4BACA

Prototype foamy virus strand transfer complexes on product dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Assembly of Prototype Foamy Virus Strand Transfer Complexes on Product DNA Bypassing Catalysis of Integration.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 82
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bacA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bacA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bacA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bacA03
3QBYA 4JRPA 1DTTA 2FBYA 3OYHA 3K57A 4E7LA 1CZBA 1U4BA 3QJ6A 1S1WA 4IFYA 4E19A 3AA2A 1EXQA 4CEFA 4N76A 4ELUA 3TAGA 1YTUA 2WACA 4CF2A 1HPZA 3AVMA 4Z4FA 3D45A 2WOMA 3IRXA 4DSLA 4E3SA 1NKEA 4FW2A 3OA6A 2GV9A 4B9LA 2MWOA 2ZQBA 3AVGA 5DMRA 5J2QA 4ICLA 5J39A 1S1TA 4DSIA 2L89A 2LDMA 3K5LA 2B8AA 4FCYA 2B5JA 3MEUA 3WNGA 1ZBFA 2GFUA 3ZSYA 3LH0A 1NJYA 4YFUA 5FRMA 3DLKA 1U45A 4FVMA 1HYSA 3S6WA 3AO2A 4M3WA 4FM2A 3SD4A 3M9QA 4Z4EA 3OS0A 1C6VA 3O3HA 4LD6A 2YKNA 4DWIA 4N47A 4FXDA 3LAKA 2G8IA 3TAMA 2HW3A 4IFVA 2VWJA 4OJRA 3RMBA 3L3UA 2HHTA 2L3RA 3OYEA 4CFAA 1L3TA 3OMCA 1J9AA 1VSHA 1EKEA 2R5MA 3UT1A 2P51A 3QNOA 3DLHA 1UA0A 4DTPA 2OPSA 4Y1CA 1VSFA 4KI6A 1WNSA 1RT2A 3P8DA 4CF0A 3K5OA 2RI5A 3OYIA 4CHZA 2F5KA 1WN7A 1KSPA 4CEBA 2ZE2A 4DF8A 5KCHA 3DRPA 4QVZA 2OZSA 4E7JA 1LAVA 2DAQA 1DLOA 4B9VA 1SL1A 4A4HA 4DU3A 1WAFA 1JLCA 4EP5A 3FEOA 1TKDA 3KKRA 1XNIA 3VQ8A 5DK5A 2OZMA 5CYQA 2X4XA 4DTNA 2IOCA 4CHYA 3L8BA 3LWLA 1ZBUA 2EKOA 4KO0A 3E9GA 5KGWA 4I2PA 1B92A 2B6AA 4OKJA 4O0IA 2FC0A 2X78A 1SV5A 4DG1A 3OS2A 2IDOA 3ZT1A 1Z26A 2DTUA 3O8VA 4DS4A 3HPOA 1HRHA 4FJ8A 3KD5E 4DQSA 3KLHA 3QEWA 3S9HA 3NFAA 3NTIA 4LY7A 3TAFA 4F3TA 4RW4A 4CJWA 5CIUA 4QOZB 2VG5A 3PUFA 4PLLA 3RR8A 1Q9YA 2HHXA 3AVIA 4WE1A 1RDCA 2O4IA 2OPQA 4DTSA 1BCMA 3RRHA 1WSEA 5I3UA 2D0BA 1UA1A 4KB1A 1IO2A 4BE1A 1TAUA 4CHQA 2XY8A 1C1AA 1T7PA 4FJIA 3V9UA 1A5WA 4FJHA 1WSGA 2L8DA 1QHTA 3OYAA 2YKMA 3TAQA 1WJRA 3I0RA 4M3UA 1NK5A 4CGHA 4HCBA 5J2NA 2LCCA 5D6YA 3NGZA 3LP0A 2RJCA 4Q5VA 4DSFA 1KRPA 4E7KA 3LYIA 3NDKA 3OVNA 3ME9A 3QLHA 3AVHA 1H3ZA 4BDPA 1KVAA 3MP1A 2JGUA 4LD0A 3PMIA 3S3MA 1X1PA 2Z1JA 3T19A 3OYLA 4HVJA 5I42A 2DIGA 3V9SA 3AVFA 2RJDA 1XC9A 3ZEHA 4FL6A 4DF4A 4BDYA 4CGJA 3VQAA 5KE2A 1CLQA 3VQDA 5C25A 4CEQA 1N5YA 2P5GA 2R7YA 1XI1A 1S1VA 2PQWA 2EQKA 4CFBA 4ID5A 3LWMA 1NK4A 4CGGA 2HHVA 5HROA 4Z0UA 1JLFA 2P5OA 2AJQA 3QERA 3HJFA 5HRPA 1BIUA 4HCCA 2OPRA 1ASVA 3LPTA 5J2PA 2RJEA 2A1SA 3SQ4A 4KREA 4B8AB 2M16A 2R58A 4DFJA 4CECA 3TAPA 3EZ5A 5D3GA 1X9SA 4EDUA 3RMCA 1A5VA 3SUOA 1UWBA 4CJLA 1HNIA 3KLGA 3OS1A 1FXXA 1MHNA 2BGGA 4DTXA 3TI0A 4FJ7A 3OYDA 2BUDA 3S3NA 5JS1A 1NOYA 2RHXA 1U48A 3SQ2A 4O4GA 1BL3A 3DI6A 3H08A 3U3YA 4CGFA 1YVUA 3MXIA 1WLJA 5D6XA 5CZ1A 1OZ2A 1QSLA 3V9ZA 4W5TA 4Z02A 2G8KA 3D0PA 5FROA 4KI4A 3LX7A 2DY4A 1QE1A 1U49A 4MQ3A 3ZSQA 3K58A 4LSNA 3OYBA 4FJNA 5J1EA 4IG3A 4FK2A 3AO3A 2DFEA 4CJRA 3OJSA 3LZJA 4CEEA 5KRTA 4PL6A 3LP1A 3NF6A 3MEGA 4BWJA 4EZ9A 4AHSA 1J5OA 4CJTA 4DMNA 2HQXA 4DQPA 4DSEA 1C1BA 3Q1JA 4Q5WA 1TKZA 2OYQA 3MXJA 2O4GA 4C5IA 3T1AA 4II1A 2YHBA 3VA3A 3P5JA 4N56A 3NTHA 2RKIA 3VQ9A 1RILA 1ASUA 4DFMA 4NCGA 3B6OA 4IKFA 1C0UA 1Z25A 1ZYQA 4QQ6A 3M8RA 4A4EA 4DTUA 4K8ZA 1GOCA 4FJ5A 4IUTA 3I8DA 4GMJB 1N27A 1OZ3A 3NNQA 1X9MA 5CY4A 4J2EA 3L42A 1C1CA 3HT3A 3AVBA 4AHVA 2YHAA 3LPUA 1JLGA 4CGIA 1K6YA 1LV5A 2EQMA 3RTVA 3TR8A 3AVJA 3BGRA 4L8RB 1TL1A 4I7FA 1C0TA 3OJUA 4OPKA 2ITGA 1TL3A 5HRNA 4AH9A 4CJKA 3HPGA 4NYFA 3PO4A 4OLBA 3EAEA 3ALYA 4CRIA 3HK2A 4CJFA 4FLTA 3S3OA 5SZTA 4DFKA 3LP2A 5HLFA 1TGOA 2IGIA 1VSLA 4CERA 3ZSRA 3RWUA 4BDZA 3C95A 5IN1A 4O0JA 4FJ9A 4FLZA 3PX6A 4FK4A 4NS5A 4F2RA 2M1HA 4LSLA 1TVRA 2HHSA 3DLBA 2HNYA 1NKCA 4CE9A 3SPZA 1OYXA 4N5SA 4PLIA 2RHYA 4FJGA 3K5MA 3MEDA 2Y1JA 4NZGA 1GOBA 2YNHA 2KFZA 3DRSA 3MO8A 4E7HA 2HMIA 1TKXA 1KLNA 3AVCA 2YNGA 2RN2A 5KRSA 2G8HA 4O44A 4IUUA 2I5JA 1I3AA 2XRIA 3V9WA 2RHIA 4PY5A 3L2QA 1YT3A 1L3UA 3HP9A 4ELVA 4H4MA 1D9FA 5HP1A 3SQ0A 4AHRA 4FJMA 4CEOA 3M8QA 3ZT3A 4CK2A 3FC3A 1XHXA 1VSJA 1Y97A 4B9NA 3HYFA 2GBZA 1VK0A 4KFBA 4FU6A 3TWHA 3ISNC 2VYTA 1CXQA 3BDPA 4DQIA 1BCOA 3AVLA 4E0DA 3AA5X 4Q0BA 3OY9A 2E6MA 5KI6A 2Y1IA 3SV4A 3C94A 2RO0A 4J2DA 4QCLA 3WNEA 5C0MA 3HP6A 5JS2A 3LAMA 4FJKA 1TK8A 1JXBA 4Z4IA 1KLMA 4KHQA 2NLUA 3KUFA 1L3VA 2LRQA 4FYDA 1TK0A 4CCHA 4CK3A 3C6TA 4CEAA 4B8CA 3RRGA 4CJEA 4C5HA 1S9GA 4HUEA 3TAEA 4FLWA 5KGXA 2EQUA 3IG1A 3DYAA 1R0AA 3QINA 4CGDA 4IG0A 1HYZA 4CFCA 4OKEA 1S9EA 5KCOA 4C8LA 1JLEA 4PUOA 3TABA 2OPPA 1JLBA 4BD3A 4F2SA 1RBTA 1KVBA 4JS5A 1EX4A 3ZSOA 1S6PA 1RNHA 5K14A 4LH4A 3CM5A 2VG6A 3KLEA 3PV8A 1RT1A 3VQBA 3KIOA 4LH5A 3MAQA 1UOCA 1HJRA 1BGXT 4O5BA 3HSTB 5D6WA 4QW2A 5CZ2A 1T8EA 4HCZA 2HHUA 4IUVA 1TKTA 3QEPA 1VSIA 3DLEA 2O4XA 4E7IA 5SWMA 1IG9A 4PWDA 3NE6A 3VQEA 1BQMA 2K3YA 3DB4A 4F3OA 2HNZA 3NHGA 3WNHA 4IUQA 4M3ZA 4N4GA 1RTIA 4KRFA 1RCHA 1HQEA 1ZBHA 3BDLA 3K2PA 2F96A 2RF2A 2XO7A 1IKYA 1YTAA 1G15A 3QIOA 4OGCA 4GY5A 2G3RA 4DU1A 3VQ6A 1NOZA 2VWKA 3NH2A 4KHNA 2OA8A 5FDLA 3VN5A 3LDSA 4FM1A 3PO5A 4FM0A 3ZSXA 2IAJA 2KFNA 4FZXC 2FBXA 3VQ7A 