4ZTFA

Crystal structure of the prototype foamy virus intasome with a 2-pyridinone aminal inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Discovery of 2-Pyridinone Aminals: A Prodrug Strategy to Advance a Second Generation of HIV-1 Integrase Strand Transfer Inhibitors.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna/inhibitor
total genus 103
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ztfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ztfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ztfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ztfA03
2R5AA 2O4GA 3HPHA 4DTRA 1YTAA 3DM2A 3ZSRA 1QQCA 3RWUA 2KFNA 2X4YA 4CESA 3KKSA 4HUFA 3V4IA 4II1A 3ZEHA 4A4EA 4DTSA 3L2VA 1WJQA 1S6QA 3E9FA 2L3RA 3DRSA 4NCGA 4QAGA 1G5VA 4B9XA 4LH4A 3V1OA 1LWEA 1HYZA 3HXMA 4FJNA 2RHUA 4CFCA 3KD1E 4LY7A 4XIUA 4A4HA 3VQ5A 3NCIA 2VWJA 5J2PA 4BE2A 3WNEA 1JLCA 4F2RA 2HHWA 3MEGA 2IS3A 3O3FA 3LAKA 3CEYA 2YHBA 3CFPA 4DQIA 3OYCA 3SPZA 3D45A 3MEVA 3ULDA 2FBXA 4E7LA 4KO0A 2OPRA 1LV5A 3QEIA 4AHSA 3TAFA 4M45A 3SJJA 4PY5A 4CJEA 4FJ5A 3G0ZA 1BHLA 2QK9A 4GW6A 4PL6A 3F73A 3SV4A 3LGLA 1JLGA 5EU7A 3ZT1A 3OMGA 2GBZA 4ELVA 3LYIA 2RJFA 3K5LA 4FJ9A 1HQEA 4OPJA 4KHNA 4CCHA 3AO2A 4DF4A 4JRQA 3AVMA 3LX7A 4FL6A 4Z4GA 1XI1A 4MQ3A 3V1QA 3ZCMA 4CJSA 3AVCA 4DG1A 3L2UA 1TV6A 5HROA 1WAJA 2PY5A 3I0RA 4CJ4A 4IKFA 4LSNA 4DF8A 3ISNC 4M3ZA 1ASUA 3V1RA 2IGIA 2OPQA 1A5WA 2HW3A 4CJQA 2MWOA 1LW2A 2ZQBA 3QEXA 1ZBIA 1VSHA 3MP1A 5HRRA 3LP0A 1JKHA 1ZBFA 1EXQA 1DTQA 3S3OA 1QSSA 4RG8A 3F9KA 1BQNA 3OY9A 4B9MA 3VN5A 1RT1A 2DTUA 2IC3A 4PQUA 1A5XA 5KCOA 4FJLA 3V9WA 2X78A 2YNIA 3QESA 4M42A 1HMVA 2P1JA 3OYKA 3H6ZA 1VSIA 1RT2A 4G1QA 2ATQA 3HO1A 3LANA 4FZZA 4DTOA 1KHCA 4FLUA 1W9HA 2B6AA 5C42A 3HYFA 1TGOA 4FJJA 1FKOA 2XK0A 4FCYA 3SUNA 2F5KA 3QIPA 4OGEA 1LWCA 1TL3A 4HUGA 5KE3A 3HPOA 1NK0A 3O8VA 4E19A 4N56A 4BE1A 4E89A 3VQ8A 2W42A 4KHUA 2X4XA 3ZSWA 4EZ9A 2K3XA 5CIUA 1S1XA 3OYJA 1D9DA 4ZTFA 4IURA 3M8RA 4DSLA 2X6SA 1F21A 1JXEA 5KRTA 2E6NA 4E0DA 4CHYA 3RR8A 3DOLA 1VSEA 4CJRA 4KPYA 4QQGA 3DB3A 2DY4A 4NCAA 2QXFA 1RI0A 3EYZA 2BE2A 4PWDA 4HCCA 4DFMA 2G8VA 3RRHA 4F4KA 3MP6A 3PY8A 1SKWA 3SQ1A 3OYAA 4HCBA 3TANA 1NK7A 1C0UA 2K3YA 2JGUA 4JLHA 4DLGA 3SUOA 3VQ4A 2P5OA 3DB4A 2Y1IA 2OZMA 4DU4A 3SQ4A 4Z0UA 4KAZA 3I8DA 3VQEA 5D6YA 3TAMA 3QIOA 2XO7A 3L2RA 3TABA 4KB1A 3BDLA 4J2EA 3QEWA 3Q1JA 4CF9A 3HVTA 3C95A 2D5RA 4FK0A 4KI6A 4CIEA 1HJRA 4B8CA 4DTNA 4CFDA 4CEBA 2RJDA 1UWBA 1RBVA 4BACA 4KTZA 4CFAA 3NHGA 4JRPA 2X4WA 1SL0A 5CYQA 3VQDA 3PX6A 2YV0X 4O4GA 4CHQA 5C25A 2KZZA 5I42A 2G8IA 3OJUA 4KREA 2LSNA 2RJEA 4CIFA 3TAQA 3LP1A 1RT7A 5K14A 1A5VA 3NH0A 4DSJA 2GUIA 1IO2A 1OZ3A 3OYNA 3OQ5A 1KRPA 1BI4A 1KVAA 1D5AA 1MU2A 4CJPA 4CRIA 1YT3A 3NH1A 2HHUA 3LP3A 4BDZA 1TKZA 4I2PA 1X1PA 4PUOA 1Z25A 4CE9A 2RI5A 3P83D 4UC4A 2RF2A 1K6YA 2YKNA 3OS2A 3MXJA 4DTUA 4KHYA 3MXIA 1SUQA 4E1NA 2Z1JA 2YNGA 3PFSA 4PLIA 3TR8A 3DRPA 2IG0A 4Z4IA 2RO0A 3ZSXA 2HHTA 2OPSA 3VQAA 1ZBLA 3QKJA 4AHCA 1EP4A 4FJKA 4L59A 3FC3A 4N4HA 1RT4A 3PO4A 4DQQA 3M8SA 2RJCA 4FLVA 3O3HA 1VSLA 4C8MA 4A4GA 1HYVA 3TWHA 4KHQA 3AA2A 4DTXA 3NF7A 3VQCA 2CKKA 4CGGA 4DTMA 1NKCA 4J2BA 2Z1HA 3L8BA 3M8QA 3SUPA 2L8DA 2D0CA 2EFIA 1LAVA 3V6DA 1NOZA 4IBNA 3RRGA 1QE1A 4AH9A 3CG7A 4Z4CA 3AA5X 1J9AA 4RW4A 4DQSA 2BUDA 4ZHRA 1ZBHA 5J2MA 1U45A 2FHDA 4AHTA 1SSFA 2OZSA 3O4QA 3LWMA 3AV9A 1Q8IA 3KK3A 1CLQA 2QKKA 4FM0A 4OKKA 2FC0A 4N4IA 4L8RB 4EDUA 5KH6A 3MP8A 4FW2A 1SL2A 4N41A 4FK2A 1KTQA 2P51A 3SNNA 4NCBA 1EETA 1WSJA 1RBTA 5KRSA 2X6NA 3KK1A 4B3OA 4DMNA 1J54A 4E7JA 3DYAA 3EZ5A 2BKDN 4OVAA 4DFJA 4H8KA 4FLWA 4RW8A 4B08A 4FJMA 1JXBA 1TL1A 5FRNA 3V9UA 1IKVA 3MEDA 3ZSQA 2YHAA 1T8EA 1IG9A 4KI4A 3SI6A 1WAFA 2OPPA 3LZJA 4IFVA 3LZIA 4CFBA 3RR7A 1GOBA 3K57A 1S5JA 3TI0A 3NBPA 4NYFA 1RILA 4KHSA 5CY4A 3B6PA 1X9WA 5C0MA 4CGFA 3MEWA 2F8SA 3T1AA 2EQJA 4DQRA 3VQ6A 3PUFA 4A4FA 3P5JA 3OYLA 1TAQA 3P8DA 3VA3A 1JLBA 4W5QA 3K5OA 3AO5A 5M9OA 3UIQA 4B9WA 4F2SA 3C6TA 2BANA 3SD4A 4FYDA 2BDPA 1ZYQA 2M16A 1HQUA 4X34A 3M8PA 3KD5E 3MXMA 4N76A 1O1WA 3HP9A 4OKEA 4B9UA 1SKSA 2RI2A 2F8TA 2E4LA 4M3XA 1ASVA 1VK0A 2VWKA 1NJYA 2XDPA 4DFPA 4B9VA 2QQRA 3V9XA 4LD6A 4DS5A 4GY5A 2RPIA 4H4OA 1RTHA 3E9GA 3OA6A 1BGXT 1Q9XA 4RW9A 4RW7A 5D3GA 3OYGA 5DMRA 3DI6A 3MAQA 1L3TA 3M9QA 4ELTA 4RG2A 4C8OA 3QJ6A 1U48A 5HRNA 4O5BA 2M1HA 1UOCA 3SUQA 2HHXA 4CJ3A 1W0HA 1C1CA 4ELUA 2VG7A 4OGCA 3FDRA 1T7PA 3HK2A 4FJIA 4OPKA 3IG1A 4DS4A 2BGGA 1WJSA 3NE6A 3C6UA 2HNDA 3AVKA 3PV8A 3JSMA 4QOZB 3SQ2A 4W5TA 4F3TA 3QEVA 4Z4FA 3AVGA 4FLXA 2ZD1A 1I3AA 1KLNA 4R5PA 4FM2A 3SQ0A 1EX4A 3LWLA 1S6PA 5IAYA 3PMIA 4DSKA 2X35A 4DSIA 3CYMA 4CK2A 2EQKA 3LPTA 3IAYA 3QNOA 4BWJA 5E41A 4Y1CA 1TKTA 5J2NA 4FU6A 1G15A 4M3RA 2KW4A 3DLMA 1L3UA 1BIUA 2OA8A 3S3NA 4FJGA 1B9DA 3U3YA 3VQ9A 3QERA 2EQUA 3FLGA 3QETA 4ZTJA 4CERA 1BIZA 1NOYA 1OYXA 1I39A 1LW0A 2O4IA 5KTQA 1VRUA 1WSIA 3NTIA 2OYQA 4W5NA 1BI4B 4AHVA 4N47A 2G3RA 3WNHA 3PMTA 4DTJA 1XHZA 3H8ZA 4CJWA 5HRSA 3QEPA 2DFFA 1TKXA 4H4MA 1WN7A 1L5UA 4O0JA 1FK9A 4HCZA 4KV8A 4K8XA 2YNHA 3L3VA 1TKDA 4C5HA 3AVNA 3EY1A 3KLIA 5D6XA 3TAGA 