3HRMA 1Y1VJ 3LDQA 4CA0A 3FXJA 2RK1A 5I2MA 3JCMe 3NWSA 4BE1A 1MGTA 4KO0A 3ZEUB 4II2A 2BOLA 3QUIA 4FLVA 4CEOA 3ZSRA 1VQ5T 4XH4A 4LB5A 1KQ2A 1N6QA 3ID6A 4X66K 4PFOA 4ENJA 5BPIA 1SSHA 1SKWA 3G0QA 3KK3A 1Y96A 5BOXA 2E2JJ 1I3AA 3BT9A 4B24A 2RPIA 2JPCA 1JL1A 5C42A 3OV8A 3RERA 1KU2A 1JKOC 3NF8A 4RAZA 4G9YA 4D0PA 3ZP5A 5SZTA 4BUGA 3CCMQ 3FKIJ 1PRMC 3BOQA 3DB3A 1TYQB 4OAZA 4BR2A 5I22A 3CCQI 2AJQA 2X1DA 5IN1A 5LJWA 4XLCA 3TO7A 3QICA 1U6GA 5A2QE 4J7IA 3OJUA 1EP4A 2O5RA 2DPDA 1LW2A 5SWMA 2A37A 2OCEA 3CMAI 3AA2A 1XC9A 3ZT3A 4CHNA 2YDLA 4NC7A 3ASNH 4B3XA 1VQKA 3MN7A 3DJCA 3HHGA 4AC0A 4MQ9F 1ORPA 1H9TA 5GAMe 4R79A 3LWIA 2AO9A 3RMCA 4AI4A 1FYNA 1YIJA 4KUDK 2E8AA 3FX3A 4BEHA 4F8RA 2K9NA 1MV0B 5AQTA 3V9WA 5FLXO 2KDZA 4D5FA 3OQ5A 1TKDA 2QK9A 3WVEB 3TPQA 1JB0E 3H9QA 3AVJA 4CGHA 1B34A 4DV6K 2YU9J 3B8AX 2QQSA 3MEUA 1K4US 3IP4B 4C5IA 1QCNA 1KHCA 1HLUA 3WNHA 2EK5A 2LSOA 1VIEA 4L0YB 3SFIA 1LAVA 5J39A 1YG2A 2K9QA 4E47A 2CJJA 1D5VA 2KGTA 3OR1C 4FWOA 1ZYQA 2FYKA 2K7AA 5CKDA 2F1LA 1PM3A 2E7WA 4YEJA 1T03A 1ZC6A 3IAYA 3GLXA 1OPLA 4J6XA 5LEJA 2EZIA 3CG7A 5BPDA 1HYVA 4KHQA 5IYCJ 4JS5A 1FYLA 4JI5K 4LLGF 4WCGA 5AIQA 5LHIA 1X1DA 2QDYB 4YPHA 1GCPA 5KH6A 1R6RA 2COYA 3I56A 3KE2A 2EPDA 2O8BA 1ZRFA 4OU0A 3NTIA 1VQ9T 4DOZA 3MZHA 1B9MA 5A0DA 3JCUC 3CCSA 4C3JJ 3FXMA 2LDMA 3SUOA 2B86A 2B5JA 5HKCA 5A0LA 4FSVA 5J47A 5GANj 3HL2A 1HNWK 2CQ7A 4CUGA 4C30A 2K57A 5E8GA 1JRIA 4ITVA 1KRPA 3VQ5A 2IS6A 2ZJQF 3GEZA 3HJEA 3IG1A 1CXQA 1YP5A 5HS9A 2WUSA 3OH9A 3QESA 2FX0A 4HA8A 4HVJA 1I1SA 1TTHB 4WCIA 2HVHA 1GBRA 2ZPHB 1MZBA 1YHQN 1YJ9I 3ZLJA 3OMGA 1HKBA 4BL0B 1NGBA 3K4JA 4IJAA 2P9UB 2OD5A 1AVZC 2DEQA 1K73U 4XKWA 2ELJA 1NBWA 4LY7A 3H35A 3HEFA 2EAYA 4XH5A 1J59A 1RT3A 1TWAJ 2ZSHB 4CZEA 1YBYA 2NRTA 5E3MA 2E1MC 1BA5A 1HMVA 2ZF5O 1OV3A 1T56A 2Z1DA 5AQWA 5F1JA 2RM4A 1TUYA 3J80Z 2CGKA 1KSWA 5CO7A 4I2QA 3N4QA 3L9FA 1KG7A 3DOLA 2QKBA 2ZPBB 1VQ5Q 2CDTA 1QNTA 3HHTB 3V4GA 2IVMA 3CJQB 3A98A 2VWKA 4NL2A 2K9SA 3JAMK 3VENA 4DV0K 1DJ7B 1OR7C 4JYKA 4JJNK 4CICA 2E19A 1IN7A 2G7UA 2KYMA 1ZBXA 1XGSA 3R9PA 1UHWA 4KTWA 3BDPA 1EH8A 4M78A 3SQ0A 1OKJA 3I5SA 1K76A 3H45C 1MBKA 2A5YB 4FJNA 1ORKA 5LJ3e 4L5JA 4FTHA 2JWKA 1VQ9A 2C06A 4Z8AA 3DXJF 4EVIA 3KEYA 2W0ZA 2IEKA 1VQPA 1UWBA 3IHOA 3I0XA 3U3YA 3OWTA 4J5YA 4L9TA 1ZQ1A 1VQ6I 5EG0A 1X75C 5D6YA 1K0XA 4KFCA 1K9MU 2RI2A 3Q0VA 3NDKA 4HNVA 3V7SA 1VQ4I 1M90U 4JX5A 3L7WA 3DXMA 2PUKB 5GMKe 2RF0A 2HYFA 1W7PA 2XROA 5JVTA 1IRGA 2NS7A 4XRSG 3ZT2A 4EJZA 1E0EA 3HGGA 2RJFA 1SS6A 3DTIA 2LG4A 3PX0A 2FPFA 3FKJA 3SCXA 1WJAA 3M8JA 4C5GA 4YOWA 2P9PB 1CZAN 4HPQA 3AARA 4XIUA 1WFXA 4CESA 3GZNB 4MMLA 1IKWA 1S72T 4BY1J 2G8VA 5CVJA 4DIQA 1IXDA 3W3CA 4HF1A 2OZUA 3FK7A 3J8AA 5I21A 5CKTA 1YI2Q 1NHAA 4PJOB 2AHQA 1OULA 5DPKA 4E7HA 1YJ9N 4G94A 4E7ZA 2UXDK 1OX8A 3OYNA 4CEEA 3QFPA 3IH4A 1NGGA 3IKVA 3SHFA 2LF8A 1HRHA 2E88A 1NGNA 3D2FA 2PBDA 3D0SA 2UXXA 2Y2ZA 5LMNK 4N9HA 1WB9A 4ETSA 3AVHA 4O5FA 3M5RA 2HAXA 1RLQC 3G73A 4RW9A 3QYEA 3E5QA 2EQRA 5GAOr 2EKHA 2HKQB 3M55A 2HHHK 4K2EA 1RFQA 2CH4W 2EQIA 1Y97A 2D0NA 1XTDA 4F17A 3LAKA 2JQ7A 3QWYA 1V5FA 