3L2WA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and gs9137 (elvitegravir)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2wA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2wA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2wA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2wA03
1ZBLA 1TK8A 4I9LA 4KRFA 4IUPA 1U49A 4GVMA 3WNHA 3NTIA 4KV8A 2YHBA 3AVJA 3M9QA 3F73A 4C5IA 4CK2A 1JL2A 1T03A 4NCGA 3KLIA 4M41A 4CEFA 1NKBA 3ZSOA 1DLOA 4LSLA 3ZT3A 4YFUA 4Z02A 5HP1A 2JLEA 3MXMA 1ZBUA 4CHQA 4M3UA 5HRNA 1NJYA 3KIOA 4QAGA 4XIUA 1L5UA 3OYGA 3OYDA 2EX3A 3P1GA 3VA3A 2BDPA 1VSJA 4FCYA 3RMAA 4PLLA 5M9OA 2P51A 4KHNA 4OGCA 3P8DA 5HROA 2GFAA 1UA1A 3HVTA 5CIUA 3NF6A 4KTWA 4DMNA 3ZSRA 3K5LA 4JRPA 4IUUA 3EZ5A 3DB3A 4CGFA 4E1MA 4CEDA 1KVAA 1UWBA 5KE2A 1C0UA 1WSIA 3LAMA 4E1NA 4YNQA 4HHTA 3PO5A 2M16A 3KJVA 3ALYA 4DWIA 2HHQA 3NGZA 2HHVA 4EDUA 1KVCA 1VSLA 4F2SA 4KO0A 4FJGA 4DTMA 1HJRA 4CGHA 4KREA 1RCHA 3HPHA 1U4BA 2JTFA 1NK5A 2BGGA 4PL6A 4DSJA 4Q0BA 3MEVA 4CJSA 2IG0A 4NYNA 1JLCA 2F8TA 2RN2A 2XO7A 1FXXA 3M8QA 2KFNA 2VWJA 4CEQA 4FJ8A 3OYKA 1D9FA 1VSEA 3AVMA 1Q9YA 2HNDA 1BCOA 2A1RA 2Z1HA 3AO2A 1RT3A 2B5JA 3JYTA 3QNOA 1T7PA 3HJFA 2L89A 4I7FA 3LYIA 3TI0A 4CIGA 4W5OA 2B6AA 3LP2A 1LAWA 4E19A 3G0ZA 3OB9A 5J26A 4OLBA 2XDPA 3LLRA 1TAQA 2YHAA 3AA3A 1X9WA 5C0MA 2KW4A 4OVLA 4Q5VA 3PNWC 2DFHA 3NGYA 2PQWA 5J2QA 1CZ9A 4Q5WA 2IOCA 3A2FA 3AA2A 4MQ3A 4QW2A 1WLJA 1Z26A 1RBRA 3DLRA 4AHVA 3KLGA 3HT3A 4B9MA 2X6SA 2DFEA 4L8RB 1KVBA 1NJWA 3PFSA 5KCOA 4FLZA 4CEOA 5J39A 3Q1JA 2X78A 3LWMA 1BGXT 1S1WA 1KLMA 3L2WA 2D0CA 1RT6A 2X74A 2Z1GA 5D6WA 3AVAA 4R5PA 3EY1A 3PX6A 3UT1A 3SUOA 4N76A 4E3SA 4KKOA 1S6QA 2OPSA 3META 4M42A 1CLQA 2G8WA 3OS1A 4BACA 3VQ7A 4DU1A 2DAQA 2YNFA 3VQAA 1NK7A 4QVZA 1NJZA 4Z0UA 3V9ZA 1K6YA 5KCHA 1LAVA 1HYVA 5KRSA 4W5TA 1KLNA 1S9GA 5KGXA 3NHGA 4CJUA 1B9FA 3C94A 4E7IA 3DOLA 3I0SA 3IRXA 4O4GA 3OYMA 2WACA 5KTQA 5SZTA 3NH0A 1ASWA 3D0PA 2XY5A 4C8OA 1YTUA 2HHXA 2PYJA 4DFPA 4DF8A 1NKEA 3VQEA 4B9UA 3OYEA 4B9XA 2HB5A 3SV4A 3MXIA 4DQIA 3VQ9A 2KTQA 2PYLA 1BQMA 3QNNA 4N5SA 1TV6A 1RI0A 2FBVA 3CFOA 1WSEA 4IURA 2ITGA 4QOZB 1KFDA 2HHWA 1A5VA 3K5MA 2IS3A 3UIQA 4C5GA 3ZCMA 3P83D 3AO5A 4FJ9A 1J5OA 1N5YA 4ELTA 5J2NA 4ID1A 4FJMA 4N41A 3SI6A 3LPUA 1OI1A 2O4XA 2HMIA 4CF1A 3NE6A 3E9FA 3OMCA 4CGGA 3V9XA 3KD1E 4CHZA 3TAEA 1QS4A 1IH7A 4M3WA 4FJLA 2PZSA 2FBYA 1NOYA 4ZTFA 4N4HA 1RDBA 4B9VA 3I8DA 1C1AA 2K3XA 4TSXA 3DLEA 4IUQA 4GMJB 3OS2A 3S3OA 3B6PA 3ZT2A 3O3GA 3V1OA 1FK9A 3QEPA 4M3XA 4F3TA 3TAMA 1EP4A 3CM5A 2WONA 4OKJA 5CYMA 3KK1A 3ZSXA 3DLGA 3NTHA 2GV9A 4ICLA 4KI6A 1TKDA 3L2VA 1RDCA 1WSJA 5CY4A 4DLEA 4DQRA 3QEXA 3ZT4A 3LH0A 1RDAA 4CFDA 3SD4A 3E01A 1TL3A 2GFUA 2GF7A 1JL1A 4AHUA 1S6PA 4CEEA 2Q3SA 2ZQBA 4UQGA 2YKMA 1IKYA 3RMDA 3SQ0A 1BI4B 1XC9A 2VG5A 4FZZA 4CF2A 4CHOA 1RILA 4DQPA 4EZ9A 3MEEA 1UAXA 3RWUA 1VRTA 4FK2A 4CERA 3O8VA 4WE1A 3C6TA 3L8BA 4J2AA 2HNZA 3IAYA 2EQKA 3KLHA 1WSGA 3LAKA 3VQCA 4HTUA 3UWNA 3OA6A 1C1CA 4FLTA 3VA0A 3MP1A 4CCHA 2ATQA 3PMIA 4N4GA 1RT1A 3FFIA 3O4QA 4FW1A 5KGWA 1EX4A 1EETA 2Y1IA 4DSKA 2JGUA 3AVHA 1GOAA 3ZSVA 4Z4HA 1D8YA 5HRSA 4DS4A 3LZIA 2OZMA 4KB0A 4FJ5A 2RHYA 3V81A 3OYCA 1U45A 4B8AB 1KHCA 4KTQA 1TKXA 1BIZA 4A4EA 1BIUA 2RF2A 4DTRA 3EYZA 2QQSA 3MO8A 2D0BA 2KFZA 1VSIA 3AVBA 4FM2A 4RW6A 3ZT0A 4O55A 4IBNA 3B6OA 4FLWA 2F5KA 4OPKA 1NK6A 3KK2A 4IFYA 4ID5A 2IGIA 5SWMA 4FVMA 4CJWA 4EP4A 3OMGA 1WJQA 3G10A 1S1VA 4LH5A 4W5NA 1ZBFA 1RTDA 1RT2A 1W0HA 5C24A 2OYQA 4N56A 3QETA 2HW3A 1J53A 4PY5A 1XNIA 3ISNC 3RMBA 4O0IA 3BDLA 1VSMA 1G15A 2Z1IA 3OYFA 3F9KA 4AHSA 4CF0A 4DFKA 1XI1A 3L2RA 2FHDA 1TGOA 3DOKA 3AVCA 3HSTB 3KKRA 4DTNA 4DF4A 4II1A 3DLHA 1WSHA 2E6NA 3HM9A 5CZ2A 4BDZA 5D6YA 3HVRA 1XHZA 2HHTA 1SUQA 4K8ZA 4E7LA 1TL1A 2GBZA 1SKRA 4CJ4A 4F8RA 3PX4A 4KB1A 1VSKA 4CJFA 1RBVA 1X1PA 4DFJA 4B9WA 1NOZA 3U3GA 4ZTJA 1N27A 3NBPA 4CHPA 3K57A 2OA8A 4DSIA 2BANA 2YRVA 3RRHA 4FJJA 4KHSA 2HVIA 4FJKA 2AJQA 1JLFA 4H8KA 1HNVA 1NK4A 1HPZA 3LP1A 2EQMA 2F8SA 4CEAA 1MU2A 1BQNA 1TK5A 2RO0A 1EKEA 2MWPA 1XWLA 3S3MA 4AHCA 4CJ5A 4B9TA 2P5OA 3DRPA 2F96A 3QIOA 3LP0A 4IDKA 4B8CA 3M8SA 3CQ8A 4FLVA 3FLGA 4DTOA 1LWCA 3SUQA 1DTTA 2R58A 1U04A 3S9HA 3OYAA 2RKIA 2BIVA 4PUOA 4FYDA 3EAEA 3NF8A 2HHSA 2R7YA 4A4HA 3VQBA 1SL2A 1RTIA 4RW9A 4DQQA 4IG0A 1LW0A 4MFBA 4FLXA 4FLUA 2X6NA 4FJNA 1YT3A 3MEWA 1Q9XA 1C0MA 3ASKA 3ZSZA 5I42A 4IUVA 4CIFA 2G8UA 2RI5A 3CEYA 4IUTA 1QHTA 1FKPA 3L2QA 3NTKA 4OPJA 3DLBA 3T1AA 3NNQA 4JS5A 3P5JA 2XY8A 2RHUA 2ZE2A 1SSFA 1JXBA 1OYXA 1UOCA 3HPGA 4CGIA 3H6ZA 4HUEA 4FXDA 2X4YA 2EQJA 3QINA 3QIPA 4JLHA 4E7JA 4BWMA 3TWHA 1L3UA 3MEAA 3ME9A 5J1EA 2WOMA 4C8KA 5J2MA 4F4KA 1CXQA 4CK1A 3CM6A 2HQXA 5D3GA 4ELVA 1WNSA 4HCBA 4W5RA 3SNNA 4K8XA 2OPPA 2G8VA 3FC3A 1SV5A 2RPIA 5C25A 4OKKA 3E9GA 3L3UA 2G3RA 4CJTA 4CE9A 2XHBA 3MEGA 3SPZA 1SL0A 3RRGA 3H8ZA 4DTPA 2L3RA 1BI4A 1S9EA 4HCZA 4G1QA 1QSSA 4H4MA 3SQ4A 4PWDA 4LY7A 1JXEA 3ZEHA 1S1UA 3OY9A 1C1BA 4FL6A 3LALA 4BE1A 4CF8A 3AVFA 4CF9A 3BDPA 1TAUA 2B4JA 3TAPA 2XK0A 1ASVA 1YTAA 2KQ2A 1IKWA 5JS2A 1OZ3A 3ITHA 3CFPA 