1EKEA 4M3YA 3ASMA 2FBTA 5I3UA 4M3UA 4KKOA 1T05A 2RHXA 1D9FA 4KB0A 4IUQA 4Q5VA 3RMCA 2L89A 2JZ2A 1S1UA 2VYTA 2HHVA 5C24A 4CJKA 2FBVA 4BDPA 3SYZA 2XY5A 2HVIA 1WSHA 3B6OA 4JS5A 4CJUA 4B8AB 1JLAA 3HVRA 1HPZA 3CFRA 5HLFA 1BISA 4CGHA 3BDPA 3NAEA 2JTFA 1RCHA 4MFBA 1JLFA 3V81A 1NK4A 1KSPA 1B92A 5HP1A 3NF8A 2E6LA 4AILC 1IKXA 2LDMA 3VQBA 2BIVA 1S1WA 3U6FA 3ZT0A 1TK5A 4GVMA 5C6SA 2QKBA 1TAUA 4I7FA 2HVHA 2DIGA 3CFOA 1KFDA 3QO9A 1VSDA 3F70A 1RBSA 3AVLA 4KFBA 4O55A 1NKBA 2RHIA 5JS2A 4CEDA 3MEAA 3OYHA 3AO1A 3IS9A 2IOCA 4LD0A 3E01A 3V9ZA 1D8YA 1WSGA 1N27A 1VSMA 4C8KA 5D6WA 3OS0A 3CM5A 1NJXA 2KQ2A 5CZ2A 2XY8A 2KTQA 2VG6A 4K8ZA 4C8LA 2NUBA 1CZBA 3C4SA 2D0AA 4CIGA 2A1SA 3K59A 2DIQA 5CYMA 4O0IA 4J2DA 1HYSA 4C5GA 5J1EA 4KTWA 3PO5A 3NNQA 1BQMA 1GOCA 3BGRA 3FFIA 5J2QA 4IFYA 3ZT3A 2XY6A 3LAMA 1RBUA 1YTUA 2G8FA 1TVRA 4BE0A 3PX0A 3OS1A 1JLEA 5DK5A 1UA1A 4IUVA 1B9FA 3AVJA 2RKIA 3WNGA 4BD3A 2R58A 4CHZA 3K5MA 2WACA 2G8WA 4KTQA 1Q9YA 2X74A 2XHBA 1KFSA 3JYTA 4C8NA 2XRIA 4KHWA 1RT5A 1WJRA 4CHNA 4Z4HA 3PNWC 2RHZA 3LGFA 2Z1IA 4HUEA 2YRVA 4B9SA 5SWMA 4C5EA 4Y1DA 4FZYA 3ZT2A 2P5GA 3OVNA 2PZSA 3H08A 4QW2A 4EP4A 3QLHA 3AVIA 5FRMA 3AVBA 2DFEA 2ZE2A 2LCCA 1RT3A 4DWIA 1NK5A 3NDKA 3ZT4A 2O4XB 4CJTA 4CF8A 4DSEA 3LH0A 3NFAA 1N6QA 1QSYA 1JLQA 4M3TA 4M41A 2EKOA 3ME9A 2P0KA 4IG0A 4IDKA 1WSEA 4ID1A 4CF0A 5KE2A 1ZBUA 4CGIA 4YFUA 4UQGA 2Y1JA 3NF6A 3LP2A 3SZ2A 2EX3A 2WOMA 4CF1A 2DAQA 3D0PA 1C1AA 4CEEA 4JS4A 1Y97A 1RDCA 4Q5WA 1IH7A 1MHNA 1HRHA 3T3FA 4IUPA 3VA0A 3QNNA 4F3OA 5FROA 2B8AA 1SV5A 2Q3SA 3L42A 3ZSOA 4CHPA 3KLFA 2D9TA 3DLEA 2R7YA 2ETJA 3GOXA 4FW1A 1CZ9A 1SKRA 4FZXC 3P8HA 1ASWA 4FJHA 3KIOA 1XHXA 4E7IA 3HPGA 4HTUA 1DTTA 3VQ7A 4OVLA 3VQQA 4FVMA 2VG5A 5J26A 2E6MA 3QIIA 4EZ6A 3LDSA 4QQDA 4FK4A 4E7KA 4I9QA 3ZSZA 3L3UA 4FM1A 5KCHA 1S1TA 1TK8A 5FDLA 3K5NA 1VSFA 4GMJB 4E7HA 4OLBA 2O4XA 3L2QA 2GF7A 3OJSA 3CQ8A 1TK0A 3TAEA 2EHGA 1S9EA 2GV9A 3KLEA 5CZ1A 2LRQA 1U4BA 4FJ7A 2R57A 4HVJA 2RHYA 4RW6A 1U49A 5KGWA 5HRPA 4B9TA 1KLMA 5J39A 3OYDA 1T03A 3NTHA 3SCXA 3KKRA 1IKYA 4CEAA 3LPUA 3DLKA 4FJ8A 1YVUA 3RTVA 3RMBA 1L3SA 1Z26A 4BDYA 1FKPA 4J2AA 3C94A 3UWNA 1QHTA 3SV3A 1S9GA 1J5OA 1NK9A 5JS1A 4FXDA 1QSLA 1L3VA 3ASKA 3LLRA 3KTQA 2IDOA 3ALYA 3DRRA 1HNIA 2PQWA 5KGXA 3KLHA 2HNYA 2LTOA 1BCMA 2QQSA 1RTJA 1BCOA 3DLRA 5HBMA 1NJWA 1X9MA 4QVZA 3HT3A 1NK6A 3OYEA 4CHOA 4NS5A 4CJFA 3KK2A 4CEFA 3FEOA 1VRTA 1ITGA 4Z02A 4FLYA 3EAEA 1H3ZA 3OYMA 4C5IA 3TAPA 2YNFA 2R5MA 4CK3A 2PYLA 2GFUA 2E5QA 4OKJA 5IN1A 3AA4A 1NK8A 3IRXA 3O3GA 3O4NA 1RTIA 3OYIA 2F96A 3AVAA 3OMCA 3G10A 4DU3A 4YNQA 2HHSA 1JL2A 2HMIA 2NLUA 3HSTB 3NGIA 3LALA 4CEOA 1KVCA 3NTKA 1RDBA 1JL1A 4NYNA 3HL8A 3AA3A 3OB9A 1J53A 3OYBA 4WE1A 1RBRA 1BL3A 1NKEA 3MO8A 4N5SA 3P1GA 1RDAA 4W5RA 1U47A 3CM6A 3MEEA 3QINA 4DQPA 3T19A 4DLEA 3K2PA 1RNHA 1FXXA 2MWPA 2KFZA 3PX4A 4Z4EA 4DSFA 3TARA 4O44A 2FBYA 3L2WA 1DLOA 2B5JA 1CXQA 3META 3THVA 4TSXA 1X9SA 3A2FA 1R0AA 2RN2A 1WLJA 3DMJA 4FJXA 2Z1GA 1WGSA 2AJQA 2KZMA 3NF9A 4ID5A 1C6VA 3HM9A 4N4GA 3SPYA 3UT1A 3RMDA 1IKWA 3DLBA 4OJRA 3KUFA 1NJZA 4CECA 4IG3A 3NH2A 1UA0A 2G8HA 1VSJA 2ITGA 1OZ2A 3DLHA 4CGDA 5T7BA 4DFKA 1N5YA 4IUUA 3AVFA 3I0SA 4I9LA 3HJFA 3KLGA 2HNZA 4BWMA 3WNFA 4B9NA 2LVMA 4CEZA 1LAWA 1XNIA 4CJ5A 3ZSVA 3ITHA 3NGZA 4PA1A 2WONA 2M0OA 1UAXA 4AHUA 3MEUA 5SZTA 3ZSYA 2JLEA 4CJLA 4LH5A 3AO4A 1WNSA 3K58A 2HHQA 4LSLA 4CEQA 4KRFA 3DLGA 3RMAA 1GOAA 4W5OA 1OI1A 1HNVA 4B9LA 4DTPA 4CJVA 4AHRA 4CF2A 2IAJA 4Q0BA 3V9SA 1REVA 1LWFA 1C1BA 2G8UA 3MECA 4OLAA 4F8RA 3KJVA 3AO3A 2HB5A 1KVBA 3U3GA 3OYFA 1KCFA 4ICLA 3AVHA 4CK1A 4EP5A 1U04A 4NZGA 4DU1A 4M3WA 3VQPA 4QCLA 2A1RA 1SL1A 1XC9A 4E3SA 2GFAA 3S9HA 4I2QA 3S6WA 2PYJA 1C0MA 3S3MA 1QTMA 4CGJA 2HQXA 4FLTA 2EQMA 3QBYA 2HQEA 4E1MA 4QQ6A 1VSKA 4FLZA 3NGYA 3DOKA 2YKMA 4HHTA 1C0TA 2B4JA 2D0BA 1S1VA 1QS4A 1RTDA 1RDDA 2DFHA 2G8KA 1XWLA 2XY7A 2I5JA 4PLLA 3HP6A 4IUTA 5KI6A 2RI3A 1WSFA 1CXUA 1RT6A
chains in the Genus database with same CATH superfamily
1PD1A 2R5AA 5HKCA 3HPHA 2PN6A 4HV6A 3KFVA 2LF7A 1X75C 1IV0A 1VQ9T 4MDAA 1QQCA 3I9V2 3JAME 1QU3A 1VQ4T 1YJWA 4XLPF 3CCEA 5H2FC 2X4YA 4CESA 3V8LA 4DV1K 5JR3A 2YHWA 3JRBA 3TMOA 4A4EA 2YHTA 3J80E 1YJ9T 3K9JA 1ZKGA 2DL7A 3SDGA 1X27A 3RKWA 2RNGA 1GXQA 3M56A 1HOMA 1NGBA 3DRSA 2DZCA 4B9XA 4LH4A 3E66A 1VQ8A 4M75C 2PMHA 1JO8A 3NMZC 3V1OA 2R7XA 1LWEA 3HXMA 3JV3A 2LFBA 1NZ9A 4X66K 4A4HA 1UECA 3WU2C 4MLOA 1XSXA 1UFMA 3JXUA 3WNEA 3MN6A 3W3DA 4XTZA 3MEGA 3O3FA 1ZHFA 4H0PA 1OKJA 2CZ0B 2YHBA 4DQIA 3OW2M 1VQOI 2UV1A 3CC4A 2Y69H 1JBMA 3OYCA 5MLCQ 3G71A 3SPZA 3D45A 3IAS2 3ZMZA 2CZ1B 3MN5A 3VYHB 3N4QA 2FBXA 4OFHA 3ZLJA 4AHSA 4IJNA 1K8AR 1YIJA 1HNZK 3BQYA 4ENJA 6PAXA 1NJIC 2LREA 3FK7A 4XIDA 3SHWA 2XDVA 2LJ1A 2DERA 3CJQB 1NLPC 2HQNA 2YJFA 3ESWB 1BOTO 1HU0A 2DXTA 2KNBB 4WQ5C 3SV4A 4ZDOA 3LGLA 1JLGA 4CGZA 4C1NI 3ECOA 2J6FA 4FPBA 2RJFA 5EEGA 3A5ZB 3K5LA 5L3BA 1R7JA 4FJ9A 1FW6A 1T6DA 5AONA 4B3SK 5J6XA 4KH1B 5IOYA 4HCKA 1BI0A 4DCHA 1VQMQ 3CCVT 3LX7A 1RAHB 4FL6A 2Z1DA 2MCNA 1IZ6A 1DP7P 4RCHA 1MWKA 3LA3A 3V1QA 1OPLA 1IRZA 1WI9A 4M75B 5DEQA 2F69A 2XPWA 1KG7A 3Q7BA 4AD9A 