2Z1HA 4M45A 4ELTA 3O3GA 4AILC 4FW1A 3G0ZA 2XK0A 3WNFA 1B9FA 2F8TA 4ZTFA 2O4XB 4CIEA 3IS9A 3NAEA 4FLVA 3RMAA 1QTMA 4AHTA 2QKKA 2PY5A 3EY1A 3LLRA 3V4IA 4ID1A 4HHTA 3OYJA 2GF7A 4W5RA 4DLEA 4I9LA 4DQQA 4CJ3A 1RT7A 4GVMA 3L3VA 5CYMA 1RT5A 2G8VA 4W5NA 2XHBA 3PY8A 2VG7A 2RI2A 1KFDA 2HVHA 1FK9A 3JYTA 3U3GA 4QQDA 3SV3A 1L5UA 3AO4A 4Y1DA 3V1RA 2KZMA 4KTWA 3OYMA 2X35A 4OLAA 4E89A 3META 2R5AA 3G10A 1BHLA 4A4FA 1S5JA 4IURA 4RW8A 2LSNA 4TSXA 1J53A 5HBMA 2FBTA 2BE2A 4OPJA 2E5QA 4N41A 3ZT0A 3ASMA 4C5EA 1VRUA 4KTZA 2PYLA 4H4OA 3ULDA 3MEWA 3DLRA 4KAZA 5FRNA 1XWLA 3NGYA 4UQGA 3V1OA 4CJVA 4N4HA 2PYJA 2Z1GA 4CJUA 4XIUA 3KTQA 1SL0A 1IH7A 4C8KA 3KK2A 3CFRA 1S6QA 1L3SA 3FFIA 1QS4A 3DOKA 3OYKA 3H6ZA 3ZT2A 1JXEA 4B08A 1ITGA 1W9HA 2JZ2A 3B6PA 4L59A 4OGEA 2KTQA 3PFSA 2YRVA 2ATQA 2F8SA 3KD1E 1WSHA 2RJFA 2HHWA 1NJWA 4KHWA 2GFAA 3I0SA 1B9DA 4BE2A 1WSIA 3CYMA 2DFHA 4M41A 2MWPA 3NGIA 1KCFA 3CFOA 4C5GA 1SSFA 2FHDA 3HPHA 2Z1IA 3NH1A 2D0AA 4M3RA 5C6SA 1LWCA 3SUNA 4FJJA 1UAXA 1QSSA 5HRSA 2BIVA 3QIPA 3M8SA 1JLQA 4DU4A 3CQ8A 1GOAA 4JS4A 5M9OA 1RT4A 3V9XA 3GOXA 2EHGA 3SQ1A 4BWMA 5J2MA 3MEEA 2B4JA 1Q9XA 3QEIA 2G8FA 2HNDA 3UIQA 2RHZA 4RG2A 4M42A 2QKBA 2HHQA 4QAGA 2D9TA 1WJSA 2XY5A 4FJXA 1CZ9A 1KHCA 4FLXA 3SCXA 1QQCA 3DM2A 2GUIA 2YNIA 4CJSA 2P1JA 2DIQA 3KJVA 5KE3A 4B9TA 4DS5A 2BKDN 2X6NA 1WSJA 4NYNA 4IBNA 4CEDA 1LWFA 2K3XA 1EP4A 1RT3A 2IG0A 3NF9A 4DFPA 4B3OA 4PA1A 1NK8A 3F70A 2G8UA 4RW6A 1IKXA 1I39A 4KHSA 4B9MA 4JLHA 3VQ5A 3AVAA 3LZIA 2LVMA 1NKBA 2KQ2A 3SYZA 3OMGA 4C8NA 3IAYA 1TK5A 3OB9A 2RPIA 2QK9A 3CFPA 4NCBA 4OVLA 2EX3A 3SZ2A 4BE0A 3SI6A 3HVTA 3F9KA 3P83D 4DTMA 3AO5A 4X34A 3MEVA 3ZSVA 3P8HA 4CIFA 4YNQA 1RBSA 4DTOA 3OYCA 3L2UA 3LP3A 4CIGA 3C4SA 3DRRA 3PMTA 4FK0A 1HMVA 4KKOA 2KW4A 4CF1A 1NK6A 4OKKA 4KB0A 1RDBA 4JRQA 3NBPA 3DB3A 4ZHRA 4FZZA 4KPYA 3VQCA 3SUPA 4FLUA 4CHNA 3SPYA 3C6UA 1N6QA 3SNNA 3DOLA 1O1WA 1W0HA 2E6NA 2X74A 4I2QA 2P0KA 4M3YA 3HM9A 3KLFA 4DSJA 4RG8A 3K59A 2XDPA 2R57A 1RTHA 4G1QA 3JSMA 1BIZA 4Z4GA 3AA3A 4HUGA 4A4GA 4M3TA 4B9WA 1S1XA 2RHUA 2DFFA 3CEYA 1HQUA 1RDDA 3NCIA 1BQNA 4AHUA 4FLYA 1SL2A 3PNWC 1RDAA 1RBUA 3VQ4A 3QIIA 1G5VA 3PX0A 3ITHA 3NH0A 3V6DA 3QO9A 1RBVA 3LALA 1S1UA 2LTOA 4CEZA 3QESA 1QSYA 4EZ6A 3NTKA 3FDRA 1ZBIA 3HL8A 1EETA 2JLEA 2RI3A 1JL1A 3NF7A 3HVRA 1WJQA 3V1QA 3L2WA 2E6LA 2XY7A 1JLAA 1XHZA 1MU2A 3L2RA 3MP8A 1IKWA 1WAJA 3SJJA 1D8YA 1U04A 1NK0A 1FKOA 4PQUA 3KK3A 1JKHA 2EQJA 2IC3A 1J54A 5HRRA 1VSEA 1A5XA 4IUPA 1RTJA 1C0MA 1KTQA 4CK1A 3U6FA 3V81A 1OI1A 3A2FA 2Q3SA 3AO1A 3E01A 4FZYA 4MFBA 3SUQA 4IDKA 1LW2A 3EYZA 3P1GA 2A1RA 3NF8A 1FKPA 1Q8IA 1REVA 4K8XA 1NJZA 3QEVA 3F73A 4DTRA 4M3XA 1X9WA 1ASWA 3KK1A 1VSKA 3DLGA 4B9SA 1BISA 3QEXA 3LANA 3O4NA 2HQEA 3T3FA 5KTQA 3HXMA 3O4QA 5C42A 1NK7A 1ZBLA 1HNVA 2X4YA 3O3FA 3OYFA 3L2VA 3TANA 4O55A 2E4LA 4F4KA 1KVCA 3VA0A 2X6SA 4HTUA 4E1NA 3ZSWA 3DMJA 3UWNA 4DSKA 4UC4A 1VRTA 2ETJA 3AV9A 3QKJA 5J26A 1LWEA 4CF9A 3MECA 2M0OA 4RW9A 2HB5A 4FJLA 1U47A 3KKSA 2CKKA 1RBRA 1BI4A 1WSFA 3PX4A 4CJ4A 3AA4A 1WGSA 1F21A 1SKRA 2X4WA 1HYVA 3OYGA 2NUBA 3DLMA 2IS3A 1RI0A 4KTQA 4CF8A 2YV0X 2QXFA 3THVA 3ZCMA 5E41A 3E9FA 3QETA 2D5RA 3ZSZA 3MEAA 4BACA 4CESA 2EFIA 3OYNA 4Z4HA 1IKVA 1LW0A 2YNFA 3HO1A 2JTFA 4N4IA 3KLIA 3AVNA 1JL2A 3FLGA 3ASKA 1SKSA 3ZT4A 1SUQA 1D9DA 4J2AA 4CJQA 5EU7A 4QQGA 1D5AA 4I9QA 1RTDA 1NJXA 4R5PA 1RT6A 2D0CA 3VQPA 3MXMA 3RMDA 4KV8A 1TV6A 4HUFA 4NCAA 4DQRA 3LGLA 1BI4B 3CM6A 4CJPA 2QQRA 2QQSA 4OVAA 2BANA 1CXUA 4ZTJA 1T03A 3OQ5A 4CHOA 3RR7A 1SKWA 2G8WA 3TARA 3M8PA 4DLGA 4W5QA 5KH6A 4J2BA 2FBVA 3QNNA 3LGFA 4W5OA 2XY6A 2HVIA 5T7BA 4KHYA 1DTQA 4H8KA 1LAWA 3K5NA 2ZD1A 2W42A 4KHUA 4CJ5A 2KZZA 4GW6A 4Z4CA 4F8RA 2WONA 1T05A 5C24A 1VSMA 4EP4A 3H8ZA 4AHCA 4B9XA 4RW7A 3AVKA 1NK9A 1KFSA 1VSDA 3CG7A 2PZSA 2BDPA 4C8MA 4B9UA 4E1MA 5IAYA 4DTJA 4CFDA 3MP6A 4CHPA 4C8OA 1TAQA 3VQQA
chains in the Genus database with same CATH superfamily
3EUAA 1BJZA 1WWXA 5C44J 5D5XB 4JRPA 1JKPC 1NM1A 3C12A 2CUEA 4ISGA 3VEVA 1GUUA 2VE8A 5DTDA 3WTYC 3P4IA 2CV1A 4DR1K 2VJJA 1U4BA 5LJ5f 2NVUB 5DM6F 5JR3A 2O5RA 2EVRA 2R7FA 1FOKA 3AARA 1EXQA 2HKXA 4PUSA 4XTXA 4RTWA 4D8KA 1XQHA 4XBFA 1H9GA 4C9YA 3AVMA 2QQAA 3AKZA 1UGQB 1UGRB 2XG8D 3RNJA 4YDUC 1SFKA 3CCEQ 1NKEA 4LN2A 2TRTA 3OA6A 4FWLA 5ICFA 5DMRA 4RGXA 3M0PA 2GBYA 1FTZA 5J39A 2RNAA 4DSIA 2NYXA 4S0HB 5LLQA 5IT9E 2LDMA 5L8RE 4RS8A 3T5XA 4FCYA 4KMFA 1VQPN 1I4K1 2CT3A 3R6SA 3MEUA 4LFUA 1K0XA 3CCRA 3LH0A 3QMLA 2A0FB 1GLAG 2XF6A 1W0TA 4LF8K 2FSNA 2EINH 5C10A 4KGVB 1TP4A 3S6WA 4C3JJ 3AO2A 4KN7X 1O13A 3V8LA 2GLOA 2AXTC 4Z4EA 1LB2A 4ESBA 2YRDA 1C6VA 3O3HA 2LFBA 3TEEA 4E6RA 5AQKA 2YKNA 4S04A 4HEA2 1C0WA 2HQNA 1YNZA 2OU2A 1U8BA 2O9LA 3UDCA 3UF4A 1QP3A 3JV3A 3ZXSA 1DT9A 4B3SK 2HW3A 3QSUA 4C8QC 3FZFA 3A1YA 2XRNA 5E1WA 4CCJA 3VESA 4R0KA 5L3BA 2MFZA 5FLXO 3LM2A 2SRCA 3L09A 4M75B 1NMDA 2E1OA 4B09A 4DTPA 2O9VA 5IHKA 2XPVA 2E65A 2M9UA 4JKHA 1LCUA 3EG9A 3K5OA 1MZBA 3OYIA 1OKRA 5M3MJ 2QM1A 2OD5A 4LGWA 3A98A 1QP2A 5KCHA 4QVZA 4LOCA 2OZSA 3SZTA 2P9PB 4F7UF 1XQSC 3LSTA 4YTLA 3JREA 2X9DA 2CW8A 1DLOA 3PNYA 5LJ5d 2FBHA 1WAFA 