4ZTFA

Crystal structure of the prototype foamy virus intasome with a 2-pyridinone aminal inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 2-Pyridinone Aminals: A Prodrug Strategy to Advance a Second Generation of HIV-1 Integrase Strand Transfer Inhibitors.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna/inhibitor
molecule keywords Integrase
total genus 103
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ztfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ztfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ztfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ztfA03
4K8ZA 4A4EA 1LAVA 2VWKA 4QOZB 2A1SA 5FDLA 5I42A 1UAXA 4LH5A 4DSEA 1NJXA 3QETA 1D9FA 1WSHA 4TSXA 2G3RA 1EX4A 1KLMA 5C25A 4ELUA 2BUDA 2E6MA 1C1AA 3G0ZA 3KLEA 3SZ2A 3NF7A 3TAQA 2OPSA 3DYAA 3F70A 3KTQA 3NE6A 3SQ0A 1X9MA 5HRPA 2BKDN 3PMIA 5M9OA 1S1UA 2B6AA 3AVAA 1LWEA 1BGXT 1UOCA 3MECA 4H4MA 3OJSA 2HB5A 1NK9A 3TAGA 4KHQA 4OVAA 3LALA 3M8RA 4J2DA 2LRQA 5C42A 1OZ3A 3TR8A 1TV6A 4CJVA 1WLJA 1WGSA 3QJ6A 1X9SA 3ZSYA 3VQPA 1I3AA 2KW4A 4CHNA 1U45A 3VQBA 3DLGA 4B3OA 2P0KA 2K3XA 2M1HA 1GOCA 3NH1A 3HM9A 3PUFA 1SV5A 3LDSA 4FLWA 4FLVA 1NKBA 3GOXA 1K6YA 1Q9XA 1XHZA 3P1GA 4M3WA 3MEWA 4IUPA 1NK5A 3PO4A 3VQCA 4DU1A 1NKCA 1KLNA 4NCBA 4OKKA 2HQEA 3META 1S9EA 4O55A 4L8RB 4QQ6A 3MEEA 5K14A 2XRIA 3NH0A 3CM6A 1DTQA 1W9HA 4CERA 4CHYA 2E5QA 2JGUA 1SL0A 3OYBA 4OGEA 4DQPA 1A5WA 4N4HA 1A5XA 4DWIA 3HYFA 1C1CA 1RBUA 3V9UA 3SPYA 4Z4IA 4I7FA 2PYJA 3P8DA 5KGXA 4YNQA 3LZIA 3LP1A 3C4SA 4BE0A 4IFYA 3M8SA 3SQ1A 3QEIA 5HRNA 3D0PA 3C95A 3AO5A 4B9VA 2RI3A 3HL8A 3MEVA 5KI6A 2IOCA 1N27A 4B9WA 1BCOA 4KI4A 4CJ3A 4IFVA 4F4KA 4DMNA 1TK0A 2G8FA 3I0RA 3CFRA 2O4XB 4JLHA 4KKOA 4L59A 4CGIA 2RPIA 1G5VA 3PX0A 1J5OA 3RRGA 1HRHA 4FLXA 1XI1A 2GFAA 3MEAA 4E1MA 3ZSWA 2FBVA 2WONA 1CXQA 1Q8IA 1WSIA 3ZSQA 4W5TA 4KRFA 4NS5A 4BDZA 4CF2A 4AHCA 3FFIA 3NBPA 1ASVA 1QE1A 3O3FA 4CEQA 1GOBA 4PL6A 3LAKA 1KTQA 3LPUA 2KTQA 1RDBA 1NK0A 4KHWA 3ZT1A 3FC3A 4B9SA 3AA4A 4DTSA 2YNHA 1RT1A 2GUIA 3NF6A 4OJRA 4M45A 4CJEA 4W5OA 3RMCA 1RTHA 5JS2A 1VSDA 4E7LA 2BDPA 4JS4A 3OYNA 1LWCA 4CGDA 2EKOA 4F8RA 4N47A 4HHTA 1RNHA 3OYEA 2DFFA 4DFJA 1SL1A 3M8PA 3MEUA 1TKTA 4KHUA 2F8TA 3V9ZA 5HRSA 4WE1A 2HNDA 3OYIA 1EXQA 4H4OA 3QBYA 3SV3A 3LGFA 1W0HA 2B5JA 4MFBA 4CJQA 5KTQA 3RMAA 1N6QA 4UQGA 3MO8A 2O4XA 3O4QA 1NJZA 4W5RA 4QVZA 4AHUA 3U3GA 2G8UA 4I2PA 4KTQA 4HTUA 4FJNA 4FJXA 5FRMA 4B08A 3AVHA 3AA5X 2QK9A 1RBTA 1BI4A 1WSGA 1QS4A 4B9XA 2RKIA 3KIOA 4KHYA 1IO2A 2RHYA 2E6LA 4G1QA 3AVFA 4CJKA 1IKWA 3KKRA 4Z4FA 4DTMA 1NJWA 4KFBA 1VSJA 3DLMA 3AO2A 1C0MA 3AVKA 3IS9A 4R5PA 3EYZA 4DTRA 1HNVA 3QO9A 4DQQA 5KCOA 2EFIA 1XNIA 2M0OA 1LWFA 2ITGA 4FU6A 5D3GA 2O4GA 4E0DA 3VQ8A 3E9GA 2IAJA 5HRRA 3AA2A 3A2FA 1S1TA 3NFAA 4Z4CA 2DAQA 3IG1A 4W5NA 2VYTA 2OZSA 3FLGA 5D6YA 2IDOA 4NYFA 2YNFA 2HNYA 4GVMA 2QKKA 1VK0A 1X1PA 2EX3A 3AVIA 1WSEA 1G15A 1WSFA 3OYMA 1Z26A 1RT3A 1S6PA 3QINA 1RI0A 4E7JA 1TKXA 3EZ5A 4EZ6A 2HHXA 4FM2A 2YHBA 3OA6A 4OPJA 3HXMA 3MAQA 1RDDA 1U47A 1T03A 1KVAA 1VRTA 1JLQA 1VRUA 1IKVA 3P83D 4DF4A 3TAFA 1UA0A 2QKBA 1HYSA 3OYCA 3DRPA 1OYXA 4FVMA 1BI4B 5DK5A 3RRHA 1RTIA 4HUFA 2JZ2A 2FBYA 5HBMA 1WJRA 1SKRA 1WJSA 5IN1A 3V1OA 5CZ2A 4DSIA 1NOZA 3NNQA 1QTMA 1FKPA 3E01A 1BIZA 3NTHA 2X4YA 3SJJA 4UC4A 3SD4A 1U49A 3LZJA 3WNGA 1IH7A 3KK3A 3OYKA 4OPKA 1D5AA 3TABA 1JLGA 3OS2A 1S9GA 2K3YA 4CEZA 1RCHA 2XY6A 3BDPA 4KREA 2HVIA 3NF8A 4Y1DA 3V4IA 1JKHA 1MU2A 1RBVA 1Q9YA 1BIUA 4O0IA 4CF9A 3QIIA 1QQCA 4KV8A 4N5SA 2XO7A 3KLHA 3SPZA 3O3GA 3HPOA 3CFPA 4CESA 3PMTA 3Q1JA 2OPPA 2HHSA 1D8YA 4RG2A 3I8DA 1TKDA 1QSLA 3AO3A 3H8ZA 4IUQA 3S9HA 1KRPA 1NK4A 3DLKA 3QIPA 3QEPA 1ZYQA 4CJSA 1JLEA 4NCAA 2D5RA 3K2PA 3HPHA 1BL3A 4A4HA 5DMRA 3HP6A 3SV4A 4B9LA 3S3NA 2B8AA 3OVNA 2Y1IA 2Z1IA 3PX6A 3DM2A 3ZEHA 3OB9A 3DLRA 4ID5A 4FCYA 4DU4A 4N4GA 3MEDA 4DTPA 4FM0A 2RHIA 2JTFA 4DTXA 3SUQA 2PYLA 2X4WA 2XY7A 2RO0A 1T05A 2RJFA 2F96A 2VG5A 2ZE2A 3CM5A 3EAEA 3V81A 4A4GA 3DRSA 2Y1JA 5E41A 2DIQA 3PNWC 3NGIA 3ZSZA 3MEGA 1T8EA 1VSLA 3AO4A 3SNNA 4DSLA 1XHXA 3T1AA 1RTJA 3RMDA 3OYGA 3SYZA 4DSKA 4GY5A 1Y97A 3HPGA 4CEBA 4M3TA 1R0AA 1SSFA 3S3MA 4CEAA 3PY8A 1YVUA 4CJ4A 2X4XA 5KRSA 2EQUA 3NGZA 3U3YA 1JXBA 4B9NA 3ASMA 2IG0A 2RJEA 1J54A 4II1A 1HQEA 2MWOA 1S1VA 4LD0A 4B8AB 4CJTA 3ZT0A 3CQ8A 4QQGA 1S1XA 4FM1A 4KO0A 1EP4A 4CJWA 5JS1A 4MQ3A 1JXEA 1JL2A 1T7PA 4B9TA 3DB3A 4FJMA 4CK3A 4QW2A 1L5UA 4FLZA 4BDPA 3C6TA 2OPRA 2ATQA 4CIGA 2VG7A 1IKXA 3OQ5A 3B6PA 4O44A 3WNEA 2IGIA 1IG9A 4DLEA 4DQSA 2HHVA 2LDMA 3K5LA 3S6WA 2RJCA 4BWJA 1VSKA 2QQSA 4HVJA 3K57A 4DFMA 3SUNA 2X6SA 1NOYA 2FBXA 2D0BA 4RW7A 1JLBA 2OPQA 1B9DA 4AHRA 1KFSA 2P1JA 4RG8A 3LGLA 3EY1A 2ZD1A 4DLGA 1L3SA 2E6NA 5D6WA 3OYAA 1HNIA 4Z4HA 4FK0A 2BIVA 3E9FA 4AHVA 5C0MA 4KHSA 2YRVA 3LP0A 2RJDA 1VSEA 3O4NA 5KRTA 3TI0A 4CGFA 4CK2A 1U4BA 4HCCA 4KAZA 1BQMA 4CE9A 1YT3A 4PA1A 1U48A 4FLUA 3SCXA 4BE1A 3PX4A 4B9UA 5KGWA 3HVRA 4KB0A 1LAWA 2ETJA 4B9MA 3KUFA 4DF8A 3OYFA 1C0UA 3KJVA 4AHSA 4FJ9A 4CJFA 3NTIA 4IUTA 3NHGA 1HPZA 3FDRA 5D6XA 3SI6A 5I3UA 4KI6A 4OLBA 2LVMA 2OA8A 4LSLA 4E7IA 2L89A 1C0TA 