3L2WA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and gs9137 (elvitegravir)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
b'AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2wA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2wA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2wA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2wA03
4C8MA 1RTHA 3NHGA 1CXUA 3JYTA 4OKKA 1N6QA 1MU2A 1VSKA 1NK9A 1NKBA 4KO0A 5HP1A 1HJRA 2Z1GA 2YNHA 2GBZA 3NH2A 2RJDA 4KHYA 3V1OA 4JRQA 3RR7A 2VG6A 1UWBA 2X4WA 4E3SA 2DIQA 5CYMA 3AVKA 4CIFA 3V9ZA 2X78A 5D6YA 2YRVA 1VSDA 3O3HA 2HHUA 3HJFA 3CYMA 2LDMA 1U49A 3AVIA 3K2PA 4A4FA 4DFKA 3RMCA 2YNIA 3NF7A 2RN2A 4IG3A 4Z4EA 1NOYA 3OA6A 4RW6A 2HQXA 3TAFA 1KVCA 4LD6A 1VSIA 2VG5A 4CHYA 4N5SA 3LP0A 1S5JA 4KHQA 2G8FA 2DFEA 4I9QA 3META 4CHOA 3Q1JA 3DRRA 3WNHA 2IC3A 2E5QA 4B8CA 3VN5A 4FJ8A 3LAMA 1Z25A 1A5VA 3MEVA 1WSEA 3V4IA 1LW0A 2LRQA 3NNQA 1VSHA 3AV9A 3OYGA 1TKXA 1QSSA 4W5OA 5I42A 3OYEA 2QQRA 2LSNA 4RG8A 4C5EA 4Z4CA 3I0SA 4WE1A 4CJ4A 3SQ2A 4CCHA 4NYNA 3OS0A 2HVIA 1HYZA 3AO2A 2YV0X 4EDUA 3NCIA 4BDZA 4FK4A 4M3UA 1KLNA 1LW2A 4KV8A 2BDPA 2KFNA 3RRHA 5KE2A 2BUDA 2PYLA 3AA2A 3PUFA 3LP1A 1LV5A 3O3GA 5KI6A 3TABA 1BI4B 1JLAA 1W0HA 4O0IA 1HMVA 4GMJB 2MWOA 5KCHA 1WN7A 4L59A 2WACA 1D5AA 3AVLA 2BKDN 1J54A 1NK4A 3D45A 2YKMA 3F70A 1RBRA 3M9QA 3QETA 1X9MA 2G8HA 4OLAA 3RR8A 1NK6A 4ZTJA 3S3OA 1ZYQA 4IUVA 4MQ3A 4F2SA 1NK5A 1H3ZA 4IUQA 1BGXT 3FDRA 3VQQA 1Z26A 5DK5A 1SL2A 1SL1A 4FW1A 2PQWA 3AVNA 3FLGA 3VQ4A 4DSKA 4B3OA 2D9TA 3K58A 3ASMA 1NK8A 1XWLA 2QXFA 4BWMA 5CY4A 2KFZA 1TK0A 3TARA 1IKYA 3DLHA 4FLZA 4B9XA 1WNSA 4J2BA 1KRPA 2L89A 1QHTA 4OGCA 3U3GA 4B9TA 3K59A 1TKDA 2R58A 4HHTA 3VQ5A 1IKVA 5HRNA 1KTQA 4CK1A 4LH4A 3FC3A 3QNOA 3ZSVA 4CEDA 2JLEA 1WLJA 3OY9A 3EZ5A 2KZZA 2K3YA 1BCOA 3HSTB 4AHCA 1RDCA 2HHTA 4Z4HA 4Y1DA 4C8OA 4HUGA 2HHVA 3LZJA 3MP6A 4Z4FA 1J5OA 1VSJA 4FJXA 4AHSA 4DS5A 4RW4A 4F8RA 4CHQA 1EKEA 4AHTA 4FM1A 3S6WA 3T3FA 2AJQA 1RTJA 3DRPA 3LAKA 4L8RB 5J1EA 5HBMA 3BDLA 1HRHA 2QK9A 3E9GA 3I8DA 4CJRA 3FFIA 4M42A 1FXXA 4DTUA 4A4GA 3GOXA 4HCZA 4O55A 4FZXC 3CG7A 4E89A 1D9FA 2ZD1A 1JLBA 3P83D 4PLLA 3ZT0A 4AH9A 3QESA 3SPZA 3QEXA 