4AIHA 2HMAA 4LG0A 1TV6A 2LR8A 3I0RA 4AM6A 4IKFA 4DF8A 3ISNC 1W1WE 1N8RO 3BY6A 2IGIA 4XEIA 2HW3A 2QI2A 3ABLH 4HNUA 1BI1A 4HSRA 3VESA 3QU3A 3GPLA 1XGNA 2IVWA 3MP1A 1AEYA 5HRRA 2OTJI 2D5VA 2OTJN 5JMVA 3ZQ7A 2HPIA 3QSUA 5GAN7 4PFZA 3Q7CA 3F9KA 1IN7A 5KQDA 1TL8A 4AT1B 1MBHA 1YW8A 4PQUA 1OKRA 3SJHA 4C8QG 3V9WA 5EEAA 3MWTA 5AZIA 3WXMB 4JNEA 1Y7XA 2EIMH 3H6ZA 4MQ9F 1RT2A 5CJ9A 3BZKA 1JE8A 3FMSA 5CVIA 4IF4A 1PSFA 1W9HA 3DXMA 3L9FA 3G6EN 2XGXA 1FKOA 2DDBA 2VVKA 3QIPA 4MDWA 1W2BP 2A05A 1M3HA 2FE3A 1MBKA 3JCMW 1K8AC 2R7VA 1HKTA 2A41A 3BWGA 4N56A 4HT8A 2W42A 4AIDA 2K3BA 4L5JA 3KE2A 2EKHA 2K3XA 2EGAA 3AGKA 5HOOA 5HL7L 1S1XA 3OYJA 2JA8J 1K9MR 1DGWY 4Z94A 2JM9A 3M8RA 1F1BB 2X6SA 4CCMA 1JHHA 1YG2A 3RR8A 2E2JJ 3LL7A 1FSEA 3SYTA 1D0ZA 4KN4X 2QM1A 2J4RA 3X25B 2DY4A 3CCQQ 3B02A 3PQJA 3THYA 2I5UA 4I99C 1X43A 1GVDA 3OW2S 3CPEA 4HVUA 2LY2A 3BDUA 5KVRA 1XQHA 2B0LA 3F21A 1RRJA 3H35A 3HFNA 3JCMc 2M4GA 4EJTA 4F4KA 1ETKA 3MP6A 4NL2A 1YJNA 3FGUA 2IVPA 3PY8A 1SKWA 1ZLMA 3SQ1A 4YG2F 5AQVA 2OQGA 4DLGA 1NJIO 2HHHK 3E6DA 3I8DA 3VQEA 1JJ6C 1D8JA 3TAMA 3I56A 2LKXA 1ZSZC 2XO7A 2L3QA 2QEXQ 2QWRA 4J2EA 4OAYA 4M7AF 1H92A 3SFZA 2R7UA 4ANJA 1JUMA 4NQWB 4JLGA 5HY6A 2KRSA 3MPUB 4B8CA 3CMEI 4BACA 3RIRA 1Q82O 2GXBA 2JM8A 2P9SB 2P9NA 3WU1B 4C0ZA 2AXLA 9ANTA 1IGQA 3H3UA 1P2FA 3KVGA 4LB6B 3CCSQ 2NUTA 1BKBA 3PX6A 2ZMEC 1XG7A 3LSHA 2OTLT 1BA5A 1TWBA 1UGRB 4PCQA 3JB9F 4AYBN 3LP1A 2M45A 5GMKm 1ETYA 4E9GA 3CQTA 3J81K 1TUGB 3OYNA 1OR7A 4IHWA 1MIJA 1VQ4I 4ZZDA 1UHSA 4GFBA 1KVAA 4JI1K 4XKCA 4L18B 1KG3A 4BGAA 4HXJA 1KU2A 2L4MA 2K4BA 3NH1A 1ZBJA 3FHZA 1AT1B 1YJ9I 1TKZA 4I2PA 2M0CA 1X1PA 2ECZA 4PUOA 4FOEA 5GMKh 1K9MC 4BC4A 1K6YA 5KHDA 3PIOL 2K5IA 2A6AA 3MN7A 2HXIA 3OSFA 3MXIA 3LA7A 5CQEA 5KAIC 2E2NA 1VQLT 2LNHB 4RB1A 3HOWJ 3HKSA 1PKSA 3ERED 2M5WA 1FEXA 4FX0A 4XICA 2RO0A 3ZSXA 2HHTA 2LDUA 3CC2Q 3BOQA 5LJ3h 1W36C 3F10A 1HQCA 1IDYA 5A2QE 1K4SA 3S16J 3QKJA 4DR2K 1RKWA 1RAIB 1VQMI 1UUEA 1ZSZB 1VQMN 3FC3A 4N4HA 2YSQA 4YOQA 1GLNA 3CC7A 4EGYA 4PKGA 5BRDA 2KJBA 3GZ5A 2P0WA 1U1TA 3HKZN 1K8AO 3GZ6A 2DPNA 4HRIA 1VI0A 2XASA 2RQWA 5C2DA 2R7OA 2FZCB 1U3EM 3O2PE 4IOAF 4MLEA 4XH5A 3QOEA 3NF7A 1J2XA 3D0SA 3CUOA 4J2BA 3M8QA 3SUPA 2FOKA 2EFIA 2ZMEB 1LAVA 1NOZA 4IBNA 4UOBA 2R7DA 1QE1A 2O8KA 3CG7A 2NRZA 2UYTA 3IFRA 3AA5X 3OBYA 1ZGWA 2DO3A 1J9AA 2HD0A 2XF7A 1IGUA 5GANh 1MV0B 4XLCA 2BUDA 1ZBHA 5J2MA 3CBOA 5CKFA 1U2WA 2GQVA 2FG0A 3LWMA 5GJWB 4EIKA 3QAHA 1XSVA 3LW5E 3IKVA 2M51A 3U4LA 1WH7A 2JTMA 1U5TA 3FRNA 4N4IA 3CCVI 2YWWA 5KH6A 4FHTA 3MP8A 3DPTA 4CH7A 2DILA 4A6DA 1SL2A 3PO2J 4J9CA 2UUZA 4M77E 3FIFA 3M5AA 2P51A 1E7OA 5AQYA 2DYIA 3OOPA 3P39A 1EQYA 4Y13A 5L3FA 4NCBA 4G6DA 5LGUA 5E8GA 3EO3A 3MD2A 3I35A 1WI7A 1RBTA 4CD1A 5KRSA 4PFPA 1MBEA 2V79A 4IQ4A 1GLJO 3KK1A 2J05A 1D0XA 1WJCA 1J54A 3JREA 5LHHA 2M7AA 1X2QA 4G12A 3VW4A 2BKDN 5HK0A 2IS4A 4EJVA 3R6OA 5L3DA 3CCMT 2ATCB 1TL1A 1PU8A 2DQRA 3MEDA 2XG8D 1QHHD 1JJ2M 1E4FT 4AUXA 2WC9A 3ZSQA 5C12A 2VUMJ 4XKBA 2YG8A 4MO5A 4Y3OA 4QT7A 2P0QA 1IG9A 1MKMA 3VETA 4HBLA 2DDAA 3LZJA 4IFVA 1NHAA 4CC7A 3CUQA 5GAOm 5EX5A 1FOWA 1ZRCA 2EK5A 3CCQN 5CY4A 5M5XJ 1V55H 4BRMA 4A59A 3MEWA 3S17J 3ZQFA 3A5NC 4EMSA 3LM9A 4J01A 3T1AA 1RGIA 4M77A 4DIQA 4DHYA 3FBNB 1TSFA 3B6AA 4BRHA 3M0QA 2VJ5A 3C65A 1R0BG 3LSKA 1K9MO 2DJQA 2FA5A 3ZQCA 3VA3A 2MA3A 1BYMA 3VEYA 1MW7A 3ZN0A 3K5OA 3ZQLA 1SF9A 5B1AH 4B9WA 2QEXN 2IGKA 4ZH4F 1SVLA 3JAMZ 2BANA 3D1NI 3T9NA 3SK3A 4FYDA 1Q95G 4ATOA 2QTDA 1BI3A 2W6LA 5DM7F 1Q18A 2DI3A 3MXMA 2OF7A 4HF0A 3CDLA 2QK0A 1H88C 1SKSA 2FD5A 2KROA 2RI2A 1JGGA 3CCJT 5EVZA 5AYFA 4KH6A 1IBKK 1H3HA 3CCSI 4DV7K 3CCSN 2BZTA 1VQ7T 4OX9K 1NJYA 2ZPIB 2VQFK 2QQRA 3BTJA 3FE1A 4G7ZF 3I58A 1Q9XA 3E5UA 5D3GA 4RW7A 1IRGA 3OYGA 2YCHA 5DMRA 1NEBA 3MAQA 1RPWA 3EH1A 5HRNA 1XMQK 2X0LA 2W84A 4DV3K 3SUQA 4BGBA 4HQEA 4CJ3A 3HRTA 3CF2A 2VXEA 4G7OF 1PP8F 1HKGA 2HKNA 2NRRA 1G8XA 3KNTA 4OGCA 4GO1A 4FYVB 3FDRA 3HK2A 4DR1K 4FJIA 2L0KA 1BL0A 1WJEA 2QAZA 1WJSA 4F7UE 3C6UA 4JV5K 2JQ7A 1W36D 1QNTA 2XICA 5HVQC 3DJCA 4JX4A 4GLKA 4EJYA 2DBKA 4FM2A 3SQ0A 4C2TA 4HVWA 2ZCWA 1BA0A 2YHYA 3CC2N 2IS2A 2GIVA 2X35A 4DSIA 3R1XA 5GIOA 4FYXB 1WNLA 3P38A 3T8TA 1H0MA 5F1RA 3QNOA 3O5BA 1BG3A 4CJ7A 3L09A 5F1XA 2L2OA 1WYXA 4YIIA 5J2NA 2CO5A 3OSVA 4M3RA 1VQKT 2NLXA 2K9SA 3DP7A 3S3NA 2QA4T 3CD6A 4FJGA 3VF6A 4XOPA 1R4MB 3VQ9A 4ZTJA 2Q2RA 3PSFA 1KC8U 1JJ2S 1FNNA 4KBMB 4CERA 1I39A 2O4IA 3C2BA 3TP3A 2Y9YA 4F7UA 1WSIA 1BI4B 3GE1A 2G3RA 3A8GB 3WNHA 2RQUA 1PVEA 4CJWA 2JPCA 5HRSA 1RUWA 4H4MA 3F5TA 2ETHA 5GAMd 4O0JA 1W0TA 2YNHA 3C12A 1ETWA 3Q5FA 1BN5A 2B63J 1RI7A 3TQ7P 3AVNA 1R9TJ 5GAMj 4LLNA 3QODA 3KLIA 1GCQA 2G6FX 3WXJA 3FZFA 4LFBK 3JCMb 4JKHA 2LRDA 1VQOA 4M3YA 3VSLA 2PFUA 4XQ3A 2QA4Q 4KKOA 1T05A 2RHXA 3VYUB 1VQ6A 2L9RA 1BO5O 5L23A 3DLLL 4YOYA 1B9MA 1ZAOA 5IHIA 2OBPA 2JZ2A 4L9NA 3WU0A 2SRCA 2FBVA 4OAZA 5HS9A 4BHBA 1Q7YU 5ERIA 1TLHB 2OPTA 1YCSB 2MF2A 4EMGA 4JKBA 3EEQA 3EG3A 4JS5A 1JTYA 5LHIA 1IJJA 5FPMA 1JLAA 4PIIA 2EFWA 1SG5A 3CFRA 1BISA 3CVSA 1R5GA 2NRTA 3V7RA 2VQCA 2KKOA 5BPLA 4NC6A 3VEPA 2JTFA 2D1VA 4HSBA 3ULEA 1QW1A 1Y57A 1RCHA 4QVCA 3S1MJ 