1TL3A 1J53A 3ZT4A 2DY4A 4IKFA 1DTTA 4LH4A 5CYMA 3VA0A 4CHPA 3K5MA 1NK8A 4QQDA 1QSYA 4O5BA 3VQQA 1BQNA 4ID1A 4GW6A 1XWLA 3O3HA 4CFCA 3VQ5A 1RT2A 4CHOA 4DSFA 2HHUA 3LP3A 3LWMA 4DSJA 3WNFA 4Q5VA 3LYIA 4CEOA 3UWNA 3AVCA 4M41A 1UA1A 4FZXC 3MXJA 2B4JA 3K5OA 1O1WA 3IRXA 1B92A 1TKZA 4C8NA 4E7HA 4Q5WA 4AHTA 2YNGA 4F2SA 4I2QA 2R5MA 1KHCA 2YKNA 3AVGA 4I9LA 4J2EA 1D9DA 1ZBUA 1YTAA 4DU3A 4CF8A 2KFZA 4CEDA 5HROA 3PO5A 4FK2A 1C6VA 4FJ8A 4M42A 2HQXA 3NTKA 3OMGA 3VQDA 3OS0A 4CECA 4CIFA 3QEVA 1ZBFA 1L3VA 4EP4A 2G8IA 3KD5E 3QIOA 5EU7A 3ZSRA 3WNHA 4O4GA 4FJJA 2A1RA 2M16A 3OJUA 5SWMA 2OYQA 3OMCA 1DLOA 2I5JA 4FJ5A 5C6SA 1TVRA 4E7KA 3QKJA 3CG7A 3LANA 4RW6A 5IAYA 3K58A 2R7YA 4KTZA 4N4IA 4DS5A 3ZSXA 4BD3A 3B6OA 1B9FA 4ELVA 2P51A 4J2AA 3L2VA 3KKSA 2R57A 4GMJB 3TWHA 3OYJA 5CZ1A 5CYQA 1LW2A 4C8KA 1I39A 1H3ZA 2KQ2A 2R5AA 4ZHRA 1TAUA 3QESA 2G8VA 1JLAA 1RT4A 4N56A 4FJIA 3DLEA 1BHLA 4PQUA 3LP2A 1S6QA 1RBRA 2XY8A 3AV9A 2BE2A 4DS4A 3ZT3A 4KPYA 4DQIA 2RI5A 5HP1A 1SKWA 2DIGA 3LWLA 4CFDA 3KK1A 3S3OA 4F3OA 3OYDA 4FW1A 4FJ7A 3MP6A 4DFKA 4PWDA 3TARA 4JS5A 3VQAA 4K8XA 3NF9A 4CFAA 3AVMA 2OZMA 2X6NA 3KK2A 4C8MA 3T3FA 2GF7A 4IUVA 2RN2A 3C6UA 4I9QA 1HJRA 2Z1HA 3TAPA 3DI6A 4FZZA 3IAYA 4M3UA 3V9WA 4HCBA 2YNIA 4KTWA 1WN7A 1LV5A 3MP1A 3V1QA 2P5GA 3H6ZA 2WOMA 1ZBLA 4YFUA 4HCZA 1SL2A 4J2BA 2NUBA 3HVTA 3L3UA 1IKYA 4C5IA 1KVCA 3OYHA 4E3SA 1NK7A 4PY5A 4FLTA 1U04A 4E1NA 2HMIA 3HP9A 4ICLA 2G8HA 2R58A 3ZT2A 2HHTA 1MHNA 3K59A 1RT5A 3VQ4A 3DOKA 1HMVA 1VSFA 2Z1GA 3NCIA 4PLLA 4EDUA 3MP8A 2ZQBA 4IBNA 1KFDA 4CGHA 1QSSA 4Q0BA 1TK5A 2DTUA 1RBSA 4CJUA 3F73A 4DTUA 1NKEA 3LX7A 1HYZA 2D0AA 3ZSOA 2P5OA 3VQ7A 3V1RA 4ZTJA 1GOAA 2PQWA 4CGGA 4Z0UA 3V9XA 5KCHA 3T19A 4FYDA 3BDLA 3I0SA 4FW2A 3PFSA 5J39A 4LY7A 4IUUA 2RHXA 4JRPA 4LD6A 1SUQA 4E19A 3RWUA 3SUPA 4CIEA 2E4LA 3MXMA 3L3VA 4OKJA 2VWJA 2G8WA 2EQMA 2D9TA 3ALYA 3DMJA 4IDKA 4C5GA 4W5QA 4C8LA 4RW9A 1JLFA 2RF2A 3AVBA 3QERA 2Q3SA 2RI2A 2IC3A 3AVNA 2EQJA 2VG6A 4Z4EA 4BACA 2PY5A 4CHZA 1C1BA 3VQ9A 4PUOA 3P5JA 1F21A 4H8KA 3G10A 3QNNA 2LCCA 4C5EA 4C8OA 4OLAA 2L8DA 1J9AA 4DTNA 2LTOA 3LAMA 3NAEA 4BWMA 3QEXA 4BDYA 3U6FA 3DLBA 3DB4A 3L2WA 3CYMA 4RW8A 2RHUA 2HNZA 2DFHA 3TAEA 2RHZA 4X34A 3RR7A 3RR8A 4CGJA 4M3XA 4LSNA 3OS1A 3MXIA 3FEOA 4CF0A 3L8BA 5CIUA 3K5NA 2IS3A 2HVHA 3O8VA 1WSJA 5KE2A 2LSNA 4CFBA 1RDCA 5J1EA 1ZBHA 3OY9A 4OVLA 3HK2A 2WACA 4Z02A 1REVA 2HW3A 3LH0A 1WAJA 1ASUA 2BANA 1LW0A 4DTJA 1SKSA 3UIQA 3KLGA 3VQEA 2D0CA 1FK9A 4DFPA 5J26A 2YKMA 2YHAA 4EZ9A 2BGGA 3M8QA 3OYLA 3L2RA 3TAMA 4AH9A 3ULDA 1ASWA 3H08A 3RTVA 2YV0X 4FJHA 3AA3A 2KFNA 4Y1CA 4M3RA 2PZSA 2QQRA 3SQ4A 3SUOA 4F2RA 4KB1A 4FXDA 5FROA 1CLQA 3HO1A 4E89A 2W42A 3ME9A 4ELTA 4AILC 4OGCA 4DQRA 4CRIA 2XK0A 3F9KA 3JYTA 4IURA 2FHDA 3THVA 4CCHA 4QAGA 2Z1JA 1ZBIA 3ZSVA 3SQ2A 4A4FA 4NZGA 4HUEA 4HUGA 5J2QA 1N5YA 5J2NA 2HHQA 5KE3A 1BCMA 3ZCMA 5SZTA 5T7BA 3VA3A 3AVLA 4CJ5A 4QCLA 1CZ9A 2XDPA 1KSPA 2JLEA 3QLHA 1A5VA 1VSMA 2FC0A 3LPTA 4IG0A 5CY4A 3RMBA 2NLUA 3UT1A 2GV9A 4JRQA 1HQUA 4CHQA 2GFUA 2GBZA 5KH6A 1RT6A 1FXXA 3BGRA 2DFEA 1L3UA 1S5JA 3DOLA 3CFOA 4N76A 5C24A 1WAFA 4PLIA 3DRRA 4CF1A 2F8SA 1JL1A 3NH2A 4CJLA 3NDKA 1ITGA 1RDAA 5J2PA 2MWPA 2X74A 2G8KA 2L3RA 3ASKA 4NYNA 4XIUA 3V9SA 4B8CA 3CEYA 2F5KA 1BISA 3JSMA 3AVJA 4FLYA 4FZYA 3HJFA 3L2UA 4DG1A 3QNOA 1OI1A 1FKOA 3PV8A 1TGOA 3ISNC 2X35A 3M9QA 4CEFA 5HLFA 1RTDA 1YTUA 2AJQA 2KZMA 4F3TA 5FRNA 3KLIA 4BE2A 3L42A 3KLFA 4N41A 2X78A 4DTOA 1X9WA 3C94A 4CEEA 3ITHA 3V6DA 2XY5A 1XC9A 3L2QA 2XHBA 4FJLA 4FJKA 3QEWA 4Z4GA 2EQKA 1NK6A 1WNSA 1WJQA 3P8HA 1Z25A 4FK4A 4C5HA 1HYVA 1RT7A 4M3ZA 3AO1A 4M3YA 4CJRA 2KZZA 4CK1A 2EHGA 1KVBA 2HHWA 4FJGA 4OKEA 1TL1A 1TAQA 1CXUA 4ZTFA 1KCFA 4O0JA 3HT3A 4KHNA 3HSTB 1L3TA 1QHTA 4RW4A 1EKEA 2O4IA 3D45A 4IG3A 1EETA 1VSHA 2FBTA 3NGYA 1OZ2A 3VQ6A 1JLCA 4NCGA 5J2MA 1S1WA 1UWBA 4CJPA 1TK8A 3TANA 2CKKA 4FL6A 2QXFA 3VN5A 3KD1E 4EP5A 1NJYA 1VSIA 1RILA 3LLRA 3DLHA 1CZBA
chains in the Genus database with same CATH superfamily
3DFGA 4DUZK 2ABKA 4I2OA 3KZZA 5E79C 5FU6C 2B6AA 5M9OA 1NGFA 3VPRA 5E8IA 3GL1A 1V5FA 3O5BA 1QLYA 3SFIA 2QI2A 3V7RA 5GJWB 4RGSA 2KJBA 2A28A 4J5YA 1KJWA 2PTKA 3RCOA 2HYGD 4NLBA 4BRNA 2JGUA 4DV0K 5LRRA 1Q82R 4I7FA 1XNRK 4BE0A 5HRNA 5GAN8 2CP0A 1SF9A 5LJWA 1F4KA 3CQTA 1QPIA 4KIFA 4L59A 4FLXA 4IL6C 4ESBA 3S1MJ 4CYDA 2CQKA 2DQRA 4DV5K 4JX5A 4CZMA 3E9OA 4IWVA 4BREA 3U1KA 3MZHA 1QE1A 1T08B 2ZSHB 4M77B 2HBWA 4ITVA 1GLNA 2NUZA 3KYCB 3RMCA 3FISA 3DPUA 2DA2A 1OYYA 2JWLA 3SV3A 3ULEB 2ZSIB 3I55T 2DODA 1EFNA 4X66K 3PFYA 2EYYA 2K6DA 1Y1WJ 1VQOA 3I55Q 2MK5A 1S8NA 1ZARA 2RHYA 3BP8A 1KG7A 3K7AJ 1L0OC 4PIIA 3JRZA 3EFRA 2CGHA 1UJYA 3IS9A 2BOLA 1QVFP 2E36A 1KQSA 2QA4A 2FQ3A 4KGVB 3QINA 1J7KA 3ASOH 4IF4A 4FM2A 2YHBA 1YHQT 1JT6A 1T2KA 2A3SA 3P83D 3TAFA 2O8EA 3OSVA 2LVSA 4BHBA 2D8JA 3BY5A 5DK5A 4XTYA 1RTIA 2FL7A 4HUFA 1M1EB 1TQIA 2LTPA 3LL3A 2RMOA 5BRFA 5LHIA 1DDNA 1IZ6A 3CJAA 1IH7A 1YYVA 1HXDA 2XY6A 2YPRA 5GANf 4KREA 3NF8A 2O0YA 1Y7XA 3OA9A 4CD1A 1ABOA 4BY1J 2EINH 4X62K 3PMTA 2CZ0B 2A5XA 1AWCA 1OFCX 1JLEA 4F91B 5DMRA 3LOCA 4LG3A 1LDJA 4L5JA 2Y0SA 1QZ6A 