4ZTFA

Crystal structure of the prototype foamy virus intasome with a 2-pyridinone aminal inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/inhibitor
molecule keywords Integrase
publication title Discovery of 2-Pyridinone Aminals: A Prodrug Strategy to Advance a Second Generation of HIV-1 Integrase Strand Transfer Inhibitors.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 103
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ztfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ztfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ztfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ztfA03
1RBRA 1A5WA 2RI3A 1TL1A 3VQPA 4CGDA 1REVA 4FJLA 1S1VA 4KRFA 2YHAA 4KB1A 5J26A 4CEEA 4FLZA 2BDPA 2L8DA 1BCMA 4C8LA 4DS5A 3QEIA 5CZ2A 1XNIA 2E6LA 3ZSRA 4I2QA 2F8SA 4PA1A 1L3TA 2HW3A 1FKPA 3BGRA 2X78A 4QQGA 1NK5A 1T8EA 3LAMA 4CGJA 4DF8A 1J9AA 3M8RA 3C94A 2LSNA 1VK0A 3UT1A 2Q3SA 1WJRA 4O44A 2E5QA 4RW9A 5KTQA 2YKNA 2HMIA 3E01A 2G8FA 4IKFA 3MXMA 1B92A 2BUDA 3SQ1A 2XY7A 4AHRA 1SL1A 3DRRA 1S1WA 5J2QA 4DFPA 4PY5A 4BACA 5CIUA 5K14A 4KHUA 3DB3A 3THVA 1WAJA 1SL2A 2IDOA 4LD6A 4FZZA 4CF2A 1WGSA 2PQWA 1VSKA 5IN1A 1BIZA 4H8KA 4ICLA 4W5OA 4DU4A 3NE6A 2B5JA 1B9DA 2GFAA 4XIUA 2HNYA 2I5JA 3TAPA 2A1RA 2YHBA 1RDBA 1H3ZA 3TAEA 3SI6A 2QKKA 1ASVA 2D0BA 1LW2A 4QOZB 1ITGA 4IUTA 4BE1A 1KVBA 4IURA 3NNQA 4CJVA 3LPUA 1RT3A 4RW7A 3DLBA 1S9GA 2X4WA 2EHGA 4DQSA 3SD4A 3OYEA 3ZEHA 5DK5A 4CHZA 1KFSA 4FJNA 3V9XA 4FM1A 5HP1A 4M3UA 2P51A 3ZCMA 1BISA 3V4IA 2VG7A 2B4JA 3CYMA 2W42A 1L5UA 5CYMA 4KFBA 4GW6A 2Z1HA 4O0JA 3TARA 1QSLA 2RPIA 2VG6A 3NF7A 2MWOA 2HHVA 2D9TA 3DI6A 5JS1A 4NCGA 3QIIA 3NF9A 4F2SA 1U4BA 1L3UA 1VSDA 3F73A 1RBVA 3ZSYA 1SKSA 4G1QA 2O4IA 4CHNA 4HUEA 4CJQA 4DQRA 4FL6A 2FBXA 4Z4HA 1DTQA 3AO4A 1N6QA 3V9SA 2RKIA 3CFRA 3IG1A 2AJQA 4B8AB 5C0MA 3O4QA 4DWIA 1HQUA 3RTVA 4B9MA 2EQKA 3P8HA 4ZTJA 4Q5WA 5J1EA 1UA0A 4FJKA 1IKXA 1RT4A 3P1GA 1RBTA 1QE1A 2JTFA 1Z26A 2HNDA 4DTOA 4UC4A 1WSFA 2R57A 2VG5A 3IAYA 1KSPA 4DTSA 2L89A 4DSKA 3VQEA 1VSFA 3VA3A 1W9HA 3JYTA 2PYLA 1XHXA 3NGYA 3ZSWA 4DTRA 3NF8A 1BI4B 2YKMA 1SKRA 4FJ9A 4KKOA 4EZ9A 4E1MA 4C8OA 1HQEA 4OVAA 3AVGA 4N76A 4NYFA 1X9SA 4E7HA 4OLBA 4M45A 3O8VA 1I39A 3FC3A 2M0OA 3VQAA 2PZSA 2RJCA 1G5VA 1IG9A 3NTHA 1WSJA 1IKYA 4FYDA 4B9TA 2D0CA 1JXBA 4N4IA 3SQ4A 5HRPA 4Z0UA 4CEOA 3OYHA 4CK3A 4BDZA 5I3UA 3QINA 1VSIA 3LGFA 5KRTA 3OA6A 5HBMA 1NJYA 3EAEA 2HHTA 1RDDA 4HCCA 4HUGA 3OVNA 1A5VA 1F21A 2KFNA 2OPRA 1RTIA 3SV4A 3LYIA 2FBYA 4CJEA 3H8ZA 4F3TA 3HO1A 3V1RA 1I3AA 2X4YA 3OQ5A 1UA1A 1RT7A 3O3GA 3QETA 4CF9A 5DMRA 4CJUA 2Z1JA 3WNFA 4I7FA 4OKJA 3NFAA 2DTUA 3PX0A 2GBZA 4KAZA 1LWEA 3PUFA 4DQIA 3WNEA 4N41A 3OYAA 3TI0A 5M9OA 4E1NA 3ALYA 3OB9A 3K5NA 4R5PA 4DSJA 5J2NA 4CIEA 4Q0BA 2JZ2A 3META 2RHYA 1T03A 2K3XA 3ITHA 2DIQA 1S1XA 3NTIA 4KHSA 4DU1A 3VQBA 1T05A 4FJXA 5E41A 3D45A 2LRQA 2IG0A 1TK0A 1RI0A 1GOBA 1WLJA 3ZSZA 4Z4GA 4B8CA 1VRTA 3SUOA 2E6MA 3KD5E 2HHQA 1UWBA 1NKEA 1C0TA 3VQ6A 3SQ2A 1JL2A 5JS2A 3TAFA 3V6DA 1S9EA 1EKEA 4BD3A 1C6VA 3OS1A 5D6WA 3AVFA 3SZ2A 3RMCA 3NCIA 1O1WA 1ASUA 4KTZA 2EQMA 4J2DA 1ASWA 4B9XA 1YTAA 3PO5A 1FK9A 3QJ6A 4O55A 4IUPA 4OGCA 3ZSXA 1RBUA 3U3YA 3RR8A 4CGIA 3C95A 3QKJA 2G8IA 1OZ3A 4IG0A 3DB4A 3HPOA 1RTHA 4FK4A 2RHIA 4CJLA 2Y1JA 3OYLA 1BIUA 5KH6A 1JL1A 3NHGA 1NK6A 1RTJA 1RCHA 1BL3A 2D0AA 4M41A 4CJWA 1Q8IA 4BDPA 1UOCA 4OKEA 2BGGA 4O5BA 1C0MA 3PO4A 3SJJA 4A4EA 2MWPA 3OMGA 1NOZA 4AH9A 4FJ8A 4FLTA 3QEPA 1MHNA 1QHTA 3QO9A 1J54A 3RR7A 3ULDA 3NTKA 4NCBA 3MEDA 2HHUA 1CLQA 2WONA 2VWJA 1NK4A 4CHPA 1L3VA 1CXUA 3ZSOA 4W5TA 4PQUA 1NKBA 5D6XA 3HK2A 4LH5A 4RW4A 1JLEA 2Z1GA 2WOMA 5KRSA 4JRPA 4X34A 1WAFA 4C8MA 3PNWC 4BWMA 2YNHA 3PMTA 2HHWA 3BDLA 4GY5A 1NOYA 1ZBLA 4UQGA 1OI1A 3Q1JA 3F70A 3AA4A 3AVLA 4QQDA 3LALA 4Z4EA 4CFDA 4FJJA 3O3HA 1HYVA 1OYXA 3MXIA 1C1CA 1YTUA 3OS2A 2RJDA 4OVLA 4KHWA 3HT3A 3S9HA 4FVMA 3TR8A 1RT1A 3BDPA 5J2MA 2RHXA 2VYTA 3K59A 4CGHA 3T3FA 2X74A 4HCBA 5CY4A 3DRSA 3LH0A 3FFIA 4N5SA 4K8ZA 4DSFA 4QCLA 3FLGA 1NKCA 3M8SA 3NH1A 1KCFA 3MEUA 2X6SA 4IBNA 3OMCA 1ZBHA 2BANA 3D0PA 4QVZA 3ZT1A 4H4MA 3QEXA 4PUOA 4CEDA 4KTWA 4AHCA 4DTNA 3DLHA 3G0ZA 5FROA 1C0UA 4F3OA 1U48A 2WACA 2KFZA 3QNOA 3DLMA 2F8TA 1U47A 3K5LA 3V81A 2DIGA 3MO8A 4HCZA 2LTOA 1K6YA 3NH0A 3ZSQA 3ISNC 3GOXA 3MEVA 3OYMA 1S6QA 3QERA 4KTQA 2YNIA 2RHZA 4ELTA 4ID1A 4C8NA 1OZ2A 3OY9A 1XC9A 2YNFA 4DFMA 3QEWA 3LP2A 4M3WA 4DQQA 4CECA 1S6PA 1UAXA 3A2FA 4EP4A 4IUUA 3PX4A 3S3NA 3OYJA 4OLAA 5CYQA 3KK1A 2RHUA 1B9FA 1S1TA 2QXFA 4NYNA 4A4GA 4KB0A 4DMNA 4B9SA 3SUPA 2X35A 2DFFA 5FRNA 3K5MA 4CJTA 2P1JA 4QQ6A 1TK8A 1NJWA 1WSGA 3DLRA 2IAJA 3MEAA 3HM9A 5HROA 1QTMA 3DLEA 2RI2A 5HRSA 1X9WA 2FC0A 5IAYA 5HRRA 2RJEA 4CJFA 3QESA 3MEWA 3E9GA 4DFJA 3HP9A 3FEOA 4CF0A 2LDMA 4FK0A 3U3GA 3M8PA 1DTTA 2RJFA 2XY8A 4DTMA 4LY7A 4F8RA 1GOAA 3VQ7A 3M9QA 3S3MA 4DSIA 3L2RA 2DFEA 3SNNA 3T19A 2ETJA 4CHOA 2DAQA 4CJ4A 4CIFA 2P0KA 4FCYA 3RRGA 1SV5A 2KZZA 3ASKA 3B6OA 4QW2A 4FLWA 2HB5A 3P83D 3S3OA 3HYFA 3AVCA 4B9LA 2X6NA 2F96A 1RT5A 2KTQA 3KK3A 4FLVA 3KLFA 1S5JA 4FJ5A 3KLEA 4BE0A 3OYGA 1RNHA 3K5OA 2E4LA 1D9DA 