4QPQA 3EGDB 2ZXHA 2OCEA 4D7MA 5C44J 2OU2A 3HZJA 2ESHA 4AI5A 1VUBA 5GAN6 3KK7A 1BM9A 3RKYA 3ZT0A 4M75G 2YT6A 2R5ZB 3L2ZA 3K4JA 4GVMA 2QKBA 1FYMA 3I59B 1ZELA 5GAGJ 4I7FA 3NEUA 3MMYB 1KFDA 2AHQA 1VSDA 1PVSA 1RBSA 5KK1A 1YQLA 4CHUA 3QPHA 1MUDA 1ACMB 3CCMI 5CVVA 3TCJA 4E47A 1YUWA 3MEAA 2NNWA 3AO1A 3HRGA 3IS9A 4OB0B 2R4GA 1J3TA 2CWEA 3V9ZA 4XMYA 1D8YA 3FZVA 4DB3A 4AFQC 4N9HA 3OL4A 4IOAL 3J7AO 1VSMA 2DMQA 1FX7A 5EGOA 3CM5A 4M77F 3U9GA 1DEJA 1FT9A 1N33K 2VG6A 1CF7B 3M6GA 4L9TA 2L7KA 4K8ZA 1RC9A 4C8LA 2NUBA 4ELZC 2LP0A 4LC9B 3C4SA 2D0AA 3K59A 1WEFA 1WRJA 4J2DA 5J1EA 3X26B 4D8KA 1IUFA 1KSWA 3PO5A 3NNQA 3O9RA 3CVTA 3H0HA 3A01A 5J2QA 4KH0B 4RDUA 2JA5J 3G4ST 3ZT3A 3R3LA 4I6ZA 4QSHA 4N4OB 4LIVA 3RJPA 5IT9O 1YTUA 2IA0A 2G8FA 3DBRB 4KICA 3T0YA 3OH6A 4BE0A 3H0DA 2H94A 4G6TB 4CBUA 4PJOG 1P8ZA 2X3WD 2CW7A 2RKIA 3WNGA 4BD3A 2R7SA 2JXBA 5IWAK 1G59A 4FT2A 1SC7A 4RB0A 4B1XB 1Q9YA 1NWKA 4HZFA 2X74A 1A04A 2O2OA 5FPEA 5AQHA 4C92C 2NOFA 4J8OA 3CCJI 4KULA 4XU0A 1DGKN 1RT5A 2A40A 4MQVA 1KG6A 2ITMA 2JSPA 4DA4A 2RHZA 4EJUA 2IS1A 3LGFA 3HUGB 1VQ7I 2ELJA 1RUNA 1GVJA 4C8QE 3GTMJ 4Y1DA 4FZYA 2P5GA 2IA2A 5FKNA 4CCNA 4QW2A 4JQFA 3QLHA 3AVIA 5ICFA 4LE9A 5E1ZB 3G4SQ 3HHGA 4HLXA 4XR6A 2OFKA 4IRIA 1S72Q 4F7ZA 1BBYA 3LDNA 3OL3A 5K7FA 3RCOA 1BWFO 3NVMA 1P9QC 2D6FA 3E6MA 3TOAA 2CJJA 1T33A 1WSEA 1M2VB 4M3FA 3FSPA 2Y1JA 4YFUA 1E6GA 5AQMA 4XTVA 2EX3A 5DLQE 1A35A 3LWHA 3LSIA 1QCOA 2PFBA 1GDTA 4JZ3A 2ISZA 3NGPA 2P5KA 3G7ZA 3CMEA 1MHNA 4M63C 3T3FA 2VBXA 3I0WA 3QNNA 4F3OA 2H8HA 2Y48A 1QVUA 4JKAA 1SV5A 4HA8A 2IVOA 2Q3SA 2CMPA 2RH2A 1FYLA 1OU9A 4C8QA 4CHPA 1ZTRA 3KLFA 3DLEA 5DM7L 2QDLA 2ETJA 3WODF 4IOXA 4M7DC 3TGNA 4FM4B 3HBLA 3SLCA 5KYYB 4WFBL 1K9AA 1O4XA 1SKRA 4BHPA 2HZDA 2QGUA 5F08A 1ZX6A 1VQ9A 1I1SA 4F7UF 1WB9A 1VQKI 2TRTA 1YE9A 1ODDA 1VQ4A 2WAFA 4C92B 2QA4I 1HW1A 4E7IA 1P7MA 4RB3C 2QA4N 2UUAK 3EKSA 1DTTA 1U78A 3TREA 2CUDA 2DAOA 3WTVC 1WKMA 3EFRA 4X6AJ 3QIIA 4EZ6A 4KA4A 1QQJA 3A02A 4UV8A 4E7KA 1YJ9A 3PL8A 3C1DA 1O57A 4KMFA 3IH3A 2BE7D 3KLOA 2D8JA 4NL3A 3SMSA 5I11A 2YUNA 3K5NA 1MDMB 1VYVA 1VSFA 4GMJB 4E7HA 4OLBA 1FYNA 3GNGA 1TQMA 1R58A 2GF7A 1OQYA 2ZWHA 3CQ8A 2FZGB 1U06A 3R8EA 3KETA 2CGKA 2XGCA 1YI2T 2RHYA 4ZYGA 2A5WA 1U9NA 3H5AA 2HTSA 4P5OA 2PUKB 4XKVA 3KZBA 3OYDA 5AQXA 1LWVA 1NTCA 1FBSA 2HSTA 1OVQA 4CEAA 2NOZA 5BNGA 2X4JA 1Z26A 4BDYA 1N39A 2LJ3A 3QRFF 3K1PA 3C94A 4R0KA 4DZJA 1QHTA 5IT3A 5CKEA 4FWMA 3SV3A 3SFMA 3GG4A 3QQAA 1IN6A 1KONA 5JS1A 2QQAA 2M1BA 1W6XA 3BG9A 3LLRA 3KTQA 3H41A 5AQRA 5HNHA 5HDGA 4FYWB 2EQIA 4A5NA 2PQWA 1Z0XA 3HJEA 2JOYA 4YPHA 2G7HA 1ZYRF 5CVUA 4M7DB 4O8UA 4AFUC 1M27C 1BCOA 2DEUA 3DLRA 1Y8QB 3QYBA 4XLEA 4DR5K 3OW2A 1NJWA 1QO0D 4QVZA 3WG7H 1QP3A 1NK6A 2LC2A 3VPRA 2HWVA 1LQ1A 2HOSA 4J5YA 1IJWC 2GX9A 2V51B 2WTUA 2VBYA 2HBMA 3UE5A 1CZAN 4ZYDA 4DOZA 4CEFA 3FEOA 4YOUA 3CCVA 4YIRX 5GAN2 4IOCL 4S04A 2YNFA 4EAHD 1SEUA 3RDIA 2D0QB 2DE0X 3X28B 2ZSHB 1TUCA 4CZCA 4CZIA 4RTWA 3TDZC 4OKJA 1JJ8C 3M53A 3PNYA 2NRHA 2Y0SA 3WTYC 2HPMA 2K4YA 3IRXA 4QS9A 3TOBA 3O4NA 4H5TA 4FYYB 2F96A 2CGPA 1YW9A 4C92D 1NBEB 2IS6A 5AZJA 4A3JJ 2ZJRL 2F9WA 1ATRA 2GXGA 3C0CA 3CERA 3OGDA 2IT0A 3NGIA 4A6EA 1QZ6A 1KVCA 3I0XA 3IWZA 1VYTA 4IRHA 3AARA 2XAQA 1WUAA 1RDBA 1TC3C 4XRFA 4NYNA 2HF3A 1FJLA 4I6MB 4KISA 1SPKA 5E18F 2Q2EA 4BY6C 2A69F 2EYQA 2QBYA 3MO8A 5AT1B 4N5SA 1AA7A 1SD6A 3NFCA 3P1GA 4LITA 3G4SI 1RDAA 1PC0A 2VJ4A 3G4SN 4WF2A 5KN8A 2RPNA 1BC8C 3SZTA 2KT8A 3MEEA 2JWLA 1S72I 2TDXA 3WHBA 1S72N 1U2VA 3CBPA 4DQPA 2P0PA 3CO7C 3GBGA 1SKUB 2HEOA 3K2PA 1PUFA 1RNHA 1ZA2B 4XU2A 1KHIA 5CVJA 4FWKA 1BR1A 3JB9H 2DPDA 2P9LA 3KHYA 2GTOA 3TBIA 4PHTX 2XKOA 2D1XA 2F5CA 1LEBA 4O44A 5GMKi 5JI6A 1T6CA 2IXSA 3W2WA 3SAGA 5GAEJ 3FX3A 3ZEUB 2ZPEB 5GAOn 4MDXA 3LM2A 3DCFA 4JBAA 2RN2A 1OCTC 2Z1GA 1HBXG 4RGRA 4BQAA 2I10A 1Z9ZA 3BROA 3EFOA 5ILUA 3HM9A 3I55T 1KG1A 3SZPA 4M7DD 5AQNA 3SPYA 2A6TA 4BR7A 1MNDA 2VXDA 4OJRA 1MGTA 1J0RA 3KUFA 1NJZA 3CJ1A 3SDBA 3JCMJ 2VIXA 2Y0MA 4H0YB 3NH2A 1WSUA 1UA0A 2G8HA 3THWB 2ITGA 1OZ2A 2VC8A 4QKUA 1W5TA 2K9NA 4I7HA 2GA1A 1O3TA 3H9JA 3SFIA 1RDUA 5EC7A 4AG2C 4IEEA 1EWQA 4J19A 1MBGA 3RZDJ 2V6EA 2EYYA 3KLGA 4D1QA 5D6FA 4KH5A 1K8KB 1BR4A 1DT9A 4BWMA 4X1VA 3REOA 4C3JJ 3JRFA 2Y4YA 1QZYA 3CCUT 2FF4A 1W5SA 3O9UA 1NM1A 3A0BC 4PA1A 4HF1A 2M0OA 1MH3A 4BY6B 2VB6A 4C8QF 3K9KA 4LSLA 4OMPA 3GCMA 3DLGA 1E3PA 1GOAA 4LFAK 1B72A 4B9LA 4FTHA 4CF2A 1ZQ1A 1KZHA 4Q0BA 1OCZH 1V5FA 2VJIA 1F9NA 1TP4A 3QP5A 3MECA 4OLAA 2W10A 1ARKA 3AO3A 4OMLA 2OTLA 2LZ6B 2NVTJ 2O01E 5KPRA 1WIEA 1ETVA 5H1SQ 4IXCA 1LE8A 4MZTA 1QKXA 1U04A 1MBJA 4RM3A 3L1PA 1SFUA 4DU1A 4M3WA 4QCLA 5FPNA 2NUZA 2BOLA 1HR0K 3CETA 2GFAA 3S9HA 2VCPA 3E0JB 2XF5A 2D8HA 3E7LA 3S3MA 4B22A 4M78C 1DUXC 5BOXA 1VQNT 1QTMA 2HQXA 4FLTA 1WQ2A 2LQKA 4IWVA 4LOCA 1JT0A 3MZHA 3KCCA 1SZ2A 3THXA 4C2UA 1XNQK 1WHGA 3OOUA 3KZYA 5HDNA 2D0BA 1E4GT 2DMUA 2Q97A 4PSXA 2G8KA 3TU4K 2XY7A 5EG0A 3LFUA 5KI6A 1VQ5T 4AI4A 2JWKA 1KQSM 4BR2A 2ADUA 4ZN3A 1MJBA 3RPUA 1RT6A 1GL5A 1WWXA 1YJWQ 3KZZA 5AQUA 1LKXA 3CCEQ 4DTRA 5DD4A 1QA6A 3DM2A 3VERA 3RWUA 2DA1A 3R9PA 5EY4A 1ZN2A 3TO7A 3GFIA 4II1A 