3RTVA 1RBUA 2E5QA 1RT4A 2JZ2A 3WNEA 1ZYQA 4HVJA 4C8LA 5KH6A 3U3YA 2RJEA 4LSNA 4CFBA 4CJLA 3KLFA 1C6VA 3DM2A 4CHYA 2BUDA 3BGRA 3QERA 3PX0A 4FLYA 3SQ1A 3NFAA 5HLFA 4CFCA 3TAGA 1NKCA 4FM1A 3LZJA 2QK9A 1BISA 3AA4A 4CGJA 4CRIA 1QSLA 4KHQA 3AVNA 3NDKA 1B92A 4CESA 1LW2A 5FROA 3LGFA 1H3ZA 4DTSA 2YNGA 4FJIA 3SV3A 4LH4A 4EP5A 1LWEA 2DIQA 2VG7A 3AV9A 2RHXA 1C0TA 2MWOA 2ZD1A 3QKJA 4RW8A 1RBTA 4DG1A 4C5HA 5FDLA 4CGDA 3HPOA 3MP6A 4DTJA 4AILC 3QEWA 3L3VA 2XY7A 1WAFA 4RG2A 3VQ8A 3C95A 2HVHA 3AVKA 5DMRA 3DI6A 3MXJA 3VQ6A 3QEVA 3P8HA 2YNIA 1L3VA 3SPYA 3HK2A 2P1JA 3NH2A 4FK0A 5IN1A 1RDDA 1REVA 1TKTA 3ZT1A 4DQSA 2LTOA 1YVUA 4DLGA 4Z4GA 3JSMA 1HNIA 1KRPA 3QLHA 1HMVA 4CK3A 3L42A 4F3OA 3O3HA 4B9SA 1GOCA 4FZYA 4J2DA 2CKKA 4CHNA 4B08A 1Y97A 2X4XA 4A4GA 3OYNA 2X4WA 2LSNA 3PUFA 2QKBA 4O0JA 3HO1A 2HHUA 4OVAA 2YNHA 3AA5X 4Z4IA 2KZZA 2XRIA 4HUFA 3PY8A 2HNYA 3DRRA 1IG9A 3TAFA 1QTMA 4FK4A 3SQ2A 1HQUA 4J2EA 2RHIA 4FU6A 2G8KA 4QCLA 3NGIA 3K5NA 2RJFA 2OPRA 3CG7A 4GY5A 4BE0A 1WN7A 1J9AA 4E7HA 3D45A 4NYFA 4E89A 4Z4CA 3SUPA 4PA1A 2K3YA 3QO9A 1QE1A 4KFBA 3NAEA 3V6DA 2LVMA 3KD5E 4L59A 1RT7A 3ZSQA 5T7BA 4F2RA 5FRNA 4DU3A 3AO4A 2NUBA 3HL8A 3DB4A 4LD6A 1FKOA 4IFVA 3DYAA 3VQDA 4AHTA 1QSYA 2O4IA 3MECA 3K5OA 4Z4EA 1X9MA 3DRSA 3VQ4A 1Q8IA 1NJXA 1BCMA 3ASMA 3O3FA 1ZBIA 4DTXA 1JLEA 2LRQA 3OYLA 2FC0A 4CJEA 1U47A 2DTUA 3LGLA 4GW6A 3NH1A 3TANA 4KPYA 1RT5A 4RW4A 4BD3A 1F21A 1CZBA 1S1TA 4DS5A 3OYJA 1LV5A 3THVA 3WNGA 1VSHA 1BL3A 3LP3A 3OS0A 4CJKA 1TVRA 4N47A 2X35A 4CJQA 2R57A 1KSPA 3T19A 1GOBA 3V4IA 1UA0A 4OLAA 5CZ1A 3OVNA 3F70A 1JLBA 4CEBA 1EXQA 1JKHA 3TARA 5KI6A 3C6UA 3TABA 4EZ6A 4I9QA 4IKFA 3ZSWA 3U6FA 3QBYA 1JLQA 5C42A 1T05A 4DSLA 4DFMA 4BDPA 1NK8A 4PQUA 4C8MA 1HQEA 4O5BA 1Z25A 3QEIA 4DTUA 1IKVA 3OYHA 2R5AA 2Y1JA 1I39A 2Z1JA 3VN5A 1WJSA 3MEUA 3MP8A 1T8EA 1LWFA 2G8FA 4FZXC 4Z4FA 1XHXA 5KRTA 2D9TA 1O1WA 4KHWA 1VK0A 5DK5A 2R5MA 2EHGA 4UC4A 4CFAA 4B3OA 2IDOA 4CIEA 1NK9A 3DLKA 4H4OA 4IG3A 5CYQA 1MHNA 4ZHRA 2RI2A 4CEZA 3QIIA 2EKOA 5C6SA 3RR8A 4DSFA 3KLEA 3SUNA 2P5GA 1RNHA 2DY4A 1WGSA 4CJVA 4I2PA 4CJPA 3HXMA 2VG6A 3NCIA 3K59A 3PV8A 4OGEA 2NLUA 1R0AA 3PO4A 4NZGA 3OYIA 5FRMA 1A5WA 4QQGA 3HYFA 2P0KA 4C8NA 2OPQA 3PMTA 1N6QA 3H08A 2PY5A 1KFSA 4FJHA 1HYSA 1HYZA 2A1SA 3LPTA 2YV0X 3LDSA 4KAZA 1X9SA 2RHZA 2QKKA 3KTQA 4KHYA 4RG8A 2O4GA 2D0AA 4FJ7A 4CJRA 4W5QA 2ETJA 3AO3A 5J2PA 1WJRA 5HRRA 1DTQA 4E7KA 3DLMA 2L8DA 4A4FA 1I3AA 3DMJA 4Y1CA 1KCFA 4JRQA 3TAQA 3VQQA 1OZ2A 1D9DA 5IAYA 5HRPA 3GOXA 3SCXA 3IS9A 2D5RA 3VQPA 3KKSA 2IAJA 1S1XA 3WNFA 3HP9A 2E6LA 3V1RA 1BHLA 1SKSA 3QESA 2B8AA 4PLIA 2E4LA 5D6XA 3TR8A 1TKZA 4QQ6A 2OZSA 1TK0A 1VRUA 3C4SA 3MAQA 4NS5A 1IKXA 4NCAA 4FM0A 3K2PA 3OJSA 4B9LA 4C5EA 3M8PA 4OKEA 2QQRA 4AHRA 3CFRA 4M45A 2VWKA 4KI4A 3KUFA 3V9UA 3LANA 4ELUA 3M8RA 3SYZA 2QXFA 3HP6A 4DU4A 4KTZA 5E41A 3OJUA 1RBSA 4J2BA 2FBXA 4FJXA 2W42A 3OYBA 3RMCA 1ITGA 2EFIA 2EQUA 3SJJA 3AO1A 4FW2A 3S6WA 3MEDA 3V1QA 4AH9A 4JS4A 2FBTA 3L2UA 2XY6A 1L3TA 5JS1A 3FEOA 1S5JA 4RW7A 3ZSYA 5I3UA 1J54A 1QQCA 3AVGA 3FDRA 2RJCA 1HRHA 1JLAA 4LD0A 1SKWA 3LX7A 2G8IA 3I0RA 1W9HA 2YKNA 4M3ZA 2E6MA 3KK3A 4HUGA 1IO2A 4M3YA 1RTJA 1WSFA 4HCCA 4BE2A 2I5JA 1D5AA 1WAJA 3VQ5A 4CECA 3NF7A 4BDYA 3S3NA 2RJDA 2DFFA 2HQEA 3OQ5A 4QQDA 3RR7A 2M1HA 1VSFA 1A5XA 4KHUA 1NK0A 1ASUA 5K14A 4O44A 4BWJA 2M0OA 2VYTA 1RTHA 4B9NA 1ZBHA 2LDMA 1VSDA 5EU7A 3AVLA 4M3TA 2LCCA 3AVIA 1SL1A 4OJRA 4I2QA 2DIGA 3QJ6A 1B9DA 3NF9A 1U48A 3K58A 4E0DA 5KE3A 4Y1DA 1JLGA 3T3FA 3LWLA 1G5VA 5HBMA 3V9SA 2RI3A 1KTQA 4X34A 2GUIA 4M3RA 4NCBA 4DSEA 1CXUA 3IG1A 4CJ3A 3V9WA 2KZMA 2BE2A 2O4XB 1L3SA 2IC3A 2BKDN 3ULDA 3CYMA 2G8HA 3O4NA 4N4IA 3SZ2A
chains in the Genus database with same CATH superfamily
1KU2A 3S16J 1NH3A 3M9QA 1UE9A 1NJYA 1BR4A 1NE8A 2GX9A 4PLLA 4G9ZA 1HW2A 2XD0A 2JVHA 5BPNA 1UA1A 5HK3A 2CW7A 4CCJA 2VQGA 3DB3A 2QBYB 1K73U 3PO5A 2FX0A 4XN3A 3Q0VA 3L9FA 4KREA 1W5SA 1ZR2A 3KWGA 5E8GA 5FLVA 5LRRA 2DXBA 1X2QA 1QNTA 3S93A 3U8XA 3JYTA 1JKRC 1RR8C 1WPKA 3MK6A 3G0ZA 4B6MA 3J7ZO 2CH4W 4M71A 3V4GA 4YORA 3HTUA 4C2UA 2PVDB 5J2QA 2F2EA 1CZ9A 2Z5UA 1WLJA 4CC4B 1OH6A 2RDPA 1LCUA 1Q7YC 3VKIA 2VKEA 4H0YB 2X74A 1S1WA 1ZBJA 1KLMA 2D0CA 1TH7A 2E34A 2YR2A 2LJ3A 3HJEA 2EA2A 5I9EB 4M42A 3CWUA 1IV8A 4X64K 3TSPA 2BV6A 3GTQJ 4FYVB 3NHGA 5CKEA 4E7IA 3IUOA 2GM4A 1M30A 2HHXA 2F5FA 1IRGA 1UELB 4ZYHA 2BZTA 1Y1WJ 3K4MA 2A3ZA 5FGMA 4ID1A 4AT1B 4WQ5A 2PNIA 3VPRA 2JPBA 4CGGA 3BR2A 2PMZN 2LRDA 3A0HC 1OCRH 2TRTA 3PQKA 2FOWA 3DLEA 1YLFA 4AIDA 1WHMA 1UGPB 2MFZA 2E3HA 1U1SA 3IH7A 3MKZA 5AQHA 3C7NB 2P9PA 2CQQA 2ZCWA 5DPKA 3I56A 3VSLA 3CCJA 3MN9A 1RLPC 3LAKA 3VQCA 3O9QA 5JVGL 1S22A 5KGWA 4BI8B 2OZMA 3V42A 1QVFS 1NJIC 4DTRA 1U9OA 2O8BA 2K9GA 4O55A 3KK2A 1NJIO 4N0AA 2HZDA 2VXDA 5BN9A 1G3YA 1TL8A 3A8LB 4L3QA 1HKTA 1W7PA 2D0OA 3KKRA 3G0QA 4II1A 5HL7L 2XB0X 2HXOA 2NRXA 5BQTA 1ZC6A 3NHNA 4OMOA 1XCBA 2GEMA 4CJ4A 4DFJA 2K3FA 2HDAA 3CC2A 4BRAA 5GAMf 2OTJA 2FSNA 4JRIA 1WUAA 1TOVA 4HEA2 1ZGAA 2ZZDA 1MUYA 3H9GA 2LF7A 3VF2A 3FXMA 2OANA 3DU6A 3PO3J 2PQ8A 1NEGA 1VQKI 4PKCC 4EJTA 1N77A 