4E0DA 4KHYA 4M3XA 2XK0A 2VWKA 2O4XA 2EX3A 2FBVA 4O4GA 4CEAA 3LGLA 3G10A 4B9UA 4C5HA 4B9VA 3CFPA 1U49A 3K57A 3LP0A 2G8VA 2QKBA 1YT3A 4RG2A 2GV9A 4OGEA 3QEVA 4Z02A 2Y1IA 3KTQA 3T1AA 2NLUA 2PY5A 4FJ7A 3AO5A 3L42A 2B6AA 2ZQBA 2R5MA 4AHVA 3SV3A 1ZBIA 1WSHA 4CJ5A 1LAVA 1TGOA 2OZSA 1XWLA 3TWHA 1VSMA 4B3OA 3MEEA 1ZBFA 3KKRA 2IGIA 1NJZA 3VQ9A 2DFHA 4CFAA 3NBPA 1WN7A 2A1SA 3IRXA 3NH2A 2L3RA 1KFDA 1LAWA 3DLGA 4CF1A 4L8RB 4CJKA 3AV9A 4HVJA 3OYIA 3B6PA 4CRIA 4NZGA 4J2BA 2FBTA 1Y97A 2XO7A 3OYNA 3JSMA 1JLGA 4CHYA 4AHSA 5FDLA 4KI6A 4CEFA 4Q5VA 4W5NA 4DTXA 4I9QA 4IUVA 4DTJA 4DG1A 5SWMA 3NGZA 4OPJA 4MFBA 1RT2A 3KK2A 3KUFA 1BQMA 4O0IA 3HVRA 4AHUA 1L3SA 4C5EA 3KJVA 4N56A 4QAGA 1YVUA 4E89A 3TANA 4DTUA 1LWCA 4CFBA 4IDKA 1TK5A 4B9NA 3HPGA 3OYBA 3SQ0A 3MP6A 2XRIA 1WSIA 1LWFA 3LZJA 1Q9XA 2HHXA 3C6UA 3L2VA 4AHTA 3KD1E 2OPQA 3LZIA 2JGUA 3V1QA 5SZTA 4M3RA 2RI5A 4J2EA 1RT6A 2YRVA 3ZT4A 1RBSA 1LW0A 2M1HA 4FJHA 3L2QA 4LD0A 4CIGA 4L59A 4DSEA 2YNGA 4Y1DA 1Q9YA 3SUNA 4PLLA 4OJRA 3QBYA 3ZT0A 3EY1A 4FU6A 3ZSVA 3NAEA 3RWUA 4DU3A 2ZD1A 2HVHA 4IG3A 4CGGA 1U04A 3OJUA 4DLEA 3OYDA 3CG7A 4FW2A 4IFYA 3AVMA 3UIQA 4BDYA 3KIOA 3LX7A 4MQ3A 1QQCA 4DQPA 3HPHA 3AO2A 1NK0A 2OPPA 4M42A 3CEYA 2XHBA 3OYKA 1J53A 3EZ5A 4F2RA 3TAGA 2K3YA 4Z4IA 1TKZA 4CGFA 1HNVA 1SKWA 4DSLA 3HVTA 3QIOA 3K2PA 2JLEA 1QSSA 1EXQA 4GVMA 3L3VA 4KPYA 1VSHA 3LLRA 3CM5A 5I42A 4YFUA 3SPZA 2G3RA 3RMAA 2G8WA 1D5AA 4LSNA 4EP5A 1NK7A 2DY4A 1D8YA 4E7LA 2HVIA 4DLGA 2BIVA 1WJQA 3C4SA 4ELUA 1WNSA 4FM2A 4ZTFA 2HNZA 4DFKA 1BCOA 1EP4A 3LAKA 5CZ1A 1JLBA 4FM0A 4ZHRA 4CFCA 4WE1A 2RO0A 3UWNA 1CZBA 4FW1A 5C24A 4A4HA 1G15A 5KE3A 4JS5A 4FLYA 3H6ZA 3HL8A 3QNNA 1BGXT 2P5OA 1RTDA 3V1OA 4LSLA 4E3SA 3DM2A 2XY5A 5HLFA 3CM6A 4M3ZA 1JXEA 3ME9A 3MXJA 3VN5A 4EZ6A 3DMJA 3SCXA 5C25A 1ZYQA 2B8AA 2EQUA 3PY8A 3PMIA 4C8KA 3F9KA 4CK1A 1FKOA 3PX6A 4H4OA 4FLUA 3ASMA 3S6WA 5J2PA 4F4KA 3M8QA 3U6FA 4BE2A 2F5KA 1JKHA 5KCHA 4B08A 1RDCA 1NJXA 2BKDN 5KGWA 4CERA 3CQ8A 1BHLA 1RILA 2PYJA 1VSEA 1XI1A 1IKVA 3V9ZA 1HMVA 4KREA 4JLHA 3RMBA 3AA5X 4CJ3A 1TVRA 3VQ5A 3OJSA 2BE2A 1X9MA 4NCAA 1VSLA 4K8XA 2R58A 3LPTA 1JLFA 4E7IA 3HP6A 3FDRA 4GMJB 4KI4A 4HTUA 3AA3A 1FXXA 3KLGA 3P5JA 4DS4A 3V9UA 4C5GA 1KLNA 3I0SA 1C1AA 1LV5A 1C1BA 3DYAA 3DOKA 3K58A 3AVBA 4KO0A 4FJIA 2RF2A 2IS3A 3P8DA 4RW8A 4PL6A 4CJSA 3KKSA 2HQEA 3CFOA 2ZE2A 1D9FA 4IFVA 1GOCA 2OPSA 2EQJA 4LH4A 2OZMA 4M3YA 2Z1IA 2XY6A 2RN2A 4KV8A 1HJRA 1VRUA 3KLHA 3L2WA 2YV0X 1SUQA 4A4FA 1J5OA 1HNIA 5KCOA 2OA8A 4I2PA 2R7YA 2ITGA 5C6SA 3MECA 2HHSA 3VQ8A 1SSFA 4HHTA 4EDUA 1VSJA 3SYZA 1DLOA 1WSEA 2GUIA 2O4XB 4CHQA 3LANA 4CE9A 1KLMA 2G8HA 4CEZA 1TKXA 3AO1A 3NGIA 3LWLA 1RDAA 3KLIA 4FZXC 1HRHA 3I0RA 4J2AA 3QLHA 3AVAA 3AVHA 1R0AA 3WNGA 3IS9A 1CZ9A 3TAMA 2O4GA 1EX4A 4E19A 5D6YA 1JLAA 3L3UA 1QSYA 5FRMA 4C5IA 4KHQA 4FJGA 3I8DA 1BI4A 3NF6A 1N5YA 4HUFA 1ZBUA 5T7BA 4ELVA 3MP8A 4FZYA 3LDSA 1TKDA 1HYZA 2NUBA 5KI6A 1BQNA 2CKKA 1KVCA 3VQ4A 2E6NA 4W5RA 4BWJA 5KE2A 3VQDA 1IH7A 3VQQA 4OPKA 3E9FA 4CEQA 3C6TA 2D5RA 2M16A 1X1PA 4CEBA 3HSTB 2EFIA 4JRQA 4ID5A 3MAQA 4E7KA 1HPZA 2KZMA 4E7JA 4FXDA 4CESA 4YNQA 1U45A 3OYFA 5HRNA 3TABA 2GFUA 3O3FA 4FLXA 1HYSA 1TAUA 3RMDA 2G8UA 1IKWA 3SUQA 1EETA 1IO2A 1W0HA 4IUQA 3DRPA 2G8KA 1TV6A 1MU2A 4N47A 2GF7A 2IC3A 1XHZA 5KGXA 1N27A 1KTQA 4FK2A 2KQ2A 3VA0A 1S1UA 4CK2A 5EU7A 4KHNA 3LP3A 1JLQA 4II1A 4Y1CA 2P5GA 1Z25A 4TSXA 3RRHA 1SL0A 3OS0A 3MEGA 3NDKA 4N4HA 3PV8A 4FJMA 4NS5A 4I9LA 4PLIA 3DLKA 3WNHA 3MP1A 3L2UA 1NK8A 4CCHA 3HJFA 4Z4FA 4PWDA 3QIPA 2QQRA 3AVNA 4W5QA 2OYQA 2IOCA 4RW6A 4B9WA 3H08A 3VQCA 3TAQA 3V9WA 4CF8A 3LP1A 4OKKA 1CXQA 2QQSA 5C42A 3LWMA 2ATQA 3DOLA 3L8BA 3ZT3A 3AVIA 2XDPA 3O4NA 2FHDA 1A5XA 1TL3A 1QS4A 4JS4A 4N4GA 2KW4A 4DF4A 5J39A 5D3GA 1WJSA 2R5AA 4M3TA 2HQXA 1TAQA 1KHCA 3SPYA 4CJRA 3AA2A 2LVMA 3AO3A 4AILC 3AVJA 4CJPA 3PFSA 3ZT2A 2EKOA 4RG8A 1KVAA 1TKTA 1NK9A 4Z4CA 2QK9A 4DTPA 3OYCA 3AVKA 3HXMA 1KRPA 1T7PA 1JLCA 2LCCA 3EYZA 2X4XA
chains in the Genus database with same CATH superfamily
1RBRA 3JB9H 1A5WA 3FXOA 2VKHA 2E6ZA 2YHWA 4CGDA 4WCIA 1REVA 1S1VA 1P8ZA 5J26A 1OCRH 1U9NA 4FYXB 1KD1R 1KQSA 1LCUA 4FLZA 1MBHA 2MMPA 5AZJA 3Q7BA 5FWBA 3QEIA 3G4SQ 1R1VA 2X9HA 4K2EA 1EWRA 3ZSRA 4M3DA 3BGRA 4AFZC 1NK5A 1T8EA 5GMKj 4GLKA 4CGJA 4JI4K 4PKIA 1IW7F 2TDXA 1FZPB 1YJNI 1J9AA 3M9AA 2Q0RA 3S14J 3C94A 3DPUA 1QVFS 2DT5A 3INZA 2YDLA 3TSPA 4RW9A 4C30A 5KTQA 3OWTA 4LOCA 5GPAA 3J80O 2YKNA 1NH3A 3HRMA 4BVPA 4JN4A 1P7MA 5EF6A 4IWVA 2EA4A 4N0AA 2E1ZA 3DRRA 4C92F 4PY5A 4FWRA 3QZ5B 3JCMd 2ZSHB 1PC0A 5CIUA 1RNLA 4ATOA 4KHUA 2RREA 3JRHA 1GT0C 2E71A 2IDOA 4AI5A 3MZYA 4BNCA 2P5LC 4JLGA 1GXQA 4XLHA 1BIZA 4H8KA 2Q0OA 1XSVA 4UY8I 4M77E 3KETA 2ED1A 3I55N 2X6WA 5GANh 1QKXA 2OC6A 3GNGA 2HOEA 2L54A 2B5JA 2XF5A 4ENMA 4EHTA 3JRDA 4XIUA 4M78B 2CP0A 2NOJB 3HUGA 4J9BA 3FX3A 2JVHA 1D4XA 2HR3A 3EG2A 4FHTA 3TAEA 4QWQA 1W70A 1AWCA 2QI2A 2V8KA 3SB2A 3THXB 1X6GA 1M4ZA 3FZMA 3NNQA 4CJVA 2BW3A 1W97L 2H8WA 3O9UA 1IN5A 2XHIA 1J3TA 4EGYA 1WPKA 2QGUA 4M7DD 4KHPK 4DQSA 2NUPA 1NWKA 3GZ5A 3PLAA 2ZC2A 1T2KA 3CCMA 4WYBA 4PSXA 1YLFA 4CHZA 4X66K 2CS3A 3V9XA 