4ZTFA

Crystal structure of the prototype foamy virus intasome with a 2-pyridinone aminal inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 2-Pyridinone Aminals: A Prodrug Strategy to Advance a Second Generation of HIV-1 Integrase Strand Transfer Inhibitors.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna/inhibitor
molecule keywords Integrase
total genus 103
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ztfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ztfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ztfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ztfA03
4CFBA 2RHXA 4RG2A 3K2PA 4HHTA 3QEWA 4ID1A 4DWIA 3ZCMA 3SPZA 2JGUA 1XHXA 4B9SA 4M42A 4UC4A 3S3NA 1BQMA 1B9FA 4IG3A 4KO0A 4KKOA 5FRMA 2HHWA 3OS2A 1C1CA 1JLCA 1W9HA 1EP4A 3AVGA 4FW1A 4Z4HA 3O4NA 1NK9A 1H3ZA 3B6PA 2LDMA 4FJMA 4IUVA 3ME9A 3KUFA 1HJRA 2X74A 4KHQA 2O4IA 3LP2A 1ZBUA 3OYLA 3AVLA 2GF7A 5CZ2A 3V9WA 2L3RA 3V9SA 3QESA 3V9ZA 4CEFA 3MEDA 2R7YA 2G8FA 4FZYA 3JSMA 3AA4A 1JL2A 3ZSQA 1XC9A 4E7HA 1QS4A 1D9DA 5HROA 1WLJA 5D6WA 4DTXA 2VG7A 3ZT3A 3RMBA 4I2QA 3AVJA 3NFAA 3DB4A 3OB9A 4II1A 4DQIA 3V4IA 2HHTA 3NTIA 2LCCA 4DQPA 3TWHA 1WGSA 1K6YA 3MP8A 2R57A 2IDOA 4RW8A 3LALA 3LLRA 4DSFA 4FJ8A 3ZSZA 3OYFA 2XY5A 1DLOA 4DFPA 3TAQA 2KFZA 3AO1A 4DLEA 4C8KA 1WJRA 4ICLA 2OYQA 3TAGA 1UAXA 2BE2A 4AH9A 3QBYA 1L3UA 5E41A 1VSEA 4B9VA 1G5VA 1BI4B 3AVKA 1FKOA 4AHCA 1UOCA 3QJ6A 3UIQA 3NGIA 3NH1A 2OZMA 4RW7A 3NHGA 4MQ3A 1BCMA 4KB1A 5D3GA 2D9TA 3UT1A 3VQ6A 2BGGA 3M8SA 4PL6A 1ITGA 3KKSA 3QETA 1S6PA 3MP1A 1RCHA 3WNEA 4FJLA 2G8VA 2GBZA 3HO1A 4FLVA 4A4GA 1KHCA 3KLIA 5CY4A 1ASUA 4CJSA 4KAZA 3T19A 4M3YA 3NF7A 2X4WA 2X35A 2Y1JA 1D9FA 2VWJA 2KZMA 1VRTA 5I3UA 2W42A 3OMGA 1IKVA 3E9FA 4O55A 2RHZA 4AHUA 1ASWA 1KVBA 1KVCA 2E4LA 4OJRA 4JRPA 3QNNA 3M8PA 2YV0X 4OKKA 3DLEA 4I7FA 4RW4A 5C24A 5HRSA 2EQJA 3KLHA 3RR7A 2HQXA 3RWUA 4CEEA 4DS4A 3CM6A 3QEIA 2JZ2A 5D6XA 3NGZA 3SYZA 3MO8A 2BIVA 2RF2A 3L8BA 1TK8A 2F8SA 1C1AA 3VQPA 4Z4IA 4YNQA 4Q5WA 2EKOA 2QKBA 4C5IA 1REVA 2EQKA 1KCFA 1WAJA 1QE1A 4CF2A 5J2PA 4A4FA 4QOZB 5JS1A 3KK1A 3O8VA 4ID5A 3IS9A 4CGHA 4DTJA 3VQ7A 4AILC 4NZGA 2FBYA 2B8AA 2LRQA 4Z02A 4W5TA 4Q5VA 3L42A 3ZT2A 3SNNA 5CYMA 1QQCA 4B8CA 2X4XA 1ZBIA 4CHPA 3O3FA 2YHAA 1SL0A 3RRHA 3OS1A 4CFDA 3PX4A 2D5RA 4Q0BA 1CXQA 2XDPA 4B9XA 5SZTA 3HK2A 3KKRA 3OYKA 4LH5A 3VQDA 2BKDN 4QQDA 2DY4A 3G10A 3ASMA 4FJ5A 4OPJA 2XK0A 4C5HA 4DS5A 4F8RA 3AA2A 3K59A 2FC0A 3HYFA 3C94A 3OJSA 4CHZA 1IH7A 1LW0A 4MFBA 5D6YA 5IN1A 3K58A 2DTUA 3ZT1A 2XY7A 1TVRA 2F8TA 1D8YA 3NTHA 4BE0A 1S1VA 1T7PA 1TKDA 5J26A 3H6ZA 2IC3A 2G8IA 1VSDA 3AO4A 5C25A 4DG1A 1VSMA 4TSXA 1BCOA 1JLEA 4BACA 2ETJA 4BDYA 2LTOA 4W5NA 3OYDA 2DFEA 3K57A 3NBPA 5KE2A 3QLHA 2WACA 3HP6A 1CZ9A 2YHBA 4OVLA 3C6UA 3WNHA 3E9GA 1WJQA 3OYHA 2DIQA 4DLGA 4E3SA 3KJVA 4DF4A 4E89A 4W5QA 3F9KA 5HLFA 4CF8A 4BDPA 1BGXT 4EP5A 3PUFA 4CK1A 2RJDA 4FK4A 3SUOA 4KHSA 4J2BA 1XWLA 4DQSA 1TK5A 2GUIA 1Q8IA 4I9QA 3PMTA 2HHQA 3OYJA 4CJVA 1HQUA 1NKEA 2ZQBA 5HBMA 3L2WA 4M3RA 3ZEHA 3NAEA 1RTDA 1BL3A 3GOXA 1U04A 3AA3A 4DF8A 3ITHA 4M3ZA 3LX7A 1GOCA 3WNFA 3TAFA 3SQ2A 4F3OA 3MXIA 3OYMA 1OYXA 3QIIA 4CEQA 4FU6A 2ZE2A 3RMDA 3ZSRA 1SKSA 1RDCA 4B9TA 3OJUA 3FC3A 2VG5A 4NCGA 3ZSYA 4CEZA 4JS4A 1J53A 1MHNA 1LAWA 2P1JA 4RW9A 3ULDA 3T3FA 2RHYA 1NOYA 1QSSA 4M3WA 4CJ5A 3LPTA 4FZXC 4FYDA 3LGLA 4KI4A 4LH4A 4DFMA 4CHQA 3U3GA 1CLQA 5KE3A 3V9XA 3DB3A 1WNSA 5KRSA 1C0MA 1RT1A 1HMVA 3TI0A 1XNIA 3NF6A 3LDSA 1IKWA 4DU1A 2KFNA 2KQ2A 5M9OA 2HB5A 3SUQA 3B6OA 3AO5A 1RBUA 1S1WA 3S9HA 3SI6A 1S9GA 1RT3A 1RTHA 1T03A 4FK2A 4OLAA 3MEGA 3LWMA 4Y1CA 4KHNA 2MWOA 4I9LA 4CIEA 1RT2A 2RI2A 2F5KA 1N27A 3H08A 4CESA 3KD1E 4FJXA 4FJ7A 1FK9A 1L5UA 2G8HA 3L3VA 3HP9A 3S6WA 3VQCA 4IBNA 3VA0A 4OKEA 4FLXA 4Z0UA 3LP1A 1RT6A 4CHYA 3V6DA 3NE6A 4J2DA 1RDAA 5KCOA 1RBVA 5KH6A 2IAJA 4O4GA 5KGWA 4FL6A 1CZBA 2JLEA 3MEAA 3FFIA 4QAGA 3VA3A 2ZD1A 1ZBHA 1TAQA 3L2RA 5KRTA 4DTRA 3SUPA 1J54A 2NUBA 2PY5A 2OPPA 2QXFA 2BANA 3VQ4A 4Z4CA 1QTMA 3AA5X 4DSKA 4CJ3A 3CFPA 4N76A 3TAEA 4FLZA 1WSGA 2YNFA 5HRNA 3K5LA 4PLIA 3JYTA 3MEVA 4FCYA 4A4EA 4G1QA 1B92A 1TL1A 4FLUA 2CKKA 1G15A 4FLTA 3THVA 2R5MA 2EHGA 1JLFA 1DTQA 3PNWC 3ISNC 2G8WA 3OYEA 3IG1A 2QKKA 1DTTA 3I0SA 1RTIA 4EZ6A 4ZTFA 3DLMA 4F2RA 3DLRA 2EQUA 3KK3A 3SQ1A 1S5JA 3MECA 1N6QA 4PWDA 4CEAA 4E19A 4C5EA 4FM1A 4L59A 1KVAA 3VQ5A 3PO4A 3AVMA 1TKXA 3RMCA 1JXBA 4LSLA 5HRRA 3OMCA 3V1RA 3VQ9A 4BE2A 3A2FA 5IAYA 4DFJA 3EAEA 3LGFA 2P5GA 4LY7A 2D0CA 3BGRA 3NCIA 1WSHA 2DFFA 4A4HA 2RKIA 4NYNA 3C6TA 3DRSA 4BE1A 1WSEA 2YNGA 1S1TA 1JL1A 1T8EA 1TGOA 4E7KA 4F2SA 3KTQA 4CK2A 4CJFA 2XHBA 4B9MA 3OYAA 2FBTA 3OY9A 3DI6A 3VQBA 1Q9XA 4FM0A 2HNDA 2YNIA 3HL8A 3VQEA 4CFAA 3DYAA 3RTVA 2M16A 3E01A 3NDKA 2PYLA 5KI6A 1KFSA 3DLBA 1NK0A 2O4XB 3AV9A 3LP0A 4N47A 5CIUA 1MU2A 4BWJA 2G8KA 1UA0A 4F4KA 3PY8A 1NKBA 3OS0A 1IO2A 4N4GA 4LD6A 4M41A 3LPUA 1VSHA 3OYNA 1LW2A 2Z1GA 3LZIA 3G0ZA 1QSYA 1HYZA 4OPKA 1RT4A 4HUEA 1NOZA 4DTPA 1NK8A 4QCLA 1RI0A 2OPQA 4FJGA 4M3TA 4KHUA 2Z1JA 1RDBA 3TAPA 3CEYA 1XHZA 4J2AA 5DMRA 3CFOA 4FJIA 1SSFA 2RHUA 4N4HA 2Z1IA 3Q1JA 