3AO5A 3L2QA 1X9SA 1XHZA 4FM2A 1SKWA 4KTZA 2O4IA 1BI4A 4PA1A 4GVMA 4CJSA 4PL6A 1G5VA 3TAGA 3QIPA 3PO4A 4XIUA 3IS9A 3SNNA 3T1AA 1KLMA 4CECA 4OVLA 2Y1IA 3OYKA 4CIEA 1DTQA 1C0TA 2YKNA 3P8DA 3DM2A 3ZCMA 3LZIA 4CF2A 4QW2A 1WSGA 4CHZA 4GY5A 4FJ5A 3HPOA 4CF8A 3HYFA 3HT3A 3KK2A 5KH6A 2EQJA 3DOLA 2ZQBA 4ID5A 5FDLA 1HNIA 3QIIA 3AVJA 3ZSOA 1S9EA 2XO7A 3OYMA 1KFDA 4B9UA 1S6QA 3RMBA 5E41A 3O4QA 4CF0A 2D0BA 1UOCA 3KLEA 2XY5A 4CGGA 3ZSQA 1TV6A 3AVCA 4CEOA 3HPGA 4CK3A 4CESA 2DFFA 1IKXA 1J9AA 3NBPA 4G1QA 3MXJA 3PFSA 4N76A 1BISA 2B5JA 3P5JA 3HK2A 3LPTA 4DQQA 2P5OA 4CJQA 4DMNA 3G0ZA 1T03A 3KLIA 4FJMA 3HP9A 3V1QA 4K8ZA 1TGOA 3DLEA 4CJEA 1S6PA 3TAMA 2P1JA 1BHLA 4F2RA 3LX7A 2KTQA 1ITGA 4DTXA 4B8AB 4DQRA 1HQEA 2LCCA 1WSHA 3ZEHA 3LYIA 4Q5VA 3OJUA 2IG0A 3OMCA 2KQ2A 2PY5A 1UA1A 2Z1JA 3TI0A 3RWUA 4IDKA 3LWLA 4CJFA 3QO9A 2ZE2A 4A4HA 1KVBA 1SKSA 4C5HA 4DSIA 1VSFA 1MHNA 3NH0A 3L2RA 2F8SA 3C95A 3ME9A 4YNQA 4CJLA 1LWFA 1L3TA 4EZ9A 1SV5A 4IURA 3VQEA 3QJ6A 2HQEA 3MAQA 2QKKA 4B9MA 3H6ZA 4HCCA 4N4GA 4W5RA 4DFPA 4CEZA 3O4NA 2QQSA 3SV4A 5J2QA 3OB9A 3KLFA 1LAVA 3OJSA 4IFVA 4JLHA 4M3YA 4JRPA 4Z0UA 4FK0A 3TWHA 1KFSA 3ITHA 2RI2A 3DLMA 2HVHA 4E7HA 4N56A 1XC9A 3C6UA 4DQSA 3OMGA 4DQPA 2EQKA 3SUOA 3ASKA 4M3XA 1L5UA 4IUUA 3ZSRA 1OYXA 4F3TA 3ZSXA 3SJJA 5KCOA 3LLRA 4C8LA 3JSMA 3AO4A 5CIUA 4FLXA 1RT2A 4O4GA 4FLYA 3AA4A 3F9KA 4KREA 4UC4A 4DSJA 4CEFA 4HTUA 2GFAA 2R7YA 1TK5A 5D6XA 2JTFA 2PZSA 4CF9A 4CGDA 1JLQA 1TKZA 2DTUA 1C0UA 2FHDA 4DTNA 3VQAA 1RI0A 2D0CA 4KHWA 2L3RA 4QVZA 4E1MA 4C5IA 1RDBA 2CKKA 3IAYA 1RBUA 4OGEA 4DU4A 4I2QA 1VRUA 2GV9A 3KKRA 3VQDA 5J2PA 4CF1A 2HHSA 1B9DA 4CIGA 1W9HA 4FLUA 1JLGA 1RILA 3VQPA 3VA0A 3SI6A 4CEAA 2RHUA 5C42A 5M9OA 3DYAA 4HUFA 1NK0A 1C6VA 4DLEA 5CZ2A 1S9GA 2R5AA 1X1PA 4NCGA 1Q9YA 3L2VA 1U48A 2JGUA 3CM5A 3ULDA 2MWPA 5C25A 3V9SA 4KPYA 3MXMA 1KHCA 3HPHA 3EYZA 3OYIA 1BQMA 4CJ5A 3V6DA 1FKPA 5C0MA 3SUPA 1WSJA 4ELTA 1UA0A 3OYFA 1NJWA 1C1BA 3SQ0A 4FJ9A 1S1UA 3L3UA 3B6OA 5HRPA 4O44A 3AVAA 1HQUA 4E19A 3AVHA 5I3UA 4O5BA 3OYDA 5KGXA 3MO8A 2D0AA 3HP6A 2XHBA 1CXQA 2IGIA 4I7FA 4X34A 1JLFA 3NGIA 4FLWA 4OJRA 2HHXA 2XY6A 1OI1A 2XY8A 4EP4A 1VK0A 1REVA 3NF9A 4W5QA 4OLBA 3NTHA 1B9FA 