4ZTFA

Crystal structure of the prototype foamy virus intasome with a 2-pyridinone aminal inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Discovery of 2-Pyridinone Aminals: A Prodrug Strategy to Advance a Second Generation of HIV-1 Integrase Strand Transfer Inhibitors.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna/inhibitor
total genus 103
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ztfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ztfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ztfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ztfA03
2X35A 3VQQA 3CFRA 3ZSOA 1BHLA 4BWMA 3EZ5A 4DTSA 1SKWA 2NLUA 3MP6A 1VSDA 3KK1A 1NOZA 1ZBLA 1T05A 3K2PA 3KKSA 2GBZA 5KCOA 3DB3A 2L3RA 2PY5A 3MEUA 2X4XA 3V1QA 3U6FA 3K59A 1JLBA 4A4GA 3NGIA 4UQGA 3AVFA 5JS2A 1T03A 4ZTFA 4GVMA 4B9VA 1S5JA 4FJ5A 3LGFA 3P83D 3SV3A 4Z4EA 1UA1A 1RTJA 2DY4A 5HRPA 4CRIA 4OPJA 3MEDA 4PLLA 3ZSZA 3ZT0A 4PLIA 1OI1A 3LDSA 4HUGA 3OYLA 4AH9A 3TAQA 3WNEA 2LVMA 4CJSA 1IKXA 3FEOA 3FFIA 2VYTA 2FC0A 4IUPA 4FK0A 4CFDA 3QETA 1QSLA 4Z4FA 3NH1A 4KI6A 3HP6A 3L3VA 3THVA 3PNWC 4I7FA 1IKWA 3SQ0A 1LWCA 3MEVA 4FJGA 1TL1A 1RCHA 4KAZA 1VSMA 4CJFA 3NF9A 4Z4HA 4DLGA 4AILC 4KKOA 3T19A 4O5BA 4FLZA 3OYHA 3VQ7A 2Z1GA 3KKRA 4CJTA 4UC4A 3IRXA 3AO5A 4JRQA 3TANA 1KLNA 2RHUA 4CJ4A 3C4SA 4OJRA 2RHZA 1NKBA 4CEZA 4DTPA 2XY7A 3LLRA 3QO9A 2RPIA 4E7LA 4DG1A 3TARA 3KK3A 3NAEA 4PA1A 4KI4A 3KJVA 4E7IA 1QS4A 3NHGA 2EHGA 3VQ8A 4B9XA 4RW9A 4B08A 3KLHA 2WONA 3NGYA 1UA0A 4KRFA 1U49A 1S1UA 1XWLA 4NCBA 2PYLA 4CF2A 4QW2A 3OMGA 3KD5E 4ELUA 3OYAA 1N27A 2DFEA 1DLOA 1LWFA 3NF8A 4PL6A 2G8VA 4L59A 3PX6A 4N47A 2O4XB 2GV9A 1NJZA 1BISA 2IOCA 4DFPA 3DYAA 5KCHA 4HHTA 3UIQA 4HCBA 1TVRA 3ZSVA 2FBTA 3PUFA 2Y1IA 3MEEA 2BDPA 4FJMA 3NF6A 1J53A 2FBXA 3KK2A 3HM9A 2A1RA 5FRNA 2YNFA 5IN1A 3NH2A 3K5OA 1LV5A 4LH4A 2QQRA 1TK5A 3LAKA 2E6MA 3NBPA 4C8LA 4AHVA 5KE2A 4KHNA 1A5XA 3M8QA 2HHTA 2L8DA 1S1TA 2X6NA 3LZIA 3DOKA 4HCCA 2G8FA 5CIUA 4B9SA 4DSJA 3EY1A 3NE6A 2G8UA 1BQNA 4KB1A 3H8ZA 5HROA 3L2VA 1IO2A 3HVRA 4CIFA 3QIPA 3SV4A 4CIGA 3IS9A 4OGCA 3HPOA 4IURA 4DU3A 2D5RA 4E3SA 5KH6A 1JKHA 3F9KA 3RR7A 4E7HA 4B8AB 3MXMA 1KHCA 1FK9A 3OS1A 4DFJA 1QE1A 5C25A 4FK2A 4C8NA 4C8MA 4F2SA 4DQQA 4E89A 4O44A 5KTQA 5I42A 2XO7A 1YTUA 4C5IA 1HYVA 3FC3A 4EZ9A 2AJQA 1QHTA 4NCGA 3NTKA 1RDCA 1X1PA 5FRMA 1U04A 3HPGA 3VA3A 1Y97A 5J2MA 4GMJB 2YNIA 4KHYA 4DTMA 3DLMA 4YNQA 3U3YA 4DFMA 4DQSA 3HVTA 1REVA 4CJ5A 4CJQA 4FJJA 5HRSA 3ULDA 3QNOA 2ATQA 4I9QA 4OGEA 4FLTA 3HSTB 3ZT3A 2RJFA 4OVLA 4EDUA 2R7YA 5SZTA 1BIUA 4CJWA 4IFVA 5EU7A 4Z4CA 1X9SA 5KRSA 1ITGA 3AVLA 4KB0A 2RHYA 2PYJA 3V9WA 2HHVA 3WNFA 3SPYA 4OKJA 3SI6A 2DAQA 4DU1A 1NK9A 3NTIA 1WSEA 5J2QA 1B9FA 3OJUA 4HCZA 4O55A 3OYIA 1VSHA 3TAPA 4KREA 1XC9A 3KTQA 3HYFA 4W5OA 2X4WA 2D0BA 5J39A 2IDOA 4FJXA 2MWOA 4QQGA 4TSXA 2HNYA 2BGGA 2PQWA 1SKSA 4PQUA 1CZBA 1VRUA 4LSNA 5J26A 3NFAA 2HB5A 3WNGA 4LY7A 3OB9A 3HO1A 2WACA 3CYMA 4J2AA 1RT5A 4BDZA 2B4JA 3I0SA 3ITHA 4N41A 4CJLA 4N5SA 3SD4A 3SUQA 2EQJA 1KSPA 1WJSA 3CFPA 4I2QA 4M42A 5K14A 3OMCA 4A4HA 1SV5A 4R5PA 1UOCA 2F8SA 4B9MA 4CHNA 2ZE2A 1JXEA 3DMJA 1TKXA 4F8RA 4J2BA 1JXBA 4CHOA 3VQPA 4N76A 1ZBIA 1KFSA 3HXMA 2DFHA 5C24A 4DTUA 2X74A 3SUPA 4FZXC 2VG7A 4ELTA 4FK4A 1KVBA 3LANA 2JTFA 4CGHA 3RMAA 3OS2A 2VWJA 4CF0A 2IG0A 3P8HA 3NNQA 2KW4A 4FM2A 1G5VA 3AA3A 2XY8A 2B5JA 5J2PA 4FJ7A 3LZJA 2B8AA 1KCFA 4E7JA 4IG3A 2P1JA 4QAGA 2KZZA 3QEPA 4FM0A 4M3ZA 2XDPA 4N4IA 2EQUA 1S1XA 2OPSA 3QJ6A 1TV6A 1ZYQA 1NKCA 4BWJA 3MXIA 3OYFA 4IUVA 3QNNA 3OA6A 1IKVA 3ZSYA 3TAGA 3O4QA 1EP4A 4B9NA 4CGIA 4B8CA 3AVCA 4AHRA 4Z0UA 4F3TA 3O3FA 3D0PA 1VK0A 4E7KA 4RG2A 2E4LA 2O4GA 3PMTA 4CF1A 2QQSA 1GOCA 2EQMA 2YHAA 2BIVA 4OLBA 4DQIA 1QQCA 1A5VA 3O3GA 2VG5A 3O3HA 2X6SA 4CJEA 1Z26A 3NH0A 2ZD1A 2D9TA 3L2WA 2KQ2A 4M3XA 1NK4A 5KGXA 4KFBA 4F3OA 1QTMA 4N4GA 4CIEA 4KHSA 3SUNA 1VSLA 3RMBA 4CJKA 1C1AA 3ZSQA 3HP9A 3DI6A 2HHWA 4CGGA 2R57A 4J2EA 2GFAA 4Q0BA 3FLGA 2OPRA 4ID5A 3M8SA 5CYMA 1RT1A 1SL0A 2HHXA 1LW2A 1RTDA 4CFAA 2FHDA 1SSFA 3PX0A 1TK0A 1EKEA 3OYJA 2XHBA 2JLEA 4CEFA 4CEAA 1FXXA 3K57A 4QQ6A 1KLMA 4DQPA 3QEIA 1SL2A 4JS4A 4CEOA 3AVHA 3MXJA 4FJ9A 3DLRA 4IBNA 3HK2A 1WSGA 3DLEA 3QIIA 3VQBA 4C5GA 3GOXA 3SNNA 3CQ8A 3QERA 3BDLA 5J1EA 1RBTA 2OZSA 1VSKA 4PUOA 1IG9A 4NS5A 3AO4A 1RNHA 2BANA 4B3OA 5FDLA 1TK8A 4CESA 4A4EA 3RRHA 2DTUA 4EP4A 3LWMA 4FYDA 2M16A 1RT6A 4FXDA 4B9LA 2XRIA 3SQ2A 1R0AA 3OYBA 3S3OA 3QINA 4AHTA 3LP1A 5T7BA 1C0UA 2EKOA 1MU2A 3V9XA 3D45A 3TWHA 3KLGA 4H4MA 3AA4A 4Y1CA 1GOAA 1RI0A 4IUUA 4FLUA 3NDKA 4IUQA 4Z4GA 1RDDA 4LSLA 1C1BA 2Y1JA 3QKJA 2RI5A 5J2NA 1JLCA 1RDBA 3P8DA 3A2FA 2PZSA 2BE2A 3MP1A 4EP5A 5C6SA 2YRVA 3L2QA 1ZBHA 2RHIA 3F73A 1O1WA 3T1AA 3O8VA 1HJRA 4DTNA 3QEXA 3HL8A 4B9WA 1LW0A 2R58A 1N5YA 1YT3A 4DWIA 2G3RA 5SWMA 1JLFA 3PO5A 2VWKA 4DF4A 1D9DA 3VQCA 3KLEA 4CE9A 1KRPA 1FKPA 5D6WA 4F2RA 1NK7A 3ZT1A 4ICLA 1RILA 4DLEA 4BD3A 3RMCA 1NJXA 4DTXA 1TL3A 3LPTA 4JRPA 1TAUA 3OYNA 3CM5A 3TAEA 1HYZA 4FJIA 3ASKA 3AO2A 1WSIA 1HYSA 4K8ZA 2W42A 4DSKA 1C0TA 4BE0A 1L3UA 3LX7A 1C1CA 5HLFA 2RF2A 1RBVA 1UWBA 