3UA6A 4FM1A 2HMAA 1FBQA 1QGPA 3E1YA 3ABMH 1FYMA 3OSSC 4IDHA 2E60A 5M1PA 2LH9A 3O5ZA 1BISA 1VQMT 3V4IA 3OL3A 3K4JA 3PIPA 2VG7A 4CZFA 4M7DC 5CYMA 2O01E 5IHIA 3HM5A 3CC2T 3L6QA 1VQ9N 3E9PA 3ULEB 2JZYA 5GAN7 2ABLA 2J06A 3NF7A 2MWOA 4UOBA 2HHVA 5JS1A 1VQKT 2EKHA 1MV0B 3WQUA 3VUZA 4A12A 4B24A 2VQHA 1YJ9N 4UV8A 2P6SA 5IT9E 2WB1N 4CD1A 3SJHA 3P9IA 4LJZF 1VQ5T 1MH3A 4FPAA 2IPQX 2O4IA 2C0IA 3E19A 1OH8A 1VYTA 3FE1A 3F0ZA 5TGTA 4CSWA 2CQQA 2KR3A 4X9DA 3IRRA 3WGGA 3ZQHA 2EB7A 4BI3A 2FBXA 1L0OC 1DTQA 5IOZA 2EILH 1FMKA 1T8IA 2KFDA 4CCKA 1AHJB 1YI2I 2VCPA 4XK4A 3HG9A 1F36A 1W2BA 1YQLA 3ZQGA 3WUHA 3GIBA 1WYXA 4BRCA 3D2EA 4LNPA 4ZTJA 1Y39A 1U5SA 5BPLA 1IKXA 4RS8A 3LFUA 3DLLF 4WF2A 3P1GA 3O3KA 1VFCA 2NZTA 2WAFA 2K5IA 2LT1A 2E5ZA 4DV3K 2R7ZJ 2DVEA 2RK2A 2E5NA 2DVJA 3C3WA 1KSPA 1FP2A 3KXTA 1OVYA 4F91B 2P6TA 5CCAA 4NQWA 3VA3A 1W9HA 1XHXA 3QB0A 3ZCOA 2XAQA 4DTRA 3OH6A 1BI4B 2YKMA 2SEMA 5B1BH 1SKRA 1ZGJA 3A01A 1M8MA 4U7DA 1YIJI 2EH3A 3QDRB 3DWLE 3G71I 3UATA 1G59A 2DTHA 3AVGA 4N76A 5JVGF 5DUKA 1Z67A 5TJJA 4B3AA 2BTFA 1WQ2A 3DAWA 2QSHX 3BPXA 3V8KA 4M77D 1D8JA 4KBOA 1I39A 3VQAA 1LNXA 2DKGA 3ML6A 3UPUA 3NTHA 1WSJA 4ME7A 5L3GA 2D0CA 1JXBA 3O6BB 1IUFA 1GV5A 2MBFA 3D5RC 1OR7C 3CCUQ 1ETYA 1PU7A 1K9MU 5HNHA 3TEDA 5I3UA 4CBWA 1VSIA 2WY8Q 3LGFA 1TS9A 4PJMA 2EA2A 1VQNA 2GXGA 4UV9A 4GV3A 1LB2A 3ZETB 1JUMA 4WWCA 2Y30A 1POGA 2GXBA 4M77C 3FXLA 4BC5A 2HBJA 2X48A 5LBQA 2KFNA 4U0WA 3BY7A 2GX9A 4B3RK 4KN4X 4CZZA 1MUZA 4CC4B 1NPRA 3CMMA 3JCMb 3OTOK 4CJEA 4XMYA 1AOJA 1VQ4A 1XS9A 5IYDJ 3HO1A 1B34A 2X4YA 1FMVA 1D1CA 3RZOJ 1RT7A 1RAEB 1XN7A 2V4JC 4CJUA 4YY3K 2Z1JA 2LQWA 2LC2A 4XLEA 1BN5A 2GEMA 2DXIA 4I7FA 4OKJA 4M78E 2DTUA 3SQNA 1PD0A 3G3ZA 3FLCO 4IVNA 1OFCX 3PX0A 2GBZA 2CH6A 3F8MA 3ABKH 1EH6A 3M3YJ 4NO7A 3PUFA 2E1MB 4IQ4A 2QCOA 1DP7P 2R7VA 4OB1B 4PIIA 4BRGA 3GLXA 2D2WA 2EBIA 1MIJA 2E19A 4R5PA 1LFUP 3HOXJ 5A0GA 4G6QA 1VF9A 2LMJA 1WRJA 2M45A 2WC2A 1NBWA 2LREA 2JZ2A 3META 3M6GA 4EJVA 2O8BA 1YP5A 3QYHB 1R6RA 1VA7A 1E17A 3NTIA 4DU1A 2L9VA 3H92A 2HBLA 3CESA 2DD4A 5JLFA 2O9SA 5E41A 5A0LA 3WXKA 4BRHA 1UGQB 3WXLA 1TK0A 4Z4GA 4BQZA 1AU7A 1MPGA 2WBNA 1W0UA 3OL4A 4WXDA 3FF5A 3SUOA 2E6MA 3CC4I 4D6WA 1QLYA 2O8CB 4A3IJ 2IS2A 1HKGA 2VV5A 2ZNYA 2VXZA 1JL2A 2JPCA 1R59O 2Z3YA 3C0BA 3V6DA 1QQJA 4BD3A 1C6VA 3AVFA 1T56A 3NCIA 2QSGX 3SK3A 1RI9A 4KTZA 4DOZA 2EQMA 3JB9D 1YTAA 5B5EC 2ZGYA 3K1MA 5AIPA 3KP5A 1M3BA 4OGCA 2FNAA 3U3YA 1SZ2A 1BA5A 1Q7YR 1CSKA 3KZZA 2DXUA 5D5XB 4IG0A 1WJDA 4EVIA 5JVTA 3ZR8X 2F2EA 1IO6A 1HBXG 5H6QA 4QVCA 1BA1A 1NK6A 1K73U 1ETOA 3UA7A 2J5PA 3R61A 1VQ7Q 3FB9A 2XRNA 2Y0MA 3JRIA 5HY6A 4JKGA 4AI4A 4A61A 4OMQA 1BL3A 4OIQF 1W5CC 4CJWA 5LJ3e 5D8KB 5LJ3f 4Y7NJ 1UOCA 5EG0A 2F4MB 2H27A 2O5RA 2YRDA 3FMSA 1E7OA 3PO4A 4CCOA 5J1YA 3SJJA 2VJIA 2AP1A 4LK1F 4AIJA 2MWPA 1TQIA 4AH9A 4FLTA 4K41A 2YX6A 1WHLA 5AQYA 2FOKA 5BS6A 4H0YB 1YTYA 3QHSA 4IHSA 1QMCA 3ZX2A 1MGQA 2E1NA 2RV8A 2DT6A 3FIFA 2WONA 2VWJA 4CHPA 1L3VA 2RQRA 3ZSOA 4PQUA 4MIMA 1W36D 5D6XA 3NVMA 1B7TA 2W0ZA 2HDWA 2COMA 3EKSA 4UVAA 5E18F 2E2IJ 5KRSA 4AQYK 4V2SA 1S7AA 3EYIA 5I21A 3PNWC 3C7JA 5AQNA 5IT9O 3T8TA 4GY5A 1Z9QA 2BHYA 1NOYA 1MBEA 3WGHA 4XQFA 4UQGA 3F70A 3HZ6A 3CCEI 4RGXA 1K8AR 4V19S 3LALA 4A3FJ 4FJJA 1W36C 2FBIA 3TO6A 4Z94A 1C1CA 1YTUA 4ESBA 1WDXA 5CYVA 4M78D 1WFXA 1K0SA 1YCSB 5FJ8J 4FVMA 3K9JA 3TR8A 3BDPA 1QO0D 4C2MJ 1UGPB 3HSCA 5J2MA 3KP2A 1YHQQ 2HZYA 2RHXA 1LPLA 2KE9A 4LC9B 5CY4A 2OTLI 2O03A 4WCEL 4QCLA 3FLGA 2VQLA 3NH1A 1KCFA 2P5KA 3I5RA 2FF3B 3OMCA 1X4OA 3M58A 3CCLN 2IA1A 3QDFA 3EGDB 3BDDA 2DO3A 2YUPA 4H4MA 3ZT1A 4PUOA 3I56T 1XTDA 4KTWA 4M78C 1KHIA 4XRFA 1RGIA 1XC5A 1OYYA 4DTNA 3FHFA 5FROA 4MZPA 3UKGA 3ZBDA 2VODA 3GDQA 4RUGA 4CCNA 3VGMA 2V7ZA 4BB7A 1U47A 1FYLA 2A6TA 3K5LA 2ZJRF 3V81A 1M2VA 1Y56A 3WTTC 2L4AA 4Z88A 3PIOL 2O8DB 1Z0XA 2DMOA 4HCZA 3HOZJ 3HRTA 2GZWA 4I0BA 2DJIA 4IO9F 3GOXA 4ZYGA 2K7AA 1F9NA 1IN4A 5AZIA 4KTQA 3A8YA 3G4SA 1R5ID 3MCAB 3X24B 2FD5A 4ID1A 2DN0A 3OBYA 1N8RC 4PSWA 3HTSB 1HU0A 3LP2A 4AIKA 3VETA 4DR1K 2IVWA 5GAGP 4EP4A 3NHNA 4BVOA 3JCMW 3HTUA 3OYJA 4XTZA 2LYCA 5CYQA 3UKUA 4IHXA 2EYWA 2BOLA 1S1TA 4EMHA 2QXFA 3CCVT 4YORA 3KWIA 4XLCA 4R79A 2E64A 1N36K 4W97A 3M0SA 3SUPA 2X35A 1SFEA 2P1JA 4QQ6A 4BBRJ 1O57A 1NJWA 1DKGD 2GXAA 3MEAA 1SAUA 5HROA 1ETQA 2RI2A 5IOYA 1X9WA 2FC0A 4DV0K 4OMZA 3R4KA 2O9VA 3VU3C 3HKZN 3HHTB 2NS7A 2QLZA 4LDYA 5E3NA 2D4WA 1WQ7A 2YU9J 5FKNA 3HP9A 4J83A 3FIWA 5LFAA 1SG5A 4CF0A 1TT5B 1HLUA 1Q82C 3U3GA 1DTTA 2RJFA 3A02A 5DD8A 2LJ1A 4IIMA 4QSHA 1T0HA 2P9NB 4F8RA 5KAIC 3VQ7A 1QWEA 3SNNA 2HS5A 3T19A 1YRNB 1GLFO 4ELYC 4FWSA 4CHOA 5EOYA 5LJVA 4JZ3A 1E3OC 2J6OA 2OCCH 4CIFA 4FCYA 1BG3A 4NB4A 4W1UA 1LOTB 3DEUA 2KZZA 2YR2A 4AG2C 3ASKA 2Z2SB 3EQLF 2OCEA 2UXCK 3BFMA 2K7LA 2VYPA 5JMVA 4I2OA 4ABZA 1IBKK 2CW7A 2VJ5A 1N8RO 1NM7A 2ZXWH 3LAPA 5IHNA 3CC7I 2LF8A 5CQYA 1E4FT 4BREA 2X6NA 3M59A 1RT5A 4JJBA 1JJ2P 4XKBA 2CQNA 2XVCA 1JCGA 3M5AA 4FLVA 3KLFA 3EETA 1IXCA 4ENNA 3CI5A 2X1EA 3Q5FA 4PZJA 2DJZA 1SAZA 3VTIA 1D9DA 5FU7C 2BZ8A 4D8KA 4KHYA 1X3MA 1ZA2B 1MDMB 1MA9B 4CYCB 3FHGA 4ZYEA 5L3DA 2PG4A 4E9EA 4O4GA 5F64A 