5GAOl 2LMDA 1VQ8Q 4DTSA 2JHJA 1WH5A 2E5NA 1X69A 3FM5A 4DR4K 2GIZA 3E9FA 2L3RA 2LOOA 1BOBA 3RSEB 2CFXA 4NCGA 2XB5A 3P9KA 3IRRA 1PU6A 2GEMA 4GY2B 1KYWA 1LDKB 1V3FA 1HYZA 3IKMA 5BR8K 2RHUA 3C7NA 4F9OA 4FISA 9ATCB 4XIUA 1R0CB 2V8KA 1OYIA 4BUGA 1JCGA 2LX9A 1M5Q1 5J8CA 1UGSB 2K7LA 5E84A 2E1HA 2DK8A 4BE2A 4ESJA 2I2LA 4LFUA 3O8MA 4F16A 3CC4Q 3JCMd 2QQ9A 5CHZA 3CEYA 1D1AA 1X1BA 3G71Q 4JD2A 5KYWB 3HSBA 2O61A 4M6XA 4M78B 5F0CA 4Y0WA 1YIJQ 1BC7C 3KP4A 4JK8A 2J5PA 3I8BA 4GDFA 2OPRA 2LY1A 5GAN4 1I4K1 2M02A 3QU6A 4NDLA 2K5FA 4PY5A 3RVCA 2PVDB 2EFNA 2RQVA 5ECAA 3G0ZA 5CPRB 1BHLA 3DKYA 3M3YJ 3F73A 2DX1A 1N75A 1SAXA 2UZKA 5HLHA 3M1FA 1WVRA 3OMGA 1SD4A 4ISGA 2V7YA 3CCMA 3O5ZA 3CJ7A 4C0GA 1OU8A 5GIPA 4DF4A 3TSWA 4WWCA 2IVNA 1EH7A 1FJGK 1Y0NA 4JRQA 4X65K 1YW7A 4HX8A 3GBQA 1BJAA 2CP7A 2WA0A 1NGGA 2JTVA 1UTIA 4MQ3A 3VUZA 3FXJA 2DT5A 1UE9A 3MCAB 4HWIA 2X6WA 4M73A 2YX7A 1PKTA 1S1NA 1ZG3A 1APLC 1K61A 4LXCA 2Z33A 3F8NA 1BU6O 3MEXA 4CJ4A 4M3ZA 2DW4A 1ASUA 4JX5A 1O7FA 2YUSA 1HUXA 4M75E 1AU7A 4RUGA 1LW2A 2ZQBA 3QEXA 1ZBIA 3THKA 5FKLA 1V4RA 4HDUA 4ILHA 1NMNA 4YDUC 2X4HA 3Q9VA 1CQTA 1TYQA 4RTVA 4H5NA 2RMOA 1JKHA 4ZDPA 1ZBFA 2IPQX 1QSSA 3O9SA 2ME6A 4E4HA 3MFKA 4J9HA 4PUSA 2W82A 3MJXA 4B9MA 1KQSS 2XSDC 2QWLA 2IC3A 1KXPA 1SHGA 4ISFA 2ZGYA 5D8LB 3CQYA 2JA7J 4HX7A 2YNIA 5IP7J 1Y71A 3I55I 4KFCA 2UWMA 3QOPA 3LANA 4FZZA 2O9SA 3VF4A 2NXNB 2Y9ZA 3I64A 3CCJA 1KHCA 1KQ2A 3AHUA 4HAMA 2FO0A 1V4TA 3GTQJ 1M1EB 3HYFA 1TGOA 3OW2P 4FX4A 3K2AA 2XK0A 3SUNA 3W6KB 4JJDA 4OGEA 3VS4A 1VQ7A 1TL3A 5E17F 2JT4A 2VASA 3HPOA 4P9FA 2ZJPF 4M78D 2QWPA 1XQOA 4E19A 2Q8KA 4BE1A 2GQIA 3EG9A 4E89A 1QPIA 1Z7LA 3A98A 3ATUA 1YRNA 1D9DA 4EMKA 3U9ZA 4ZTFA 4BRAA 1ABQA 1F21A 1H641 2DBMA 4CHYA 3BC8A 2FL7A 1R4NB 5BREA 3FHNA 2E1NA 1SSHA 2JJ9A 4PDKA 4ZJZA 2MABA 2W00A 2GTDA 4M7AC 1F5TA 1NGNA 2QXFA 1YJNQ 3EYZA 2HEQA 2V8JA 3UF4A 2GWJA 1WPKA 1K4US 4DFMA 1YJWN 2G8VA 1OCOH 3KTUA 1ETXA 1K4TA 2PZ1A 3CCEN 3VJPA 2HXOA 3H9QA 4N9IA 4LDUA 3OYAA 4HCBA 3WTXC 5HDKA 4OFAA 1V1CA 3TANA 4V19K 1NK7A 3I56Q 4CSWA 1C0UA 2KKZA 2WB1A 3SUOA 2P5OA 2PBDA 1L3LA 4L9VA 2Y1IA 3KYLA 4G8XA 2KIMA 2ESNA 4Z0UA 2ROTA 2O8CB 3QIOA 5AQLA 1VQ8I 4LDWA 1VQ8N 1SQKA 1UG0A 3BDLA 3HVTA 5C10A 4Y4RA 2D5RA 3BUZB 3BP8A 1BA1A 1VQKA 1S7OA 4A3FJ 2W40A 5K7HA 1VRLA 2QA4A 4CFDA 3G3ZA 1R5ID 3W0LA 4X1EA 1O75A 1V5GA 4BEHA 4BVPA 4PJOA 4JRPA 3NHGA 4NXNK 1JQQA 2OV7A 5ICCA 2M30A 5JLHA 1UGVA 1T6SA 3HTUA 4CO8A 5HLTA 4ON0A 2FBIA 3K4LA 5I42A 1D1CA 2AXTC 3CC4I 3O3KA 2LSNA 3CC4N 4CIFA 1QCFA 3LSPA 4OMZA 1RT7A 2ZB9A 1XMXA 2DTRA 4AC0A 3G71N 2GUIA 1IO2A 1OCCH 3BG6A 2AQEA 3WTTC 2CGLA 4FIBA 1YIJN 3EYYA 1D5AA 2RK1A 3VSKA 5M5YJ 3JTHA 1MU2A 4CJPA 1XC3A 1YT3A 1QMCA 2IIRA 2HHUA 2VV5A 2CZ7B 2KRHA 4J6XA 3F8BA 1XC5A 4M7AB 1Z25A 2E1MC 4KT5C 3WHCA 3M54A 2P9IA 4LG3A 2YKNA 2DYSH 2BE9B 1XDUA 5H6RA 1SUQA 3VS1A 2RD1A 3MZYA 2VYPA 2P9UA 1EF4A 3LSMA 3EGUA 3A1YA 3PFSA 2JN6A 5FFXA 5ELZA 5M1QA 1ENHA 1ILYA 4GGGA 2DYBA 4Z4IA 2CUZA 2WAQA 3VQAA 3WVDB 4BRKA 2NYXA 5E3NA 4XL9A 3RKXA 4GV3A 2KLAA 4GXOA 3CC7Q 1JUSA 3HBTA 1EP4A 1GLCG 3R6SA 1IDZA 1KAZA 3GFJA 4U7BA 3PO4A 2Y75A 3SBGA 3A8OB 5LFAA 4F55A 4UXNA 5GAGP 1I3QJ 2QQ8A 2HF4A 1TW3A 1AOJA 4A4GA 2YXYA 3RSNA 3GF5A 1GBQA 1WCMJ 2HBPA 2NRWA 1VYUA 3AG3H 4IZ9A 3M8JA 3V6DA 5DUIA 3PTAA 1IF1A 4V19S 3G1MA 5DCMA 4ZNXA 3FLCO 4E70A 2CQXA 2RQRA 4Z4CA 5M3FJ 3GNFB 4XTYA 3TEEA 2HQHA 4RW4A 1T08B 2FF6A 3J81Z 1GXIE 4DQSA 4ZHRA 2HYFA 1X6BA 3EG0A 2XDBA 2V4JC 1WJDA 3H3ZA 1EIFA 4JOMA 3OR1C 4OB3B 4FT8A 1XN7A 1Q8IA 2QZ8A 1GLLO 3S41A 2KSSA 4AIJA 2VOPA 2BY2A 4CDGA 2QKKA 4FM0A 3U1KA 2FC0A 4V2SA 2RQTA 5F6FA 3GW2A 3OIPA 1MJ9A 5TRDA 4EDUA 4FW2A 2VPLA 1WJ5A 2GTJA 2RA2A 1P4XA 3VEZA 5CR2A 2DKGA 1Z77A 3SNNA 2COZA 1EETA 1IV8A 3R4KA 4KJZA 2L9NA 3GTGJ 4HG2A 3ULQB 2X6NA 1PHTA 2MH2A 4DMNA 1A0NB 3EZ5A 4GBQA 3G4SA 4PGGA 2K6DA 2M8GX 3T1YK 2X1CA 1TTHB 4S05A 1Z9QA 4PL7A 5F2RA 1KQJA 3KEQA 4OIQF 4M7AD 4AM3A 4BU2A 2XAFA 2K40A 4X64K 5I21A 4HLYA 2F1LA 5GAOq 3R60A 1T8EA 3SI6A 1WAFA 4LG0B 3QP6A 3LZIA 3RR7A 3F72A 4LUEA 3K57A 5KYXA 2DA6A 2VBWA 1YJNI 1YJNN 3DPLC 1J6ZA 1X9WA 5C0MA 4CGFA 3JAMO 4EPCA 4M75F 3M5RA 1H9TA 2HMPA 3JB9D 5K1YA 1QKWA 4I01A 4RTZA 1LWYA 4ILJA 3VS2A 4DQRA 2QLZA 2L7FP 3I56N 3PUFA 3NHNA 1ZGAA 3SAFA 3P8DA 4J7IA 2E5KA 3T5XA 1UB4A 5GINA 3C0BA 5M9OA 1T3VA 4F2SA 2DOFA 3EQLF 3PIOA 2ZGZA 5LJ5h 3RERA 2DU9A 4EQQA 2DF6A 3EGXA 1QVPA 2BDPA 1ZYQA 5FGMA 1SEMA 4LB5A 4RM2A 4L6V5 4X34A 3DXMB 3KD5E 4EA5A 3HP9A 4YOVA 2KAFA 3SWNA 3S93A 1QVFM 1EFNA 4I76A 1ZSGA 3BDDA 3FJ5A 2F8TA 3TW6A 1B6AA 4JK7A 1TNTA 2J6OA 1NGAA 3EZWA 2NS8A 2BTTA 1ASVA 5GAHJ 2M8EA 4HOBA 4XLHA 4B9VA 2COWA 3GIBA 4LD6A 1EH8A 3OA6A 1G3YA 1BGXT 4K42A 1OR7C 2IP2A 2DM1A 4RG2A 1QVGM 1LEAA 3QJ6A 3R6MA 1X1DA 2OUMA 1G2HA 1YN8A 1X4OA 2XPVA 2FEIA 2GOMA 2CU7A 1R5HA 3S2HJ 4PJOF 1W0HA 1C1CA 4BR5A 4ELUA 4B3RK 1KQ1A 2EZLA 1R1VA 2D4WA 3VS5A 3THYB 1B8IA 1T7PA 3D5RC 2RN7A 1NK2P 4CZMA 1JKOC 3IG1A 1Y96A 2PJRA 1W7PA 1BR2A 3VDXA 1KD1U 1U9OA 5FLVA 1PSEA 2HNDA 5I2SA 3JSMA 1GBRA 4UY8O 4F3TA 5LJVA 2DRKA 4Z4FA 2NOGA 4FLXA 3UB5A 3A8YA 2HVRA 2V7FA 4DOWA 1JXMA 2QTXA 4RBOA 1S6PA 5F1JA 