3S6IA

Schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
206
structure length
206
Chain Sequence
TKAEIHLSGLDENWKRLVKLVGNYRPNRSMEKKEPYEELIRAVASQQLHSKAANAIFNRFKSISNNGQFPTPEEIRDMDFEIMRACGFSARKIDSLKSIAEATISGLIPTKEEAERLSNEELIERLTQIKGIGRWTVEMLLIFSLNRDDVMPADDLSIRNGYRYLHRLPKIPTKMYVLKHSEICAPFRTAAAWYLWKTSKLADYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 1
publication title Analysis of substrate specificity of Schizosaccharomyces pombe Mag1 alkylpurine DNA glycosylase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase/dna
total genus 72
structure length 206
sequence length 206
chains with identical sequence D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3s6iA02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3s6iA01
4EJZA 1PU7A 1YQLA 5CHZA 1NGNA 3S6IA 3N5NX 3F0ZA 1N3AA 4YPRA 3OH9A 2YG9A 1MUYA 3CVSA 5AN4A 1YQRA 1KG2A 1LMZA 3CWAA 1LWYA 1HU0A 1KG6A 2JG6A 2H56A 5KN9A 3FHGA 1PVSA 4OFEA 1KG4A 4AIAA 1NKUA 3F10A 5KN8A 3KTUA 4UNFA 2YG8A 4E9GA 1EBMA 4B22A 1YQMA 3CWSA 2I5WA 2ABKA 1VRLA 2JHJA 1YQKA 4OFHA 3FSPA 3I0XA 3D4VA 1KO9A 1MUDA 4DK9A 1WEIA 3CWTA 1WEFA 3CVTA 4E9EA 1XQOA 1P7MA 1LWWA 4E9HA 1WEGA 2XHIA 1KG7A 1FN7A 3FHFA 3OGDA 1MUNA 1XQPA 1RRQA 2OFKA 4YPHA 3CWUA 2OFIA 1RRSA 3KNTA 3I0WA 4EJYA 2NOBA 3G0QA 4EA4A 4EW0A 1XG7A 4PIIA 2NOHA 4B21A 3IHOA 1KEAA 2JHNA 4EVVA 4EA5A 4EW4A 2NOEA 3OH6A 4AI4A 1LWVA 1N39A 3CW7A 4AI5A 1M3HA 1M3QA 1ORPA 2NOZA 2NOFA 3N0UA 4E9FA 2NOLA 4OFAA 1PU8A 1N3CA 1KQJA 4B24A 1PU6A 1P59A 1KG3A 4HSBA 1ORNA 5DPKA 1DIZA 3IH7A 4YOQA 4B23A 4UOBA 1KG5A 2NOIA 1MPGA
chains in the Genus database with same CATH superfamily
4EJZA 1PU7A 3OYCA 1YQLA 5CHZA 1NGNA 3OYFA 4BDYA 3S6IA 3N5NX 3F0ZA 3OYMA 3OYAA 1N3AA 4YPRA 3OH9A 3OYGA 2YG9A 1MUYA 3CVSA 4E7HA 5AN4A 3S3NA 1KG2A 1YQRA 1LMZA 3S3OA 3CWAA 1LWYA 3OS1A 4ZTFA 2JPSA 4E7LA 3S3MA 1HU0A 1KG6A 2JG6A 2H56A 5KN9A 3FHGA 1U84A 1PVSA 4OFEA 1KG4A 5FRNA 4AIAA 1NKUA 3F10A 5KN8A 3KTUA 4UNFA 5FRMA 2YG8A 4E9GA 1EBMA 4BACA 4B22A 3L2VA 1YQMA 4BE0A 3CWSA 2I5WA 2ABKA 1VRLA 2JHJA 1YQKA 2V75A 4OFHA 3FSPA 3I0XA 3D4VA 1KO9A 1MUDA 3OYLA 4DK9A 1WEIA 3CWTA 1WEFA 3CVTA 4E9EA 1XQOA 4E7KA 1P7MA 1LWWA 3OY9A 4E9HA 1WEGA 2XHIA 3OYNA 3OYDA 1KG7A 4ZTJA 4BDZA 1FN7A 3VW4A 3R2XC 3FHFA 3OGDA 1MUNA 1XQPA 4BE1A 1RRQA 2OFKA 4YPHA 3CWUA 2OFIA 1RRSA 3KNTA 3I0WA 4NZGA 4EJYA 2NOBA 3G0QA 3OYJA 3OYBA 4EA4A 4EW0A 1XG7A 4PIIA 3OYKA 3L2RA 2NOHA 3OYEA 4B21A 3IHOA 4E7JA 5FROA 4E7IA 1KEAA 2JHNA 4EVVA 4EA5A 3OYHA 4EW4A 3LCNA 2W04A 2NOEA 3OH6A 4AI4A 1LWVA 1N39A 3CW7A 3OS2A 4AI5A 1M3HA 1M3QA 1ORPA 2NOZA 2NOFA 3N0UA 3NNQA 3L2WA 4BE2A 4E9FA 2NOLA 4OFAA 3L2UA 1PU8A 3OS0A 1N3CA 1KQJA 4B24A 1PU6A 1P59A 2W03A 1KG3A 4HSBA 1ORNA 3L2QA 5DPKA 1DIZA 3IH7A 4YOQA 4B23A 3OYIA 4UOBA 4IKFA 1KG5A 2NOIA 1MPGA