4FYDA 3K5LA 1JXBA 1ZBHA 4FCYA 1KSPA 1BIUA 2ITGA 3U3YA 4FJ7A 1CLQA 4FVMA 1KVAA 4KRFA 4M3ZA 2O4XB 3A2FA 3DLKA 3VA3A 3OS1A 4PWDA 2IOCA 2IDOA 2X4XA 2F5KA 3QERA 1CZ9A 5K14A 1N27A 4KI6A 4LD0A 3AO1A 3VQCA 1SSFA 1U47A 3HVRA 2HMIA 1VSEA 5KTQA 2KZMA 3LGFA 2B6AA 4CJWA 4LH5A 3PO5A 3PX6A 1J53A 3KJVA 4CHPA 3K5OA 3NFAA 3ALYA 4NCAA 4TSXA 3UWNA 3PMIA 2LTOA 4BWJA 5SZTA 1TVRA 1JXEA 4KHUA 3HXMA 2G8UA 1R0AA 3NF6A 4AHRA 1RDAA 4R5PA 1O1WA 4KI4A 2OPSA 2IS3A 3M8SA 3K5MA 4DLGA 1BQNA 3MEEA 1IO2A 3VQ9A 3AA5X 1LWCA 2EQMA 4FJGA 3OYLA 4DG1A 4PY5A 4F4KA 2YNFA 1N5YA 4DF8A 5KE3A 2KW4A 5J2MA 5IAYA 1LAWA 1RTIA 2RHXA 3SQ4A 2OYQA 2O4GA 2Z1IA 1WSFA 2M1HA 2NUBA 4BD3A 3WNEA 1I39A 1GOAA 4RW8A 2R57A 2F96A 4DTMA 4FJKA 5FROA 1HYSA 3QBYA 4B9WA 1ZBLA 3DLRA 3THVA 2X74A 4Z4GA 2EHGA 2RKIA 1EX4A 1NJZA 4B9VA 4CFAA 3WNFA 3TAQA 3SUQA 4EZ6A 4QAGA 1G15A 3AVMA 4FW2A 4O0JA 4N4HA 2DIGA 1CZBA 3NDKA 3LH0A 4ELUA 3QKJA 3ZSYA 2G8WA 4J2EA 4IBNA 3S3NA 1ASVA 2RHYA 4N4IA 3V9UA 3ZT4A 1RDDA 4OPKA 3DRSA 3DB4A 3V9WA 1IH7A 4Q5WA 5JS2A 3L42A 2VYTA 4DQIA 3O8VA 3PNWC 3SV3A 2X4YA 2RJEA 4B9NA 4AILC 2GUIA 4DU1A 1DTTA 4FZZA 3NTIA 1JLCA 3QEWA 2VWJA 4DWIA 3U6FA 1T7PA 4E7KA 1ZBIA 2OZMA 1S1XA 2HHWA 2NLUA 3SYZA 1XHXA 4ID1A 3VQ8A 1RT4A 2YNGA 4CEEA 2YHBA 1JKHA 3RMDA 1S1VA 1IG9A 1ASWA 1U4BA 2P5GA 1TKTA 2QKBA 4FLVA 4Y1CA 4LSLA 1VSMA 4NS5A 2A1SA 2G8VA 1RBSA 2BIVA 1IKWA 1LWEA 2RJCA 3LGLA 3V9XA 2WOMA 1QTMA 2BANA 1C1CA 3OQ5A 2X6SA 3T19A 3LDSA 2ATQA 4M3RA 3SUNA 3SD4A 4OKEA 2PYJA 3NGYA 3TR8A 3SZ2A 3ZSWA 1TK8A 3AVFA 4NZGA 4DFJA 2DAQA 1UAXA 4DFMA 2E4LA 2HNDA 4DTSA 4DTPA 1QQCA 3QLHA 1KCFA 2IAJA 1A5WA 4DSEA 3DMJA 1SUQA 2OPPA 5HRRA 2F8TA 2E6LA 4DU3A 1RNHA 2W42A 2M16A 1JL2A 5FRNA 5J39A 4E7IA 5J26A 4KTWA 3NH1A 1OZ2A 4IKFA 2DFHA 3M8RA 3C4SA 5CYQA 4DSLA 1HYVA 3MEDA 3OYJA 4W5NA 2Y1JA 3QINA 2RI3A 3KK1A 3KTQA 2BE2A 4PQUA 5FRMA 4FJHA 3OYBA 4FL6A 4K8XA 4HUEA 1RT7A 3PV8A 1T8EA 1WJQA 1QE1A 4C8KA 4DTJA 3P8HA 3KIOA 4CRIA 1Q8IA 5T7BA 5EU7A 1WAJA 2RPIA 3MEUA 3B6PA 3OYCA 1NJYA 3HL8A 4FU6A 4DSFA 1GOCA 3QEVA 2HW3A 4H4OA 3ZT3A 2RF2A 3QNNA 3RRGA 3MP8A 1C0MA 2P51A 5D6WA 3S3MA 4CJVA 1BIZA 1EETA 2Z1HA 4CFCA 3D0PA 3BDPA 1FKOA 1WJSA 1X9WA 3P1GA 4ICLA 3E9FA 3UIQA 4CFBA 