4EA5A 1SHGA 4DIQA 2PX9A 3PIOF 1PVSA 1ON1A 1M4ZA 4XM3A 1MBHA 2HOAA 2GWKA 3VPZA 4AYBN 3H9QA 4II1A 2MWOA 4CZGA 2ZXHA 4JK8A 5GAN3 4K25A 4JJCA 2TRTA 1L3LA 2UZKA 3MN2A 2XAQA 2GXAA 3SUNA 2QQSA 2QTVA 3GTOJ 1RZ4A 2OPTA 1I1JA 3J7AP 5FU6B 2NOZA 1YQLA 1U6GA 2XPUA 2DZCA 4Z4HA 3MKYB 1YOVB 1UB9A 4CGFA 1MGTA 3LSTA 1LAWA 4J6WA 3KUFA 1C0UA 4I09A 3I58A 3F8NA 3FDRA 2DETA 4LG0B 4H0YB 3RIRA 3FRNA 3J7AF 3QOPA 3W3CA 2CJJA 3LQQA 3VQQA 5KYWB 2O6GE 3LP3A 2A69F 4M7DC 4DSJA 3R2XC 1W7AA 4M73A 2YNGA 1VQ6A 1KAYA 2MC4A 2DFUA 3VDXA 4XBFA 1DKGD 3TP3A 1Q86O 1T3SA 3LQRA 5AN4A 3W6KB 3M8EA 4K0KK 2FB7A 2A1RA 5SWMA 4JZ4A 1KFZA 4KUIA 3CDIA 3EYIA 5GADP 4Y4RA 5EGOA 5CYQA 1UHCA 3M59A 1CZAN 3BG6A 2DJQA 4PQUA 3W2WA 4HEA2 2VPRA 2VGMA 3KK1A 3OYDA 1E3HA 2KHOA 2VKNA 2R7UA 1FYMA 2MA3A 3JB9D 4C92E 4HCBA 3V9WA 2ROLA 1R00A 3V1QA 3H6ZA 4YFUA 2FSWA 4FPBA 3ECOA 4IX7A 3OYHA 4YIFA 3SJMA 4AVPA 3VW4A 4W1UA 4R0KA 2I8DA 4NBQA 3VSKA 2HDCA 3ZSOA 4B1UB 2LNVA 4OPHA 5AQNA 2BUPA 3I56N 2DMQA 1Q86C 3WG9A 2K2VA 2GOMA 2TDXA 4F14A 4DEXA 2ZMEB 1UUEA 4Z4EA 4DW6A 1ZBJA 3RR6A 1VQNI 3F0CA 3DXMB 4BWMA 5AZJA 3PO3J 1TP4A 3U6FA 4ENKA 3RR7A 1B9NA 2PBDA 2HQAA 1Y0NA 3V7SA 5CIUA 3GE1A 2LSNA 2F4OB 3MMYB 2DA4A 3I55A 1REVA 3K2AA 3JAMZ 4KULA 4FE7A 1RUOA 2DPDA 2XB0X 3EH2A 3CMAQ 1NBWA 3OS5A 1V4TA 2VVKA 3E6MA 3J80Z 3S14J 1MWMA 3M8JA 1HKBA 5CY4A 3LPTA 3HGYA 2L3SA 5KQ8A 1RL2A 3VF2A 2DK3A 2EA4A 3K4JA 1WHHA 2K5IA 4YOVA 4C92B 5C10A 3BE3A 1Q7YR 2G8KA 4B8CA 3JSMA 4BG8A 1RLQC 1OI1A 1FKOA 4B47A 5LHHA 2DDBA 2OD5A 2HI3A 2NOBA 3LSKA 3I35A 5H6RA 1IB8A 1XS9A 2KXDA 3CC2I 2F5FA 3DKWA 1IN4A 5FGMA 3REBB 2CUDA 3BTIA 2YSQA 2DL8A 3AGKA 1VQ8Q 3HSTB 3E0JB 2FBTA 3MKLA 5CKDA 2I5WA 1K61A 5HL7L 4AM6A 1TS9A 4LFAK 4OPAA 2AS5F 2LG4A 2ZCWA 4HG2A 4EMSA 2EIMH 4C8QF 5F1RA 3FLCO 2BZ8A 4NQWB 1T0FC 2P0KA 1O3TA 1GL5A 1WUAA 3DXKB 3A5MC 3CCLN 4DR3K 2QSHX 4OWRB 4FYVB 1YW9A 7AT1B 3AG4H 4C2TA 3HYFA 2FZGB 4CBUA 2DLLA 2VJIA 1QMCA 4Q5SF 3QEIA 1OEBA 3KFVA 4IHSA 3ZQGA 2ROTA 5AJ3K 1TK0A 4BRPA 3R3LA 4S04A 3JCUC 3Q0VA 3WE2A 3IQLA 2OTLN 2FLOA 1PU7A 1ASVA 4FIBA 5EG0B 1S22A 2L0AA 1RDBA 4JOMA 1RT1A 3DEUA 3CPEA 2PMHA 1SFOJ 4B9QA 3H9JA 4Z89A 1KQ2A 3TEDA 3OYIA 4H4OA 3VGMA 3CWSA 3U3GA 1Z3XA 2QA4T 3AVHA 2QK9A 2DYIA 1UFFA 2HMPA 1IO2A 4KBMB 3SXYA 1CKAA 2LD5A 5J40A 4PJLA 3WXKA 5KCOA 1XNIA 3NFAA 4Z4CA 1WJDA 1WFXA 2H6BA 4DR2K 1SPKA 2V7FA 4JPBW 4OFHA 4CC2A 2LP0A 4G7HF 4H0VB 5JVGL 3TVTA 3NEUA 3WE3A 1I5OB 3REAB 4DSIA 3G4SI 4UUSB 2FPFA 1X43A 1S9GA 1SAXA 4B3TK 2PI0A 1TUYA 1VQ9N 1TOVA 3R9PA 2P4WA 3Q1JA 2HHSA 5LJ3g 3SAFA 4AUXA 4NXMK 3S9HA 3T69A 1E4GT 3K1NA 1ZK8A 1YITA 4M71A 4LDYA 1AEYA 2A37A 3MN7A 3SUQA 3EAEA 3X24B 5E8GA 4A4GA 1VQKQ 4HKEA 3KE2A 2VB6A 2MLKA 4G8XA 4ZDOA 3IUOA 2OTJA 4XLCA 2H1LA 3CO7C 3TSUA 1P4XA 4LFCK 4B8AB 3VYGA 5IP9J 4QQGA 1WXUA 4IO9L 4L5GA 1LWYA 4QW2A 4BQZA 1ATSA 2ATQA 1LWWA 3EG1A 5M5YJ 2RNJA 4HXJA 2K3PA 3S6WA 4IOXA 3IRQA 2DA9A 3DKYA 5KYUB 2BY0A 1WXTA 4JYKA 1WHKA 3M07A 4IHWA 3M3YJ 1GV2A 3O80A 2XAFA 4UY8O 4U0WA 2YRVA 1TYQA 2RJDA 2UWMA 4HDUA 4CC4B 2A07F 3RZOJ 4IFEA 5KGWA 4JBAA 4KT5C 4F7UF 4BRIA 1BB9A 3TDUC 5GADJ 5AFUA 3C65A 5I3UA 4P96A 3HSBA 3DV8A 2XI9A 2K5CA 4ILGB 1D1CA 1YWOA 3KXTA 4WFAL 3JCMP 4L5EA 4EM0B 3V8KA 4CEOA 1ZQ1A 2VLAA 1KU3A 3OIQA 5JR3A 4BEHB 3CMEQ 4F2SA 2R5MA 1Q81C 2E5KA 1D9DA 2KL4A 2CSOA 2QXLA 1IZ1A 1WX6A 2G8IA 4OMFB 3WUHA 3TQNA 2DXUA 2HMIA 1N3CA 1QQMA 4WF2A 4BD3A 2JNGA 2V8IA 1TW3A 4YFXF 2V1RA 3FHGA 1H3ZA 5ELZA 4GFBA 2UU9K 4YDUC 3QBWA 2WV1A 1S72A 3GF5A 4Z8AA 4M7DG 4PJNA 4F04B 3VYSB 1Z05A 5FWCA 4XIDA 4C23A 3IMXA 3CCSN 3DF8A 1QVGA 1OQKA 1K73O 5J47A 1JKPC 5JMVA 1VQNQ 4BRMA 5ICGA 2DA6A 3CC4I 1NM1A 4CJUA 5GAOm 4DTUA 4ATOA 3V4GA 2O8BA 1R5HA 4KH4A 4AFQC 3M0SA 1N25A 3HFOA 3ZMSA 1A31A 2FE3A 4E9HA 4K11A 1YS6A 3CWUA 2E4LA 1N33K 4YDUA 2KMUA 4CHZA 1FBUA 5M1PA 1VQPA 3WHBA 5IYBJ 3CMMA 4XLPF 3MVPA 4E1JA 3A2KA 4IEIA 3RR8A 1OH6A 4G12A 3OS1A 3L8BA 2BHYA 3A01B 2W84A 1LOJA 1RRJA 4YOTA 4YG2F 3VEYA 2BANA 2ACJA 3J80K 2CH5A 1VQ8N 4IDHA 1NGEA 1WWXA 3M8QA 3G6EA 1MW7A 3QRFF 4JRKA 3E2UA 3THYB 2PZSA 3M1EA 3LL7A 4JI2K 3K9TA 1H3HA 4KMUX 4A3IJ 1R59O 4AILC 2M51A 3ZGKA 3J81E 1X75C 5SZTA 4KUMA 1YI2N 3A98A 3FK6A 4KISA 1W97L 1LFBA 2GFUA 2FJ1A 3QSUA 3AG3H 2O3FA 2JUGA 2X4HA 2X74A 1BIBA 3V9SA 2GQVA 5GINA 2COBA 4D6WA 1X4PA 5KVRA 3HJFA 3L2UA 3JW4A 3CCET 1ZA1B 4J8OA 1X9WA 3IWZA 5K5QA 4W5NA 3L2QA 1WHGA 2IVOA 3OGDA 1M3BA 3CBPA 5A2QO 4CCOA 5AIPA 4HV5A 2O4IA 3ZFJA 4NCGA 4BJ5C 2ZJRF 1YAGA 4CZFA 1JKQC 4PSXA 1VQKT 1ETWA 1NJXA 3C7NA 4ORZA 4R55A 3OBYA 3F70A 5F27A 2QK0A 4AI4A 4OVAA 2LRQA 1F36A 2FXAA 4OOIA 5F64A 4ENMA 3A5ZB 2JWKA 1TC3C 3GBTA 3HM9A 1NKBA 3KZIC 3ZMDA 3CJCA 3L00A 4WWCA 2CUZA 2W41A 3O8MA 3EETA 1TWFJ 4HVUA 3KWIA 1DTQA 2LC2A 3GEZA 2HOTA 1NLVA 3EFOB 1S29A 3LP1A 3M8SA 3ZLJA 1HW1A 4PCQA 1T8IA 4XKCA 2IOCA 5GMKh 5KPTA 4IFVA 3KPHA 3LDPA 4CC7A 4DV2K 1HA8A 3G1JA 3PIPA 5GMKl 3HRGA 2JRTA 3ZSQA 3AL0B 2OTLT 1KQ9A 4NDLA 2GBYA 2HBPA 2LY9A 1X69A 4M7DF 1IN5A 4XLAA 2GUIA 5LFAA 2WC9A 1RTHA 2DNUA 1H88C 1M90C 5GAMe 2CQ7A 2JSCA 5KN8A 1A0NB 4XU1A 5EZGA 2FOKA 4ZZDA 2HKXA 1RKWA 3DBRB 4W5RA 1VUBA 4FK2A 2BW3A 3CCLT 2QAZA 1K8KA 