2MGQA 5HS8A 3EG0A 3FEOA 5D8LB 2NRRA 1WXUA 1VQMQ 3CHWA 5DK5A 1NGDA 4F7UE 4LB5A 2D1VA 4A3FJ 4LF7K 2XSDC 4J9HA 2CG4A 2MH2A 1X1AA 1X4OA 2EZHA 3LOCA 1QKXA 4HDUA 4BRMA 3L8BA 2VC1A 3R2XC 2EIJH 1B92A 1HXDA 4C8QF 2B6AA 4OKJA 3F8NA 1KC8C 2CW0F 4DA4A 2XC7A 2L3PA 1UZCA 3C7JA 2ZPFB 1N9RA 2A6AA 3W6VA 3CCRT 1AWCA 5LJ3g 3OS2A 1ZLKA 3EH2A 5GAMf 2FE3A 3ZT1A 1NH3A 2DTUA 4FYYB 2DL8A 1R5GA 1GL5A 1HRHA 2OQRA 4OB0B 3KD5E 4DQSA 1BC7C 2BE9B 3HFNA 1D0YA 3TAFA 4LY7A 2D5VA 5J47A 3GYHX 1WHHA 5CQYA 1YWPA 2ZBKA 2NS8A 4IOXA 1BM9A 1YHQN 3K4BA 2NRAC 1N5ZA 1N3AA 3VSKA 3KFWX 2E5LK 5KVRA 1ZH5A 2PX9A 3AVIA 3MQ0A 3SEQA 1WSEA 1YJWI 1HKTA 7AT1B 4MO5A 1UA1A 1LEAA 1Q81O 1IO2A 4EW0A 3GBTA 3F8BA 1M90O 1JU5C 1C1AA 3I5SA 4FJHA 1JEGA 2WA0A 1OOTA 1W36D 2L3SA 1WSGA 3OYAA 3TAQA 4M3UA 3H0IA 2DJNA 4QWQA 1DP3A 2GWJA 4J9GA 2LCCA 4CJ7A 1W5TA 4Q5VA 4DSFA 1KRPA 4RB0A 3M8EA 3QDKA 4MFEA 3V7SA 3AVHA 6AT1B 2WTEA 2FMYA 1QVPA 2JGUA 3UKRB 3BQYA 3IV5A 3OYLA 4IX7A 2QVOA 4N9IA 1I07A 4BBRJ 5IOYA 1M4ZA 3G71N 2F9TA 5GAMh 5KE2A 2A5WA 3GUDA 1CLQA 3GBQA 4QS8A 2FRYA 3A03A 3UNGC 5JVHL 2Q2EA 2MPXC 2P5GA 2PQWA 4EIKA 2E7XA 2FZKB 4PK4A 2H8RA 2P5OA 3ZQIA 4OAYA 3QERA 4YFKF 3BOQA 5HRPA 4LMYA 2XGEA 3I55I 4BJ5C 3RDVA 2Z3YA 5BNGA 4M7AA 1PDNC 4MTEA 1EWRA 4DR2K 1T56A 1WBDA 1NGBA 4X66K 5J2PA 3DFGA 1Z9QA 1IUYA 4CECA 3TAPA 1FJGK 1KU2A 1QGPA 4WQ5A 5GAMd 2BHYA 3R6OA 2YJFA 4P96A 4AFQC 1WXBA 4BUPA 3OS1A 3AAFA 1TLHB 4HSBA 2COWA 1GXIE 4F7UG 4WQ4C 1QZ5A 2VB6A 3C3WA 5M5XJ 2VWBA 4AFSC 2QXLA 2MLGA 3MMYB 3EE8A 4UXNA 4AIHA 4O4GA 1BL3A 4M77D 3KYDB 1IJJA 3MWPA 1V4TA 3V4GA 2KGTA 4XKVA 4BROA 3NWTA 1OZ2A 4HA8A 2EA2A 2VXEA 3T69A 1IXRC 4OIQF 3KHYA 3PIPA 3RKXA 2EKHA 1OH8A 4YOVA 2WSFE 2KE9A 3U2RA 1B34A 2ED1A 2DD5A 3VRZA 3F8MA 3G2BA 2NUTB 1R23A 1JXOA 4WWCA 3PTAA 3P9IA 4WK8F 3TVTA 4Y3OA 4LK1F 2GQVA 4M7AF 1FMVA 5F08A 2LK2A 1VQ5I 4AIAA 3E6DA 3K58A 1WUAA 4LSNA 1YIJN 2ESWA 2LQNA 3EGXB 3J80K 3LZJA 3U23A 4M7AE 4PL6A 3JW4A 3M5AA 5LBQA 1VQ6N 2HOTA 2E8AA 1Q81R 5I21A 3BF1A 4N9HA 4PKGA 4DSEA 4IVNA 1I5LA 3HBLA 2K7LA 1M90R 2L01A 5D8KB 3WT0A 2GWKA 2WC9A 2OYQA 4PJOA 5HS9A 5GANf 2XDVA 4E9GA 4II1A 4YEJA 1J75A 2GCXA 1K1ZA 4FSXA 1OCRH 3OBYA 3OSVA 4N56A 3C65A 3NTHA 3GG4A 1U5TC 4O6JA 2NNNA 1RILA 4GO1A 4DFMA 4A6DA 1G2HA 3B6OA 3BG3A 3PIPF 2X6WA 2AO9A 2DILA 3EGDB 3HXLA 3VETA 4DTUA 4HRIA 3O3KA 2PMZN 3IHOA 1BKBA 4Z94A 5E3LA 2NOIA 4X62K 2A68F 2KZGA 4UVBA 2VT3A 1ZSZA 4GMJB 1OZ3A 4JK7A 3NNQA 2V8JA 2VONA 5CY4A 2H94A 1C1CA 3LDLA 2LNVA 3VDXA 4OMYA 4OMMA 4HQEA 1KAXA 3SBGA 1YE9A 4UUTA 4XQ3A 3N05A 1LV5A 4LIVA 3RTVA 2V1XA 1NE8A 3T9NA 3C7NB 5F0XA 3OR2C 1OX8A 1QHHD 2H09A 1C0TA 3OJUA 1E0EA 2RHKA 2O88A 1A6IA 3ZOBA 2TDXA 1FMKA 4IO9F 3O6BB 4GKJK 5FB2A 2A6EF 3HPGA 4YOTA 4FWNA 4BR0A 2E1NA 3EO3A 4H5NA 3G6EQ 2K5CA 2WADA 2E1MC 4CJFA 4XU3A 3TL4X 1VAZA 3LP2A 1Y57A 1QQJA 4KJZA 2DBMA 5K7ZA 5TGTA 4G7HF 3CJNA 3PQJA 3ZSRA 2FEIA 3C95A 3LSPA 3G4SA 1I3QJ 2G7UA 5IN1A 2ECCA 4IZ9A 5TRDA 3RTRA 5DCMA 2DF6A 1Y71A 2DW4A 4F2RA 3ZGKA 1FLIA 4BR9A 3RKQA 2X4HA 4A54A 3DLBA 2P6TA 1NKCA 2CGHA 4PZJA 1BG3A 4XOTA 4ZGEB 1U3OA 3KZZA 1NEGA 1MWMA 3Q7BA 3MEDA 4M7DC 3WTTC 3O6WA 3OIQA 1HF0A 3GCMA 2KFZA 3GTGJ 4DR3K 5GANd 3TTCA 4CZMA 1LWYA 4J8FA 1FP2A 4CZGA 3CPFA 2BE5F 4UV9A 1E17A 1YCSB 4M63C 2P5KA 5H1SQ 2G8HA 4IUUA 4M7AG 1I3AA 5GAHJ 1PWTA 1YITQ 2HBKA 4A3GJ 2RHIA 2ADUA 1OVQA 5EEGA 5A2QZ 4PY5A 2WB1N 3CPWM 1QVGS 1WGXA 4M9XA 1YT3A 4MNUA 1W2BP 1X2QA 1M1GA 4ELVA 1D9FA 3ZETB 4CK2A 1YJNQ 1R0CB 3WTXC 1YTYA 3L1AA 3JXUA 3HYFA 3I35A 1YHQI 2D0NA 2LJ0A 4BS9A 5LJ3j 2QA4Q 4Y13A 1ERDA 1M8MA 3TWHA 1ENHA 5JHUA 4M3EA 4J9IA 1HJDA 1CXQA 4KICA 3AVLA 3DEUA 4YELA 4JZ4A 3QYEA 3MWTA 4M7DF 3OY9A 5AJ3K 3S15J 2L3QA 2Y1IA 1POGA 1ZG3A 3FBNB 4RDUA 2HDCA 1RETA 4M3DA 5FKMA 4J2DA 2OTLN 2W25A 2Z9OA 3WNEA 3VGLA 3HSFA 3G4ST 3HP6A 1XB4A 4BRHA 2CUFA 3K0SA 1LEBA 3BG6A 5C2FA 2FD5A 4ITVA 1TK8A 3J80O 2EB7A 4DBFA 4M74A 2CDTA 1XJWB 2ZJPF 3RBBB 2LRQA 3UB5A 1XGMA 1L0OC 1TK0A 4CK3A 1IN8A 2DBKA 4JX5A 4ILHA 3FZLA 3TMOA 2F4OB 2DXTA 3ZN1A 3H41A 3I55A 1R0AA 5AQLA 3AG2H 4RCBA 1XTAA 2AA4A 3FIWA 1IV8A 4A57A 1U1SA 4OPHA 2JZYA 5I9EB 3JB9J 4BYYA 2KT0A 4C8LA 4IHVA 1BR1A 1O7LA 4PFZA 4J6YA 2R7WA 4CZFA 1X3UA 3TABA 3IUCA 3VFZA 3FXRA 1RBTA 4B3XA 5E26A 3D5LA 1TSFA 3ASNH 5FU6B 1EX4A 3DWLE 2ZF5O 5AFUA 2RNJA 3HFOA 4JHDB 1MMGA 3ZCOA 4X64K 1RNHA 4LH4A 3CM5A 4B21A 2KDSA 2OF7A 5IHNA 2QTVA 4PSWA 2HYFA 4GY2B 2CFOA 1ZUUA 5E79C 2LYCA 5HLTA 2DA9A 2CV0A 1ZR2A 2XKOC 4DK9A 2H1LA 2CH5A 2E12A 3VQBA 4IQ4A 1HJRA 1BGXT 4O5BA 2OQGA 5AQGA 1J3TA 1KQ2A 4NUBA 4Z6YA 2VASA 3G73A 3U1DA 1U2VB 4OMZA 4HCZA 3ZEUB 1Y0MA 2GA2A 1D5VA 3QEPA 5GAN5 5L3DA 3DLEA 1BA1A 1YP5A 3KNTA 2O4XA 3RSNA 4CZEA 2KKOA 4P5OA 3G1JA 2DA2A 9ANTA 1BQMA 4FTHA 2M34A 4CZKA 1XDUA 2P4RA 3DB4A 4XTWA 3LWFA 1O75A 1NG6A 4I6ZA 2HNZA 4XLHA 3WNHA 4KRFA 4NXMK 2OA4A 1IXDA 3CC2A 4EATA 1IKYA 2QKMB 2FOKA 4O8UA 4OX9K 2RDPA 5KAIC 4GY5A 2G3RA 4ZZDA 3OSFA 2VWKA 3NH2A 5BPLA 4KHNA 1HW2A 2IVOA 3VUBA 3I55T 3H5RA 3C6AA 5GP9A 3P9KA 2JUCA 2R7QA 1ETWA 1R8OB 4FM0A 4KDPA 3OOPA 4NB4A 4PCQA 3EDPA 3CVSA 4GYGA 2JA8J 2MD5A 2MW8A 3ER0A 2Z1HA 3KEQA 5GAEJ 1Y96A 5HL7L 