4EMHA 2LT1A 2VOPA 4BQQA 2XAGA 3I55I 2WAFA 3ABMH 5EYRA 4F3TA 2D0QB 2HNDA 1BM9A 3CCUI 1X4OA 2X6XA 1KTQA 1DPUA 2O03A 2DA5A 2P7VB 4RAYA 3CC2T 1NYFA 4EP5A 2A61A 1WCMJ 1D5YA 1IV6A 2FRYA 5EEHA 2GNCA 2IA0A 3VUZA 3FIWA 3CCVN 4R0KA 2H8WA 2H1KA 4DQPA 1BCOA 2W42A 4JUVA 1OISA 3A0HC 1Y8QB 2D6FA 3C94A 1QVFP 3M8EA 1MA9B 2P6SA 4FJ5A 4DV7K 4M75G 4E1NA 1TUGB 1YJNN 4P5NA 1WSEA 3MXMA 1HOMA 2BE2A 5DTDA 2QA4Q 2OA8A 2NLXA 1KCFA 3SPYA 2VE8A 1EF4A 2JG6A 4NC6A 1HSTA 4O6JA 4QWQA 3QIOA 1U3OA 4EIKA 4M7DD 3EGDB 4PJOF 2E41A 2QTDA 5C2FA 3KEOA 3CMAT 3TANA 1TS9A 3OBWA 3G4SI 2ZJQL 4JK1X 3HGYA 3WHCA 2J6FA 2M45A 1PDNC 1VQ7Q 3ZSWA 4W5NA 3QOPA 1JKPC 4C2MJ 4XRSA 4N0AC 4XKBA 4IEIA 1W7AA 3HM8A 4UHTA 1QPIA 4AHCA 5FRNA 1LJ9A 5KGXA 4M78C 5IHNA 4FJLA 5C25A 2V8IA 5JS2A 4Q5WA 2BVLA 1B6AA 3I56N 3TMOA 2WB1A 3GIBA 4EV0A 1AWWA 4IL6C 4OMPA 1L0OC 3ASMA 1ZLJA 2LQKA 1Q81U 2LCCA 1ABQA 5FU6C 4HQMA 3OYMA 3J7ZO 1N9SA 2ECZA 3SNNA 2YNFA 4Q47A 2X1EA 4FPAA 4AT1B 1FBSA 4IUTA 3VYTB 3SEMA 4U67L 1C0GA 4BR5A 4RB2C 3OW2S 4W5TA 2LREA 1V4TA 2WOMA 3E97A 3K59A 2QQBA 2JMCA 4YOYA 2BUDA 1S22A 5GMKl 1U2WA 1B07A 3MWTA 1Q95G 3CC2Q 2QA4N 3HIFA 3SLCA 3JCMc 3CUOA 3NTHA 3LSKA 2XGCA 1REVA 2O8BB 2EIMH 3HFNA 3CLOA 4KB1A 1Y1WJ 2EFPA 1OPCA 4A3CJ 2HOAA 4EM0B 4EMSA 4H0XB 4C8QE 1YITA 1Z67A 3GCMA 1DKGD 2JTMA 3EDPA 3D7SB 1HQEA 4KB0A 1S9EA 5IP6A 1ZGJA 1VQ9I 2HBPA 1SC7A 1K9MC 5BR9A 1NK3P 5EX5A 2DYBA 1RRSA 3E3VA 4A63B 3SJHA 1U2VA 5HDKA 1XQOA 3MKDA 1P2FA 3OYYA 2P9IA 2HDWA 2F4IA 4RG2A 1VQ4N 1MW7A 2MG4A 3PY8A 4LD5A 4BRKA 4PJJA 4BVPA 2FHDA 3F8NA 4A0XA 2RK2A 2CQNA 2P9NB 5F1XA 2GGRA 4GRIA 1WQ7A 2QKMB 3PIPA 3L2UA 3RKQA 2HHXA 4M7AA 2ESHA 3MAJA 3P8DA 3DM2A 5E1WA 2LKSA 3QYFA 4CZKA 5AQJA 1R4NB 2HVQA 1W36D 2RHKA 3X28B 2HHVA 3JTGA 2MH9A 5GAHP 3RQ4A 3CWAA 5E84A 4CJWA 5CQGA 4C8QA 4AIKA 1W9HA 1BK2A 5D7UA 2L2PA 2ZJRF 4IDKA 3PSIA 3KWGA 4I6MA 2RA2A 4YOXA 5HP1A 1WUAA 2H3GX 1IH7A 4JAXA 4C92F 3GTQJ 4DQ2A 2F96A 3CCVT 3AT1B 1ONVA 3CESA 1KD1C 2DX1A 2PMHA 2R5YB 4Y15A 3OBYA 1T0FC 2G9WA 1QVFS 2QYOA 4LGWA 5DV5A 1SL0A 4B8CA 3F70A 3BQZA 1ASWA 3LALA 3QDRB 2UYTA 3KK2A 2M3AA 1PG5B 2R5ZB 3ZQQA 2QVOA 3CHWA 2Q36A 1ON1A 1VQOI 4KA4A 3PNYA 2YRDA 3JCMX 5C24A 2DTZA 2RVCA 2HMPA 3H9NA 4M45A 3CC7Q 2KRHA 1USSA 1FXXA 2ESNA 3CC4A 4HVUA 5KRTA 4FK4A 3DPUA 4I0AA 3CJCA 1GVJA 1RILA 5CVIA 5EU7A 3CCJT 1T0FA 2HDCA 3THVA 4I01A 2IVNA 2OF7A 3E6DA 2V1RA 3S2WA 3IH2A 4D7MA 2YKNA 2KZMA 4RW4A 3A01A 1WHHA 1YJWN 2EIFA 5E8IA 2ZXHA 5LFAA 1S8NA 5LL6S 4ISFA 5T7BA 5M5WJ 4ZC3A 2A6TA 2JVGA 3KLFA 1VYVA 1ZREA 2Y90A 4Z4HA 1Z9ZA 1P7IA 4V2SA 2XRNA 1XSVA 4YFKF 5F0HA 3MN5A 3HOVJ 4CRIA 4AYBA 4DF8A 3VSLA 4DQIA 5J8FA 3JCMQ 1CKAA 3QP6A 5GINA 1BU1A 1BIAA 4H0EA 4IO9F 1WIEA 3CDIA 2JUCA 2A28A 4E1JA 3NCIA 2QKKA 2DTHA 4XTZA 5JR3A 4HTLA 1NGFA 2VONA 1GOBA 1Q8IA 3JRHA 2FMYA 4Y13A 4H5RA 1UMQA 1V4SA 2H6BA 1IW7F 1YS7A 4HCZA 2OTLI 2VVKA 4A3FJ 4JKBA 5AQRA 5CE3A 4D6WA 2HKOA 4JZ3A 4OVAA 4DR1K 1HYSA 1N5ZA 5IHKA 3BWGA 3VQ6A 5GAMf 4HYEA 4JI0K 3KP4A 3GFIA 1KFSA 1XJWB 5GAMg 1YW8A 1UAXA 2NZTA 1X01A 5GANd 1VQ8T 1XPXA 4HV5A 2DO3A 3C2BA 3I64A 2OV7A 4PJLA 1RBVA 