3VS3A 3F0CA 5IAYA 3PMIA 1CSKA 4ZZLA 2H6CA 2NRAC 3CC7N 3CYMA 3EUHA 4JUVA 3ZMVA 1LOJA 2K9MA 1V29B 2EQKA 1JXSA 3ZQQA 2KT1A 1J75A 1AOYA 2E3IA 2Y90A 4DBQA 2H6BA 1YI2A 3LSRA 3CD6Q 5E41A 4NC8A 4BHCA 2P9NB 1TKTA 1FBQA 4EJOA 1KC8R 3BT9A 4UVCA 1G15A 2QSFX 3KWIA 3DLMA 4MTEA 2NUTB 1S6LA 2EJ9A 1B9DA 3DEWA 3LA2A 2WSFE 3H1VX 2P5LC 1SVMA 1FTZA 3QERA 1TXQA 2CP6A 2W7NA 1SD7A 2EQUA 4IVNA 3QETA 1RAGB 2F9TA 2A3LA 4MMKA 4RWTA 2YSRA 3GMEA 1LW0A 4JK9A 5AQOA 1W0UA 2HOAA 4BQOA 2DVJA 4IZZA 1HXDA 3FZLA 2K9QA 1NYGA 3OMYA 4HX4A 5FFZA 3QZ5B 4AHVA 2PMZA 1YITT 4N47A 3E3VA 2JUFA 4FQGA 2A5YB 4RAFA 4BRDA 2JA6J 3PMTA 1U5TC 3QEPA 2BEOA 1N3AA 1TKXA 3RESA 3WT0A 2YX6A 1WN7A 4A12A 2ENMA 4KV8A 1ZARA 2VLAA 1VQOQ 4ELYC 4DGWB 2Q1ZB 3M1EA 1MSEC 1VQ6Q 5ILVA 1RRQA 1YS6A 3I53A 3VB2A 4MTDA 1XD7A 2XGEA 3CCYA 3URGA 3IUCA 3QPLA 2FBTA 3RQIA 2E34A 1Q7YR 4KB0A 5EF6A 4RTTA 1OQKA 4Q5VA 4MO7A 2EVRA 4UVAA 2OZ6A 2RGVA 2HHVA 5C24A 4RGXA 4WQ4A 4JPBW 4BDPA 3LCNA 5AQPA 1QVFS 2XY5A 2XMFA 4OP0A 3B6OA 3DU5A 1ULYA 1NM7A 4CJUA 2E4HA 3HVRA 4NHJA 3H46O 5CO7A 4CGHA 3BDPA 3UNGC 1IW7F 4DYQA 1K73C 3CUQC 1YBYA 3HHHA 5E79C 4M3GA 4K43A 1GFDA 3NF8A 2LH9A 3VMFB 3QBWA 1Z6TA 5CHIA 4IHSA 1WHJA 2H3EB 1LOTB 1L0OC 2MK5A 1YX3A 1WBDA 2EA4A 4M77C 4XLFA 3O8HA 4LDXA 2KPMA 3QWLA 1TG0A 3U6FA 1FSHA 2DT7B 1T3SA 1H8KA 3W6JB 3GBTA 5C6SA 2LVSA 1TAUA 5IT9E 1XOVA 3OIQA 4ENKA 2G9WA 2V9KA 3CFOA 1N3CA 3QO9A 3ZGKA 3F70A 3BR6A 1C6VX 2DTZA 1S9HA 4KFBA 4LDVA 4O55A 3TVTA 1U5TB 5JS2A 4UUSA 3AAPA 1SFKA 1NEGA 3DKWA 1ZXOA 2FQ4A 2DL4A 3K4MA 3OYHA 2ABKA 2LC4A 3I0TA 5GAEP 3E01A 3HPWA 2BBYA 3G1LA 2LX7A 3H3OB 2ZJQF 5CQYA 2KQ2A 3ZXSA 4UUTA 1N36K 3WTWC 4S0HB 3IH2A 2VONA 2KTQA 4XKWA 1KQ9A 1R71A 1H1VA 2MLKA 4DEYA 5GMKj 4F93B 3ENOA 2CW8A 4EIAA 4O0IA 3ML6A 1HYSA 2LCLA 1BI2A 4KTWA 4RLQA 2EH3A 3I55A 3FFIA 1EBMA 3WEEA 4IFYA 2FRWA 1O3SA 3JCMX 4NO7A 5LJ3d 3HRSA 3I4PA 4FE4A 4EJWA 1K76A 5DK5A 5LJ3j 2LF8A 3I9QA 3CUQB 1UA1A 4AU7A 2JPSA 2ECCA 4CXFA 3O9QA 1B9FA 2DODA 5LMNK 3K5MA 5ILSA 3G73A 3I59A 1IN4A 4M77B 3GX4X 1GXPA 3CCUA 3CJBA 2XGDA 3PT9A 2IRFG 4KHWA 1WJRA 3QYGB 4CHNA 5IP6A 3E6CC 1LFUP 4Z4HA 3RBBB 3P31A 4QS7A 3H6EA 2DFUA 2FRHA 2YRVA 4KNYA 2ASMA 3E2UA 4C5EA 5GANd 3OV8A 1Q81U 3ZT2A 4DV6K 3OVNA 4KH4A 1YTYA 2PZSA 3H08A 1I81A 1RESA 5GANj 4HDVA 1NH3A 1PJRA 2PLYA 4DV2K 3MWPA 1GCPA 4TVRA 2DFEA 3CD6I 1D3BA 3CD6N 3N05A 1B59A 5DDGA 4IDHA 3J7ZI 1R77A 2M4KA 3M0RA 1Z21A 4BUPA 1ZLJA 4DSEA 4CF8A 3DLLA 4BS9A 3NFAA 3LMMA 2V52B 1S3XA 3S6IA 3ATVA 5D5WB 1NK3P 1RAAB 2EKOA 4LFCK 3WGGA 3ME9A 4IG0A 4IDKA 2R7TA 1JRIA 4ID1A 4N4NB 2M34A 3WGHA 1TU0B 2RDPA 3CMEQ 3BZCA 4CF1A 4A5MA 3F3XA 1JGSA 1VQNA 3IAM2 4AM7A 2DAQA 2X6YA 4JS4A 5J3BA 4CEEA 2FPEA 1IH7A 4TV7A 2FSNA 1BBZA 1ZHIA 3GDQA 2WSCE 2BZXA 4GKKK 3C2GA 4A3KJ 1B1BA 3CJNA 4YFKF 2X51A 1T0FA 3JCUC 4I2OA 1VQ5A 4F17A 3VKIA 3Q0VA 1VQ9Q 1OH5A 1KC8O 1GCQC 3M07A 2CP5A 4LLGF 1FMWA 5BPDA 3DU6A 4NOYA 4FW1A 1VQON 1UHCA 4BB7A 1VQ4Q 1DPRA 2CFOA 3RKQA 4DV0K 1VQ6I 4FWLA 4FZXC 1VQ6N 2F2WA 2MW8A 2XROA 1ASWA 4QPOA 1IZ1A 4U87A 4BC2A 2YR2A 1YJ9Q 3LFKA 4B4CA 3VQ7A 3VQQA 4FVMA 5J26A 1T0JA 3LDSA 4QQDA 3Q9SA 3ZSZA 3L3UA 2KEAA 4FM1A 4K25A 4C92E 2CYYA 4BC5A 1KQSA 5J47A 3AKZA 3L6QA 1BJZA 5FDLA 1MNEA 3FB9A 2N8GA 1YITI 3L2QA 2CREA 3MAJA 1JKRC 1TK0A 1B34A 4OIRF 3TAEA 2A28A 4M77D 1JU5C 4FJ7A 2R57A 1WHUA 2ISYA 1PDNC 2DCEA 1U49A 1Z67A 4YPRA 2AKLA 4QVDA 2OJED 5L8RE 1NPPA 2HKQB 3QO3A 3V4GA 4BL0B 4FE7A 5FD6A 3SCXA 1Q7YO 1IKYA 3W2VA 3DLKA 1VF9A 5KYUA 4A63B 3W6VA 4F7UB 3N4PA 1YVUA 1L3SA 3UR3C 1OPKA 3OHRA 2IJLA 3MHXA 1KFZA 3UWNA 2VGMA 5FLXZ 1J5OA 1NK9A 3QDRB 2L02A 1BB9A 5BMZA 1L3VA 1UCRA 2EB7A 3HOXJ 1OH6A 3RNJA 3DRRA 2ABLA 2ZGWA 3PUBA 1TZLA 3M59A 4X9CA 1LJ9A 1RTJA 4DKWA 3QXEB 1PRLC 2JS0A 4CCKA 4HQMA 1IUYA 3UKRA 5AIQA 5K5QA 5J4VA 1MMNA 4JRIA 4OINF 3M1CA 3OYEA 4U88A 3KK2A 4ZGJB 3P9IA 3CCVQ 3B8AX 1VRTA 5D5XB 2QVOA 1HSQA 4FLYA 2L7MP 3OYMA 1DU6A 2E71A 1GV5A 2V75A 3QB0A 1OYYA 4CK3A 2PYLA 3HHTB 5B1BH 5KCMA 4UUVA 3AL0C 3ULEB 2UXCK 1RADB 3J7AF 3K69A 3AA4A 5LBQA 3HZ6A 2L7ZA 3LQQA 1N25A 2O8BA 2V1RA 2XHIA 3NVKA 1UB9A 2QYOA 4BXFA 1DKGD 2E19A 3ULRB 1VOMA 3QDFA 5AQJA 1HSJA 4XONA 4DU3A 2HGCA 3TSPA 4BR0A 1WEGA 2HMIA 1CKAA 1HA8A 5LY3A 4H4KC 4CEOA 3MKZA 4PNOA 2L0AA 3H5RA 1TWCJ 1S7AA 3KWGA 3QJYA 3MKWB 2GBQA 3HL8A 2FOWA 5FU7C 2W1OA 3EN9A 2EFOA 4KUMA 4RGSA 1RBRA 1BIAA 2Y31A 1ZRDA 1NKEA 5AN4A 4BC3A 5EJCA 2JTEA 1KAYA 5AQWA 3IL2A 3RI4A 5J4YA 2KQRA 3X20B 5FKMA 3JRHA 1Q86C 1U47A 3CM6A 5BQTA 2X1DA 5EGOB 2E7XA 2C06A 3CCLT 3QMLA 4K2EA 3JRIA 1Z3YA 2EZKA 4A3CJ 2KFZA 2BW3B 2LY9A 2V1NA 3LAPA 2A0FB 3GP8A 4ZDLA 5LRSA 3CESA 1XTDA 3C2HA 2LK2A 2FXUA 1P4AA 1A6QA 1DLOA 2B5JA 3META 2FSWA 5C4XJ 1X9SA 2RQQA 3A2FA 3CMEN 4BBSJ 4E2FB 4BJ5C 1I5OB 3LH5A 3DMJA 3K4NA 2ZC2A 4MMLA 5ADXA 4JDSA 3NF9A 4BREA 4CZGA 1T3LA 2VJJA 2HL3A 1VQPT 3AL0B 3UT1A 2JRMA 3CWTA 2EIJH 4C8QC 3IH4A 4FSXA 3DLLF 4IG3A 2FLOA 1O3QA 1ON2A 1S29A 2KGTA 1VQ9I 1VQ9N 2ZJQL 4LF9K 3M8EA 3DLHA 4E7ZA 4CGDA 3L00A 1VQ4N 1BW5A 1MJAA 2WV0A 4PGHA 3IMXA 2EPDA 4YIFA 3I0SA 4I9LA 3A0HC 1MWMA 3HRUA 1T56A 2HYGD 4HEA2 4B9NA 2RREA 3K6GA 4W97A 1LAWA 2ZF5O 1HD3A 4CJ5A 1YJ9N 