4B08A 2YKNA 5C42A 1NJXA 3NNQA 2E6LA 4BDZA 1SV5A 2IS3A 3P1GA 1KFDA 4H4OA 3CQ8A 3SV4A 4OKJA 4WE1A 3L3UA 3S3MA 4CJUA 5SWMA 3WNGA 5C6SA 2F96A 3NF9A 3KLGA 3EY1A 1IG9A 1HQEA 4PUOA 1EETA 4IFVA 5JS2A 4QVZA 4AHVA 1VSFA 4FW2A 2MWPA 4W5RA 2M1HA 3C95A 2G8UA 1GOBA 3NTKA 4IURA 3OYCA 2QK9A 4DQQA 2RO0A 2BDPA 3MEUA 4YFUA 3RR8A 2IOCA 2I5JA 1HNIA 4NS5A 1A5XA 3L2VA 1OZ2A 4O44A 2FBVA 2XY8A 4B8AB 4E1NA 4IDKA 4DU4A 1NK5A 3HVTA 1C0UA 2Y1IA 1CXUA 2M0OA 2FBXA 3DLHA 2KZZA 1SL2A 2A1RA 1ZBLA 4KHWA 3P8DA 2GFUA 2OZSA 2OPSA 3CG7A 4PLLA 2QQSA 1WAFA 3KLEA 3HXMA 1RBTA 3FLGA 2WOMA 3U3YA 4N41A 1WN7A 4PY5A 3DOKA 3MXJA 2HQEA 3OYIA 3H8ZA 1F21A 1LWFA 3VN5A 1NJWA 2ITGA 3MEEA 1NKCA 1IKXA 4DSJA 3O4QA 4C5GA 4KFBA 3HT3A 1RT7A 4FVMA 4HUGA 1TKTA 2VG6A 3META 4ELUA 2O4XA 2HNYA 3K5MA 5I42A 2E6NA 1TL3A 2D0AA 3DLKA 3VQ8A 4Z4GA 4QQGA 4C8NA 1U4BA 4FJKA 1BISA 2P0KA 4HCZA 1R0AA 4CRIA 2HNZA 2VYTA 3LYIA 3PX6A 4CJRA 5KCHA 3V81A 4M3UA 3MP6A 2D0BA 4CEOA 3O3HA 2YKMA 4O0JA 5FDLA 4CIFA 3RMAA 1YTUA 2HVIA 1X9WA 1C6VA 2BUDA 3D45A 1LWEA 3V1QA 4CJEA 2L8DA 4NCAA 1RDDA 3M8QA 4DQRA 5J2NA 4KI6A 2EFIA 4HCCA 3AVNA 4B3OA 2XO7A 4K8XA 4OGCA 4E7JA 3PMIA 4BD3A 2RPIA 2KW4A 2HVHA 1RT5A 3HVRA 1U49A 3IAYA 3U6FA 3HSTB 1WSFA 1W0HA 4KTQA 2IGIA 3SQ4A 3AO2A 3T1AA 3IRXA 4CEBA 1LV5A 4DSLA 3F70A 2PQWA 2HHVA 2B6AA 1C1BA 3L2UA 3TANA 4W5OA 2YRVA 1HRHA 1JLAA 4FLWA 1LWCA 4DMNA 3PO5A 2PYJA 1HYSA 3FEOA 4CJKA 1RBSA 3DRRA 4XIUA 3SD4A 2AJQA 2XY6A 2LVMA 3OA6A 5KGXA 2ATQA 3DM2A 4HVJA 4KREA 1ASVA 3NGYA 3EZ5A 3P83D 5J2QA 1X9SA 4EDUA 4FJJA 3BDPA 3HJFA 4C8MA 4AHSA 1RBRA 2WONA 4HCBA 2HHSA 1FKPA 4EZ9A 4QQ6A 3VQAA 1YTAA 2GV9A 4DTMA 4GY5A 2DFHA 4GMJB 2K3YA 3MEWA 1HNVA 4DTNA 1NK7A 3S3OA 1OZ3A 1KLMA 1O1WA 2KTQA 4E7LA 4OLBA 1D5AA 3DOLA 3SUNA 3QEVA 2RJEA 4X34A 3D0PA 4HUFA 2EX3A 3F73A 1SKWA 4CF0A 3AVIA 4FJHA 3QEXA 4BWMA 2X6NA 3BDLA 3P5JA 1NJZA 3LAMA 3LP3A 4FJNA 1HYVA 2RJCA 4NCBA 2X4YA 1S1XA 4IG0A 5J1EA 5HP1A 1QSLA 2L89A 1S6QA 3QINA 4KTWA 4CFCA 3QNOA 1TK0A 1SKRA 2HMIA 4Z4EA 1T05A 3TARA 4N56A 3NH0A 1VSKA 4RW6A 4JRQA 3MXMA 4DSIA 3M8RA 2RN2A 4CERA 4UQGA 3QERA 4PQUA 3KD5E 1KTQA 4CHNA 2GFAA 4DTUA 2OA8A 4FLYA 3P8HA 3AVBA 1B9DA 2R58A 1TKZA 4KHYA 1LAVA 2Z1HA 1RTJA 4O5BA 2K3XA 3LAKA 1VRUA 5CZ1A 4LD0A 4CHOA 1L3VA 1WSIA 1BHLA 4CJLA 3SV3A 1NJYA 4CGIA 3NH2A 3C4SA 3DRPA 1J9AA 1I39A 3M9QA 1S9EA 1UWBA 2A1SA 4CJQA 1JKHA 4LSNA 2FHDA 5EU7A 1KLNA 4KTZA 2EQMA 3L2QA 2R5AA 2VWKA 4CK3A 3MAQA 4ELVA 3AVFA 2XRIA 5FROA 4CIGA 1JXEA 1QHTA 3ALYA 4H4MA 4Y1DA 3LZJA 4ELTA 3AVAA 2DAQA 4KB0A 5J39A 1Z25A 1N5YA 3SJJA 1J5OA 2RHIA 4KPYA 1A5VA 3HM9A 1XI1A 4M3XA 5DK5A 4CF9A 1U48A 1HPZA 3ZT4A 3CFRA 4ZTJA 4RG8A 4AHRA 1EKEA 1GOAA 3CYMA 1L3SA 3PX0A 3LANA 2E5QA 3KK2A 1YVUA 5C0MA 2Q3SA 3V1OA 2JTFA 2X6SA 3PFSA 1KSPA 5T7BA 3OYBA 4CJWA 3EYZA 2B4JA 3CM5A 1EX4A 4CJ4A 4DFKA 1TV6A 4Z4FA 3LH0A 5K14A 4IUUA 1VK0A 1WSJA 2P51A 3OVNA 4CGGA 4KRFA 4C8LA 1A5WA 1OI1A 2HW3A 4CGJA 3SCXA 3ASKA 3DMJA 4DTOA 1UA1A 3OYGA 4IUPA 4EP4A 1BI4A 3QO9A 2PZSA 3RRGA 3SPYA 4B9NA 4C8OA 4FJ9A 4GVMA 1JLBA 3KIOA 3QIOA 2YNHA 3KLFA 4FK0A 4B9LA 1ZBFA 5J2MA 3SQ0A 1VSLA 5HRPA 3LWLA 4N5SA 4N4IA 2HHUA 2RI3A 1IKYA 1Z26A 2LSNA 3AO3A 4CGDA 2IG0A 4E1MA 1JLQA 5KTQA 3QEPA 5FRNA 2RI5A 1VSJA 3ZSOA 3HPOA 4AHTA 3PV8A 4K8ZA 4CF1A 1Q9YA 2G3RA 3HPGA 1BIZA 4DSEA 5CYQA 1ZYQA 2NLUA 3OQ5A 1C0TA 1SL1A 1NK6A 2O4GA 4IFYA 3UWNA 3TR8A 4B9UA 3DLGA 3V9UA 4CE9A 1KRPA 1RILA 1U45A 1EXQA 1I3AA 4FXDA 4CECA 4DU3A 1WJSA 2OPRA 3QIPA 2X78A 3VQQA 4ZHRA 2QQRA 4L8RB 2B5JA 4NYFA 2DIGA 4B9WA 1L3TA 1NK4A 3ZSVA 3NF8A 4HTUA 4J2EA 3K5NA 4FZZA 4F3TA 2E6MA 3FDRA 4I2PA 4O0IA 3QKJA 4CEDA 4H8KA 4DTSA 3TABA 4E7IA 4KV8A 4CGFA 4R5PA 4IUTA 1S1UA 4CJPA 3SZ2A 2HHXA 3K5OA 4M45A 4CJTA 4FM2A 4OVAA 1X1PA 3HPHA 1RNHA 3AVCA 3ZT0A 1U47A 1BQNA 1Y97A 3O3GA 4E0DA 1X9MA 2RJFA 3ZSWA 4JLHA 4IKFA 1YT3A 1JLGA 1FXXA 4JS5A 4PA1A 3TAMA 1SUQA 3AVHA 4GW6A 4IUQA 3I8DA 3I0RA 4CCHA 2P5OA 4QW2A 1VSIA 3ZSXA 4OGEA 1BIUA 1TAUA
chains in the Genus database with same CATH superfamily
2RHXA 2JHJA 4DGWB 5C15A 2X51A 3EGDA 2XRNA 1XHXA 1VQ6N 3QOEA 4WTOB 1NGDA 5CKHA 2K9MA 4IG3A 5FRMA 5LL6Z 2X1DA 1C1CA 4AC0A 1X3MA 2X74A 1QVFA 1B8IA 3IUOA 3K1PA 1BW5A 2EW3A 2I10A 2K9LA 3VRZA 3UKGA 1GXPA 1M1KU 4YOYA 3TBIA 4UNOA 1KU9A 3NTIA 3CJ7A 1FMWA 1R77A 4CJ7A 2COYA 3LLRA 2NYXA 4NC7A 4C0DB 4M6VA 2HKOA 4XKVA 4C8KA 2E1MC 1NWKA 4BRIA 3TAGA 2BE2A 1KK7A 3JS6A 1SAZA 1WB9A 2PBDA 5LMNK 2V8KA 4RW7A 4X1EA 4F55A 3VQ6A 1Z3YA 4LG3A 1IJJA 5CY4A 2E70A 1VQ9A 4BUGA 2WB1A 1VRTA 2P0WA 5CPRB 2CW8A 1HNWK 1JHHA 3H5RA 4OJRA 5F2RA 3RKQA 1IAWA 3EKUA 1Q82C 3RWUA 4X1VA 4OFEA 3IH2A 2JZ2A 1MBGA 3LSMA 3GFIA 3JCMb 2LQWA 2GTOA 1UB9A 4A53A 2M87A 1RADB 5FLVA 4ID5A 4YOTA 3MX2A 3G1OA 3ZQHA 1RAAB 3NHNA 1ONVA 4CD1A 4LN2A 2DXBA 1LOTB 2PMZN 4C8QB 5E3MA 2ZXHA 2XDPA 4QQDA 2HEQA 4WFBL 3SZGA 1WYXA 3MKLA 3MEXA 1TVRA 4MO7A 1M1KO 3CCVQ 3W3CA 2AXLA 3FX3A 2LC2A 4OB3B 1OMIA 1FBQA 1JLEA 1CF7A 2WACA 4DF4A 4EM1A 3TO6A 2F2XA 5GMKh 2HDDA 2ZJQF 1PYVA 1TK5A 1NMNA 1Q8IA 5FWCA 2HHQA 2KYBA 4ZJZA 1BK2A 2K2VA 3ZEHA 4FWSA 3FZFA 3I33A 3FIFA 3I3LA 4U88A 2X9DA 1K8KB 1EWRA 3THYA 3A5MC 4FYDA 5HS7A 