4BE2A 2LNVA 2Y9ZA 4IUUA 3LLRA 3FMQA 4DV4K 2DT7B 1JTYA 4FX4A 4AHRA 1HK9A 2STTA 1Y39A 3O3FA 1E6HA 2IS1A 3PO4A 3EY1A 2F5DA 1BC7C 3QLHA 1QVPA 2E1NA 2LOOA 1T05A 3QPTA 5GAOp 4CH7A 1C6VX 2XAJA 2Q2RA 5KPTA 1RT4A 4QT7A 3TP0A 4DYRA 4B43A 3OOUA 4CZHA 4I0BA 4ANJA 2VLAA 2JA5J 4GYIA 2W84A 4RGSA 3RBBB 1SANA 5D8LB 3LSPA 2R7QA 5AZIB 1FMVA 3U3GA 2X6YA 2FB7A 4DR4K 1S1XA 1U45A 3ZMSA 1RZ4A 3BY5A 2LRDA 1YX5A 3MN6A 2K9GA 1E3PA 2JRTA 3FISA 3P1GA 1QHHD 2NNWA 2OYQA 2ID3A 1MMAA 1T0JA 1RBSA 1YJWT 3MD2A 1VQNI 2P0PA 2CQQA 2RNAA 3T1BA 3WTWC 1TXQA 3COAC 2Y31A 2RHYA 4BJ6C 3O4NA 5EDNA 2CUJA 2ZXIA 2DPUA 5FPNA 4RBOA 2EV6A 3DI6A 3KCCA 2UU9K 1X3UA 1QLYA 3E9LA 4BQZA 1OQYA 1L3LA 3LP3A 4KITB 1MV3A 5KK1A 1NJYA 3J7AO 2L01A 4OPHA 1PKSA 3HOYJ 3KYDB 4CE9A 1RDUA 3H9GA 1ZGWA 1TKXA 4NHJA 4MFEA 2WSEE 2R7TA 2JS0A 3RDVA 3RESA 1SKUB 5GMKi 3ZQ7A 4FWSA 3OIPA 4AMCA 5K7HA 3JB9J 2V7FA 1A35A 2H1LA 1BGXT 2D0CA 4B09A 2IVPA 4U7DA 3F0CA 2VWFA 5IXBA 4KH4A 2L54A 1S7EA 1Q1HA 2H3JA 4M9SA 4BRCA 3ZN1A 5DDGA 4E9FA 4JKCA 1GHCA 3G71N 3WVDB 5KCHA 3GFLA 3DXKA 3LW5E 3KD5E 4KHPK 1HKQA 3CD6T 1HYZA 4M78E 5HRRA 2IS3A 4N9IA 3BROA 4H5VA 2KT0A 3SAFA 2A42A 3L4IA 4M7DF 4FT4A 1DGKN 3ASOH 4Z4CA 2RB6A 4HF2A 3QAHA 2CW0F 5HS8A 1ZYRF 4IWVA 3HSRA 4DGWB 1HU0A 1ODDA 3K69A 2QWQA 1VQLA 4A3KJ 3IQLA 2XPWA 1VQMA 4K8ZA 4FLZA 3LNQA 3DQVC 3I56Q 2UUZA 4W5QA 1PP7U 3BTCA 3L2RA 3VS1A 1LDDA 2E65A 3AVAA 3TAEA 3RTVA 1KD1R 3R0JA 5C0YA 2YX7A 2VQFK 4AM7A 2JMAA 1VQON 2MPXC 4DR7K 3U2RA 2C0IA 1TKTA 1UGPB 4EPCA 4BVOA 4UUVA 2V1DA 2XKOC 2HS5A 4YIRX 1ULYA 4Y3OA 3OW2A 3K2ZA 2F2WA 3WU1B 1EZZB 1KK7A 3CJBA 4WFAL 2QEXI 4M78B 4H0OA 3AO5A 3VTHA 1HUXA 2HYJA 3NH0A 2P1JA 3L2CA 2HPMA 3PO3J 1LOTB 3ZX0A 4BROA 5GJWB 3N0UA 5J2MA 1Q81C 5J3LA 4WX9A 2YR2A 1IB8A 4XLAA 1KAZA 4BRMA 1KLNA 2IA1A 3CI5A 4IHVA 4CJSA 2FPEA 2KXCA 2EQJA 2HEOA 3BG7A 2CO5A 5EEAA 1HJOA 1GLLO 2F2XA 1KVCA 1DP7P 2IGIA 4FSSA 4MDAA 4J19A 2HQHA 5ADXH 2DMOA 4FM2A 2MA3A 2VUMJ 1TWHJ 4XRMA 3PIPL 3M8PA 2AP1A 3KEQA 1YI2I 3LDSA 1WPKA 2V9PA 3HSFA 1IHVA 1VQOQ 4FLTA 2QCOA 2YUPA 4UUSB 3QPLA 3IKTA 3I0RA 5FU7B 3CW7A 1RPWA 4DNCA 1LWFA 4B23A 5JS1A 2OBPA 3LANA 3JCMP 4OJRA 3HTVA 3WE3A 1TKZA 4MQ3A 2QSHX 1ZG3A 4LIVA 3KHYA 3LFKA 2IIMA 4CK3A 3EUAA 1N8RU 2CYZB 4YORA 1LAWA 2EGAA 5IYBJ 1KLMA 2JMWA 2NWMA 3NAUA 2P9SB 1J9AA 3KYCB 1SRLA 4FW1A 3ECOA 3CO6C 2R5MA 3D5RC 4OX9K 3JCMd 3KP5A 2H09A 1YQLA 5GANf 1VQPN 2F2EA 3K0LA 1FIAA 2KXDA 4XN3A 1GXQA 4PA1A 1G3TA 3C12A 3SZPA 4ENMA 3RR6A 1RKTA 2V1UA 3ZMVA 5D5VB 4IJNA 3LH5A 3QJ6A 4LC9B 3CCET 5CHIA 4IOAL 2CZ7B 2DJNA 2ITGA 3VS0A 2LCLA 4E7JA 4M7DA 2KZGA 4OKKA 3CJ9A 5GANg 5E41A 1X27A 4W1UA 3WQUA 3QNOA 4CIGA 4CJEA 2L3SA 4Z4FA 1KQSA 4Y28E 2IVOA 2BXYA 1BN5A 4HDVA 4XU3A 4A6DA 4BR9A 1FJGK 4AIJA 1TC3C 1KQSS 2HXIA 2A05A 1Q86R 4RB3C 2RJCA 4RMOA 1RCHA 1S3XA 3K5OA 2YHTA 1JUPA 4C23A 1X43A 3CD6Q 3GNGA 4A0YA 1SFOJ 2HBMA 2HNIA 3DEUA 2EKOA 5GAEJ 3FJ5A 4HUGA 5GAN2 5HL7L 3OYAA 4GKJK 5EJCA 3H1VX 4LSNA 1LWYA 3QZ9B 1Q86U 5FLVA 2DA6A 3F8BA 1WQWA 1Z05A 3GO5A 1K8AO 4A69C 3LSRA 5AQMA 3PJRA 3ZMDA 4OPAA 1POGA 1EH6A 5ICEA 4ME7A 3TSWA 3F23A 2W10A 2F8TA 