chains in the Genus database with same CATH topology
4EJZA 1PU7A 1YQLA 5CHZA 1NGNA 3S6IA 3N5NX 3F0ZA 1N3AA 4YPRA 3OH9A 2YG9A 1MUYA 3CVSA 5AN4A 1YQRA 1KG2A 1LMZA 3CWAA 1LWYA 1HU0A 1KG6A 2JG6A 2H56A 5KN9A 3FHGA 1PVSA 4OFEA 1KG4A 4AIAA 1NKUA 3F10A 5KN8A 3KTUA 4UNFA 2YG8A 4E9GA 1EBMA 4B22A 1YQMA 3CWSA 2I5WA 2ABKA 1VRLA 2JHJA 1YQKA 4OFHA 3FSPA 3I0XA 3D4VA 1KO9A 1MUDA 4DK9A 1WEIA 3CWTA 1WEFA 3CVTA 4E9EA 1XQOA 1P7MA 1LWWA 4E9HA 1WEGA 2XHIA 1KG7A 1FN7A 3FHFA 3OGDA 1MUNA 1XQPA 1RRQA 2OFKA 4YPHA 3CWUA 2OFIA 1RRSA 3KNTA 3I0WA 4EJYA 2NOBA 3G0QA 4EA4A 4EW0A 1XG7A 4PIIA 2NOHA 4B21A 3IHOA 1KEAA 2JHNA 4EVVA 4EA5A 4EW4A 2NOEA 3OH6A 4AI4A 1LWVA 1N39A 3CW7A 4AI5A 1M3HA 1M3QA 1ORPA 2NOZA 2NOFA 3N0UA 4E9FA 2NOLA 4OFAA 1PU8A 1N3CA 1KQJA 4B24A 1PU6A 1P59A 1KG3A 4HSBA 1ORNA 5DPKA 1DIZA 3IH7A 4YOQA 4B23A 4UOBA 1KG5A 2NOIA 1MPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EJZ A;  1PU7 A;  1YQL A;  5CHZ A;  1NGN A;  3S6I A;  3N5N X;  3F0Z A;  1N3A A;  4YPR A;  3OH9 A;  2YG9 A;  1MUY A;  3CVS A;  5AN4 A;  1YQR A;  1KG2 A;  1LMZ A;  3CWA A;  1LWY A;  1HU0 A;  1KG6 A;  2JG6 A;  2H56 A;  5KN9 A;  3FHG A;  1PVS A;  4OFE A;  1KG4 A;  4AIA A;  1NKU A;  3F10 A;  5KN8 A;  3KTU A;  4UNF A;  2YG8 A;  4E9G A;  1EBM A;  4B22 A;  1YQM A;  3CWS A;  2I5W A;  2ABK A;  1VRL A;  2JHJ A;  1YQK A;  4OFH A;  3FSP A;  3I0X A;  3D4V A;  1KO9 A;  1MUD A;  4DK9 A;  1WEI A;  3CWT A;  1WEF A;  3CVT A;  4E9E A;  1XQO A;  1P7M A;  1LWW A;  4E9H A;  1WEG A;  2XHI A;  1KG7 A;  1FN7 A;  3FHF A;  3OGD A;  1MUN A;  1XQP A;  1RRQ A;  2OFK A;  4YPH A;  3CWU A;  2OFI A;  1RRS A;  3KNT A;  3I0W A;  4EJY A;  2NOB A;  3G0Q A;  4EA4 A;  4EW0 A;  1XG7 A;  4PII A;  2NOH A;  4B21 A;  3IHO A;  1KEA A;  2JHN A;  4EVV A;  4EA5 A;  4EW4 A;  2NOE A;  3OH6 A;  4AI4 A;  1LWV A;  1N39 A;  3CW7 A;  4AI5 A;  1M3H A;  1M3Q A;  1ORP A;  2NOZ A;  2NOF A;  3N0U A;  4E9F A;  2NOL A;  4OFA A;  1PU8 A;  1N3C A;  1KQJ A;  4B24 A;  1PU6 A;  1P59 A;  1KG3 A;  4HSB A;  1ORN A;  5DPK A;  1DIZ A;  3IH7 A;  4YOQ A;  4B23 A;  4UOB A;  1KG5 A;  2NOI A;  1MPG A; 
#chains in the Genus database with same CATH topology