1DU0A 1PCXA 3NGZA 3EG2A 2WONA 5EZHA 5SZTA 3ZSYA 2JLEA 5FU7B 3QYEA 1C0FA 4BY1J 1K0XA 2HHQA 1OV3A 4CEQA 4EEFG 1OJLA 4JAXA 2L54A 2D1HA 1M3QA 4IJAA 1OI1A 3MN9A 2E6ZA 3WVEB 4KYWA 2H56A 1HNVA 4AFSC 4A2UA 3VOVA 1UGQB 2H3JA 4AHRA 4XN0A 1P7JA 2OTLQ 1I07A 2PEXA 1EZZB 4U67L 1N5ZA 3TSZA 3SEMA 3QWYA 1NGIA 1Y6IA 2XRNA 3OYFA 4PK4A 3HM8A 4R55A 1NLVA 1S8NA 2HNIA 1XC9A 1PU7A 3TP0A 1OOTA 5M1KA 4RTXA 1FP2A 3L7WA 1POGA 5GAN8 1TUYA 1QLYA 2H3GX 5GPAA 3V8KA 4CGJA 1HX1A 2R5YA 2EQMA 4HTLA 1A6IA 2UXDK 1XG1A 4LGWA 3VS0A 4C8QB 4E1MA 3CJAA 1VQLQ 4OMQA 2CW0F 1QS4A 5EEHA 2W03A 2KXDA 4BRIA 5C3EJ 1Z1DA 4EW4A 2DMPA 2RI3A 2BZ8A 3CHWA 5B8HA 1U84A 3LDLA 2QSHX 2O4GA 3BW1A 3S8PA 2JZYA 1PP7U 1ZGJA 2P7CB 1M1KU 1YTAA 3CCVN 3ZSRA 2KHOA 1KQ0A 2JW4A 3PNVA 2QM3A 2R7FA 2KFNA 4AIKA 3KKSA 2RAEA 2CUBA 2ID3A 2Y0SN 2ZFUA 2OCCH 3L2VA 3KEOA 5JHUA 5EXWA 2I7NA 4IEJA 2FPDA 2IW5A 1G5VA 1FOXA 4IIOA 1I0CA 4FJNA 1M9SA 5BPIA 4LN2A 4CFCA 3KD1E 4LY7A 2QGFB 2D2WA 3VQ5A 3NCIA 2VWJA 2RVCA 5EYRA 1IN5A 2H1KA 1R36A 3DXKB 3WXLA 1ZLKA 1W70A 1JLCA 4D5FA 2XV4S 4YHHK 2WWYA 4F2RA 3AFHA 2HHWA 3A5LC 1AVZC 4BG8A 5LJ5e 1D4XA 2KBTA 3ZX3A 1U6ZA 3SZGA 3S32A 4Q47A 3CFPA 3TSQA 1KYZA 3PSIA 2BY3A 3INZA 2Z16A 2DZ9A 2NVUB 3TTDA 4O3MA 1YQRA 3MEVA 2DLLA 3ULDA 2JN0A 4KO0A 2QKMB 1TQPA 1CKBA 3QEIA 2IIMA 3KEYA 3TAFA 4B3AA 4EATA 2IAIA 4M78E 3WXKA 3SJJA 4CZEA 1E0EA 4CJEA 2WC2A 2CS3A 3BPVA 4FJ5A 1V5EA 2P84A 2IPOB 2QK9A 4BXUA 4BRGA 2VT3A 3CCMQ 2XKOC 4PL6A 3BE3A 1RIOH 5EU7A 2I0NA 2P5VA 3PGGA 2GBZA 3IRQA 2KDZA 2A36A 1YHQT 3LAJA 1ATNA 1QWEA 5D4RA 1HQEA 4C8QD 3AO2A 4WFNL 2HSPA 3FJPA 2K02A 3J80Z 3X2QH 2NOIA 2L4AA 4R1HA 1M30A 3AVMA 1RDWX 4JKGB 3ROUA 1KQSP 4Z4GA 4BBRJ 2JA2A 3VU3C 1XI1A 2FU4A 4B1RA 3PFYA 4H0OA 4CZZA 1KU7A 1ZREA 2E1CA 1S22A 3ZCMA 1XGSA 4CJSA 3Q0WA 2OAZA 3JR9A 5AZJB 4DG1A 3L2UA 1GLFO 5AFUH 5HROA 4H5VA 2PY5A 1W1FA 4A69C 4LSNA 1W7AA 4P96A 3V1RA 4AMCA 4EM1A 4DW6A 4CJQA 2MWOA 3CCLI 3E19A 3Q0UA 3FFKB 3M0PA 3LP0A 2WFBA 3VFZA 4RAGA 3HDDA 4DBRA 2Q2EB 2E60A 1EXQA 3S3OA 3FHGA 4RG8A 2QBYB 1TNSA 4M3DA 1RT1A 2DTUA 2A37A 4X62K 3UDCA 1A5XA 5KCOA 3ZETA 2X78A 3FKIJ 3S2WA 4J00A 3CCJQ 4HPQA 1T44A 2HQ5A 3QESA 2P1JA 3EHQA 3N4MA 1VQPI 1VSIA 5GAMe 1U2VB 2F2VA 4YTLA 1IXDA 2OTLI 1PUFB 2R92J 2EYWA 1VQ7Q 2OTLN 1SD5A 4DTOA 1KQ8A 2B6AA 5C42A 3AGRA 5TGTA 2AHJB 2LQNA 3F6OA 2P9LB 3ZMTA 4FJJA 1MZBA 3DWLE 4M4ZA 4FCYA 2YLCA 2PX9A 4HUGA 4HKEA 1K73U 4H0TB 3UKUA 1NK0A 1E3HA 1TWHJ 2C6YA 3O8VA 3RUXA 5BR9A 4WTOB 2NNNA 2LCSA 5K7ZA 4KHUA 4BRNA 1KEAA 5BRHA 4NBQA 4EZ9A 3NAUA 3EFOB 4D6WA 3O80A 4CCLA 4R56A 3ZX0A 1TQIA 1QVFA 4CZFA 4OMFB 2FEZA 4IURA 4D0PA 4DSLA 3BTLA 1WDXA 3GTPJ 4E0DA 3GWZA 3CWUA 1D3YA 3O1BA 1VSEA 5TKYA 4CJRA 2NAZA 5J3LA 4KPYA 3RZOJ 2UXBK 2UXNA 1VQLI 1VFCA 4HYEA 1K6OA 3DB3A 4QQGA 1VQLN 1VIFA 3B6CA 4IOCF 3LSTA 1NKUA 3S2DJ 2GOXB 1QVGA 2BE2A 3BQZA 2FVUA 1R22A 1UMQA 1C0GA 4RAYA 4A2BA 3RRHA 4KGZB 1P6RA 2BYVE 3H3VK 2LP5A 3GUDA 2E10A 2K3YA 3DWLA 4JLHA 1NE8A 2ZJRF 4PZJA 1AKHB 2DT6A 2FMYA 4G6QA 2EFPA 4DU4A 2E5ZA 5M1OA 1B4AA 3SQ4A 4A62A 3HOUJ 3A8LB 1XX5A 7AT1B 3FZHA 1GRIA 1VQKQ 2HTJA 3M7GA 4B43A 3EDPA 1B72B 1YLFA 2DETA 2FXAA 1K79A 2OTJT 3TABA 3Q1JA 4CF9A 4Y28E 2O8FB 4FK0A 4KI6A 4DTNA 2IBDA 2UUBK 1UWBA 1RBVA 4KTZA 2RQPA 5F0FA 4CFAA 5JFRA 2NRVA 2X4WA 4Y92A 1LE8B 4LLLA 5H20A 4AQYK 1XB4A 4ZGEB 3VQDA 4O4GA 4CHQA 3JSCA 4JRKA 3MMVA 3OJUA 1QHAA 1OULA 2RJEA 3OS5A 1ZUKA 3G6ET 3TAQA 1YITA 4XSZF 2KYBA 2HQAA 1K1ZA 1A5VA 2RM4A 1OZ3A 2A6EF 1S7EA 3K0LA 3THXB 3ZP5A 2JVHA 5LJ5f 1JI8A 2J6KA 1U3OA 4P55A 1TOVA 4IHVA 5C15A 2LBFA 1K78A 4BGDA 5EG0B 4CI6A 2RI5A 1X58A 1P59A 2RF2A 4IRGA 2MFZA 1G2BA 4LF6K 2ICWG 3MXJA 3HM5A 4I09A 5B5EC 2W25A 4OWRB 2DJZA 2ZNYA 1DPUA 1JUPA 4X9DA 4E1NA 1Y8RB 3CCMN 2YNGA 1MPGA 4CD3A 1OX9A 1UAAA 2GGRA 1I1GA 2PBIA 3ABKH 3TR8A 1PNJA 2IG0A 3ID6A 2CSIA 2F4OB 4A3IJ 3KYCB 1ZBLA 5GTIC 4FJKA 2EYXA 4L59A 1XJWB 4PFOA 2P4RA 3M8SA 2E64A 2RJCA 3J81O 3F8FA 2BXZA 4C30A 1JT6A 1UJ8A 4A5BA 2ESWA 1HW5A 4KHQA 3AA2A 3VQCA 1KU3A 4DTMA 1NKCA 1S5LC 3K70C 3L8BA 1RKTA 2A5XA 2L8DA 4YY3K 1QZEA 4CICA 1FYKA 3M4OJ 4CVNE 3Q3SA 4JD2B 3K4KA 3CZ6A 2IVMA 2E8AA 4DJAA 4JJBA 4CUGA 2LLKA 3I4MJ 1YX5A 1U45A 4AHTA 1SSFA 1OLTA 1N34K 3DEEA 2STTA 2OZSA 4JI0K 3V42A 1UDLA 2GWKA 3KK3A 1CLQA 1GLAG 1RLPC 4DR7K 2R7ZJ 1WQ7A 3CCJN 4N0AA 4NLBA 4L8RB 2L01A 2DQLA 3O6WA 4IHTA 3H45C 4M78F 4N41A 1VQ7N 2YU3A 4FK2A 1KTQA 2HQRA 4JEPA 4B24A 3T8RA 4LK0F 5E26A 5EOYA 3BFMA 2CH5A 2Q0UA 5GAMf 3HI0A 2P4TA 3HOVJ 3H3NO 4EW0A 3KZIC 1FWZA 4E7JA 2XHKA 1E6HA 2V26A 5A2QZ 4OVAA 4B1UB 4DFJA 5E3LA 4IIMA 4EMKC 4FLWA 3KBGA 2EBIA 4RW8A 4QS8A 1OISA 4NUBA 4YOTA 2G0EA 3X24B 2VQHA 3V9UA 1YAGA 1HK9A 1IKVA 3CXCM 3N5BB 5E20A 3RPUD 4IX7A 5CAIA 5F27A 2YHAA 4KI4A 3LSJA 4Y17A 1NPRA 3CQXA 2YS9A 1PD0A 1GOBA 3A4CA 1VQMT 3SEZA 1S5JA 2QKLB 3NBPA 2GWRA 1RILA 4NYFA 4KHSA 1GT0C 3GLLA 1QP2A 4DYCA 2P9KB 5KPTA 3GYHX 4Q4ZF 1WXTA 2JHNA 4BRLA 2DMOA 2WB1N 3DEUA 2F8SA 1TYQB 4B48A 1C0WA 3FXMA 2DRMA 2O8EA 1K83J 2O9LA 1LVKA 2KIQA 3WUHA 4LD5A 3I54A 3S14J 4MDBA 3M9AA 5K5OA 3GO5A 3P5JA 1B7TA 1TAQA 5LJ5g 1QQOA 2DPUA 4W5QA 2DPPB 1VQKN 3AT1B 3UIQA 3G1OA 3T1HK 1TWAJ 