4HSTA 1MIJA 2ZFUA 3LAJA 5AQYA 3JCMP 5AQWA 2EA4A 1H3HA 3CJ7A 1IGQA 3HSFA 3VS0A 1U5SA 4E7JA 4RTTA 5BPLA 3CBOA 5DY9A 3PT9A 4HCBA 3M0PA 5FKKA 4X1EA 1TNSA 1C6VX 3E9GA 5IOZA 1ATRA 2XHBA 2DO3A 2PMUA 4FM4B 4LY7A 4MEXF 2AQFA 1QVGM 1MMDA 3R2XC 1ASVA 4BJTA 4J01A 1RT4A 4H0OA 2F5VA 4ZH4F 1X1DA 3AG3H 4UV9A 5FWCA 2QW9A 4M7DB 3TAGA 1D5VA 2JT4A 2A5XA 2COYA 3HGGA 1WKMA 2YHWA 2HPIA 1H3ZA 1GUUA 4FPAA 2DIQA 3QYHB 1LFPA 3K4CA 3IL2A 3H3OB 3RMQA 4WTOB 2Q1ZB 2CV0A 3E2UA 2XAJA 3HK2A 1Z05A 3CCUQ 2BW3B 3QLHA 3ENBA 2NOJB 4ZYGA 2FVUA 4O5VA 4OVAA 2NVQJ 1V5EA 2XAGA 2HNYA 2DMQA 1HQUA 4E9HA 4RAYA 1VQ8A 3RUXA 4A5AA 3M0UA 3X28B 3JCMJ 3U9GA 2LVMA 3TL4X 3ASOH 2M02A 3VQDA 5LGTA 1VQOQ 2DA6A 1Q8IA 4UUSA 4C8QG 1X3UA 3CC2T 3MFKA 1K78B 4NLBA 4H5WA 3RVCA 5GAN4 2V9KA 1KQ0A 5A2QO 4N47A 1JO8A 2EJFA 1VQ8Q 2DLLA 5FU6C 3GTGJ 3CJNA 4IKFA 3G4SQ 3HL2A 3U6FA 1T05A 2I10A 1SAUA 1T56A 2R5AA 2RAEA 3FKJA 2Z1JA 4CD3A 5EEHA 4DK9A 1ZAOA 1OKRA 3ZETB 1VK0A 2P9IA 5D5UB 4J9FA 3VEOA 2P9SB 2Y30A 2EKOA 1IN8A 2O8FB 1KG4A 3I53A 2DZ9A 3CJAA 5K1YA 2HKXA 2ZPIB 2JM8A 4BXUA 3VFZA 4KT6A 4DW6A 1QO0D 1Q82C 1RR7A 4BR7A 4BC5A 3I9V2 4M3WA 2VONA 4Q5SF 3GOXA 3ZMZA 2D5RA 3KKSA 2XASA 3TOAA 1SKSA 3K2AA 3QDRB 3ZL7C 4X1VA 4ZC3A 4CYDA 3CCYA 2RQPA 1NGFA 2OTJT 4RCHA 4BQZA 1B1BA 3MKLA 2FBXA 3OYBA 2RN7A 3JB9D 2P5LC 3SJJA 1FYLA 3MEDA 1NM1A 2FBTA 3J81O 2IS6A 5GTIC 3AVGA 4C23A 1SVLA 1NZ9A 1DPUA 1X1BA 2ZXWH 1HPMA 2YG9A 2DA3A 1D1BA 4B9NA 4GY2B 3K58A 1IV0A 5KE3A 1YP5A 2PX9A 3LFUA 3LA7A 3T5XA 1L3SA 3TGNA 4EMSA 1TYQB 3IHUA 1UZCA 5AQVA 4BQLA 2AP1A 1JL2A 2P81A 5EDNA 3J7AF 1SF9A 5DS9A 3HSBA 5TRDA 3QO3A 4BY6C 5M9OA 3A03A 1YJNA 1AWJA 3KP6A 1SFOJ 3NF6A 1VQ6Q 4MO7A 1KHIA 1VQNA 1C0UA 3NGZA 1R8OB 4RGUA 3V7CA 2GBQA 4PL6A 4AIJA 7AT1B 1SG5A 1XDUA 2QDYB 2JA6J 1YITT 3BJOA 3AVMA 4ETSA 3LYIA 1V4RA 3BY5A 4E19A 3ELKA 4OLBA 1WA7A 3EKUA 2R7XA 1VQ6N 2XMFA 3H1QA 2E2JJ 3PIOA 1K9MU 4KN4X 2COBA 3PFSA 3NARA 3JAME 1M1EB 3SUOA 2IVPA 2DU9A 4A54A 5BR9A 1QWEA 2QVOA 4FT8A 1Z21A 2EWNA 2ZFWA 1UJ0A 3A0IX 2GBYA 1BG3A 3JS6A 1SHGA 5HOOA 3WUHA 2K79A 1S9HA 2W48A 3OSFA 2EFNA 3K4BA 1J9IA 2FUG2 1I5LA 3FE1A 2ELHA 2QKMB 3KYCB 4YPRA 3E9FA 3OMCA 4J7IA 3TAEA 3BTCA 1QS4A 1MW7A 1VQ9N 4GLMA 3TAMA 1N78A 1DGWY 2UUZA 3CJTB 3LOCA 5F27A 1T95A 1IKYA 3DXKB 3ZEUB 1M90U 1ZUKA 2MA3A 2QGGA 1UAXA 2PMZA 4ZDPA 1N39A 2HNZA 4LJZF 3ECHA 3KFWX 4HTUA 3NWSA 4M3BA 3PMIA 1S7EA 1GXIE 3R8EA 4FJ5A 4M72A 4H0EA 5BPDA 1U45A 2R7WA 2UV1A 3S15J 3F0CA 1MBGA 1WHHA 3DXMB 4P96A 1W0UA 5SWMA 3E97A 4FT4A 1WXBA 2OYQA 3EO3A 2R7ZJ 1FLIA 1S72N 5FO5A 4YOUA 4EGZA 5A0DA 3BDLA 2J5OA 2GIZA 1FIAA 2K02A 2KMUA 4DZJA 2QM3A 3SAGA 1QZ6A 4RKUE 3D2FA 4LF7K 1D5YA 4A2AA 4IX7A 4CGZA 1YI2A 4A3DJ 1K73R 4PJMA 3E6BA 3CCLT 2YRVA 5CK9A 1K8KB 3R1XA 4QVDA 3N0UA 2VN2A 5J1YA 4QPQA 3S2WA 4FWOA 2I0NA 4RW9A 1HXDA 4AQYK 1N3CA 4FLXA 3KEYA 2X6NA 4BRPA 1N34K 1KG5A 1VQ7Q 1J09A 3K70C 4I2OA 1FMVA 1YW7A 5GAMe 4IUTA 5CVVA 2KFDA 1H0MA 4HUEA 4FXDA 2X4YA 3VUBA 4N9HA 3DLLL 4F4KA 1ZRDA 4YIRX 1H1VA 1OCOH 3EH2A 1T08B 2OPPA 1T8IA 2WTEA 2WUSA 2G3RA 5KNLA 3DF8A 2QUFA 4HX7A 4FE7A 3GBQA 2W4SA 4C92D 3COAC 3VS5A 1V54H 2B4JA 2XK0A 3CFPA 2LDUA 2JZ2A 4RLFA 4J83A 2EWSA 4C0DB 3UKUB 3W2WA 2BUDA 3BGRA 4NQWB 3CDLA 3FM3A 3Q9SA 2J7IA 3CC7I 4C9YA 4OIPF 3VYUB 2E7WA 3SV3A 1YW8A 3FHGA 1XJWB 5BN8A 4IZ9A 1T0JA 4C5HA 2F9TA 3CCSN 3VQ8A 4LF4K 5IOYA 2HI3A 2Y0SN 5DLQE 2Q36A 3JCMf 1L3VA 1ATSA 3SPYA 3KP7A 1MDMB 1QA6A 1REVA 2BY2A 1ZX6A 3QRFF 1HNIA 5M5WJ 3ZP5A 1W6XA 2V1QA 1ETYA 4YDUC 3EKSA 4B1XB 1TQIA 1OCZH 1M1FA 4GO1A 2FF3B 1IG9A 1DJ7B 5M5YJ 3WQTA 2RHIA 4HWIA 1J9AA 4Z4CA 4PJOB 4ZDOA 3PNVA 5FRNA 4MDWA 3DYAA 2BVMA 5AQTA 2CGKA 4IHVA 4JQFA 1M1GA 3VTIA 4OMMA 2D2WA 4GW6A 4BD3A 4DS5A 2HTJA 2ICWG 4HRIA 1SEMA 3W6JB 2X35A 5L3DA 1VQ6I 2LZ6B 1Q81C 4AFSC 4KDPA 4RB3C 3F6VA 1TQPA 3HIFA 3T0YA 3DWLA 5ILUA 2JQ7A 4HV6A 2FMYA 2JSCA 2K7AA 3L2ZA 5FKMA 3Q0WA 4C0FA 3WTXC 1NK9A 3DLKA 2DNUA 5CYQA 2JG6A 3NGPA 3K9TA 3J81K 1Q18A 1FTTA 4F7UB 1N32K 1KJWA 3LMMA 4M7AG 1FZPB 3TMOA 2J6FA 2CV2A 3FR0A 3QYBA 5D4SA 1F1BB 3ZOBA 3IS9A 5KVRA 4BC2A 4JI4K 1WFWA 2HL3A 5TKYA 1XG7A 2HU9A 2P9LA 4M74A 4OKEA 1M2VA 3DXMA 3ULQB 1RC9A 4XLFA 4DOZA 1TW3A 2CQ7A 2CSOA 3BQYA 4JV5K 1S5JA 2A6TA 1SKWA 1JLAA 3GFIA 5CLSA 2R92J 2I5JA 4EJVA 2P4TA 2IW5A 2VC8A 1KQSS 4WF9L 3NF7A 3GP8A 3OQ5A 4M7DC 1B9MA 3EYYA 3QJ6A 5HCKA 1S72I 1MBJA 3E5UA 2GUIA 3TKYA 3U21A 4JPBW 2KXCA 2L0KA 2DYIA 3ABTA 2LTPA 2PFBA 1AEYA 3H1CA 1ORNA 4KRFA 3I56T 1T03A 3H3ZA 4BL0B 1ACIA 1U2VB 1PRMC 1YIJA 2QWQA 3GFLA 2KRHA 4RBOA 4ITVA 4ESRA 4FCYA 3RMAA 2MABA 2QAZA 2KJCA 2GFAA 3CCUI 4LNPA 1B9NA 5EY4A 1TNTA 2VIXA 1AOYA 2EPDA 3BY6A 4EV0A 3HFNA 1VQNQ 2FNPA 4C8QC 4KMFA 1Z7UA 2JTFA 1OYWA 4XU1A 4A57A 1Y0MA 1BCOA 3AO2A 3O1WA 1TWFJ 4J9HA 1YJNN 5E3MA 2B6AA 2WTUA 3HM5A 1TAQA 3CDIA 3CJRB 2KW4A 1QCNA 3KYLA 5FU7B 2PQWA 1VQNN 3BZKA 2R7RA 3B02A 4DIQA 2DFEA 1EFNA 3EUAA 4CW7B 3OL3A 3A5LC 2DERA 3ZYYX 4BROA 2L4MA 3EFOB 4U88A 2QI2A 4DCHA 5BREA 1A35A 1S9GA 1WHUA 1B8IB 3ZFJA 2ESNA 1MSEC 4F14A 3IHOA 4D5CA 4DQIA 3OYEA 2COZA 2ZJQL 2MSYA 2R7UA 3OHRA 3W6KB 3QNNA 2WAQN 4N5SA 2EV5A 4ISGA 