4ZHRA 2RJFA 1K6YA 1RCHA 4E0DA 4YFUA 3KKSA 4CJUA 4QCLA 2RHIA 4C5GA 4DF4A 3LP3A 1NKCA 4Q0BA 2X35A 3E01A 4ZTFA 1D9DA 4KHSA 2BGGA 2B8AA 3VQBA 3KLHA 3OYNA 3SCXA 3L2WA 2FBVA 1NOZA 5C6SA 4FZYA 1L3VA 2EQUA 1RT5A 1ASUA 4RG2A 1NKEA 1ZBUA 1Q9XA 1T05A 5HROA 3CFPA 4M3WA 1QS4A 5DMRA 4CE9A 4CEQA 3LP2A 1VRTA 3L3VA 3UT1A 3CEYA 4N41A 5KRTA 4FLTA 3PX0A 1RTDA 3KK3A 3MEGA 4OVAA 4QQDA 4PLIA 3NTKA 2HNYA 3QEIA 4AHVA 1WAFA 1L3UA 4IUTA 3DB3A 1YT3A 4JS5A 2HHQA 5KGWA 5CZ1A 4B9LA 1WSIA 2FBTA 1NK7A 3EY1A 4BE2A 2OZSA 3TANA 4CJPA 2RI5A 3L2UA 4OKJA 4QOZB 3PY8A 4FK2A 3DLGA 2ETJA 3FEOA 1RT3A 4FXDA 3CFRA 3KD1E 1HPZA 2WONA 3C6TA 1S1TA 3BGRA 4QQGA 3HVTA 3DLBA 2RO0A 4H8KA 4IFYA 4IUPA 2L8DA 2OPQA 4J2AA 1A5XA 4B08A 3DI6A 4CJKA 2Q3SA 3KLGA 4H4MA 1XI1A 3AO3A 2DY4A 1TAUA 4KB0A 1OZ3A 3I0RA 1RT6A 3O3FA 3LANA 4KAZA 3PMTA 4GW6A 5C24A 4M45A 3TAEA 2EX3A 4FM0A 3NAEA 4B9SA 1WGSA 3HO1A 2G8KA 4DTRA 3ZT2A 4DTOA 3CQ8A 3V1RA 2EFIA 3M8QA 2R5MA 1I3AA 3MEWA 1F21A 3G10A 5KRSA 4M41A 4OPJA 3MP1A 1RT1A 2XY7A 3OYAA 5D3GA 1HNVA 4IG0A 1NJXA 4ELVA 2E6NA 4CERA 3ZT1A 1EP4A 1RBTA 4NYFA 4AHUA 4CGHA 5IN1A 2VWKA 1U04A 4CGIA 4FJIA 3NGZA 3V81A 2FBYA 3SQ1A 4RW9A 1B92A 5HRSA 3VQ7A 4FJJA 3QIOA 2OA8A 1YTAA 2GF7A 3MECA 2VG7A 4BDYA 3AVBA 3KUFA 4NCBA 4E7JA 1BCMA 2YHAA 4RW7A 3S9HA 1U45A 3ISNC 4W5TA 5SWMA 2XRIA 3IG1A 2JZ2A 4CEBA 2D5RA 3AVGA 1Y97A 2LVMA 5HLFA 2P0KA 4KKOA 4F3OA 1JLEA 4CGJA 4CFDA 3NF8A 4Z02A 4BACA 4N47A 3LPUA 3OVNA 4HVJA 3RMAA 4J2DA 2K3XA 1SKRA 1DLOA 1XNIA 4MFBA 5J2NA 3SPYA 4Z4IA 3LWMA 3F73A 3KD5E 3VQ6A 4CHNA 1JL1A 2G8IA 4I9LA 3MEAA 2B4JA 4BE1A 1TL3A 1WJRA 2FC0A 2M0OA 4CJTA 2XDPA 2X6NA 3M8PA 4C8NA 2I5JA 1RBVA 2FBXA 4M3TA 3PX4A 3OYHA 2EKOA 4FJNA 4LSNA 4LY7A 4E7LA 4KB1A 4BDPA 1TL1A 1GOBA 3RTVA 3TAPA 4KTQA 3LALA 3HM9A 2GFUA 3EAEA 1C1AA 1S1WA 3CFOA 2O4XA 1L3SA 3ZSZA 2RHZA 1YVUA 3CM6A 1QSYA 1ZBFA 4CK2A 4II1A 3WNGA 4E1NA 3K5NA 4KFBA 4BE0A 3C94A 3IRXA 3MXIA 3K57A 4KHNA 1YTUA 3AA3A 1FK9A 4CGFA 2XK0A 1QSLA 2HNZA 3QEPA 4CJ3A 4I2PA 4UQGA 3L8BA 2HB5A 3NE6A 4QQ6A 3DOKA 4FJLA 4DS4A 2A1RA 3H8ZA 3OS2A 2E6MA 1BL3A 3H08A 5JS1A 1EXQA 2OPRA 4EP5A 4A4EA 2G3RA 1SL0A 1D8YA 4PUOA 1VSLA 4JS4A 1TAQA 4HCBA
chains in the Genus database with same CATH superfamily