1SUQA 2RJEA 4CK3A 3LGLA 2O4XA 1S9EA 3QEWA 2G8WA 3RTVA 4PWDA 3OY9A 1C0MA 1JLQA 3LPUA 2CKKA 2YHBA 1WJRA 4M3RA 1KVAA 3AVIA 3AA2A 4FLYA 1DTTA 3G0ZA 4CGJA 3CM6A 4BACA 1BI4B 3DM2A 4E0DA 1RBUA 4C8KA 4I9LA 1RDAA 4CJRA 1IH7A 5HRRA 1Q9YA 2KTQA 3VQDA 1XHZA 5IAYA 1TKTA 4CK2A 2Z1IA 2E6NA 5D6YA 1SL1A 1DTQA 3SQ4A 4RW4A 3E01A 4IKFA 3OS0A 2RN2A 2KFZA 4CFBA 3ZT4A 3HJFA 2Z1JA 4DS4A 5KI6A 1RT7A 4RW8A 4Z02A 3S3NA 3SYZA 1UAXA 4FLXA 3MEAA 4L8RB 4ID1A 5HBMA 3V6DA 4KTWA 4CHPA 2HHSA 3M9QA 1BL3A 3QIOA 1HNIA 5CZ1A 3JSMA 2M1HA 1X9MA 5E41A 1JLAA 3KD1E 4B9UA 3SJJA 2RO0A 4CHYA 4W5NA 4CJ3A 4CEBA 2LCCA 1IKYA 2JZ2A 3AO1A 4QVZA 3OQ5A 4NCAA 4E1MA 1KTQA 3AVBA 1KFDA 5CYQA 4DTRA 5CY4A 4M3TA 2Q3SA 4BE2A 4DMNA 3DOLA 2DFFA 4FVMA 4FM1A 3LAMA 3AA5X 1ASWA 4DQRA 3G10A 1TKDA 1RT2A 1I3AA 1NK5A 2L89A 2K3XA 1BI4A 2XY6A 3ZSWA 1EETA 3DB4A 4QCLA 4FZZA 1Q9XA 4RW7A 1CZ9A 1EXQA 3PV8A 4CGDA 2P51A 4K8XA 1CLQA 3KIOA 4CJUA 4M41A 2IS3A 1N6QA 2RI3A 5CZ2A 2DIGA 1ASVA 2GF7A 2FBVA 2RKIA 5DMRA 2LRQA 4AHSA 3OYDA 2HQXA 4F4KA 3UWNA 1I39A 4DSLA 3L3UA 2IAJA 4NZGA 1XHXA 1QSYA 3VQ5A 4DSFA 2I5JA 1VRTA 2LSNA 1WNSA 4Z4IA 3K5NA 4J2DA 1Z25A 2ZQBA 2GFUA 1H3ZA 1VSJA 2VG6A 2IGIA 3OYGA 4G1QA 3RR8A 5HP1A 3OYCA 3DRPA 4CECA 4IFYA 4DFKA 1TAQA 3U3GA 2F8TA 4NYNA 1L3VA 2R5AA 1T8EA 1GOBA 2QXFA 3CFOA 4KTQA 1A5WA 4IUTA 3QESA 1RT4A 2P5GA 4XIUA 3DLKA 3F70A 2E6LA 1RBSA 4KHQA 2MWPA 3DLGA 4Q5VA 3OJSA 3MO8A 3OYMA 4OVAA 4DU4A 3NTHA 1WSJA 3AV9A 4OPKA 2GUIA 2OPQA 3DLHA 1EX4A 3B6OA 3WNHA 1CXQA 4DF8A 4X34A 4FJ8A 1TGOA 3IAYA 3S9HA 3L2RA 4HUEA 2HNDA 1U45A 3META 3V9ZA 5JS1A 4JLHA 1T7PA 3TAMA 4BDPA 3L2UA 3KLIA 4FJLA 3DRRA 2OZMA 4CEQA 3SCXA 2KFNA 2HVIA 2M0OA 4W5QA 3QBYA 4FU6A 3M8RA 3ASMA 3V9UA 4JS5A 3TABA 3TI0A 3P1GA 2RJDA 4RG8A 4KHWA 2OPPA 3BGRA 1OYXA 3LP3A 4II1A 4E19A 3AVNA 1B92A 3AVMA 3O4NA 4CF8A 4B9TA 1WAJA 1U47A 3C6UA 1JL1A 3HPHA 2HHQA 1RBRA 3CG7A 3UT1A 1NOYA 1K6YA 1JLGA 2EX3A 1VSIA 1SKRA 4KO0A 1RT3A 1MHNA 4YFUA 1J9AA 1OZ2A 4DSIA 3OYKA 2HMIA 1WSHA 4EZ6A 2P0KA 1NJWA 1HQUA 2JGUA 3V81A 3V1OA 3V1RA 3PY8A 3M8PA 5KGWA 1HQEA 3OYEA 3V9SA 3EYZA 5D3GA 3VQEA 3L8BA 4QOZB 3H08A 4FJKA 1RTHA 3CEYA 4KTZA 4Q5WA 2EQKA 1WLJA 1LAVA 3C94A 2RJCA 5KE3A 4KPYA 5M9OA 3L42A 3S3MA 3JYTA 4FLVA 3MEWA 1VSFA 4HTUA 2D0CA 2RI2A 5FROA 1NK6A 2WOMA 1YVUA 2XK0A 4GY5A 4FW2A 4AHCA 1S1WA 2X4YA 1KVCA 3VQAA 3IG1A 4O0IA 5D6XA 3ISNC 3K58A 1W9HA 4HVJA 3VN5A 4M3UA 4CHQA 4C5EA 4CK1A 4O4GA 2RHXA 3PFSA 2NUBA 4AHUA 1VSEA 4CEEA 2HHUA 2YV0X 3S6WA 1NK8A 2IC3A 2HVHA 3V4IA 4DTJA 2R5MA 3DRSA 3PMIA 3TR8A 5C0MA 4HUFA 4CGFA 1OZ3A 5I3UA 1NK0A 3NGZA 2QK9A 3SPZA 3DLBA 4GW6A 1B9DA 1QSSA 4PY5A 1YTAA 1S9GA 4ZTJA 1BCMA 4MFBA 4DSEA 1BQMA 3ALYA 4N4HA 3LALA 1D9FA 3EAEA 1JL2A 5HRNA 5KRTA 5C42A 4CF9A 2P5OA 4O0JA 2YKNA 4I2PA 2X78A 3SZ2A 1WGSA 2G8KA 3C95A 3AVJA 4ZHRA 1NJYA 3LH0A 4RW6A 2EFIA 3AVAA 3ZSXA 3QEVA 3ZT2A 4W5RA 3KUFA 3LP0A 1ZBUA 3MP8A 4WE1A 1NKEA 3SQ1A 3LYIA 1WJQA 5DK5A 4KHUA 4CJPA 1L5UA 2QKKA 1RTIA 3RRGA 1WAFA 1S1VA 4C8OA 2G8IA 3ZCMA 4NYFA 3K5MA 2F5KA 1S6PA 4LD0A 2LDMA 4BE1A 2HQEA 1JLEA 4IG0A 3AVKA 3LWLA 3RWUA 1S6QA 3BDPA 4ELVA 2OA8A 2K3YA 1HMVA 4M3YA 4DTOA 3LP2A 3T3FA 1LAWA 1U48A 1XI1A 1F21A 4A4FA 1HNVA 2HW3A 2F96A 1BIZA 1J54A 1L3SA 2OYQA 3ZEHA 3VQ6A 1WSFA 3VA0A 3AVGA 3TAFA 3I0RA 2A1SA 1L3TA 4LH5A 4Y1DA 4KV8A 2E5QA 3ME9A 2DIQA 3PX4A 4QQDA 3AO3A 4M3WA 1J5OA 4CERA 1TKZA 3H6ZA 2XY5A 1Q8IA 1C6VA 4MQ3A 3PO4A 1BCOA 3QLHA 3VQ9A 4FLWA 1ASUA 4E1NA 2G8HA 3MEGA 3FDRA 1HPZA 3P5JA 4LD6A 2O4IA 4FL6A 2QKBA 1WN7A 1D5AA 4N56A 3OVNA 2BKDN 1X9WA 4FCYA 1ZBFA 4FW1A 2B6AA 4OLAA 4H4OA 1HRHA 2KZMA 3K5LA 2YNHA 3HT3A 4DS5A 3E9GA 1XNIA 1U4BA 1D8YA 4CFCA 3MECA 4CHZA 3KLFA 3Q1JA 2LTOA 1FKOA 4OKKA 4FZYA 4FJHA 1G15A 4M45A 3E9FA 3VQ4A 4FJNA 2YKMA 3SUOA 3B6PA 2FBYA 1LWEA 3NF7A 4IDKA 1BGXT 2D0AA 4BDYA 3ZSRA 1CXUA 2ETJA 3MAQA 4OKEA 4CEDA 4CCHA 4W5TA 3I8DA 2Z1HA 3C6TA 2BUDA 4C5HA 4H8KA 4CJVA 3NCIA 2HNZA 2ITGA 2YNGA 3RMDA 1W0HA
chains in the Genus database with same CATH superfamily
2K9QA 2X35A 5F27A 1K4TA 4RTXA 2VXZA 4CCJA 4A4KA 5CR2A 2CZ7B 4ZGDB 2HR3A 1KQSA 3A8OB 4BWMA 2H56A 2RQRA 1SKWA 2XAQA 5JI6A 3QP5A 2IP2A 4J19A 1VSDA 2Y2ZA 3JCMd 3LDOA 4L3QA 3HZ6A 1T05A 4B1WB 2LT1A 3KKSA 3FHFA 3CWAA 1OCOH 2DL5A 4AVZA 4CZCA 4PJJA 3NHNA 2L3RA 2W41A 1LVKA 5E84A 1A04A 3MEUA 2X4XA 3BG5A 1HKCA 3E1SA 3F0CA 2EYYA 3U6FA 2AHJB 2NVTJ 1JLBA 4UQGA 4RAFA 1FTTA 1E0EA 4JI2K 5AQRA 1S5JA 4DCHA 3LGFA 4AD9A 3P83D 2O5RA 4IIOA 4QTRA 2HL5C 5HRPA 3I0TA 5ILUA 3EETA 1B34B 4N4NB 3LQRA 1OPLA 3ZT0A 3MVPA 2HPIA 1APLC 2R7QA 1OI1A 2W57A 2G9WA 3JCMV 2KZVA 4CCMA 4ZNXA 4M75B 3TOAA 3AHUA 4H0YB 3VESA 3M1FA 1JBMA 2FC0A 4BEHA 4FT8A 4JN4A 1QSLA 5D8KB 3NH1A 5ILVA 5GANe 3HP6A 4JEPA 3THVA 1S72T 2DO3A 3JCMb 3VS2A 1OULA 5AQSA 4J9DA 2FLOA 3NF9A 2WA0A 4DLGA 3AG4H 4YG2F 1PG5B 3SFMA 1F5TA 4FE4A 2ZMEA 4BY6B 1E3PA 1S72Q 1OH6A 1MD0A 4UC4A 1TXQA 4JRQA 3VYHB 4CVNE 2LKSA 2DJIA 2P9PA 2DYRH 4ANJA 2C0OA 1OU9A 5BPNA 2XY7A 3LLRA 1JO8A 1IO6A 4JX6A 3FFKB 3FZKA 4E7LA 1M90R 3NAEA 3R6OA 4J9GA 2PBIA 2ZNYA 3CLOA 3CCJT 4OMQA 4JD2A 4MFDA 1Y8RB 1AD5A 3NHGA 3M3ZA 5CLSA 1ZA2B 3PNTA 4I02A 3GBQA 2ENMA 