3G1OA 1Y07A 3I56Q 1WI7A 3DLMA 3JRAA 2R4GA 2CH4W 3VF4A 3QOEA 3OR1C 4RAZA 3BW1A 2M7AA 6AT1B 3BDUA 3EG0A 3JB9H 3FLGA 1K78B 1UGSB 3DKXA 1GLJO 4GVMA 1VQ4I 1WSEA 4EZ6A 3E6BA 4ZDPA 3OW2P 4HYEA 1JI8A 1UA0A 4XRFA 4PJOB 4XH5A 3KX2A 1OCPA 2FYKA 2WAFA 3EE8A 2M2EA 1HW2A 2K5FA 1S7EA 4IQJA 3LZJA 1LE8B 3KK3A 4LGWA 2PFBA 2NXNB 4XRSA 1N34K 2NS7A 1RBVA 1BIUA 1HJOA 1XB4A 1TUGB 4KV8A 1X1BA 5KHDA 1VQLN 4JHDA 4C92D 2P6SA 2EYWA 3E7LA 1D8YA 3AO3A 1OKRA 1BL3A 1U5TB 1B6AA 1YUWA 3OB9A 2E2QA 2VI6A 2NS0A 2DRKA 5CK9A 2PYLA 1I27A 2RO0A 2YRCA 2P9LA 5E41A 3NGIA 3EE9A 3W3DA 3PQKA 3CXCP 3S41A 4DSLA 2ZNYA 3PY8A 2FF4A 3C6AA 3F10A 2D1HA 1HQEA 2YJFA 4Y92A 3ZT0A 4BRLA 1VQPI 1PYVA 2ZFWA 4B9TA 4O44A 1VQ5N 1SD4A 2IPQX 3ECHA 1JKOC 1Q18A 2HKOA 4HVJA 4V19K 2OCCH 4FE4A 2D0BA 1XCVA 1MUZA 4B3SK 3GTMJ 3F23A 1KQ8A 4FK0A 1YQAA 5C0MA 1VSEA 4O8UA 3VMFB 2EKHA 1M3HA 3SCXA 3JRGA 4LDXA 1SMTA 4AIKA 2CH0A 4M75E 2L89A 2KT8A 2GA2A 1DTTA 1W7PD 1WJCA 1FJLA 1ZRFA 3S93A 5HLIA 2YUNA 2BZXA 4GW6A 5AQLA 3FZLA 2DMOA 3EGXA 1BA0A 4FZXC 3K5OA 3BT9A 3QPHA 2VQGA 5IHIA 3DWLE 1YTAA 4FWQA 2L54A 2HAXA 1C6VA 3FXLA 4DBFA 3JS6A 2P9KB 3OS0A 1VQ7I 2BH1A 2L4AA 2NOLA 5D7UA 3R60A 5BMZA 3CJ9A 1GCQC 4AIAA 2MGQA 1X6OA 2KIQA 2R7YA 2HNIA 5JVTA 1XOVA 4H5WA 2P51A 1FX7A 1Z6RA 1XC5A 1EIFA 3WG7H 1BHLA 4H0TB 4OB0B 4FW1A 5LJ5f 3AL0C 2JHNA 1D8KA 4MO7A 3SFMA 3C6UA 1BC8C 4C92C 2E65A 4GLKA 2CUJA 3ZQ7A 1ZUYA 5C44J 2E1MB 2BY2A 2X6YA 2DTUA 1IGNA 3H1VX 9ANTA 2P5KA 3VQ7A 4EV0A 3V9XA 3TW7A 2EGCA 1GXQA 4XSXF 4LD6A 1R71A 3OR2C 4HNUA 3MWTA 3HRUA 3AVNA 3P5JA 1NG2A 4FX4A 3PTAA 1NGCA 3AT1B 3CCJA 2MPXC 3GX4X 4BKXA 5KE2A 3TTFA 1KC8R 1WI9A 2NWMA 1FK9A 2ZWHA 3CCSQ 3QJYA 1ETVA 3H08A 1NLPC 4FXDA 2LZ6B 3C2HA 4BQOA 4M3GA 4MLOA 3U23A 2H3GX 3CMAN 3JYTA 1QQIA 1Q81R 4EHTA 1KZHA 4Z94A 3GLXA 2NUTA 3EPZA 3HKZA 3HRTA 2Q0RA 4CYCA 2Y4XA 2VUBA 5LJVA 1CZ9A 1VSMA 2UYTA 4OF1A 1U6ZA 1M27C 5M3FJ 1X6GA 1RT6A 2IXSA 1S5JA 3CFOA 3ASNH 2E70A 3WVEB 4G9ZA 4LLGF 3FHZA 3QPSA 4J9IA 4JEPA 1WKMA 1ETQA 1KAZA 4M7AB 3QNOA 4B48A 2X35A 3SWNB 1M90U 3DWLA 4PKIA 3ID8A 3HOWJ 1KG1A 4BHCA 3P8HA 2KYMA 1B59A 1RT7A 3FXKA 2NS8A 5K7ZA 2LQNA 1TAQA 5JVHL 4ZGDB 2WB1A 2LF7A 1QHTA 2GIZA 3CF2A 3BCAA 2UUZA 1PSFA 3CHWA 3FM3A 1YHQN 2G3RA 3PM1A 2V1UA 5F0XA 2EGAA 2RN7A 2AZSA 3LWFA 1DGRM 4Q48A 4ZYDA 3TOBA 3AVAA 3MECA 3HPWA 2QUFA 2EWSA 3PNYA 3ZSYA 2DYSH 4B24A 2K3FA 3VQBA 5KAIC 3T1BA 5IHKA 1XHZA 2QF7A 2VV5A 3CCJT 2QA4I 4NCBA 1MBGA 2HQEA 3CM6A 1A36A 3V9UA 2LJ3A 3L09A 2IIMA 4A3JJ 3C4SA 4IFYA 1RIOH 5FU7C 3D0PA 1T44A 3OH6A 1U1TA 2FVUA 1KD1U 4B9WA 4CJ3A 3ULEA 1M1GA 5DD4A 4BH9A 4PL7A 3MN5A 1XI1A 1AHJB 4E1MA 1CF7A 3THWB 3O9SA 1NGAA 4WQ4C 1YIJN 3NBPA 3EGDA 1BBYA 4UB8C 4C3HJ 4A6DA 2KTQA 2F2EA 2DPUA 3D5SC 1ZUUA 1K4TA 8AT1B 4B9SA 4DTSA 3AHUA 2WFBA 3CMAT 4KHSA 3HG9A 2ZPBB 1SL1A 1R23A 1V76A 5AQQA 1OH5A 2DXBA 4FWLA 1ZH5A 2Q1ZB 1MDUB 4CJQA 4UQGA 3BR0A 1VQLQ 2ISZA 3SZPA 2VQLA 4FWSA 4UB6C 3UKGA 2HXOA 1ZLJA 1WSGA 2QKLB 2ZC2A 3KIOA 1D1BA 5L23A 1Y56A 4EJWA 2E6LA 4EA4A 2GA1A 3AVKA 1OH8A 3QICA 2OZSA 1FSEA 2H1KA 3IDHA 2HF4A 3L2CA 2A68F 3QWYA 4FVMA 2G6FX 4LD9K 3HOZJ 2X48A 3V1OA 1BIZA 3SJJA 2E7WA 3G1LA 3KNTA 3SD4A 3LFUA 2FF6A 4HX7A 2VYPA 1Q82O 4C8QD 1WH7A 4S0HB 2XO7A 4OIOF 2AQFA 4RAYA 4JI5K 4FYYB 3I8DA 5J8FA 2JK3A 3DU6A 1AOYA 1ZYQA 1P6RA 3HP6A 2K79A 3OVNA 5GTHC 3CVSA 3OL3A 5M1FA 3WGIA 2M34A 3L7WA 3H3OB 3AO4A 1RTJA 1ZX6A 3SYZA 4LF6K 1VI0A 5D5WB 3ZN0A 1WJBA 4M3TA 3S3MA 1NKUA 3TDZC 3NGZA 2EQUA 5GIPA 3G71Q 2RJEA 4FX0A 2RQRA 4KO0A 3E5XA 4MQ3A 1JXEA 4OMOA 2FPEA 3BY6A 3ZMUA 2H3JA 5FW9A 1FOWA 2DPPB 2XAJA 1NOYA 3F21A 2M1BA 1U1SA 4A5NA 3NMZC 2FMLA 2DU9A 3WXJA 1WI3A 4AHVA 4Q4ZF 1U4BA 3BEXA 4LF4K 2J5PA 2NOIA 4DYRA 3N4QA 2W40A 3CIPA 1S3JA 4KB0A 4B9MA 1WJ5A 3H35A 2GWJA 2YU3A 3NHGA 4IXAA 2DOFA 3HFNA 4UNOA 5K1YA 1C0TA 2DY4A 2C6YA 5CKBA 4LH4A 4K43A 3VA0A 4CHPA 2I10A 1NK8A 5HVQC 5FLXO 3TO6A 1DGKN 3CXCM 5C15A 4CC3A 4K41A 5CVJA 5HOOA 4BG9A 2C0OA 5CHIA 4UHTA 2OBPA 3EUHA 2JUCA 3ABMH 3TSQA 2A36A 1HC8A 1OPKA 5LHGA 2FSNA 2P9PB 3NTKA 2XGDA 3ZSRA 3UNGC 1QHAA 2ZFUA 4RKUE 1T6SA 5C6SA 2R5ZA 1QCOA 2LNHB 2P9NB 1R77A 2EIFA 3ATVA 3KKSA 4GMJB 1VQ9I 3OYJA 5AQIA 3QWLA 3E97A 2W25A 2GGRA 2H8WA 1NJIU 4CA0A 2H56A 2ZGYA 4ILJA 2JTMA 1QNTA 1WHJA 2VXFA 2CP2A 4B1WB 2X6NA 3KK2A 3T3FA 1K79A 2P5GA 3TO9A 3RKXA 1I6XA 4E3SA 3ZP5A 2DL4A 1AT1B 1SC7A 3DOKA 1HMVA 4EDUA 2E60A 3F2KA 2QW9A 1JJ2P 3ABTA 3HUGA 1RRQA 2DLPA 2D0AA 2DMNA 3UR3C 3M5AA 1MDMA 5CHZA 4KYWA 3RWUA 3FMSA 4MDAA 3SUPA 2XICA 4CIEA 1NTCA 4NC7A 4M3YA 2VBYA 1AOJA 2BTFA 4FOEA 2IVMA 2PY5A 5I9EB 4EIKA 1A6QA 3CCVN 3EG2A 3MXIA 4HLXA 2NRXA 1ZBXA 5LGUA 5J1EA 3OY9A 4DTJA 4F7UE 3KBGA 3BWGA 2ELHA 3M9AA 2FRWA 2JT1A 2DI3A 3AA3A 1OPCA 4Y1CA 4WFBL 5BPIA 5DCMA 4HQEA 3HO1A 3I4NJ 1HJDA 1P4AA 2Q2RA 1TU0B 5J2NA 3ZCMA 1PSEA 5GAGP 4IG0A 1JUPA 2XB5A 4CHQA 1ZGWA 3INZA 1K0XA 4N76A 4I0BA 1BBZA 5KYYA 3DRRA 3R6NA 5J2PA 4FZYA 4E9GA 4DG1A 4FOIA 3PV8A 5GAN4 3CUQB 2E3HA 4PJ0C 4N41A 1LOTB 2E1HA 3GOIA 3GYHX 2JA7J 1X3NA 3M7GA 2ED0A 4PFZA 1QWFA 4CK1A 5JHFA 1ZSGA 1BN5A 5AQJA 1BI2A 4YEJA 4IIOA 3D45A 3H45C 2KE9A 5M5XJ 1OZ2A 5J2MA 5EYRA 1T39A 5FWBA 2KPMA 3I3LA 