2Y75A 1KAZA 2KRCA 1VZ0A 2M34A 2NNWA 5KPZA 2L3QA 4EGYA 4OB2B 2ECBA 4YFKF 2GLOA 2FA5A 3DEEA 2VV5A 4A5BA 1VQLN 2LX7A 1IDZA 4HSBA 4YOVA 4GCVA 3N5BB 1OYIA 2LVSA 1A5JA 3WODF 2E5LK 3B6CA 3I8DA 1NG7A 4IUQA 1RRQA 4N9IA 4IHWA 3CM5A 3JTGA 2YRCA 3DLGA 1TKDA 4JZ3A 4J5YA 1V1CA 1ESVA 2GFUA 4K0KK 2AS5F 1IBKK 4U0WA 2YKMA 3GTKJ 3MN5A 4FZZA 4RTWA 3ULRB 3RWUA 1SRLA 2OFIA 3K70D 4E7ZA 1JJ2P 1VFCA 2A6HF 5B1AH 2EYQA 1SZ2A 4M77A 3CIPA 4JEPA 2FEIA 1HNWK 2E1ZA 4D7MA 5GMKm 3TP3A 1TZLA 4J6XA 3H41A 3SWNC 1HSTA 3HOSA 4B8AB 2QQSA 4LLNA 4XOPA 3TQ7P 4IBNA 2F5KA 2W10A 1N5ZA 4FPBA 2VBYA 1E4FT 2BE5F 3L7WA 2VYPA 4M9SA 2K2VA 3VRYA 4N56A 5FD5A 4C92C 3ISNC 3IDHA 1RACB 2GOXB 1TTYA 2E6NA 1UFMA 1P90A 2GBZA 3VDXA 4DSIA 4KHSA 4XM3A 3RQ4A 5AQLA 4OIQF 4AF1A 2RO0A 5HS9A 4DZPA 4Q48A 4AHCA 5GAN7 2JPCA 2HEOA 5GIPA 3MZHA 2HHSA 2XGXA 3WGHA 5F1RA 2HYFA 1QPMA 3EGXB 5GJVB 1C0MA 3ASKA 3FZLA 3R6MA 4EQQA 4CCOA 1M3QA 3AAPA 3P5JA 3CC4A 4DOWA 3BG3A 5M3MJ 1JCFA 3OW2S 3QINA 3C2BA 3TWHA 1F9NA 2RQVA 4JX5A 4IHTA 2HQXA 1LDKB 2LNBA 3ONQA 3SNNA 1LKXA 2G8VA 3FC3A 3ZQHA 3LQRA 3RRGA 2LJ0A 4YFXF 1AWWA 4IRGA 2LQ8A 4G6QA 2GA2A 3IQLA 2OTLT 1U84A 3AVFA 2KQ2A 4AU7A 2EYXA 5HDGA 3WNEA 1ZGWA 4WWCA 4HQMA 4OMLA 2QK9A 3DBLB 4FWPA 1K7AA 2O9SA 4CRIA 3C0BA 1LW2A 2LQKA 4FJIA 1RADB 1LWEA 2N8GA 3QEWA 1MKMA 3M53A 5GP9A 2XI9A 2DTZA 4B21A 4LB6B 4EJOA 3S8PA 1YVUA 2L01A 5D5WB 1Z3XA 2Q1NA 5A2QZ 4NC8A 4F3OA 4AM3A 5CHIA 1BOAA 5IWAK 4BRCA 1NLVA 3AA5X 3NFCA 1OQYA 3DBRB 2CZ1B 1E17A 4LFBK 4XLCA 4PJOG 4J9GA 4I6MA 2D1VA 3D45A 2TCTA 4HNUA 1G3SA 4C3IJ 4DU3A 1W4MA 3K6GA 1VQ7T 1IXDA 3LSPA 3MCPA 2L7FP 3DBHB 3O3FA 3ENOA 4RGXA 1ZH5A 4F7UG 3DXJF 5C44J 4CC3A 4DYRA 1TVRA 5L3CA 2Z16A 5FKLA 1WQWA 2IT0A 1X4PA 4MGRA 3JRAA 2YPRA 1O9SA 3TABA 4FWMA 5C42A 4ELZC 3OYHA 4EW4A 5GANd 5F0CA 1U5TB 3RESA 1K76A 4IG3A 3FHNA 3TPQA 2KIMA 2CU7A 2XGEA 1WGSA 5F0XA 1D0ZA 2DL3A 3LSJA 2VKVA 4JI0K 4AM6A 1IUYA 4FJHA 2YSRA 2QXLA 4BREA 1ZA1B 2RHZA 3CCVA 1I1GA 3BEXA 2O8CB 2L8DA 2UXXA 1KCFA 4XK4A 1I1SA 2WY7Q 3C6HA 4IIOA 1BHLA 3QESA 3CPWS 1I3QJ 3I71A 1ZKGA 1KD1C 1BR1A 3CFRA 4CO8A 2ESHA 4XN0A 4B4CA 2X9HA 2ZGWA 3I4MJ 1U06A 4C8QB 2V79A 4FWKA 3SB2A 5I3UA 4XMYA 1HRHA 3LX7A 5LD2C 3I0RA 4RB2C 3TSWA 3VTHA 4HUGA 3BR5A 4BE2A 1HR0K 1PUFB 3Q7CA 2RJDA 4Y33A 2K5FA 4DUZK 4OO1J 4IHXA 4E0DA 4BXXJ 3AG2H 1FN7A 2Y4XA 3V9SA 3FKIJ 5E1ZB 4GLKA 3CWTA 1MV0B 1G6NA 3MMVA 2A41A 4XTVA 1K0SA 1U49A 4XSZF 2CZ6B 3KP5A 1Y7XA 3JAMZ 5AQKA 1H641 4IUUA 2CH4A 3EZ5A 3JCMW 1UWBA 3LAMA 2CP2A 4S04A 2YX6A 4PFZA 2Z2SB 1QVGP 4Y91A 1CF7A 2PUKB 1NG9A 1HNXK 1OQKA 2ZJQF 3PNTA 1XSVA 1IGUA 3VYHB 1FXXA 1QWFA 1NGHA 4BR9A 3QWLA 5IYBJ 5DM7R 2FNAA 1DGRM 3AA3A 4JHDA 1LCKA 1M5Q1 2HEQA 4MQ3A 3ZR8X 4PUSA 1A31A 2X6SA 4S0HB 3O4WA 2RB6A 2O8EA 1D9DA 1IN5A 3A5MC 5FFZA 2H8HA 3MD2A 4DYQA 1UGSB 4JD2A 1ASWA 3O8HA 3PE0A 4JKHA 2KGTA 3E3VA 4MO4A 4C3JJ 5EG0A 1UGRB 5I2MA 5LJ5e 3SHWA 4GVEA 1Z3YA 4IURA 1KFDA 3GMEA 2WY8Q 3MWMA 3SXYA 3TSUA 2C06A 3CD6A 4HPQA 3LSHA 4CA0A 4RCCA 2OZ6A 3JRBA 1JUMA 1PG5B 3A01B 5L23A 4C92E 3CC4Q 4B9VA 2FL7A 2FB7A 4FIBA 2B63J 2DETA 1KGSA 3S3OA 3VEWA 5KPTA 2VT3A 3O6WA 3BTIA 2GV9A 3LAPA 3RNJA 2MYSA 2STWA 4AHUA 2KKZA 2VJIA 4YDUA 1BBZA 4WXCA 3CC7N 2P9IB 1C1CA 1Z0XA 1V29B 4A3IJ 3UKUA 2DTRA 5GAHJ 1YCSB 1M27C 2RHYA 4BG9A 3O9TA 2KFZA 3AGRA 2P84A 4O6JA 4LH5A 4W5NA 5FLMJ 2VBXA 1UCRA 1J53A 3JSOA 4OMPA 5GAN3 3HHTB 1YQKA 1VYVA 1TU0B 1QP3A 2NRVA 5C10A 4DTNA 3DOKA 3DLHA 4C0DC 1P6RA 4KH6A 5AQSA 2XIDA 3IC7A 3JSCA 1YI2Q 2QZ8A 2VBWA 1Z67A 4KB1A 1VSKA 4CJFA 2VVKA 3D7EO 1UUEA 3NBPA 2RKHA 1WWXA 1N8RU 1HPZA 2E65A 1PCXA 5IP6A 2KVQG 4BHCA 2R0QC 1XWLA 4E4HA 1KAYA 5EXWA 3CUQA 1SL2A 3SDZA 3K0LA 4DQQA 3NAUA 2BOLA 2Y69H 1XCVA 3UPUA 2QENA 2E19A 2E2HJ 1FKPA 2YUOA 3L4IA 1K79A 3G4SI 3D5LA 3ME9A 4A5MA 2WOMA 4X6AJ 3QSUA 3KYDB 1UB4A 2Q2RA 3SPZA 1ZQ1A 1T39A 4EJWA 1OMIA 4XH5A 3OY9A 2CUFA 3ZMUA 2HAXA 1WJAA 1QZ5A 2WFBA 1X69A 2KBTA 1XGNA 5CKDA 5J47A 1XMAA 2D5VA 4BKXA 1DUXC 2HDCA 4CGJA 3BE3A 3JCMh 2RV8A 2Y0MA 2JUCA 4QS7A 1NGGA 1ZTRA 1W36C 1BI0A 2FRYA 4Y7NJ 4EP5A 2ZD1A 5KGXA 4BY6B 3QXEB 3J80Z 3I55N 3QICA 5GAN8 4R8HA 2ABLA 2OU2A 4HSRA 4BQOA 3L09A 2LOOA 4KGVB 1ZG5A 2LSNA 4DR4K 1WHJA 3EHQA 3RKQA 3BG7A 2XROA 1ARKA 3K5NA 2RJFA 3CG7A 4BE0A 2JOYA 4NYFA 4E70A 2K3YA 2EFQA 1PP7U 1XNQK 3JCMc 1Y0NA 3CCUA 2JS0A 4BQNA 3A8YA 4GKJK 3AG1H 1QVPA 4OMYA 1I1JA 3L6QA 3CCVI 2FG0A 5AQRA 3IUCA 3M07A 3J8AA 4EZ6A 1YITN 2ADUA 3ZSWA 4DSLA 4BDPA 1KC8C 3Q9VA 2W04A 2KXDA 3F72A 2H09A 3BLYA 5BOXA 2HCKA 3FXLA 1IGNA 1VQLT 3ERED 2PUOB 3TREA 1IXSB 5FB2A 4H5VA 3CCMN 2A37A 5EF6A 1POGA 2NLUA 3U9DA 2DT5A 5F0FA 2P5VA 3G1OA 1A5WA 1R71A 1VQ4I 3LDSA 4HA8A 4W5QA 1X9SA 1OZ2A 1N9SA 3ZMSA 5GAOr 2ZXIA 1OFCX 2GIVA 4XBFA 4J9CA 3JCMg 2KL4A 2PJRB 1AOJA 2DZCA 1VRUA 4NS5A 2VPRA 4NNJA 4IXCA 4MNUA 5EVZA 2CRGA 1SFXA 4J2BA 2HMAA 2BE7D 3M9AA 5CVIA 2XY6A 2X85A 1VQ9T 1XQSC 3OMYA 4YTLA 1Q1VA 4DNCA 1YVNA 1MGTA 2E6MA 3PJRA 2HQEA 2NVXJ 3EEQA 2VOPA 4F17A 4M7AC 1VQLA 2ROLA 1IHVA 2QWLA 2HYJA 2RH2A 5GAMj 4X34A 4VUBA 1NNEA 2DFIA 3VF6A 1XTAA 4WCEL 3UF4A 4MFDA 2DOEA 4JAXA 2FZKB 2RQTA 4RM3A 3ZSOA 