1NH3A 5DLOA 1SD7A 1SUQA 3TBIA 1LNXA 1ZHIA 1H89C 1OEBA 3I59A 3AY9A 3G71I 2FRHA 2XB5A 3WUHA 2YUQA 1RGIA 1WSHA 4X64K 2LRQA 3EG3A 3B73A 3RPUD 4UNFA 4BAYA 2HI3A 5CKBA 3EHRA 1FIPA 4J2BA 4AM6A 1YQAA 4QPQA 3F0ZA 4DEXA 2V1NA 4Z94A 2NUPA 1QQJA 1HLVA 2IGKA 5EG2A 1H0MA 5M9OA 5GMKj 2LJ3A 1E7OA 4A4GA 4Y52J 3DKYA 4KH1B 1T08B 1YTYA 4M3BA 2LT4A 2DLLA 5KCMA 5FFXA 3AAFA 3MWPA 4F2RA 1WBBA 4I2PA 2IBDA 1XNRK 2FG0A 2VJIA 2A6AA 3AV9A 3HTRA 3QINA 2O8EA 3KK1A 3ROUA 2Z1HA 3A8YA 5FJ8J 4CHZA 3PLAA 2WSFE 3N05A 4LMYA 3FM3A 3ZFJA 1BHLA 1HYOA 2XASA 5AQSA 1KQ8A 4X9DA 4JLGA 3ZT0A 4DFPA 1VQNT 2EYWA 2XGXA 4PJOG 3JRDA 5FFZA 3GBTA 4WFBL 4AIAA 2CH5A 2JW4A 4CF8A 1DU0A 2Z1IA 2QEXN 2TCTA 2NRXA 4C3IJ 4NNJA 3C6UA 1HJRA 2E2IJ 4FYXB 3OA9A 3HRSA 2J6OA 2VG6A 1ETKA 3LA2A 1IUFA 2W7NA 4UY8I 3PX6A 1PSFA 3K4BA 3JB9G 3HSEA 1A5JA 1E3HA 1PHTA 2P9UA 3T7ZA 3HB9A 2PEXA 4LD9K 3MKLA 1HJDA 3DKXA 3GYHX 3CWUA 3E5UA 4CZCA 3HM5A 3E01A 4F04B 5FO5A 1FNNA 3CCEN 4M7DE 2HEQA 4BWMA 3BZ6A 2BZTA 2WB1N 3WTXC 3RKXA 2ZFWA 4PNOA 5L3FA 4KIBA 3BCAA 4G6DA 1KXPA 1FBQA 3CJNA 1VQLT 2KSSA 2KP6A 3NMUA 1PYVA 4KMUX 4BREA 2LFBA 1M9SA 4LSLA 3DLLF 4LIUA 2JWTA 1W5CC 1KA8A 1JCGA 3C2HA 1YITN 3ULQB 4C0FA 2GQQA 1SZ2A 3F21A 4RW8A 2DMQA 3S1QJ 3QMLA 2G0EA 3QPSA 1EO1A 3FIFA 1W6XA 3V6DA 2YI1A 4CCHA 2G8HA 3CMMA 2KT8A 1J75A 1LUJB 5LJ5f 3ZMTA 4CFBA 3ENHA 3T1AA 5CYVA 4EATA 3WHBA 3MEDA 3VOVA 3K4LA 1U0JA 1KQ1A 3KP2A 1C6VA 3ABLH 3VQPA 4V2FA 2GXBA 1GLNA 4HNUA 3MEEA 3H5NA 2VWBA 1HKGA 4G12A 4ZYAA 1O4XA 1OU8A 3U1KA 3SBTA 2VXFA 2ITMA 5C0MA 2XY5A 1BBYA 2DA7A 5CZ2A 3BDDA 2LNHB 1TVRA 3TP3A 4JI4K 4CZJA 2R93J 3VV0A 2VT3A 4AVPA 2EYZA 1LWVA 3IRXA 3O08A 3M59A 3I35A 1VQNQ 1GCQA 1FOYA 4M9ZA 2YKMA 1LFPA 2CSQA 2BY3A 1VFCA 1XGNA 1NKUA 1NK9A 1FPQA 4CJ4A 3FJPA 1OVQA 5J3BA 1G83A 1BW5A 4CIEA 3VEPA 1ILYA 4OMOA 3PO5A 3AO1A 1A5VA 3H46O 5AZJB 3D45A 5J2QA 1SG5A 4M7DG 1QE1A 1IN5A 2DTIA 4M75B 4JRQA 3R6MA 1SFXA 3G1LA 3MWMA 4J01A 3BZCA 3A1PA 3M1EA 4AHSA 1JHHA 2MABA 5LRSA 2HSEB 2YHXA 3UWNA 3K4KA 6PAXA 1JKHA 4IPAA 4XLPF 4DSEA 3UIQA 2DFHA 4C2UA 1RC9A 5KYWA 2XUBA 4WQ4C 5C4XJ 2MLKA 4C0GA 4PFPA 2FBIA 3EAEA 5KPZA 4YOUA 1K78A 2NUBA 3HK2A 2V7ZA 3VEVA 2LBFB 1MBHA 4A2UA 3FZFA 3S9HA 3A1YA 3TOAA 2XSDC 3IH3A 4GLMA 1R58A 1ZBSA 3FBNB 1ENHA 3WG9A 4TSXA 3SUNA 1RT6A 1RIOH 3IH7A 4CGGA 2NRZA 3SV3A 3GFMA 3LX7A 1HX1A 2E1OA 2DIGA 3LSTA 1PWTA 4YNQA 1E4FT 3REAB 2XD0A 1KVBA 1R59O 5EXWA 1M90O 5J1EA 4CZGA 1J53A 2P7CB 4JZ4A 4OB3B 1TOVA 1SFKA 3T0YA 2L9VA 4MMKA 3F10A 2TRTA 2Y0SN 3TTDA 3ZEUA 4MLHA 4EMKB 3FRNA 2VBWA 2OJED 4XLEA 1NK7A 5HLTA 2PVDB 3JW4A 3G6EA 3CC4N 1M1KR 1LFBA 3URGA 1R5ID 2M0MA 3I55A 1SVLA 2YX6A 4KGXB 1BU6O 5J2NA 4D5CA 4AG1C 1QCFA 4YIIA 4LD0A 3CCRI 1JI8A 5AZJA 4KFBA 2ROTA 3CVSA 4A57A 1X9WA 2K4BA 1X1BA 3BY7A 3DPTA 5AQPA 4CCMA 1M1KU 4CJRA 3HRTA 2GCXA 2JVVA 4IO9L 2ME0A 2CWEA 1PJRA 5KE3A 4DR6K 2EBPA 2HF3A 5FWCA 1VQ7A 1WHKA 4XTUA 2RJDA 4EVVA 1TU0B 5GAEP 1ZHFA 1LNWA 2P9LB 1TBXA 5KRSA 1TV6A 2LX9A 1I94K 5GADP 3GG4A 2CP6A 3CXCS 1Q82R 2HL5C 5DCFA 2GBZA 4KBOA 1VQ6N 3FBIB 4M77A 4OAYA 2Q0OA 4JV5K 3BTJA 4MEYF 3I54A 1XC3A 4FJHA 2ZM6K 