2QGUA 2BVMA 1ORKA 1NBWA 1QHGA 2KVQG 2PVDB 1FNNA 2D0PA 4KRFA 3W2WA 3FR0A 1KC8R 4M7AE 3CERA 1GXIE 3CCRN 1X3WB 4NCBA 5FD6A 3QPTA 3J7ZI 4QW2A 3OMGA 4ELUA 4LIUA 1VYUA 3OYAA 2L2OA 1VQOT 4XIDA 5IT3A 4M3GA 4UXNA 2DOEA 3ML6A 1VYTA 1SFEA 1PP7U 4OMNA 2RQUA 2K02A 3K70C 2BE7D 3FSPA 4LJZF 1F1BB 1NJZA 4CC7A 3QYFA 4DFPA 2I7PA 1PVEA 4M77C 4HHTA 1O75A 4ELZC 5GAOr 4M78G 1VQOQ 2WV1A 4EJYA 1E2XA 5GAGP 4M3EA 3GMEA 3J7AY 3V7RA 2KQRA 4CCNA 5K7ZA 3D5SC 4FJMA 2K9SA 2JT1A 4XMYA 3HM9A 2L9SA 3OHRA 1QZ5A 2QAZA 1KHIA 5AQFA 2A1RA 4KH0B 2Y30A 3K9KA 2YNFA 4WCIA 5IN1A 1VQMI 4KN4X 1LV5A 5LMNK 4BRLA 3O8MA 3JRDA 5M1QA 2FA5A 1K73O 2E6MA 3NBPA 1VQ6T 2KP6A 2Q36A 2DK5A 1RRSA 2FOKA 2DDBA 2KDZA 4MDBA 5HS9A 2ECZA 4V2SA 5GADP 2VPRA 2CGJA 4A57A 3EFRA 5GIPA 2ASMA 5CKHA 4ENNA 3TCJA 3GG4A 3LZIA 3DOKA 1W7PD 5CIUA 5F6FA 2YT6A 4KNYA 4B23A 4B47A 3H9NA 1JXSA 1G2HA 1VQ6Q 1QVFP 2DLPA 1EIFA 1Z77A 3DEEA 3SV4A 2XDDA 3IS9A 3LL3A 4QIWN 1G99A 4EW4A 1SAUA 1JJ2S 3JCMJ 4E3SA 1KEAA 5CQGA 4PJOD 2IVNA 4DQ8A 4AG1C 2HTJA 3RR7A 4E7HA 3U2RA 1KHCA 1ETQA 5JMVA 1LJ9A 1XSDA 1EF4A 1QE1A 2XAHA 3ZETA 1XGNA 2YCHA 3HTVA 3MK6A 1X6BA 1NG6A 1M1KO 4F2SA 4OF1A 4AQYK 5L3GA 1R9TJ 2L7KA 2PJRB 5BPLA 1VZ0A 2RD1A 5DD8A 3DKMA 3E1YA 1X1PA 2HXIA 2JTVA 3PNVA 1U04A 4RAGA 1TLHB 1YHQT 1Y97A 2MYSA 1R23A 2YNIA 2DA6A 3IH2A 1KD1U 4YOYA 2WAFA 4ATOA 1Q86U 4BJTA 4XKBA 4LD5A 2BXZA 3T1HK 1PUFB 3VUBA 4KIGA 1UHCA 3ZQFA 3N97A 5AYFA 3IQLA 4CJQA 3CJ7A 3CJRB 2V6EA 5HRSA 2KBTA 3L00A 3THWB 2SEMA 2M5WA 2V8IA 3EFSA 4BY1J 3GNGA 3HSTB 5GMKl 2RJFA 2H27A 2P6SA 3CMAA 3LSKA 5SZTA 1BIUA 4PHTX 4JKAA 4TVRA 1U5TA 1QCFA 4IFVA 2L9RA 1T08B 5EU7A 1X9SA 3ER0A 1YI2A 4BUPA 1ZR2A 1LNWA 4FWQA 2M1BA 4OKJA 5FLMJ 1JU5C 3RVCA 1Q7YC 2AP1A 4H03B 1WSEA 1P9QC 3FHZA 2VASA 4XORA 3CP8A 2K3PA 3CP2A 5GAN4 2QBYA 3OYIA 3TP3A 1VSHA 1WHMA 3CCMN 3KTQA 4JKHA 4MTDA 4A3IJ 2DPNA 5JVTA 2D0BA 1IN5A 2A6AA 2R7RA 2EGCA 4FJXA 1ULYA 2MWOA 1QQIA 2WC9A 2VKDA 2BY2A 2FU4A 3VW4A 4HZFA 2HNYA 1I81A 3THYA 3F8MA 2PQWA 3SHFA 4C1NK 4I99C 4HTLA 4G9ZA 3JW4A 1J5EK 1CZBA 2DLLA 5KQDA 5J26A 3SAHA 3OB9A 3K4MA 3CYMA 2QEXQ 3UKUA 5AQTA 2CP2A 3TP0A 4DNCA 3FMRA 4LDXA 3D2EA 3JXUA 5BN8A 2WAQA 4RCBA 2UV1A 1WJSA 3CFPA 3GLXA 3EYIA 1TH7A 7AT1B 4M42A 2O8DA 3E6MA 3HGGA 5EEHA 5JLHA 1UOCA 5LGNA 4LK1F 5GAOq 3WGIA 1JXEA 1N39A 1WB9A 5LHGA 1X2MA 2O0YA 1OH8A 1WI3A 4OMFB 3VGMA 2ZBKA 2HFHA 3EEQA 1MJBA 4BHCA 1T0HA 4DTUA 1YJNN 3FK6A 1K8AC 2OTLN 3CZ6A 4ZDLA 2M0MA 3QWLA 3VRZA 4LE9A 2E5KA 1I0CA 2V51B 2C06A 3G4SI 1K7AA 1TYQA 2RQPA 4A2AA 2VG7A 4BI4A 2HOAA 2YHYA 4ELTA 3LANA 4YOQA 4CGHA 4D9JA 2MK5A 3RMAA 1D1BA 3ZMZA 2IG0A 3NNQA 2KW4A 4FM2A 5J2PA 4FJ7A 1D1AA 4PIIA 4IG3A 4HT8A 4E9EA 4QAGA 2H3GX 2VI6A 3ROUA 2KZZA 4FT2A 3INZA 1VIFA 5DM7R 3PGGA 2VWFA 4J01A 4N4IA 2EQUA 3EPZA 3QAHA 1RUOA 4HG2A 3I4PA 1DDNA 1H641 3TREA 3QJ6A 1TV6A 4X0GA 3IKMA 3MDQA 1SMYF 3JTGA 4WYBA 1N8RU 1UJ8A 1OCZH 5AZIB 1IKVA 1WHHA 2A5XA 4YOVA 3CMEI 3O4QA 1EP4A 3SWNB 2KXDA 2ZAEA 2O01E 4B8CA 1IXDA 1S7EA 4AHRA 1XCVA 4M78E 5M3MJ 3O3FA 4CGZA 2EJGA 1VK0A 3W6KB 1U8BA 2XF6A 1PWTA 3FLCO 3CC4T 1NGAA 2O4GA 1JB0E 4CF1A 3MKZA 1GOCA 2YHAA 1FYLA 1DPUA 4OLBA 4DQIA 1TWBA 1GV2A 4XNFA 2QWQA 3OW2S 4CJEA 2EZLA 4DOWA 2W4SA 3L6QA 2ZD1A 2O8FB 4EA5A 2D9TA 3M4GA 3UA7A 2P9SB 5D5WB 1YW7A 2H1KA 3ABTA 1NK4A 5F0CA 5KGXA 1JJ2A 4F3OA 2LY2A 4HF0A 2A36A 3V4GA 4FWNA 4M7DF 2LC4A 2DODA 3H5RA 1VQ4I 3DLLF 3NMUA 2BHZA 1C1AA 3ZSQA 2FOWA 2L7ZA 2Q8KA 3H3OB 4DHYA 1B8IB 3URGA 2DILA 3VS3A 3SEZA 2VODA 2R57A 5LJ3g 1YN8A 4J9CA 3VOEA 4J00A 2ZJ2A 4P5OA 4ID5A 3RNJA 3M8SA 3KLOA 1S72N 1RT1A 3S1NJ 4BC2A 1G3TA 2JPCA 3I9V2 2FHDA 4X64K 2ZPEB 3DXMA 1W7PA 4F14A 2XHBA 3RR6A 2YHTA 4ZDPA 1ZBSA 3IL2A 2J7IA 3OSVA 1I5OB 3HXLA 4X62K 5L3EA 1RAGB 4LFBK 2VLAA 1WEFA 1SL2A 4AVPA 3HI0A 5F1XA 2XC7A 3GYHX 1XGMA 2PLYA 3UKRB 1HJOA 3M0SA 3CXCM 2FVUA 3QIIA 3VQBA 2FF3B 3H3UA 4PJOA 3GOXA 4J8FA 1EV7A 1WI9A 5K1YA 2R4GA 3CO7C 1MMNA 3BDLA 3CD6I 4LNPA 3SXYA 2OZSA 1U06A 3NAUA 1VQMA 3EFOA 2CUDA 4B43A 4XLPF 5EG0A 4NS5A 3V8KA 1RIOH 2A6HF 2CSIA 2BANA 4B3OA 1OV3A 1TK8A 5TISC 2GELA 4A4EA 5LHIA 3RRHA 5AQXA 3VYUB 2PI0A 5KYXB 2TCTA 3FZLA 1RT6A 1SEUA 2JTEA 4FXDA 3QSUA 5LEKA 2XRIA 2LDUA 5FLXK 3OYBA 3QINA 4ORZA 3PIOF 3NFCA 2MLGA 2R5YA 3DXKB 1SD5A 1MWMA 1M4ZA 2W6LA 4ENJA 4LITA 3LP1A 2EKOA 1WZOA 3PQJA 3EG3A 2JUGA 3JCUC 2J05A 4H4MA 5AQPA 2XSDC 1PSEA 1RI0A 4FLUA 3B6AA 4IOAF 3K4KA 1VQON 5DM6F 4LSLA 2Y1JA 2DMPA 3VSLA 5AQUA 4IEIA 5AZJB 3P8DA 2BE2A 5KYWB 2E1ZA 3L2QA 3H0HA 5FGMA 3HOSA 4C23A 2X6YA 5D6EA 2HU9A 3PLAA 4B9WA 1V1CA 2R58A 2DQLA 4ABZA 3FGUA 1N5YA 1QWFA 1EH8A 1IBLK 1YT3A 4LXCA 1I94K 4DWIA 3CUQA 2NUPB 2HOEA 4NC8A 4JI0K 4DZPA 1UZCA 4MLEA 3KLEA 2WSEE 1KRPA 1FKPA 3PUBA 2V1QA 1BI3A 1MH4A 4F2RA 2X51A 3TEEA 2OCEA 1NK7A 2YG9A 2CH6A 2GOMA 2IS2A 2XI9A 2CYZB 1WNLA 1F36A 2AZSA 1ENHA 3K2ZA 3RIRA 4OIRF 2K9MA 1VQ6N 3CCEQ 2H94A 4XRSG 3DBLB 2E41A 1TL3A 4JRPA 3BY6A 3K2AA 3TAEA 3CDLA 4FJIA 3MEXA 3AO2A 3E19A 3GTKJ 4M73A 1YJ9I 4IO9F 4UY8O 4PGGA 1C0TA 2ZXIA 3U4LA 3BOQA 4BHBA 3TBIA 1K8KA 4B48A 5C10A 2RJEA 4JQFA 4E9GA 5BRHA 4A3MJ 3QEWA 1IV0A 5JLWA 2IIMA 4L9JA 4PWDA 3OY9A 4M77G 2DJNA 3BUZB 4Y4RA 