3CW7A 1DGRM 2K3BA 4XEIA 1SD7A 4CC2A 4PJOD 2E5NA 3TI0A 5IXFA 4EVVA 4E1JA 3JCMf 4OLAA 1QQIA 3HOZJ 3K2ZA 4AM3A 2F7TA 3M3ZA 3CETA 2IIRA 3OIPA 3HM5A 3V6DA 5MLCQ 4EMKC 2WC9A 1T08B 2OFKA 3BG7A 3KLNA 4QAGA 1F43A 4ORZA 1Z6RA 3H41A 4DTRA 1OYWA 1YIJI 4XRSA 2NUBA 1QZZA 2EK5A 4CJ3A 2YUQA 2EJ9A 4CYDA 2FX0A 4A4EA 2WAFA 4RMNA 2NRRA 1TL1A 3G3ZA 3THVA 2D6FA 3W3DA 2EQUA 1KONA 3G4ST 3KP4A 4PWDA 2D45A 3MJXA 1SMYF 3QZ9B 3MWPA 1ZBSA 4IQ4A 3TEDA 5AR0A 2OTLT 2OZUA 1WZ2A 3DKYA 3CC2Q 2HNDA 4LK0F 2I7NA 5E20A 3RI4A 2IPOB 5TJJA 4HNTA 5BMZA 2NOBA 4N4GA 2ZO4A 3CJTB 4EJTA 2VYPA 2Z1GA 3LPUA 3GTLJ 1VQLQ 1YJWI 1PWTA 2QQAA 3O08A 1K4TA 3CEYA 5HLIA 2WWYA 4BC2A 1EO1A 1T98A 4YOQA 2QBYB 1ABQA 2YKNA 2QVOA 2IS3A 3CCVA 2HDAA 2HL3A 2JG6A 1JCGA 1IG9A 2X0LA 2ZPEB 1J09A 1WZOA 1VQKI 4I0AA 2QWMA 5L8RE 4CHUA 1JI8A 2GGRA 3PT9A 2ABKA 3RR8A 4NS5A 5LJ3h 4LK1F 1V76A 2O2OA 3CWAA 1N32K 3NEUA 1I81A 4U87A 1UHCA 2OZ6A 4OINF 3QPTA 1VQ9T 3FDYA 1PP7U 1Z77A 4J5YA 3F0CA 4C5GA 1PSEA 2DTOA 3GZ6A 3M8EA 1WSUA 3WG9A 2M8EA 1ZUKA 3EYYA 4CEOA 1U6ZA 2NUPB 1FBUA 3C7JA 1FX7A 3AVNA 2H09A 4BD3A 2R5YB 1JT6A 1HUXA 4NNJA 4DSLA 4BRKA 4KN7X 1VYUA 3BDUA 2Z0WA 1MDMA 3GF5A 4EHTA 2R7RA 1AT1B 5M1FA 3KE2A 4FSXA 5J3BA 2K7LA 3LSKA 3ZOBA 3LM2A 5J47A 3I9V2 2ESHA 1BUPA 1RDUA 4IHTA 4EQQA 5FKLA 3I0WA 1VQ7T 1W7PB 3U9DA 3S2WA 1YF5L 4IOAL 4JYKA 5E3NA 2LZ6B 1S72N 1S3JA 2R4GA 4BWMA 3CJ9A 3QODA 4L5IA 1D3BB 3J8AA 3R6OA 1Q7YU 3KP3A 4PJOC 3CXCA 1TW3A 2Y0SN 4JRQA 4A59A 3HB9A 3QERA 4D5FA 3AG2H 2GFAA 3REAB 4XQ3A 3LAKA 4LD0A 3CC4T 2HI3A 1QWEA 3CBPA 3SV3A 1VUBA 4CJQA 1YJ9A 1IUFA 2RQQA 1VQ7Q 2OC6A 2C0TA 1W5TA 1OCCH 4DUYK 2RHIA 2YSRA 4X0GA 2ZFWA 1EKEA 2XGDA 4MFEA 3OA9A 2JTFA 1YN8A 4B1WB 3CCSN 1KSPA 3CM5A 4MEYF 4PUSA 5GAEJ 3O9RA 4BRDA 1OKRA 2LVSA 4IUUA 2DBKA 1A5WA 2KROA 2ROTA 2HW3A 4DKWA 3HRUA 5BNGA 3EHQA 3FXRA 3CBOA 3H0HA 2J06A 3M8FA 3EFOB 2V79A 1KG4A 4JQFA 1XTDA 3G71N 4Q48A 5IHIA 4MO4A 3JR9A 4JK1X 4O6JA 2NLUA 3FLCO 1ZYRF 4N0AA 4CE9A 1Z7LA 2ECBA 3REOA 2NRXA 5GAN7 3HGGA 3QDRB 1E4FT 4HTUA 2DFUA 1SHGA 4R5PA 1S1UA 2FPEA 3K5OA 4B1ZA 2M8GX 4PDKA 1XUPO 2COZA 2J05A 4OAZA 3IWZA 3ZSWA 1KD1R 3WHBA 1YT3A 1AWWA 2LREA 4CCHA 4DZJA 1IV0A 4B48A 4AFSC 3CC7N 3DTEA 2DMOA 3VEZA 1W0TA 4LLLA 2V7FA 2PQ8A 2RREA 2R93J 5AZIA 2NYSA 3EG0A 3ME9A 4HRIA 5GAOl 3G6ET 2MGQA 3K9TA 3FSPA 2EZKA 3QESA 3HZJA 1W0UA 3PFYA 1MPGA 1BA0A 5H6RA 2WV1A 3MMYB 1X19A 5D6WA 3WG7H 5M1KA 1HW2A 4RWTA 1X4PA 2LNVA 3UATA 4BJTA 1BU6O 3G4SQ 1VQ9I 1YRNA 2F9TA 3NGIA 4A3BJ 2LRDA 5L3CA 3VWBA 4AF1A 5KYNA 4BY1J 1GXIE 3ZPLA 2M51A 3A0IX 3VF4A 3OMGA 1MJBA 2VT3A 3RVCA 3RR7A 3DLEA 4MEXF 1ORNA 3JRCA 3QEIA 4L9NA 1H88C 1IRXA 3EGDB 2OANA 3R2XC 1KCFA 2YLBA 2LRQA 1WEFA 2PMUA 3BPXA 1YBYA 4M75C 2D1KA 3J7AO 8AT1B 4G94A 3VB2A 1XN7A 5CHZA 1T2KA 2UV1A 2VE9A 2DRMA 2KXDA 4J8FA 2V1QA 2OTLA 1WOQA 1GVDA 3M0TA 1IG8A 1R6RA 3GX4X 3CC4A 4TSXA 1HJOA 2NOIA 2ZF5O 1WPYA 3HP6A 1RRSA 3KYDB 5M1OA 3A01B 1CSKA 5GAN6 2RJDA 3WEEB 1X27A 2FD5A 3P39A 2XF5A 3L09A 4K11A 1LCKA 3OYJA 3T8TA 1VQLT 2ZQBA 3M1FA 4M3RA 2NS7A 1HK9A 4RDUA 4RMOA 3RMDA 4JAXA 2M2EA 4HQMA 2C6YA 1MHNA 3P9IA 4CJ5A 3DLLF 1YJ9I 2CP0A 5AQLA 3HXLA 2G9WA 3RKYA 2QF7A 2LFBA 2XSJC 3DTIA 1GLJO 1MUDA 1EH6A 3CMEA 2ZGWA 4ZYDA 3B6OA 4KBMB 1FSEA 4Y1CA 3Q7BA 1YFNA 4C0DC 1GFDA 3C2BA 1BJZA 4A3KJ 4OKEA 2P9KA 2R7YA 1LPQA 4LFUA 4UV8A 3F6VA 2ZMEB 4B8XA 3SUPA 5IT9E 2CV0A 1V4TA 4QS9A 3TAEA 4C0ZA 4FLZA 1UEBA 5KN8A 4JI1K 2CKKA 1R5ID 1YJNN 1DTTA 4ZTFA 3DLRA 4E19A 4WCIA 3QWYA 4L59A 1TS9A 3LW5E 5IAYA 4LY7A 2D0CA 4FXDA 1RLQC 3DRSA 4DV0K 4F2SA 2E1CA 1FIAA 4HT9A 3VQBA 1D0ZA 3NDKA 2PYLA 1DP7P 3GNFB 4A54A 4J9IA 3D0SA 3IRRA 1LW2A 1NK2P 2QSFX 3HTSB 3BJOA 1F5TA 4RCCA 4M3GA 1A6IA 4N4HA 5H6QA 3IRQA 2QSGX 1KQ0A 1D09B 4MTEA 5K5QA 1YTYA 3S1MJ 2DETA 1XCBA 1PKSA 2RO0A 3EUKL 1NYGA 2R7QA 1G3TA 4E1NA 2Y1IA 2WADA 3ZQQA 4QT7A 1NKCA 3M7GA 3BY5A 1SVLA 3ERMA 2E2QA 4Y4RA 2O4XA 3JREA 3DLKA 3VQ8A 2EKHA 1U4BA 4RB1A 2QI2A 4KULA 2JVHA 3GMEA 5KCHA 4I09A 4CJEA 3SFMA 4XN0A 1I5LA 1WGXA 4ISGA 1OFCX 2QWWA 2CU7A 2HQRA 3HSTB 1I5OB 1XGMA 4B3XA 1KU2A 5FFXA 2ZGYA 5CJ9A 2MCNA 3FF5A 3FEOA 3BY7A 3QOPA 4U7DA 1VQ9N 4XLAA 3NGYA 5DEQA 2MC4A 2R7XA 3PQKA 3JCUC 1RUNA 1KG6A 5DDGA 3DF8A 1YTAA 1KLMA 4FT2A 2A6TA 3DLAA 1SKWA 5AQJA 2E5KA 1R0BG 1VQLA 1D1AA 1WHGA 1T05A 3SJMA 4N0BA 2ROLA 2OA4A 1KTQA 2V1XA 2CGHA 1KQSP 2NOLA 1D1BA 2L5QA 3S8PA 4IZ9A 4CJLA 4Y13A 4C92E 1VHXA 5EU7A 4AFZC 4WFAL 2IA1A 4JD2B 4LF7K 1EF4A 2W04A 3UB5A 2WAQN 4PJOG 1N9SA 1G3SA 2FJ1A 3CFRA 1RAFB 3JCMW 2GM4A 1F4KA 4KGVB 2DL3A 3GTQJ 4OFAA 3F9MA 3IP4B 1NG9A 2XMFA 3SDBA 2DK5A 4JKCA 1HPMA 3FKJA 4FJ9A 4GVMA 3KIOA 3LSHA 4PHTX 2JA7J 5HRPA 4AG1C 1OEBA 2LSNA 2IJLA 1B07A 1OPKA 3W2AA 3HPOA 1JJ2M 3E5UA 2E34A 1C0WA 4BR5A 4H0YB 1FN7A 2DYIA 5EJCA 3IV5A 4M7AD 4G6TB 1EXQA 1ZHFA 4DU3A 2QQRA 4J2EA 3I64A 4CEDA 3I56A 2MH9A 3CWUA 4CJTA 2QDLA 4KA4A 2KYMA 4DV4K 2O0YA 4JLHA 4I6ZA 5GANh 4ZN3A 1TWAJ 4C8QC 4QW2A 1VSIA 3TMOA 4B1YB 2MLKA 2PUOB 2DRKA 5K5RA 3SPZA 2JGUA 3G1MA 5ERIA 4XNFA 1MWMA 4HNVA 1Q18A 1YW8A 3A5LC 3AVGA 1C6VX 1U2VA 2MD0A 2OCEA 2MPXC 4EATA 3OYLA 3VS5A 1SMTA 4BNCA 4C3HJ 3RQIA 2XSDC 1JL2A 3ZLJA 1D9DA 2NRZA 