3MXMA 3GF2A 2P7VB 3IP4B 4AVPA 2JS2A 2NRZA 4KNYA 2K27A 5BRDA 4CEDA 1LPLA 1YJWT 4ME7A 3SBTA 4EW0A 2WSEE 2HHVA 4M77F 1GVJA 1K8AO 4FJGA 1ZHIA 2BGGA 4M78B 1KG7A 2E71A 3OSVA 2CQNA 1IHWA 2Z1HA 2MOXA 2B5JA 4UY8I 4I7FA 3OOPA 2XDPA 1VQOA 5CCAA 3PNWC 2O8CA 2DFHA 5GTHC 2VQLA 2KLAA 1FBSA 3CD6I 5CQYA 1CZAN 1BO5O 3H6EA 5DCMA 1VQ8T 3OSGA 5L8RE 3SEQA 5HNFA 4R5PA 3S14J 2J4RA 2HSPA 5E1XA 3CC4I 4CSWA 3PVQA 3GZ5A 1NJZA 1W97L 4Z0UA 5J3BA 1HYVA 2E2QA 2ZBKA 3GOIA 1YCYA 3G4SN 3P38A 4JJDA 1KQ9A 1UHWA 4ZGJB 1TV6A 2Y48A 2YXYA 1ZLJA 2FBIA 4QOZB 3K5MA 3K69A 4FJ9A 4NDLA 3ZQLA 2O4XA 4JBAA 3HRSA 3FISA 2AQEA 3D7SB 3CC7Q 4LD9K 1MNDA 3P8BB 3HB9A 4C1NI 2MK5A 4HXJA 2HZYA 1KEAA 2NS8A 4WF2A 3O3GA 5LJ5f 2DBKA 1VQOT 5ILSA 1M90O 1RDCA 2K40A 8ATCB 3ZT4A 3N4PA 2YUSA 2CMPA 4KICA 5CHZA 5E3OA 5KQDA 2XAUA 4KBMB 2WADA 2ZPGB 4JKFA 1SMTA 2DOAA 4LK0F 4EMKA 3OA6A 3FB9A 2YX7A 3CPWA 2ATQA 5FKOA 4JYAK 3RYRA 2WBMA 3M57A 2HR3A 1KHCA 3MO8A 4BR2A 1IXRC 4EVVA 4FLWA 1KG2A 4J00A 4WYBA 1IDYA 1YJWQ 1ZBFA 1BL0A 2PI0A 1XNIA 2ZPFB 3CVSA 2IVMA 4HT8A 1WJDA 3GTOJ 5AQPA 3MCZA 3TDUC 3E1SA 1FT9A 3HM9A 2K4JA 4BDZA 4ZN3A 4MO5A 4M75D 2WAQA 3B73A 2HVIA 2YDLA 1R5ID 3L0QA 4XQ3A 3GUDA 3PIPF 2A68F 1KC8R 4PUOA 4PKHA 4JJBA 1JCGA 1YT3A 4XICA 4CIFA 2DL8A 4UVAA 1T3LA 3GNFB 2WA0A 4X0GA 2IGOA 2Z9OA 3I55A 1L3UA 3TCJA 1OCCH 3ZX3A 2A5WA 1BB9A 4UB6C 1ODDA 4LF6K 1JEGA 1XS9A 3MEGA 3H8ZA 1YJ9A 1OPLA 1ZR4A 2LLKA 2FF6A 3GTMJ 1VQKN 1RFQA 4GXOA 1NWKA 1FOKA 2W00A 2BHZA 1W7AA 5KH6A 2DLPA 1GL5A 1MBFA 2RGVA 4BEHB 2EH3A 1NLOC 5GAOp 2UXDK 1DDNA 3A1YA 1PU6A 5EZHA 6PAXA 3P7NA 2DA9A 3JCMQ 4Y17A 3DWLE 2KY9A 3ABMH 2PAVA 4JI2K 4DBFA 3FDYA 5JMVA 3ZBDA 1QVUA 1PU8A 1QKWA 2P0PA 2H3EB 4BJ5C 5LJ3h 4M77E 3THXA 2HKNA 3CCMT 3KETA 3K1MA 1HDDC 3HOVJ 2E7XA 2CUDA 4PA1A 2L2PA 3AO4A 3A4CA 4U0VA 4CZKA 4Z4EA 2JT1A 2QWNA 3J80E 1JLEA 1WJ5A 1MMNA 5C4JJ 1XMQK 3ERMA 4EAHD 3NH1A 1WX6A 4KB0A 2E5ZA 1WLPB 5D6EA 3CXCS 2V8JA 4CEBA 1ZA2B 1EXQA 5E8IA 4C8MA 1HQEA 2F5CA 2AHQA 2DK3A 3D6RA 1HSQA 5DK5A 3TO9A 4NUBA 1JXOA 4M77D 3C7NA 1MHNA 4JHDB 4ZHRA 3LSGA 3K2ZA 1BDGA 1RNHA 1PD0A 2OQGA 3RJPA 3TO7A 2D1XA 4OGEA 1VQ9Q 2HS5A 2AK5A 2DXIA 1W7PD 2NS0A 4N0BA 1T0HA 2A1SA 4KGXB 4QS9A 4RS8A 3I35A 4JRQA 1ETOA 5AT1B 3WVEB 4ENJA 2V7YA 3SCXA 1Q81R 1VQ5T 1P4AA 5M1PA 1HNZK 2GWRA 4NCAA 4YELA 1PJRA 3FZFA 4BB7A 4AHRA 5LEJA 2KISA 4XQFA 2SRCA 3A5ZB 5FU7C 3WU1B 2F4VK 1IF1A 3K9JA 3LCNA 1GFCA 1YWPA 2P5KA 4J9BA 5CR2A 4M3YA 4IEEA 2DFFA 4BDYA 3EQLF 6AT1B 3S1NJ 4PCQA 1AHDP 2DYSH 3CJCA 2COWA 5C3EJ 4ORZA 1U48A 5J3LA 5ICEA 4CBXA 2QWRA 4C8QF 2A3SA 4XSXF 4NCBA 2M45A 3KVGA 1KYWA 1TK8A 1KD1U 3G1MA 4YIIA 1K9MC 1QZYA 3F73A 4NCGA 2LD5A 1HKSA 1S29A 3G6EQ 4CHQA 4KISA 4B1UB 1BIAA 4QAGA 4XIUA 1TT0A 1L5UA 1P59A 3OYDA 1FJGK 5AIQA 4KIGA 3OYYA 3FXKA 2ZAEA 3I4PA 3IMXA 3VGLA 4FSSA 1WSIA 3PIOF 4ZYEA 2WSFE 1K78A 5LL6S 1IBLK 4KO0A 3ULEB 5MLCQ 3FLCO 1A6QA 5TISC 2JMWA 3P39A 4C2TA 1QRYA 4F7UA 2YX4A 3JR9A 4CCMA 3CXCM 4IDHA 2YHAA 1RETA 1PU7A 1NG6A 3S1QJ 3FGUA 2FXUA 2H6BA 5HVQC 1MDMA 4ATOA 4BRIA 5JVHL 1EH6A 4CEOA 2BXYA 1RT6A 2G9WA 4M3EA 2Q31A 2CZ0B 1D3BA 5LMNK 3VQ7A 2EAYA 4E1JA 4DU1A 1BK2A 2AXLA 3S2DJ 3T69A 3CCQI 1KLNA 1HDPA 5KTQA 4ZYAA 1OX9A 2DK5A 4BNCA 1VIEA 3SV4A 4B8XA 4RAFA 1T6CA 2XHIA 3DKMA 4D0PA 1OEBA 3JRFA 4O8KA 4FL9A 3SFZA 2NUZA 1J5OA 4FJMA 2K9MA 1A0NB 4EJUA 3FSPA 3TU4K 3O8MA 4M7XA 2OTJN 2FBYA 5FLXO 1OR7A 2R7SA 4N4HA 4XLHA 1RDBA 3M58A 2E35A 4UVBA 1N8RR 4PJOA 2DDBA 5IYDJ 4F3TA 2WONA 4OMZA 4KULA 1Z6TA 3THYA 4M6YA 1LNXA 2K9LA 2KIUA 2VB6A 3VEZA 3LNQA 2QYZA 1T7PA 2BBYA 4CEEA 4CBWA 1I50J 1IV6A 1EQYA 1RAHB 4R56A 2P8TA 2HF4A 2DFUA 1MUNA 3L8BA 1HF0A 3TTFA 4Q47A 3UWNA 1WRJA 2QTVA 3PFIA 2L2OA 1FOXA 1GLNA 2JGUA 4E9FA 2V8KA 3KE2A 3M59A 1HK9A 3P9KA 2CS7A 5D7UA 1TKXA 3LA3A 3EYZA 5DUIA 2IPQX 4BRQA 4CCNA 3C3WA 2NUTA 1R49A 2CYYA 1ZBXA 5DCFA 4FWNA 4XRMA 4DEYA 1VQNT 2HW3A 2EQIA 5DLOA 5H20A 4UXNA 4J6WA 2PMHA 3JTHA 1VSMA 4II2A 1QLYA 2DE0X 2EPFA 3I55I 1YJ9N 1TUGB 3G71A 2IVNA 1B7TA 2NRWA 1QVFP 3IAS2 5TGTA 5I22A 2EQMA 1I81A 4DKWA 3CO7C 2VKNA 2F96A 2HHHK 4DTOA 5TKWA 1U04A 3JCMb 1WZ2A 4WQ4C 3QU3A 1SVMA 1YI2T 3E5QA 4U0YA 5LL6Z 1D09B 3PM1A 3V7SA 2ZE2A 2RN8A 3CLQA 1XQPA 2EQJA 4MLOA 3G6ET 2DN0A 3F23A 2DM1A 1CXQA 2QWWA 2DRMA 1U6ZA 3CQTA 4W5RA 1O3QA 1KQSP 2V4JC 4FYXB 2FJ1A 3R61A 1RRSA 4LN2A 3LDLA 1BI4A 3EGDB 4XLNF 4JKBA 4F16A 3HOXJ 3BZCA 3GW2A 1QHHD 4FOIA 4CF9A 1TAUA 4JX6A 3K1PA 5CR4A 2LF8A 2EILH 3LDNA 3FWEA 3DM2A 4CHYA 3SQ1A 4FM1A 3LZJA 5CAIA 3AA4A 2ZKZA 4A5NA 1ILYA 1B92A 1GLFO 2YNGA 1C0TA 2XVCA 3PO2J 2E2OA 5FDLA 3RMSA 3HPWA 3OL4A 3EG0A 3QYGB 3AVKA 4GYIA 4XTWA 3WTZA 3P8HA 3CMEI 5LEKA 2F69A 4DLGA 5FJ8J 4IHSA 2JA7J 1OU9A 2E70A 3CQXA 3L42A 5BR8K 3I33A 2FU4A 3PUFA 1MUZA 4BRNA 1Q86C 4HUFA 3DRRA 4A93J 4BRFA 3SK3A 2OPRA 3RR6A 3WT0A 2K5CA 3KP4A 1BA5A 3RBBB 2QQAA 2QWMA 2E6ZA 4M75G 2ME6A 3THKA 1BCMA 2E1MB 5LJ5g 2FF4A 2HQNA 2JSPA 2K3PA 3G71Q 1K61A 1RPWA 2D1KA 1PUEE 3CD6Q 2GWKA 4MLHA 1XOVA 2OBPA 4QT7A 4CJQA 2UXCK 3CPEA 5IP9J 2A40A 3LM2A 2K9SA 4B3RK 1Z25A 3THWB 3M4YA 1E3MA 3HRUA 1IG7A 3VN5A 3MP8A 1SD7A 4AG1C 1LFBA 1J0RA 2RNAA 