2KZVA 4A6EA 3SHFA 3NHGA 1DEJA 4NO7A 4OKKA 1KQ9A 4BG8A 2LY2A 1VSKA 4XEIA 4KO0A 1T95A 2J6OA 1VQKI 1PU8A 3JCMc 1YOVB 4YFNF 1UGPB 3O8HA 2B63J 4C8QE 4D5CA 4D7MA 1R5HA 1YITT 2PLYA 4HWIA 3NH2A 4PSWA 3HSEA 1Z0XA 1Q82O 2DTOA 4EJTA 4LDWA 2CT4A 3SFMA 1YHQT 3CHWA 1GCQA 2L3PA 3TP0A 4IO8A 3RR7A 2VG6A 3CQYA 3LA2A 4A4KA 1QVGS 3TVTA 2HOAA 4M7XA 4CIFA 3BTIA 3VGMA 2O6GE 3GCMA 2X78A 3OIPA 1F9NA 3ECOA 2O0YA 4G6QA 2RC4A 3L1PA 3K4NA 2NRAC 2HBKA 1RFQA 4RTYA 1TU0B 2PI0A 4I99C 1SFEA 1WBDA 4DFKA 3O9TA 4YPHA 2X3XD 2F69A 3QHSA 3NQOA 1Q82U 2RN2A 2KVQG 1FZPB 1NOYA 2A5WA 3CLOA 3OA6A 4RW6A 2HQXA 3H3OB 2LSOA 1AWXA 2FEZA 1NYGA 2RM4A 4A3GJ 1KVCA 4YIIA 5I2SA 1NNEA 1VQ7I 1S72T 3NVKA 1RKTA 4N5SA 4M75A 5FWCA 4YG2F 3M59A 3SEZA 1KSWA 3Q1JA 3DRRA 2JSPA 2O8DB 4B8CA 3VN5A 3CCVN 3CC2A 3L09A 4FJ8A 4BVOA 5AQGA 4M7DB 5CKBA 5CR2A 2IJLA 3R1XA 1TZLA 1SD4A 1GLCG 1H89C 2M34A 2DXBA 1QWFA 3OYEA 2OAWA 1U78A 2OCEA 1ZG5A 2A41A 2LSNA 4RG8A 2IRFG 1QQOA 4Z4CA 3I0SA 2FB7A 4E9HA 5M1QA 4YTLA 2MC4A 5HCKA 3L2ZA 2JRMA 3H5NA 3H3ZA 2ZJPL 1P2FA 4WCEL 4F7UA 1IV8A 3KHYA 1QVFS 2FX0A 3F0CA 3ZBDA 1BYMA 1ZGWA 3Q3SA 1RI7A 1U9OA 4M3UA 4GYGA 2Q2EB 3CCVI 1LPQA 1LW2A 4LG0A 1G99A 4XN0A 2BDPA 4EVIA 3BQZA 3ONQA 5KE2A 4FL9A 1YQKA 1GCPA 1MW7A 2VODA 3MVPA 3WXKA 2PYLA 4X64K 2K6DA 1Z6RA 3QG1A 3RR6A 3FXLA 3V8LA 1ORNA 2DA2A 4GMJB 4CZZA 5JI6A 3J8AA 2JHJA 2BGCA 2OI3A 2UV1A 2H8HA 3ASNH 1WXTA 3THWA 2L2OA 4C92C 1WN7A 4L59A 4RGUA 2UUAK 5DDGA 5EG0B 4KH6A 1SQKA 2JTMA 2IGOA 3F70A 1X1CA 4BQQA 2HYJA 1X9MA 2GTDA 2YUNA 2K9NA 1XGSA 4OMYA 3LW5E 4ZTJA 3AHUA 3S3OA 5MLCQ 2M5WA 1ZYQA 1JHHA 1PCXA 4B09A 3TQ7P 3CCJA 4F7UE 3KWGA 1HBXG 4E7SA 1NK5A 5DM6L 4CICA 4Y28E 1JKRC 4FYXB 3FDRA 4IUQA 3VQQA 3HOWJ 2JWKA 5DK5A 2GWJA 3FHZA 3WTWC 2PQWA 1BK2A 3AVNA 2JHNA 3ML6A 2DO3A 3DKYA 1BBYA 1GLAG 3VQ4A 5LJ5g 4DSKA 4B3OA 4MEXF 2EA4A 1WA7A 1NK8A 1WJBA 2QXFA 3ZETA 2JVVA 2KFZA 4ZC3A 1U1TA 3IP4B 2DYBA 1LVKA 1QHTA 1QLYA 2B0LA 3JRFA 5F04A 2ICWG 2FQ4A 1VQ7T 1Z7UA 4K25A 3SFZA 3RPUD 4OU0A 4LH4A 3FC3A 3CBMA 3QNOA 3ZSVA 2D0QB 4CEDA 2VXZA 4J9FA 3QZ5B 3TOAA 2K3YA 2UYTA 5DEQA 4C1NI 1PVSA 3VGKA 4Y1DA 2HHVA 2LBFA 1WLPB 3U23A 1AKHB 2RNJA 4DBHA 4LK0F 1GHCA 1J5OA 1GBQA 4J5YA 