1AKHB 4IOAF 4PJOA 2EGCA 3LSJA 4LF8K 4DOWA 1RTDA 2PZ1A 3O1WA 3AO4A 1F9NA 2C6YA 3ULEA 4AHUA 1WEIA 3CDHA 2OFIA 2HWVA 3TQ7P 4L3QA 5CCAA 5DM6L 4XR6A 2V52B 5ICCA 2DXTA 5CJ9A 4XKCA 4HT9A 2WA0A 2NRWA 1Y64A 2K3XA 4W97A 1X1AA 1YJNQ 1NGJA 1M3CA 1NJIC 3CMEI 1B9FA 4N56A 1ATNA 1WNLA 3EL2A 5FPMA 1SRMA 2EFQA 2HBJA 4OPKA 5DM7L 2LZ6B 3I33A 4BRPA 2Q8KA 2DDBA 2V75A 3CDLA 3QYGB 5AQYA 4A3EJ 1S72I 4A3DJ 1B1BA 3V7RA 1YJ9Q 1CGPA 2YWWA 1W5TA 2PAVA 5DM7F 1S1WA 2VBYA 4Y91A 2P5LC 2HYGD 3ENBA 4JBAA 3UR3C 1K8AR 4FJ8A 2VN2A 4IHYA 1JJ2P 2RN8A 3VYGA 4S05A 1C1CA 2HKNA 3CQ8A 3LAJA 2QGGA 3O4QA 1PSEA 2W00A 2CGLA 3NAEA 1QQOA 2JK3A 3CCVA 3UKGA 4JKHA 2JWLA 1VSFA 1GLDG 5C3EJ 3OS5A 3OYBA 3QERA 1K79A 2GTOA 2I2LA 3ZRGA 5LJ3g 3NMZC 3J7ZI 2P9NA 4KDPA 3BDLA 3CC7I 2AQFA 3C7JA 3I55N 4EZ6A 4KHWA 1J09A 2OQGA 2CSIA 2VKHA 5IP9J 3S2DJ 3VESA 1Q7YO 3LSGA 2QA4I 4BC2A 4C2TA 4LDUA 1JKQC 3I3LA 4HNTA 4HF0A 2YHAA 3CCMI 5DS9A 1I5ZA 2B0LA 3FHFA 4BXUA 2A69F 1JXOA 2CP0A 4HW0A 2VUBA 4IBNA 3K2AA 5HRPA 3CC2I 4DS4A 3ABKH 1ZSZA 4YELA 3VGMA 4QKUA 2DYIA 3IWZA 3I0WA 3F5TA 5J1RA 3NH1A 3KD1E 1JBMA 3MEAA 3ZX3A 2ZJPL 3HKZA 2ZB9A 1EWRA 2VBXA 1VQ9N 3HP9A 2N8GA 4OLBA 2XV4S 5FLMJ 3AVMA 4PL8A 3HO1A 1WJSA 2YUNA 3EEQA 2PBIA 1YWOA 1HF0A 2PVGB 1T6SA 3OA6A 2FBXA 4CERA 2GZWA 4FWRA 4ICLA 1D0XA 3K4CA 2A5WA 2P5OA 4PUOA 2ABKA 1B72B 1MBJA 1U78A 4GGGA 2TDXA 5GAMj 3F8FA 5I2SA 1VQLQ 5I42A 3P9IA 2E5KA 3I9V2 1USTA 2P9SA 4GVMA 4BRAA 4KH6A 3JRGA 4DTRA 1B72A 4PLIA 3I58A 2HHTA 3ML6A 1G8XA 2R7WA 1Q1VA 2W4SA 1SMTA 3F8MA 2E5ZA 2QUFA 1B9NA 4K11A 2QASA 2IT0A 1XOVA 2EJGA 2VIXA 3HVTA 3CCUA 1Z21A 2E2QA 4BB7A 2R7VA 3L2ZA 3KNTA 4BD3A 1LOJA 1WFWA 3SWNB 2FBHA 2STWA 1D5AA 5BR8K 2XG8D 4GV9A 1A5XA 3BF1A 4M75F 3F9KA 2MC3A 3H3OB 1NGAA 4UC4A 5D8KB 4I9QA 3VFZA 1YFNA 5AONA 2H94A 5KI6A 2JA8J 3BFMA 1CSKA 4GY5A 3FXRA 3FGUA 3P9KA 2PG4A 3O9SA 3CCSN 2W41A 4CHYA 4JKEA 2E71A 4UB8C 1TGOA 3WTTC 3CCSQ 5HCKA 4B22A 4C8QD 1M1KC 3H8ZA 1U2VB 1R1TA 3R4KA 2HB5A 3P39A 3E0JB 4C8MA 4BJTA 2YRVA 3VF2A 4LB6B 2GOMA 3G71Q 4W5RA 1T8EA 4OMFB 4FLYA 3CCJQ 3GVAA 1BIZA 4DSIA 4ZH4F 3K0SA 2O4XB 3WXKA 2MK5A 1AWJA 3D5SC 1RI9A 2QSFX 3M0UA 1VQKI 3SYTA 1XGOA 2R57A 4BI4A 1VRLA 4GCVA 3VEOA 3CC2N 4EDUA 3CLQA 3CCUQ 4E4HA 3QWXX 2R5ZA 1U4BA 1BOAA 3L1AA 2X74A 5LJ5j 5GAN3 3ZX2A 1MWMA 3C7NA 3GBQA 4CC7A 3CTAA 1UTIA 2OTJT 1XNQK 1S3JA 2ZJ2A 4FE7A 5GTHC 3AVGA 1JHFA 2OA4A 3LA7A 4FM4B 3J80O 1UHCA 5J4VA 3QP5A 4M42A 4L5IA 2K5FA 3A4CA 2EFIA 4PWDA 3CCUT 1KFZA 4B9TA 4DUYK 4ATOA 5HK3A 4M3GA 3OYCA 1IHWA 4M75D 4DU4A 2VODA 3CFOA 3A5OC 3C2GA 1VQMI 2E1CA 4KGZB 2CH0A 4EW0A 1AOJA 1RAEB 4O5BA 1BIUA 2JNGA 1ZELA 2JSCA 4FJJA 2E70A 4FVMA 3CF5F 4J9CA 4UUTA 3BR3A 4M3ZA 2CT3A 1B3QA 1VSMA 3EYYA 2YJEA 2DMNA 3VYUB 4V2GA 1NWKA 4BC3A 4DLEA 4PDKA 2BY1A 4JPBW 1W2BS 1RT2A 5DK5A 1LV5A 2GXGA 4MZTA 4JI6K 3CCRT 3WT0A 2P9PA 2ZGZA 2FXAA 4HSBA 2E1ZA 5CHZA 3CCLI 3DBRB 1KYWA 2ZSIB 2L3QA 4J9BA 1B7TA 2R7UA 3QPHA 1FX7A 3IDHA 5H6QA 1X9SA 5E3OA 2FNPA 4RB1A 2M0OA 5AQLA 1XSDA 2Q31A 1W7PB 1ZAOA 4DFJA 3RI4A 3EPZA 3LWMA 3DV8A 2CUFA 4MZMA 3S1NJ 3WEEA 2O8DB 1DT9A 2BHZA 2RE2A 1QVTA 3AL0B 