3L6QA 5IOZA 3MDQA 3DAWA 4PL7A 5JVHL 3WEEA 5DUIA 3HHTB 2Q2RA 1WJAA 1SEMA 2GXBA 3OYFA 4PCQA 3ZMVA 3A8HB 1EJ9A 2X6OA 4WF2A 4F3QA 3SQNA 1TWGJ 3CCEN 3NH1A 4KB1A 1Q81O 1HU0A 2FL7A 4RTUA 2V1NA 5HKCA 1J9IA 1KQSM 2FBIA 2KQWA 2HQ5A 3EG9A 2RHZA 2DA2A 1ASWA 2IA0A 3M8PA 5HRSA 2OAZA 4J7IA 4M77A 4OIOF 5CCAA 4YIIA 1C1AA 2DBMA 2QW9A 2D4WA 2EKOA 3H9GA 3G6EI 3HTRA 1WAJA 1QHHD 3PL8A 2GQVA 2CSIA 5CYMA 1SEUA 1Y7XA 2OQGA 3LQRA 2K9NA 2EILH 2VGNA 2DFIA 2K86A 1VQNN 4M7DE 2JPBA 4BBSJ 4CZEA 3CMAN 2QUFA 5EG0B 2EQIA 5E1XA 4Y28E 1TYQA 1W2BP 3E6BA 2JN0A 5GAMj 1XPXA 4JKFA 3CUQB 4BDYA 3T7ZA 3H0DA 1XMXA 1MDMB 1J59A 1E7OA 1H3HA 4B1XB 4IPAA 1K8AU 2WAQA 3A8GB 1HKSA 1MKMA 2ZXJA 4JI2K 5D8LB 2HVRA 2EV6A 2BY3A 1TOVA 1GLDG 1HKBA 1B8IB 5DCMA 4EW0A 1VQ8Q 2H6BA 3K6GA 2XHIA 3ZSRA 1JGGA 4BRHA 3D5LA 1R59O 3Q3SA 3U1KA 4Q4ZF 2VG5A 2VBZA 1Y56A 1CQTA 5AQSA 1NGGA 4A57A 1MBFA 2E19A 3RMQA 5KE3A 3WVDB 4A0XA 1R9TJ 3NF6A 1IKWA 3S9HA 3SI6A 4FX0A 2I2LA 2HPIA 5FLXK 1VQNQ 2XGCA 5A0GA 3VQCA 1TT0A 3CJQB 5TISC 1WLPB 3LP1A 1MJ9A 5KGWA 5KH6A 2JLEA 4NC8A 4W97A 3MEAA 2ELJA 4C92C 4G9YA 1ZRDA 3L2RA 4BROA 1D8KA 1QTMA 3FB9A 2L3DA 1IB8A 2P4TA 1D5VA 1TUGB 2QZ8A 2HF3A 2HS5A 2YPRA 2ZJRL 3I0SA 2EYWA 4OX9K 1UG2A 2LG4A 1OULA 4PFZA 4L0YB 3AVMA 5B3SH 3AG1H 3K7AJ 1LEBA 4YDUC 4NYNA 4FWNA 2VGMA 3QPSA 4XLCA 2IVMA 4B9MA 4P5NA 3BCAA 4CFAA 4G7OF 4JI7K 1K76A 3WXMB 5GANd 5F1XA 1V54H 1GDTA 4OMZA 4EJVA 5I2SA 4OPKA 3BT9A 4B3RK 2IVOA 2GUPA 5HDNA 3NNQA 2V52B 4RCHA 3T8RA 3WNGA 4CBXA 9ATCB 4E9FA 4AM6A 2PI0A 1HC8A 4FASD 3LAPA 2I5JA 4RM3A 3TTFA 1H9GA 2FBVA 1NK5A 2DCEA 1VQ4T 4C8QE 1SL2A 4DBHA 4EJYA 1OCRH 3CVSA 1H89C 3U3YA 1RBTA 4PY5A 2YHXA 2EYXA 2K9QA 2LQNA 3GUDA 1HKGA 1IKXA 1K73O 4FHTA 3DQVC 1EH8A 2FZKB 2VG6A 2JRTA 2YDLA 4M7AC 4Z4GA 2AT1B 1UAAA 2LBFA 2FLOA 3D2FA 4M7AB 3AL0B 4M7DB 4F7UG 2N8GA 2DL4A 4KTQA 1Y96B 1CF7B 2X1EA 2NOFA 4OMQA 2FXUA 1WQ2A 5KGXA 2VASA 4LLGF 1ASVA 1LDKB 5GJWB 1N33K 3CCQT 4N9IA 4ZYHA 1ZBXA 1O1WA 4FO0A 3SAHA 3DOLA 2E5ZA 4BUPA 3CCJA 3MQ0A 1KC8R 1H641 2HF4A 3UKRB 1POGA 3IH4A 3VEWA 1S6QA 3QINA 1HYOA 3HHHA 1QPIA 3HFNA 5HCKA 4AUXA 4BJ6C 3M0QA 2HMPA 2DAOA 4XLNF 1LAVA 1FYNA 3NH2A 1I39A 4JK9A 2OTJI 3KYCB 3CXCP 4C92A 2JVVA 1W4SA 2EH3A 1VQ8N 3ALYA 4B23A 3GBQA 5HODA 1BA5A 4CF9A 4GYIA 2K7AA 1JJ2P 3KK2A 4NL2A 2P9LB 2XI9A 5CKDA 3G2BA 2CP7A 1RACB 3CUQC 2EJGA 2PEXA 3HOWJ 4J01A 5B1AH 4RUGA 3BR2A 1XSDA 2FQ3A 2E5LK 4CZLA 2QA4N 3JB9D 4XU3A 1TUUA 2A7YA 2DMNA 1UZCA 1P90A 2A5YB 2ZGZA 4YY3K 2JZYA 2PBIA 4EMKA 4Y0WA 4IFYA 3WQTA 5M1NA 4JJDA 3N4PA 1KRPA 4MQ9F 1TC3C 3VQQA 2EFPA 1SQKA 1AD5A 2KT8A 4PL8A 3FDRA 2XDVA 2PFUA 2JWTA 3U23A 3E2UA 4HPQA 4IKFA 2Z2SB 2R7DA 1YI2A 3Q9SA 3QDKA 4ITVA 2KKZA 2K5FA 2F5VA 2HSPA 1KD1C 3S3NA 3CC2T 3DXKA 4KKOA 4UXNA 3ROUA 4IUVA 1VQ6A 1R1VA 2NRAC 2ATCB 5CZ2A 3WGHA 2M02A 3V9ZA 2BXYA 5L3EA 3JW4A 3UNGC 1XS9A 2PMHA 4WFNL 2OBPA 1YCYA 2PU9B 4HF2A 2LCCA 1EWQA 2XAFA 1Z1DA 2LY1A 4ELZC 4QLCU 1DLOA 4M7DA 4DLEA 1LNXA 2V26A 4M7AE 1E3PA 4C23A 2WTEA 3GP8A 1RAGB 3H3UA 1FKOA 1SFOJ 1J3TA 4XAXB 2CQXA 3E6CC 2E3IA 1N75A 2OCCH 1M1EB 3O4WA 2VWJA 4V19S 3E9FA 4E4HA 4EMHA 3LSPA 4F7UA 2XDBA 4CZZA 1UE9A 3MO8A 1TK8A 1J6ZA 1REVA 1HA8A 2D0NA 4CF2A 4EJWA 5AQXA 3IS9A 3MN6A 3ZYYX 3G71A 4P9UA 4YELA 5J40A 2XC7A 1Q86O 1FEXA 5GINA 5BPMA 3ASMA 2KDZA 4U0WA 1BU1A 1QVFP 1Y8QB 3OJSA 4XIDA 3F8FA 4CHZA 3JB9G 1LW0A 5D6YA 4BE0A 4ME7A 4DEXA 1VQLI 4LB6B 5E84A 5JICA 3KX2A 4BACA 3GZ5A 1KIKA 2DTHA 3K57A 4M74A 2YHBA 4OVLA 2GOMA 5IHKA 4XSZF 3IKMA 3J7YP 3CCJN 4CK1A 1LJ9A 4ASNA 2RAEA 2WSEE 4LFCK 3WTVC 1VAZA 3MXIA 3KP2A 3O9TA 1K4SA 5GANg 3SAGA 4CHQA 5KRSA 2ZPBB 1RTHA 1T03A 2H1KA 1NEGA 1OX8A 4I9LA 1RT2A 2M7BA 2RI2A 1N27A 3NRVA 5AZJA 3M4GA 3HP9A 3TP3A 4RTXA 4R79A 2RK1A 4FWLA 2IP2A 1M1KC 5FD5A 3FFIA 2Q8KA 2JRMA 4KIBA 4DZPA 2OPPA 2YJEA 2CDTA 1NH3A 4HVUA 2DYSH 1JBMA 3I71A 5IY5H 3WHCA 2R5MA 3VYGA 1ZG5A 2AXTC 4BY9C 3DPUA 4WQ4C 4C5EA 2FQ4A 3EFRA 4DFJA 2W82A 4BYYA 4Y92A 4XU0A 2VE8A 1PP8F 1I07A 2Z99A 3OY9A 4HDVA 3KYLA 1OPLA 4J8OA 1M27C 2RN8A 5C44J 1KG7A 4LD6A 2HSTA 4M75G 1QSYA 2QTVA 2OPQA 4M3TA 3CCVI 1ITYA 4FJIA 6PAXA 4S05A 4A5BA 5IT9Z 4CJUA 3VDXA 3LOCA 3N4QA 4IXCA 4DV6K 3P7NA 2BDPA 3EFSA 3ZMUA 1YNZA 1A5XA 2P9SB 1KC8O 1N8RO 2KZZA 4KBOA 4JX6A 2QA4Q 2NRHA 1KU7A 3CG7A 3GTGJ 2DL7A 3KLEA 3R8EA 1LWFA 3MEEA 3OV8A 4BGAA 3A5NC 1QVGM 2BE7D 2R5ZA 1M9SA 1SAXA 1VQON 3O3HA 5FDLA 3R9PA 1Y8RB 1LEAA 3BP8A 1S29A 3CDIA 3H1CA 2GAUA 4AIDA 5I22A 2EINH 1RT5A 2PJPA 2IGIA 4P55A 3T1AA 4CEBA 3SJHA 5FJ8J 4DMNA 4XN3A 4XIUA 2FPDA 3WVEB 1ZR2A 3WT0A 3QP5A 4FJJA 2LX9A 3BDPA 3S41A 1KQJA 1AWJA 1TK0A 1T95A 4GCVA 1HSTA 1XC5A 3NAUA 5JI6A 5GADP 5E1WA 5GMKm 2FRWA 2VKEA 1VQPT 5DV5A 2RH2A 1VSKA 3MN7A 3CQZJ 4WQ5C 5L3DA 1JUPA 2O9VA 1VRUA 4EHUA 5CVVA 2DILA 3BQYA 1RL2A 3DFGA 1N77A 4CCNA 1V5EA 1N8RC 1I5ZA 4CZJA 3MAQA 1YJWN 3S17J 3AVAA 3I5SA 3QDFA 4BR9A 4AFQC 2UXCK 5DK5A 1HPZA 1YQAA 3CYMA 1HDPA 3CF5F 2H3GX 1M2VB 4M75D 3AAPA 3GFLA 2R0QC 4CJWA 3ZFJA 4CJ4A 2CUDA 3OVNA 3HOXJ 5E1ZB 1OI1A 4O8UA 2NRWA 1K9MO 4J9FA 2ADUA 4P96A 3FMRA 1UJ0A 4C8OA 2ZPIB 2HQHA 3B73A 2V1RA 4CZGA 5HVQC 2TRTA 3OW2M 3OHRA 2RE2A 1VSJA 3WTYC 3BR0A 2YUPA 