4JI5K 4BRDA 3QP6A 2W4SA 2LBFB 4AILC 4PL7A 3CXCM 1HR0K 3G0ZA 2LJ1A 1YIJI 2BYVE 4AUXA 2XK0A 3TKYA 3QPLA 2M0CA 3KYCB 1RUNA 4FWKA 1QVFA 3CQYA 3DPUA 1VQ6I 4C92A 5CQEA 2DOFA 4LFCK 1N39A 2QKKA 1UHCA 2PY5A 4LDUA 4EMGA 4RGRA 1YX5A 4HHTA 1PKSA 5EF6A 3S1MJ 4NL3A 4XOPA 5HK3A 4E9EA 4I9LA 1S6LA 4GVMA 4B3TK 5EVZA 2G8VA 4W5NA 3KP7A 2STWA 2XHBA 3PY8A 2KK4A 2OTJA 2HVHA 3D7EO 4GLKA 2QGFB 4L9NA 2GIVA 1S29A 2DERA 4IDHA 3SV3A 2PAVA 2EWSA 1L5UA 2H8WA 2MIOA 3OYMA 2ZAEA 4D0PA 1NK2P 2HD0A 2GEMA 4HG2A 1ZUYA 4E89A 1FBUA 2PFUA 1VQOA 4K0KK 3RJPA 2KRHA 1HSJA 2PI0A 2LSNA 4TSXA 5HBMA 1KD1C 3H5NA 1WHGA 2BE2A 3CC2T 1JKRC 3ASMA 3S41A 3JCMf 1FSHA 4C5EA 3V7RA 1FOYA 1ZTRA 1NG2A 4H4OA 3HOUJ 3MEWA 4ZN1A 1SAZA 3CPWA 4UQGA 3I4NJ 1P6RA 1SKUB 4N4HA 2PYJA 3FFKB 4CJUA 3I9V2 1IH7A 4J19A 1M9SA 5J8FA 3CFRA 4UUVA 2BVLA 3DOKA 2QTXA 5EG2A 2VUBA 4CH7A 3B6CA 3K9TA 4BRNA 2KTQA 2LQ8A 3JRZA 2HHWA 1Q82C 3RUXA 4BE2A 3GNGA 4WFBL 3H3NO 1ZGJA 3WTZA 1RUOA 1K78B 3MN6A 4C5GA 4B1YB 4OMFB 4BRQA 2IW5A 3HPHA 2D0AA 3MN2A 4M3RA 1KG6A 2QEXA 5C6SA 2MA3A 1JUPA 1TQPA 2UXNA 3C18A 3DKXA 2OV7A 1ETQA 3SZGA 2H1KA 3VS4A 1RAHB 4FJJA 2FXUA 2EWNA 1ORPA 4TVRA 4IEEA 2V79A 1JLQA 4DU4A 5GMKl 3RQIA 3LA2A 4A0XA 4JS4A 2NRZA 2OTJT 5E84A 3V9XA 5TKYA 3FK7A 4IFEA 2KXCA 3GOXA 2EHGA 5AQUA 1ETOA 4C0GA 5GAHP 5FGMA 4PGHA 2HNDA 4ZH4F 2O6GE 1VI0A 1E4GT 2LDUA 2KRNA 1VQOT 2D9TA 3CC4A 2XY5A 3LDQA 2F1LA 3JCMh 2X1DA 4B43A 2DE0X 1R00A 3G0QA 3UKGA 1F1BB 3FJPA 4L9TA 2KLAA 1YQKA 3OIPA 4M75C 2P1JA 5LRRA 5KE3A 2XICA 3EYIA 2X6NA 4WCIA 1WSJA 3FXKA 5IP7J 4NYNA 2VJ5A 3KZIC 4ON0A 4LC9B 3DBLB 4IBNA 3CD6N 2F5TX 4NQWB 1WJCA 3T1YK 4L18B 2EV5A 2L4MA 1ETYA 1EP4A 4IHSA 4ZNXA 5GAGJ 4I01A 3NF9A 1Q1VA 3JCMd 4JI8K 1HC8A 3F70A 2G8UA 4RW6A 4YORA 1VNDA 4JX4A 3CCVA 3HDDA 3NMZC 3O9QA 3PLAA 5AQTA 1BN5A 4L9JA 4ESFA 2V7FA 2LVMA 5AIQA 2R3SA 1Z6TA 3E9OA 1DDNA 5GMKj 2VT2A 1B1BA 2OTLI 1TK5A 3OB9A 2QK9A 3N5NX 3HZ6A 1PSEA 1X4PA 3REBB 2OPTA 1XG1A 3O1BA 1WXTA 2OJED 3HVTA 4CD3A 2QEXT 4DTMA 1ONVA 1IG8A 3K70C 1Z6RA 2P9LA 4FQGA 3P8HA 5ILUA 3F8FA 1TUUA 4YNQA 1Q7YO 2RQUA 3CQXA 1JJ8C 4NO7A 3WXKA 4CIGA 3KP6A 5DM6L 3HKZA 3PMTA 2YCHA 2JT4A 3L7WA 4BY1J 3D2EB 5KQ8A 4YOYA 1FSEA 2NYSA 2KW4A 4CF1A 3BG7A 2G6FX 4EMHA 4OO1J 3N97A 1R36A 2COMA 4RA2A 4A3EJ 1RAEB 1VQ8N 2X6XA 5HK0A 1RESA 3VQCA 1NHAA 3SUPA 1VQLN 3QODA 2CZ0B 4FLUA 4CHNA 3EQLF 1M1FA 5F0HA 3CC4T 1X3MA 3HHHA 1BDGA 1GT0C 1MDMB 1W0HA 3GOIA 2E6NA 3VF4A 4M9SA 4OINF 2WAQN 4W1UA 2P0KA 2CGPA 2JVGA 3QB0A 4DSJA 5IHIA 4C0DB 2AXLA 2J5PA 3K59A 4P1WA 3PNTA 3BDDA 1X6OA 4M6XA 4XRSG 2GTDA 2XF7A 3IQLA 4CZJA 3Q9SA 1J59A 4HUGA 4C3HJ 4A4GA 4M3TA 3GTQJ 2JJ7A 2H56A 4CCLA 3FMRA 2ELKA 1S1XA 2RHUA 1G99A 1XQPA 3CEYA 2Y0MA 2JHJA 1LVKA 4EM1A 3TO6A 4AT1B 1RBUA 2B9SA 3QIIA 3JB9D 3V6DA 3QO9A 3A8GB 3LALA 3M3YJ 1YI2N 3CCVT 3CC4N 4BRPA 1YCYA 1RLPC 2D4WA 1UTIA 1PNJA 2CP6A 1ZBIA 2Y0SN 2RI3A 5HDKA 1ZLJA 3SK3A 5CKFA 3GTJJ 3HPWA 1BB9A 5GADJ 1WJQA 5LJ3f 3NARA 4EMKB 1NJIO 1JLAA 1X3WB 2DL5A 3L2RA 3OW2P 1IKWA 4PHTX 1WAJA 4L5JA 1EWQA 2EA4A 3HEFA 3SJJA 1D8YA 4JKAA 4BB7A 5GAEP 1FKOA 1ARKA 4BGBA 4BY6B 2EQJA 1J54A 1H0MA 1VSEA 1GXPA 3J7AF 3TPQA 1YUWA 1OI1A 2Q3SA 1WQ7A 3DAWA 1S72I 4MFBA 1SAXA 1TUYA 1ZC6A 2K2VA 2O8CA 4BI4A 2YJEA 3SUQA 1LW2A 3EYZA 2JOYA 2UUAK 2DK8A 2DOEA 5F1XA 2VI6A 1IW7F 2P9NA 2QKLB 4KBMB 1FKPA 1REVA 2BOLA 1NJZA 2NAZA 2X4JA 1MBHA 1MH4A 2FF4A 1MNEA 3CCJQ 3H9NA 1VQMI 4ZYAA 2D2WA 4HVVA 1NPRA 2HI3A 3OYFA 4O55A 1LJOA 3PVLA 2E4LA 3NEUA 4B48A 1WOQA 1Q7YR 1BI1A 2MYSA 1AWXA 4E1NA 3ZSWA 3MN7A 1OR7A 5E8IA 4UC4A 5GAOm 5F0CA 2IS1A 3PIOF 2P9SB 3QKJA 1CSKA 2CQXA 1ZRCA 5GAN3 2Y9ZA 3P7NA 4CUGA 3HRUA 1WSFA 3PX4A 3DKWA 1HCRA 2J6OA 1EFNA 1SRLA 5IT9Z 1IREB 4IIOA 3H6EA 2F4IA 1SEUA 1F21A 1J5EK 4HV5A 3ZR8X 4RTYA 2IBDA 4H0YB 1BOAA 4RUGA 2GELA 5M3FJ 3A8YA 1SKRA 2M9HA 2X4WA 3ABMH 3OV8A 2PTKA 2IS3A 4LDYA 3EFOB 4L0YB 4YY3K 1Y0NA 3ULEA 1W5SA 1DU0A 2VIXA 4A3LJ 5CVIA 3R4KA 3SQNA 1ZBXA 2O8BB 2HDAA 2D5RA 3CESA 1OJLA 5LJ3d 4FIBA 3OYNA 2GZWA 1UHWA 4M73A 5CKHA 1SD7A 4PGGA 5AQXA 4N4IA 2FF3B 2ZXIA 3THYB 4FX4A 3J7YP 1MNDA 3IAM2 1AZGB 3QWLA 1SKSA 3K1PA 1ZUKA 1XSXA 1TZLA 4CJQA 4QVCA 1RTDA 1OV3A 4R5PA 1TWAJ 5DM7L 5AZIB 3CCLQ 1MGQA 5EG0A 1TV6A 2DK5A 4U0YA 4NCAA 1YF5L 1G59A 4KIBA 1T0FA 2QQSA 4OVAA 3M8FA 3M54A 1NLVA 1ZLMA 1MV3A 1T03A 4NXNK 2NOJB 2G8WA 2FBIA 4HX4A 4U7DA 2FBVA 3QNNA 1JJ2S 1NJIR 1KC8O 1XPXA 4X9DA 2DKGA 2XPUA 3BZKA 5T7BA 2CSIA 3E3VA 4CXFA 4IIMA 3VW4A 3K5NA 3A5LC 1FIPA 4BQNA 4A3MJ 4Z4CA 3A8HB 2WONA 1T05A 1OULA 2BW3A 4H0EA 4EP4A 1UB9A 2V75A 2YSRA 2ZGZA 4B9XA 2KLOA 4O5FA 2W57A 1ZA2B 1VQ4N 1YFHA 2ZKZA 4M78D 3CG7A 4IOAL 3AFHA 4E1MA 3FXJA 3J81K 4DTJA 2ESNA 4KA4A 1YJ9N 1VQKI 3QBYA 6PAXA 4XEIA 3FHFA 4XU2A 4X1EA 5GAGP 3Q0VA 3ECHA 3GZ5A 1PG5B 2JRTA 1WI7A 2CU7A 4MFDA 1C6VX 1G3YA 2E1CA 4E7LA 4DV7K 1S1WA 2RC4A 3JSPA 5A0GA 3RYPA 1EF4A 2RN7A 1E3OC 2E60A 4N76A 3BY6A 3WVEB 2FSKA 4MIMA 1OPLA 1YTUA 4XIDA 2RVCA 4JNEA 4DUYK 1Y56A 2D45A 3QHSA 4F93B 3M8JA 4GNIA 1YN8A 3F22A 5E20A 4Z4FA 3RZDJ 5ICGA 3QQAA 4DSLA 3L00A 2CGJA 5AQNA 2GV9A 4E7SA 3AVGA 5J2QA 3THXA 1S1TA 3RR6A 1I8FA 4C2UA 2LD5A 4AC0A 1K73U 2QASA 