2COWA 1K9MR 1PVEA 3TSPA 4CJUA 3CJTB 4BG8A 1M1FA 1X3MA 4J8FA 4HWIA 1BCMA 4A6EA 1J5YA 3OS0A 3CETA 3EE9A 2GWKA 4O0JA 2FQ4A 1E2XA 1BA0A 2DQLA 1ZUYA 1JXEA 1U9OA 2O8XA 4IRIA 3TKYA 4O8KA 2XY7A 2LJ1A 1XDUA 5CLSA 2RMOA 4IZ9A 3KZYA 2OPRA 1KC8C 1XWLA 2JZ2A 1ZGAA 3J7AY 1D09B 1LDKB 3HSCA 4XEIA 4DQSA 1JLBA 3MMVA 2UUBK 1X6OA 2IGOA 3HZ6A 1UELB 1XDSA 5GAOm 1W70A 2QWLA 1EXQA 3RMAA 3CP2A 5EC7A 2K3BA 2QQ8A 5FKOA 1OYIA 2O9SA 1OQKA 4Z4IA 2F48A 4M78G 1N32K 5CQXA 2V26A 2E1YA 4KTZA 5CVRA 5ICFA 3ZQFA 1ABOA 4I02A 4M7YA 2NOFA 5DCMB 1K78B 5DUKA 2ASPA 1M27C 2ZQBA 4N4NB 3BY6A 2PX9A 4CEDA 4HHTA 4F52A 5H1SQ 1NGEA 2R7OA 3AL0C 3DLKA 2ZJRL 2O61A 2E64A 4O3MA 1W2BM 1UGRB 1WA7A 1WGSA 4NUBA 4FPBA 4DLGA 5FPEA 1X9MA 1FMKA 4M3WA 3G4SN 2L0KA 3GTLJ 3ZT4A 3BR0A 3U4LA 2FMLA 5CAIA 1FN7A 4DQRA 4N0BA 2EVRA 2DT5A 1WH7A 2HSTA 1Z77A 2HZYA 4DB3A 1Z1DA 2F5CA 2I0NA 2RV8A 1RKWA 1WN7A 3G0ZA 1OH5A 2P0WA 3R6NA 4KH0B 1JXBA 2YNHA 2OU2A 4MO4A 1Y56A 2RAEA 5D6XA 5KPRA 7AT1B 5ECAA 5CYQA 1GXPA 1L3TA 2HHQA 3L2QA 5LJ5g 2P5KA 2F5VA 1TWCJ 3KVGA 4U87A 1U8RA 3SZ2A 2J06A 4BHBA 4XBFA 2EQKA 2K85A 3CCMT 3LDPA 3FC3A 3QB0A 5EG0B 2R7ZJ 2K79A 2XF7A 2IAIA 4FOIA 2FF3B 1LEAA 4FYYB 2Z3YA 5ADXA 5HOOA 1NJXA 1EBMA 2BIVA 3S14J 3T8RA 3N4PA 5ERIA 2NRAC 2GM4A 1OR7A 1TW2A 4J2EA 2OUMA 1RLPC 2VYTA 1FW6A 2XHKA 3VS2A 2E1MB 1C0TA 3AA3A 4FZYA 2ISZA 1EX4A 1WSFA 2CW8A 2K3YA 4M7XA 5DLQE 3HOZJ 2EYQA 2BE9B 5KYYA 1C0WA 5M1KA 1KG4A 1ARKA 1XS9A 3X2QH 1PUFA 2QQAA 3VEYA 3CC4T 1D0YA 4ILJA 1KJWA 4IHTA 2KROA 1W2BA 3H08A 1VQOT 1RI7A 4ELTA 3J81K 3CMYA 1AU7A 3GPLA 4FJ7A 5AQIA 5KVRA 1JLCA 5AQUA 4A5AA 1VK0A 4B21A 3O3HA 1HSQA 2KRMA 4IQ4A 1BUPA 4BRNA 4WQ5A 5TJJA 2BKDN 4EMKA 3ZPLA 3A8LB 4OMYA 1TW3A 4NB5A 2EFWA 2YHWA 1O3SA 3AA4A 2Z0WA 4HBLA 3QHSA 1H88C 1ERDA 4BY7J 1OCRH 3TAQA 3M56A 4FM1A 3CMAQ 4EFHA 3EGDA 1NM7A 4M7AG 2KDOA 4E9GA 1ZG1A 2HR3A 4A3GJ 2OX7A 4DSFA 1TP4A 4NXNK 5IP7J 3H1CA 1N27A 2E3IA 1RNHA 2YX4A 3TL4X 5KQ8A 4LNPA 3H36A 3EUHA 4FYDA 2LMJA 4GY2B 3GF5A 4NC8A 2XY8A 3QO3A 4ZDLA 1ETVA 3K1PA 2JTFA 3L0QA 3M8FA 2V6EA 2QAZA 2LH9A 3RMSA 4WQ5C 4BGBA 4PJOD 1NG6A 3AGRA 4M77F 3VETA 1YE9A 1JTXA 3M1CA 4IVNA 2KBTA 4OIOF 2VKNA 2H8HA 2CSOA 2MIOA 2YXYA 4KHSA 5L3BA 2R5AA 3TU4K 4A54A 1JE8A 4FZXC 4LDWA 3K4MA 2UWMA 2QQRA 1GV5A 3JR9A 5F1RA 3CF5L 3NE6A 3BG9A 1O3RA 2A0FB 2NAZA 1Y57A 3DRSA 1D0ZA 1W7PD 3S3OA 4A62A 4HTUA 1ZRCA 3C0CA 3GNFB 1L5UA 3M3YJ 1TNTA 4FYVB 3S15J 1V29B 5HBMA 1R00A 4BQLA 3EGXA 2KW4A 2G3RA 4X65K 3TABA 2KAFA 3CPWA 1K4SA 3MP1A 1X2QA 4C8NA 4ZYDA 2XAUA 5CVVA 3L3VA 3CQTA 1GLJO 1FP1D 3CJ1A 4CECA 2Z9OA 3DB4A 3VEWA 5F64A 3WNEA 2HF4A 3J7AF 3MXJA 1VRTA 1MNDA 2DOEA 5KYUB 2RI3A 2QM1A 1TT5B 1YVUA 3CBPA 1W0HA 5CY4A 4ID1A 1S6PA 1RL2A 4YFXF 3EKSA 3K7AJ 5KAIC 2AT1B 4LXCA 4CD1A 5K1YA 1E4GT 3OYFA 2IIRA 1X1CA 5BQTA 3OYDA 2NYXA 2M5WA 4CZZA 2DA3A 1OCTC 4RLQA 2GUPA 2XI9A 1W36C 3S2HJ 4GBQA 3IKMA 2BBYA 2DMPA 2XAHA 3G71A 3BR6A 3J80E 1GV2A 2MCNA 2CGHA 4ZGDB 3RJPA 1IREB 1VQ9Q 2Q0UA 3IC7A 2IOCA 5HDGA 1QPMA 4CYCA 4Z2YA 4RM3A 4PLLA 3BEXA 3CC4Q 1A04A 4G7ZF 4DSJA 2JVHA 1GLBG 1YITQ 3MX5A 1MD0A 4A5NA 1A5WA 4PFZA 