4IOCL 2YHXA 4BRPA 4JNEA 2AXTC 4J5YA 4AM3A 3QDKA 4J9HA 4KFCA 3BG7A 5A2QK 3M53A 4H5TA 1U49A 2J5OA 3I59A 2ZCWA 3EG1A 2HFHA 1FTZA 1YWOA 2QKBA 1YT3A 3NWTA 4FWMA 2WBMA 1N9RA 1SC7A 2GTDA 3CCQI 4Z02A 2Y1IA 3WTSC 1D8KA 4KT0E 1XQHA 3AO5A 4N4NB 2ITMA 4I09A 2ACJA 5FU6B 2ZQBA 2R5MA 1KFZA 2GWKA 1FWZA 1XMAA 2LY9A 3SYTA 2BE9B 4J9CA 2L0AA 3K4KA 1WFWA 2GCXA 4CJ5A 3U21A 1TGOA 3T8RA 1XWLA 3TWHA 2CH0A 3MEEA 1ZBFA 1J59A 1NJZA 4U0YA 2G0EA 2F48A 2LRDA 1WXUA 1OULA 4O3MA 2LR8A 4E1JA 1BK2A 5GAEP 2DAOA 2ISZA 4KUIA 4OX9K 2CZ0B 4CJKA 3AV9A 4AC0A 4HVJA 1LEBA 3A8MB 3CTAA 4CRIA 5CJ9A 5AQRA 5FPMA 4M75G 4MLHA 1DGRM 3CD6T 4FT8A 1W7PA 2ZBKA 3MMVA 5CAIA 4GRIA 3JSMA 2KLAA 2ZFWA 2FOWA 3AFHA 5GP9A 2GQQA 2JMWA 4CHYA 5LRRA 5HL7L 1FTTA 2P9UA 2E1MC 3R6OA 3OIQA 5J8CA 4M75F 4OPAA 5SWMA 1X58A 4Z89A 4OPJA 4MFBA 1RT2A 1RPWA 3KUFA 1TT0A 3IKTA 1FLIA 2XDBA 4AHUA 3O1WA 1U5TA 2KK4A 3I5SA 4N56A 3JAMZ 4E89A 4C3JJ 2CUFA 4B21A 1FOXA 2COZA 2HQHA 2ECZA 1PUFB 3VMFB 4DNCA 1LWCA 3HPGA 1D5YA 3SDGA 5JHUA 1QZZA 1SKUB 2HHXA 1IF1A 4CC2A 3C6AA 1KD1C 1T3SA 3RCOA 1F5TA 4MZTA 3KD1E 2RMOA 4OP0A 3RDIA 3LZIA 2W1OA 3DEWA 3JCMh 1NLPC 1EJ9A 1K8AU 2EGEA 4M3RA 3LQRA 3HEFA 3RMSA 2E2OA 4ESJA 2YRVA 3ZT4A 3CCUA 3CC2N 5LHHA 1X3WB 4WCGA 4CIGA 1HQCA 3QQAA 5CR4A 1S22A 1VQKN 2OZUA 2QUFA 1E4GT 4PLLA 5KYXB 4LFAK 2KAFA 4XLFA 1I5ZA 2VL8A 1NMNA 3EY1A 2E35A 1S72I 4XOTA 3E6CC 5GAMe 1VQ5N 2ZD1A 2ADUA 3TTFA 1RUNA 2JS0A 5LJ5e 1A36A 5KVRA 4GKJK 1U3EM 5LJ5f 1JJ2A 4CGGA 1CF7B 1U04A 4MDAA 5F08A 4D1QA 1RADB 4BRMA 3BC8A 1K4SA 3AVMA 1K76A 3WXMB 1R4MB 2RAEA 2EYYA 1M30A 3VEYA 1ERDA 1FN7A 3ULRB 3KIOA 1IBLK 4YTLA 4MQ3A 1QQCA 4KH0B 1UG0A 2EZKA 1R8OB 3E9OA 3WTZA 4XU1A 3AO2A 3VOEA 4M42A 1KZHA 5E79C 4PUSA 3CEYA 4XBFA 4M6VA 2VLAA 4M7XA 3CPWM 2QA4T 1T3LA 3ZQ7A 2KNBB 5FLXK 5DCMB 1H88C 3IUCA 5I2SA 4DSLA 5E3MA 3BTLA 2QENA 4HAMA 1PVSA 1UE9A 2R5YA 3K2PA 4M7AG 2CV0A 4R8HA 4GVMA 3L3VA 3CUQC 2W48A 1KD1O 3ZMSA 1VQ9Q 3SPZA 1YS7A 2DFUA 1IRGA 4LSNA 2X6YA 4HEA2 1VYUA 5E1WA 2MC3A 1K0XA 4M7AF 1VQ6N 1R4NB 4CZMA 1Q81R 4C92B 1GCQC 1YJ9Q 2D1KA 5AN4A 4ELUA 4FM2A 4ZTFA 4DFKA 4JK9A 4L18B 1H641 2LJ0A 1ZQ3P 3AAFA 3CJAA 3KWGA 4CFCA 4JX4A 1OCZH 2RO0A 4HVVA 5FD5A 1CZBA 4FW1A 2GTOA 3AARA 3DXMA 1G15A 2A05A 1B8IB 3HSFA 2NS8A 3MN7A 3SDBA 3K70D 5IYCJ 5L3FA 1K8KB 1CKBA 5HLFA 4E2FB 3QFPA 4DIQA 4G8XA 2YT6A 4XIDA 3VN5A 4EZ6A 3IH2A 4MO7A 3DMJA 1VQOI 4LE9A 5C25A 2ENMA 4WQ4C 1PP7U 5BPIA 3FZHA 3TSZA 1S8NA 2EQUA 4C0FA 3SFZA 3BR3A 2HEOA 3N5BB 4CK1A 4BROA 1FKOA 4RLQA 4CBUA 1VQ7A 4FLUA 3CP8A 2HOSA 3K70C 3LCNA 2L3DA 4L0ZB 4OIRF 5GAHP 2E41A 2FMYA 4FISA 4B4CA 3C2GA 1RDCA 3NWSA 4RTZA 3EG9A 4BEHA 1IUYA 3CQ8A 4LF5K 5D7UA 3L00A 4EA5A 1ZQ1A 1NGBA 1IKVA 3LOCA 4FOEA 2VB6A 3FFKB 4CJ3A 1TVRA 2ZM6K 3VQ5A 2JTMA 3OJSA 1X9MA 3OGDA 1JLFA 4E7IA 4GMJB 1EH8A 2XAUA 2KEAA 2NVXJ 4M7DA 3H3ZA 1LV5A 3DYAA 3KX2A 3K58A 2M4KA 4QT7A 2P9SA 5BOXA 4FJIA 3MD2A 1QW1A 1P4XA 2RF2A 3WTUC 3LNQA 4PL6A 2LF7A 1Y0MA 2O3FA 4HLXA 3J80Z 1I3QJ 4LG0B 3HOSA 1HR0K 1X19A 1MJAA 2DL7A 2QK0A 1K83J 2EINH 2KRHA 3LW5E 2M3AA 4ZYAA 1GOCA 2AQFA 5LEKA 1KIKA 1FIAA 1XOVA 3I55I 1YHQA 3SAFA 2JWTA 4M3YA 3P38A 1NG7A 2DYBA 3LH5A 1RKTA 3VSLA 2PTKA 4AU7A 3U8XA 2IJLA 4CH7A 2NOFA 2YV0X 3OSFA 1GBRA 4OOIA 2CH5A 3JXUA 2OA8A 4H0TB 1SFKA 3FBIB 4XN3A 2ITGA 2L3SA 1WHGA 3F3XA 2LY2A 3HRUA 3ER0A 1VSJA 3SYZA 3OSVA 4B1UB 6AT1B 3LANA 1HC8A 4CE9A 4L5JA 3G4SI 4CUGA 4B1YB 4C1NK 4OIPF 2H56A 1UECA 4FT4A 1ODDA 1T33A 2L2PA 4CI0C 3LWLA 4PJOG 4BRFA 3Q9SA 2IVOA 3I0RA 2M0CA 4JX6A 4J2AA 3VEPA 5KPTA 4M77G 3E66A 1EO1A 3TAMA 2KMTA 1SVOA 3CCRN 2DPPB 3MJXA 1WJ5A 1KO9A 5JI6A 4HSTA 4PJOF 3GW2A 3G1MA 1ETKA 4A2UA 4BGDA 2VXFA 1KQ2A 2UUCK 5JVHL 2BVMA 4DYRA 3RJPA 1ZBUA 1P4AA 5T7BA 1T0FC 4ELVA 2LCLA 3ZXSA 3VGKA 2ASPA 3LDSA 2K2VA 1KONA 5F0CA 3K4BA 3P8BB 5GAOp 1BQNA 2IAIA 3VRYA 2IS6A 3K4NA 3VQ4A 2EFWA 1OR7A 2G7HA 3ZMVA 5GAMh 3JCMQ 3CCMT 3EHQA 3R6NA 4CCLA 5J3BA 1TQPA 3F21A 4C92E 2R7XA 4CEQA 3C6TA 4D5FA 3RDVA 3QXEB 2D5RA 2CDTA 5FU6C 2ME0A 4M77A 4CEBA 2KYBA 1OCOH 2GIVA 1Y0UA 2RC4A 2EZLA 1YW7A 4ID5A 3MAQA 2PJRB 4E7JA 4FXDA 3EUHC 4FOIA 4YNQA 4IHWA 2AHJB 4F14A 4Z8AA 5GANj 2K40A 1O3SA 4XSXF 4LB6B 2YCHA 1GV2A 3O3FA 3FZLA 4WQ5C 1TAUA 4A3KJ 3B6AA 4RM2A 1EETA 1SVLA 4BHCA 4YPRA 4IUQA 1WSUA 4I99C 4BI4A 2WSEE 3G6EI 2HU9A 5BPDA 3ZOBA 4N47A 4M71A 2JM8A 1Y8QB 1DPRA 1KTQA 1QA6A 4BRAA 1S6LA 3BZ6A 1ZG3A 4ZGDB 4KHNA 2FL7A 1P2FA 3D0SA 2F5VA 5CKFA 1Q7YC 5AQZA 2IVNA 4II1A 4HXJA 4Y1CA 1Z25A 4ENKA 2AK5A 1U6ZA 2HKQB 3VV0A 1NE8A 4P55A 4N4HA 4FJMA 1X6OA 4NS5A 2MGQA 3L2UA 2QEXQ 2DXCA 3LM9A 4LITA 3JS6A 2L7KA 4A3MJ 1XQPA 1YJWI 3BROA 1YITI 2ESHA 2F1LA 3E9LA 5CHZA 3TAQA 1O4XA 3SMPA 1WA7A 1NK2P 4JI7K 1CXQA 2QQSA 3PT9A 3LWMA 4CZGA 1E6GA 4ESFA 4OMFB 3ZT3A 2XDPA 2PNIA 4MLOA 4V2GA 3JB9G 2DO7A 1P90A 1SRLA 3M57A 2DOFA 4A0XA 1ZGWA 1X3UA 4MNUA 5AQMA 1BKBA 5FKKA 3CCVN 2CP2A 1KG6A 4I01A 4WFAL 2ZPEB 2P8TA 1WJSA 1R0CB 2XU8A 5IPAA 4CJRA 4I6MA 3KP7A 1Z3YA 1MBGA 5M3FJ 2VT3A 4PGHA 1BB9A 5MLCQ 3LSRA 3BZCA 1KVAA 3P7NA 3OIPA 4HX7A 5B66C 1RIOH 2DTOA 4DTPA 3C2HA 1G99A 3AVKA 4IIOA 4WXCA 4B48A 3EYZA 1IJJA 2P81A 2DA9A 2EQIA 2M0YA 4FJLA 4BC4A 1IAWA 