1BIZA 2ESNA 2JPSA 3U8XA 1GV5A 3DLGA 1U45A 2KZVA 2OPRA 2B5JA 5GAMf 1C0FA 1ZLKA 5B1BH 3L7WA 3J7AP 4I2PA 3HTVA 4E7IA 1H8AC 1AKHB 3BC8A 1F1BB 1XSVA 1HD3A 1M1KR 2V9VA 4E0DA 1X9MA 1LOJA 1S72T 5ICCA 1V1CA 4JS5A 5EG2A 4GW6A 4IUQA 1KG1A 3ZSXA 4OGEA 2P9UA 1MBHA 5FKOA 2CUJA 4BG9A 4KH1B 3B6PA 2E10A 1FW6A 3KETA 1BC7C 2DVJA 3VS7A 3KBGA 4EMKB 1JE8A 5JHFA 4ZZDA 1FMKA 1YIJA 4DQ2A 1OLTA 1U9NA 3AVJA 2XKOA 3OSGA 3U1DA 2IDOA 3BJ6A 4R1HA 2NXNB 1WJRA 1P8ZA 2G0EA 3WE2A 2ID6A 3O1WA 1MW7A 4BU2A 1WX6A 2XAJA 4XKBA 4AHCA 3OBWA 3CC2N 4MQ3A 4R55A 4M77G 2HMAA 4NBQA 1U5TB 3HO1A 2P7VB 2QEXI 4J00A 3KLIA 1D9FA 4QPOA 4XRMA 2KE9A 5GAOm 1IKVA 3JCMe 1U3EM 2XF7A 1J0RA 3TPQA 3B02A 2PFBA 5E8GA 3TOAA 4C92B 1UDLA 4NL3A 3QRFF 1WWXA 3BCBA 1Q7YC 4EV0A 4FM4B 1VQMT 1XQHA 2HWVA 4UUTA 3LDOA 4FSVA 4A2BA 2E12A 3R6NA 3WXKA 3LA7A 4E9GA 2DTRA 1J5EK 4FJ5A 3M59A 1R1UA 1XDUA 4BR2A 5EC7A 1IREB 2A36A 4C8QG 3CVTA 2OD5A 3NMZC 3PIPL 5FU7B 3F22A 5KYYA 3HSFA 2UZKA 3AHUA 3NBPA 4LF4K 1CZ9A 4X9CA 2O88A 4I01A 2FSNA 1YXQA 2P9NA 1U06A 3SUOA 3MCPA 1R36A 4I9QA 2ID3A 3NAEA 1RTDA 3HUGA 3LX7A 2ZPGB 3OYMA 1VQ4I 2FPFA 5AQIA 3ZSYA 3D7SB 2XB5A 4LOCA 1NOYA 4FZXC 3F6OA 2JK3A 2AQEA 3VTIA 1E3HA 3RCOA 1C0MA 3LFKA 4BXUA 2KFNA 2JMAA 4J9HA 2HAXA 4OMOA 1S1WA 2Q2EA 2SEMA 1RUWA 1VQKN 5F27A 3FWEA 2F5KA 1MBKA 4L9JA 4OPAA 3GLXA 1A35A 2B0LA 4CHYA 2NAZA 4FX4A 4CJRA 3ZQIA 1D0XA 1G2HA 4RM2A 3VEPA 1ETKA 2HU9A 3J7AF 3HKSA 4KITB 4Z4CA 3K5LA 5HL7L 1MBJA 4FLTA 2EHGA 1HKCA 1DTQA 5BPIA 4PJOA 2KRMA 3CCQQ 1R4NB 3CC7A 1N6QA 5BPDA 4BY6C 4LSLA 3HZ6A 2Q97A 2E8AA 5AFUA 2YNGA 2ZJPL 1IBLK 1P9QC 1B3QA 2E88A 3VF2A 2GWRA 1S9HA 2QQBA 3O6BB 2EPFA 3F21A 1IRFA 4G7HF 3CFOA 3B6CA 4A3EJ 4M78G 2HL5C 5GAMg 3AY9A 1KFDA 1SFXA 1YQLA 4BQOA 4M73A 1AZEA 4QVZA 3MK6A 4C8QD 4HTLA 2MWPA 3NVMA 3C95A 3V8KA 3DKXA 4OWRB 2QWLA 4ZYAA 3VRYA 3UR3C 1PRLC 2VQGA 3CMYA 1WN7A 3DOKA 1NJWA 3H8ZA 3OYIA 1VQ5I 3ERED 1X75C 4DSJA 3HT3A 5DM7L 3GNGA 1TTYA 3GF2A 3AT1B 1VQ5A 2HNYA 2GOXB 4MIMA 4L9TA 1YW9A 3PX6A 1YTUA 2YKMA 3EG1A 5FO5A 1ZAOA 2DA1A 2VN2A 2F4MB 2KMUA 4ZC3A 1YJNT 3LSGA 1W0HA 4ISFA 2DZCA 3GW2A 2VWBA 1WXTA 3F10A 1TWBA 2E71A 2PQWA 2M9UA 3KZBA 1UJYA 2JA8J 2KAFA 3CMMA 1BOAA 2PNIA 2GA2A 2QSHX 4C92G 3SD4A 3VUBA 2LVMA 4DV7K 2ATQA 5AONA 3A5OC 3MAJA 4Y91A 2CW7A 2DK3A 3HJFA 1N3CA 3LWHA 2GV9A 3I54A 1S72A 3JRIA 5KYUA 1K83J 3KCCA 1KO9A 4I98B 3P5JA 3HKZA 2RJCA 4DV2K 4LG0B 4DK9A 1SC7A 3M8RA 2LKXA 5E17F 4CHNA 1R00A 3AVBA 3K4KA 4XRSG 3MKYB 4AU7A 2QK0A 4FE7A 3ZMTA 2I8DA 1V5FA 3H0IA 4XL9A 2BVLA 1UWBA 2A1SA 2J5OA 1XOVA 2CFOA 4EVIA 2CQQA 2CUZA 4IO9F 3W0LA 4F14A 5M1PA 5J39A 4KPYA 1XI1A 4BC5A 1U48A 4XH5A 1EV7A 1WJ5A 4E6KG 2VQHA 2QEXT 3HC7A 1BW6A 2BTTA 1BR2A 1WA7A 3PFSA 5LGTA 2GCXA 4DR3K 2E65A 5GMKj 4L5JA 2KRCA 5D4RA 3VODA 3I5RA 1ZUUA 3DMJA 4DTOA 3H45C 5JHUA 1QVUA 2HNIA 2HHUA 4CCMA 3CCRQ 1PD1A 1X6OA 4KRTA 3THXA 2DA4A 2HQAA 1XMOK 2L9SA 1NJIC 1T39A 3E66A 1I3AA 2MABA 5LJ3j 3RR6A 1V4SA 1GLAG 3UKUB 1K8AC 4F3TA 1BR1A 4O0IA 4J6XA 2E1NA 2L0KA 2HBMA 3GFMA 2UWMA 2JOYA 1SUQA 3I0RA 3DPLC 3ASNH 3K2PA 2IGKA 1LFUP 3RQ4A 4HDUA 1EH7A 1XTAA 4G12A 4JJBA 1AU7A 1YITI 3Q5FA 2O4IA 1P4WA 5ILSA 1H9TA 5DLOA 1Q82R 1QS4A 2IGOA 2LF8A 1BDGA 3OS5A 2YCHA 2JUGA 2VG7A 3EFOA 2HVSA 4HXJA 4E70A 2HBKA 1NG6A 3ZSZA 4YG2F 2UUAK 3NQOA 1X4OA 4ICLA 5EXWA 2KT0A 2CSOA 4Y17A 2H8WA 3CCQI 3PIPA 1G8XA 1N9RA 1FIPA 3QJ6A 5D3GA 2M4KA 4Z88A 4F9OA 3CCUA 4NLBA 1IGQA 4XTYA 3CWSA 2KSSA 2HXOA 4OIPF 2BEOA 1HKTA 4JRPA 1K4US 2EQJA 1ZGWA 3CM6A 5FWBA 4FYWB 2JT4A 2ME0A 2HBPA 1TUDA 2GZWA 5K5OA 1SVMA 4BGBA 3KK1A 3O8VA 4MZTA 4DTJA 1WQ7A 3IWFA 3SNNA 3EZWA 5EF6A 5F6FA 2P9PA 1D8JA 3FXMA 5D5WB 3PX4A 4MDBA 4Q0BA 1PU6A 1T3LA 4ZZLA 4IJNA 1UMQA 5KYUB 3P4IA 3RZDJ 1DT9A 4OPJA 4XM3A 4F8RA 1Z05A 3FK6A 4PGHA 4MFBA 2NRVA 2EBPA 3C3WA 1G59A 4IHYA 2M5WA 3GL1A 2UXNA 2VB6A 2HOTA 2YRDA 2XAQA 1VSMA 2UUCK 1BCOA 2ETJA 2LTOA 3CCMQ 4C0GA 2WC2A 3O80A 5JLFA 1OX9A 3SEMA 2JVGA 1LCUA 1X2NA 4P5OA 4XONA 2X1CA 1OQYA 3X25B 3SLCA 1G99A 4C9YA 3DXMA 2DMTA 3TQ7P 3UF4A 5HBMA 5ELZA 4M3ZA 3EUHC 1YHQI 4FWKA 1SVOA 4ILHA 1IBMK 3KZYA 2G7UA 3CMEI 3PNYA 3ULDA 3CJCA 3T0YA 3TO9A 2FMYA 1SG5A 5GIOA 2VQLA 4BRAA 1Z9ZA 1BKBA 1RT1A 3TEEA 1AOJA 4IDHA 4DU1A 1YIOA 2XG8D 1XD7A 1NU0A 5BS6A 2QM1A 4QWQA 3B6AA 4YPRA 1BYMA 1YHQQ 3ZN1A 4Z0UA 4J2DA 5KCOA 3KXTA 3VQPA 4A3GJ 2IGMA 4J6WA 3O2PE 2IA2A 5A2QK 2QBYA 2I5WA 2HOEA 1U5TC 1TQMA 2E41A 4A5NA 3CCSQ 3QFUA 2XKOC 3ZX3A 1VQPI 4YORA 4MHGA 1AWOA 4HWIA 3MECA 2NUTB 1KAZA 4CEAA 3VQ5A 1TKXA 5HRRA 3OMCA 1VQ7N 3A8LB 4OPHA 3H35A 5C2FA 2M0YA 3C6HA 5AYFA 3QHSA 3GBTA 1VQ6I 3MD2A 5KI6A 1FTTA 4C1NK 1GUUA 3EGXA 4N47A 4UOBA 4WWCA 1VSHA 4K43A 4QCLA 1RKTA 2Z1JA 1LVAA 5FU7C 2DQLA 4GO1A 1Q86R 4Z2YA 3OOUA 4LMYA 1QMCA 3SV4A 5J8FA 2P9KB 5KAFC 2QTXA 3WXJA 1JJ2S 3MPUB 1ERDA 1OZ2A 2G6FX 5CR2A 3KZIC 3PQJA 1O13A 1ZBLA 1QA6A 4R56A 3GBGA 1YI2T 2ZKZA 2QEXA 4M75E 2STTA 2VBXA 2HXIA 5CR4A 4ELUA 5GANj 3K5MA 2EB7A 1BISA 2VYTA 1P7IA 4RB3C 2GA1A 4XSXF 4HX7A 3SZTA 4JK7A 1WHHA 4NHJA 4CC4B 5F08A 1WSFA 2HOAA 3S2HJ 3LMMA 2HHVA 3JAME 5L23A 1P92A 2COBA 1BA1A 2EPDA 2E7WA 3VGKA 2ELKA 3HJEA 4ENJA 1NBWA 5D8KB 1M90U 4IRGA 1DU6A 