3RNJA 2R7RA 2BZTA 4BY7J 1ZRCA 2LKPA 3CJ7A 1KLMA 2E6MA 1ONVA 2YRDA 1LMZA 3PMIA 1S1UA 4RTZA 3G6ET 3TAGA 1JHHA 3M8RA 2IS4A 3LDLA 1K9MC 1VQKN 1DEJA 4A3MJ 4RB3C 1JO8A 2HU9A 4M6VA 2UXDK 1JTXA 1X1CA 5F0HA 4FT4A 2K3XA 2M1HA 3PUFA 1SV5A 1MV3A 3JCMe 2K9LA 3MEWA 5GAOn 3VGKA 4YOWA 2NUPB 4OKKA 3META 1MBFA 2DXTA 3G25A 3MEEA 3RPUD 4CHYA 3QYGB 1HUXA 1DIZA 3FZHA 3S2DJ 2NRTA 2WAEA 2PUKB 1R7JA 4PGHA 2COZA 3I5SA 1Z67A 4G6TB 1YCYA 4DR5K 2KZGA 2ZCFB 4JLHA 1G5VA 1GLEG 4OMNA 2O8FA 1IUYA 2W7NA 3ZSWA 2VKDA 2O9LA 1WSIA 5EEGA 2KRFA 2EAYA 2FSJA 4XL9A 3R0JA 4CSWA 1UHSA 5CKHA 2RF0A 4E4HA 2M9UA 3ZT1A 1DPUA 1MMNA 4MDBA 4M45A 3NF6A 3TI0A 3CMEA 4JS4A 4E70A 2RB6A 1RNHA 4HTLA 1TWBA 1Q81O 2YHXA 1YITI 5BR8K 1KC8C 5D4RA 1S5LC 2B5JA 5B5EC 1NZ9A 2O4XA 2DJIA 4FJXA 2JSPA 5D6EA 2ID3A 4KHYA 1CSKA 4EMKA 3V42A 4Z4FA 4DTMA 2BHZA 3ZN1A 4M78E 3CERA 1H8KA 1BYMA 1Z7LA 3IG1A 4M77F 1ATNA 1VRLA 4U7DA 3G4ST 1VK0A 1NMNA 5TKWA 5L3CA 1T03A 1HSTA 1JLQA 3CCYA 2XAUA 3ROUA 3RMQA 4CZHA 1YJWN 3CCJI 4XSZF 1I5LA 1SD6A 3S15J 1V54H 4OPKA 4UUVA 4PL8A 2LREA 3O3GA 1OR7A 2LX9A 2HL3A 3BOQA 5FB2A 4UVBA 1BKBA 3QIPA 3QEPA 4KFCA 2M9HA 3N05A 3A0BC 2KIMA 4F3QA 3H92A 1CGPA 2EV5A 2NAZA 4B9NA 1MJ9A 2IG0A 1SFUA 4WQ4A 1RAFB 5FPNA 5JS1A 1T7PA 4V2FA 3HZ6A 2E1OA 5FLMJ 1BJZA 3H5AA 4N4NB 1EH7A 4L0YB 2Y90A 2QTDA 4DLEA 1KQSS 2Y69H 4O5VA 4YTLA 3CCUA 1TNTA 2WBNA 1YJNA 4RW7A 1QVTA 3EY1A 5MLCQ 2W0ZA 1S72I 3CXCA 4IIMA 2L2PA 2WSCE 1AWOA 5GMKi 4JAXA 3CC7A 2QBYB 1AD5A 2F5EA 3QHSA 4FLUA 2DA7A 2KROA 3G71A 2LQKA 3JCMg 3NTIA 4E7IA 4IHYA 1J53A 2CH6A 4PFPA 5JHUA 4C2MJ 2FBIA 3X26B 4M7DE 4B1YB 3H9NA 2XDBA 2LR8A 3CUQC 5BPDA 4HSTA 5GAOl 4OMZA 2M5WA 4J2EA 3MZ8A 4XTVA 4DU3A 2GLOA 4CIFA 2P4RA 1EQYA 2YSRA 1WIEA 4LG0A 3RKQA 2DJNA 3TU4K 3RUXA 1TH7A 1GXIE 2LQ8A 5BPLA 2E10A 1IJJA 1YCSB 4RW6A 4J2AA 3ZQHA 1G3SA 1N8RU 3DLEA 2MD5A 1RACB 4FM4B 2JT4A 2K9GA 3S3OA 2RA2A 4JS5A 3TARA 3IHUA 2GF7A 3F8FA 1WN7A 3MP1A 1JEGA 2H8HA 3LSPA 2RVCA 2KR3A 4GLMA 4ICLA 2R58A 3DTEA 1RT5A 5K7HA 1VSFA 1QVGP 1KHIA 3U21A 2QM1A 2JTVA 3NVMA 3A01A 2ZJPF 1XX5A 5GP9A 2V1DA 2P5OA 4HNTA 1QVPA 3M0UA 3BR6A 2EZIA 3U3YA 1MUDA 3PFSA 3MXMA 3L3VA 1BG3A 4LC9B 2RKHA 5BN9A 3O9RA 4KAZA 2PLYA 1P9QC 2L9SA 2R92J 4EVIA 1NEBA 2L8DA 1J9AA 3L6QA 3S17J 2CP3A 2JM8A 4M3BA 1VQ5Q 1ASUA 1LW0A 4XORA 3ABKH 2YKMA 4BU2A 5FKMA 1HOMA 3M0RA 4FJHA 1MH3A 3VKIA 4KB1A 2KLOA 1T3LA 1ODDA 1QCFA 2XAGA 4LDWA 3CCRN 4H03B 3KFWX 4DBQA 4IURA 2HXIA 2VONA 1UE9A 2DK8A 1N3AA 1X2QA 4QCLA 1ON2A 1KSPA 2JLEA 3S16J 5M1QA 1S72Q 4XKBA 5FKNA 3DOLA 4CF1A 1B1BA 1NG9A 3BPVA 3L1PA 4LDVA 5F0CA 1NGHA 1D09B 3AVJA 1R1VA 2CUFA 1ZYRF 2ZPFB 3M9QA 1YTUA 2DL3A 3QMLA 4DV1K 3LDOA 1EA3A 2YWWA 2QGFB 4Z4GA 3BF3A 1NMDA 4ZYGA 1HYVA 2KZZA 3P8BB 2VXZA 1IV0A 3HOVJ 4ZTFA 3KP2A 3QODA 3GW2A 2CZ7B 3WTVC 5IOZA 4KH1B 2FO0A 1Y96B 3P39A 2CGLA 2EWNA 2EPFA 1NJYA 2GQIA 4EATA 1TTYA 1Y8QB 3LM9A 1UAXA 2OA4A 4LH5A 4Y17A 1N36K 5C25A 3SZ2A 1XGSA 4EHUA 3SQ0A 3EFOA 3I64A 2VJ4A 4PHTX 4BI4A 5DUKA 4D0PA 3CC4N 4JKBA 4WCIA 3DEEA 5BNGA 5F1XA 4IUPA 1NKCA 3SAHA 4I99C 1TWGJ 5HY6A 2M0YA 4OB1B 4DQPA 2VBXA 3LWIA 3GZ5A 4FJ8A 3CCUT 1P4WA 4FWOA 4Z4IA 4OMMA 1MGQA 2PYJA 1G3TA 1N78A 2F2VA 4IZ9A 1FOKA 4M9XA 4ESFA 4H0PA 4WTOB 2XRNA 3G1MA 3CFRA 4XAXB 1QZEA 3CCUI 3HTUA 3F22A 3AAPA 3PNTA 4XQFA 3VS7A 1JXOA 2KJCA 3GTKJ 3O3FA 4OMLA 4AFSC 2QEXN 4DR1K 2NVTJ 5D8LB 2Y0MA 4KRTA 4OJRA 2LRDA 2XF7A 3HTSB 1LJOA 2Y30A 4FO0A 4LD5A 3CETA 2Z5UA 4ZJZA 3CPWM 3MEUA 2E35A 2FD5A 1XG7A 1H92A 4CZKA 2HKNA 3GF2A 2RQWA 1NJZA 3FKJA 1VQMA 1RESA 5DTDA 3EUAA 4KTQA 5FRMA 1MNDA 3P4IA 3AA5X 1N77A 1AWWA 4N4OB 5IT9E 4FQGA 3AY9A 4G1QA 4CJKA 3K10A 2ZXJA 3R61A 2EJFA 4OMQA 3CCMN 4FSXA 3F8CA 3VESA 3CCMQ 2VOOA 2DD4A 3SDBA 1PD0A 2QKKA 1Z26A 5LMUK 1RI0A 1J3TA 1XN7A 3BR5A 2XIGA 2JVGA 2QWQA 3EHRA 3ENHA 3OYCA 3CCQT 2JZ2A 1SVLA 1SEMA 2C0IA 4B8XA 3JREA 3E01A 2VKHA 3Q9SA 1WSUA 4XTZA 4XH1A 1JKHA 4D8KA 2R93J 1Q9YA 1WHLA 4M78B 4N5SA 1JBMA 1MZBA 1IUFA 3CCEN 4NCAA 1QVFS 2Y1IA 4FM0A 3RKYA 4CO8A 1G3WA 4DZPA 3O9UA 3CC2N 2CO5A 3ZSZA 2A08A 4DQ8A 1TW2A 3OYGA 1E6GA 1MKMA 3JRDA 4C8QA 4OO1J 5AFUH 4BUGA 2MF2A 4ZYEA 1S1VA 2G7HA 5EVZA 2RH2A 3IAS2 4FJMA 5BRHA 3C6TA 4PJOD 3DTIA 4CIGA 4G94A 2DO3A 3KK7A 1QO0D 4RMNA 2EH3A 3HM5A 2WBMA 3FJPA 3TQ7P 1HLVA 1KGSA 1WNLA 2FEZA 3LP0A 1OCZH 2OTLQ 2IS6A 2M7BA 4BE1A 4A0YA 4NC6A 5M1NA 1FP1D 1FY7A 4AHSA 4B43A 4GDFA 1YJ9T 4FJ9A 4KI6A 3OSGA 4BI8B 3VRZA 3NMUA 1BWFO 4GKJK 2STTA 4U67L 2J05A 2PQ8A 1J75A 3C2BA 1FNNA 1HK9A 2NZTA 3BQYA 1QSYA 5DYMA 1GV5A 4JLGA 2IAIA 1BQNA 4E7ZA 1O57A 1PM3A 2RK2A 2E5NA 4Q5VA 1BIAA 2KRMA 2CZ1B 4M77E 4L6V5 5EEHA 4M78D 2YKNA 1FBQA 2CREA 4I9LA 3DKMA 3SEMA 3MAJA 4KGXB 3WEEA 1XD7A 3T1YK 2HCKA 2L7MP 4O6JA 3QEVA 4IEEA 3CBOA 5L3FA 3CQXA 1Q86U 1HU0A 1VHXA 4RM3A 3F8BA 4E7KA 1W7PB 1JCFA 2R57A 4XLEA 1TSFA 1HYOA 5HS9A 1YHQQ 4QTRA 2KQ2A 1VQLI 3D2EB 1AKHB 2G8VA 5JVGF 3OSSC 1QVGS 4MTDA 3WXIA 3H36A 2RI5A 2J6OA 4F3OA 3J80O 3VQAA 2DK5A 1JB0E 4L9JA 2JS2A 2P9IA 3AVMA 4C8MA 2RN2A 4IUVA 5LLQA 2M8EA 3MPUB 3VEVA 3A5LC 2FZCB 4P1WA 1R5GA 3LNQA 2O88A 4ESJA 1FMVA 3HP9A 1ACIA 2ATCB 4JKCA 4EEFG 3PJRA 1WQWA 5L3BA 2M4KA 3F73A 5KPZA 3O5ZA 