5BRHA 4FL9A 2VBZA 3QFUA 2EV0A 2V7YA 2B5JA 3WODF 1JXSA 3TQ7P 2PFBA 3CCEA 3HTUA 2ELHA 1G83A 2XRLA 3WNGA 4IXAA 3I56N 4WXHA 3EYYA 3ZSYA 4OMPA 1U45A 2YUQA 4NNJA 1HYSA 2EYXA 2X0LA 4LJZF 1TWBA 4FM2A 1SAUA 5M1FA 1N25A 1VQLI 2IJLA 3M9QA 3SD4A 4BEHA 2DOAA 3HOSA 1YJWQ 1IDYA 4LD6A 3VYTB 4BXUA 4FXDA 1IV6A 3D4VA 2G8IA 3PIPL 4E1JA 5CAIA 4MZTA 2K9QA 1WPYA 2XAJA 5TKWA 4XLNF 3RDIA 3HRGA 2XHCA 1OU9A 3L3UA 3CC7N 2L3RA 3OYEA 3AGKA 3R1XA 3OMCA 2DEQA 2BUPA 3UT1A 3QNOA 1Z9CA 4DYCA 5GAMe 1NLOC 3URGA 2ZSHB 3P8DA 2C06A 4CHZA 1OFCX 2ZPGB 5K5QA 1F43A 4IO8A 4CEBA 2ZE2A 1E3HA 2KT1A 3OA9A 4DF8A 1IB8A 5GADP 4ELYC 1KC8R 2LKSA 4BHBA 1VTNC 2DO7A 1FNNA 4E7JA 1LAVA 5DYMA 3ABUA 4K2EA 4IO9L 2DMOA 3HI0A 2V1QA 1S72A 2HU9A 4B1UB 4AWXB 1D1CA 2PBDA 1RIOH 4EP5A 4M77A 3CJ9A 3ERED 1TKDA 1XNIA 3VQ8A 3ZL7C 4J6XA 2X4XA 4IEIA 4DTNA 3CCSN 2IOCA 3IC7A 3JCUC 3LWLA 4HTLA 4IEJA 5BQTA 1N78A 3CPEA 3QWXX 1PD1A 1PVSA 1M8VA 4B24A 2DXIA 4UOBA 1W2BM 5GTIC 2X78A 1D3BA 3CCET 4OB2B 1VQMA 3TQNA 3LSMA 5C4XJ 1Q1HA 1D1BA 4JKDA 3IMXA 4BQAA 3JCMV 1Z26A 3O8VA 1JRIA 5M5YJ 1RC9A 3DQVC 4CC7A 4B3MK 5KYUA 4I99C 1KZHA 3W3DA 1UJ8A 2AS5F 3EG9B 3NTIA 5GAN8 4QPOA 2PVDB 2A3LA 3TSWA 4RW4A 4QOZB 2BZ8A 2BZYA 4WFAL 2HHXA 3JAMK 1LKXA 4N0AA 4DYRA 3EUHA 1SQKA 1N3CA 3PJRA 2KFDA 1OVYA 3CMAN 2VODA 4RB1A 4KB1A 4BE1A 4CBUA 4B1XB 3M0QA 2GOMA 1IRXA 3EKSA 2VQGA 1Z9ZA 2ED0A 3QICA 5LFAA 4C0ZA 1HKGA 2DRMA 2VPRA 5A2QK 2EGCA 5HNFA 4KT5C 3ZQFA 3QRFF 2YKMA 1NK5A 3MCAB 4HCBA 1EA3A 3KLNA 3E7LA 4RB3C 2QWPA 1APLC 1S7EA 2HFHA 2LC2A 3LP0A 2L7FP 4BHPA 3T0YA 3CMEN 3HRSA 3I3LA 1Z7LA 3ME9A 2RQTA 4YRVA 1Y8QB 4E70A 4BDPA 2L0KA 1VQ5Q 4A5NA 3MP1A 3MX2A 3WU0A 3S3MA 2Z1JA 5FPDA 3DPTA 3W2VA 3D5SC 4JJCA 4CZLA 4LITA 4FL6A 4DF4A 3VQAA 3MKZA 5LMNK 1H1VA 3IWFA 2GM4A 5C25A 4CEQA 4ILJA 2EQKA 3LWMA 2QWRA 3J80Z 2E2QA 1NK4A 1VQMT 4CGGA 2QYOA 1YIOA 2CFXA 5HROA 4Z0UA 2ZJPL 2CQNA 4CYDA 2XGCA 4KISA 3HJFA 4XU1A 1BIUA 1TOVA 2JM8A 5FWCA 2P5LC 5LMUK 2Q0UA 1Z21A 4BREA 2NOLA 1AKHB 3D0SA 2L5QA 4DV1K 1UE9A 2M16A 3DLLA 4GCVA 4DFJA 5A2QE 1NYGA 5F1JA 3J7AY 2PUOB 2E2JJ 4RLQA 2D0OA 5D3GA 1X9SA 1UWBA 2EW3A 3DXMA 4CJLA 2DPDA 1HNIA 3KLGA 3K0LA 1FXXA 4YOUA 2E2IJ 1MHNA 2BGGA 2K85A 2MLKA 2MD0A 4DTXA 1VQPQ 3WTSC 3UKUA 1A6QA 5LL6Z 2Q31A 4PFOA 3MDQA 1NOYA 4L3QA 3O5ZA 3DI6A 3H08A 1E6GA 2Z1DA 3U3YA 1X6BA 3VJPA 3DLAA 4IQJA 2CMPA 3O9RA 4QTRA 2RA2A 1PC0A 1WLJA 2Q2EB 4A0YA 2ZFWA 4K11A 3ENOA 5D6XA 1LE8A 4MGRA 3F10A 3CDIA 3ZQLA 4ESRA 2L7KA 2PMHA 3B6AA 2OI3A 5L23A 2HEQA 1ETVA 3SAGA 4JD2A 3E5XA 3QP5A 2XMFA 1NGEA 4M7AB 1WEFA 4R1HA 1WBBA 5IWAK 1RDWX 2LNBA 3ZQHA 5E1ZB 4MQ3A 3ELKA 1TU0B 1EV7A 3H0DA 4K42A 1GCQC 5H6QA 4I76A 3OYBA 1YJ9I 2IXSA 4ANJA 1FEXA 2LP5A 1C0FA 4BRIA 4FK2A 2V4JC 3AO3A 1QVTA 4CEEA 4Y52J 3KEYA 3NF6A 4BWJA 1WHMA 1T2KA 4EZ9A 1WHJA 1J5OA 1KG5A 2E1YA 4CJTA 1NGIA 2YU9J 2EJFA 2A6TA 3CBMA 2C6YA 2E3IA 1I1SA 3I0XA 1HNWK 4HPQA 2MF2A 3MZYA 3I5UA 4IJAA 3NPFA 2DMPA 2V1DA 3SJMA 2O4GA 3T1AA 2K4BA 5KPZA 1BA5A 2YLBA 4AYBA 4ENJA 4JI2K 3VA3A 3HG9A 2NVYJ 2KPMA 2RK1A 2RKIA 3HTRA 2MI6A 1ASUA 1R1TA 5E1XA 2YHYA 4KUMA 4XTYA 1Z25A 1MBEA 1B34B 2DVEA 4E9HA 1ZYQA 1H9TA 1QQNA 1Y8RB 4QQ6A 3M8RA 3HJEA 1ZKGA 3JAMO 5M1NA 2VBYA 3MD2A 2JWLA 4B3RK 1XMXA 1X1BA 4AMCA 3LH5A 4IUTA 3I8DA 2E1HA 5ICCA 2V8IA 1DP7P 2WTUA 1W7PD 1P7IA 1K9MU 1N27A 1A35A 3H0HA 2LY9A 4ESJA 2HNIA 1N8RU 1W2BA 2YHAA 1K9MC 2JJ9A 2PN6A 1A04A 1JLGA 4XMYA 1BYMA 4CGIA 1YHQQ 4FOEA 4MLEA 3TR8A 2Y30A 3L0QA 4XM3A 3ML6A 5TJJA 4B1WB 1XGNA 2QWLA 1TL1A 4PJOB 4KUDK 5EJCA 4OPKA 1KQ1A 1TL3A 2ZPBB 4BC5A 3FX3A 3T1HK 4AH9A 4CJKA 4BQQA 1YS7A 2EFPA 2COBA 4P9FA 5CLSA 3HK2A 2DEUA 1YRNA 4YPHA 4M75A 2IP2A 3CC7I 1JTYA 3UATA 4FLTA 3GIBA 5SZTA 3MJXA 1ZHFA 5HLFA 2P8TA 1RUWA 4Y0WA 4UHTA 3ZX0A 4CERA 3WVDB 2KJCA 1LNWA 2ATCB 3RWUA 4O0JA 4FJ9A 4H5RA 3PX6A 1AT1B 1MIJA 1U9NA 4LSLA 4KMUX 4EHUA 4BXXJ 2KZVA 3FKJA 1ZSZB 1O57A 2ICWG 3F6OA 2DT6A 1WHUA 1QRYA 3CDHA 2ZM6K 3JRCA 4ELZC 1K4TA 3SPZA 1OYXA 3K9JA 4N5SA 3CETA 2RHYA 4DR4K 3N4MA 2I5UA 4FJGA 4NZGA 2GAUA 3G71Q 1GOBA 1UMQA 3VOEA 5FD5A 3DRSA 4RTZA 4CDGA 3MO8A 2BGCA 5BR8K 3E97A 3EHRA 3HM8A 2DTOA 5LHGA 2JMAA 3I59B 1KLNA 1XCBA 3ZP5A 2A37A 5F6FA 3CCSI 3AVCA 4C0DC 4IZZA 1RL2A 2EPDA 2GXAA 1TWCJ 4O44A 4JKGA 4F14A 2JPSA 4YG2F 4HNTA 4FPBA 3I0TA 2A5YB 1BU6O 2QYZA 3BJ6A 1UGPB 3GWZA 5FFZA 1IF1A 4JRIA 1P92A 5LGTA 2M0MA 4DIQA 1WHLA 3HP9A 2QQ8A 3K4JA 1BWFO 4RAYA 1XX5A 5DCMB 2X6OA 1Y39A 4FJMA 4CEOA 3M8QA 5BPDA 3FC3A 4UVCA 1LWVA 2LF7A 3CLQA 3M0UA 2D0QB 3ESWB 4WXDA 1YITA 5AQVA 2ZPHB 5IH2A 2FU4A 1GV2A 2GBZA 1VK0A 4O3MA 2HVQA 3DBHB 2F5EA 4FISA 1F4KA 1X58A 4E0DA 4N0BA 3KPHA 1MV0B 3NHNA 4XSXF 3A5ZB 5KYYA 3EZWA 2K57A 4Q0BA 1YJNA 2HZDA 2HEOA 4EMKC 2F2WA 2KSSA 5KI6A 3FBIB 5K5RA 3C94A 3BTCA 5D4SA 2RO0A 4PFPA 3VB2A 5JS2A 2DAOA 4AVPA 3G6ET 1JXBA 1Y0UA 4BY6C 2P84A 5J40A 4Y92A 1KLMA 3BG5A 1BR4A 2NLUA 3KUFA 2BY3A 1HNXK 4CJEA 4C5HA 1TG0A 2ME0A 4CC4B 4OOIA 4BUGA 5CHIA 3TAEA 4FLWA 5KGXA 2EQUA 3IG1A 3FE1A 2CUDA 1E6HA 1YIJQ 4JQFA 4CFCA 1VQ9I 2RK2A 1S9EA 5KCOA 4A2BA 4BU2A 2EYZA 4BBSJ 3BPXA 2PBIA 2OPPA 3BR0A 3O4WA 1JBMA 1VQNN 1MUYA 2RMOA 4BD3A 1VQ6Q 3M53A 4BRFA 