4F8RA 1BR2A 4CHQA 3UR3C 4AHTA 3VEZA 5AQYA 2DF6A 3EG9A 1FJLA 1NJIR 1Y1VJ 2KJBA 1RTJA 3DRPA 4M7AB 2OF7A 3G0QA 3NRVA 5KAIC 1HRHA 3E9GA 4UV8A 4XKBA 4AM3A 3T7ZA 3ZQ7A 3RZOJ 2O9SA 4M42A 5CLSA 4A4GA 1Q81R 1OYYA 3R4KA 4O55A 4FZXC 1QVFA 5D8LB 2MC3A 3CG7A 1PUFA 2ZD1A 2LLKA 4B1RA 5M1KA 2BTFA 1Q1VA 4XLAA 3ZT0A 3SPZA 4M9XA 2FYKA 4IQJA 3QEXA 4H0XB 3BWGA 2Y48A 3JR9A 3PQKA 2CZ0B 1K7AA 2O4IA 3GDQA 1BI4A 3K4JA 4CJSA 4BVPA 1N36K 3QIPA 3M1FA 3PO4A 1R77A 2P4RA 4XIUA 4PL8A 5KQ8A 2Q0OA 2JPBA 2YX7A 1KLMA 2DBBA 4ENMA 2Y1IA 4OFEA 3M54A 5GANh 4CZCA 5JFRA 5IP6A 1W4SA 2E3IA 1C0TA 2FBIA 3HTRA 2CW8A 1WSGA 4JI0K 5E3LA 3N97A 3HPOA 3CPWM 3HYFA 1Q81O 1Y57A 4WXHA 4HYEA 1FT9A 5EDNA 4JNEA 4PJ0C 3Q0VA 3HT3A 2WSCE 3MDQA 2LK2A 1VFCA 2Q2RA 3O6WA 1QQNA 2ZQBA 2V7YA 5TKWA 4JKHA 3UKUA 3MEXA 3BR5A 3AVJA 5J4YA 1S9EA 1XMOK 4RGXA 4HT9A 2EZLA 3N5BB 1SEUA 5AZJA 1KG2A 5AQZA 1QPIA 1QZ6A 4E2FB 2KT1A 3A5ZB 3CXCM 2V52B 3KLEA 1N75A 2UUZA 4A3FJ 2CSQA 3HTVA 4CEOA 4II2A 2JT1A 3HPGA 1KQSM 4D7NA 1LNXA 4M9SA 3TP3A 3ZQQA 2X6YA 4V19K 1BOAA 5CCAA 4NC7A 2QWRA 3PFSA 5E3NA 1MMNA 4JN4A 3G71Q 5EF6A 2UXDK 3LPTA 4DQQA 1Q18A 5GPCA 1OLTA 4FHTA 2DT6A 1IO6A 3THKA 3KLIA 4I76A 4CCMA 4C8QD 3IKTA 1MGTA 2LKSA 3G6ET 1TUCA 2E2NA 3KWIA 3DLEA 3FX3A 5EEAA 4KFCA 2W48A 2DXCA 1M30A 2WC2A 1BHLA 2DA9A 1VQLQ 1IDZA 4MDXA 3UKRB 4F2RA 2IPQX 1U6GA 4YOWA 2M51A 4I09A 3LQRA 1JT6A 2LCCA 4LDVA 1WSHA 3ZEHA 1KAYA 2NUTB 5CAIA 3OJUA 1JJ8C 1G2BA 5LJ3d 4J6XA 2KQ2A 2YXYA 1UA1A 3TI0A 5C44J 1NEGA 1N25A 4WQ5C 5C3EJ 2QENA 1TXQA 2ZE2A 4MLHA 1E2XA 3W6VA 1KVBA 3ENHA 2HL3A 2VUBA 3WTUC 2LKXA 2QWLA 1OQKA 4EMGA 3RSNA 1WHMA 4XORA 4LLLA 2IP2A 1EWRA 1N33K 2EYZA 4RGSA 1TNTA 4YNQA 1V55H 3K4MA 1LWFA 3SWNA 1VNDA 2KR3A 1L3TA 3HFNA 2LTPA 5EG2A 3BJOA 2GM4A 4ELZC 4IURA 3C2HA 3O5BA 2ZNZA 1ERDA 1VQ9N 2KT0A 3VETA 4BBRJ 2QZ8A 4HCCA 2KRCA 3VYGA 4W5RA 1YQLA 3PGGA 2P8TA 2QQSA 5CR4A 2M7AA 3SV4A 4A62A 3IHOA 3OB9A 4CYDA 2R7OA 1LAVA 3TKYA 4BR7A 4CJ7A 2WY7Q 1VQ4N 1JJ2S 3TBIA 3ITHA 4DR6K 5ILUA 3DLMA 1IN7A 3H3NO 4B47A 2XAJA 1XC9A 4C30A 4PNOA 3CCSN 4S05A 4WFBL 3I5UA 3U9ZA 5DTDA 8ATCB 4RM2A 3ASKA 2LY1A 2VT2A 2E71A 4IUUA 1D1CA 4Y0WA 3P31A 2LC4A 4DYQA 4IXCA 4ORZA 3KYDB 5K5OA 3JCMd 4F3TA 