4AM3A 2KK4A 3JXUA 3ML6A 3QYHB 3I0SA 2RHXA 3CCQQ 1OX8A 3GFLA 2QWMA 2G8WA 3G4SN 4BACA 5GAMd 4PUOA 4C0DB 4I01A 3PO2J 2E1MC 5IH2A 3HBTA 2NRRA 4KPYA 3LSHA 4UVCA 2RHZA 1ARKA 1UAAA 2W10A 1VZ0A 1SKSA 4GXOA 5L3GA 4X9CA 4CUGA 2IVPA 3NAUA 3H0DA 2YHAA 3ULDA 2KFNA 5E17F 2IP2A 2YV0X 1Z9QA 2E5LK 3AKZA 5LJ3f 5FD6A 1DP7P 3VENA 4LLNA 2WY8Q 2UUBK 2XK0A 4AI5A 4MFEA 4QAGA 5CQGA 2M45A 4F16A 3SQ2A 4LIVA 4LK0F 1BUPA 1W0TA 3UT1A 4RCHA 1FXXA 2DFEA 1ZUKA 5FLXK 3EG3A 3NDKA 2E12A 2MWPA 4A3GJ 4DYQA 2L3RA 4XIUA 3O9QA 3AG1H 5GANd 5FRNA 4BE2A 2VXEA 2CP5A 4WYBA 4F7UA 5IP7J 2VE8A 1S6LA 3I55I 3IC7A 5LJ3j 4F9OA 2R5YA 2V8KA 3AO1A 4ZH4F 3K0SA 2PVGB 1ATRA 1KCFA 5CVRA 1VSHA 4WF9L 2GAUA 3TANA 2IS2A 1JRIA 3VTIA 1LAVA 5EC7A 4BR0A 5CJ9A 3CLOA 5TISC 1E0EA 4ISGA 2MSYA 2F4VK 4B09A 3G0ZA 2Z16A 2OPSA 1N9RA 5K7FA 4H4MA 2HQNA 2E7XA 2SEMA 4BRKA 2FPDA 1X9SA 2GTDA 4GV6A 4PKHA 2DRMA 2ZBKA 1GOCA 1FW6A 3HHHA 4FLVA 2FUG2 3UDCA 4JKAA 3MCPA 4HF2A 4JI3K 4BYYA 1Y1VJ 3P38A 4N0AC 3BPXA 4PKGA 5LJ3d 1VQ7N 4O55A 2PJPA 2XRIA 4AD9A 1AVZC 3IWFA 2OAUA 2W6KA 2CH4A 4HSRA 2PZ1A 4YNQA 3LZIA 4QT7A 4PJJA 2K3BA 2A3ZA 4CDGA 1OVQA 3M4GA 3LMMA 2KIFA 3HKSA 3MEAA 1YIJQ 1O7FA 1ABQA 4P5OA 2WONA 1Q8IA 2KSSA 1MWKA 5DY9A 3ZX3A 1JGGA 4XK4A 2D4WA 1Q7YO 2W24A 3LPUA 3CF5L 2Q2EB 2QYZA 5ILVA 2YNHA 1N9SA 1FTTA 2BVMA 2BDPA 4E7LA 1FTZA 5CQYA 1M3AA 5A0DA 5K5OA 2Q1NA 2HDWA 2OZUA 3WU2C 2DX1A 3CJRB 3BG7A 5KTQA 2JUFA 2LFBA 4QVZA 4B08A 1VQ4Q 2QG9B 1RETA 2Z3YA 3ZETB 1YNZA 2VL8A 2R7FA 1PP8F 4HA8A 3RKWA 3QDKA 1HNVA 3QO9A 4DQQA 2L9VA 5GAOr 2ASMA 4A2UA 3GTGJ 2XGXA 1G2HA 2YX6A 1UGVA 5CPRB 2BW3B 3K9JA 3EGUA 1HYSA 1IKVA 3BG3A 4YPRA 4F7ZA 2YUQA 1K8KB 4D7MA 1SKRA 3OW2S 1NOZA 2O61A 3JB9J 1ORKA 1JLGA 3GFJA 4MQVA 4LDUA 2VCPA 3QZ5B 4GBQA 2VT3A 4B1VA 3B8AX 1QZYA 5F08A 3A5NC 3H8ZA 1YIOA 2D5RA 1A5JA 4YHHK 1VFCA 3DM2A 1OCCH 4UV8A 2H27A 1T05A 1I8FA 1IDZA 1RDWX 5EF6A 2JQ7A 2Y1JA 1RAEB 2VJJA 5JLWA 3GZ6A 3I4PA 4A93J 1UECA 3T1AA 4GNIA 1R58A 4AQYK 4JNEA 2MIOA 4EMKC 1J54A 4J7IA 5GAHJ 2OF7A 2PBIA 3JCMf 4RB1A 1U5TA 4GO1A 1DUXC 5LJ5g 2OPRA 4J6YA 3MZYA 3E6CC 1RAHB 3K57A 3GFMA 2EV6A 2IGMA 3F6VA 2P1JA 3OYYA 3S1QJ 1HNIA 3O9TA 4YORA 3SMSA 2YUOA 4EJOA 4BUPA 2VGNA 1U2VA 4WFNL 1EO1A 3THKA 1E7OA 1UG2A 2EK5A 1ORPA 2UV1A 2P9PA 3HGGA 4IUTA 3I56T 2A5WA 3H0IA 5CKEA 2E19A 2E1CA 4J9GA 4DYCA 4DZJA 3PIPF 3QB0A 2XF5A 2PJRA 1SD5A 1U06A 3I8BA 4CXFA 2JS0A 1WEIA 4CHOA 3PIOL 5CVIA 3OOUA 1ZRDA 4M41A 1UA1A 2IPOB 1WFWA 2NOEA 1ZGJA 5AQUA 4I2QA 2ASOA 4HVVA 2NOHA 2O2OA 2VQEK 3G2BA 1O9SA 2OTLI 1JJ2S 4XONA 4J9CA 2AP1A 5EXWA 3TKYA 5IT3A 1LDKB 4BRHA 5KQDA 4OIPF 4BVOA 2VOPA 1HKQA 2OANA 1LW2A 1NYGA 1S7OA 2HSTA 2YUSA 2O5RA 1B8IA 2K2MA 2RQTA 4ZYHA 1WHUA 2ECZA 2KT1A 2OZMA 4L18B 1HNZK 1VQ6Q 4RMOA 4NL3A 2P9UA 4BXFA 5LL6S 4BXUA 2Z1HA 3WU1B 1R0CB 2YT6A 2ZMEA 4QIWN 3JRHA 3BF1A 4C5IA 2O03A 2LNBA 3ZOBA 4PY5A 4P9FA 1U04A 2G8HA 1U84A 5J3BA 3VQ4A 5F1JA 3M0PA 1VQ4N 1ZLMA 3MP8A 3K4BA 1QSSA 4UNFA 2B0LA 3K1MA 1GVDA 2YG9A 1RBSA 1R9TJ 4EJYA 4FWRA 3CCQN 2V8JA 2KVQG 2PMZA 5GPAA 2Q31A 1B4AA 2P9SA 2VWJA 1IRZA 1YW7A 1RI9A 1U2WA 4C8OA 2HOSA 2HQRA 3DPTA 1KC8O 3UB5A 3TSWA 3DLLL 2IS3A 1ZBSA 2HVHA 3VFZA 2XROA 4H5RA 2HW3A 3UIQA 2ELJA 5KYYB 2OTJQ 1UHWA 3L2RA 1H8AC 3CUQA 3SQ4A 1UCRA 2X6XA 2W42A 1ILYA 1QWEA 4A0ZA 4DQRA 3F9KA 1OX9A 1VNDA 4LNPA 2XSJC 2CMPA 3UA7A 5J2QA 2ETHA 3AVLA 3WTWC 2NLUA 1A6IA 2Q0OA 3OW2M 5C24A 2F8SA 5BOXA 1ITGA 2XKOA 4HT9A 4D5FA 3LA7A 3KLOA 2JA6J 3O4WA 1Q1HA 1SAUA 2X4JA 2EB7A 5E18F 2CFOA 3VGLA 4DTOA 1T6CA 5ERIA 1WJQA 4CJRA 2NOGA 3GTQJ 1CXUA 1T33A 1PNJA 2LY2A 4O0JA 4NQWA 1MMGA 4RLFA 2ZNZA 3NGYA 1JLCA 1U3EM 3DXKA 1J0RA 1FLIA 2NUPA 3A8MB 5C0YA 3CC4T 4I98B 4A4EA 5FDLA 3FIFA 2DXIA 2IRFG 2BUDA 4HNVA 2X51A 1NJIC 4E9EA 3AG2H 1CLQA 4EPCA 3OJSA 2V9VA 1ZBIA 5IYDJ 2E2JJ 3K0LA 3BDDA 2DXCA 3R6SA 2KW4A 3VEZA 4CHNA 5EOYA 4LF9K 1GFDA 1Y6IA 3QXEB 2KRCA 1M1KC 5B3SH 3CQZJ 3LAPA 2F48A 1BOBA 3I55N 2GEMA 4NB4A 2ECCA 2RNAA 4GGGA 4IHTA 3QP5A 1VYUA 5KI6A 3G73A 4DMNA 2M0CA 5BREA 3VOVA 5F0FA 1FOXA 1RUWA 1TTHB 2FBVA 1X4OA 2WAQA 3VEXA 3CMEI 2XD0A 1J5YA 3VRYA 2V79A 2PNIA 1GOBA 2KKOA 2QCOA 3MJXA 4EIAA 2HPMA 2KLAA 2K02A 3OYNA 1FSHA 4N47A 3CPWA 1ZC6A 2F8TA 4D7NA 3FGUA 1ZHIA 1XMAA 3FXOA 1M1KO 1CF7B 1BI4A 2JMCA 3THWA 5J3LA 5EG2A 1Z77A 3BUZB 2WA0A 3IUCA 2P81A 3AO2A 2R7TA 1MUNA 2HEQA 4FU6A 3R0AA 2IAJA 2DAQA 1JJ6C 2HNYA 4L0ZB 3EZ5A 1TKXA 1VRUA 3PIOA 3RRHA 2JHJA 5HBMA 2FBKA 3G0QA 5CR2A 3U9ZA 1FKPA 3GLLA 1VQOQ 4UC4A 5DV5A 1YQRA 2A6TA 3K70C 1N6AA 1PKTA 1VQOT 1J59A 1U9OA 3KP3A 2CT4A 2Y31A 1U5TC 5J6XA 3R1XA 3D5RC 4BNCA 4G6DA 2F4IA 5FFXA 4UVAA 3M4OJ 1O4XA 3AARA 2X9DA 4DTPA 1JQQA 1A04A 2QWOA 2X4WA 4AG1C 4B44A 3V81A 3CM5A 3BY7A 2CS3A 3TO7A 5LRSA 3HSCA 5C2DA 4KJZA 2RK1A 3I59B 4CZZA 4RB2C 4GV3A 1R36A 1K1ZA 4A54A 2GQQA 2A6EF 5FPDA 2HGCA 2QBYA 4CZIA 2K5LA 5GPCA 3ULQB 1HPMA 1EP4A 2XAHA 3O6WA 2JVHA 2HOEA 3HJEA 3NFCA 2VG7A 2IGIA 2JOYA 2JJ7A 2RJCA 1VSKA 5GAHP 2L3QA 3TSPA 1HSQA 3G71I 1L3SA 2MLGA 2IJLA 2RAEA 1RGIA 2KISA 3PIPL 3SMPA 4CE9A 4BEHA 2QQ9A 2ME6A 1F5TA 2GBQA 2Q97A 4B9UA 4LOCA 1ETYA 2ETJA 2QEXQ 2RQVA 4DF8A 4GRIA 3OYFA 1BU1A 4HVWA 5BR9A 5J4YA 3CD6I 