1KVBA 3QU6A 4JS5A 1RRQA 3SB2A 1LFUP 3G6EN 3MZ8A 4JYAK 1S3JA 3A8LB 2XF5A 1IN4A 3CCUN 4J8OA 2J05A 4IPAA 3KLEA 4NHJA 3HSCA 5IYDJ 4DZJA 3O8GA 3MK6A 3EH1A 1T3SA 3KIOA 1J0RA 3MAQA 2M4KA 1IZ6A 1W4MA 1YITT 4UY8I 4A5AA 1ON2A 3KK7A 1MD0A 1UGVA 1IN6A 5DUIA 1D4XA 2DPPB 2OC6A 3EG2A 2KP6A 4AM7A 1FYKA 2RD1A 3RCOA 1KJWA 1RABB 4E7IA 2NVQJ 2RREA 1J2XA 1YJNT 2KI7A 2ECBA 3VQEA 2QUFA 1GVDA 1W0UA 2VGNA 4IOCL 3JTGA 3OW2M 2O8FA 2QA4T 4PKHA 4JPBW 2ASPA 1HLUA 3CCMN 3MPUB 1T95A 1M2OA 4C8QD 4E4HA 4BJTA 3BDLA 3THKA 3NVKA 1WI3A 3OSGA 3OYYA 3NMUA 4AG1C 5AQWA 4HCKA 1G15A 4OGCA 1K8AU 1IDZA 4MQVA 3BTJA 2AT1B 4ZYGA 2DETA 4A6EA 1KEAA 2XB5A 4EMSA 3FJ5A 5CHZA 5EGOA 4AI5A 4F3QA 2Q36A 1EO1A 1TW2A 1Q86C 2D1KA 1B9MA 3CO7C 3BUZB 1KYZA 1YJNN 2VOOA 3VQ7A 4M45A 1G2BA 3O3GA 2MCNA 1MMSA 3QYBA 4FW1A 1PU8A 2QA4N 3HHGA 2LLKA 2DXUA 2FG0A 3ZMVA 2GNCA 4J6WA 5J3BA 1PD0A 3PSFA 2F8TA 2O4XB 4YFXF 2G0EA 3G1OA 4G7ZF 3IS9A 2WY8Q 1XTDA 3MKWB 3JCMe 2AQFA 4BR2A 3RMAA 3ABLH 5FLXK 5D5UB 3E9PA 4JV5K 1GHCA 2Z0WA 1IAWA 1IV0A 3A5NC 2O61A 4E9FA 2P9KB 3FHNA 4KBOA 3JRAA 4BXFA 2JA6J 3R3LA 3VS6A 4KT6A 2R5YA 1RT7A 3H36A 3L3VA 5CYMA 2EIMH 1MBGA 2L9SA 3DXKA 1A31A 1KFDA 2V8KA 1FP1D 3KZYA 3JYTA 3KVGA 2RE2A 3HKSA 1XSVA 5B5EC 2DZ9A 4J9DA 4Y1DA 3V1RA 2KZMA 4A4KA 4KTWA 4QSHA 2X35A 4U67L 4XLFA 3K10A 4OLAA 2BHZA 4W97A 1AWJA 1Y96B 4LG3A 1BHLA 1GLBG 4A4FA 1S5JA 4IURA 1EIFA 3DCFA 3ULRB 4OPJA 1KU9A 1O7FA 3FMSA 1D09B 2CQ7A 1FOWA 2DPUA 1IG7A 1KFZA 4RCHA 4BHCA 4H5TA 4C92B 3ULDA 1FT9A 5FRNA 2JNGA 4G94A 4FVUA 1Q18A 5CK9A 1UECA 2Z1GA 3WG9A 4ZDLA 1K4SA 3KTQA 1IO6A 1GRIA 1EH6A 2F5CA 4I02A 3BY7A 1Q81U 3M59A 3OYKA 2HR3A 3H6ZA 1UHMA 2ZGWA 2JZ2A 1M90U 3B6PA 5B3SH 2EZKA 1G3TA 1Q81C 2OTLQ 2ATQA 3KD1E 4HF1A 1WSHA 3KP4A 4AF1A 1NJWA 1HU0A 2GFAA 2FNAA 3QOEA 1WSIA 1Z0XA 3CYMA 2DLLA 1AOYA 3FZHA 4M41A 4B3AA 1N8RR 3NGIA 3D2FA 2YPRA 3CW7A 5ADXH 4JAXA 4GV6A 3QFPA 3NH1A 5J1UA 4GV9A 4XU0A 2V51B 3VEWA 3GP8A 3QZ9B 3SUNA 3TU5A 5JI6A 5HRSA 3CCQN 3P38A 2CH6A 3BY5A 2KIQA 3A02A 3JCMX 2N8GA 4OMOA 4R8HA 5KYXA 2ZPEB 3SQ1A 4FSVA 3IRQA 4MDAA 3INZA 1ZQ3P 3V8KA 3U9DA 3MEEA 3GMEA 1AD5A 2B4JA 3ZQ7A 1Q9XA 3QEIA 1VYUA 2P0WA 1P7MA 5AQSA 4M42A 4YHHK 3ID6A 3CI5A 1WJSA 1RLQC 1UHSA 2EPFA 4FJXA 1RGIA 2FLOA 4FLXA 3MZHA 2JMWA 4CJSA 4CZHA 2YS9A 3P39A 1UB4A 3TOAA 3CO6C 3KJVA 4FYVB 3CCLI 4B9TA 2R4GA 3Q0UA 2HL3A 2PUKB 1SVMA 1RR7A 3VS7A 3SWNA 3IKMA 4ME7A 1KA8A 3FXOA 4EIAA 4AVZA 1BK2A 1TS9A 3NQOA 3QDRB 3ENBA 2O0YA 4YFNF 1LWFA 3DKMA 2YX4A 1JB0E 4OFHA 1RT3A 3CBOA 3X24B 2GA1A 4DFPA 3CLOA 4OMNA 1WYXA 3CVTA 5F1RA 1IKXA 1B8IA 2KRFA 1BW5A 1Z77A 4A5BA 4KHSA 2XI9A 2G7HA 1K8AO 4UVAA 3ZX3A 3BC8A 1VHXA 3AVAA 3LZIA 1NKBA 3LCNA 4B47A 2KQ2A 2VCPA 4C8NA 2A40A 2UZKA 3D1NI 3CFPA 4OIRF 5J3LA 5ICEA 2HOEA 3OW2A 4HX7A 4C0FA 3OH9A 3S2HJ 4BE0A 2UUZA 2VQFK 5LJ5h 3F9KA 3P83D 2CYZB 4GKKK 3AO5A 1YW7A 3W0LA 2O31A 2BBYA 4DTOA 3OYCA 5IP9J 3CBPA 3LP3A 1QVFS 3AG4H 1JUSA 5CKDA 3DRRA 1I6XA 4M7XA 2LKPA 3DV8A 1S72Q 3QPHA 4KKOA 1MJBA 5AQFA 4F91B 4NL2A 2M30A 4CW7B 4GLMA 4EVVA 5GAMg 4QS7A 4WXCA 1RDBA 3C0BA 2QCOA 2A41A 3K9KA 5M5WJ 4JKBA 3QO3A 4FE7A 3SPYA 1VQNI 2XD0A 3C6UA 4GRIA 1VYTA 3I33A 3O9UA 4X65K 3L9FA 1SRMA 2J06A 3DOLA 1LDKB 3RI4A 5BN9A 5HDGA 3TDZC 3CWAA 1UG1A 3WXMB 3HM9A 4BNCA 4M71A 2LP0A 3WUHA 2R57A 3W6KB 2Z16A 2R7SA 4UB6C 1MBKA 2HQAA 4M6VA 3CCUI 1VQ7I 2JG6A 2XGXA 1BIZA 3AA3A 3K4NA 3ATUA 3EFRA 4HWIA 2I0NA 4B9WA 2PJRB 3ZLJA 2DFFA 1QMCA 2YUNA 3V8JA 2R7RA 2QQ9A 3GTOJ 3NCIA 3CMYA 4AHUA 2P9LB 5LD2C 4E47A 1RDAA 4O8KA 3Q0WA 1H8KA 2FPEA 2A08A 1A0NB 3WHCA 1S1UA 2DYRH 1R4MB 1SFUA 5ILVA 3CPWS 4BY9C 5GJVB 1R9TJ 4EEFG 3VTIA 3HL8A 1X3NA 1EETA 2JLEA 2ABLA 1B7TA 4PNOA 5GPAA 3CCMI 3HBTA 3M3ZA 5AQYA 2EBIA 2NRVA 2CP2A 3JRDA 1X1CA 1XN7A 1PP7U 1MU2A 3MP8A 1KQSP 2Y75A 2PVOB 1QVUA 5C0YA 1ITYA 4B1VA 3I53A 3CCRN 2GX9A 4Y28E 3HOWJ 4NBQA 2K6DA 4IUPA 1RTJA 4H0PA 1KTQA 2LBFA 3H45C 2OCCH 4CK1A 4U0VA 3U6FA 1P7JA 4M78A 3WGIA 1S8NA 2O9SA 3V81A 3AO1A 3E01A 4YPRA 1TQIA 3AG3H 2VOPA 2F5DA 5AZJA 2H3GX 1KGSA 3DTEA 2IS6A 3IL2A 4M7DD 1Q8IA 2FZGB 4RTTA 2CWEA 5TISC 5FLMJ 5DM7F 5H6RA 4J83A 5CKEA 2K02A 3EG3A 3DXJF 1K8AR 1ASWA 2NRHA 3E66A 4FT4A 3KK1A 4CCMA 1VSKA 2LC4A 3QEXA 4LF4K 1S7AA 1UJYA 5HKCA 3ZMUA 3LANA 2UUCK 3O4NA 2HQEA 2QG9B 4ATOA 5HS7A 2A42A 2K9MA 2E88A 1RI7A 4XH5A 5KQDA 2MOXA 2OCEA 2YR2A 2X4YA 1NU0A 1SS6A 2HPIA 3D7SB 1FBQA 2EH3A 4F4KA 3MKYB 3CCJA 1TL8A 2RGVA 1BC8C 3DMJA 3UWNA 4DSKA 4M7AC 1VRTA 5F64A 2WUSA 3JRBA 5J26A 4CF9A 3MECA 4RW9A 4A59A 4HNUA 3KKSA 1MGTA 4WQ5C 1VQKQ 3FB9A 2W41A 2O8CB 2DK3A 2LZ6B 1P4XA 5HLHA 1S22A 4KNYA 2QAZA 2P9NB 4IOAF 3CD6Q 3OYGA 2RM4A 5GAOq 1TWGJ 3J81Z 1RI0A 1U06A 4CF8A 2QXFA 3THVA 4JN4A 3KWIA 2NLXA 2P5VA 3MMVA 4RM2A 2O2OA 2DPNA 5GAN6 3E9FA 3QETA 1SHFA 4B4CA 1XCVA 3MX5A 5GINA 5AQHA 1FWZA 4XLCA 2NWMA 3MEAA 4Z8AA 2Z2SB 1OISA 1LPQA 4B22A 3I58A 1LW0A 2YNFA 1EH8A 2IEKA 2COZA 5FPNA 2DTHA 4XL9A 5ELZA 3M7GA 4BGDA 1ACMB 1B07A 3FIFA 3ID8A 2DN0A 4F17A 3VUZA 5CVVA 2X1CA 1EBMA 4I9QA 3H0GJ 2HBLA 2D0CA 1CF7A 2JWTA 2Q0RA 4WYBA 4KV8A 1PRMC 1S5LC 3LGLA 2VQCA 1WH7A 2HCKA 3CM6A 2QQRA 4FWQA 5A0LA 1CXUA 4ZTJA 3OQ5A 3P8BB 