2ZD1A 4F7UA 4GYGA 4RWTA 1MDMB 2EGEA 4P1WA 3VRZA 2DILA 4ABZA 4E2FB 1VSEA 2KFDA 4LG0B 4M3UA 4PY5A 3A01B 2WV0A 1ZBJA 1LVKA 3KUFA 2P4WA 2ZAEA 3K9JA 2QTXA 1I1GA 4KKOA 3B6AA 2RDPA 5AT1B 1ZN2A 1LEBA 5LGNA 5KYWB 4IX7A 3GBGA 3ISPA 3RUXA 1Z26A 3BDUA 3MEWA 1QKXA 1X3NA 3DEWA 5M5XJ 5A2QK 1OYYA 1YJ9A 3UF4A 2HZTA 4BDZA 5K7ZA 4Q5VA 4G7OF 5KGWA 4G9ZA 4ZJZA 3DLEA 4M71A 5CKEA 2PMZN 2RGVA 3HTSB 2H3EB 2LX7A 5HLFA 2F4MB 1YI2A 3META 4LE9A 2L8DA 3BLYA 3BJAA 4XMYA 5FDLA 4O55A 3M1FA 4BY9C 1WZ2A 1IV8A 3DRRA 2HBWA 2DE0X 5D6EA 1SV5A 1QQIA 1Q81O 3VQ7A 2JHJA 3FB9A 3MJXA 4LN2A 2O0YA 2RF2A 2HHWA 1KO9A 4CVNE 3BR2A 1UG0A 4FM0A 2V8KA 1QSSA 1HNXK 1NK8A 1YITT 1B34B 2LC2A 3REOA 1MU2A 4H5TA 2BTTA 4KT6A 3NGIA 1SEMA 5HLGA 4IFYA 2JTEA 4XU0A 5B66C 3CXCP 1TT0A 3A02A 2DQRA 5FD6A 3TVTA 2BW3A 1Z6RA 4BC4A 3RR7A 1IBLK 1YQMA 1NZ9A 4M73A 3W3DA 3I5UA 1SSFA 3I55T 3QSUA 1RABB 3FK6A 1J3TA 3DEEA 4KISA 3LPUA 2XAQA 1QP2A 1V1CA 3KTQA 3EETA 5CKFA 2Z99A 1JUMA 4MHGA 5JICA 1MH4A 1QHTA 2V1XA 3D4VA 2L7FP 3A5NC 4XORA 1M2OA 2NUPB 3A03A 1R0BG 5KQDA 4KH5A 1NMNA 1XMKA 2L7MP 5LJ5e 5LJ5d 3OSVA 3M4YA 2EYYA 1ATSA 1VSHA 4KJZA 4F93B 2OTLT 4FWLA 3X26B 3LFUA 3RZOJ 4CEAA 4BUPA 1IGQA 1GT0C 4X1VA 3EH1A 2DOAA 3ZSYA 1PCXA 4EMKC 2HSPA 4KUIA 5E1ZB 5B8HA 5B3SH 3HKZN 4MLEA 2M8EA 4DHYA 3J80K 4JLHA 1WDXA 3CEYA 1AZGB 2D45A 4OB2B 3ULEB 4M3EA 2PJRA 2IG0A 4F7UF 3CCEA 4L6V5 4GV6A 4C8LA 1NGCA 2ZJPF 4ASNA 3RWUA 4CEQA 5F27A 3O4WA 4JD2B 4XQFA 5IAYA 2QGFB 2W6KA 4EAHD 2HD0A 1P4AA 1UJYA 2VC1A 3THWB 1RDWX 4B8AB 4G6TB 1SAZA 5C44J 1VQ7T 1WHUA 5BN9A 4N41A 3RKYA 3L4QA 3CJAA 3KLOA 1CF7B 3AVLA 1T2KA 1D3YA 3U6FA 4CCNA 1C1AA 3T1YK 3OHRA 4ENKA 2GIZA 1RESA 2KRSA 4PJOC 2MBFA 3A0BC 4M77E 1VQNN 4PIIA 4HCBA 1JGSA 4QAGA 3TW7A 3ISNC 4XSZF 3HM9A 1N9RA 4J2DA 3T8TA 4AIHA 5E17F 3GTOJ 3O9QA 3SFZA 3VQAA 3T9NA 4YTLA 2GA2A 5AQHA 4AYBN 4FIBA 2JT4A 4R5PA 1HKSA 2XDVA 2E2HJ 3BCBA 1P4WA 3J7YP 2DFFA 2YS9A 1OPKA 3T5XA 1JLQA 4JD2A 3AKZA 2EV5A 3ZXSA 5DM7R 3ENOA 3PGGA 1NK6A 2A68F 2JTVA 2PYJA 1NK4A 1LE8B 3GDQA 2DU9A 4B9LA 3OYKA 1KG3A 4U7BA 4J9GA 2BE7D 2MFZA 3BR5A 5KCOA 3G4SA 2DN0A 1S1UA 3MKYB 4DZPA 4YDUC 3TU5A 1RAAB 4DR5K 3CWTA 3KFVA 1JUSA 2VBZA 4C1NI 2L0AA 3SK3A 3D7EO 1NLPC 1TNSA 1T95A 2L4MA 1RRJA 1D1BA 4CJFA 5GAN6 3FR0A 5GADJ 2BE5F 1Q7YU 1OH7A 1NJIR 1I6HJ 1E17A 2OFKA 2DJZA 1UDLA 3ZSQA 4KYWA 3OS1A 3ZEHA 4CJKA 4DEYA 4NQWB 2HGCA 3CCLA 3OVNA 4CYCB 4Q4ZF 1R49A 5BMZA 1U04A 3X24B 2RREA 2VASA 3K5MA 1I4K1 3LM2A 4F7UE 2NOLA 1VQ4T 5KNLA 3P31A 3KLHA 1Z0XA 3V8JA 2YHBA 1W97L 1JKRC 2XC7A 1VSIA 1NU0A 3H3UA 2UXCK 1YAGA 3Q9VA 3GZ6A 1VQPI 3F8CA 1Y71A 2EWNA 3EH2A 3K9TA 5EVZA 2FQ3A 4D7NA 5FKKA 1SKSA 2VQLA 3RPUA 2GFAA 3GXOA 2BZ8A 1VQ8Q 2K5IA 2X3XD 4ISEA 3VWBA 1RDCA 4DQQA 1YCYA 1GOAA 5HNHA 4G8XA 5IOYA 1LMZA 1IG8A 4JJDA 5GAN8 1Z7LA 3BE3A 4J9DA 1M4ZA 4CZFA 2OANA 1VYUA 4WWCA 4C92G 2JPSA 3OGDA 1ZQ3P 2BUPA 3VQ8A 4D8KA 4DU3A 3D6RA 1BDGA 3H5AA 2R0QC 4BU2A 1JLGA 3O8VA 1TQMA 5LLQA 2HDDA 3RRHA 2CQXA 2VE9A 3PQKA 2C0TA 1A36A 2WACA 3C3WA 2CKKA 1D8YA 3UB5A 2P4TA 3ONQA 3O9RA 5E26A 3ZT1A 3E6CC 3PVQA 4BS9A 2BGCA 5DMRA 3DLHA 4NCBA 2DD4A 