3CXCS 4TV7A 2EQIA 4C92G 4E9FA 4OIRF 2E41A 2OU2A 3NWTA 3ZEUB 2JN6A 1QCNA 2RDPA 1WBDA 1FC3A 1HKSA 3JAME 5HNHA 3A1PA 2NRWA 2QWRA 4CFCA 4DSFA 1YN8A 3CD6T 2EGEA 2JA5J 3PVQA 2OC6A 1VQ5T 3MN6A 3R6MA 4MMKA 2IBDA 3FXMA 3EQLF 3ZYYX 2L0KA 3N5BB 1L3VA 5D5VB 2YUPA 5H20A 4ABZA 1SQKA 2JTEA 5K5RA 2M16A 4MIMA 3CMAI 1XQPA 4LLLA 3C3WA 4EM1A 2NVQJ 3BTCA 3GBQA 5E3NA 3H5RA 3IKTA 1JLAA 4HZFA 3CCEI 3D5LA 4DQIA 2A5YB 2CG4A 4JLIA 2HKQB 4P9UA 3MP6A 1AWJA 3I56I 3CJNA 1I5ZA 4RGRA 2OTJN 4ZN3A 3HEFA 4Y33A 2LSOA 3IRRA 3MQ0A 4LIUA 2IA2A 1KG2A 2R5ZB 1GBRA 1VQNN 4FLTA 1W0UA 3RQIA 5AQGA 1WRJA 4XOPA 5EGOB 4Y28E 1FJGK 4ELYC 4IBNA 3I53A 1GFCA 2KBTA 1HQCA 2QKMB 2H8RA 4ZTJA 4ZC3A 4A3LJ 3O08A 4V19S 1SMYF 1VQ8I 4JRIA 2L3PA 1SUQA 4X65K 1YJ9N 2MD0A 1YJNQ 1NYFA 3ALYA 1HLUA 3AVBA 4M75C 1OCOH 1QU3A 1RR8C 3CC7Q 2DD5A 4OFEA 4IEJA 3DLLA 1TLHB 2Y0SN 4QS8A 2LJ0A 1WPYA 1RLPC 1ZBHA 1RDCA 2HDAA 4HW0A 4Z02A 2YLCA 2B86A 1Q7YU 1MPGA 3QEWA 2GTJA 3SUOA 4AYBA 4UUTA 1X3UA 3DXMA 2B63J 2Z1JA 3EZWA 2M0MA 1XNQK 5CQEA 1IDYA 4HUEA 1W5SA 1R5ID 1SKUB 1B72A 3A8YA 5J4VA 3VS0A 3RBBB 2LX7A 2V7YA 2DA5A 1JL1A 5AQRA 3MWMA 2RQPA 4NYNA 2IA0A 2F5KA 5I2SA 1VQMQ 3ISNC 4X64K 1XTAA 3ULRB 2X85A 5L3EA 4FVUA 4QSHA 2F1LA 6PAXA 2EA2A 4R79A 1NK6A 2L7ZA 1ZREA 3MDQA 3CMYA 2DQLA 1K9MU 3SBTA 1MBEA 2QA4Q 2ED1A 4H4KC 5DCFA 4JYAK 4RM2A 1NGIA 2WV0A 1HBXG 1TK8A 2CKKA 4FL6A 4KH6A 4PJMA 4H0EA 3KLNA 2XKOC 2K9NA 3CWAA 5GTIC 1M8VA 2CGJA 2E34A 2MCNA 3TAQA 1WA7A 1O7LA 2MH2A 4XN3A 5AQTA 5LJ5j 1VQMI 3NWSA 2BKDN 1WXBA 1BGXT 3D0SA 4MQ9F 4BQLA 2V52B 2LH9A 1OZ3A 4UY8I 3VS3A 4EJVA 2BYVE 2DVJA 3TU5A 2ZO4A 3IFRA 4X1VA 1Y71A 1P7IA 2EJ9A 2L2OA 2QZ8A 1PJRA 1S9EA 2C0TA 2X3XD 3LWLA 3RPUA 3C18A 4DWIA 1A5XA 2OZ6A 3F72A 2E64A 4BR5A 1U3OA 5DS9A 3D4VA 2LDUA 5GAMh 3JB9F 3MEVA 2RREA 4L5IA 4OFAA 2QEXT 2VC0A 3PX0A 3RRGA 3QU3A 1WBBA 4AHCA 3FFIA 1B34A 4BGBA 3OWTA 3H3NO 2AIRB 3KEOA 3UKUB 2FF3B 2V75A 2KRNA 1TUCA 1TKTA 4NHJA 2VPLA 1NBEB 4YY3K 3CD6A 3QBYA 5ICFA 1IGUA 4QVDA 1W0HA 1N6QA 3CP2A 3MO8A 3M54A 1VQ8T 2O8FB 5IHNA 4E6RA 4PJOA 4EM2A 4LK1F 5FPEA 2P0QA 4B9XA 4CZLA 3Q5FA 2K4BA 3KKRA 4BRDA 2IVWA 5EG0A 3P9IA 3EYZA 2RE2A 2EFIA 2ASPA 4H0OA 4EW0A 4RS8A 1KQ1A 3RI4A 1X1PA 4XNFA 1I4K1 4F7UG 4E7JA 2EJRA 1LCKA 3MAQA 5KN9A 1UB4A 1NJIR 5HDNA 4RTFD 2GZWA 5KNLA 4J9EA 4XU2A 2FSKA 1BW6A 2YJEA 1U49A 3DQVC 1X6BA 3JRFA 1D5AA 4BL0B 3MX5A 2RGVA 1VQNT 2PVOB 1F43A 3V4IA 1TT5B 3H0GJ 5DM6F 2YXYA 2XGEA 2EBPA 2IW5A 1ULYA 4M9ZA 1XUPO 5LGTA 4CJSA 1SEUA 4DOWA 4BR7A 2EW3A 3K2PA 3DLRA 5LEKA 3W6VA 1XSVA 4DTXA 2JMWA 1E2XA 3I0WA 2RJFA 4UV9A 2F9WA 1BO5O 1KAXA 2RV8A 2AZVA 4E2FB 1GLAG 5JLXA 1Y97A 4CEAA 3RPQA 1PU8A 4QLCU 3ASMA 3SEZA 1YJNI 5CAIA 1VQ7Q 1XSDA 4CJWA 2DO7A 1KG6A 4CK3A 4FLZA 5FLXE 1PUFA 3SHWA 3K5LA 2Z0WA 1DJ7B 1V4SA 4BWJA 3DLLF 1H1VA 2FBXA 2M8GX 3ZX2A 2ZD1A 2EFOA 1Y0UA 1KQSP 1E3OC 3E9FA 2V1QA 1WPKA 4IOAF 3F9MA 3LDNA 4LE9A 4C9YA 3IKVA 3CJ1A 3JCMJ 2DVEA 2NVYJ 3GG4A 5LY3A 2OFIA 1C0FA 1T38A 3JCMh 3C0CA 4LSLA 1T3VA 1FYNA 1W7PA 4O5BA 5I21A 4DCHA 2FX0A 3WNFA 3MXJA 4KNYA 2BE9B 1KHCA 2L3DA 3OHRA 1WQ2A 4FYWB 2RD1A 2HQXA 4IZZA 4EP4A 4A2AA 5LJ3h 1QA6A 2UUCK 2I5JA 4BRQA 3LAJA 1LEAA 3MKWB 2VQFK 4DS5A 3HZJA 3B6OA 1B9FA 1ZSZA 4BY6B 5ADXA 4ZHRA 1K76A 1HR0K 1A35A 1S6QA 2XY8A 2P84A 3J7YJ 3A8HB 4ZGEB 3ERED 5M1OA 4FJ7A 4IQ4A 2F7TA 5LJ5e 1YW8A 1EWRA 4DOVA 3TAPA 4AIDA 4CCKA 4KTWA 3H1QA 5CKFA 4J8FA 4YIRX 1I3QJ 1IAWA 1KVCA 1PRLC 1QKWA 4XU3A 5GANh 5H2FC 3ONQA 3FJ5A 1VQ5A 3VUZA 3FHNA 3EFSA 3VTHA 5AIQA 2QWLA 3ZCOA 2FG0A 2J4RA 3BDLA 1YJWI 4IUUA 2VC8A 3L4IA 1IHWA 4M42A 4C8LA 1H641 1ZTRA 2DBKA 1N39A 4KH5A 1VQ9A 4RW9A 1NNEA 2WADA 2EIKH 1F21A 4KICA 2LCCA 3QNNA 2ZF5O 3NAEA 3DLBA 3O1WA 2NUTB 5FD5A 2KEAA 5M1KA 4M3XA 2GX9A 4CF0A 1IRGA 3X28B 1M90O 5BS6A 5A2QZ 1IC8A 4DBHA 3PQJA 3GVAA 3VEPA 2VQCA 2QA4N 3MWPA 2EIJH 1IHVA 3D1NI 5J26A 1D0YA 4DNCA 1JE8A 3E1YA 2M87A 2D0NA 4JZ3A 1P2FA 4M7AA 2FZKB 3F0ZA 3A8LB 4M3RA 4RGXA 1D3YA 2O8DA 3C6HA 4LFUA 2R5YB 2HHQA 4XTWA 2PG4A 3QUIA 1BL0A 1M1KU 3VB2A 2GV9A 3CJBA 1R6RA 3EYYA 1X19A 2DTOA 3WTSC 1FP2A 3HBLA 5DLOA 1GBQA 1BISA 2J5OA 3L42A 3KLFA 4CJ7A 1T0HA 5IXBA 1XC9A 4FJLA 4GVEA 5J8CA 3CPWP 4BAYA 1WNSA 1H0MA 3R8EA 2HHWA 1U5SA 2VWBA 2ZMEC 3X2QH 2NNNA 4BRCA 1VQ6T 4RW4A 4ZNXA 4HLYA 3KCCA 2QXFA 3KD1E 4A3FJ 3M3ZA 1ESVA 2OTJI 1CZBA 3SK3A 3S32A 4E7SA 1JT0A 1VQ6I 1EX4A 2BEOA 2HEOA 4FT8A 1FEXA 1SRMA 2D6FA 4J2DA 3TEEA 3TR8A 1ZG1A 4IOCL 3H0HA 1S72T 3VQPA 1UG0A 1GLDG 1XG1A 4BR4A 1OULA 2AA4A 2QYOA 1T95A 1NK5A 3VQCA 1YJ9I 3LSRA 5GAEJ 5M3MJ 1SD7A 4CERA 3FR0A 3CCJQ 4JJDA 1A5WA 1JUMA 5JFRA 1RBUA 1B9MA 2E8AA 4RTUA 3ID6A 4L9VA 2DZ9A 3SQ1A 4AWXB 4EMGA 4G7OF 3AO5A 4FSVA 2P0WA 3CCSA 4JD2A 1KG4A 1RAAB 2DKGA 3A5OC 3LSMA 1NPPA 3GCMA 4W5TA 4YIIA 2YHYA 2F5DA 3CCVQ 1QVFM 4CEQA 3LAKA 1ZKGA 1N8RR 4BB7A 2O8CB 5D8KB 5GAMf 3CC4Q 4DFJA 2NRZA 3JB9I 3H0FA 2Q8KA 4MFBA 2G8UA 1ITYA 2KRSA 3Q3SA 3SHFA 4FTHA 4KITB 2Z99A 3H1CA 2DMPA 3OL4A 3UATA 1M2VB 2K7AA 3VS5A 3N5NX 1IXRC 1POGA 5FLXZ 2VT2A 3HC7A 1RADB 2WTEA 4HRIA 1U48A 4R5PA 1LWFA 2XKPA 3MCAB 4IHVA 2NYXA 3CCVI 4XEIA 3G6EN 8ATCB 5D6YA 4BRGA 2XHKA 2DOEA 4DV4K 2ZPGB 1RT3A 3I71A 4BQAA 