5K1YA 2Y48A 2NVTJ 1OQKA 1FKPA 4UB8C 2K3YA 3S3OA 2KTQA 3J7YJ 4OOIA 4E7LA 2FRYA 3SUNA 1FJGK 2ZC2A 2EX3A 3QEXA 2YU9J 2HKQB 3BDLA 4DYRA 5EDNA 4NCBA 5GPAA 3SDGA 1RI7A 2J6OA 4PQUA 1T0FA 2PMZA 5CVIA 2KRNA 4M77B 3ECOA 1IV8A 3JRZA 3JTGA 1WSIA 4CGIA 4OMLA 3CJNA 4OMNA 4XR6A 3O9UA 2A41A 5F1JA 1EQYA 5FROA 2XRIA 1JXEA 3VPZA 5BR8K 4HF0A 3HUGB 1CKBA 1FMVA 1K73C 3SB2A 3G0QA 3GWZA 1FTZA 1HNZK 1UGRB 1JHFA 5KPRA 1EX4A 4XKWA 4GV6A 2MBFA 1VK0A 3TO7A 1Q1HA 1YRNB 4A3DJ 3LH5A 4ZH4F 3LQQA 1ZBFA 3LWLA 1JLQA 5GAHP 2K5CA 2YJFA 2WBMA 4JZ4A 3RDVA 2LBFB 3JCMJ 2PAVA 1U6GA 2A6EF 3QU6A 1NK6A 2KEAA 2YX6A 4DB3A 4QIWN 2JUCA 3FM3A 1JO8A 5EGOB 3QYBA 4LFAK 1Y64A 3ISPA 1W2BA 4LUEA 4KV8A 4M3BA 4OVAA 3CMAQ 1FYMA 1RNHA 1M3AA 1M90O 3MMVA 2JTVA 3RSEA 3VYRB 2ZPFB 4HT8A 1RUOA 3I8DA 3I4MJ 3QPHA 4A3MJ 3THYB 3VS0A 2W85A 4KO0A 4BC4A 2CGPA 1T6DA 3O4NA 2QYOA 3D2EB 3S6IA 5AQRA 2O03A 2IW5A 2G8FA 3AA4A 4AIJA 4F92B 4CC7A 1IW7F 1W97L 2K5IA 2ISZA 2ABLA 1T3VA 4G6DA 2HKXA 3E7LA 3QMLA 4YRVA 2RHKA 2CV2A 3EN9A 3BW1A 4DHYA 2HBLA 3H3NO 4DV1K 4RW8A 2DPUA 2E1OA 2HGCA 3CJ1A 3FXOA 2F5CA 4GYGA 5FU6B 3QG1A 4RB2C 4S04A 5FPEA 1YWPA 3F72A 1HLVA 1UUEA 2XAHA 2HZTA 4KT5C 2CQNA 3UT1A 4EM2A 3CDHA 3WODF 5F0FA 3MCAB 4HOBA 3TKYA 3DXKB 2KZMA 4MDWA 1QVGS 3ATUA 2VODA 3ECHA 3WU2C 1X9JA 1O4XA 1LE8A 3OW2S 1JXSA 3LA2A 3O8GA 1MIJA 3CD6Q 4M78C 2QDYB 3EGUA 3LDPA 3Q0WA 2CZ6B 1VQPN 4W5TA 4RAFA 3VS1A 4M7YA 3IC7A 4MGRA 2Y75A 3CMAA 3HK2A 4B09A 2BKDN 3G10A 1Z0XA 2YUNA 2KMTA 1H8KA 1IH7A 2VQFK 1HBXG 2CS3A 4DA4A 1IV6A 2RVCA 4PJJA 5J26A 3H6ZA 1PJRA 1XMKA 4RB0A 1S72I 1W1WE 5BOXA 2DFEA 2RMOA 5KE2A 2RNJA 2NUZA 5F0HA 4DLGA 1WJQA 4IOAF 2DIQA 2JWKA 2M34A 5HLHA 3TU5A 2W4SA 5HLFA 3O8HA 4DNCA 2P5LC 3UDCA 3G4SN 1GOCA 3TAFA 2P4RA 4F3OA 2F4IA 1SKSA 2EYQA 2GXAA 5E26A 2EIKH 2P1JA 3C0CA 3LPTA 1ON1A 5CQEA 4KI4A 3I35A 4LH4A 1OR7C 3ZXSA 2CUBA 1IXDA 3BUZB 1G4DA 2I0NA 3GG4A 5GAOr 1O75A 3BR1A 1YQRA 3MN2A 1ZRFA 4CESA 3J7ZO 4E7ZA 2OTLI 2OUMA 4FLXA 5IP9J 1NGIA 1RDAA 3RTRA 1QW1A 2MH2A 1ZSZC 2W1OA 4M9ZA 1B9NA 4JJCA 4GKKK 1Q86C 1O9SA 4N4OB 1MZBA 1RTIA 4C2UA 4FWQA 4I6MB 2K5LA 5GAN8 2M3AA 1NGNA 3ULRB 1KAYA 2RKIA 3DBHB 2LOOA 4ENKA 4Y15A 2X4HA 4E6RA 4JYAK 1BL0A 4WK8F 1S7OA 1JKPC 1KFSA 3CCLQ 1X1DA 4F04B 3LL3A 1QKWA 4KIFA 2FMLA 1IF1A 3BTCA 3I0TA 4HUEA 5HLTA 1RI0A 3LFUA 2ZMEA 2ZM6K 1PU8A 4AMCA 1NJXA 3JSPA 2CGKA 4LF6K 4MTDA 1VIEA 2LY2A 3L3UA 4MZPA 2CZ1B 1SS6A 5SWMA 1QPMA 4IXAA 2G7HA 3CCSI 4FW2A 4JI8K 2QEXQ 3M1EA 2QK9A 2HR3A 2IOCA 3CCQA 1HNIA 3K4CA 3DKMA 3E0JB 4H03B 3CC7I 2J4RA 3E9OA 1JJ8C 2OZSA 3HXMA 5BRFA 1WHJA 2ITGA 1EA3A 2EIFA 5JLWA 1RT7A 4FVMA 1HR0K 2LYCA 3SFZA 2A28A 5FLXO 2P8TA 2E6NA 2HDWA 4EW4A 4FJKA 1Z7UA 4XTZA 2CV1A 3ZBDA 2D0BA 4HQEA 4NCAA 2L8DA 4DQRA 1ZKGA 2LKSA 1EZZB 4CW7B 1ZREA 1QHAA 3HGYA 2BYVE 2P9LA 3PIPF 1YIJT 3F70A 1C1BA 3RPUA 3QJYA 3CCMN 3GPLA 4J19A 2XY6A 1R4MB 3P83D 4HF1A 5AJ3K 3I53A 1RBRA 4WXDA 4IWVA 3R60A 1NK7A 3CCMI 3JRFA 3QEVA 2AA4A 3D0PA 4OMPA 3CCQN 1YJNQ 2LH9A 5KK1A 1RGIA 3HI0A 4M7XA 5EYRA 2H56A 3GDQA 2JJ7A 1I8FA 1ETVA 4GGGA 3THWA 1GL5A 5CZ1A 2KLOA 2O8BA 1WI3A 1BHLA 3I55I 4R0KA 2QENA 5BR9A 1Z6TA 1FWZA 5DS9A 2O8XA 3BTJA 3LZJA 4CC3A 1JUSA 1VQMA 2F2EA 1OPCA 1ABOA 1W5CC 1IJWC 1S3XA 2E1MB 4ZTJA 2QWNA 4JPBW 4F7UF 5C0MA 3V1OA 4BR7A 2VL8A 1VQMQ 2KI7A 1TNTA 3CCEQ 2PJRB 1XMAA 1WSJA 1R5GA 3R1XA 1Q1VA 1LNWA 3ENOA 3OYGA 4IUPA 5BN9A 1USTA 4HBLA 2YNHA 3SQ0A 4XQFA 3I55Q 3M8JA 1HKQA 4BHBA 2E20A 4AHTA 1MV3A 3CCRN 2B7EA 1ZYQA 3OQ5A 4DV5K 3QO3A 1SD4A 1WJSA 3BTLA 4L8RB 1N8RU 1YJNI 1S7AA 3ZMDA 3IL2A 3TABA 1FLIA 4CGFA 3SZ2A 1KG2A 1WPKA 4FM2A 1X1PA 1YHQN 1NEBA 5ECAA 4BREA 4UVAA 1LE8B 4OB1B 4W1UA 1SRLA 4BL0B 2JJ9A 1BIUA 1MWKA 3FISA 4ZYGA 2JXBA 4CZMA 1ARKA 4RKUE 2XHCA 4B24A 3GO5A 5TGTA 2H6CA 4FJMA 3EH1A 5TRDA 1K8AR 4XU1A 2AO9A 2OAUA 1VYTA 4FZYA 3VS3A 2A42A 3G71T 2ECCA 1WLJA 4ISEA 4DQIA 3V4IA 3H1QA 2NVQJ 1VRLA 1AWXA 1ILYA 1AEYA 5M3MJ 2XUBA 4H5NA 2L7MP 4LC9B 1EBMA 2DBBA 2FXAA 2GBZA 2XICA 1KHCA 1XSXA 1TQPA 2WSCE 2DXUA 2OJED 4ENMA 3BZ6A 1KVCA 4LB5A 2EZLA 2F6CA 2M30A 4L18B 1MMNA 4M72A 4Q5SF 2RF2A 4Z4IA 1VQ6T 3JAMK 1QGPA 4YNQA 1GV2A 4C5IA 3CCLA 2GX9A 3S16J 3RZOJ 4HLYA 3A8MB 3A03A 2WFBA 1U84A 3MVPA 2H27A 3VKIA 4JX5A 1T0JA 1QQCA 1ZBIA 4BS9A 1G3WA 4YFNF 3RRHA 2HZYA 2HZDA 3LSTA 2C0OA 2KXCA 5F0XA 3OYKA 4LH5A 3IAM2 4DS5A 2CH4A 3UKRA 3M0SA 1JKOC 4NOYA 2KBTA 3LAJA 2KRSA 1LMZA 1H0MA 2O8EB 3TREA 4EEFG 2L3QA 4JEPA 3RERA 3JCMh 3PSIA 3HKZN 3RIRA 2IRFG 1WFXA 3G1JA 3OYHA 1WVRA 2EWSA 2YR2A 3PUFA 3SWNA 4DBQA 4J2BA 2NOHA 2HBWA 4DQSA 2OAWA 2RNGA 4CJVA 3WU1B 5I21A 1ZLMA 2VIXA 1XB4A 3ULEA 5JVGL 2JA6J 4ZYEA 1BOBA 2A3ZA 2G8HA 1NMDA 3F0ZA 4KH5A 4PJOF 1KQSA 3CCJI 1PCXA 4KH0B 1WEGA 3MN5A 1Y0MA 2VKNA 4ANJA 5M9OA 1RBUA 3QB0A 3G6EQ 3MEGA 3LWMA 4EPCA 3MZYA 3CF2A 3PGGA 2WA0A 4M71A 4L6V5 2OTJA 3VA3A 2WBNA 2VXDA 3CCUQ 4MO5A 5K7FA 2K40A 4RGXA 5KYXB 4IRHA 5JMVA 1TG0A 1WSGA 3ENHA 3VSKA 5LL6S 2JHNA 3CHWA 3ASOH 1S72Q 3PJRA 3DLMA 3KK3A 1VQLN 1Y96A 4MLHA 3PO4A 4Y33A 3A2FA 3EAEA 1X1CA 1NGEA 3DWLE 2CZ0B 3BY6A 2BHZA 4M9XA 1S1TA 2P81A 1NBEB 1TGOA 3CQYA 5CVRA 2FBKA 1RNLA 3OYAA 2FBTA 3S1QJ 1Q9XA 4NQWA 2ASOA 3DYAA 