1IZ6A 4NXNK 1EH7A 1QZZA 2BY0A 4FWRA 2Y31A 2XVCA 3DWLE 1WJRA 3OL3A 1KG7A 1KVAA 3AVIA 2LCSA 3AA2A 3AL0C 1IRXA 4FLYA 1I1JA 3CM6A 1RKWA 4E0DA 2JQ7A 4ZYGA 3VS0A 2ZJPF 1QQMA 3PSFA 4M7DE 1MW7A 2HTSA 3TTFA 5LJ5j 1Q82C 1U0JA 2KTQA 1XG1A 1A6IA 3M1CA 2O03A 1Q7YR 4JBAA 2ZKZA 5D6YA 1R36A 2V8JA 1HW2A 2O8XA 4IKFA 2FEIA 3CC7Q 4CD3A 4OFHA 3ZT4A 3PJRA 3IKVA 2P0QA 4Z02A 3J7YP 4CICA 3OW2A 4ID1A 4CCKA 5HBMA 4FSSA 4M77B 1X3NA 2HHSA 2HKXA 2JVVA 4XTYA 2A5YB 3HIFA 3TO7A 3JSOA 4HXJA 3OSGA 1X9MA 2DT7B 4QWQA 3SDGA 1J9IA 4B9UA 1LB2A 4CHYA 3W2AA 4CJ3A 2LCCA 2X6OA 9ANTA 3ECHA 1WYXA 2CGKA 4PSWA 3EG9B 3CCQT 2DBMA 3AO1A 4AIDA 4LF4K 1NGCA 4U0YA 2D0QB 4FIBA 4IXCA 3SEMA 4M3TA 4EJTA 2PQ8A 4B3XA 3REBB 4AWXB 3CF5F 2O9VA 2F48A 3G4SA 2EYXA 4FYXB 3OH6A 1D0YA 1WUAA 3CCQQ 3TSUA 4C3JJ 3IRQA 2DL8A 3CWTA 1NLPC 1FJGK 3ULRB 5GAGJ 4D7NA 1ZGAA 3G10A 4GGGA 3BZ6A 2EB7A 4BQNA 1K8AR 1NK5A 2RQTA 2PU9B 2W24A 2K3XA 2LC2A 1BI4A 3X28B 2NXNB 3ZSWA 3DB4A 4L5EA 2GEMA 5FFZA 3WODF 1Q9XA 4RW7A 2AXLA 2G0EA 1CZ9A 4HEA2 4K25A 5FD5A 4U0WA 1WI7A 5GAOn 4K8XA 4RTTA 3HEFA 1RESA 2DA5A 2B7EA 1CLQA 2XPUA 2M7AA 2RI3A 1Y1WJ 2EFOA 5CZ2A 1OR7A 4JAXA 4WWCA 2P9KA 4C8QF 2RNGA 2VV5A 3OYDA 3H0IA 2OANA 3UWNA 1XS9A 3FXJA 2PTKA 2JW4A 1K4US 2F5VA 2K5CA 1T44A 2CP6A 4ETSA 4BEHB 4CZMA 2NAZA 2LF8A 2X6XA 4N0AA 2KDOA 1VRTA 2LSNA 4QLCU 2XPWA 1WNSA 1JEGA 2L0AA 4J2DA 2JS0A 2GAUA 2JWKA 3FBNB 1VSJA 4Q5SF 5LJ3h 1ZG1A 1ZG3A 2L01A 3OYCA 4KMFA 3A8HB 4IFYA 2YX7A 4DFKA 1MUYA 4KMUX 2Y0MA 5GANd 5HLTA 4BNCA 3TQNA 1HKBA 3CI5A 1L3VA 2ZMEB 2M87A 3OIQA 4U7BA 5CAIA 3I53A 1T95A 2Y4YA 3CFOA 4LDVA 1JKQC 5GPCA 4IUTA 3LA2A 4E7SA 3MX2A 3C7JA 3DLKA 4B21A 4NC6A 1LFBA 2HYFA 4XOPA 4G7HF 3F0ZA 1RBSA 2MWPA 4G9YA 1M3BA 3HTUA 4DU4A 2CP5A 2LYCA 3IV5A 3DKWA 3HB9A 3DF8A 2DZ9A 3BZCA 2VQLA 3PQKA 4XTVA 4OPKA 1EX4A 3WNHA 1HNXK 1CXQA 3CLQA 4XK4A 3CCUT 2CS3A 4X66K 3WQUA 3V8JA 1VQKQ 4CJ7A 3A5NC 4FJ8A 1RUWA 4JD2B 2DCEA 2LTPA 2O8EB 2HNDA 2A68F 2XUBA 2ISZA 4A93J 2KRNA 3KZYA 3META 4JJBA 5JS1A 1YJWT 4EPCA 2DRKA 3CCUQ 5HOOA 3E7LA 1U2VA 4EAHD 3IWZA 2VXDA 3WXMB 3DRRA 4WF2A 1W5CC 3EYYA 4F3QA 3VETA 2YI1A 2KFNA 1QNTA 3T0YA 4UUSA 5GAN2 4W5QA 4FU6A 3O6BB 5CKBA 3CD6A 3M8RA 3ASMA 1YHQA 4LIVA 1UE9A 3ID8A 1KG4A 2MC4A 4GRIA 2JJ9A 2QM1A 4RG8A 4M71A 1QZEA 3C6HA 2HDCA 3LH5A 5E26A 3O4NA 5F64A 1TWFJ 4CZIA 1M3HA 2FF6A 4OIPF 1N3CA 1IN6A 5B8HA 3KXTA 3BG9A 1M27C 2BH1A 4MDWA 3HPHA 1NJIU 3CBOA 5AONA 3ZX0A 3CG7A 2ZWHA 1X27A 1K6YA 4ZZDA 2WSCE 3CXCP 1I50J 4C92F 1KG5A 1N9RA 1JLGA 2P9UA 2ZCFB 4JX4A 3A8LB 3QFPA 1J9AA 2LH9A 4EZ6A 3V8LA 3JRIA 2DE0X 1O13A 4GBQA 4LF9K 2GXBA 1R1VA 1YO5C 3V1OA 1P2FA 5ICGA 3V1RA 1XB4A 1SFUA 1H8KA 3F8CA 2JS2A 1BBYA 1XSVA 2EJRA 4GYGA 2M8GX 3VQEA 3RSEA 1J0RA 2UXXA 1KQ1A 3H08A 1RTHA 3CEYA 1Q18A 3K4BA 1LAVA 2I7NA 3KFVA 1BI1A 1VQ8I 3BF1A 3FMQA 1NMNA 4KJZA 5FLXO 2FQ3A 3S3MA 4A3CJ 1ZQ3P 1YWOA 4PFOA 3BJOA 4HTUA 4F7ZA 2R7TA 1BK2A 2E64A 3TTDA 2EINH 1YVUA 4IZ9A 2M4GA 2IGOA 4AHCA 3ZFJA 5AQZA 5ECAA 4KIBA 2X4YA 4JKCA 3K4NA 1OR7C 1TUCA 5D6XA 3ZETB 4BH9A 1ZUUA 3ISNC 2GQQA 5IP6A 1LDKB 2FBKA 2HD0A 3MAJA 4RCHA 2HZDA 2DOAA 1YJ9A 2NUBA 4A0ZA 2LK2A 2WAEA 4XLFA 4CEEA 2YV0X 2PFBA 4DTJA 2DVJA 3CVSA 2K79A 4N0AC 3JAMO 1FMKA 2DTRA 4EFHA 3MCPA 1HF0A 1UMQA 1P8ZA 4RB3C 2AQFA 3SMSA 2VC8A 3VDXA 3CMMA 3SPZA 4GW6A 4KICA 2MAMA 4YOUA 2I8DA 1VQNI 1QSSA 4EQQA 3EG0A 1ZAOA 1YTAA 5M5YJ 3S1MJ 1DKGD 2K3FA 3M57A 2P9LA 2VKNA 3RDIA 2DT5A 1BQMA 3ALYA 4C8QC 2EK5A 1P59A 4EJZA 2C0IA 3K9JA 4A59A 1X4OA 2KIQA 2LMDA 3C0BA 5JVGF 1IDYA 1LFPA 4FSXA 1OMIA 3EAEA 5HRNA 1YJNI 2OTLI 4YRVA 5C42A 4C1NI 1EH6A 2YKNA 4I2PA 3JB9I 1K73C 3SZ2A 3CJTB 1WGSA 2L4MA 3TU4K 3C95A 1DU6A 3FXLA 4V2FA 3AVJA 2JWTA 4Z89A 2RV8A 1W1WE 3LH0A 4RW6A 3PIPL 3IKTA 1PRMC 1Q82R 5A0GA 4YFXF 4W5RA 1BC8C 2DTOA 2HMPA 2QBYB 2FX0A 3W3CA 5IH2A 3CBMA 3VF2A 4M74A 1RFQA 4XU0A 1T98A 2EH3A 2DJZA 5DS9A 2DRMA 2A7YA 3EGXA 1S1VA 2G8IA 1HW5A 2P9NA 3S2DJ 4BR2A 3THYB 4M75D 3FHNA 3CC4A 2HYJA 2KSSA 2DEQA 2ZM6K 2DK8A 2OUMA 1S6PA 4LD0A 5ICEA 4LF5K 1YUWA 1TT5B 3GX4X 1I1GA 1S3JA 1B07A 2DAOA 2PN6A 1JLEA 4RB2C 3AVKA 1A35A 3BDPA 5AQQA 4BR0A 1SRMA 2K2VA 3UKUB 3RKYA 2HW3A 3D2EB 3L9FA 4YEJA 1RRJA 4MO5A 1TW2A 2F6CA 3JB9D 2KRCA 3T5XA 1ZUYA 3H1CA 4PDKA 3ZEHA 2O8DB 4C3IJ 1AVZC 3I0RA 3Q3SA 1BR4A 3BPXA 4LH5A 1W4MA 2GUPA 1UDLA 1AA7A 3GPLA 2E5QA 1FSHA 2CW7A 3TO9A 2BOLA 4HX8A 1JKOC 3ZN1A 1MPGA 3AO3A 3O3KA 4M3WA 4C92E 4BL0B 1LDDA 1IRZA 1TL8A 2HKOA 3N0UA 3MWTA 1M8MA 1Y57A 1TYQB 3FE1A 3X20B 4B6MA 2QWLA 1FJLA 4UB6C 1SVLA 4YIRX 4CZFA 3C0CA 1BCOA 3ISPA 2ELHA 3G1LA 2GA1A 4ILGB 4F7UA 1UG0A 5E3LA 1R0CB 2G8HA 3TU5A 5GTHC 3FDRA 3P5JA 3PM1A 2P6TA 4FL6A 1W6XA 2YHWA 2QKBA 1S72I 1WN7A 1S7AA 2EFWA 4KT5C 3EH2A 1KGSA 4N56A 2BXYA 2IRFG 2BKDN 3CCQN 3OL4A 1X9WA 1ZSZA 1V5FA 3WTWC 3HFNA 5JLXA 1RETA 2RN8A 3O9UA 5LRSA 3QYHB 2KZMA 1IC8A 4K43A 3K5LA 3IAS2 3QRFF 2A08A 4CHZA 2J06A 1Z9QA 1FKOA 4OKKA 4DV1K 4DR7K 1KXPA 4A6DA 3E9FA 2FRHA 3AFHA 5DYMA 1GLCG 1MDUB 4UVCA 2YKMA 2P4RA 3VS7A 1YNZA 1N25A 2FBYA 4GLKA 1QVGM 2K9GA 3NWSA 4L0ZB 4IDKA 2BY1A 2LQWA 3M0RA 2DKGA 4HVUA 1TBXA 4BDYA 1Y96A 2ETJA 3RKQA 4CEDA 1BBZA 2Z1HA 4Y3OA 3G71I 