3CQYA 1AA7A 4P5NA 4J6XA 1KVAA 1FPQA 2O01E 2N8GA 1JUSA 4Y3OA 1BK2A 5FO5A 3RMSA 1DGWY 4PJOC 1TUUA 4HV6A 1QTMA 4CD3A 2W6LA 1OH7A 4B3AA 4FT2A 1GLFO 1NJIO 2K3YA 3I56A 5GAN6 4ENJA 1RCHA 4CF9A 3HPOA 4I0AA 1QSLA 2LC4A 1OVYA 2KKZA 4IUQA 2CYYA 4KT6A 1HKTA 1FBSA 2WC2A 1NLOC 2B8AA 2X0LA 1RABB 4N4GA 3IL2A 2JTFA 3OIOA 4A5AA 1J09A 2DTIA 1W36C 1T8EA 4TVRA 4A69C 5A2QK 1K9MR 5ILUA 2VKVA 2LF8A 4CEBA 4ZN1A 2X4XA 4FL9A 5EEAA 2AXTC 3WTYC 1JXBA 4M3ZA 4ASNA 3CWTA 3M1CA 3R6OA 2RNGA 1FOYA 5KCMA 2CP6A 2K40A 4DV7K 3DB3A 2Y2ZA 4JN4A 1QQOA 3WNEA 1D5VA 1PD1A 2A41A 1J5EK 3PUBA 3SDZA 2BXZA 2PJRB 1NWKA 2YR2A 4K42A 3HSEA 3S6IA 4C8QB 4PK4A 1VQPQ 3RYPA 3O4NA 1RFQA 1IXCA 4M77G 1X1DA 3K4CA 4VUBA 2DAOA 2X9HA 4XRMA 2JVVA 3BJAA 1E17A 3CP8A 2P9NA 2E2PA 3FXUA 1I81A 1NK3P 3O3HA 1LDDA 3VQ5A 4M77C 3LWMA 1OYIA 2CT3A 4M7AE 5AZIA 1K6OA 4CBXA 3Q0WA 4FSSA 4HX8A 1K4US 5HDGA 1O13A 3LM2A 5GMKm 4CEDA 4BY9C 4B4CA 3QIOA 5LMNK 2XDDA 2OYQA 1DLOA 3I0TA 1UTIA 1QVGM 3VYTB 1QW1A 3CCLA 3CLQA 3EGXB 4N56A 1LUJB 2CUEA 4M6YA 4CZEA 3FIWA 5HNFA 3IAYA 3RYRA 1BM9A 2KDOA 4J2BA 1QP2A 4A4KA 3WQTA 1M1FA 3GIBA 1XGOA 1UGQB 4E1NA 2HHTA 5AZJB 2OTLA 2BXYA 4NOYA 5DLQE 4NB5A 2F5CA 3E5QA 4UXNA 1M8MA 2LMJA 1QVUA 3MHXA 1O3QA 2P7VB 2E1ZA 2KZVA 3LDQA 3GMEA 1PWTA 4JRPA 2EZKA 5KK1A 2P9IB 4B6MA 2H94A 4LF8K 4OKJA 3HL2A 3EN9A 5DCMB 4BHPA 1M30A 2BE5F 1Q95G 4OLAA 1PHTA 4LUDA 4RBOA 4LUEA 1WB9A 1IBMK 4LFBK 3MX2A 3QYBA 3QEXA 3DB4A 3K4KA 2G0EA 1P8ZA 3VETA 1M5Q1 4BBSJ 4LSNA 4KA4A 2R7OA 4JKGB 1B07A 4CFBA 3HK2A 2GNCA 3KLGA 3WQUA 5EX5A 4A5BA 4XK8E 5GAOp 4EZ9A 3OYLA 2ESWA 3PVLA 4B21A 4Q47A 4RTVA 1DPRA 4C2UA 3ME9A 2KI7A 2HWVA 1N5ZA 4NNJA 2FHDA 3HXLA 2E5ZA 3EG9B 2PAVA 5CYVA 3MKDA 3VA3A 1Y57A 3QLHA 4Y52J 3CC2Q 3RMBA 4XLHA 2ADUA 5GAOq 2O9SA 1ORNA 2OV7A 3H3ZA 4M3DA 4PLIA 2FMYA 4CJLA 2NYSA 3JCMb 1BR2A 2V1XA 2DW4A 3MD2A 1SZ2A 1TGOA 5AQHA 4UOBA 3GTPJ 5B1BH 3X25B 4CEEA 3J7YP 1E3PA 1TT0A 1Z25A 3W2AA 4CYCB 1VQON 1QQJA 1Z91A 4FJGA 4M75B 2EVRA 1TL1A 1WEGA 1Q82C 2GWRA 4KHNA 3QPTA 3CPFA 1EETA 2A7YA 1YFHA 3AAQA 1X2KA 1LB2A 3IH2A 2I7NA 2E6ZA 1YRNA 4XRSG 3DLHA 3SWNA 2ISYA 5F2RA 4O5FA 4FISA 2L01A 2O7OA 3NF7A 3DP7A 3DYAA 5E1XA 4MFDA 3DU5A 5C42A 3UA6A 4EFHA 1XGMA 5DUIA 3HI0A 1H9GA 3H6EA 4HPQA 5IY5H 3VJPA 1K6YA 3GOXA 3CCVA 1QHGA 5LEJA 5CQXA 4DU1A 1KLNA 4BRFA 3E5UA 3KZBA 1JJ2A 3M56A 4MGRA 1P90A 4Y7NJ 3UPUA 2LP5A 4PNOA 3P9CA 3C95A 4B9VA 3CC7T 3U9GA 2M02A 2HVSA 5LL6Z 4KUDK 3BTJA 4BQQA 3DEWA 2O4XB 4CGIA 1J5OA 1HRHA 3DCFA 2R7DA 4J9DA 2JRMA 4KRFA 2ZXIA 1MJBA 3A0HC 1KU2A 1NK0A 4KHUA 5JS2A 3KWGA 1YP5A 2EQRA 2DEUA 4KN4X 1U8RA 3A03A 1X27A 1LFUP 3LGFA 4CI6A 2ZXWH 1KG5A 4AF1A 1RBTA 4DV6K 1K73R 3CCJN 1RUNA 4E47A 1T98A 2Q2EA 4U87A 3KVGA 4DTRA 3BZKA 1S72N 3BFMA 3AA2A 1S1TA 4XU0A 1TWAJ 1WSFA 3OYMA 2VWFA 3E6DA 4RA2A 4RTWA 3JCMV 4IVNA 1OYXA 2DEQA 1R4NB 3HKZN 2RHKA 1VQKA 2TCTA 2W4SA 2A6HF 3WT0A 2HFHA 2JPSA 1MSFC 4A12A 1VQ6N 1FMKA 3TABA 5GANe 5E84A 1Z6TA 2A0FB 3RTRA 1MU2A 3BG5A 3S2WA 4PSWA 2NRVA 2QQ8A 2ZPIB 2OPPA 3CESA 3U2RA 4MNUA 1VQPN 4RTXA 1OKJA 2LOOA 1SHFA 2QM3A 2BY3A 3NQOA 4DU4A 3ZPLA 1SFXA 2WB1N 1NPRA 3BJ6A 1U0JA 1Z9CA 3DRSA 4A3DJ 1F1BB 1UGPB 1T6DA 3ER0A 4ETSA 1XHXA 2L5QA 1MBJA 1TG0A 5A2QE 1TYQB 4PDKA 5KAFC 1OJLA 1YHQA 4LD0A 2H09A 1JL2A 3CMEN 3TTDA 1HSJA 2A61A 3MMVA 1YI2A 1R22A 4A6EA 4MEYF 4DQSA 1WHMA 4IOAL 3I5UA 2HHHK 1WGXA 5HCKA 5KYXB 2X6SA 2HR3A 5GMKe 3ENOA 2DBBA 3LGLA 4DLGA 1YE9A 2E6NA 3OYAA 5GIOA 2K57A 3SFZA 2K85A 4CK2A 1BQMA 3HVRA 4C0ZA 3KJVA 4YPHA 4CJFA 5D6XA 2LVMA 4M7YA 4F55A 1N8RO 3PFIA 1RKTA 1IRFA 4ZYAA 4JI1K 1JHFA 4JJBA 3WHCA 3RSNA 3LYIA 1WYXA 1BA5A 3ABLH 1IJWC 2O8XA 1U2VB 1YITQ 1ZBUA 4J9BA 4K2EA 3OMGA 3P9KA 2KDZA 1VYVA 1LKXA 2CQNA 5DM6L 3WNHA 4O4GA 2V7ZA 2D8HA 1Q7YC 4YELA 3OMCA 4FJ5A 3B73A 3FK7A 1TVRA 5IAYA 1FMWA 3ZSXA 3U1DA 1ZXOA 3L2VA 2HVQA 3KP5A 5GANg 3TWHA 4JI8K 1HW5A 1QRYA 2UXCK 1SFKA 3OSFA 5L3DA 2R7WA 3CPWS 1W5TA 4EQQA 3GFIA 3CZ6A 5FFZA 3BR2A 1NGJA 4A53A 3HVTA 1I1SA 2BGCA 4AU7A 1MHNA 2LBFA 1GLBG 2Q36A 4QWQA 4CGHA 1TK5A 1Z0XA 2XG8D 3LX7A 4M7XA 1GOAA 1YJNN 2L4MA 5TJJA 3RDIA 2F4MB 2DL5A 3J80E 3DMJA 1S1NA 1AU7A 2Q3SA 3QERA 2EJGA 4C1NI 3VQ9A 2LKXA 4C5EA 2KFDA 4M63C 3G71N 4BDYA 4RW8A 3H3UA 1P7MA 2DFHA 1B72B 3FEOA 4MZPA 3VV0A 5D5UB 1YJWQ 1WSJA 3HUGB 4DBRA 3ZQIA 1D3BA 3L0QA 3OH9A 3VQEA 2D0CA 1JKRC 2XF6A 5DM7R 4N9HA 2P9SB 4U0YA 3LA2A 2ZGWA 2QQRA 4F2RA 3ZQQA 2K27A 5IXFA 4CCHA 1KONA 2DCEA 1LQ1A 2G7UA 3E9PA 3A02A 4HUGA 4JJNK 1N5YA 1GT0C 5T7BA 3CCEQ 4I6MB 4CJ5A 4DUYK 2P8TA 2X1EA 1ZQ3P 5KH6A 2EFWA 2LMDA 1M90R 3NH2A 3H5NA 3VS4A 2FNAA 2AK5A 1VQLA 3SZTA 5HLFA 1BOTO 1XQSC 2XASA 2X78A 2WWYA 1YS7A 3C7NB 1WJAA 2OFKA 2XHBA 9ATCB 3K69A 2PUOB 3QFUA 4BY6C 3F3XA 3IH7A 3VUBA 3QAHA 3JCMQ 3HT3A 4HF0A 4C92A 1WH5A 4U0VA 3LLRA 2MFZA 2F2XA 4K8ZA 5E3LA 3LFKA 4J83A 1WSHA 5BRDA 1C1AA 2DT7B 3NE6A 5IOYA 2PN6A 4M7DB 4AVZA 4KHQA 5CVUA 1M9SA 4CJVA 3QDRB 3RZDJ 2R0QC 3ERMA 2NLXA 4BI3A 3HSFA 5H1SQ 2E71A 3C12A 4ELVA 3LDSA 3P1GA 3GP8A 1F1ZA 4N9IA 1PVEA 2XV4S 4B3XA 1PP7U 5K14A 1M2OA 3NH0A 1SL0A 2D1XA 1W9HA 1ENHA 2CFXA 1MMSA 3UKUA 2LKSA 3P8DA 1VQOI 1LEBA 1G6NA 1YITN 1IN8A 3HL8A 5B1AH 2LY1A