3P4IA 1TWFJ 3J8AA 4CEEA 1IV0A 2L8DA 4C8LA 4DS5A 1D1BA 4B9QA 3LSPA 1G2BA 4PJJA 5CZ2A 1Q7YO 5EGOB 2LKPA 3R0JA 4I2QA 4K42A 3ID6A 2F8SA 4PA1A 1O9SA 5KPZA 4DR5K 3MKLA 2X78A 1VQNT 4AM7A 3K4LA 3D2FB 2BZXA 3THWA 3M8RA 2WSFE 3CDHA 3CWAA 2LSNA 3P9CA 3UT1A 1J75A 1WEIA 2PMZA 1AWOA 3DWLA 2DXTA 1JGGA 1WHHA 1VQ4T 3E01A 1FBSA 4J9FA 4IKFA 3MXMA 4C92D 4RCHA 2VPRA 3DU5A 2XY7A 3QU3A 1SL1A 3BWGA 3K6GA 1S1WA 4IXCA 5J2QA 4DFPA 4G9ZA 1XNRK 3CCSI 2YRCA 3AY9A 1U2VA 1Z77A 1CZAN 3GL1A 4X9CA 3CCUI 1LE8A 4I7HA 3THVA 1WAJA 3CPWS 1SL2A 4LD6A 4H4KC 3T0YA 2D45A 2E2JJ 1WGSA 1OU9A 2CYZB 4R1HA 1B3QA 3F6OA 1RC9A 4IF4A 2ZXHA 2Q31A 4B1RA 4C92C 2JOYA 2DI3A 2JWLA 1VQLT 1XMQK 4DU4A 3NE6A 1F43A 1T44A 4KULA 1UHWA 2HSTA 3K9TA 3FXMA 2AIRB 3LL3A 1IN7A 3QMLA 1STZA 4M7YA 3GLLA 3WXIA 1MMGA 1MNMC 1RDBA 1X9JA 1WNLA 4QPOA 1H3ZA 1KYZA 4MO5A 2XGDA 1H8AC 1ZGAA 4HA8A 3H3OB 2D0BA 2YLBA 1LW2A 3R2XC 1FY7A 2JNGA 4BE1A 4H5VA 2X6OA 1IZ6A 4GDFA 4P1WA 1R9TJ 1SFUA 4M78A 3LDOA 3DLBA 4DR6K 2DA3A 3E5XA 2X4WA 2Q2RA 5DV5A 2EVRA 3H35A 4JI3K 3SHFA 2VUMJ 3SD4A 1YIJN 5CKDA 4FE4A 5A2QZ 3G71N 1H0MA 1M90U 5GMKl 1HKCA 3CJCA 2EYQA 2R92J 3FJ5A 3CD6N 4G9YA 3THXA 4XOPA 5GMKi 1P92A 2CT4A 4CD3A 2QVOA 1QQMA 1GUUA 1V4TA 5C15A 1NBEB 2JMAA 2FO0A 3BTIA 3CYMA 3RMQA 5C4JJ 2P0WA 4KFBA 4GW6A 5FLXO 4D7MA 1Z1DA 4O0JA 2RPIA 2HYGD 4GFBA 3V4GA 4LF8K 2D9TA 2GOXB 2PZ1A 1U06A 2RNJA 1YBYA 1W1WE 5GAOn 2J7IA 4NCGA 1TNTA 3ZMZA 2E2PA 1NJIC 4UUVA 3VENA 1JUSA 1U4BA 4OF1A 4MHGA 1V4SA 5HLIA 1NMDA 1VQ9A 1T6DA 1L3UA 1I0CA 3GBGA 3ZSYA 1SANA 5GTHC 5CPRB 2VGMA 4K43A 4CYDA 1ZHFA 4P9UA 3E6DA 4EM0B 4CHNA 4HUEA 1IG8A 4MZMA 2IPOB 4KN7X 1YJ9A 3N0UA 4FSVA 3VEVA 4AFSC 4Z4HA 1N6QA 2BE5F 2ECBA 2V9PA 5IT9Z 2RKIA 4MGRA 4BR4A 1B6AA 3CFRA 3SZPA 3EH2A 5KYWA 3U2RA 4I98B 4BXXJ 3RKWA 3W6KB 3IUOA 2JK3A 1G8XA 3V8JA 1KAYA 3K4MA 3P8HA 1IRXA 3J81E 4EPCA 1RT4A 2WV1A 2OTJQ 2OFIA 3K9KA 3CCLI 1Z26A 2AZVA 1WSFA 4WXHA 2R57A 2YI1A 5CVUA 4KT6A 2HKOA 2HSPA 1LVAA 4PKHA 1HJDA 4EMSA 4FX4A 2RN7A 2FZGB 3DPTA 4A3LJ 1LJ9A 3VQEA 2HPIA 4XONA 4L5EA 2GUPA 1HW2A 3NF8A 3HSRA 3JCMP 2IRFG 2QWPA 1QVPA 1HQEA 4A5BA 3M0TA 2Y4YA 1KC8U 1X9SA 2HVQA 2F69A 4OLBA 5H6RA 4U7BA 3WGIA 2M0OA 3BT9A 3CC4N 2ESWA 2MLKA 1RDUA 2PZSA 1NJIO 1Y57A 1X4PA 2X4HA 4B9TA 2QA4N 4EJOA 2FBHA 3TOBA 2JXBA 1WBDA 4JP0A 4Z0UA 2VPLA 2XAGA 3DP7A 3RR6A 5IY5H 5ILVA 3WT0A 4OB0B 1BOAA 5GAEJ 2Z99A 2EV6A 3ENOA 3OA6A 5HBMA 1UGVA 3ENHA 3WG9A 1NJYA 1BR4A 2KPMA 4XRMA 4HCCA 1PD1A 4HUGA 3DV8A 5LMNK 1XG1A 3OVNA 3SWNB 1A5VA 1F21A 3TW7A 1Q86C 3DJCA 2A40A 1WJBA 2WV0A 3GTKJ 2XD0A 5E1XA 5ECAA 2FBYA 1SPKA 2FRYA 2X3XD 3OSGA 1ABOA 4F3TA 1IN6A 2ZFUA 3J7AY 1I3AA 3K69A 2HZDA 3U1DA 5LMUK 3VOVA 3OQ5A 2A7YA 4Y0WA 3IH4A 2F5FA 5DMRA 3ZETA 1AEYA 1TL8A 3VYSB 2CP7A 2Y48A 4O5FA 1D09B 2XGCA 2KRNA 2GWRA 4XU2A 3GTGJ 2DA7A 5KYYB 3I54A 1HX1A 4DQIA 4KDPA 2NUTB 2D6FA 2A42A 5JLHA 5M9OA 3GZNB 1KU3A 2VOOA 4NNJA 5B3SH 1IB8A 1NEGA 2ZAEA 3WEEB 2YHTA 3L4QA 3FXQA 2D0NA 1FEXA 1VQPI 5M1FA 1KG4A 1T03A 3ITHA 4M75B 2XROA 2R4GA 3VGLA 1KJWA 4GV6A 4KHSA 2E10A 2QWRA 2NRXA 3VS1A 4DJAA 4BRKA 1T05A 4NOYA 3PM1A 2OUMA 2CRGA 2LK2A 2YPRA 2K5LA 3H0GJ 1YQKA 1REPC 1WLJA 3CCEN 3M55A 2LNHB 3ZSZA 3A5ZB 4RTVA 2DL3A 2LFBA 2DA6A 3PL8A 1BBZA 3P31A 3AG2H 1X1DA 2CQ7A 1AWXA 2HHQA 1UWBA 1T39A 1VQ6Q 2L01A 1KQ1A 1HNXK 1VQ8Q 2NRVA 1Q86O 4IEIA 2P9LB 3O08A 1S9EA 2R7FA 1AOYA 4HKEA 5M1KA 1O1WA 2OTLN 4EEFG 3NPFA 4DZJA 4A5AA 2FF6A 4J2DA 1ASWA 1YE9A 4B9XA 1FK9A 3QJ6A 4BRIA 2OJ2A 3CMEQ 3ZSXA 2ESNA 3RR8A 1QVGP 4CGIA 3QWLA 3C95A 3RSEA 1GLCG 1JU5C 2P9PA 2DJQA 1RTHA 1SEMA 2RHIA 1JJ8C 3OYLA 2Y1JA 1JL1A 2QWOA 1R36A 1OMIA 4YELA 4JV5K 3U4LA 3M0PA 1T6CA 3CJ7A 1PSEA 4JX5A 4S05A 2D0AA 3OR2C 3PIOF 3A8HB 5LGUA 3BG3A 2EFQA 2CZ7B 2BGGA 3L2CA 4F92B 1Q81C 1R58A 2XPUA 1OH7A 2ZNZA 4CZEA 2UUZA 4FM4B 2W6LA 1GFDA 4IHVA 2JQ7A 1NOZA 3WHCA 3LA7A 2JUFA 4OMOA 1JHFA 1QHTA 2EPDA 3QUIA 2V1NA 3RR7A 1TWBA 3O2PE 3ULDA 2EK5A 3LL7A 1ZC6A 2MG4A 2ZB9A 4ITVA 4LFCK 2XG8D 1NK4A 4B1XB 3M1EA 4JHDA 3M8FA 2YSQA 5I9EB 4JD2A 4DR3K 3HK2A 3CF5L 4LH5A 4RW4A 3N05A 1KAZA 2Z1GA 1RETA 2FUG2 3H45C 2YX4A 2O0YA 2WOMA 3NEUA 1VYVA 4JRPA 4JK7A 3OW2M 4A59A 4BY6B 4BWMA 2E1HA 2KKZA 2YNHA 1TTYA 2OV7A 2HHWA 4PNOA 2STWA 1N25A 1ULYA 1OI1A 1K1ZA 3CXCP 4JI6K 4UY8O 3Q1JA 3HUGB 2L02A 3CUQA 1EIFA 3VS5A 3AVLA 1HK9A 2QEXA 3MX5A 1LFPA 2DQRA 1S5LC 3GO5A 4CFDA 1O3TA 5F0HA 2CGHA 3X28B 3OS2A 4M7AB 2Y75A 1UDLA 3GVAA 2QKMB 1YS6A 3VYRB 4IZ9A 2HTSA 2X85A 1XB4A 3D1NI 3HM8A 1ON2A 1JHHA 1MGTA 3DXJF 3T3FA 1VQMI 4HCBA 5JLWA 4N5SA 4RLFA 3CJQB 3CW7A 1X6BA 3J81O 2NUPB 3MEUA 2I5WA 2MW8A 5E26A 3CC2I 3SBGA 5CQEA 4BQAA 1N6AA 4IBNA 1ZBHA 2QWWA 2V7FA 2OD5A 1XDUA 4QVZA 1Q81O 1VQKI 4CEDA 4MO4A 1NGIA 4XTWA 4AHCA 1G3TA 1ZXOA 2K9NA 3DLHA 3GMEA 1C0UA 4F3OA 3QNOA 4CJ7A 1VQ5I 3DLMA 2ROTA 2DL8A 1ZLKA 3JCMg 2LZ6B 2VE9A 3Q9VA 5D4RA 4BYYA 3CC7N 3BF1A 5E8IA 5BR8K 1UJ0A 2FMLA 3NH0A 3CWTA 3ZSQA 2MI6A 1H9TA 4HQEA 3OYMA 4HT9A 4LN2A 4HDUA 2YNIA 2ELJA 2RHZA 4LD9K 4IOCF 2XSJC 4ELTA 3CF2A 1ZHIA 3X26B 5BPMA 4UUSA 2Q2EA 2YNFA 3E6MA 4RGUA 3TU4K 3VPZA 4D9JA 3CCRQ 2CFOA 2O8DA 1UAXA 4B44A 4L6V5 4IUUA 2D0PA 4HYEA 3DU6A 2W04A 1QVGA 1BR2A 