1TWBA 5FU7C 2F6CA 2JA6J 1ETOA 4AUXA 3DLRA 5GANh 1MDUB 1XCBA 1RAHB 5DCMA 4P55A 1U3EM 1M2VB 4M77D 2XGEA 1Z3XA 4ELYC 4EJWA 4DV3K 5GANe 2QWRA 1GLAG 4GKKK 4FISA 5LJ3h 3JCMf 2WC2A 3MECA 1KQSM 2I5UA 3VQCA 1ZTRA 1ETQA 4F14A 1T98A 1HQUA 5AQXA 3SWNC 1BJAA 1JO8A 2QGUA 4EHTA 3LDOA 2Q97A 1UCRA 2CFXA 4HUEA 2XK0A 4MFDA 4H0TB 3PVLA 1OYXA 4EGZA 3PUFA 1L3VA 5FGMA 3TDUC 3I56T 1X6BA 1QSLA 2H56A 3PNWC 3HRUA 3L2WA 3QU3A 2MW8A 3K1MA 1I81A 2BZYA 2QYZA 2OQRA 3QKJA 2M9UA 5C2DA 3M9QA 1ZG5A 4NLBA 4QS7A 3CCMA 5K5QA 4N76A 2ETHA 5LGUA 4RS8A 3Q7CA 1VSJA 1PP8F 1CLQA 3PIOF 3OTOK 2OPTA 2X9DA 2NYSA 1YTAA 4H5NA 3QG1A 1NGIA 3U23A 3G6ET 4Q5SF 3LDNA 3KLNA 4BR4A 2X51A 3IWFA 3J81O 1PUFB 1BIBA 1TAUA 3SEQA 2CFOA 3VKIA 1WJFA 2P81A 2HQRA 3M4OJ 1ESVA 4J6WA 1S5LC 1J54A 2AKKA 2KIMA 2IS4A 4IEJA 4F9OA 3BPVA 2XY6A 1DU6A 2JXBA 1KONA 8ATCB 2D1KA 3E9PA 1KG6A 2FZGB 4IXAA 1QZZA 4H4OA 4PJNA 3SDGA 2JJ9A 2FXUA 2QXFA 3TAMA 5AZIA 2GEMA 4CEFA 3V9XA 2RN7A 4FW2A 1YTUA 3BG5A 2GXAA 3NEUA 3FXLA 2VB6A 3GLLA 5ILVA 1D1AA 3VJPA 4DCHA 1QQNA 2P0KA 3K5NA 5GTIC 2M4KA 2CZ0B 3QZ5B 4KPYA 5DD8A 1YHQA 4E3SA 1VQLN 3I4PA 4CC3A 3S8PA 2G8FA 2XHBA 3VRYA 1TZLA 1GLFO 3W6VA 4XK8E 4BY6B 2X35A 4DTXA 3C95A 2GQIA 2QXLA 3IUCA 1SKRA 1XG1A 4DFKA 2ETJA 5CR2A 2VPLA 2VV5A 5M1QA 4L59A 1R4MB 1QBJA 2RQRA 3ESWB 1J5OA 2X4HA 2KTQA 1XC5A 3DCFA 1OLTA 1JL2A 3O9UA 4YOQA 2DA4A 2GAUA 5M1PA 3HG9A 4B9SA 3C1DA 1RTIA 4Y92A 1X69A 2NVQJ 1BYMA 5IT9O 1MHNA 2LK2A 5B1BH 3AAPA 2W82A 3PFIA 2ZNZA 3VPRA 3EG2A 4CF1A 2MGQA 4DMNA 4MDBA 4UUSA 4RGRA 3ZL7C 5IT9K 4B1VA 3M57A 2ZGWA 1UHSA 4FCYA 3T19A 3CMEQ 3C65A 2RPNA 4BHPA 1WJQA 2KDSA 4CJPA 4GXOA 1RETA 2X6SA 1YS6A 5TGTA 3ATUA 3HP6A 2V51B 5HY6A 3G25A 4R1HA 4M74A 1XQSC 4BRFA 3MP6A 1MWKA 1SVOA 4HCKA 2GWJA 5EY4A 3RSEB 3CCQQ 4U0YA 4I76A 4JI3K 3AO2A 5B1AH 2YLBA 5JVGL 3SDZA 5FKNA 1CQTA 2M87A 1P59A 4LF6K 4M4ZA 2D0OA 5GMKh 1SL1A 2LY1A 3PIOL 2G7HA 4UB6C 1Q82O 1AT1B 4X1EA 3MEXA 4HXJA 3KX2A 4N4HA 4JS4A 3REBB 1N36K 5FROA 4FWQA 1H9GA 1M8MA 2BDPA 4E6RA 3F72A 1RBRA 2GLOA 2HQXA 2F4VK 3RZDJ 2DXBA 4ZDPA 3MMYB 2EV0A 2DL3A 3AG4H 3WEEB 2Q2EB 1VF9A 2K02A 2CGJA 4BR7A 2P84A 1WYXA 4Y7NJ 2KFZA 3TCJA 5AQKA 4F7UB 4LF5K 1VQLI 1JT0A 2EZLA 4P9FA 3ZETB 1FT9A 3CPFA 3M0RA 2JM9A 3SMSA 3GTKJ 3JSPA 2DW4A 2D4WA 1NJIO 2H8RA 4Y33A 3CCQN 2VG7A 1FY7A 1OCPA 3PM1A 1OYWA 3KP7A 3VERA 3GE1A 4B9NA 1S7OA 2M4GA 2RNJA 3ZQCA 3TTCA 5EEGA 4AIDA 5GAGP 4JI1K 1IJWC 1IDZA 2JPBA 2V79A 2A41A 2IRFG 1L3UA 1NMDA 1HW5A 1BISA 1NEGA 3O3GA 4NCGA 1B4AA 3OL4A 4H03B 4DK9A 2E36A 1AEYA 5KYXB 5DEQA 2X6OA 3KIOA 4BHCA 2V4JC 4M75A 1GOCA 2IPOB 2ASOA 4M41A 3L8BA 3CQXA 2X48A 2RHUA 1NGDA 1K8AU 4ID5A 3MN9A 2JN0A 2A7YA 2K9MA 1A6IA 3I4NJ 2OAWA 2GA1A 3S6IA 3RYRA 2MH2A 1KC8O 3PTAA 3JTHA 3LPTA 1IN8A 3FXQA 3B6OA 2H6CA 5LBQA 3OYGA 1UECA 3AFHA 1EV7A 1T8IA 1WI3A 2XO7A 3NFAA 5KYUA 1U06A 2JHNA 5AN4A 4IG3A 4B9XA 4CJQA 4FJGA 5ILUA 3RDIA 3WE2A 2O8CA 1LWWA 1Q7YC 1I27A 2CZ6B 2QZ8A 4M75C 5GIOA 4BWJA 1SF9A 2OPQA 4DJAA 1K1ZA 3VU3C 1KFDA 2AZSA 4B9VA 1LB2A 4OMNA 3SAGA 4BEHB 3CPWS 4DWIA 2DAOA 1K7AA 2GUIA 1MNEA 4A3BJ 2I7NA 2FSKA 3V1QA 1S7AA 1IRZA