3D4VA

Crystal structure of an alka host/guest complex n7methylguanine:cytosine base pair
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Synthesis and structure of duplex DNA containing the genotoxic nucleobase lesion N7-methylguanine.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3d4vA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3d4vA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3d4vA01
3S6IA 4YPHA 1YQRA 1RRSA 4B24A 2NOLA 1PU8A 5KN8A 1DIZA 1WEIA 1N3CA 4E9EA 2YG8A 4E9FA 2OFKA 1YQMA 4DK9A 1KG6A 3CW7A 2I5WA 3KTUA 1WEFA 2JHJA 1KQJA 1ORPA 1KG2A 1FN7A 4OFAA 3OGDA 4OFHA 2NOIA 2YG9A 4EA4A 2JG6A 3I0XA 4PIIA 3OH9A 1NKUA 2NOBA 1EBMA 3CVTA 1RRQA 3D4VA 1XQPA 4UOBA 4B21A 3IHOA 1YQKA 4AI5A 2JHNA 4B22A 3IH7A 4YOQA 1MUDA 1P7MA 4EJZA 1KG5A 1ORNA 3CVSA 3N0UA 1MUNA 1PVSA 4B23A 1P59A 1LMZA 1KG7A 1LWWA 4EW4A 2NOZA 2NOEA 3CWTA 3CWAA 1M3QA 1NGNA 1KEAA 3G0QA 4AI4A 1MPGA 3FHFA 1HU0A 1LWYA 3FSPA 1XG7A 1LWVA 2ABKA 3FHGA 4YPRA 3F10A 2NOFA 3OH6A 1VRLA 5CHZA 3N5NX 3KNTA 1N39A 1WEGA 2NOHA 4EW0A 4EA5A 3I0WA 5AN4A 2XHIA 1KG3A 4E9GA 2H56A 1XQOA 1KG4A 3CWSA 1PU6A 1YQLA 1N3AA 4OFEA 3CWUA 1KO9A 3F0ZA 5DPKA 4EJYA 4AIAA 1PU7A 4HSBA 2OFIA 4E9HA 1MUYA 5KN9A 1M3HA 4UNFA 4EVVA
chains in the Genus database with same CATH superfamily
1TGHA 4PY5A 4YPHA 2G30A 3OCIA 2JOIA 1QTSA 2HKPA 2V92A 1DIZA 1WEIA 4E9EA 1PZDA 2OFKA 1LXTA 2D0CA 4IL8A 1JFIC 2HZMA 3PMGA 1VKLA 1UT7A 3OLPA 4EA4A 1T6AA 2JG6A 3I0XA 1C9BB 1YTBA 2O3OA 3OYKA 3OYDA 3OYAA 4B22A 2IV8A 1QN5A 1VTOA 3ENCA 3DPTA 2MJ7A 1VOLB 1ORNA 5FRNA 1QN6A 1PVSA 5FROA 1KY6A 4B23A 1LMZA 2QR1A 2HL9A 3OS0A 2NOEA 3CWTA 1M3QA 3TE5A 1NGNA 2Y8LA 2JPSA 1HU0A 3L2WA 1V5SA 2HL8A 3OYJA 3FSPA 1XG7A 1LWVA 1TBPA 3SNSA 4YPRA 3OYGA 4D7RA 2OOXA 5IYCP 2NOFA 1VRLA 3N5NX 1WEGA 1PCZA 4E9GA 1K35A 4WX8A 3NNQA 1UL7A 1NVPA 3L2QA 4ROCB 3RSMA 4ROEB 2D0BA 3F0ZA 4IKFA 3OS2A 5F9CA 2V9JA 1NH2A 1YQRA 3EAYA 2NLVA 1PU8A 5KN8A 1N3CA 4E9FA 1YQMA 2LAEA 3CW7A 2Y8QA 4HJHA 2I5WA 2R5XA 1WEFA 2DKCA 1QN9A 1RM1A 3OGDA 2H4LX 1QN8A 4MRQA 5JMVD 2YG9A 1KFIA 2Z0FA 2MZ8A 3VW4A 1B9KA 2VJ0A 1QNCA 3D4VA 5BMNA 1XQPA 4B21A 