1YCYA 4IOCF 2W0ZA 2DZCA 3PVQA 3IH3A 1YIJT 3AL0B 1U2WA 2L7FP 2OD5A 3MN6A 1VNDA 4HV6A 1YAGA 5GAMf 2M7BA 2VQHA 3OBYA 2CW8A 3HZJA 5H1SQ 1XSXA 1W0HA 4PJOG 5GIOA 3A01A 2VE9A 3T7ZA 2O7OA 3VQQA 1I3QJ 2J5OA 1U9NA 4RTUA 3CFRA 3M8JA 4QPOA 1RZ4A 3ZSOA 4DR5K 1SEMA 3GCMA 1FMWA 3SK3A 4I6MB 1RUNA 2HAXA 4BRIA 1TWAJ 1NOZA 1HLUA 4ISGA 1ZBLA 1G6NA 4A3KJ 2MFZA 2GBZA 2YUNA 3DXMB 3P39A 1NGIA 2RQWA 2EBIA 2YS9A 3SB2A 4E6KG 2PY5A 1UFFA 1SSHA 1N6AA 1YRNA 2E3HA 1NGHA 1BR1A 3HOWJ 4A4GA 3NGIA 4WFAL 2Z5UA 4DV3K 3K6GA 4ZTFA 4KISA 4JKGA 4GVMA 3LSJA 1FYKA 2F9WA 2A05A 4FWLA 3MMYB 3SV3A 3CPEA 1UA1A 1V55H 4DYRA 2OZ6A 2DY4A 1LUJB 4CRIA 3M59A 1WH5A 4OWRB 3EGDA 3VTIA 2XHKA 1X3MA 1HA8A 4F16A 4PLIA 3CCUN 3NMZC 5EG0B 2JN6A 2F5DA 3J7YJ 5AQVA 1PRLC 2V1NA 2FPEA 3TAQA 1VQLT 1FOKA 2LVMA 4CJSA 1IKXA 3FEOA 4FWSA 3FFIA 2VYTA 2F1LA 1GHCA 4IUPA 1UAAA 1BI2A 3M1EA 4CFDA 4MO7A 2E2QA 4CHUA 4KI6A 1WJ5A 1MBJA 1RACB 1IKWA 3M56A 3TW6A 1LWCA 3MEVA 4FJGA 1IHVA 4XEIA 4O5FA 4KDPA 4Q4ZF 1DGRM 1VQLQ 4UB8C 4CJFA 1VQ8A 3WE2A 3VRYA 2J6FA 1WPYA 4AILC 3P4IA 1KD1C 2K5FA 1Q86C 3JRCA 4IOXA 2CT4A 5E8IA 2LJ3A 3JSCA 5L3BA 4PFZA 5FB2A 2VJ4A 1JT6A 2Z1GA 3OS5A 2EPFA 2VN2A 2XB0X 5F1RA 4BQQA 1N75A 2Q0OA 5EY4A 3C4SA 4M9XA 3G6ET 3IC7A 2DFIA 3JSPA 4DTPA 3CUQB 1VAZA 5E1WA 1P6RA 1IB8A 2STTA 1V4SA 1M8VA 4UV9A 4KI4A 1HKSA 3G6EQ 1JT0A 1HOMA 3KJVA 5E1XA 3M0UA 5AQLA 5LGUA 3S16J 2RK2A 4PK4A 1ZLMA 4RW9A 4B08A 4A3EJ 2HQAA 2PMZN 3KEQA 2WONA 4CSWA 4M75A 2R7DA 2HBWA 3FDYA 1VQNA 4XOTA 2PYLA 2XD0A 2WBNA 1R5GA 1ZLKA 4UVAA 2DFEA 1YQKA 1B9NA 8AT1B 2H8WA 2OZUA 1WZ2A 3QXEB 1SPKA 1QO0D 2AO9A 1LWVA 3HTRA 1ERDA 3BJAA 2R3SA 2Y0SA 1VQ7T 3OV8A 2BZXA 2D5VA 3FISA 4XKCA 4BRPA 5DDGA 2XAFA 1G83A 3ZSVA 1KU2A 2FBTA 1KA8A 2BDPA 3S2HJ 4M63C 3NF6A 1J53A 2HKQB 3KK2A 5A0DA 2QEXI 2KFDA 2CQQA 3WGGA 4L5JA 5FRNA 1VQ7Q 1K73R 3F9MA 1VQPT 4A69C 1RAIB 2DJQA 2NRVA 3K1PA 3MN7A 2GXAA 4LH4A 2QQRA 3TSWA 1GVDA 1HNZK 5LL6Z 2WTUA 1IXCA 3R4KA 2K57A 4LGWA 4E2FB 4C8LA 4AHVA 4BXUA 1IBMK 2BGCA 2FO0A 4M3FA 1I07A 2ZJRL 2OI3A 2X0LA 1VQ9Q 2HVRA 3M8QA 2HHTA 3O5ZA 1GLBG 1VQPQ 4KGXB 4YTLA 1D0ZA 2YSQA 1YTYA 4B9SA 1JXMA 4DSJA 2G8UA 1AZGB 5E3MA 2MOXA 3H8ZA 1A5JA 4OFAA 2KT1A 5M1PA 5FPDA 3QIPA 1RNLA 3BFMA 4OGCA 2LRDA 4ZYEA 4JRIA 2K4BA 2DBKA 4ITVA 2D5RA 5D5XB 2M2EA 1LE8A 1V54H 1QP3A 2CSQA 2VXEA 3P9CA 1GBRA 3F9KA 2R5ZA 1Q81U 3JR9A 4BU2A 1MGQA 2W48A 4CC2A 2R7SA 2CJJA 1BU1A 4IIMA 2VKHA 4FK2A 5C2DA 3T8TA 1SANA 1PC0A 4DQQA 1ZH5A 4E89A 1ZGWA 4IO8A 3D2FB 3CCLI 1QU3A 2XGEA 3W0LA 3NTKA 4FWPA 1MDMB 1RDCA 5FRMA 1AU7A 3VA3A 1NEBA 2P84A 4PJOE 5J2MA 3WHBA 2Q0UA 5BRFA 4CYDA 3NRVA 1MUDA 2DN0A 1YS6A 4YNQA 3U3YA 3HVTA 5HDKA 3KP5A 1IN7A 1WVRA 3A0IX 2EYZA 5J4YA 3A0BC 2PEXA 1T3VA 2E60A 2DNUA 4I9QA 4JUVA 4LUEA 2FD5A 2XHCA 3BTCA 2P9KB 4OVLA 1UB4A 2R7YA 4FWMA 1D0XA 3HG9A 2CRGA 3D6RA 3KHYA 5HNFA 1HW1A 2W85A 3CCSI 5BR8K 2DMTA 4KIFA 5KRSA 2E2NA 3AVLA 4KB0A 3KZZA 4B8XA 5J1YA 2JXBA 3WNFA 1N9SA 1AWXA 1KJWA 2WUSA 4DU1A 2RC4A 2D1KA 1ON2A 2QDLA 2ZJQL 4X9CA 1GUUA 1P7MA 3DP7A 3GDQA 3EQLF 2EJ9A 4HCZA 5K5RA 4DR3K 3OSSC 4YDUC 3G71A 1XC9A 2VCPA 1KG6A 1YG2A 1Z05A 4W5OA 4XU1A 2NOFA 1BWFO 5HLIA 1P7IA 2IDOA 1ZHFA 2NOGA 1D3BA 1G2BA 3QZ5B 1U3OA 3HSRA 4TSXA 5KPTA 1UG2A 2CYYA 4AFSC 1J5YA 1UGRB 2L02A 5LJ3e 2PJRA 2COBA 1RDUA 1I4K1 2FRWA 2KIFA 1FBSA 2UUBK 4PQUA 2M02A 1SHFA 2HB5A 2YDLA 3PE0A 3S2WA 4LY7A 2E2IJ 3PVLA 3M53A 2WACA 2DYSH 3OOPA 4IHSA 1QVGP 2RE2A 2QZ8A 1RT5A 4BRQA 2B4JA 3I0SA 5AQHA 4N41A 4N5SA 1BJAA 3U1DA 1USSA 5FKNA 4AU7A 4I2QA 2GBQA 4JLIA 2XIGA 1OYIA 3FB9A 4H0VB 4A4HA 4IQJA 1NM7A 1B7TA 3RDVA 3VPZA 1XC5A 2F8SA 2VKVA 5CCAA 2DA9A 2KLAA 4MIMA 2YUQA 1TNSA 2VQEK 4B24A 5CKFA 4N76A 1ZBIA 3X25B 1KFSA 3I55Q 4B9QA 5EDNA 3Q0WA 3LQQA 1D8KA 2EA4A 1DT9A 4IWVA 3EH1A 1XDUA 3LWHA 3BJ6A 3OIOA 2OTJI 4OINF 1K61A 2QDYB 2J6KA 3AKZA 4NDLA 2VWJA 4CCLA 1B72B 2BTTA 2E7WA 1YIJN 2UUZA 4AIKA 2WB1N 4J9HA 1G5VA 3AA3A 5BRDA 1ORPA 3LZJA 3T9NA 2NOHA 4FOEA 1DQUA 4E7JA 1EBMA 4ZYAA 5E17F 1FTZA 3LW5E 2R7VA 2EGAA 1YS7A 1LEAA 3G1MA 4M3ZA 2O9LA 2ME0A 4IL6C 4DV0K 2CG4A 2GIZA 2E1MC 1LKXA 4DJAA 1T6DA 1OU8A 4JV5K 2OPSA 1R7JA 1ZYQA 1NKCA 2LP5A 1IXRC 1MBGA 5GMKj 2OAZA 3OYFA 1UJ0A 1D5VA 3OA6A 3O80A 2NLXA 3LM2A 2K85A 3O8GA 2Y90A 1KAXA 3TSQA 3TPQA 1KSWA 2OF7A 4RWTA 3TL4X 2W7NA 2JOYA 4Z0UA 3HYIA 3GFMA 4FTHA 2QGFB 1LPLA 2FSWA 4FPBA 3CCEI 3RSEB 1YX3A 2DI3A 3G3ZA 2QQSA 2EQMA 1KD1R 3E6BA 3GIBA 2LKPA 4A2UA 5K5OA 5LJ5d 2VG5A 1Q86R 3O3HA 1Q82U 3LWFA 1Z26A 4L5GA 1SAXA 2LJ0A 4C0DC 2NRWA 2DTZA 4FM4B 1GLAG 2KQ2A 4M3XA 4CYCA 3H9JA 4KFBA 1QTMA 3VODA 2F5FA 3ENHA 3UR3C 2DBBA 5DPKA 3EHQA 4CJKA 1AT1B 2F5CA 1T38A 4G7OF 1HDPA 1VQLN 4BGDA 3U9GA 2HHWA 1Z21A 4Q0BA 4H0EA 4IXAA 2H6BA 3CMAT 4NQWB 1JRIA 1BM9A 4PJNA 2WSFE 3GZ6A 4WX9A 3QP6A 5CYMA 3E66A 2BV6A 1KU3A 2RAEA 5L23A 1LW2A 2P4TA 2XASA 1UG1A 1X2NA 1RTDA 2FYKA 1TK0A 1T56A 1YI2T 4JI1K 4CW7B 3KP6A 2JLEA 4ELYC 5LY3A 3RESA 3QPHA 3DTEA 4CEFA 4CEAA 1FXXA 4M7AD 1JE8A 4M7YA 3K57A 5IYDJ 4QQ6A 3CMAQ 1KLMA 4DQPA 2CUZA 4NO7A 1VFCA 1K6OA 4YELA 2OFIA 4Z6YA 3AVHA 4FJ9A 3CC7I 4BXFA 5JFRA 3HK2A 2CDTA 2NVXJ 3HKZA 3OH9A 4Y7NJ 3WXLA 4E9FA 5I22A 3CJ9A 1J09A 