4I0AA 3CCJQ 4M75E 2GOMA 2RHUA 4RAYA 1TC3C 3MMYB 5FW9A 3PNVA 4Y28E 3CCQN 2UWMA 4A4GA 2HBPA 3JCMc 3AT1B 4F7UG 3IHUA 4B9SA 2MC4A 1UJ8A 2CW0F 2X0LA 3URGA 4N9IA 1WSGA 2FEZA 3VEZA 3ABTA 3DLEA 4L9VA 4ILGB 4JKCA 5HRRA 2YU3A 4F7UF 3TEEA 1ABQA 3MEWA 3QG1A 3FEOA 3NFCA 4NQWB 4EMGA 1HA8A 2ED0A 3TL4X 3VS4A 4CA0A 3O6WA 1GOAA 3V7SA 3A01B 3M9QA 1NG6A 3S3MA 2FJ1A 3L2RA 3JSPA 1JI8A 2CP5A 2BY1A 2A5XA 2DAQA 4OPHA 1KA8A 5IP9J 2FF4A 1PUEE 4XORA 3FM5A 1WJFA 4BJ6C 1VQLQ 5ICFA 1H89C 3LAJA 2UZKA 3I4NJ 2GAUA 3B6OA 4Y17A 4ELZC 4LF7K 3H41A 1YJNQ 2KHMA 1UB4A 4FLWA 1KQ9A 2P9NA 3CXCA 1OCTC 4DCHA 1LVKA 2HQNA 2R0QC 2NNNA 1EF4A 3VYTB 3PIPL 3TBIA 4ZYHA 2F7TA 2FB7A 4BRQA 5BRDA 2F96A 4C2UA 2V6CA 3F8CA 2M8GX 3JW4A 4DBRA 2DTIA 2KTQA 1ESVA 3KK3A 4CCJA 1YQAA 3OYGA 2E4LA 3CIPA 2FSWA 1VQNN 5J6XA 2FU4A 3SJMA 3LMMA 4CEAA 1MV3A 1ATSA 3LGLA 3SFMA 1G4DA 4B9UA 2BEOA 4NL2A 2EJRA 1PRMC 2H8RA 4XH1A 4NL3A 5AQTA 2Y0SA 2M8EA 1O3QA 4LDUA 1BI3A 2HCKA 2DL5A 1ZN2A 1VQ4N 1J5EK 3EUAA 2CUZA 4E9FA 4U87A 1VQ7T 3T1AA 1T0FA 1MDMA 4GGGA 2E4HA 4WFBL 1AKHA 4CYCA 4XN0A 3FWEA 3SV3A 3MDQA 1W5TA 2TRTA 1PM3A 3TQNA 1JKPC 1MSFC 1S72N 4IJNA 4RB3C 2D5VA 1Z3XA 3FXUA 2CGJA 3LSMA 4M7AE 2M7AA 4KH4A 3SWNC 2IBDA 3VQ9A 2MD0A 2DFHA 4HF0A 5HS7A 4J8OA 3NBPA 2CS7A 1Y1VJ 3IRXA 3NH2A 1GLEG 2CG4A 2COWA 2L3RA 2XF6A 4QTRA 3DLGA 2I10A 2A68F 5JLXA 1ATRA 4OMMA 1D3BB 1HUXA 3OYIA 2FEIA 3B6PA 1JEGA 3ELKA 1M5Q1 4BC3A 1EZZB 3EUHA 1Y97A 4RAGA 1HDPA 3L1PA 4QIWN 5ED4A 4IRHA 1Z7LA 1PYVA 2K86A 2K5FA 4GV9A 2HEQA 5FPEA 3EE9A 4WQ5A 4M75D 2WFBA 1JLGA 1QNTA 3VEWA 2OTJA 4CZHA 2MABA 2E70A 4JKBA 4KI6A 4Q5VA 1U84A 2V1UA 4DG1A 2VWBA 4XTVA 2KBTA 4XRSG 3NGZA 2QM3A 3KK2A 1RAFB 2HL3A 1SD5A 3TO9A 2GQVA 4KRTA 3RKYA 4QS9A 4M9SA 2V26A 3E5QA 3GTPJ 2H3EB 1MJBA 2CUDA 3F2KA 1VRLA 4QPQA 3I71A 4DTUA 3MQ0A 1RI7A 4M75C 2KKOA 1ZG1A 3SQ0A 4C2TA 1YHQT 4LFUA 3LZJA 1DJ7B 4OMLA 4NHJA 2FYKA 1ETWA 2CUJA 4C23A 1JXOA 2LBFB 1OYIA 3TU5A 5AQUA 3KFWX 2X6XA 4C1NI 1E3MA 3HHHA 3T5XA 5K5RA 1YI2Q 4MFDA 2RQPA 4DSEA 2BV6A 1QKWA 3MN5A 4G7OF 3CWUA 2GNCA 3A1PA 5LJ3d 1Z05A 1USSA 4OJRA 3E7LA 4J9EA 4RTFD 3PO2J 3I5UA 2HL5C 2IS4A 3RWUA 2C6YA 3HZJA 2HVHA 4KMFA 3IAM2 4LG3A 2KRCA 2QQBA 2QKLB 4ISEA 3OYDA 4ZYDA 3QYGB 3IP4B 4FW2A 4IFYA 2EBPA 1XJWB 4KH1B 3CO6C 1GLJO 5KYXA 1TWCJ 4ZDLA 1XGMA 1NNEA 2DRMA 2WA0A 3CERA 1YIJQ 4DQPA 1VHXA 1TXQA 4JI5K 1J53A 1CF7A 4M9XA 3EZ5A 2H3GX 1R1UA 2DLPA 1FNNA 1F1ZA 1W2BP 2LOOA 2K3YA 1TKZA 2L4MA 4M4ZA 4CGFA 2R7UA 3I56I 2HF3A 3HVTA 1LFBA 5C3EJ 1J0RA 2HKNA 1HKQA 4RM3A 2DPDA 2QWNA 3TP0A 4C92G 4CHUA 4JI8K 3KYCB 1QSSA 4M3GA 1QP2A 2DM1A 2XKOC 4BKXA 4PL7A 4KPYA 4KH5A 2M1BA 3D5LA 1QZEA 3DBRB 4M7AD 2G3RA 3RMAA 2G8WA 1K9AA 3HSEA 4YOYA 2LLKA 1C0GA 1M27C 1NK7A 2DX1A 5DCMA 2EIFA 4BY6C 2ZPHB 2DTRA 2BY0A 1PRLC 3EFSA 2K9LA 2BIVA 1DT9A 1R71A 1NYFA 3C4SA 5M1OA 4L5GA 4PL8A 4DV1K 5HODA 2DODA 3S1NJ 5JICA 3I4MJ 1JLBA 4PJOE 5GMKm 1VQ6A 1TUGB 4RDUA 4IHTA 1I1SA 1UHSA 2PU9B 1QVFP 3LSJA 3JAMK 4Z6YA 1WXTA 2K9SA 4M7AC 1VQ8A 3IRQA 4FWKA 4KIFA 2VBYA 2RQUA 1Q1HA 3T1YK 3OW2S 5KE3A 4FLYA 1U2WA 4G12A 3VEOA 3QNNA 2LNVA 1K73R 4C92A 3V1OA 1I4K1 4E3SA 4J01A 4II3A 1A04A 2FSNA 3CM6A 3CCVI 1YX3A 5GAMj 4M3ZA 3CMEA 1R00A 3MXJA 3I53A 1U8RA 3M4OJ 1NGAA 3FXRA 1EWQA 2Y2ZA 4EJUA 4E7SA 3BF3A 4ZN1A 3T1BA 3PY8A 3REOA 5F0XA 2K4JA 3F9KA 1IBMK 1B8IA 2GBYA 3PX6A 4H4OA 3G4SN 5AQVA 5H2FC 3QWYA 5ADXH 3ASMA 1IGNA 4M9ZA 4Y15A 4FX0A 2QXLA 4B8XA 2MSYA 3CJBA 3CJTB 3BW1A 5IT3A 2JTVA 1UG2A 4F4KA 3M8QA 2F5KA 3A4CA 5KCHA 1JKHA 1DGWY 5EEAA 2P9IB 4BGAA 1I94K 3TMOA 3CMAT 3A0IX 3S41A 5LL6S 2K3FA 1FP1D 3G25A 1FMWA 1WJEA 3NARA 4LF9K 4BR0A 2XC7A 4KREA 3QFUA 1BIBA 4JLHA 3LDNA 2LKXA 1GHCA 2AS5F 1HKTA 5C0YA 1VSLA 3BTCA 2QEXI 3EDPA 3HP6A 2NVQJ 2XDDA 3ZYYX 2EJFA 4DS4A 2KHOA 5C44J 2EGCA 4MFEA 2PVGB 2DA4A 1C1BA 4RWTA 5CKEA 3DFGA 2COBA 3WU2C 2OANA 1KQSM 2A0FB 3HFOA 3CVTA 2C0TA 4KO0A 3ZQQA 2J4RA 3B02A 2DF6A 3K2AA 2IS3A 4HSRA 3P8DA 1ENHA 4RW8A 4QS7A 3K10A 4CJSA 3KKSA 2JN0A 1IREB 3RI4A 2H09A 2MF2A 3UKRB 3FDYA 1D9FA 4ZZDA 2F4IA 2BY3A 1DDNA 1ZBSA 5GINA 3AAQA 3JTGA 2ROLA 1I27A 4A5MA 4LH4A 2EZIA 5AJ3K 1NU0A 3W3CA 4KV8A 1HSQA 1VRUA 4YDUC 3MHXA 5IWAK 2Y9ZA 1QPIA 2XKPA 3LWHA 3GF2A 3KEQA 4PKCC 3G6EN 1Y96B 1TWGJ 4LG0A 2PLYA 1NG2A 1A31A 4I2PA 5EYRA 2ZCFB 2I8DA 5GAOq 4BG8A 5C6SA 3H3UA 2DEQA 3VQ8A 2NOHA 4NXNK 4CC7A 5BNGA 4EDUA 1I1GA 4V19K 2GUIA 3FKIJ 4LD5A 4JI2K 3V42A 3K0LA 2A6EF 1P7IA 1T95A 1DU6A 1IHVA 4A69C 2R93J 1GL5A 2BYVE 2RNAA 2GTJA 3NGIA 3D5SC 4LF6K 3EYYA 4YG2F 1HRHA 4Z2YA 3X25B 3FZKA 4M6XA 3RZDJ 4FPBA 3DLLA 3UB5A 5D6FA 5CE3A 4PJOD 1YJWN 2H6CA 1YITN 1BM9A 1QVFA 3CCEQ 1MD0A 3JRAA 1J6ZA 1JLAA 3C1DA 3CD6I 2EZHA 1OKJA 2KVQG 1RRQA 3GEZA 3ATUA 4IRIA 1QSYA 5FRMA 5GAN2 4RMNA 4KHQA 3RPQA 4FJGA 2MH2A 3NF6A 2HNHA 4UB8C 3FMQA 1JRIA 3MP8A 4BS9A 2FRHA 3CCRA 4E6RA 1M1KC 1HYZA 3JTHA 1XMKA 1SF9A 1I5OB 5KI6A 1W6XA 2NYSA 3QYBA 3CCJA 1TUCA 1R5HA 5BN8A 5C12A 2VVKA 5F0FA 4PJOC 2E6NA 3LSKA 3T1HK 3RKXA 1W4MA 3RQIA 1FOYA 3VQDA 3GE1A 5K7FA 3VQQA 1XG7A 3T9NA 3E9FA 1W7PB 3L2ZA 1ITYA 3CP2A 1X1PA 3HSTB 4B3TK 2A69F 3A5MC 1HPZA 1Y07A 2M7BA 3H5AA 3OYFA 4C0DC 2LD5A 4ILHA 2GFUA 4PJLA 