4BYYA 4A53A 2L9RA 4RMOA 3M3ZA 4CFAA 2J06A 2HVQA 4MMLA 2GOMA 5F08A 3WXLA 2ITMA 4NB5A 2FBHA 1WJEA 3LSIA 2PZSA 2GQIA 2YUNA 3TQNA 3G2BA 1DP7P 1B07A 4A62A 3KTQA 4FT2A 2NOIA 2H27A 4H03B 2F48A 3MN7A 5LGUA 1P4WA 1G59A 3ATVA 2W24A 3I5UA 4CC2A 2BZ8A 3M8RA 1VAZA 4KTZA 3HXLA 3WTUC 3OJUA 4FJXA 3CMET 1WB9A 3CCLN 3I64A 3ZPLA 1H8KA 1ULYA 1GT0C 1O7FA 2NVTJ 1W9HA 4M3ZA 3CCEA 1WSFA 2KDZA 1YHQQ 4LITA 3BW1A 3G71T 5EU7A 3DPTA 4EMKC 3HOTA 1VRLA 1G5VA 3S2HJ 1B3QA 2O4XB 1X3NA 4D8KA 1XD7A 3EN9A 4Y15A 2NRAC 4HLXA 4F7UE 1DPRA 5HROA 4BHBA 1ABOA 2QA4I 4CGFA 2L9VA 3JREA 2VQEK 3BG5A 1WDXA 4DWIA 2M16A 1W5CC 4DTMA 4B1VA 5GAOl 2XAQA 5LJ5d 4DSJA 3MHXA 1Y96B 2XPVA 3VS6A 3URGA 5JICA 2GTJA 2XPUA 3FZKA 4XNFA 4NL3A 1Z9QA 3NGYA 2H6CA 1X19A 4M9ZA 4A3FJ 4M7AD 1MMGA 1IG8A 3V8LA 4AHVA 3KLGA 5L3FA 4OMNA 3SBGA 4F9OA 4HG2A 2Q8KA 3D5SC 1FBQA 4FETA 3L2WA 2H1KA 2GXGA 3EY1A 1PSFA 3UT1A 9ATCB 4LLGF 1TT5B 5KYWA 3OS1A 1UDLA 2CG4A 4A69C 1B9FA 3NH0A 3ZMTA 3D1NI 1RAIB 1YTUA 1USSA 1LFUP 4DFPA 1NKEA 3KXTA 1YITQ 3VQ9A 2PYLA 2OZUA 1BQMA 4II3A 2LNHB 2ZF5O 1NGAA 4EM2A 1AKHB 3F8FA 3AO5A 3HOZJ 3ZX0A 5E1WA 3LPUA 1RUOA 5BS6A 4CHZA 4M7AF 3E6CC 2WV1A 1ZHFA 2E20A 1C1AA 4KH4A 2L4AA 2IIMA 2B86A 3OA9A 2LP0A 5CYMA 1LOTB 2ZXHA 3L2VA 3EFSA 5CY4A 4DLEA 3ZQ7A 2FZGB 5L3GA 1S6PA 3SQ0A 3L1PA 4KHPK 5F2RA 4JI7K 2HOTA 2HVRA 4CERA 3B8AX 1S72Q 2M2EA 3QG1A 3OW2A 1YJNI 5KYYA 3MQ0A 1N25A 4B3SK 2OFKA 4BRGA 5AR0A 3OR1C 3KNTA 5B5EC 3VPZA 1CF7B 2O88A 2L54A 3OIQA 1KQ2A 2D0BA 5I11A 1X3WB 1EWRA 4H0VB 3CI5A 1ONVA 3CESA 3CF2A 3WTVC 3H92A 5C24A 3LW5E 3KP2A 2P9LB 3VEXA 3OYFA 4CF0A 3CCET 4R1HA 5BPIA 1HOMA 4GV3A 3LH5A 4AFZC 4F8RA 3U23A 4B9WA 2FPFA 3K57A 3CWSA 1JQQA 3LDQA 4LC9B 2V7ZA 3F0ZA 1BQNA 1TK5A 1MZBA 1EKEA 2V51B 4MTEA 3CQ8A 4Y92A 4XTYA 2NUPA 2RKIA 5F1XA 4LDVA 2YHYA 2IGMA 3O80A 4A4HA 3VQBA 1YQAA 1K9AA 1JUSA 4BUPA 1M3CA 2HHWA 3M7GA 3N97A 3JCMX 2NNNA 2W6KA 5J2MA 4FWSA 2ZO4A 3I0XA 2AKLA 4CZHA 2E1HA 3KFVA 1ZELA 2DMPA 1SD5A 2P9KA 2CGJA 3L3UA 3BR3A 1W2BA 4CE9A 2DVEA 5EOYA 2BZXA 2EZKA 4HCZA 2MG4A 4EHUA 4BS9A 5GAHP 1IRFA 1YIJI 3N05A 3TSZA 1Z9CA 1ZLKA 2EIMH 1FYNA 3BDDA 3M1FA 5HODA 2DL4A 5J1RA 3CCUN 1QCOA 5FW9A 4XKBA 4XIDA 1X75C 1IBMK 1QBJA 2FRHA 3QKJA 4BJ6C 3PSIA 2K5LA 3HPOA 1VQPT 3L3VA 3O5BA 5LJ3f 5C2FA 3SAFA 4KRTA 4IO9L 1FSEA 1M90C 3DEUA 5AQFA 1GLLO 4J2DA 3F6OA 3H3VK 4A4GA 1MH4A 3SYTA 3PY8A 3MKWB 1I5OB 2TDXA 3NGIA 1B8IA 3CMAI 5AQNA 4E89A 2IP2A 4L8RB 5ICGA 3GPLA 1U5TC 3H0IA 4W97A 1I8FA 2EGEA 2VXEA 1JKPC 1K8AC 1QSYA 4E6KG 4YOXA 2VT2A 3DRSA 1X9MA 1NJXA 3E7LA 2FC0A 3ZMDA 3LGLA 3TANA 4RW4A 1F21A 3J7AO 3OYJA 3LP3A 4MEYF 3LA2A 1YJWA 4OLAA 3OWTA 4M77B 1EH8A 3BZ6A 1JXSA 4YOWA 2EZHA 3CCJT 4DTUA 1UAAA 1MBEA 5M1FA 3VEVA 3SMPA 3GXOA 2DDAA 3DTIA 4LFCK 1QCFA 4KUMA 1OCPA 2R7QA 3KZYA 4YHHK 1KXPA 1Q86O 4CJVA 1G3TA 4C2MJ 3A01A 4C8NA 1N6QA 2YRDA 2OAUA 1HJDA 1JGSA 1AD5A 4FHTA 3WHCA 2QKKA 2V7FA 2JHNA 1D3BB 4OINF 4F04B 2FMLA 2FQ4A 3WXIA 5HRPA 4Y4RA 1KZHA 1O4XA 2CJJA 3WVDB 2B8AA 3U1KA 4FM0A 2Y31A 2B7EA 1XC3A 2BW3A 3M3YJ 1IC8A 3CCVQ 1X58A 1FEXA 2FE3A 2V9VA 2W42A 4PJOC 4I09A 5JS1A 3PSFA 4RW7A 1HLVA 2RJCA 2G8IA 3CCQQ 1ZUYA 2RVCA 1LEBA 2PVGB 3VQ5A 4CECA 3S3NA 5LY3A 1YHQT 5EG2A 2M30A 4BQQA 4I2QA 2DCEA 3H0HA 2VBZA 1G83A 4XORA 3UKRB 3T3FA 5JVGF 1VQPN 3RCOA 2FLOA 4M3RA 4WCGA 3V9WA 2XGCA 2IIRA 3I8BA 4BHPA 1JGGA 3JXUA 1EV7A 2KT8A 1G2BA 4I9LA 1WI3A 4IUPA 2MD0A 5K7ZA 2AA4A 2GTDA 5J6XA 2KE9A 4M41A 1NKBA 5FPDA 2H3GX 2BE9B 2JLEA 2PJPA 3GX4X 1Y0UA 3O2PE 4OAYA 1GXPA 1VSJA 1VQ7N 3CXCP 5H6RA 4HLYA 4JRPA 2EIKH 4LXCA 4E1MA 4FSVA 3AY9A 4V2FA 2MI6A 4IJNA 4V19K 1MUDA 3G71I 3F9MA 4NC7A 1ZLMA 3MEVA 1DP3A 4IQJA 1P92A 1K9MR 2Q0UA 2D0PA 2R7DA 3QFPA 1PKSA 2EKHA 1J75A 2V6EA 4EPCA 2P9SA 2PG4A 3IWFA 2PBIA 3AL0B 1RBRA 3Q1JA 1X2NA 2KRFA 5D6WA 4LDWA 4L5JA 2L0AA 3PX6A 4E3SA 4IQ4A 4KKOA 2M7AA 2OPSA 2ZXJA 3META 2Q97A 2VKHA 1YJNQ 4PKGA 1NK7A 3FK7A 4QVZA 4K43A 1K6YA 1RI7A 1WEIA 3EG9A 3C94A 3IRXA 5JLWA 2Q0RA 4I01A 1UGVA 4CH7A 3CJBA 1BN5A 2V9PA 3UNGC 2XUBA 3CUQC 2P6TA 3NEUA 1PRLC 2EFWA 1U1TA 3OIPA 3SZTA 4JLGA 1ZK8A 1Y07A 3M6GA 4ELTA 1M3BA 1FMWA 3A2KA 2E88A 4RTZA 4HV5A 1M3AA 4Z2YA 4RGRA 1WFXA 1BIBA 4QPOA 1YJ9I 2CT4A 3OV8A 2WBNA 3BTLA 4M6VA 4X9CA 2OAWA 3ZSXA 5AFUA 1UHSA 4LE9A 2JA5J 3QEXA 3LH0A 3SD4A 3E01A 2F6CA 2X1EA 1VQ4A 3REBB 2OTJQ 3CCSI 1JJ8C 2HQAA 1WPYA 3VOEA 1WSGA 3UE5A 3CC4N 2CV1A 2DTHA 3VA0A 1BR2A 4Z4HA 3LZIA 2BTTA 5I2SA 2UZKA 3RKYA 4A4EA 2EQRA 1LMZA 3B6OA 1NK6A 1JHHA 2EBPA 2L7ZA 3A5NC 4JI1K 2FSKA 3TVTA 5GAGJ 2FPEA 2Z99A 3QU6A 1AA7A 4AHSA 3L2RA 4DF4A 3AVCA 5E17F 1SS6A 4CZLA 1ACMB 1NOZA 5EEGA 5AQJA 2BANA 3NWTA 4FJKA 1GLEG 3TP0A 1NEBA 3HKSA 4IRHA 5DM7F 1JE8A 2VQCA 1XX5A 3AGKA 3SUQA 1Y64A 2CP7A 1KQSM 2A28A 1BJZA 4IG0A 4K42A 1DIZA 1HD3A 3ZN1A 4CXFA 3SHFA 4Z88A 3CEYA 4IO8A 4DGWB 2QDLA 4BRLA 2A05A 3H6ZA 4CGIA 1K83J 2FQ3A 2NOFA 1R5GA 3PIOL 4IOAF 3CZ6A 1VQ9A 1YNZA 2DT6A 5LJ3e 1S9EA 4G1QA 4FWQA 3NMZC 3ZEHA 3K4LA 4BE1A 2OCEA 2YS9A 1R4MB 4AFUC 4C8LA 3SJMA 4LSNA 3VS4A 3PX0A 4M75C 3NFAA 3H0GJ 2KRMA 2ZMEC 1SQKA 1RDWX 1LNWA 5GAGP 1QSLA 3CCEI 2IGKA 4NC6A 2NOEA 4IOCF 