2AKLA 4L6V5 1YI2Q 3K10A 5KN8A 3G6EN 1RI9A 3CMYA 5KHDA 4GFBA 3GXOA 2P9LB 4WFNL 2PX9A 3GTMJ 2QEXA 3QERA 4IHWA 2JSCA 4JX5A 4OB1B 3MJXA 1IG9A 3VGKA 1RNHA 3R3LA 3BE3A 1K1ZA 4A5MA 5GJVB 5C4XJ 2DTUA 4BXXJ 1QZ6A 3LWMA 2JA5J 3S15J 4BRGA 3I4NJ 2O8FA 2BUPA 3I54A 2QK0A 1KC8O 2M9UA 5M1NA 3VV0A 2NYXA 2O6GE 1Z7LA 4M6VA 4UOBA 3F8BA 1VQ5A 1MU2A 2D8JA 3WE3A 5KVRA 2P5LC 5KYUA 1NK2P 2BE5F 3LAPA 3AA4A 3FRNA 4JHDA 3VGLA 4KH1B 3C2BA 1ABOA 4NBQA 2L2PA 4OB0B 4Z4GA 1RDDA 1RR8C 3JAME 3QO3A 2RI5A 1GLLO 2WFBA 2EZIA 2KY9A 5IYCJ 2G6FX 3MP1A 4EP5A 5C6SA 3BQYA 3F73A 2NUTB 4MLOA 3P7NA 1VQ7N 2YUOA 3CQYA 5IHKA 2HOSA 3CC2I 3H92A 4RUGA 1LW0A 3GWZA 1KQSM 2P4WA 1MV0B 4A6EA 3A1YA 5SWMA 2CP3A 1D5YA 4M3BA 3IDHA 1EWQA 2F2EA 3M4OJ 2R7WA 4MZMA 3CCLA 2V4JC 3CWSA 1VQ9N 1UGQB 3A8MB 5D6WA 1B9MA 2ZXWH 2JA8J 2LSOA 3FJ5A 1VQPN 3I56I 1YCSB 1NM1A 4UUTA 4IJNA 4CBXA 1D8JA 4XAXB 2E34A 4ICLA 4AG2C 4BD3A 3RMCA 3EUHA 1NE8A 3UKGA 5AQKA 3OYNA 3LSHA 2JRMA 2RNJA 2QYOA 4M4ZA 2E12A 1G3WA 2YLCA 2DO7A 2KT0A 2PMHA 2W42A 4D0PA 3O2PE 4DSKA 5GANj 1C1CA 5HLFA 2I5WA 1H92A 4AIJA 3HOTA 2QTDA 1E3HA 5HY6A 3LSTA 4BUGA 4ENKA 2UXBK 4JK1X 3CCSA 3MFKA 1XX5A 1ORNA 1UHFA 4YOWA 1JLQA 1NG2A 4IOCL 5AN4A 5ERIA 4M3RA 1SRLA 3Q0VA 3FM3A 4OB2B 4F7UF 3EG2A 5AZJA 5F0HA 5GAMg 3REOA 2VONA 4KH4A 3DM2A 3DTIA 1RBUA 1B4AA 4I9LA 2F2VA 2COZA 1PM3A 1RDAA 4PJ0C 2MCNA 1IH7A 5HRRA 4HNTA 4LD9K 1VQKI 2LY9A 1MMSA 2AXTC 4OPHA 1TKTA 2GZWA 2Z1IA 3NWTA 3QQAA 4JKDA 3DQVC 1Y8QB 4PKHA 2CQXA 3OS0A 2RN2A 3VEVA 1Z3XA 3TMOA 4LLGF 3HM8A 3SYZA 4FLXA 4L8RB 2A6TA 1PU6A 1E17A 1Q95G 4KTWA 3O08A 4A2BA 1XMXA 3M9QA 2QG9B 1BL3A 3MZ8A 3QIOA 1HNIA 1TUYA 5CZ1A 3JSMA 1AZEA 5E41A 5J8CA 1TP4A 3SJJA 4NC7A 1SFOJ 2XF5A 5FLXZ 4RGUA 2RO0A 1K79A 2AT1B 3LSGA 1WJDA 3FF5A 2LLKA 3A01B 2JZ2A 3GE1A 1NJIC 4QVZA 3H3ZA 3ZXSA 1OVYA 4NCAA 4E1MA 2C6YA 4DTRA 2RM4A 2CV1A 2GIVA 2UXDK 2DVEA 4DMNA 4XTZA 4XLHA 4DZJA 1VQMT 2DFFA 3JRGA 2CUJA 2XV4S 3CCMQ 2YWWA 4FYVB 2DX1A 3CCVI 4YHHK 2P7VB 3S8PA 2VJIA 2Z3YA 4OFEA 4BS9A 2OTJA 1WXTA 4DQRA 2PBDA 2VJJA 4F92B 4NL3A 1R71A 1YRNB 1RT2A 2V7ZA 1Y64A 1HXDA 2OJED 2O8CB 3M5RA 4BG8A 2IA0A 4HDUA 2VT2A 2ETHA 3CUOA 4FZZA 2COMA 1NMDA 2OAWA 3PV8A 2DEUA 1TUDA 3K4LA 2HL3A 2RREA 1T3LA 1MSFC 2NOJB 1M1FA 4AM3A 4CJUA 4M41A 4U87A 1WOQA 1OX9A 2RDPA 2EV5A 4V19S 1HUXA 1ASVA 1ATNA 2RKIA 3H35A 4I09A 2LRQA 2HQXA 1GCPA 4AT1B 4EW0A 4DSLA 4BR9A 2AIRB 4NZGA 4S0HB 1WJAA 5IWAK 3VQ5A 5LJ5f 4BRAA 1OQKA 2I5JA 4EGZA 4AUXA 4HCKA 3CCEA 5IT9O 1VI0A 4M7AA 2CUFA 1K76A 2ZQBA 2EV0A 5HP1A 3UNGC 4ESBA 3DRPA 2XGDA 3QG1A 2LKXA 2ZC2A 3S93A 3EUHC 1K73U 1G8XA 5ADXA 2F8TA 4NYNA 2R5AA 1T8EA 3A98A 4M75G 3CHWA 4KTQA 3M3YJ 1ETOA 4MFEA 4L18B 3QESA 4HX7A 4XIUA 2XMFA 3CCYA 4XBFA 4KHQA 4Q5VA 1OKJA 3HTSB 3QYBA 4EVVA 2BW3B 1O7LA 1WSJA 3BCBA 4YPRA 2I5UA 3AV9A 2OPQA 5IYBJ 2LQ8A 1W4SA 1XN7A 4MZPA 3WU0A 2M51A 2XG8D 4R79A 3JB9G 2QA4I 3MHXA 2MA3A 5AQGA 3GBTA 1TGOA 2IPOB 2QKLB 4IFEA 3S9HA 3LDNA 2QF7A 4MQVA 1M1EB 4KUDK 3DKXA 1X75C 4JLHA 2AA4A 1T8IA 4L9VA 1T7PA 4KFCA 5GAHP 3TAMA 4F7UE 3CC7A 1LNXA 4GV3A 1M1KU 5FPNA 1YLFA 3FJPA 4CEQA 3SCXA 5C4JJ 2QQ9A 1NGNA 3R0AA 1LEBA 3SHWA 1T33A 1FX7A 4EATA 2H3EB 4D8DA 5CHIA 1WXUA 5CVRA 3BR5A 4EMSA 5FFXA 2OPPA 4KHWA 5EEAA 5K7FA 5C0YA 3LP3A 4II1A 5J47A 3E9LA 2IEKA 4EA4A 2W00A 4CF8A 1SS6A 1WAJA 4BR7A 3RTRA 2FPDA 2Q97A 1XQOA 5BR9A 2HBJA 1U47A 1MBKA 5C12A 4JYAK 2K2MA 3IUOA 2MH2A 2JVHA 2H8HA 3Q7BA 3IHOA 4LB6B 2LBFB 2E36A 2WTEA 3ZCOA 5HS8A 1V29B 4YFNF 1VSIA 3CMAN 2A3ZA 2ASOA 1SZ2A 4KO0A 4R56A 2ZGWA 1MHNA 1Q1VA 4DSIA 4KH5A 3QUIA 1BOAA 2GM4A 1PP8F 4OAYA 5EXWA 3E6DA 4RGXA 1YI2N 2GTDA 4LN2A 2ICWG 2CZ1B 1YBYA 3G25A 1U6GA 1P7JA 3M8PA 2HQRA 3ZQ7A 1O7FA 1BOTO 4EM0B 4ILJA 3EYZA 3L8BA 3G4ST 4D5FA 2O8EA 4DOVA 5KNLA 3CC2A 4FJKA 4KTZA 2YUPA 3IAM2 2GWJA 3DBRB 2EQKA 1KQ0A 5KE3A 4KPYA 1HYOA 3GFIA 3SYTA 2EJFA 3CPWS 1YQAA 4EJUA 2XICA 5E8GA 3JYTA 2YR2A 4LG0A 3CCJQ 1FOXA 3I56A 5E3OA 1ZX6A 3MEWA 2VBZA 1MMAA 2CSOA 2QWWA 1W2BS 1LE8B 4WCEL 3VS1A 3OOUA 4KULA 2GWKA 1F1ZA 3K1MA 2R5ZB 1K9MO 1IW7F 3EHRA 3IG1A 4O0IA 5CVUA 2DPUA 3Q0UA 3K58A 2HEOA 2E1HA 1IAWA 4C5EA 2WAQN 3QZ9B 1KQSP 2V1RA 5H20A 4O4GA 1QVGA 3PFSA 3F6VA 4CD1A 3S6WA 2FBHA 3V4IA 5GAMh 4ASNA 1C0FA 2HCKA 3KX2A 1BO5O 3F10A 2MD5A 4C0DB 4A63B 3PMIA 2X3XD 4M7AC 3LL7A 4F91B 5BN9A 4HUFA 4CGFA 5LBQA 1SMTA 1QLYA 4BBRJ 4CI0C 1HR0K 2NYSA 4H5WA 2FF4A 3BG7A 2QK9A 5D6FA 5KQ8A 3U9ZA 3DPLC 4HF2A 4HKEA 2EV6A 1TUGB 4PY5A 1S9GA 4ZTJA 4BREA 1BCMA 1A6QA 1GCQA 2R92J 4CI6A 3P31A 4A3FJ 1BIBA 2EFNA 1R77A 2NS7A 2VGNA 3ERED 1CSKA 1XGOA 1D9FA 5KRTA 1VQKA 3QPLA 3NVKA 4CF9A 4DV6K 4ZC3A 2KNBB 4P9UA 4Q47A 4OMPA 3K0LA 5HL7L 2G8KA 5TKYA 4RLQA 4ZHRA 1NJYA 2R7XA 1IDZA 2LJ1A 4M7DD 5JLFA 2HNHA 2IVMA 3ZT2A 4ZYDA 1S8NA 3KUFA 3KZIC 2FZGB 1XQPA 3MP8A 1ZN2A 4CZZA 1NGFA 3LYIA 2LQKA 2DQRA 4KHUA 4G94A 3EKUA 2H8RA 3LA3A 1YQLA 5FKOA 2A3LA 1O4XA 2Q31A 1L5UA 2QKKA 1RTIA 1XCBA 1QRYA 4M78F 2O9SA 1X01A 5FU6C 1D3BB 4C8OA 3ZCMA 4NYFA 2EA2A 4F55A 2KAFA 3KP2A 5D4SA 1LCUA 5HVQC 2QM3A 4MMKA 3KYCB 2LF7A 3JRHA 3LWLA 3S32A 3D0SA 5H6RA 1W0TA 1HSJA 5J4VA 3MKWB 3HBTA 2NOEA 3CD6T 1U48A 5LJ3d 1XI1A 1F21A 3N5NX 4Y92A 