2XASA 4FLXA 1NGHA 4JZ4A 3RMDA 1KU7A 1IKWA 3SUQA 5AQLA 2KYMA 4JYKA 3JCUC 4FETA 2G8KA 1BYMA 1LWYA 1TV6A 3HRGA 2L9SA 3J80K 2PJRA 3TDUC 4ENJA 2D1HA 5C10A 2FBKA 5K7HA 3VA0A 1V54H 1VQ9T 2O8FA 3ZMDA 1ACMB 2GLOA 5IP7J 3LP3A 4IPAA 1HCRA 1VQLA 1EH7A 3K1PA 1TUDA 2ZGZA 4HV6A 4BXUA 2P5GA 3QPHA 1TUUA 3NMUA 1YJNA 4G7ZF 4TSXA 3RRHA 3ZX0A 1B9NA 3VW4A 2Y69H 1YJ9T 3MEGA 2Z5UA 3NDKA 3PV8A 3QO3A 2KDZA 2OA4A 1NK8A 5AQKA 3CCSN 2YS9A 2UUAK 2NVYJ 1M1KO 4HW0A 3O8HA 3I33A 2O7OA 4OFHA 2QM1A 3CCUN 3QPTA 3VQCA 1GRIA 4CF8A 3S1MJ 1NHAA 3QSUA 4LDXA 1BOTO 4OKKA 2DA1A 3KPHA 1KSWA 1HDDC 2RQVA 1GLNA 3DOLA 2QA4I 2ASMA 2RK1A 5FPDA 1TL3A 1QS4A 2DL4A 1ORPA 4XM3A 5GAMd 1USTA 4DQ8A 5LJ5d 5J39A 5EG2A 1T38A 3G73A 4HT8A 4LFBK 1SQKA 4MLEA 1K78B 5BRFA 4J9IA 3M1CA 4J7IA 4M3TA 2X9DA 5K5QA 3TQ7P 3QP5A 1QCNA 2CUEA 4LK0F 2DU9A 3QU6A 3AO3A 4AILC 2EKOA 4BQOA 3LSHA 1ZUUA 3A5NC 1TKTA 4Z4CA 4B22A 2HF4A 2YJFA 4HF2A 3OYCA 1JXSA 2JPSA 5CVJA 3GX4X 1MH4A 3CHWA 1BU1A 5KHDA 2X4XA 4XH5A 4KYWA 3MVPA 2NRHA 2JT4A 4LLGF 2RI3A 1S7OA 1QPMA 2W25A 4RB1A 2HBMA 1KG2A 2EW3A 4KB1A 4JI1K 3HSBA 2BDPA 1BCMA 3A03A 3H0FA 4YIRX 3BQYA 4FYWB 3CC7Q 3LM2A 2YUSA 1XNIA 3EHRA 4FWLA 2XIDA 2E6LA 3GG4A 1DU0A 3MEXA 4QVDA 5M5XJ 2LQKA 2DPNA 2QTVA 4HLYA 1WH7A 2V1DA 4QQGA 3LDPA 5DYMA 3VYHB 2HVRA 2YXYA 1WEGA 3QJYA 3BDUA 1VK0A 2Q3SA 4CZJA 3X2QH 1R49A 2RHKA 5EGOA 3N97A 3QBWA 1B92A 4OAZA 2KDSA 3SQ1A 4AHRA 1IRFA 2MPXC 3WODF 2VKEA 2JJ9A 1BW5A 4IX7A 3TO7A 4YOUA 3KCCA 2Y4XA 2BVLA 3CCQQ 1X2QA 4JRKA 4BACA 3GTQJ 4UUTA 4PFOA 3MPUB 1XNQK 3VUBA 1MKMA 3CLOA 3CQZJ 2R7TA 3DB3A 2F5EA 2Q1ZB 3IH3A 4FZZA 4CF2A 2JWKA 3QRFF 1JGSA 5DPKA 3IQLA 1VSKA 5C2FA 5IN1A 2FX0A 4ICLA 1ZRDA 3O5BA 4F17A 3F23A 1B9DA 3M8EA 1V5FA 5HS9A 1M3QA 4L0YB 2CSOA 2HNYA 2VXDA 1ZK8A 4RCCA 3TAPA 4M3FA 1YI2A 1VQ7N 4B6MA 5KK1A 2DA2A 5ICEA 5IYBJ 4BQQA 2EQRA 3EG9B 3CZ6A 2V75A 4R55A 3IKMA 1WKMA 1ITGA 1KVBA 1OV3A 5KN8A 1TW2A 3LPUA 3VS2A 2OQGA 4A53A 5ICGA 4KISA 2XICA 3DQVC 1VAZA 5AQPA 3OYEA 5BMZA 1ATNA 3ZEHA 1DIZA 2LNBA 5DK5A 4AD9A 2PVDB 4A54A 1KFSA 4FJNA 5DDGA 4FO0A 5HP1A 1FSEA 5JR3A 4EW4A 1JTYA 1EQYA 4M3UA 1YIJA 4UNOA 1HSJA 3KYDB 3DKXA 1K4TA 3BUZB 1DP3A 2A3ZA 1XD7A 4CGZA 3ZRGA 3ZCMA 2B4JA 2W42A 1G3WA 2MAMA 5GAN6 3C0CA 1U6GA 4HSBA 2Z1HA 5LL6Z 3TARA 3QBXA 1NLVA 1QSLA 1BWFO 2M0MA 4BBSJ 4MTEA 3N4QA 4FASD 2P0QA 2NS0A 2RH2A 4LLLA 4A3GJ 3QIIA 4DV6K 4C0GA 3WTXC 2LKSA 1OH6A 1JXMA 1MNDA 2VC8A 5GIPA 5HDNA 4XTXA 3HJEA 4M74A 2RA2A 1VSDA 1RBVA 3HC7A 1EBMA 1SKSA 3BOQA 4G1QA 2MA3A 1W1FA 4OB2B 3IKVA 4AVZA 1I8FA 1TUYA 8AT1B 2PUOB 4CZIA 2KXCA 1S72Q 3KVGA 1B4AA 2BE7D 5EZGA 2W40A 2QTXA 2KT8A 1VI0A 3V9SA 4AYBA 3PNYA 2YLCA 1N8RR 3IG1A 4C8QF 2DOAA 4F7UB 4B8AB 5C0MA 5GANf 3MCPA 1BBYA 3QOEA 1ZELA 4FWOA 1ILYA 1HQUA 2VOPA 3RTVA 1SMTA 4B9MA 2EQKA 4JDSA 1KQSS 1KU2A 4IOXA 2F2WA 3MCZA 1YNZA 1QE1A 5IHKA 2UXNA 5J4VA 2HNDA 4DTOA 4UC4A 2FA5A 1TU0B 2IGKA 2VG5A 4G6TB 3S16J 1RUWA 2EJGA 4DTSA 3MKDA 5E20A 3CCMI 2QEXT 5AQOA 4DSKA 1RRJA 2QWQA 4TVRA 1WVRA 4E4HA 1VQPN 3J81Z 1QRYA 1M9SA 1VSFA 2PYLA 3ZSWA 2NVTJ 2B9SA 2IVPA 2WSCE 3ASOH 2D8JA 3WXJA 4M6YA 1HKSA 3OMYA 2DDBA 1FBUA 4OVAA 3H9GA 4YOWA 1Q82R 1E6HA 4NYFA 1J09A 2NOZA 2P4RA 3I0TA 2HBKA 4M45A 1G6NA 4S0HB 1NLOC 4MDXA 1VZ0A 3FC3A 3GTLJ 3H1QA 3O8GA 2CGKA 5ELZA 1IKYA 4FYDA 3E5UA 4HQMA 4N4IA 4HZFA 3E97A 1C6VX 4L9NA 4YPHA 3M7GA 3M1FA 4JKDA 3QICA 1WIEA 2NWMA 3BCAA 2A6AA 2DYIA 3CMAQ 5KRTA 5AONA 2CW8A 3ZP5A 3BY6A 3HGGA 1SD4A 1Y6IA 4MQ9F 3E2UA 2V1RA 2CQXA 5H1SQ 1JO8A 3K2ZA 2OPRA 1RTIA 3SV4A 3BZKA 1AZEA 5FFXA 4BY1J 4KICA 4UVCA 4XAXB 4BQNA 2R5ZA 4XKVA 1KU9A 3R0AA 3Q0UA 1VQOQ 1SS6A 1UFFA 2OZ6A 5FD6A 5LJ3h 1UA1A 5E17F 2E5KA 3ISPA 2EYXA 5DM7L 2F5CA 3QETA 3EL2A 4NC8A 4QS8A 4A2BA 4GCVA 1J2XA 1I1JA 3LDQA 3SWNA 1K9MC 4PGGA 2VXEA 2H3JA 5AT1B 1LJOA 2RKHA 4OO1J 3U23A 1FPQA 1XUPO 3R6SA 3OYAA 4F55A 5FPNA 3CF5F 3TI0A 5HOOA 3H1CA 3ZEUA 1YFHA 1TOVA 3MZHA 1P9QC 4MDWA 5IT9K 5J2NA 2MD5A 4ZZLA 2C0OA 2H1LA 2H8HA 2HDAA 3PQJA 5KYYA 2K3XA 3B73A 2F4OB 4EW0A 3B8AX 2EAYA 1GFCA 1KGSA 3GWZA 3VQBA 2NUTA 2QASA 5KYUA 5KAFC 2DK3A 4KIGA 3VFZA 2DNUA 1YCYA 1G3YA 1PJRA 1RI0A 2IA0A 3PVLA 4J8FA 5IXBA 2M34A 4EMKB 5J8FA 2L9RA 3SMSA 4DV5K 1RABB 1PU6A 1TYQB 3FRNA 3O9QA 1KEAA 4M75A 2VBZA 2DK5A 1WHJA 3CCEA 2QYZA 5E3LA 1VQNI 1HLVA 3SQ2A 2R7RA 3TAFA 5FB2A 2BTTA 2IT0A 2XGXA 1LMZA 2YX7A 4I6ZA 3RMCA 1VQMN 2KIUA 1N32K 1BUPA 1ASUA 1W4SA 1WI9A 3M8JA 4O55A 4IEJA 4IUPA 1XMOK 1VQ4I 3OA9A 1GXPA 3I55Q 2P9KB 1WJAA 3LSTA 2Q0UA 3QKJA 4KBMB 1OZ3A 1E2XA 4FIBA 1K9MO 2E2HJ 3HPOA 4FK4A 3HI0A 4CJLA 1BIUA 2P9LA 3NHGA 1IV6A 3DCFA 4VUBA 1RTJA 4IFEA 5K1YA 1WCMJ 2STTA 4BQLA 2WADA 3THWB 4EJWA 4M41A 1IXRC 1Q8IA 3G1JA 5F04A 2JMCA 4BDPA 4O5BA 4F7UE 3GNFB 4N9HA 3TPQA 2WAQA 1TWAJ 1BR1A 1XDSA 3FXKA 2YG8A 5F6FA 3QODA 3OMGA 3R3LA 1J5YA 2AA4A 2G9WA 2PMZN 1VQLI 2HAXA 5GAN3 2XMFA 4XTUA 3QEPA 1OLTA 1F1BB 3QO9A 4WX9A 3WE3A 2CSQA 4YIFA 2KZGA 2ELKA 4EA4A 2MYSA 3NTKA 4NCBA 3BPVA 3MEDA 2HHUA 1U2VB 3CJ9A 3BJOA 2D0OA 2HXIA 4H5WA 1LE8B 2HOTA 4DHYA 1K73C 1D3YA 3H0IA 5CQXA 2VASA 2HNIA 1NGDA 1JLEA 4M3BA 1TTHB 2VT2A 3ID8A 4NLBA 3GCMA 4X34A 3PMTA 4YFKF 3BDLA 3KK7A 2YUNA 3Q0WA 