3IHOA 1VTLE 1QNEA 3OYFA 3ENOC 4YOQA 3OYMA 1KG5A 3CVSA 3N0UA 4BDYA 5IYBP 3I3WA 1LWWA 4EW4A 1YTFA 1J3MA 4EAJA 4EAGA 1R4XA 3DPUA 3G0QA 1MPGA 2YH5A 1KYFA 3OYEA 1LWYA 3HS9A 1C4GA 3OS1A 1KYDA 3OSEA 3S3MA 4EW0A 4EA5A 2D0AA 1C47A 1KG3A 2H56A 1KG4A 1K2YX 4C7PA 1YQLA 4OFEA 1U84A 3CWUA 2W04A 3LCNA 5DPKA 4EJYA 1KY7A 1CDWA 1PU7A 1TUOA 4E9HA 2NVMA 3H1ZA 2FUVA 1M3HA 5JN5A 1XSZA 4EVVA 3S6IA 1WQAA 3ASMA 3L2VA 4B24A 3OY9A 5EPCA 2YG8A 1D3UA 4BE0A 2JPIA 1UT4A 4WZSD 4DK9A 1KG6A 2Z8UA 3KTUA 3S3NA 2JHJA 1KQJA 1KG2A 1FN7A 4OFAA 3OSMA 2IV9A 3OYIA 4PIIA 1P5GX 3OH9A 3C04A 3RPJA 2NOBA 1PCMX 1EBMA 1RRQA 1YQKA 3VN5A 2PWWA 4BJUA 3KRMA 4EJZA 1W80A 1MUNA 4I8OA 4NZGA 3ULXA 2QLVA 3D7QA 1NGMA 4RODB 3FHFA 2DKDA 4QG5A 1KFQA 3OH6A 5CHZA 2NOHA 3L2UA 4EAIA 3BKQX 3L2RA 3I0WA 5FRMA 4ZTFA 2FKFA 1XQOA 1QTPA 2H5AX 3CWSA 1KO9A 3R2XC 4E7JA 1VOKA 4HSBA 1Q9UA 4WXAA 2QREA 3OYLA 1QNBA 3OYBA 5BMPA 2V75A 1RRSA 2NOLA 1TBAB 1JDYA 1M5Q1 4D7QA 2ZFDB 1ORPA 3OYNA 3OYHA 4OFHA 4BE1A 2NOIA 4EAKA 1EUVA 3TDHA 2EHBD 5KL0A 1QN7A 2OOYA 1NKUA 4BDZA 4DULA 4E7IA 2QRCA 2FGTA 4BACA 3CVTA 1P5DX 1QNAA 4UOBA 4AI5A 2JHNA 4E7HA 3IH7A 2FKMX 3UW2A 1MP9A 1MUDA 3EIKA 5IYDP 1P7MA 1AISA 3OSTA 1P59A 5HSHA 3OYCA 4B0AA 1KG7A 4EALA 3OC3C 2NWVA 2NOZA 2YA3A 3CWAA 1KEAA 4AI4A 1WJWA 4CFFA 4BE2A 2QRDA 2ABKA 2F7LA 3FHGA 3F10A 1KYUA 1N39A 3KNTA 4E7KA 3N89A 4Q11A 3NA5A 5AN4A 4E7LA 1E42A 3HS8A 2XHIA 3PDKA 1PU6A 1N3AA 1QN3A 2V8QA 2W03A 2HZSA 4TPSA 2DKAA 3T4NA 4AIAA 2OFIA 1MUYA 5KN9A 1PCJX 1QN4A 4UNFA 4ZTJA 3S3OA
chains in the Genus database with same CATH topology
3S6IA 4YPHA 1YQRA 1RRSA 4B24A 2NOLA 1PU8A 5KN8A 1DIZA 1WEIA 1N3CA 4E9EA 2YG8A 4E9FA 2OFKA 1YQMA 4DK9A 1KG6A 3CW7A 2I5WA 3KTUA 1WEFA 2JHJA 1KQJA 1ORPA 1KG2A 1FN7A 4OFAA 3OGDA 4OFHA 2NOIA 2YG9A 4EA4A 2JG6A 3I0XA 4PIIA 3OH9A 1NKUA 2NOBA 1EBMA 3CVTA 1RRQA 3D4VA 1XQPA 4UOBA 4B21A 3IHOA 1YQKA 4AI5A 2JHNA 4B22A 3IH7A 4YOQA 1MUDA 1P7MA 4EJZA 1KG5A 1ORNA 3CVSA 3N0UA 1MUNA 1PVSA 4B23A 1P59A 1LMZA 1KG7A 1LWWA 4EW4A 2NOZA 2NOEA 3CWTA 3CWAA 1M3QA 1NGNA 1KEAA 3G0QA 4AI4A 1MPGA 3FHFA 1HU0A 1LWYA 3FSPA 1XG7A 1LWVA 2ABKA 3FHGA 4YPRA 3F10A 