2DDAA 1BA1A 4UVBA 2MD0A 1NJIR 1Q7YO 3CCVA 4EM2A 2K6DA 5I2SA 2P9IB 3VA0A 3H5AA 2A1SA 4BJ6C 1ZRCA 4M75E 1L3TA 2HBMA 2YSRA 1KO9A 3CD6Q 1YHQQ 3WXIA 4DKWA 5CKTA 2NOZA 2RGVA 3ZEUB 4RTVA 4VUBA 2E65A 1OFCX 3H6ZA 2XY5A 4FPAA 4MQ3A 3DEUA 2NRTA 4BRKA 1UEBA 1GXPA 1PUEE 4JI6K 4Z88A 1VQLI 3QLHA 4YY3K 4CBWA 4V2GA 3JRBA 3JTHA 3VQ9A 4FLWA 3M5AA 2MIOA 3WTXC 3MEGA 3VYGA 1HPZA 1R22A 4LD6A 2O4IA 1Z67A 2EKHA 1WGXA 4OMYA 2KDSA 4UV8A 2X1EA 2DW4A 4OP0A 1D5AA 3F2KA 1I8FA 2FQ4A 2MLKA 4FCYA 4FW1A 1OEBA 2HNIA 1FZPB 4H4OA 3VEOA 2P7CB 3BY7A 1K0SA 2HI3A 1ETXA 1VQMN 3E9GA 1FPQA 4JDSA 3JCMf 1K8AO 2FZCB 4FX0A 1MUZA 3Q1JA 1Y0UA 3H5NA 5EJCA 2NZTA 3TKYA 4XH5A 1ZR4A 1GV5A 1DPRA 2KJCA 4FZYA 3A5ZB 2UUCK 3G6EI 3CJAA 2YU9J 2F9TA 2CU7A 1HC8A 1UGSB 2V52B 3SUOA 3PIPF 1LWEA 2DD5A 2O31A 2KMUA 2OFKA 4PL7A 1YJ9T 1T3SA 1USTA 2D0AA 3HSCA 3ZSRA 1OVQA 4BC3A 4EMKC 1M3CA 1FYNA 3I8DA 4HLYA 4AFQC 2UYTA 1FN7A 4HQMA 3C6TA 4C5HA 2ZXJA 3CPWA 1SVMA 4XN0A 5TRDA 1IBKK 1AWOA 2E5NA 3KWIA 4L9NA 5HODA 4CYCB 4G6DA 2ZGZA 3X24B 2QA4A 5EZGA 1NBEB 4HVVA 4A3GJ 3QYEA 1W36D 1W2BA 3NQOA 3ZYYX 2NVQJ 1YJ9Q 3E2UA 1LWWA 4RBOA 2ITGA 2FUG2 3ZR8X 2LT4A 2QSHX 3IH4A 2IIRA 1GCQC 1YFHA 3P8BB 1ZTRA 3VYTB 5BNGA 2A41A 5GAN3 2IPQX 2HBLA 4RA2A 4DK9A 1QVPA 3PO3J 3MP6A 5GAN7 3KK1A 3ZQLA 2M45A 1ZC6A 1T2KA 1E3MA 4BI8B 4LFAK 2JA2A 4D5CA 1CQTA 3EUKL 3FMSA 3SDZA 1OPCA 3AAFA 3MWMA 3EG1A 2ZF5O 2OCCH 5I9EB 4BHPA 3H0DA 1QP2A 3V1QA 4EEFG 3K59A 1M3AA 3VEXA 3ABMH 1FOWA 3P9IA 1T03A 1FIAA 2HDWA 1VQ9I 4J6XA 1EA3A 2KRSA 3KWGA 3AGRA 2G7HA 2GXGA 4IRIA 3VKIA 2AKKA 2X85A 3QPSA 1UELB 1WSUA 2V1UA 1KAZA 2HWVA 2E10A 1GBQA 2ZO4A 3OA9A 2EILH 2EIKH 4HUGA 4G12A 3MN9A 2DA1A 4AH9A 1SVOA 1Q81C 3ZMTA 4F93B 3WNEA 3KP7A 4CA0A 4K41A 5J6XA 2JPSA 1ATSA 5J1RA 3LOCA 4D1QA 2OJ2A 4JOMA 3WTZA 4UNOA 3ONQA 4ESJA 2IXSA 4A3LJ 1UUEA 4LDWA 3CC4Q 3GFLA 2GLOA 1N5ZA 3PNWC 3L0QA 4I7FA 2CV2A 1GL5A 3OW2M 2JK3A 4HSBA 4YORA 3QU3A 3P9KA 5KYUB 3VOVA 1RCHA 3A8GB 2STWA 5LGTA 1VSMA 4JHDB 1X19A 4M78C 2FSNA 3KEOA 5C15A 4HOBA 2A69F 4KKOA 3HRMA 2CGHA 4I6MA 4FLZA 3OYHA 3VQ7A 4IHXA 2IVPA 4A3DJ 3RJPA 4LB5A 4O3MA 3SBGA 1DU0A 1RLQC 4CJTA 1FWZA 4KRTA 3IRXA 3AO5A 4J6YA 2NRXA 2NNYA 2DFUA 4ISEA 2RHUA 5D8LB 2D45A 4OJRA 2O8KA 2RHZA 1NKBA 4LLNA 3FZVA 2GA2A 2W84A 2Q2EB 5IHIA 1XMAA 1QW1A 1Z6RA 1POGA 1QBJA 4CDGA 2VKEA 4M7DA 3DLLA 3HSEA 5KYNA 3A03A 1LVAA 2IGNA 1QS4A 3VPRA 2NRZA 4C8QD 3VQ8A 2A40A 4C2UA 3W6VA 1Y07A 5FWCA 3ENBA 2HVSA 3M8EA 3VSKA 1H1VA 3R8EA 3K69A 1WRJA 3NGYA 1UA0A 1KQJA 1S1UA 4O8UA 3I8BA 1XWLA 2ZZDA 4RM3A 3CCJN 3G4SN 1TNTA 1O3SA 2F4IA 4S05A 2F2XA 1T0FA 3SEQA 1VOMA 4JK7A 5A2QO 3TEDA 1HDDC 1LWFA 4J9EA 3RSNA 1M9SA 5AQIA 4PL6A 1NNEA 1NGBA 2ESNA 3L7WA 4M6XA 3PX6A 4AFZC 4QS9A 4EMHA 2VGMA 3VEZA 2IOCA 3BQZA 3DYAA 5KCHA 5DLOA 3LAJA 2ID3A 3UIQA 1VF9A 4HCBA 1TVRA 2KHMA 2ELJA 1Y56A 1T6SA 3FZFA 3WVDB 2BEOA 2TDXA 5M5WJ 3BP8A 1CF7A 2AZVA 2PJPA 3CO6C 4PKIA 5AQMA 3K5OA 4N9HA 5KK1A 1ZRFA 3BG6A 4YOTA 2X48A 1YW9A 3JAMK 4OX9K 2YUSA 3VWBA 1X69A 3LAKA 1WHGA 1Y71A 2JA6J 2F7TA 3PIOA 3FKIJ 1IJJA 3HOZJ 4F52A 1W0UA 1ZXOA 4AYBA 2K40A 1RDWX 2L8DA 3EDPA 1S1TA 1WFXA 2MBFA 5E20A 4HCCA 2G8FA 1YITI 1QVFS 3I55I 3EY1A 4KB1A 2A37A 1X1AA 2JJ7A 1IO2A 1FP1D 2G7UA 4KUIA 4JI4K 3FXOA 4CIGA 2QW9A 2VC0A 3RZOJ 2Z99A 4DQ2A 5L3DA 4H0OA 1MWKA 4FL9A 4IEEA 5GAHJ 4DU3A 4JZ3A 4WFBL 1JUPA 4NUBA 2QLZA 4BJ5C 2W40A 3RKXA 1JJ2P 4NL2A 4DUZK 2MW8A 1LJOA 3QFUA 1FK9A 4XKWA 2Q1NA 4Q48A 4P96A 3BG3A 4MDXA 5LHHA 4GVEA 1F4KA 1Y0NA 2E6ZA 2QQAA 2O88A 1BIAA 2B0LA 2J6OA 4O44A 2O61A 3J7ZO 5I42A 3SAFA 4C5IA 4EZ9A 2ELKA 4NCGA 5J40A 3IRRA 2M0CA 5AQNA 4C92D 3HBLA 1KG3A 5GAMj 5LD2C 4M7AG 1W97L 2X1DA 2V75A 5B66C 1QKWA 3DLMA 1DP3A 3I58A 2RKHA 3QBXA 2Y69H 4DQSA 4IHYA 1M2VA 4CJ5A 4M72A 3PT9A 1VQ8T 1ZELA 4I76A 3ULDA 1XNQK 3CD6N 1YHQN 4FLTA 1JJ6C 2HF4A 3BF3A 3DJCA 2L3DA 4EDUA 3CDIA 5BPMA 2E3IA 4CJWA 3J8AA 3KK7A 2M9HA 3D1NI 2VOPA 3X2QH 3X26B 2PNIA 4Z4CA 1VQ8Q 4XICA 2A5WA 4LF8K 1ITGA 1BB9A 1NGEA 1IZ1A 2PYJA 3V9WA 2P5VA 2DAQA 4RB0A 1NK9A 1N3AA 2M4KA 1D1CA 2DD4A 4M7DC 4JK8A 4BQOA 2OAUA 3AG2H 4M7AB 5J2QA 4CBUA 1GFCA 3EZWA 4AC0A 3I35A 3OJUA 2CO5A 2YJFA 1YYVA 1MUNA 4O55A 4KREA 2EFQA 2PVOB 3ULEA 4M77F 2X4WA 2MMPA 3JB9H 3J80O 1STZA 1WCMJ 3GNFB 4JLGA 2LFBA 2E8AA 3CQZJ 1U1TA 2RF0A 3QDRB 2BGGA 1LOJA 3BT9A 2ZJRF 2JNGA 3D2FA 2DA4A 4RTFD 1SKSA 1VQNT 2E1CA 3NFAA 1T0FC 3WNGA 3SJHA 2WADA 4NLBA 1MDMA 3COAC 4FISA 2NS0A 3T8RA 4J2AA 4DGWB 1YI2I 3TDUC 4CJLA 3M9AA 3P38A 1KSPA 2OTLT 4X65K 2CFXA 3O6WA 5K14A 1OCRH 1VQNQ 1QMCA 1C6VX 3ZPLA 1IRGA 1SQKA 3O5BA 3W3DA 4B9MA 2EYWA 1ZQ1A 4CHNA 3RQIA 4EGYA 2ZE2A 1RLPC 2KMTA 1TKXA 4F8RA 4J2BA 2X9DA 4CHOA 1X58A 4M3DA 3MMVA 5FU6B 5GADJ 5EZHA 3ABLH 3CMEA 5IT9E 1VQ9A 4GV6A 5C24A 2KKOA 2I10A 2ID6A 4IRHA 4AMCA 3SUPA 1JGSA 3CCRI 4FZXC 1JCFA 1YJ9N 1AWCA 2EQIA 1PVSA 4O6JA 1TWGJ 4FK4A 3WU1B 1JHFA 5GMKi 2JTFA 2ABLA 4CF0A 4IX7A 3BPVA 1RAEB 2QWPA 3VENA 2XY8A 2B5JA 2DK3A 2FSJA 1WFWA 3W6JB 1KCFA 2ZB9A 2KK4A 3QEPA 1MKMA 4FM0A 1TTHB 1I5LA 2NOLA 2DTIA 4DA4A 1TUUA 3FIFA 2DL3A 1EFNA 4C8QA 1VQ4A 4BWJA 1Q81R 1SD7A 2LOOA 3MXIA 4IUVA 2JUFA 2AK5A 3QNNA 2DXUA 3I0XA 4KUMA 