4I6MA 1SKWA 2RPNA 2QSHX 2Y4XA 3EN9A 3IFRA 4W5QA 5KH6A 5HLGA 3CCLA 4W5OA 3ULEB 1MUDA 1XS9A 2XY6A 4FWMA 2HVIA 4EPCA 4J01A 1F5TA 1VQ8Q 4KHYA 4H8KA 1LAWA 1VQLQ 2EJ9A 3CCJT 4KHUA 4UB8C 4PJOC 4C2MJ 4D9JA 1X6GA 4F8RA 2DRKA 1LUJB 1VSMA 3P31A 1RI9A 1AU7A 2CH4W 5B8HA 5LHHA 4UUSB 3UPUA 3HUGA 3L4QA 1FMWA 4A61A 4OFAA 4KIGA 1Z91A 1V55H 1VSDA 3ERMA 2PNIA 2O8DA 4AIKA 5IAYA 4JJBA 3MKDA 2Y69H 4CFDA 1QVFP 3LMMA 3MP6A 4CHPA 5CE3A 1BIAA 1TAQA 3VQQA 2QQBA 1SF9A 1T33A 1DTTA 2AZSA 1ZREA 4LD5A 3ZQCA 2CSQA 2FBYA 2PVGB 2KVQG 3OYHA 2YHWA 3K57A 1ZSZC 3CF5F 1VQPI 4JZ3A 4RMOA 1YI2Q 4DBRA 3M4GA 3O1WA 4A3DJ 4E19A 3AA2A 1T38A 2DTRA 5BPIA 2IIMA 3J7ZO 1V5GA 3J80E 1T6SA 1V5EA 2W82A 1HPZA 1ATRA 2K3PA 3D5RC 3IUOA 1QQIA 5ECAA 3KEOA 4RAZA 2R7DA 3CWUA 1JHHA 4PJOF 4MDXA 1TWHJ 1WQ2A 3IRXA 2BW3B 2VKVA 4FW2A 3DLLL 2F4VK 2XIDA 2VPLA 2YU3A 4B9LA 2ZCFB 5F2RA 2ID3A 4HSRA 4Y7NJ 2LTPA 4EGYA 1SD6A 1R71A 4PJOE 1USSA 5GANh 4KUIA 4JK9A 4XSZF 3CCLT 2HMPA 2B8AA 3K5LA 2HVSA 2W10A 3JB9H 2QI2A 1FW6A 5IOZA 1JT0A 2GFUA 1T8IA 1YS6A 1NJYA 3X26B 1S3XA 4YFUA 2BZTA 3GNFB 1OLTA 3DLKA 3H5AA 1DU6A 2XDDA 4FVMA 2BXYA 2ACJA 4ZN3A 4KITB 1M1KU 4M3WA 3LSIA 4QPQA 4C2TA 4RTUA 3OS0A 2CUZA 2IGNA 1NGNA 1H8AC 4DWIA 4N47A 3LAKA 3FHGA 1M3HA 1JI8A 5AQIA 4IFVA 2WSCE 3JAMZ 1PVEA 1EZZB 1SZ2A 4OJRA 1K9AA 2IGOA 3SAHA 5AYFA 5DD4A 2E7WA 4CFAA 1KG4A 1L3TA 1J9AA 2X6YA 5DLQE 1VSHA 1JCEA 1EKEA 1ATSA 3E6CC 1YJWA 4X1VA 2KYMA 3FM5A 3F2KA 2R5MA 2LQWA 1YQMA 1JGSA 1UA0A 3DLHA 2OPSA 5LEKA 4KHPK 1T44A 1R22A 1WCMJ 4KI6A 3THXB 1WNSA 3M57A 3QYFA 3IH4A 4PJNA 2DQRA 3BTLA 1MMNA 3M0TA 1KSPA 1IXCA 1Z05A 2HBWA 3DRPA 3RPUD 3WXIA 3OTOK 1IN5A 3C2BA 1XUPO 1WZOA 2DAQA 4B9VA 1PM3A 4DU3A 1S9HA 2K2MA 2E41A 3H0FA 1BR2A 3KKRA 1V29B 4BEHB 3F9MA 1FIAA 5AIPA 3FZMA 3IRRA 3NGPA 1KG2A 3X20B 4YIRX 3HOTA 1YLFA 4CHYA 1K8KA 4HQMA 3G25A 2W24A 2KY9A 1BI2A 4JI6K 2K5IA 3E9GA 5KGWA 3CCRI 4O0IA 1Q95G 2FC0A 1SV5A 1AA7A 1YW9A 2KEAA 1QZZA 3N5BB 1P4AA 2WAEA 3GFMA 1ZXOA 2IDOA 3TOBA 2DFUA 4PJLA 3JCMb 2KBTA 3HPOA 4FJ8A 1I5ZA 2GGRA 3F8CA 3S9HA 1MW7A 4LK0F 2IS4A 4F3TA 4LFAK 1QA6A 3BZCA 2VG5A 2RH2A 3PUFA 3ENHA 2FL7A 2OAUA 4V2FA 2W0ZA 1IZ1A 3R6MA 4PLLA 2FNPA 3BEXA 1Q9YA 3RR8A 4BG9A 2NOFA 2OPQA 4DTSA 4II2A 3RRHA 4XAXB 1ORKA 5HY6A 2H27A 3IDHA 5I3UA 2D0BA 3G71I 4JI0K 4M77B 3PO3J 3G4SN 5JVGF 3K4KA 1REPC 3BWGA 1YJWT 1MUNA 4CHQA 2ZMEA 1GCPA 4A69C 5BPMA 4PJOG 1YO5C 2E2OA 1T7PA 5GIPA 3H9GA 1A5WA 5FO5A 1QWEA 2F4MB 1PSFA 1SMTA 2AHJB 1VIFA 2DL4A 2L8DA 2IGMA 3FRNA 1QHTA 5DS9A 3TSZA 4M75D 3AY9A 2UXXA 3M9AA 4FT8A 1KQ8A 3H1QA 3VS5A 3BR2A 1HYOA 3NGZA 1W5CC 4LLGF 1D3BB 4DR6K 3CUQA 3LYIA 3CP2A 3OVNA 3LSHA 1VQ4Q 3QLHA 1H3ZA 3RVCA 4I0AA 1O3RA 3G7ZA 4BQLA 2D8HA 1KVAA 1D1AA 5KYUB 3G1MA 4EJYA 4KIFA 3PMIA 3NVMA 1X1PA 4HVJA 5KK1A 1YJ9Q 1W7PA 3V9SA 4PIIA 1XMAA 2RJDA 2R93J 4J9EA 2AP1A 2M02A 2FBKA 2CQKA 4MO4A 4BDYA 5FPEA 2G9WA 1LCKA 1EJ9A 4H5WA 1VQ5A 1M5Q1 3VQDA 4BC3A 2MG4A 2OX7A 2R7YA 3J7AP 1XI1A 1S1VA 4V19K 2FOWA 4IWVA 5M1PA 4CFBA 4ID5A 2QBYB 4I98B 1ZK8A 1TNTA 2A5XA 3QDFA 1JLFA 3K2AA 3M1CA 4EHTA 4FWSA 2AJQA 1MSFC 1O3QA 1SFEA 3UA6A 2GXGA 3FXLA 3K70D 1GDTA 1T98A 2LCLA 3HOYJ 3LPTA 3HYIA 1Y64A 4HAMA 3OH6A 1ZN2A 4L5GA 3JTHA 3PT9A 2FMLA 1PUFA 2M45A 2DMNA 1WZ2A 3I0WA 3RMCA 3SUOA 8AT1B 4H0TB 2K3FA 1TXQA 1Z3XA 4CCKA 1Q7YU 3A5MC 1N36K 4FJ7A 1RADB 1N33K 2HL5C 4HW0A 2BUDA 3NWSA 2X51A 4GGGA 5C4JJ 3DU5A 2VWFA 1ZAOA 4M4ZA 2JVVA 1U48A 1M1KO 2JXBA 3SQ2A 2JT1A 4IJNA 4EJTA 1ETKA 3S2WA 4C92C 1DEJA 1LOTB 5GTHC 1GLFO 2F2VA 3MXIA 3RKWA 4G8XA 2DT5A 1X19A 3Q9VA 3I71A 1VQPA 2MABA 3I55N 3WEEA 2HKNA 1QSLA 3V9ZA 3WTVC 3MFKA 4W5TA 4Z02A 2G8KA 2KROA 4BL0B 1X27A 1STZA 2PG4A 2ENMA 5FROA 3F6VA 2P4WA 3LX7A 2O8XA 1FJLA 4QT7A 3H3UA 4B1RA 3CC7Q 2W6KA 1GVJA 2DY4A 1U49A 3WTWC 3S2DJ 2Y9YA 1RZ4A 2HAXA 3ZSQA 1HKQA 1Y07A 3X28B 4BC4A 1U2WA 3F3XA 4FJNA 2Y2ZA 4Q5SF 5IXBA 3GPLA 1VQ5T 2QTDA 4F92B 5AQOA 3ZQGA 2ZJRF 4ENNA 4KFCA 4QLCU 2DFEA 4CJRA 3OJSA 3A2KA 2R7TA 2NZTA 1YXQA 1D0XA 3UKUB 2L54A 4YOWA 4DQPA 2HDDA 3M58A 4RGUA 1C1BA 3N4QA 4DUZK 1QZEA 2R7OA 3WE2A 1TKZA 1IBKK 5E3NA 4AD9A 3MXJA 2R7XA 3QJYA 4GXOA 4HXJA 3VPRA 3QBXA 4C92F 1IHVA 4PKIA 5MLCQ 1LE8B 3VMFB 3P5JA 2F5FA 2DL7A 1WH5A 4G6DA 2RQRA 3LSRA 3WU2C 1NJIU 3MN5A 1SFXA 3CCSQ 4CYCA 4IKFA 3VERA 1C0UA 4C92E 1JTXA 4JD2B 4CZZA 2ZC2A 1NYFA 2ME6A 1IBLK 1GOCA 1IBMK 1RKWA 4LDWA 4AG2C 1QVGP 3BG9A 4KYWA 2ISYA 2HDWA 4XORA 3CC2N 4LD9K 4JLGA 1M30A 1OMIA 3HC7A 3CQZJ 3J7YJ 2R5ZA 1VUBA 2GQQA 4J2EA 3L42A 3EPZA 2DM1A 2XAFA 3HT3A 4AHVA 1VQPT 2XAHA 3IAS2 1X1DA 1SSHA 2ZXHA 1OEBA 1WLPB 2AKKA 3D6RA 1K6YA 4NB5A 4H0VB 1MSEC 3ISPA 2V6CA 1V3FA 2YXYA 3BGRA 5IY5H 4HF0A 3KTUA 4I7FA 4L8RB 2A3SA 1AVZC 4EGZA 1OH7A 4G9ZA 2K9SA 2L3DA 3CMAQ 1KONA 4YDUA 5HRNA 4DV5K 3PO4A 2RQQA 4KGXB 3EAEA 1YHQA 4CRIA 5FW9A 4A3CJ 2XPWA 2M7AA 2GTJA 3S3OA 5GAOr 1RAAB 4DFKA 2J4RA 2FEZA 1SFOJ 2NRTA 4F9OA 3QUIA 2JHNA 2IVNA 2UV1A 3WHBA 3M56A 1OCTC 4D1QA 2IAIA 2VGMA 2IGIA 2YG8A 3OSSC 1VSLA 4BDZA 1O3SA 1IRZA 2VBXA 2KDOA 3FMQA 2MK5A 4F7UA 3CMEQ 1HSQA 3M07A 4FLZA 4YIIA 4FK4A 4NS5A 1FC3A 2M1HA 1M1KR 1TVRA 3P9CA 2E1ZA 3KP3A 3SFMA 4JJDA 3TP3A 3HIFA 3I9QA 