2ZB9A 1HU0A 1JCFA 2JMCA 3A8GB 3ZSXA 1M3QA 4HZFA 1HKBA 3AG2H 1VQ9I 3TREA 2HNHA 2YJFA 1DQUA 4OPHA 2C0TA 2EJRA 3E9PA 5AFUA 3FISA 3AO4A 1O4XA 2NXNB 4M74A 1BIBA 1ENHA 1NGDA 1N5ZA 2ISYA 4KREA 3GTJJ 2DMPA 4AI5A 3J80Z 4CEFA 1X6GA 4X0GA 1VQ4I 2X3WD 4HTUA 2V8JA 1ATNA 2BH1A 5HL7L 2FUG2 4JBAA 2Z3YA 2E8AA 5D6XA 4AVZA 2PFBA 4EV0A 3CCSI 2XICA 1LNWA 2OTJA 5K5RA 2YU3A 4M77F 2PFUA 3FFKB 3A02A 2D0CA 1Q1HA 3M07A 1DDNA 2VXDA 5E3OA 2KRHA 2JNGA 4QVZA 3TPQA 4E1MA 1B9NA 4C5IA 3CESA 4B43A 4JKDA 2E1MC 3GYHX 1WJAA 2CKKA 1V4TA 4KJZA 4JHDA 4Q5SF 3GBQA 4OGEA 1W2BA 1RIOH 3VQDA 1XTAA 4JI6K 4OIQF 4Y17A 4CF1A 4YEJA 1D5YA 3WVDB 4CIGA 4FLUA 1RAGB 2GOXB 3NEUA 4DR2K 4F7ZA 4G9ZA 4BY6C 3M0PA 4DLEA 4FE4A 2A3ZA 3ER0A 1S9GA 1IN6A 4RAGA 2BEOA 1K4US 3IC7A 5DLQE 2DE0X 2L3SA 2QWWA 3JB9D 2R7UA 5C25A 4JI4K 2PZ1A 3MWMA 4E1JA 1EWQA 3HPHA 3DLLF 3OYIA 4XLPF 3CF5F 4CJ5A 1FJGK 3DPTA 1VQ5Q 2ZPFB 1FKPA 4C8QG 5C0MA 5E8GA 1LMZA 2Z5UA 3D0SA 2NS7A 1K4TA 1M3AA 4A12A 1XC5A 5GAOm 3AL0B 4XLCA 2DL5A 3E66A 4R79A 1N8RU 5I3UA 1I94K 3LSRA 3OYDA 5KGXA 1U9NA 2DLPA 2LNVA 3ERMA 2ASMA 1O3SA 1G3SA 4OB0B 2HHXA 4HOBA 3IUOA 2XAHA 2K5LA 4OB3B 1ZARA 4BGDA 1ZKGA 1REVA 4W5QA 4OLBA 1LPLA 2A08A 2HBPA 1B9FA 1M27C 3FIWA 5BPDA 2JMWA 3K70D 1OR7A 1B72A 2QQBA 2OPTA 4DBQA 1TL8A 2LQ8A 1X3MA 1KC8C 4PWDA 2IOCA 2GTOA 2IDOA 3Q7BA 2X4XA 5FJ8J 2JPCA 4JYKA 5HNHA 4JUVA 3EH2A 4KI6A 3AO1A 1E3PA 3VQCA 3VYSB 1SSFA 2CH4W 1U47A 2LJ0A 4HNVA 3JRBA 1H88C 5AQQA 3SAGA 3MN9A 4YFKF 3F23A 2GNCA 2O8FA 1UGQB 5KTQA 2KZMA 2DMTA 2QDYB 2DEQA 3CCUT 2GQQA 4M78C 1HNXK 5CVIA 4LH5A 2HKOA 4XU0A 5FU6B 4BGAA 1GLEG 1ACMB 2MG4A 2ME0A 4NCAA 1MNMC 4AFQC 3UWNA 4DOZA 2IA2A 5B3SH 2LTOA 1W1WE 3QYFA 1Y07A 2JWTA 1JXEA 1J75A 1NG2A 2ATCB 1UMQA 1POGA 2VE9A 1J7KA 2G8UA 2JA6J 2X9HA 1WJDA 1YF5L 5IH2A 2OPSA 2ZZDA 3GIBA 4JKEA 1W1FA 2D6FA 2NUPB 5KYWB 3I56A 2NVXJ 1ZUUA 3A8HB 1OCRH 2JJ9A 3SJHA 2SRCA 5L8RE 4XSXF 3ZQHA 2GXAA 2IA1A 2K7LA 4QT7A 4OPAA 1T56A 3MEEA 2P9SB 3RQIA 3M53A 1R22A 2K4YA 4FX4A 4FX0A 1LWCA 2I8DA 4M6VA 2EILH 3WEEB 2Y75A 2R3SA 4DG1A 2E10A 3IUCA 2DBMA 1N5YA 4DF8A 5EJCA 3VMFB 1LEBA 2M7BA 1JTYA 4ISFA 4M75G 4NOYA 2M1HA 4BD3A 5CKTA 2IGNA 5F0CA 3FHGA 4IOXA 1BA5A 2F96A 1TUGB 5GTIC 4NDLA 