4KYWA 3ZSYA 2HGCA 3VFZA 2HVQA 3NEUA 5LL6S 4B9NA 4O5VA 4CGIA 2QCOA 5AIQA 1P4XA 1T39A 4F3TA 4ZYHA 1NYGA 3S41A 2HF3A 3D0PA 1H3HA 5FKKA 1OISA 4E7KA 3WT0A 4RG2A 3AAPA 1XNRK 1ZGJA 2IVWA 2ZJQF 4BKXA 2MC3A 1QVFA 4PFPA 4HSRA 3M0PA 2YLBA 2BIVA 4XTUA 1XMOK 5D7UA 1A5VA 2X6SA 1XDSA 1G4DA 1NWKA 3LCNA 3PSIA 3OW2P 1X6OA 1H9GA 2ZPHB 5E1ZB 1N78A 4N4GA 4C3HJ 4LG0B 3F22A 3RPUD 1W36C 3HC7A 1SG5A 3CC4N 1FP2A 4UUVA 1VSLA 3NARA 3C3WA 3RMBA 2M8EA 1R5HA 1YIOA 2W04A 1HCRA 1I6XA 2E20A 3HP9A 3AT1B 1YJWQ 3SZPA 1JTXA 2V9VA 1WIEA 3C7NB 2CMPA 2E5ZA 3KP4A 1B72A 3E9PA 3R2XC 3CF2A 4KGZB 1ZRDA 3ID6A 2OPRA 4UNFA 3U23A 1MA9B 4BROA 3ZMUA 2QGGA 1PKTA 3MKLA 4CFAA 1R6RA 1SSFA 3J81O 3PX0A 4U7DA 4EMKB 3BR3A 3L1AA 1P4AA 4FX4A 4IRGA 2QYZA 4X1VA 2Z2SB 3I64A 5DY9A 4JS4A 1X2QA 3HFOA 4HYEA 4CEOA 1B3QA 3MXJA 3DLRA 1KFZA 4IBNA 2DXBA 1J7KA 1TU0B 5GAMe 2DL4A 2OV7A 3G71T 1JXOA 4C5GA 2P0WA 3SNNA 1UHWA 4M77E 4UY8I 2WV0A 1ETWA 3A1PA 5J1EA 5F1JA 2CH0A 2X9HA 3R61A 1AHJB 3LA7A 1VSKA 4BY7J 3OYYA 1K0XA 3AO4A 1KYWA 5FDLA 1BA5A 3G71Q 1FIPA 2R0QC 4EP4A 4FYDA 3GLLA 2VQGA 3HOUJ 4J7IA 1GT0C 2FL7A 1HNWK 2Z16A 4GLMA 3SQ2A 1R0AA 4C92A 3S3OA 4XLAA 1FSEA 5IT9Z 4P9FA 1YITA 1C0UA 3I55A 2L9VA 3V9XA 3D45A 3K0SA 3FXMA 2JWLA 3KLGA 4EV0A 3CCMI 4Y1CA 1GOAA 4GXOA 4IUUA 3CJBA 1B1BA 2FXUA 2D0OA 4LFCK 3BR6A 4IUQA 3JRZA 2HOTA 4XQFA 1XQHA 3QKJA 2Y48A 1OYWA 4NQWA 3C2GA 2PZSA 3R1XA 2CP7A 2O3FA 1RKTA 3M8FA 2YRVA 5LJ5h 4CZGA 1ZBHA 4YPHA 3VS4A 2RHIA 3TW7A 3T1AA 1HJRA 1K9MC 5ELZA 5LLQA 2D0NA 4H5VA 4FVUA 2XB5A 2G3RA 1JLFA 1IUFA 1VRLA 2KR3A 4DR1K 2QI2A 1C0GA 4A5NA 2D4WA 3MD2A 2COWA 4CE9A 3D4VA 1MV3A 4DB3A 2WC2A 4BGBA 1RI7A 3ZT1A 3K4CA 1ZG5A 1H8AC 1KIKA 1U78A 3CETA 4M78B 5FW9A 3Q9VA 4DLEA 1BKBA 1NJXA 5EYRA 5K5QA 2Z33A 4FWOA 1JKPC 4RDUA 1TAUA 4A3JJ 3O9RA 1NK3P 3CM5A 5I11A 3SDBA 2YX4A 4JKEA 3JCMg 3ASKA 1E4GT 1NU0A 2PUOB 6AT1B 1HYSA 2A42A 1Z9CA 1TWHJ 2IGMA 2QQBA 2EIJH 4OMOA 4BE0A 3F8NA 3DU5A 2RF2A 1RBVA 1UWBA 1SUQA 1BN5A 1YVNA 3ATVA 4CK3A 4R8HA 2RQQA 5AQOA 3QBWA 3LGLA 1ZREA 2O4XA 1S9EA 1J75A 3A0HC 2BZTA 3HL2A 3A2KA 2G8WA 3RTVA 2H09A 4AM6A 3ASNH 5J3BA 2E5LK 4IPAA 2KRMA 2CKKA 3D7EO 2E2OA 3WEEB 4L0YB 1DTTA 1WBBA 3G0ZA 5LMUK 4C0ZA 4BACA 4C8KA 1KQ2A 2CZ0B 2NUTA 3DBHB 3OWTA 2ZGYA 3DFGA 3FWEA 4GCVA 1Q9YA 4HPQA 3VQDA 2ZSIB 1XHZA 5IAYA 3ZMSA 2E6NA 1SL1A 1DTQA 2XKOA 3A5MC 4RW4A 2ZMEC 3ASOH 2HDDA 1M1KC 1RGIA 2KRHA 4CFBA 2ROTA 3HJFA 4DS4A 5KI6A 2PAVA 1RAFB 1S29A 1ETVA 1WXBA 4RW8A 5HS7A 3SZTA 2XRNA 2FPFA 5HLHA 1UAXA 1Z3YA 3MEAA 1Y39A 4BR4A 5FKMA 5J8FA 3VEYA 2JPBA 4BAYA 1V4RA 2W1OA 1W5SA 1VQ8N 2ZNZA 2L0KA 2FNAA 3EN9A 2KXCA 2M1HA 3N4MA 4B3MK 2O8BB 1MSEC 3QJYA 1E7OA 2D8HA 4NLCA 3R6NA 1VHXA 5BMZA 4JKFA 4W5NA 2V6CA 4BRHA 2JTMA 1IKYA 2XKPA 2RVCA 4D6WA 4R1HA 3LDLA 4HW0A 3WTVC 2JMAA 1HKTA 3VEWA 1XPXA 4NHJA 4BVPA 1QKXA 4G7ZF 2QEXT 4A61A 1ZUKA 2Q3SA 3BCAA 2L9NA 4BE2A 4B09A 3VU3C 4EJOA 1QQJA 3DOLA 4F9OA 3CCRA 4PZJA 1R59O 3AA5X 1PSFA 4XL9A 1AOYA 2GCXA 4CZEA 2DPPB 5CK9A 1WHLA 4H0XB 4XH1A 4HDVA 5KPZA 4C92C 1TKDA 1I3AA 1BI0A 5GANf 2L89A 1ESVA 4I98B 3JRAA 2XY6A 2ME6A 1VQ5T 3RPUA 4Z94A 4MLHA 1EXQA 3ESWB 1VQNN 4CGDA 4JJNK 3KTUA 2P51A 5DCFA 2OC6A 1IV8A 4LDUA 4R55A 2VBWA 2EPDA 1S22A 3THXB 4GO1A 2GF7A 2FBVA 1C0WA 5IP7J 1ACMB 4AHSA 3AG3H 4MZTA 4F4KA 2PVGB 1VQ5Q 3TSPA 3AAQA 3L3UA 2Y0SN 2HS5A 1O3QA 1X43A 2IAJA 3CCJI 1ZLJA 2JM8A 1NHAA 1XHXA 2CH5A 2CW0F 1AOJA 4DSFA 2LD5A 1JKRC 2FE3A 2EIFA 1BW6A 4M7DG 4CCOA 2IS4A 1EQYA 3CCLT 4Z4IA 2YG8A 3K5NA 5ILSA 2K4YA 1Z25A 2HSTA 2GFUA 1H3ZA 2RHKA 2KGTA 5D5UB 2VG6A 1X3UA 2IGIA 3OYGA 4IF4A 3RR8A 4MHGA 1F9NA 3U3GA 1IXSB 1YIJQ 1VQOI 4A5AA 1IRFA 1GOBA 3CCLQ 1FOYA 1G59A 1A5WA 1M5Q1 3QMLA 1RT4A 2UXNA 2E71A 2E6LA 1YWPA 3DLGA 3MO8A 1VYVA 1TTYA 1Z1DA 4OVAA 3NTHA 2DU9A 4GY2B 1UB9A 2FSKA 2E35A 1R1UA 4OU0A 2M3AA 3G2BA 2KYBA 2O8CA 1AKHB 2KT8A 4DF8A 2R7UA 3H36A 4X34A 5IOYA 3CCST 4M7DB 4PSXA 3KYDB 3ZOBA 4EHTA 3HHTB 4C30A 4HSTA 2XHIA 1T6CA 3IAYA 3L2RA 1EWRA 2NVYJ 2A0FB 1U45A 2JA7J 2DYIA 2ABKA 2VL8A 2MSYA 3SZGA 1VQ6I 1KD1O 4K11A 1G3SA 3CW7A 4BDPA 1UECA 4FJLA 3CCSQ 1Q86O 2XU8A 5EGOA 1KYZA 1U3EM 2LR8A 4W97A 4J5YA 4CC3A 4MEXF 4RAZA 2HVIA 3B8AX 2M0OA 2ZPBB 3QBYA 5HCKA 2XKOC 3MZYA 3V9UA 4PJOF 3TABA 2LNVA 3TI0A 3P1GA 2R93J 2QUFA 1YJWN 2RJDA 3QICA 5DM7L 2RNAA 4E19A 3AVNA 1B92A 1GRIA 3TDZC 1U5TC 3AVMA 4MQ9F 4HLXA 4B3RK 1CKAA 4LMYA 4RKUE 5KYYA 5D5VB 4FOIA 2RB6A 5TGTA 3F5TA 1OCPA 4NXMK 3PFIA 1WEIA 2FZKB 5LJ3j 5AFUA 3C6UA 3QOEA 2OPTA 4KITB 5GAOm 5E79C 1E3OC 3CXCS 2UWMA 2HHQA 1RBRA 2M34A 3UT1A 1NOYA 1WX6A 1BDGA 2IA2A 1CF7B 1WHJA 4L9TA 3VMFB 2QASA 1RT3A 2L3QA 3CCMA 4YFUA 2QWNA 3OYKA 2V7FA 2HMIA 2BW3A 4GKKK 2SRCA 4Y52J 2HKNA 1NJWA 2JGUA 3SAGA 3V81A 2TRTA 3QWXX 4E47A 2O2OA 1JQQA 1FW6A 2DL7A 2ZSHB 3PY8A 1YHQI 3MKYB 2NOIA 2PMUA 1HQEA 3OYEA 3V9SA 1YW8A 1KONA 4QOZB 1H0MA 2EBPA 2ACJA 4E70A 3LDQA 3I0WA 1CKBA 4YDUA 4I2OA 4Q5WA 2CP0A 3AARA 2OTJT 3C94A 4NB4A 3G71N 2C0TA 4FT4A 5A2QE 2CH4A 3JCMh 5M9OA 2VYPA 3ABKH 3ZQGA 1K9MR 3OR2C 2DF6A 3EE8A 4FLVA 4EIAA 3GF2A 1QVTA 2D0CA 2RI2A 5FROA 3WG9A 3BEXA 4GY5A 2OTJQ 4FETA 3D5LA 2EAYA 1X1DA 1D3YA 1TQIA 1YOVB 3HUGB 1ZYRF 1KVCA<