 4EJZ A;  1PU7 A;  3OYC A;  1YQL A;  5CHZ A;  1NGN A;  3OYF A;  4BDY A;  3S6I A;  3N5N X;  3F0Z A;  3OYM A;  3OYA A;  1N3A A;  4YPR A;  3OH9 A;  3OYG A;  2YG9 A;  1MUY A;  3CVS A;  4E7H A;  5AN4 A;  3S3N A;  1KG2 A;  1YQR A;  1LMZ A;  3S3O A;  3CWA A;  1LWY A;  3OS1 A;  4ZTF A;  2JPS A;  4E7L A;  3S3M A;  1HU0 A;  1KG6 A;  2JG6 A;  2H56 A;  5KN9 A;  3FHG A;  1U84 A;  1PVS A;  4OFE A;  1KG4 A;  5FRN A;  4AIA A;  1NKU A;  3F10 A;  5KN8 A;  3KTU A;  4UNF A;  5FRM A;  2YG8 A;  4E9G A;  1EBM A;  4BAC A;  4B22 A;  3L2V A;  1YQM A;  4BE0 A;  3CWS A;  2I5W A;  2ABK A;  1VRL A;  2JHJ A;  1YQK A;  2V75 A;  4OFH A;  3FSP A;  3I0X A;  3D4V A;  1KO9 A;  1MUD A;  3OYL A;  4DK9 A;  1WEI A;  3CWT A;  1WEF A;  3CVT A;  4E9E A;  1XQO A;  4E7K A;  1P7M A;  1LWW A;  3OY9 A;  4E9H A;  1WEG A;  2XHI A;  3OYN A;  3OYD A;  1KG7 A;  4ZTJ A;  4BDZ A;  1FN7 A;  3VW4 A;  3R2X C;  3FHF A;  3OGD A;  1MUN A;  1XQP A;  4BE1 A;  1RRQ A;  2OFK A;  4YPH A;  3CWU A;  2OFI A;  1RRS A;  3KNT A;  3I0W A;  4NZG A;  4EJY A;  2NOB A;  3G0Q A;  3OYJ A;  3OYB A;  4EA4 A;  4EW0 A;  1XG7 A;  4PII A;  3OYK A;  3L2R A;  2NOH A;  3OYE A;  4B21 A;  3IHO A;  4E7J A;  5FRO A;  4E7I A;  1KEA A;  2JHN A;  4EVV A;  4EA5 A;  3OYH A;  4EW4 A;  3LCN A;  2W04 A;  2NOE A;  3OH6 A;  4AI4 A;  1LWV A;  1N39 A;  3CW7 A;  3OS2 A;  4AI5 A;  1M3H A;  1M3Q A;  1ORP A;  2NOZ A;  2NOF A;  3N0U A;  3NNQ A;  3L2W A;  4BE2 A;  4E9F A;  2NOL A;  4OFA A;  3L2U A;  1PU8 A;  3OS0 A;  1N3C A;  1KQJ A;  4B24 A;  1PU6 A;  1P59 A;  2W03 A;  1KG3 A;  4HSB A;  1ORN A;  3L2Q A;  5DPK A;  1DIZ A;  3IH7 A;  4YOQ A;  4B23 A;  3OYI A;  4UOB A;  4IKF A;  1KG5 A;  2NOI A;  1MPG A; 
#chains in the Genus database with same CATH homology
 4EJZ A;  1PU7 A;  1YQL A;  5CHZ A;  1NGN A;  3S6I A;  3N5N X;  3F0Z A;  1N3A A;  4YPR A;  3OH9 A;  2YG9 A;  1MUY A;  3CVS A;  5AN4 A;  1YQR A;  1KG2 A;  1LMZ A;  3CWA A;  1LWY A;  1HU0 A;  1KG6 A;  2JG6 A;  2H56 A;  5KN9 A;  3FHG A;  1PVS A;  4OFE A;  1KG4 A;  4AIA A;  1NKU A;  3F10 A;  5KN8 A;  3KTU A;  4UNF A;  2YG8 A;  4E9G A;  1EBM A;  4B22 A;  1YQM A;  3CWS A;  2I5W A;  2ABK A;  1VRL A;  2JHJ A;  1YQK A;  4OFH A;  3FSP A;  3I0X A;  3D4V A;  1KO9 A;  1MUD A;  4DK9 A;  1WEI A;  3CWT A;  1WEF A;  3CVT A;  4E9E A;  1XQO A;  1P7M A;  1LWW A;  4E9H A;  1WEG A;  2XHI A;  1KG7 A;  1FN7 A;  3FHF A;  3OGD A;  1MUN A;  1XQP A;  1RRQ A;  2OFK A;  4YPH A;  3CWU A;  2OFI A;  1RRS A;  3KNT A;  3I0W A;  4EJY A;  2NOB A;  3G0Q A;  4EA4 A;  4EW0 A;  1XG7 A;  4PII A;  2NOH A;  4B21 A;  3IHO A;  1KEA A;  2JHN A;  4EVV A;  4EA5 A;  4EW4 A;  2NOE A;  3OH6 A;  4AI4 A;  1LWV A;  1N39 A;  3CW7 A;  4AI5 A;  1M3H A;  1M3Q A;  1ORP A;  2NOZ A;  2NOF A;  3N0U A;  4E9F A;  2NOL A;  4OFA A;  1PU8 A;  1N3C A;  1KQJ A;  4B24 A;  1PU6 A;  1P59 A;  1KG3 A;  4HSB A;  1ORN A;  5DPK A;  1DIZ A;  3IH7 A;  4YOQ A;  4B23 A;  4UOB A;  1KG5 A;  2NOI A;  1MPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...