2NOFA 3OH6A 1VRLA 5CHZA 3N5NX 3KNTA 1N39A 1WEGA 2NOHA 4EW0A 4EA5A 3I0WA 5AN4A 2XHIA 1KG3A 4E9GA 2H56A 1XQOA 1KG4A 3CWSA 1PU6A 1YQLA 1N3AA 4OFEA 3CWUA 1KO9A 3F0ZA 5DPKA 4EJYA 4AIAA 1PU7A 4HSBA 2OFIA 4E9HA 1MUYA 5KN9A 1M3HA 4UNFA 4EVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6I A;  4YPH A;  1YQR A;  1RRS A;  4B24 A;  2NOL A;  1PU8 A;  5KN8 A;  1DIZ A;  1WEI A;  1N3C A;  4E9E A;  2YG8 A;  4E9F A;  2OFK A;  1YQM A;  4DK9 A;  1KG6 A;  3CW7 A;  2I5W A;  3KTU A;  1WEF A;  2JHJ A;  1KQJ A;  1ORP A;  1KG2 A;  1FN7 A;  4OFA A;  3OGD A;  4OFH A;  2NOI A;  2YG9 A;  4EA4 A;  2JG6 A;  3I0X A;  4PII A;  3OH9 A;  1NKU A;  2NOB A;  1EBM A;  3CVT A;  1RRQ A;  3D4V A;  1XQP A;  4UOB A;  4B21 A;  3IHO A;  1YQK A;  4AI5 A;  2JHN A;  4B22 A;  3IH7 A;  4YOQ A;  1MUD A;  1P7M A;  4EJZ A;  1KG5 A;  1ORN A;  3CVS A;  3N0U A;  1MUN A;  1PVS A;  4B23 A;  1P59 A;  1LMZ A;  1KG7 A;  1LWW A;  4EW4 A;  2NOZ A;  2NOE A;  3CWT A;  3CWA A;  1M3Q A;  1NGN A;  1KEA A;  3G0Q A;  4AI4 A;  1MPG A;  3FHF A;  1HU0 A;  1LWY A;  3FSP A;  1XG7 A;  1LWV A;  2ABK A;  3FHG A;  4YPR A;  3F10 A;  2NOF A;  3OH6 A;  1VRL A;  5CHZ A;  3N5N X;  3KNT A;  1N39 A;  1WEG A;  2NOH A;  4EW0 A;  4EA5 A;  3I0W A;  5AN4 A;  2XHI A;  1KG3 A;  4E9G A;  2H56 A;  1XQO A;  1KG4 A;  3CWS A;  1PU6 A;  1YQL A;  1N3A A;  4OFE A;  3CWU A;  1KO9 A;  3F0Z A;  5DPK A;  4EJY A;  4AIA A;  1PU7 A;  4HSB A;  2OFI A;  4E9H A;  1MUY A;  5KN9 A;  1M3H A;  4UNF A;  4EVV A; 
#chains in the Genus database with same CATH topology
 1TGH A;  4PY5 A;  4YPH A;  2G30 A;  3OCI A;  2JOI A;  1QTS A;  2HKP A;  2V92 A;  1DIZ A;  1WEI A;  4E9E A;  1PZD A;  2OFK A;  1LXT A;  2D0C A;  4IL8 A;  1JFI C;  2HZM A;  3PMG A;  1VKL A;  1UT7 A;  3OLP A;  4EA4 A;  1T6A A;  2JG6 A;  3I0X A;  1C9B B;  1YTB A;  2O3O A;  3OYK A;  3OYD A;  3OYA A;  4B22 A;  2IV8 A;  1QN5 A;  1VTO A;  3ENC A;  3DPT A;  2MJ7 A;  1VOL B;  1ORN A;  5FRN A;  1QN6 A;  1PVS A;  5FRO A;  1KY6 A;  4B23 A;  1LMZ A;  2QR1 A;  2HL9 A;  3OS0 A;  2NOE A;  3CWT A;  1M3Q A;  3TE5 A;  1NGN A;  2Y8L A;  2JPS A;  1HU0 A;  3L2W