1VNDA 1K0XA 1YFNA 2DPDA 3R0AA 3NCIA 1VQKQ 4DTJA 1WAFA 1W5TA 2PJRA 1IO6A 2HZTA 5DMRA 3KPHA 3BC8A 3HG9A 3D2FB 2LTOA 3ZT1A 4DQSA 5GMKi 5GMKh 1SKUB 2IBDA 1ZSZB 1R7JA 2VCPA 3HO1A 5AJ3K 2HHUA 4RB1A 4O0JA 2HVSA 3H3UA 4DJAA 4A4KA 4LG0A 3TAFA 3IH3A 1UHMA 2OQRA 1P8ZA 5CYVA 1TUUA 2GA1A 3C7JA 4I76A 5ILVA 2D45A 3MECA 3H9NA 2CW8A 2PBDA 2WV0A 1BA1A 2IAIA 4RGSA 3IKTA 3C2HA 3OBWA 1YF5L 4Y0WA 3MX5A 1NMNA 3C2GA 4ABZA 5H2FC 3G25A 2CQKA 3V4IA 2PFUA 2QEXI 2DD4A 3GFMA 2ISYA 3DKXA 1D0YA 4BGBA 3F2KA 2DJZA 2FOKA 3WU0A 3K4NA 4WFBL 3QQAA 1YIOA 4HW0A 1LWFA 4FZXC 1MJBA 1RL2A 3B6AA 1F5TA 2PTKA 2DJQA 3FK6A 2VXZA 3SJHA 1P7JA 3PIPA 3CDHA 1M1KR 3BF3A 1PNJA 2RI2A 1W0TA 2ZJRF 2D8JA 2WWYA 4I2PA 3HXMA 3PV8A 1HKCA 2M7BA 5IP7J 2OJ2A 2R7FA 4GYGA 3CCMA 2P4WA 2V52B 2VL8A 4AIHA 5IPAA 3DMJA 1U0JA 2ZMEA 4NXNK 2LY2A 1X2MA 3GYHX 4A12A 4C92F 3BR6A 1Q82U 5ICFA 2KHOA 1B34A 4QVCA 5D5VB 3DPUA 3RMCA 2EQUA 3AO1A 1XC5A 3S6WA 1VQPQ 1H9TA 1T33A 2XDDA 1J54A 4HAMA 2NAZA 2IGNA 2Q0OA 3M5RA 2M1HA 1A5XA 5K14A 1A04A 3CCVN 4PFPA 3FXOA 3MX2A 4M77C 2YLBA 1YX3A 5FLXK 2KZMA 4JK7A 4WK8F 1QP2A 1FJLA 4EMGA 3VB2A 3A8HB 3INZA 3CF5F 2O7OA 2PY5A 5E26A 1WZOA 3HEFA 1QZEA 3FMRA 1RUWA 1FYMA 2MGQA 2EX3A 4PJOE 3VV0A 1NYFA 3NQOA 3P8DA 3ZX2A 2HOSA 3HVTA 4KTWA 3J7ZI 2GNCA 2MC3A 3F10A 4YNQA 1U2WA 1FMKA 1V5FA 4FSXA 2W41A 3SFIA 1YJ9T 4DR3K 1Y8QB 5IY5H 3NMUA 1TWBA 3M8QA 3F8NA 2L02A 1QVFA 4OPAA 3I59B 1TP4A 3WE3A 2L3DA 4CBUA 4LIUA 4M3GA 4ESFA 3GTPJ 5C0MA 2RQRA 4LB5A 2RQQA 1VQON 4MFEA 3AVAA 2OPTA 2EBIA 1S6QA 3EPZA 3L1AA 4A0YA 3H5NA 4BI4A 4LF8K 1LWYA 3OBYA 1OKJA 3CETA 1WI9A 2KZZA 3QYFA 3EHRA 4O4GA 3REAB 2EIFA 2WACA 3ZGKA 4DV7K 2WB1A 4B9UA 3MXIA 4M7DG 1KG1A 1KQ1A 1XMKA 1A5VA 2M9HA 5CQEA 1N5YA 5ADXH 4N41A 3GG4A 4OPHA 1OI1A 4DV2K 4LG3A 4CF1A 2H56A 3KD1E 1GCQA 4Z6YA 2OTLQ 1ITYA 2LBFA 1NOYA 3K4JA 4CZGA 2DK8A 2JN0A 2K3XA 4X9DA 2HFHA 2R7VA 3B6PA 5GAOn 2ME0A 3RZOJ 1VQ4Q 1M1KU 1EP4A 1NKUA 3C65A 1W36D 1MNEA 1MNMC 1RDAA 2R4GA 4YG2F 1XC9A 4A61A 9ANTA 2EGCA 5CPRB 2M9UA 3O8VA 4M7AA 3FMQA 1IREB 3EG2A 4XH1A 2H8RA 5LHIA 2IA0A 3THXB 3J7AY 1R5HA 5AQXA 2GXBA 3LWIA 4N4GA 4CCHA 5J4VA 4I99C 2I5WA 1Q1HA 1UTIA 3BWGA 4MZTA 5C15A 2NOLA 1U5TA 2QWOA 3CMEA 2B0LA 2DKGA 3AVBA 4A6DA 3DV8A 3M1CA 4B09A 1WJQA 1AU7A 4JP0A 1N9RA 1C0WA 2AT1B 1IN7A 2DBMA 3Q7BA 5L3BA 4B1RA 3HSTB 2F4IA 2HBKA 2HBLA 1H9GA 4OB3B 1WH7A 1UG1A 4AI4A 1LPQA 2W84A 1VQ7A 3G7ZA 1RLQC 5EJCA 1X1PA 1MJ9A 4ZTJA 2W7NA 4FJJA 2MBFA 2J6KA 3MWPA 3H9JA 3ZMVA 1SANA 2JW4A 3C18A 2L9SA 3FX3A 5HS8A 2DXUA 3EAEA 4RTYA 4MDAA 3JRIA 5ERIA 4L0ZB 3M4OJ 1V4SA 4IUVA 3QPSA 4CHUA 4C30A 3JB9I 3QB0A 5CKBA 3HGYA 5KK1A 1OYXA 3CCRI 1YI2I 4FX4A 3W6VA 4JK8A 1T3VA 1CSKA 4MZMA 1PP8F 2RPIA 4IEJA 5DV5A 1YHQI 3NVKA 3WHBA 2QEXT 2XRLA 1WNLA 3SQ4A 4ESBA 5J8FA 3KBGA 1QKXA 1FWZA 3THYB 1UFFA 1W2BM 5J1UA 2OV7A 1YTAA 3RTVA 2NWMA 5LJWA 1OZ3A 3CMEN 4UNFA 4JX4A 3VYTB 5GAN5 1IN4A 2RJEA 3I55T 1ZG3A 2FRWA 3KLFA 2P7CB 1NKCA 3A98A 3KX2A 2CT3A 2KT0A 3VS2A 3LGFA 1BW6A 1CGPA 2DPPB 4XRFA 2VG7A 3ENHA 1RBTA 4AILC 2XY7A 3OGDA 4RG2A 1WIEA 4C8QE 1Z7LA 3MXJA 3CMEQ 3LL7A 3LSKA 2P1JA 4FK0A 4C92A 3OS5A 3LSMA 4ASNA 2R7OA 3QUIA 5ECAA 4BC3A 3H35A 2F5EA 2RC4A 2CKKA 2XB5A 3HBLA 2GQVA 2YNHA 1YW9A 2NRHA 1I6HJ 3E6MA 2EYWA 5KHDA 4H0TB 3N4QA 1TBXA 4RA2A 2LMDA 5DD4A 3M55A 1ENHA 3FM5A 4LD6A 2MPXC 4Y28E 3K5OA 2OTLA 2HXIA 2F5DA 1VQPI 2KKOA 1TWHJ 4CJEA 3S1RJ 5B66C 4DBQA 1LV5A 5IXBA 1OPCA 2R57A 2DW4A 5ED4A 4EMKB 5GANj 4NXMK 3LQQA 1PVEA 1Q86R 4IO9F 2V1UA 3FBIB 4H4OA 3C12A 1R36A 3CMAT 1D1CA 3QIIA 1M8MA 1NGCA 2DY4A 4BVPA 4CJPA 3AARA 2JUGA 3IKMA 3PMTA 4C0ZA 5KYYB 4FJ7A 1VQ6A 3DLMA 1EIFA 2V26A 3CW7A 1VUBA 1SFKA 1KSWA 1S1XA 4RWTA 2E6LA 4BBRJ 5HS7A 4B1ZA 3I4NJ 2CP6A 2CSQA 4AM7A 3T8RA 3WEEA 4KH0B 3MVPA 5F04A 1X4OA 2LNVA 2QQRA 1L3LA 2VWKA 5E41A 1PM3A 1RBSA 1ZRCA 5FFXA 3HOWJ 2PLYA 3HYIA 1RI9A 4AVZA 1OLTA 3JRZA 4H0XB 1YRNB 2LMJA 4HCCA 1N3AA 3U9ZA 2EJGA 1B6AA 1R1TA 3GO5A 4LG0B 4L18B 2Y9YA 2LCCA 3AVIA 4GFBA 1B9DA 3QOEA 1GBQA 1R22A 2DXCA 4J9IA 2COMA 2YLCA 3FXUA 1DU0A 3IG1A 2NUPB 1J5YA 3GTLJ 3RI4A 4C92G 1LOJA 1RAFB 4DV1K 3ZT3A 3PNYA 4GV6A 4FWLA 2CSIA 4EJZA 2Y9ZA 3EGDA 2R93J 3CLOA 3IKVA 4KHNA 4UHTA 2YHXA 4DMNA 2CFOA 2NVYJ 4XK8E 4E9EA 1KVAA 1T98A 1OJLA 1GCPA 4HHTA 5FPMA 1E6GA 3I55Q 5GIOA 1O3RA 3OIOA 5E79C 1NK5A 1TWCJ 3RPUD 3HUGB 2O61A 4CZIA 2MAMA 2XO7A 2HOAA 4A3EJ 1VSEA 2HTSA 2A1RA 1RT3A 5GAMg 3QNOA 2HBWA 4W5OA 1MWKA 2KRNA 1WBBA 1LJ9A 5J26A 1BYMA 2M0MA 1JJ2A 1NK3P 4YOYA 1VQ5I 3HHGA 4B9MA 2VKDA 4HX8A 2RREA 1NJWA 1JJ2M 3O3KA 1ZBSA 4OMQA 3EL2A 2G8WA 3EUKL 1ZG1A 2DAQA 2YNFA 2Q2EB 3D0PA 1JB0E 2ZJRL 3VQEA 2BYVE 2L7KA 1W2BP 4YIFA 2M4KA 2UUCK 2FXAA 2AZSA 4G94A 3LWHA 3O9RA 2L3PA 1V55H 2HMIA 5IHKA 1VQLI 3I5SA 1FBUA 3WTWC 2VGMA 2E10A 4JN4A 3GTJJ 2IS4A 3QEPA 2A36A 2E1OA 4J8FA 3NTHA 4KI6A 1WSJA 4DQRA 2K6DA 3CCRT 3RMDA 2Q3SA 3CCVT 1TW2A 1BI4B 2VG5A 4BEHA 4FK2A 1HW1A 3RSNA 2DX1A 2JNGA 2P9UB 3FF5A 3KLHA 1GVDA 2GCXA 4ZGEB 4RB0A 2O31A 4F55A 3M0QA 4NLCA 3ZSVA 2DOFA 3VS1A 1WOQA 1BIUA 3VGKA 4PJJA 2DO7A 2KK4A 4GV9A 1KD1O 2ZGYA 1VQKA 4FVMA 4CJWA 4EP4A 4AG2C 2QGUA 4O0IA 