2D1XA 3CD6A 5CIUA 4HEA2 1RIOH 1I6XA 1DQUA 3CO6C 4GFBA 4IEEA 3ML6A 2VXEA 4AYBN 3O6WA 1SSFA 1QVPA 5E8IA 2R92J 1NPPA 4BDZA 2E35A 4RGRA 2Y4YA 1J2XA 2E64A 5C6SA 3NF9A 4FWRA 3FK7A 2FSKA 5KNLA 5GAMd 2P9UB 3M5AA 4A3FJ 4ETSA 3HOSA 2XGEA 5J6XA 4WCGA 1YO5C 1U78A 4YFUA 2PVGB 5GPCA 2RQVA 5DM7F 2VCPA 4GV9A 2P7CB 1KYZA 2MYSA 1M3CA 1WXUA 2DPNA 3FIWA 3VN5A 1X3UA 2HQEA 3LNQA 1F21A 2QXLA 4IIMA 2L9NA 4A0YA 2VJ4A 4HSRA 3L4IA 3HOTA 1UGQB 2D0AA 4LLNA 1R0AA 2ZNYA 4B6MA 3URGA 3O9SA 4TV7A 2HVIA 3FE1A 1VA7A 2BUDA 4DYQA 4LDWA 4KGXB 1C6VA 1LWEA 3V1QA 2HHWA 2XO7A 1PG5B 2EQRA 1TSFA 4BRPA 3DLLA 3CMEN 3AO2A 1VQ4Q 4BVOA 2DXTA 1TW2A 1D5YA 3T5XA 3X24B 2E1YA 1OVQA 2JN6A 3VJPA 3EE9A 4HVJA 4EDUA 2K27A 4AFUC 2E6ZA 1B6AA 4E9HA 2EJFA 3K4JA 1VQPQ 4EZ9A 2CT3A 3IUCA 3CC7Q 3CMAI 3OIQA 3ABMH 3F8MA 2XKPA 4B3SK 4KT0E 4HUFA 5GAGJ 4BRQA 4M6YA 2DF6A 2VLAA 3FMSA 3OBYA 1ZA1B 5J1EA 1S1XA 1Z9CA 1SKRA 4IEIA 4N56A 1XGOA 2VUMJ 4XTVA 4WF9L 2VQCA 3TOBA 1KA8A 2L01A 4IFEA 2YWWA 1NJIR 3M9QA 4LSNA 1KLNA 3W6VA 3S2DJ 1JQQA 3SK3A 2B86A 3MWTA 1QHTA 3EG9B 1K79A 3M07A 4DR2K 5KCMA 3COAC 2VJJA 1J5OA 1OJLA 2VV5A 5HY6A 4CCJA 3GOIA 1OKJA 3LANA 2E5QA 1BI3A 4LGWA 3KFWX 4MDAA 1P6RA 2P9NB 3EYZA 3BE3A 4MLEA 4EMGA 4JP0A 4N9HA 2CP3A 4BI4A 1QHGA 3SDZA 2X6YA 4IOCF 1VQNT 3OMYA 4FYXB 2Y9YA 3QEPA 4DYCA 4K8ZA 2P4WA 2G3RA 1VQPA 4DSEA 5M3FJ 1KXPA 2RK2A 1E17A 4JHDA 4XBFA 2BGCA 4H0VB 1RAEB 4GXOA 2V8JA 1UG1A 2EVRA 3D2EA 3MKZA 1VQ4A 4ON0A 1W70A 4M45A 4LFBK 1X3NA 3ZT0A 1DDNA 4FTHA 2C06A 3LSIA 3CLOA 2XIDA 4KH6A 3U21A 2OQRA 2DX1A 1GCPA 1H3ZA 2DERA 3RPUD 1LUJB 1KFZA 2L3RA 2F5FA 3MEDA 2W00A 1XC9A 5HROA 2KKOA 5CKTA 2VVKA 3ZQGA 1ZXOA 4II1A 1UELB 1OU8A 1X3ZB 1BO5O 3TWHA 3FBNB 3V8LA 4DSFA 3ABUA 1ACMB 4IIOA 5LGNA 4UUSB 1UB4A 3CCVT 4HX4A 2O61A 1UAXA 2CH6A 5LGUA 1JCFA 5D4SA 4M77C 1TL8A 1ZARA 3VYTB 2NNNA 2X6XA 4LDYA 1RCHA 3C18A 5D5XB 2X35A 4A5AA 2K6DA 2E2IJ 1YQKA 1YITQ 1WH7A 2MG4A 4OKKA 4I7FA 2QG9B 4XRFA 3TDZC 3L8BA 2F8SA 5JR3A 3D6RA 2IVWA 1N8RR 3ZETA 1VQOQ 1MGTA 3HTUA 2VC1A 1IN5A 4CGHA 4DW6A 3VQ7A 3J81K 4Y3OA 2GEMA 3FZKA 3K4BA 2DA6A 2X6WA 3DPTA 3FR0A 5SZTA 4C5HA 3K59A 2FC0A 1QVGA 3HYFA 2XPVA 4B44A 2BY1A 2XY7A 4K41A 2OU2A 2IC3A 3U4LA 4KUMA 1JKQC 4AI5A 1D3YA 5IHNA 3G6EA 1RI9A 5HOOA 2XPUA 2CRGA 1XWLA 1YHQA 2LC4A 3VSLA 1Y39A 3LWIA 3WGIA 2CJJA 3KZZA 3GOXA 4I0BA 3WNFA 2LJ1A 3HPWA 3SQ2A 2MA3A 3J80O 4DCHA 3U9ZA 4BVPA 5B66C 2M4GA 1TP4A 4M3WA 2WSFE 4KT6A 3V9XA 1HW1A 2O8KA 5IYCJ 1OVYA 3T9NA 2MWOA 4NO7A 1HLUA 3LL7A 5IT3A 3DCFA 4LG0A 4IBNA 1VQKT 1RT6A 2YS9A 4AWXB 6AT1B 1QSLA 4FL6A 5GMKe 3CTAA 1TAQA 1W7PA 4HVWA 4N76A 1I27A 1ZR4A 4FCYA 3JYTA 2IEKA 1WFWA 3DXJF 2Z9OA 2ZCWA 3OYEA 2FUG2 4OB0B 4AYBA 4HCKA 4LIUA 1KVAA 3EHRA 5J8CA 2RPNA 2LJ0A 1T8EA 4A3JJ 3CCVN 3KTQA 1VQ5T 3CD6N 2R7WA 4FM0A 1VYVA 5CQGA 4EMSA 4KGZB 2EZIA 2O4XB 4BWJA 3LP0A 1ETWA 2NWMA 1IO2A 4M41A 4JLGA 3OYNA 2E2OA 5GJVB 4J2AA 5BQTA 4E2FB 1Q7YR 4OIRF 4M63C 3I55N 2E6LA 1SV5A 4HZFA 3CQ8A 3S3MA 2ESWA 5JS2A 1VSFA 4M77E 4W5RA 1OH7A 3OYCA 3TL4X 4M75B 1I3QJ 2QA4A 4G8XA 3S14J 3BR5A 2DYBA 1PDNC 3CMET 2GFUA 4X62K 3GFJA 1X58A 2MFZA 1UG0A 2M9HA 4IQJA 3TW6A 2IIMA 1VQOA 3BTIA 2O5RA 2ETHA 1ESVA 2LF7A 3CPWA 4LF9K 1VQNA 3P9CA 2EFIA 4HCCA 4K8XA 1Q86U 3PMIA 2RPIA 2X3WD 4D7NA 3JV3A 1U49A 4JUVA 1A6QA 2QKLB 1ETXA 1NPRA 4BRMA 3IRXA 2IBDA 3J81E 3L2UA 1I1GA 1YI2N 4U7BA 1KQ9A 4KUDK 4ILGB 3CJRB 2AJQA 2H3EB 3ATVA 3OR2C 3QZ5B 5C0YA 5HDKA 2P5VA 2YU3A 1ODDA 2DNUA 1S8NA 1BOTO 2NZTA 2F69A 3JB9F 2FNPA 2KT1A 1UHMA 1B9MA 3CCEI 1LJOA 3CPWM 5JVTA 2X4YA 4M7DC 2YXYA 1HF0A 4KTWA 4GDFA 3NH0A 5AQUA 2DTIA 3CCEA 3BZCA 4YTLA 4DEYA 4FLYA 1DPUA 4M75F 1NJYA 4BG8A 1IG7A 3DRPA 4M3EA 1XJWB 2FHDA 2EQMA 2VWKA 1I4K1 1FOWA 4A3LJ 4H4MA 3SYTA 2EFNA 3TCJA 3W2WA 9ANTA 1P4AA 3TDUC 2DI3A 2EA4A 4A3CJ 3ZL7C 2LP0A 1GOAA 3E6DA 3PX0A 5EEAA 1XQOA 2VPLA 1F36A 1MGQA 4DFKA 5K14A 2QEXN 1PVEA 4K25A 1ZHIA 3QO9A 1E0EA 5DY9A 3SPYA 3M0UA 4JI4K 3QYEA 2STWA 2ME6A 4PJLA 5CYQA 2EIMH 1W7AA 2NNYA 3E1YA 3K9JA 4J9DA 1WJEA 4ZHRA 1VF9A 3M53A 5AZIB 1R71A 1D1CA 5GAN2 4G6QA 5J1RA 3X2QH 1RDWX 2KLAA 1WHKA 1WHLA 3AVCA 2NLXA 4C92F 2RJFA 4C0FA 1IDYA 4QKUA 2B63J 3HSBA 4PJ0C 3TAMA 3A98A 2FF6A 4LNPA 2KJCA 4CGZA 1YITA 4DWIA 3JB9H 2BW3A 2QTDA 1Y1VJ 1JLCA 1EP4A 1NK9A 4EA5A 3GYHX 2O8FA 2LMDA 3KUFA 2BOLA 1QQNA 1SD6A 5I11A 4JRIA 4AM7A 1RKWA 3HHGA 2EV0A 5EVZA 3OB9A 5LJ5f 1K6YA 2JA5J 4CVNE 2HCKA 3TAQA 3U2RA 1KQ2A 3N97A 4A6DA 1XCVA 1LPLA 1BBYA 4IO9L 2A6HF 1G5VA 4IO8A 1ZQ1A 1K9MR 3T1YK 1Y6IA 3HL2A 1QNTA 2BGGA 3I58A 1ITGA 1GXQA 4FJLA 5D6FA 1M1FA 1RPWA 1ASUA 3QUIA 2JT1A 2W42A 1VQOI 4E7SA 4AHUA 3QNNA 1YQMA 5C24A 4UY8O 1YS7A 4CEEA 4DS4A 2LT4A 1M5Q1 2KVQG 1AKHA 2FF3B 2EQKA 1QZEA 4PKCC 1QE1A 4LDUA 2CGJA 4FJNA 2B8AA 3K4NA 1XQPA 4F16A 3DTKA 2Y4XA 4CHPA 3OOPA 2FF4A 2QKMB 3I9QA 2D5RA 4B9XA 1MMGA 3KKRA 3KNTA 1MUNA 4CH7A 2AP1A 3C94A 2M7AA 2IPQX 2DJZA 3WXIA 1UGPB 4CZIA 1QVTA 2DO7A 2E1HA 4BEHB 2Q31A 2PTKA 4B3TK 4E47A 3FRNA 4BHCA 4EP5A 3UA6A 4OFHA 2L7KA 4KHSA 3IKVA 3PMTA 1AOYA 2Z1DA 1RESA 3L2WA 4QS7A 4QPQA 3FXUA 1UGSB 2V4JC 4B22A 4PJOB 4XICA 1RDCA 4NCGA 3FFKB 3V7CA 1LWWA 1HMVA 5CKBA 3AAFA 3C1DA 1N34K 1NE8A 