A;  1V5S A;  2HL8 A;  3OYJ A;  3FSP A;  1XG7 A;  1LWV A;  1TBP A;  3SNS A;  4YPR A;  3OYG A;  4D7R A;  2OOX A;  5IYC P;  2NOF A;  1VRL A;  3N5N X;  1WEG A;  1PCZ A;  4E9G A;  1K35 A;  4WX8 A;  3NNQ A;  1UL7 A;  1NVP A;  3L2Q A;  4ROC B;  3RSM A;  4ROE B;  2D0B A;  3F0Z A;  4IKF A;  3OS2 A;  5F9C A;  2V9J A;  1NH2 A;  1YQR A;  3EAY A;  2NLV A;  1PU8 A;  5KN8 A;  1N3C A;  4E9F A;  1YQM A;  2LAE A;  3CW7 A;  2Y8Q A;  4HJH A;  2I5W A;  2R5X A;  1WEF A;  2DKC A;  1QN9 A;  1RM1 A;  3OGD A;  2H4L X;  1QN8 A;  4MRQ A;  5JMV D;  2YG9 A;  1KFI A;  2Z0F A;  2MZ8 A;  3VW4 A;  1B9K A;  2VJ0 A;  1QNC A;  3D4V A;  5BMN A;  1XQP A;  4B21 A;  3IHO A;  1VTL E;  1QNE A;  3OYF A;  3ENO C;  4YOQ A;  3OYM A;  1KG5 A;  3CVS A;  3N0U A;  4BDY A;  5IYB P;  3I3W A;  1LWW A;  4EW4 A;  1YTF A;  1J3M A;  4EAJ A;  4EAG A;  1R4X A;  3DPU A;  3G0Q A;  1MPG A;  2YH5 A;  1KYF A;  3OYE A;  1LWY A;  3HS9 A;  1C4G A;  3OS1 A;  1KYD A;  3OSE A;  3S3M A;  4EW0 A;  4EA5 A;  2D0A A;  1C47 A;  1KG3 A;  2H56 A;  1KG4 A;  1K2Y X;  4C7P A;  1YQL A;  4OFE A;  1U84 A;  3CWU A;  2W04 A;  3LCN A;  5DPK A;  4EJY A;  1KY7 A;  1CDW A;  1PU7 A;  1TUO A;  4E9H A;  2NVM A;  3H1Z A;  2FUV A;  1M3H A;  5JN5 A;  1XSZ A;  4EVV A;  3S6I A;  1WQA A;  3ASM A;  3L2V A;  4B24 A;  3OY9 A;  5EPC A;  2YG8 A;  1D3U A;  4BE0 A;  2JPI A;  1UT4 A;  4WZS D;  4DK9 A;  1KG6 A;  2Z8U A;  3KTU A;  3S3N A;  2JHJ A;  1KQJ A;  1KG2 A;  1FN7 A;  4OFA A;  3OSM A;  2IV9 A;  3OYI A;  4PII A;  1P5G X;  3OH9 A;  3C04 A;  3RPJ A;  2NOB A;  1PCM X;  1EBM A;  1RRQ A;  1YQK A;  3VN5 A;  2PWW A;  4BJU A;  3KRM A;  4EJZ A;  1W80 A;  1MUN A;  4I8O A;  4NZG A;  3ULX A;  2QLV A;  3D7Q A;  1NGM A;  4ROD B;  3FHF A;  2DKD A;  4QG5 A;  1KFQ A;  3OH6 A;  5CHZ A;  2NOH A;  3L2U A;  4EAI A;  3BKQ X;  3L2R A;  3I0W A;  5FRM A;  4ZTF A;  2FKF A;  1XQO A;  1QTP A;  2H5A X;  3CWS A;  1KO9 A;  3R2X C;  4E7J A;  1VOK A;  4HSB A;  1Q9U A;  4WXA A;  2QRE A;  3OYL A;  1QNB A;  3OYB A;  5BMP A;  2V75 A;  1RRS A;  2NOL A;  1TBA B;  1JDY A;  1M5Q 1;  4D7Q A;  2ZFD B;  1ORP A;  3OYN A;  3OYH A;  