3C6TA 1J09A 2E70A 3FXRA 5D6EA 1G83A 2M16A 4OMMA 2EILH 2FMLA 2L5QA 2QWNA 3HC7A 5D5UB 1O1WA 4PJOC 1Q82C 4OKEA 2KP6A 4B9UA 1YQKA 2CDTA 2DMTA 3EG1A 2DMNA 2O7OA 3LNQA 1VIEA 1MBFA 4J9BA 2E4LA 1NNEA 2VXZA 5LGTA 2VPRA 4BY7J 4LD9K 4BQQA 1VK0A 3EG9B 4EM0B 3KXTA 1X3UA 3AAQA 3D6RA 4J7FA 3ZX2A 4BJTA 4DFPA 3CBMA 3V8JA 5JVHL 4DS5A 4GY5A 2RPIA 4H4OA 2K85A 1YRNB 1FC3A 1WLPB 3H5NA 4EMKB 4RW9A 3DI6A 1L3TA 1HNWK 3M9QA 2F5EA 1U48A 4CBWA 2YU9J 2M1HA 1UOCA 1WJAA 2MLGA 3CJ9A 1Y0UA 3UPUA 4E6KG 3HSCA 5DM6L 3DPUA 1IB8A 1M90U 4MNUA 1KD1R 4BAYA 4U7DA 2HYJA 2ED1A 4C0FA 1X3NA 2E1YA 4AVPA 1NLOC 1Z91A 3A1PA 4ESBA 1Q86U 3AVKA 1YS7A 3PV8A 4QOZB 4HSTA 1E3MA 2WAQN 1X3MA 4Z2YA 1DDNA 1OFCX 3AVGA 4IO8A 2ZD1A 3J8AA 2XDDA 1K0SA 2B86A 2HKXA 1H9GA 1XUPO 1KLNA 3D2EA 2KVQG 3CCQT 4QWQA 2HZYA 3MQ0A 3BJOA 2B9SA 5LGNA 4DSKA 1WZOA 3G6EI 1YI2Q 1ZUUA 4CK2A 3F23A 3U23A 1GV2A 3ABTA 1BUPA 2CP0A 3HTVA 4DZPA 3HOYJ 3K70D 3D2FA 2GUPA 4L5GA 2JMCA 3QYFA 4YFNF 1IO6A 2VXFA 3WTZA 1A5JA 2QTVA 4M7XA 4BEHB 4Y1CA 4PJOB 4IFEA 3E1SA 4FU6A 5FW9A 3EFSA 2GLOA 3D4VA 2WY8Q 5GAMg 1WHMA 1QQIA 2QEXT 2HVSA 4ZGDB 3PO3J 3BR3A 3NQOA 2KE9A 2CSOA 1ETOA 3WTSC 4L9JA 1V76A 4NLCA 1RABB 3VRZA 1I27A 3FLGA 3M55A 4H5RA 2K2MA 3CXCS 3JCMV 2W85A 5GPCA 3FIWA 4N0BA 4GYIA 3GZNB 1FZPB 1BIZA 1NOYA 4KRTA 1OYXA 2RNJA 3FZKA 2WADA 1D09B 3F8MA 4JN4A 5AQTA 5KTQA 1R1TA 5J8FA 4M9SA 3NTIA 2W41A 2OYQA 4W5NA 5KPZA 2A07F 3CCST 2OQRA 1YOVB 4MFDA 3D7EO 1QVFP 1QHGA 2QF7A 4WFAL 1ZC6A 1D1BA 1IC8A 1MMDA 3VEWA 3TO6A 1XHZA 3H8ZA 2DA9A 2P9PA 4OPHA 4NXMK 1TTYA 8ATCB 4FWNA 4HCZA 1AD5A 3FXQA 3N0UA 2P9IB 1KG2A 3CF5F 3L3VA 4PSWA 2XHCA 1BW6A 1JCFA 4F04B 2A08A 1WPYA 3PQKA 3EY1A 2XI9A 4V2FA 1WEIA 3SAHA 1QVGP 4WK8F 3VF2A 2CS7A 4M75D 1LPQA 3VS6A 2P9UB 3U21A 1TWFJ 5TJJA 5E3OA 4P1WA 1VHXA 5J1RA 5I3UA 5JHFA 4BXXJ 1ACIA 4BVOA 1KD1C 1Q1VA 1D9FA 4BI8B 4IUQA 1HLUA 3RMCA 2Q0RA 3A5MC 5M5WJ 4IHXA 2BZYA 2L89A 3ZMDA 4A0YA 1S1UA 2VYTA 3K10A 1R23A 4H0EA 4A53A 2UXXA 4WCEL 3SYZA 1WSHA 2YPRA 3G0QA 4B8AB 2XIDA 4J6YA 2VQLA 2NUPA 5HLFA 2C0TA 1AWOA 5IXBA 3CC2T 1MNMC 2L2PA 1YIOA 2DOEA 2STWA 4UNOA 1NK4A 4A3MJ 1S3JA 4FWOA 5HP1A 3P4IA 1YNZA 1QVTA 2E6LA 1IKXA 5DCMB 2BIVA 1S1WA 2H1LA 3QPSA 2CYZB 3F22A 3ZMSA 4MZMA 2X9DA 1TK5A 2P7VB 2KXCA 5CVRA 5IT9K 1R1UA 2X85A 1PYVA 2HVHA 5LLQA 5DS9A 2DIGA 3JRCA 4G94A 4JI6K 1WJFA 2LNBA 2YUOA 2E2QA 4II2A 1BK2A 2K2VA 4EV0A 4PJOD 1NKBA 2RHIA 2NVYJ 3R6NA 4AVZA 4JYKA 1IHWA 1IRFA 4CEDA 3RR6A 3CI5A 5CLSA 3FXOA 2KRMA 2D45A 2VI6A 3CCLA 3WQTA 4XN3A 3OR2C 1DJ7B 1QBJA 3SWNC 4CYCA 1WSGA 1N27A 2XPUA 2VKDA 1T8IA 6AT1B 4C8KA 5BN8A 1ZH5A 1Y0MA 3RYPA 5CZ2A 5GAN3 2I5WA 2AO9A 4WXDA 3T7ZA 1CZBA 3H9GA 1MGQA 2CH0A 1AWWA 3E5XA 4H5WA 2A1SA 4CIGA 3I55Q 1XMKA 5IH2A 3KLNA 3QHSA 2KL4A 4FWRA 4KHPK 1PUEE 2Q36A 2CQ7A 2EWNA 2BXYA 1BQMA 5FLMJ 1GOCA 1WFXA 1VQPA 4UNFA 3BGRA 3TKYA 1KO9A 2Z0WA 3CP2A 4A0ZA 4H03B 2QQBA 3AG4H 5I2MA 1YF5L 2RN8A 3EUKL 3AY9A 2XY6A 2F5TX 2O8DB 2AT1B 3REBB 1RBUA 1TVRA 3PX0A 2E7WA 5KYXB 2D1KA 4A2AA 4IUVA 2FBHA 3DQVC 3M57A 3CCUQ 5F04A 5KN9A 4CHZA 5DD8A 3GF2A 2QWWA 2W4SA 2EZHA 4KTQA 4EMHA 2HDAA 4CCJA 4LF5K 2XHBA 1KFSA 2OI3A 1XCVA 1Q81R 1JCEA 4C8NA 2XRIA 1HYOA 3JCMe 2BY1A 1IBLK 3D5SC 3PNWC 3GTLJ 2CQQA 3BTCA 2GZWA 3CP8A 2Z1IA 3FDYA 3VYRB 4B9SA 3EUHC 1VQLA 3MN2A 3K4CA 1YI2I 4IQJA 1YI2N 5AQQA 1FMKA 3EGXB 5IOZA 2QWQA 4EP4A 2ZFWA 2VODA 5GAN5 3OIOA 1WA7A 3AVBA 1KD1O 2W04A 3SWNB 2ZE2A 4A3LJ 2D0NA 4KUIA 1RT3A 3NRVA 1NK5A 3S1QJ 3NDKA 3ELKA 3HSFA 4J9GA 1LMZA 1U8BA 1U5SA 3ZT4A 2DYRH 2ASPA 2O4XB 3LH0A 3HRMA 2VKEA 1OVYA 2J5OA 3C7JA 2M0YA 1JLQA 1QSYA 2HZTA 3TTCA 4M41A 2LT4A 3KP5A 2EPFA 1VQNQ 4DOVA 4CF0A 1ZBUA 4UQGA 2PMZN 1QZ5A 3KP6A 4KGVB 2E65A 3H1CA 3M4YA 4FPAA 2X3XD 2HI3A 2LMJA 3H9NA 4RLFA 3CCQI 4Q5WA 1XCBA 4L0YB 3IQLA 1VQ5Q 3VA0A 3FISA 5FROA 3HSRA 3CLQA 4AIAA 3IC7A 4ZYEA 1P4WA 1B8IB 3ZSOA 2D9TA 2JNGA 5AQSA 4O5VA 3GOXA 1Y96B 4G7HF 2PJRB 2KT0A 1SMTA 1W7PB 1VZ0A 2PJPA 3HFOA 1PG5B 1CZ9A 2QENA 2EJGA 5E3MA 2BVLA 1TWGJ 3ZMUA 2JMWA 3PVLA 4FJHA 3KIOA 1HW2A 1XHXA 4QLCU 1N9SA 5DYMA 2QEXI 5GAOp 3MDQA 3ZQIA 3A8MB 2E6MA 1H8AC 4WQ4C 3ZRGA 1M1GA 3LDPA 3VENA 1ZBXA 4FK4A 4K41A 2F6CA 1W5CC 4I9QA 1UJ0A 4B23A 3SBTA 5M1PA 3CPWM 3E9OA 5ICEA 4YELA 4J9IA 5I22A 3ZBDA 1Q81C 4LUDA 3QFPA 2X48A 3OJSA 1AHJB 4C2MJ 2WTEA 2EHGA 5EG2A 1S9EA 5FLXO 2NOLA 5LJ5d 2E3HA 5CZ1A 1U4BA 1SRLA 3CCRT 1RLQC 1Z3XA 5ADXH 1XGMA 4RW6A 5LJ5j 4B21A 5J39A 2NNYA 1T03A 3NTHA 3S1RJ 2QCOA 4IHYA 3LDOA 3R0AA 3CMYA 2CG4A 5LL6S 3LPUA 3HB9A 3RTVA 1GHCA 1FKPA 4J2AA 3RYRA 2KR3A 1USSA 4ESRA 2FZKB 2D0PA 1S9GA 4YOXA 4E7SA 3A8HB 5BRFA 3BCAA 1QSLA 3TO9A 3WQUA 3ASKA 1LFBA 2WBNA 1NMDA 1FN7A 2P81A 1NU0A 4D9JA 2IDOA 4AFZC 3KLHA 2HNYA 2V9PA 2L3PA 3HTSB 4DR6K 3CC2I 5HBMA 4C9YA 1J9IA 1IG8A 1ZQ3P 2DL8A 1X9MA 3EPZA 2L9SA 2XVCA 3HT3A 2YDLA 3CCRQ 4ORZA 2BVMA 4Y15A 1K7AA 4CHOA 2DJIA 2AK5A 4E9FA 2FPFA 3GFLA 1SAZA 4CJFA 1YHQA 1WBBA 3PJRA 2E41A 1LFPA 2CRGA 2KZGA 3I55N 1ITGA 2FNAA 3ENBA 2E2PA 1LDJA 4CCOA 2NS0A 4M6VA 2O88A 1H3ZA 2M9UA 5E8IA 4C5IA 3TAPA 1RAEB 4JHDB 3WTUC 5C0YA 4MGRA 1W7PD 5IN1A 2EINH 1NG6A 2GA2A 5KQ8A 3REAB 4G9ZA 3I5SA 2ME0A 1N78A 2KRCA 2COYA<