2O9LA 2DYRH 4K41A 4XTUA 1SD6A 1ETWA 3AKZA 1Y39A 5LHGA 1IJWC 3ZQFA 3CMAA 3OW2P 1RBVA 1D3YA 5M1NA 2XU8A 3I56Q 4BH9A 4AWXB 4H8KA 3LP1A 4MDBA 2F8SA 2ZWHA 4RUGA 4CEAA 1B72A 1MU2A 4HT9A 2MWPA 1RNLA 3NVMA 3FBNB 2EW3A 3LP0A 3M8SA 2XICA 4LFAK 3NRVA 2R7YA 1V76A 3V8KA 3JCMe 3QPTA 4TV7A 3OSSC 3MEWA 2KZGA 3KCCA 4I0AA 1YN8A 1KQSA 4OPJA 1RGIA 3T1AA 5E3NA 1SSFA 3ULEA 1U6GA 4FVUA 2LQWA 3PVLA 3CM6A 2QA4A 3PUBA 2KIQA 1YITA 4GBQA 4OIOF 3TO6A 1JXEA 3HRMA 4ISEA 1S1UA 3E0JB 2O8DA 3TAPA 2M8EA 2E5QA 1B34B 3E9OA 2XIGA 1LE8A 4V2SA 2QQ8A 4B23A 5DM6L 3RDVA 4A3LJ 3CCRQ 1R6RA 3GIBA 3BCBA 3ZQCA 1S5LC 2RHXA 4RTFD 4DG1A 5LGNA 2R3SA 4PKIA 1PWTA 3CMAN 5D6FA 3KEQA 1CQTA 2DYBA 2JVVA 2CP3A 5AONA 2DPNA 5JR3A 1KRPA 2ABKA 3O3HA 2F2WA 4X62K 3ABUA 3TSQA 1GXQA 1VTNC 4OF1A 3FIWA 3LDPA 4FK4A 4BY7J 5DEQA 1EA3A 1VQ5N 3CERA 3QDFA 3BUZB 2O8KA 5L3EA 1LWWA 1RT7A 1OYYA 2XF7A 2PZ1A 5DCMB 2O4IA 2BTFA 3GZ6A 1ZBIA 3OYLA 1RZ4A 2DTUA 3FXJA 2VPLA 3JAMK 4OFEA 2XV4S 1JKOC 1Z91A 4M7AE 3VU3C 5JHUA 3OS0A 5IH2A 4JRKA 1UA0A 2HMPA 4KUIA 4CC7A 4XU0A 4PL7A 2D8HA 1KONA 1NGJA 2K85A 5GMKe 1NPRA 4M78F 1HLUA 4RDUA 3MEUA 2BY3A 2W1OA 5F0HA 4KITB 4G12A 2JJ9A 2G7UA 3M56A 4B3OA 2RQWA 3ZQGA 2DJIA 4DV6K 1SC7A 3F5TA 3MDQA 3VEPA 3LM9A 2ECCA 3G6EI 1VYTA 2M0CA 3W2AA 1KU7A 2CGLA 2E2PA 4MLEA 1AZEA 1J59A 5J2PA 5AQQA 1DTQA 3VQQA 4FX0A 2LH9A 3V1RA 4PLIA 3TR8A 5D6XA 1SD4A 2JHJA 3MAQA 4KN7X 3SZGA 4BC4A 3QDKA 4KI4A 4HF1A 2ZPBB 3VUZA 5ICCA 1V3FA 2K5IA 4FW2A 1ZXOA 4A2BA 4X66K 4C92B 1QQCA 2RNGA 2B9SA 3N5NX 2JMAA 5HK0A 4JUVA 2ESWA 1CKBA 5DTDA 1ASUA 1R23A 3BJAA 2VYTA 2LDMA 2J5PA 1VQNI 3QWYA 4H5NA 3OH6A 2JTVA 1YOVB 1YJNT 4JLIA 2KR3A 4JKAA 3HDDA 1K73O 2HYGD 1CXUA 2X6WA 1BA0A 2BE2A 2BKDN 3T9NA 3O4NA 4CI6A 3T1YK 5D5XB 2CS3A 3WNHA 3M8EA 4XTXA 2YHBA 4C5IA 4CK2A 3KLIA 3BFMA 1DLOA 1TUCA 3UDCA 3VS7A 1BJAA 4FOEA 2F4OB 1R00A 1HA8A 3KZBA 3MKDA 4O3MA 1FOWA 1RCHA 4L5GA 4D7NA 4Q0BA 2WC9A 4YOQA 1JLCA 1FSHA 2VWJA 1U3EM 1VYUA 2L89A 4H5RA 3ZLJA 2GGRA 5GAEP 1IRXA 4L9VA 1R0CB 4RCBA 2O01E 3KTUA 4HNVA 2A6AA 2JWTA 1KO9A 2IOCA 3ECOA 2YU9J 4QW2A 2QCOA 4XTZA 3IH2A 3LWMA 5B3SH 4N76A 3S1MJ 4I6MB 4EIAA 2CGPA 3HOUJ 4B9QA 3CPWM 3VYGA 1XGSA 5CKTA 1WXTA 3VQAA 5KCHA 2L7MP 3BTJA 5IT9K 3GLXA 1OCTC 5JLFA 2DA2A 1W1WE 2LKSA 2HB5A 5GAN2 3KWIA 3ROUA 4JOMA 2EK5A 3UATA 5J2NA 3O8GA 3TEEA 1PC0A 4XONA 1GLAG 5AQMA 4L5IA 1OX8A 2MD5A 3D4VA 4ZTFA 3QPLA 1S6LA 3KHYA 1BU1A 2ROTA 5FD6A 3THWA 3I9QA 1NU0A 3KK1A 3H0DA 1ORPA 4UQGA 4DBHA 3K1NA 2XF6A 1OU8A 2LT4A 2GELA 3HSCA 2LX9A 4CHOA 5A0LA 1VRTA 3C6TA 5IHNA 2YG8A 1HBXG 1Q86U 4JI5K 4DV3K 2M3AA 2H3JA 3MP1A 3O4QA 3FFIA 1F43A 4FW1A 1EX4A 1EETA 4DSKA 2LYCA 1T44A 5HRSA 3HKZN 1XG1A 3OYCA 1YI2N 2QEXQ 1Z77A 5IT9E 3MWTA 4OPKA 4IFYA 2IGIA 2NOBA 1LB2A 3CCMQ 1LDDA 1W0HA 4EEFG 2JA2A 3S41A 4OU0A 1G15A 3RYPA 1XI1A 1TGOA 3H5AA 4ELYC 1YWOA 1WSHA 2CZ7B 2WAFA 4E9GA 2DAOA 2QGFB 3KP3A 4G7OF 3U3GA 1N27A 1Y96A 2RPNA 4BR4A 3F8BA 1QMCA 3RRHA 1JLFA 2K2MA 3MAJA 2HPMA 1OISA 2OA4A 2MW8A 1YITI 4B8CA 1LWCA 3G6EN 5KYNA 5CVJA 3S32A 4FYDA 3IRQA 2LY1A 3TDZC 1E6HA 2RF0A 1RTIA 1N33K 4A3MJ 2OD5A 4A6EA 3DAWA 1Q9XA 2CUJA 2YHTA 3IFRA 5I42A 3CCST 3TW7A 2VOOA 2F9WA 4UV8A 4ENMA 3F21A 4DS4A 1SAXA 4C3HJ 4EA4A 1E2XA 3BPVA 4PJ0C 3QODA 3MEAA 1HW5A 4A0XA 2OJED 3F8MA 2QYOA 1LDJA 4CJTA 4B43A 2P0QA 3ATUA 4H4MA 2VC0A 4PWDA 2HF3A 3WGGA 1NK2P 5GAMd 3BDPA 2X6OA 1KD1R 1ZYQA 1OPKA 4HVJA 3DXKA 3U3YA 1C6VA 1QQIA 4FLYA 4HX4A 4JK9A 1K8AU 3CMYA 2BVLA 3C1DA 2EB7A 4CGDA 4L0YB 3U1DA 3C95A 2MMPA 3S17J 2VASA 5GAOm 3VSKA 1YFHA 1UG0A 3VEYA 3H36A 3JSMA 4M7AB 4CK3A 2AKKA 1U3OA 2EIJH 2FO0A 1AWOA 3NPFA 3OYNA 2X4WA 4R55A 2NRRA 3A8GB 4IXAA 2XRIA 4HF2A 1VQMA 1MV3A 4ESJA 4JKDA 1Y1VJ 3QO9A 4KFBA 3KD5E 5T7BA 3EG1A 2NUBA 4AHTA 1J3TA 2E5KA 3CO6C 5BRHA 5CKHA 2ZJ2A 3G6EA 3WNGA 1VF9A 5CZ1A 3OVNA 5GMKl 5KI6A 4M7YA 3VMFB 4B48A 5JHFA 4MQ9F 5EC7A 1FYKA 1JJ6C 2ASOA 2NZTA 1Q7YO 4Z4FA 1XHXA 5FLXZ 1IN6A 4KHWA 4YRVA 2EV0A 3O6BB 4FYYB 4CEZA 2OTLN 2DVJA 2ZPHB 4KA4A 2VG6A 3PO4A 3WGIA 5IT9Z 5EGOB 3HYFA 1IUFA 5LBQA 4FO0A 3RKWA 2AHJB 3VYRB 4KAZA 1ZUUA 1C0FA 3VRZA 4EFHA 4E7KA 2LJ1A 3CBPA 2R5YB 3H46O 3C6AA 1RABB 3FZHA 4M73A 1IKXA 4CI0C 5GANe 3SZPA 4TVRA 1R9TJ 4M45A 1YO5C 1OR7C 3R6SA 4BRKA 5BNGA 5C4XJ 1MMSA 3SLCA 4EM1A 3EE8A 4LD0A 2MC4A 2YKNA 3LL3A 1RTJA 1LEAA 2ATCB 5HLGA 3RR7A 3DLLA 4BWJA 1RTHA 2D1HA 2NNYA 3R4KA 3AVLA 1ETVA 3U4LA 4OJRA 2IRFG 1JCEA 2DT7B 2RI3A 2DQLA 5M3FJ 3SWNA 4NBQA 1K1ZA 4N4IA 3RZDJ 3HTSB 1X27A 2YJFA 1KU9A 1JKQC 4D9JA 3E1YA 3AVJA 5HP1A 4Z02A 5LJ3g 3QOPA 3I56I 3KIOA 2VUMJ 8AT1B 3CCJI 5IHIA 2KDOA 3P9IA 2DMOA 5GAN6 4M7DF 3HZJA 4M75E 2ID6A 4J9EA 3KJVA 1YUWA 4EDUA 1VSLA 1U8RA 1TXQA 1VQKT 1GLDG 2DPUA 2C0IA 1AHJB 2X0LA 2V1NA 3ABLH 4CJSA 1NM7A 3DTKA 2F8TA 1Y71A 3IAM2 3O9SA 2KHMA 4CEQA 1Q9YA 3I58A 1I6XA 3LDOA 3QAHA 1OULA 2JK3A 2MLGA 3CCQT 4XOTA 1Q82R 5AZJA 1C0GA 4KUDK 2K4BA 4OWRB 4LFUA 4O8UA 1S7OA 1VQ7I 3DLRA 4BG8A 2HSTA 5KQ8A 2EFPA 5J39A 4UUSB 1TLHB 5F64A 2E41A 3MCAB 2A5YB 5DM6F 4A59A 4XAXB 4QWQA 4BACA 1EZZB 3MZ8A 2X1CA 4UB8C 3CC4T 1KAXA 1QVTA 2Y90A 2YT6A 5AZIB 2PYJA 5CVRA 2HWVA 4B9XA