4OFH A;  4BE1 A;  2NOI A;  4EAK A;  1EUV A;  3TDH A;  2EHB D;  5KL0 A;  1QN7 A;  2OOY A;  1NKU A;  4BDZ A;  4DUL A;  4E7I A;  2QRC A;  2FGT A;  4BAC A;  3CVT A;  1P5D X;  1QNA A;  4UOB A;  4AI5 A;  2JHN A;  4E7H A;  3IH7 A;  2FKM X;  3UW2 A;  1MP9 A;  1MUD A;  3EIK A;  5IYD P;  1P7M A;  1AIS A;  3OST A;  1P59 A;  5HSH A;  3OYC A;  4B0A A;  1KG7 A;  4EAL A;  3OC3 C;  2NWV A;  2NOZ A;  2YA3 A;  3CWA A;  1KEA A;  4AI4 A;  1WJW A;  4CFF A;  4BE2 A;  2QRD A;  2ABK A;  2F7L A;  3FHG A;  3F10 A;  1KYU A;  1N39 A;  3KNT A;  4E7K A;  3N89 A;  4Q11 A;  3NA5 A;  5AN4 A;  4E7L A;  1E42 A;  3HS8 A;  2XHI A;  3PDK A;  1PU6 A;  1N3A A;  1QN3 A;  2V8Q A;  2W03 A;  2HZS A;  4TPS A;  2DKA A;  3T4N A;  4AIA A;  2OFI A;  1MUY A;  5KN9 A;  1PCJ X;  1QN4 A;  4UNF A;  4ZTJ A;  3S3O A; 
#chains in the Genus database with same CATH homology
 3S6I A;  4YPH A;  1YQR A;  1RRS A;  4B24 A;  2NOL A;  1PU8 A;  5KN8 A;  1DIZ A;  1WEI A;  1N3C A;  4E9E A;  2YG8 A;  4E9F A;  2OFK A;  1YQM A;  4DK9 A;  1KG6 A;  3CW7 A;  2I5W A;  3KTU A;  1WEF A;  2JHJ A;  1KQJ A;  1ORP A;  1KG2 A;  1FN7 A;  4OFA A;  3OGD A;  4OFH A;  2NOI A;  2YG9 A;  4EA4 A;  2JG6 A;  3I0X A;  4PII A;  3OH9 A;  1NKU A;  2NOB A;  1EBM A;  3CVT A;  1RRQ A;  3D4V A;  1XQP A;  4UOB A;  4B21 A;  3IHO A;  1YQK A;  4AI5 A;  2JHN A;  4B22 A;  3IH7 A;  4YOQ A;  1MUD A;  1P7M A;  4EJZ A;  1KG5 A;  1ORN A;  3CVS A;  3N0U A;  1MUN A;  1PVS A;  4B23 A;  1P59 A;  1LMZ A;  1KG7 A;  1LWW A;  4EW4 A;  2NOZ A;  2NOE A;  3CWT A;  3CWA A;  1M3Q A;  1NGN A;  1KEA A;  3G0Q A;  4AI4 A;  1MPG A;  3FHF A;  1HU0 A;  1LWY A;  3FSP A;  1XG7 A;  1LWV A;  2ABK A;  3FHG A;  4YPR A;  3F10 A;  2NOF A;  3OH6 A;  1VRL A;  5CHZ A;  3N5N X;  3KNT A;  1N39 A;  1WEG A;  2NOH A;  4EW0 A;  4EA5 A;  3I0W A;  5AN4 A;  2XHI A;  1KG3 A;  4E9G A;  2H56 A;  1XQO A;  1KG4 A;  3CWS A;  1PU6 A;  1YQL A;  1N3A A;  4OFE A;  3CWU A;  1KO9 A;  3F0Z A;  5DPK A;  4EJY A;  4AIA A;  1PU7 A;  4HSB A;  2OFI A;  4E9H A;  1MUY A;  5KN9 A;  1M3H A;  4UNF A;  4EVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...