4XOPA 3KWIA 1DU0A 2NVUB 3L3VA 1SRMA 3CJBA 5AT1B 3NE6A 2KIQA 1RBVA 2YHWA 4XMYA 3GCMA 1ZBHA 4LJZF 1OH8A 5CVJA 1WI7A 1J54A 4DSKA 2HEOA 5CQXA 2YLCA 1KQSS 2K4BA 2Q1NA 4YOUA 3CCJQ 3EETA 4LITA 3H6EA 1BWFO 4RS8A 4RCBA 2R7OA 3RMCA 4BE2A 5L3FA 2DO3A 4CZFA 4I99C 4E7KA 4IHVA 1QQJA 2XHBA 4BJ5C 3DI6A 4EJUA 2ZZDA 5DUKA 1CZAN 3OTOK 5IH2A 4JOMA 2A07F 3BF1A 3OS0A 1NKBA 2BHYA 4CI0C 2F4OB 5LY3A 4KHUA 1RDBA 1M3QA 1U2VB 2RHUA 5GMKi 2HQNA 3RDIA 4M7DF 4CUGA 3K4MA 2XGXA 1S22A 2F96A 1HQEA 3CUOA 1EETA 5IYDJ 4IFVA 1YJ9T 1KGSA 1U2WA 3HYIA 3RPQA 4B8AB 5JVGF 4M7AG 3KP7A 1ZQ3P 2F9WA 1WUAA 1BI1A 1WAFA 1UFMA 2WOMA 2LR8A 1MMSA 1WJFA 4XLEA 3CC4N 4HUGA 1VQNI 2K79A 3E97A 4UVCA 4HCZA 4MNUA 4CRIA 1X43A 4MFDA 3OSVA 3L2ZA 2HTSA 1RDDA 3M8QA 3ZQLA 4E7JA 2WB1N 3BROA 3W6KB 3V7RA 4HX8A 3SQ4A 2JTMA 3EGXB 1RLPC 4A2AA 2DJNA 3EO3A 3PVLA 1K61A 2E60A 3CPWP 3PO5A 2PYJA 2KISA 1RBSA 4C1NI 3IAS2 4WX9A 1ORPA 3A01A 2M45A 3QU3A 1TLHB 5KYWB 1M2OA 3A0BC 2MLGA 1QCOA 5JLHA 5F64A 3FZHA 2DA7A 4H0OA 3CCUN 1JU5C 2DFHA 3NARA 4XK8E 2KFDA 1OZ3A 2ECZA 1TBXA 1NJZA 2BE9B 1VTNC 2IXSA 5EZHA 1TWFJ 1Y0UA 4KHYA 4F93B 4EIAA 1WJCA 4ESBA 4OIQF 2AZSA 4CHOA 2DPPB 1J9AA 5LJ5h 1XGNA 3WE3A 4YFXF 4AIHA 3J81O 1YW7A 4BBRJ 4XTWA 5BPNA 3JSCA 1TXQA 4CIGA 3C65A 1P7MA 2DAQA 3CC7T 4IOCL 1XC3A 2AQFA 4PKHA 3KEOA 3C7NB 4M3XA 3TP0A 1ZRCA 1IZ6A 3V8JA 3R4KA 3D5RC 5T7BA 3WXLA 1WDXA 3ZCOA 1N78A 2LT1A 3ZGKA 1TT5B 4C8LA 3NPFA 1V4RA 4CGJA 3SCXA 3ASKA 2NUTA 5LJ3g 2P0PA 1UA1A 2LQ8A 3CUQA 1OYYA 3DU5A 2PJRA 2A69F 5J2MA 1KSWA 3I55A 2RI3A 4E1MA 3HBLA 2COWA 5LLQA 2MI6A 2O3FA 2DLPA 4CF1A 3CCMT 3CF5L 1HJDA 1VQMI 3S93A 3I59A 3VESA 1SD5A 2DPDA 2JS0A 3E9PA 4ZGDB 1RILA 2PG4A 3NWTA 4KDPA 1NGAA 3M54A 2PX9A 1YX3A 1OH5A 3H0FA 3KHYA 3ZSVA 3A8OB 2DKGA 3NF8A 4D1QA 1QBJA 4FT4A 3C7NA 1Y97A 2C0IA 5EX5A 4JI6K 2HKNA 3CD6I 1KG3A 3AVHA 4F7UB 1E6HA 3HOVJ 5DYMA 2GNCA 4DOWA 1BQMA 1R7JA 1W36C 4FW1A 4KHQA 1HJRA 3WTWC 1MDUB 1GBQA 1BI2A 3ER0A 2GF7A 1PUEE 3V9WA 3GTJJ 4ZNXA 4GNIA 5E3LA 1YJNA 3JSMA 2XAUA 2DD4A 4GRIA 4DTXA 3RMBA 1HCRA 1Q82U 3CPEA 3WGGA 5HS9A 4FE4A 1MMDA 1WQWA 1W7PD 5FKNA 2R3SA 1A36A 5FPNA 4DBRA 2GIVA 3M0PA 3VS2A 1USSA 2QA4I 5B8HA 2K2MA 1ZG1A 1BCMA 3GTOJ 1WJDA 2Z16A 1TZLA 2G8VA 4BB7A 3GXOA 2MD5A 4BXXJ 2FSWA 1E6GA 5KHDA 4O8KA 3NF7A 4EFHA 3AAQA 1ZGAA 2ED1A 3PNVA 1RRJA 2PVOB 1GCQA 4AI4A 2E4LA 2X9HA 2CFXA 3ELKA 3M57A 3AARA 2Q0RA 1O3QA 4L9VA 2CZ7B 4BRCA 5GAMe 3JRDA 3VEVA 3O8MA 1XGSA 2CH0A 4AILC 4FK4A 4NZGA 2FBYA 1U3OA 5A0LA 4Q5VA 4JK8A 2QQ8A 1WXBA 3CCSA 2DTZA 4QVCA 2KGTA 1G2BA 3LCNA 5L3BA 2DMUA 2XK0A 1OCPA 3ZRGA 3FZVA 3J7AY 5IN1A 2CH5A 3ONQA 3ZT1A 4KHPK 1S1VA 2ED0A 1T7PA 1TKDA 2ZNZA 1LDDA 2V6EA 4DG1A 4B3MK 4M6XA 3CCLI 3E9GA 2EIJH 2YG8A 1TYQB 4FWMA 3J81Z 3MX5A 4E89A 1MSEC 4NB5A 3F9KA 5EZGA 3ABTA 2FB7A 4P9FA 2XASA 1MJAA 4L3QA 4BDPA 5M5YJ 3H3VK 3PO2J 5I9EB 1YJ9N 2DODA 2UYTA 1H1VA 2KHOA 1HQUA 1BL3A 1U04A 3BWGA 2ZE2A 3JRBA 3TW7A 4DR4K 3CP8A 2XU8A 3T3FA 4Z8AA 1FPQA 1V55H 4RTYA 4DIQA 1OISA 2ISYA 2Y0SA 2DDBA 5FD6A 3U3GA 2IS6A 5HK0A 2J5PA 1IXCA 2K9GA 2R5ZB 3LDSA 4A69C 1FNNA 4G7ZF 3MZ8A 1S9GA 1RT3A 4BQLA 2KDSA 1L3LA 1ATNA 2L54A 3PIOA 4O5VA 1FK9A 3CCMA 3F23A 4D5CA 3E1SA 4CDGA 1NYFA 1CZBA 3N4MA 3CXCM 1KYWA 2HFHA 1K73U 3CESA 4H5WA 4RLFA 4M78A 5A2QZ 4PLIA 1B92A 3M4OJ 3K70C 3TVTA 2OTLN 4FLUA 4D8DA 3EE8A 3ABLH 1DKGD 1X6BA 3PNWC 2QKKA 1UFFA 1B1BA 4GV3A 3IHOA 5AQHA 5GAMh 1TUYA 5LEJA 4ZDPA 3U9GA 1WSHA 4A4HA 2ICWG 4YIFA 4CK2A 1LVKA 5H1SQ 1APLC 3CCUT 2M16A 4BHPA 3VEOA 4PIIA 3RUXA 1NK0A 2RA2A 1ETYA 1MU2A 4ESFA 3PY8A 1UTIA 2GELA 3MKDA 2BZ8A 1YITN 1TH7A 3SHFA 1NOZA 4BRLA 5EEGA 1K78A 3CC2A 1ZK8A 4B08A 1WH5A 1TU0B 4IHSA 4CZCA 4WQ4A 3EDPA 1FYKA 2RM4A 1B59A 3FMQA 5GAN5 1W5SA 2H3JA 3ID6A 4DQQA 4CBUA 3AL0C 3L2VA 5CE3A 3GTKJ 1W2BS 1G6NA 2HYGD 5GTHC 3ZQCA 4ABZA 4KFBA 2UXBK 2MC3A 1QZ6A 1TKTA 3S1NJ 3LA3A 5FLXE 2HNZA 1M1GA 3EL2A 1M8MA 2YT6A 4O0JA 1VQ6Q 1R5HA 4IVNA 3FKIJ 3H5AA 2EYZA 5DPKA 1LWCA 4DR5K 2D1VA 3JXUA 3OA6A 1JXMA 5LJ3d 3EZ5A 5K7ZA 2WONA 2LCLA 3MEWA 4WXCA 2WTUA 4C8QA 3VYHB 2A5WA 4GY2B 1ZGJA 3JCMQ 4M75A 3SAFA 3LP3A 3INZA 1HYVA 2Q36A 1FOYA 1T44A 5LJ5j 3FM5A 3QNOA 2HMIA 4G9ZA 4GKJK 4UQGA 5GIPA 2Q1ZB 1U1TA 1WRJA 1PHTA 1RTJA 2JWLA 1SAUA 3TSZA 1L3VA 1Z9QA 1YYVA 1JJ6C 1DGWY 1TUCA 1ATRA 4L5EA 5J4YA 3KLOA 1W6XA 2M0MA 4YOWA 3VGLA 4DQ8A 4KB0A 3CMEQ 3E3VA 1A5VA 4CCLA 3ZT4A 4AHRA 3Q0VA 1PUFB 2OTJN 3BG3A 2MF2A 3IKTA 2P51A 2KP6A 4NB4A 2X3XD 2BY2A 5M1QA 1A5JA 2RNAA 4JKGA 2YI1A 1IO6A 2EBIA 2UXXA 1VQ9Q 2OTJQ 3A0HC 4IX7A 3RKXA 2ZPHB 4N4IA 1IKYA 3EH2A 1NLVA 3QFPA 2QGUA 4CGDA 2CT4A 3JAMZ 5EG0A 4D7MA 1Q81U 1K9MU 4AVPA 2ZBKA 4A3IJ 4CI6A 2Y9ZA 2YRCA 2OTLQ 1L3TA 2KIFA 2QLZA 2E6MA 4DTSA 3EG2A 3J80Z 5DTDA 1KHIA 5H20A 2R7SA 1FYLA 2EFWA 5M5XJ 3THWB 3IAYA 3ENBA 4C3IJ 5B5EC 3GTPJ 4JN4A 2P5OA 3JCMX 2NS0A 4Y1DA 2L2OA 1REPC 3QEWA 1E3OC 4ENNA 1VQ5Q 1JTXA 4Z4HA 2NNWA 2L9VA 3FJPA 4LD9K 4IOXA 1X3WB 1ZBUA 1IBKK 2CQ7A 7AT1B 4HVVA 1ZN2A 4E7HA 2ZB9A 2ZSIB 3NFAA 1RETA 4M78D 4X64K 3LALA 4HV6A 2Z33A 3SEZA 5E3OA 1MUZA 1BI4B 3VS4A 1K8AO 4UUSA 2WUSA 4LUDA 2EV5A 4HAMA 3KEYA 3M8SA 1KU3A 5CVUA 4FLVA 4A4GA 1UJ8A 2ZJPF 1M3HA 4KAZA