1QQOA 2E10A 2OTJN 3VU3C 3MKLA 1VQ9Q 4A3JJ 2FO0A 2ISZA 2JQ7A 1B3QA 2D8JA 4PLIA 2NXNB 2LVSA 3K5MA 4CA0A 3K2ZA 1TUDA 2M1BA 2QDYB 4WF9L 2YNHA 2E35A 4AI4A 2V26A 2BV6A 1ATNA 1RAGB 4K43A 1Q86O 3VYUB 1VQON 4C8QA 3A0BC 1GFDA 2HMIA 1TKXA 4Y17A 3QOPA 2YNGA 3IKVA 4TV7A 5KRSA 4IHXA 2WAFA 5IP6A 3COAC 1YRNB 3G71A 2I5JA 2XRIA 3BZ6A 1YQLA 2NOGA 1IGUA 5DY9A 3L2QA 4XTZA 1L3UA 4U88A 4J7IA 4HT9A 3GTPJ 3R9PA 1OCOH 1BO5O 1N34K 2JPCA 1VSJA 3X2QH 3KBGA 4EJOA 2ITMA 2IPOB 4H5VA 4Q4ZF 4ISFA 2HVRA 5JLFA 2J5OA 2VXDA 1TC3C 1GBQA 2FPFA 4FU6A 3ISNC 3SMSA 2VYTA 2XHKA 2KQRA 1YHQT 5K5OA 4C92G 5C15A 3AA5X 2P9UA 4A3BJ 5CQXA 3K6GA 3G4SI 1KC8U 3EE9A 2FQ3A 4ZGJB 3OIOA 3CXCA 3E6BA 4IOCF 4QCLA 1WJ5A 2FB7A 1WKMA 2QEXN 5C0MA 1LFPA 1HDPA 4AM6A 4B1ZA 3K7AJ 1NZ9A 3AG1H 2JN6A 4JKGB 2JA5J 1ABOA 1L3VA 2FQ4A 4FYDA 4CCHA 1GLNA 4XLPF 4VUBA 4B8CA 4C8QE 3RRGA 1HW1A 2UU9K 5HNHA 4HBLA 1W1FA 4JK8A 2M2EA 4HUEA 2DYBA 1J5YA 2EAYA 3DYAA 4DYQA 1LDJA 3QINA 4CGDA 4IG0A 5EEAA 3BR5A 5FWBA 5IYBJ 4E6KG 3C0CA 2CRGA 2IGKA 2NUPB 2KYBA 4QIWN 3ABTA 4JI4K 4PUOA 3CF2A 5IT9O 1JLBA 2IVMA 3W3CA 4LE9A 2Q1NA 4BAYA 1LDDA 1OCZH 5KYWA 2OAWA 3G71T 3ZSOA 2ESHA 1YIJA 5KYYB 1S6PA 1LMZA 1K0SA 4ZDOA 1SD4A 5GAN7 3TTFA 2C0OA 2QDLA 2X3WD 5BR9A 1AKHA 5FLXZ 1U6ZA 1VQ6A 1ZSGA 4AIJA 9ATCB 3VKIA 4EFHA 3BQZA 1HX1A 2DO3A 3GLXA 2BTFA 1XMOK 1NTCA 3X25B 1UOCA 1W97L 4B44A 3WTUC 3H9JA 4QW2A 2OZ6A 5CZ2A 1HDDC 3J8AA 1T8EA 3CCVN 1W2BS 2HHUA 1FPQA 4IUVA 4ZYDA 4FE4A 3LWIA 2K9GA 3CIPA 2CYYA 3NE6A 4JLIA 2VUMJ 3MCPA 1Q86R 2DMTA 1I94K 1KQSM 2PLYA 1B72A 2FF6A 1ULYA 2PMZA 4IUQA 4N4GA 1RTIA 1ZBHA 2COYA 2DL3A 2F96A 2PQ8A 2RF2A 2DD4A 2EFOA 5AFUH 3GF2A 1U6GA 3THWA 5JLWA 3HKZN 2F2EA 1NEBA 4DU1A 1UJ0A 1NOZA 2O8EA 1CGPA 2P0PA 1B9NA 5FDLA 3R8EA 3QU3A 3PO5A 3ZSXA 4H03B 2XUBA 3WGHA 3S16J 2IAJA 4FZXC 3IWZA 2EILH 1OR7C 3VS0A 1LFBA 4D6WA 3SDZA 4ELTA 2HKOA 5LJ3h 4WQ4A 3BLYA 1IUFA 1WQWA 4DOVA 3TW7A 2DMQA 3G1LA 4ZTFA 2JSCA 3C2GA 4MZMA 5GJWB 4EVIA 1YIJT 2J6KA 3NAEA 4BH9A 4FLVA 1XC3A 1T6DA 3L2CA 4AHTA 2O8FB 3EY1A 1P9QC 1M2VA 1VQ6T 3HOVJ 3LLRA 1LNXA 4ID1A 3OYJA 3GO5A 3GDQA 3BE3A 4DLEA 3VPZA 3TO9A 5K1YA 4C8QG 2IIRA 4QS9A 5F27A 5J1RA 3C2HA 4CO8A 3CP8A 1RT5A 3E1YA 1SPKA 4X9CA 2V52B 2HKQB 2OANA 2M4GA 1HNZK 1FK9A 2YHXA 1TUCA 3WQUA 4QQDA 1OKJA 5EGOB 3AO4A 1BW6A 2NNYA 2J6FA 3VEOA 2E19A 1KG3A 1N32K 2MSYA 2X1EA 3OBWA 1NGFA 4CSWA 1R6RA 1K4US 2KT8A 3LA3A 2L9RA 4HDVA 3S17J 3G10A 1RRJA 5FLVA 4AFUC 3CC2I 4RW8A 3SFIA 2FBTA 2YI1A 4L9VA 5GAOl 1BUPA 2B7EA 3PFYA 2E5QA 4N41A 4J9FA 1T0FC 3C6HA 5CKTA 5JVTA 5LJ5e 5CCAA 3DLRA 3ECOA 4MLOA 3M1EA 1XWLA 1MBJA 2YRCA 1RDUA 2LF8A 2WB1A 3V1OA 4CJVA 4OU0A 3FLCO 1XGSA 2IA2A 4XIUA 1U5TA 1S6QA 2Q8KA 1L3SA 3FFIA 1QS4A 5FU7B 2BXZA 2RKHA 2R5YB 4CI6A 3ZT2A 2XGDA 4HF2A 4B08A 5ED4A 1PHTA 2FX0A 3DXKB 3E2UA 4L59A 4OGEA 2F8SA 2RJFA 4R55A 2FSWA 3QXEB 4KHWA 1BI3A 1RPWA 3I0SA 1B9DA 5D5VB 1YQRA 4Y33A 2QWNA 1U8RA 2EK5A 1QWFA 2K9NA 3H1CA 4CGZA 2MWPA 3A8MB 5BS6A 4OMLA 3ZFJA 3CFOA 2ROTA 3GZ6A 1SSFA 4XNFA 2FHDA 1ESVA 1WRJA 4U87A 5H20A 2Z1IA 2JS2A 3RSEB 3HB9A 4LF6K 2KIUA 2OTLA 2DBBA 1UDLA 2ZZDA 1LWCA 4OWRB 4MQ9F 4X6AJ 2KIMA 1UAXA 1QSSA 4Z89A 3CD6I 4DV2K 2OTJI 3CQ8A 1GOAA 2FA5A 5BPNA 1JXMA 2KMTA 1MJ9A 1HD3A 1RT4A 2CZ6B 3WQTA 2DTIA 1WFXA 1VQNQ 3I59A 2VE9A 4IRHA 4BWMA 3HGGA 4KH1B 1XMKA 2ZCWA 3M0RA 5J2MA 4A12A 1VQOI 1V5FA 2L2OA 2G8FA 3UIQA 5I11A 5BN8A 3VYSB 2I8DA 1QVFM 2QKBA 2HHQA 4DEXA 2NOBA 4H0OA 3BR1A 2EQRA 4AM3A 3CCUQ 1VQ7Q 1LQ1A 3U21A 1CZ9A 4CVNE 2DTZA 1QQCA 3O8MA 1W36C 5L3CA 4LG0A 3DM2A 4DKWA 4JDSA 3CJRB 1DIZA 1MUZA 1W1WE 2ZNYA 3VS1A 3D2FB 1M3BA 4LB6B 3GTKJ 4JI7K 4AFZC 3TDUC 2VC0A 2CS7A 1UELB 2KDZA 1K73C 2K3XA 5DCFA 1PP8F 3J81E 4M7DA 4P5NA 3Q3SA 2QLZA 4JP0A 4PA1A 3IH3A 1NK8A 1AWOA 2P9IA 2LR8A 2HS5A 2PU9B 1WX6A 1VQ8I 4ORZA 3HSEA 5KYXB 3CCMQ 1JKOC 1QPMA 1P4WA 4B9MA 4JLHA 1DGWY 3GBGA 4BR5A 1YQAA 4GDFA 3VQ5A 5J6XA 2UYTA 2KR3A 2K7AA 2JTMA 2DCEA 4YOQA 4ZGDB 3OMGA 1UGSB 2HWVA 2QEXI 2RPIA 3OWTA 2QGUA 5D5WB 4NCBA 1PCXA 4OVLA 2O8KA 4EQQA 5GAOn 3MEXA 3T1BA 1KQSA 2OTLT 3K1NA 1NWKA 4CIFA 3JCMc 1KQ0A 3DWLA 2I2LA 3CF5L 2JA2A 3AGRA 2ETHA 3L2UA 3ZYYX 2X85A 1K7AA 1IXSB 4PDKA 2LX9A 3C4SA 1HMVA 1VYVA 2M5WA 3VSLA 3SWNB 4R56A 2BH1A 4BJ6C 4OKKA 1A5JA 4HZFA 4JRQA 2LOOA 3DKYA 3NBPA 1DPUA 3DB3A 2W7NA 2W03A 1YI2I 3CC4I 3R60A 4FZZA 3CJBA 3TSPA 3JCMW 3PSIA 3VYRB 1N6QA 4Z88A 3FXUA 3SNNA 1FBSA 4K41A 3TTDA 1O1WA 2M3AA 3PE0A 3ULQB 1B8IB 1WEIA 1TYQA 4M77C 1OX9A 1ZHIA 5AONA 5DM7R 4A93J 4RG8A 1HBXG 3EG1A 2XDPA 1RTHA 1QCOA 4M7DE 4WCEL 1SMYF 3I5RA 3O5BA 4Q48A 2ASOA 4J5YA 3HHTB 3JSMA 3FGUA 4Z4GA 4PL8A 2F9WA 2DJIA 1LOJA 2KQWA 1I1JA 4DR7K 2X3XD 4HSTA 3OMYA 3H9QA 3K69A 1NBWA 4CC3A 1BQNA 4RCCA 3SDGA 1SL2A 3PNWC 2AIRB 3VQ4A 4PJ0C 3CCVI 3PX0A 4L6V5 4DJAA 4LLNA 3M4YA 4FWPA 1X01A 4JYKA 1P59A 1RBVA 2LTOA 4DOWA 3OS5A 5AQPA 3U1KA 1QSYA 5CPRB 2YSQA 4RBOA 2I10A 3NTKA 3FDRA 2E2HJ 2JA7J 2ZJ2A 5L3FA 3AT1B 4OF1A 5D7UA 1JL1A 4N0AC 3CJTB 2VBWA 3S14J 2JRMA 3NF7A 3EUHC 3BFMA 3HVRA 3V1QA 3L2WA 5E18F 2E6LA 3KXTA 4DV4K 2YX7A 3H92A 4CC2A 2XKOA 1QZ6A 3CCEN 2JUGA 3FISA 4M77F 4CBXA 3VENA 3U9GA 1B59A 1NK0A 1H89C