4XTYA 3FJPA 1ZBLA 3I3LA 2CSIA 2XKOA 2JUGA 2K4YA 3AA4A 4QQDA 4Z4EA 1RAGB 1M1EB 1ZRCA 2FQ3A 2JA8J 4OINF 3J7YP 2CFXA 2RJDA 4OVLA 2E1CA 3HT3A 3S9HA 5HK3A 2VN2A 1RT1A 4F16A 2AHQA 4ZDPA 3J7AF 1FOWA 2V9KA 2OTJT 2VYTA 3TGNA 3MKZA 3NVKA 2O8KA 3LH0A 4K8ZA 4DSFA 3TKYA 2DW4A 3AL0B 1JUPA 1ZH5A 4A93J 3M8SA 1NKCA 3I35A 3FM3A 2X6SA 1UHFA 5D5WB 5IP6A 9ANTA 3D0PA 2OAUA 2F4VK 3RTRA 4M7AA 3QEXA 4MEYF 4PCQA 1YF5L 1X1AA 2WTEA 4UB6C 1PHTA 5HK0A 2KJBA 4YOQA 5A2QE 2W41A 1N8RU 5CVVA 4R0KA 1PU8A 3G6EQ 3G0ZA 1YWPA 3SHWA 1R23A 2ICWG 3TW6A 3UNGC 3GXOA 3PIPF 2L3PA 4H5RA 1Z6TA 4JUVA 3NQOA 3KP6A 3QYEA 3RIRA 1K73O 1K6YA 3UR3C 2FG0A 2QDYB 3MEVA 2M4GA 2E7WA 1S6QA 2CZ6B 2BH1A 4PFPA 3DKMA 3ERED 2ZXJA 3CC7A 4KT5C 2PBIA 2NRRA 1JKOC 4C8NA 3H36A 2QF7A 3RSNA 1LCKA 1YJWQ 5DUIA 2Z33A 3F8NA 3OY9A 1YITQ 4HX8A 1MNEA 4DFMA 1WX6A 4CECA 1S6PA 2VKNA 4P5OA 3V8LA 3A2FA 3FR0A 2QYOA 1Q82U 3HIFA 4H0PA 1KQ8A 1JJ2M 4OLAA 4M3EA 3KK1A 2JSPA 2Q1NA 1B9FA 2K6DA 4H0XB 2KIMA 4RA2A 1QZYA 3IFRA 3KFVA 5KYWB 1V29B 3DXKA 3LA3A 5M1QA 4KB0A 3RERA 4DMNA 4OFAA 1ZYRF 3U9DA 5FRNA 3K5MA 4CJTA 3DBHB 4UNFA 1TK8A 3DLRA 2IAJA 2GIZA 3HM9A 5L3CA 3CCQA 2XB5A 4ETSA 2NYXA 2XB0X 4HVWA 4EIKA 3OYYA 3SXYA 4DV4K 1SSHA 2KJCA 1UAAA 2PX9A 3I9V2 2RJEA 2Y31A 2IIMA 1UCRA 5TKWA 4CJFA 3CDIA 3ASNH 2RF0A 3F6VA 3GZ6A 3I8BA 3I64A 4YIIA 4CO8A 5DM6L 2R7QA 5E8GA 3DLAA 1RAHB 2XY8A 4DTMA 1IV8A 4C9YA 4LY7A 2E8AA 2JA5J 3JR9A 3WVDB 4E70A 2NOIA 5ERIA 4D8DA 2OFKA 2RD1A 4JJNK 1G83A 2NVUB 1T0JA 8ATCB 4BJTA 2AZSA 3C2BA 2AO9A 1TP4A 2DT7B 4J6XA 2CREA 3G1LA 2KL4A 4YOXA 4S04A 3RRGA 4EAHD 1DQUA 1YX5A 2W4SA 4YDUA 1H1VA 5D4SA 1JT0A 2ME6A 1SEUA 2NXNB 4G6DA 2E5LK 2CV1A 2K3PA 1M90R 4CC3A 4L3QA 3J7ZI 2E65A 3HYFA 5J4YA 3AVCA 2JT1A 4B9LA 3MKYB 1SVMA 5FU7B 1EFNA 3BQZA 2K85A 1YOVB 5GANg 1VQ6T 4BRLA 4AFUC 1S29A 2HXOA 2F2XA 1WHKA 4AM6A 3REBB 1VQ8T 1QZ5A 2DEUA 1IDYA 1S5JA 4FJ5A 2EWNA 3KLEA 1RNHA 5BRHA 4RTYA 5J47A 3K5OA 3CCSQ 2V1XA 1OH5A 4NC7A 3FZFA 4M3XA 2XK0A 3JRZA 2O4XA 2EX3A 4C5HA 3VDXA 3KYLA 3CMET 3CJ1A 4B9VA 3G0QA 2LQ8A 4HDVA 3CFPA 4XQ3A 2B86A 3BCBA 1JCEA 3LP0A 5FO5A 2M30A 3F9MA 2RQQA 3VB2A 2GV9A 4OGEA 2MIOA 2LSOA 1OVQA 5KNLA 4DV7K 2F6CA 3CBOA 5FLXE 2PY5A 2NLUA 3L42A 3WG7H 4AHVA 4A3JJ 3O8MA 3A5LC 3JSOA 2XV4S 1ZBXA 3VRZA 1ZBIA 5CK9A 3FXJA 4J19A 1WSHA 1LAVA 2OZSA 2LMDA 3R6MA 4PJOA 3D4VA 5C2DA 3S6IA 5LJ5h 3KHYA 1B59A 3PSFA 1EA3A 2X3WD 1U8BA 4HRIA 4IOAL 3P39A 1ZA1B 2ZJQL 1S72A 1LAWA 4H5NA 2L7FP 4XNFA 2L2OA 2WY7Q 2CP6A 1P7JA 3A1YA 4NB5A 2RN8A 2QWMA 4JKFA 3EGXB 3F72A 1X2KA 1QQNA 1DPUA 1KD1U 1XQOA 4ESRA 1BA0A 2PMHA 5I22A 2I0NA 3H46O 1YIOA 4FWNA 5FDLA 4W5NA 4DTXA 3I56N 4I9QA 5M1NA 1D3BA 2DMUA 1VNDA 2UV1A 1O3RA 4O0IA 1KC8R 2RGVA 2XUBA 1V76A 2D0QB 4C5EA 1ZREA 1IJWC 4QAGA 1YFNA 1OYWA 5F27A 3TANA 2H1KA 4EVVA 1CGPA 4MDBA 4ON0A 1P59A 2E1YA 3HXLA 3W0LA 3THYB 2KSSA 4CFBA 4IDKA 4B9NA 2E7XA 1ZX6A 3MP6A 2XRIA 3ATVA 3U9GA 1MUNA 1TSFA 1WSIA 1LWFA 5CR2A 2OU2A 3VTHA 3MZ8A 2AXLA 3RSEB 2MOXA 3QYFA 4A0ZA 4K11A 3C6UA 2P9PB 3C6HA 3DPLC 3L2VA 4AHTA 4PKGA 2KLOA 1L3LA 4EMKC 2R7DA 5HLHA 1IG7A 1QCFA 5AFUH 1KQ0A 4GNIA 2JGUA 1UZCA 2E3HA 3SEMA 2RI5A 1RT6A 1HPMA 2P0PA 2BXZA 1XCVA 2VGNA 4FJHA 3L2QA 1ZRFA 4FYVB 4LD0A 1D0ZA 2CWEA 4L59A 2WUSA 4UHTA 3CMAA 4IRGA 5A2QO 2LT4A 1Q9YA 1NZ9A 3SUNA 2KMUA 2AT1B 2DBMA 4O8KA 2EFOA 4CZKA 3KEYA 3NAUA 1TH7A 4N0BA 1R5GA 4FU6A 2QBYA 5HDGA 2LBFA 3NAEA 4BR5A 4LMYA 4DU3A 2ZPFB 4JKEA 3CCLQ 2CYYA 5E1ZB 4IG3A 2FPEA 2E2NA 4WFNL 2NOBA 4DKWA 1GLDG 4JHDB 4JD2B 1SAXA 3OJUA 1VQOA 1WI3A 2ZJ2A 1WOQA 5I2MA 1K8AC 3HDDA 3DEEA 2CUBA 2QDLA 1JCFA 3EH1A 3FISA 5TRDA 2K5CA 3QWXX 3CCRT 2PI0A 3PVQA 2VIXA 1FOKA 3HPHA 2OPPA 3W6VA 3ERMA 3CCJT 3PTAA 4HTLA 2O8EA 4BRDA 2XHCA 4YRVA 3CUQB 1M3AA 3OYKA 2WWYA 2ZPIB 2KT1A 1QQIA 3JSCA 4Z4IA 3N4MA 4YOTA 1SKWA 2UYTA 4JK1X 2KIFA 3MKWB 2YWWA 3QIOA 1LEAA 3ZQCA 3ABUA 5F1XA 3RUXA 1LDJA 3DTEA 2JLEA 4TV7A 2QEXN 1WPYA 3HKSA 3S15J 2GELA 5LGNA 5KCMA 5M5WJ 1O7FA 2P5VA 1VSHA 2CO5A 2KT0A 2BY2A 3E6BA 1X43A 3CM5A 2NRAC 5I42A 2EIJH 4YFNF 4JQFA 1D5AA 4UXNA 4ANJA 4DOWA 4EP5A 2VQEK 1D8YA 1XGNA 3BR6A 1QU3A 5CVIA 4FSSA 2NOGA 3WU0A 3B6CA 1IGQA 4DBHA 1LOJA 1NGEA 5GAOl 2E12A 2HNZA 1AHDP 5B1AH 1BCOA 2DMPA 4ZDOA 1FSHA 4FM0A 2BBYA 4ZHRA 5FFZA 2NRWA 2KISA 3JCMe 4WE1A 3SAGA 1V55H 2PEXA 4J9DA 3JCMf 3UWNA 5C24A 3FSPA 3GPLA 4B3MK 3S1QJ 4A4HA 1IN8A 4JS5A 4BG9A 3HL8A 1A5JA 1D1AA 2K9QA 1CQTA 1RTDA 1YJNT 1Y64A 3DM2A 3FBNB 2HOAA 1K8AO 1QWFA 3AL0C 3I55A 3VERA 1GVDA 1BO5O 2GA1A 5J3LA 1R1TA 1ZYQA 5LLQA 2ZMEB 3LSIA 5D5UB 1KK7A 3BLYA 1UGRB 4UUSB 4C8KA 2Q2EB 2UXXA 2ID3A 4CXFA 3IHOA 3OBWA 3CPWP 3ABLH 1VIEA 3CCYA 4BH9A 2VBWA 5GAGJ 1YQMA 3C7NB 2O6GE 2JVGA 3S6WA 1IGUA 1VQPQ 3T7ZA 1S1NA 3M0QA 2HMPA 1VTNC 2Q8KA 4BE2A 5ADXA 2BKDN 3DTKA 3O1BA 1UEBA 5KGWA 4CERA 5E84A 3A2KA 3VYGA 3HPWA 4Y13A 1MMNA 2LQNA 1RILA 4DUZK 2PFBA 2PYJA 3F22A 5ILSA 3SBTA 3VWBA 1PKTA 1JT6A 1E3HA 2A5WA 1XI1A 3V9ZA 3CVSA 3RMBA 1MWKA 2NOEA 5HNFA 6PAXA 2FLOA 4NCAA 2R58A 5CKTA 3LPTA 4A2AA 1Z9CA 3G7ZA 2P9IA 3GFLA 2HYFA 4F9OA 3AA3A 1FXXA 3FKJA 3KLGA 3P5JA 4YHHK 3V9UA 2CH4W 3RYPA 3I0SA 1XCBA 4L5IA 2JA2A 2VQCA 4A5NA 1ONVA 4G94A 1YO5C <