2QGUA 4JRIA 2X4JA 3UF4A 4H0YB 1GLFO 3WTYC 3THVA 3THYB 2A68F 4Z4GA 1Y96A 1TS9A 2CT3A 1EX4A 1WI9A 2FSKA 1NJZA 4LB6B 1VQ8T 5E84A 4CFAA 4BC4A 2VQCA 4AC0A 4OAYA 1MV0B 5A2QE 2F1LA 3P7NA 4EZ6A 2JXBA 4A59A 3CCEQ 4LF9K 3A01B 4N4NB 4N4HA 2DIGA 5C2FA 3LH0A 1JI8A 2CGPA 4A53A 2XDVA 1YJNA 5DCMA 3DLLL 2IS6A 3S1NJ 4KDPA 2WTUA 1D0ZA 1P90A 5LMNK 1HCRA 2HYGD 4A0ZA 4GBQA 3D5SC 3VS3A 2DOAA 2COWA 2CUFA 5CE3A 5GAN3 4Q5WA 3CD6A 1NMDA 3FZLA 5JS2A 3GTMJ 3EUHA 4DQIA 4BQNA 3PNWC 1Y64A 1ZBSA 2RJEA 1YI2T 4OMLA 5E3MA 2HKNA 3I55I 3DTKA 1ILYA 1RPWA 3I64A 4AILC 1IBLK 2HBLA 1WHUA 3Q7CA 4FZZA 1GLNA 1R36A 4JEPA 1SAXA 2R7ZJ 3U6FA 1ZBIA 2F7TA 2HDWA 2QSFX 2RKHA 4DUYK 2K9LA 3H41A 1T0FC 3G4SA 3VF6A 4ILJA 4HG2A 5IT9E 2KRSA 5LJ3e 1B34B 1JKHA 2GWRA 2X51A 1Z05A 2DPNA 4B3MK 3F8FA 1YWPA 1WBBA 2MPXC 2CGJA 4EMSA 1AWWA 3VEWA 3BTJA 1O9SA 1RBSA 2BIVA 4JX5A 3H1VX 2K5FA 5IYDJ 2WOMA 1X2NA 2BANA 3HRTA 2X6SA 1X4PA 2ATQA 4H5NA 4MZTA 2K3FA 2ZNYA 2HL5C 3SUNA 4EW0A 2OCCH 2HYFA 4RB1A 4H0VB 3OOPA 3NGYA 1T2KA 4DA4A 2M8GX 2WBNA 2HVQA 3LOCA 3CC7Q 5CQXA 3O08A 1KQ0A 5BN9A 2IAIA 5A2QK 2E2IJ 3SB2A 2W4SA 1PKTA 4B1VA 3CIPA 1Q7YU 1QQCA 3QLHA 3ZQIA 2E5LK 1ZR4A 3G71N 1TW2A 3CXCP 1RL2A 1A5WA 2XIGA 3I9V2 4QPOA 1BBZA 3DBHB 2X1DA 1D1BA 1SUQA 2PTKA 3WXIA 1T38A 1Y0NA 4PL7A 3JXUA 2JA5J 3SZPA 1T0JA 3NWSA 1RNHA 5HK0A 1PUEE 5J39A 2V4JC 4KTWA 1VQNT 4D9JA 3S2DJ 3K70C 2PAVA 1VQLN 2DFHA 2CUEA 1GXPA 3JCMe 2QEXA 1ZG1A 4DSLA 2ACJA 4L0ZB 1GXQA 3NARA 4OX9K 3BDUA 3KTQA 4CDGA 2OTLT 4GKJK 3C7JA 4HVUA 5KN8A 3VJPA 2ZJQF 1TH7A 3CWAA 3CCRA 4L3QA 2RDPA 1FX7A 3OHRA 4L5EA 3T1HK 2FOWA 3SJMA 1RT7A 4ZDPA 1WJQA 3D7EO 5IT9K 1UAAA 4FPBA 8AT1B 3G71I 1ZTRA 4GDFA 2V75A 2F5FA 4M3EA 1YTYA 3BR6A 4QLCU 1APLC 5KCMA 3KP4A 4LC9B 1YJWQ 3MWTA 2E65A 4MDBA 1GOCA 1Q86C 5TKYA 1NM7A 4H4OA 1G2HA 4AIHA 3SBGA 3QNNA 1S7EA 4GFBA 2HBJA 1IG8A 2COYA 3KETA 4GO1A 1EETA 4LF6K 4E4HA 1FKOA 4M73A 5GP9A 3I55T 3VTHA 1WJSA 4RLQA 4HAMA 1IBMK 3UIQA 3BT9A 3EEQA 3ZQCA 1HX1A 4RCHA 2DKGA 4E0DA 1I0CA 4YFUA 4KIBA 4CJUA 2KIMA 2NYXA 1RUNA 2LMJA 3TDZC 3CVTA 2VONA 4Q0BA 1D1AA 4KHSA 3CMEA 1X2KA 3UKRA 1WZ2A 3VQBA 3KLHA 4JD2B 5LHGA 2LREA 3ZR8X 1JBMA 2FBVA 4EA4A 3I4MJ 1NOZA 3OBYA 5C6SA 2JS2A 2W04A 4RKUE 3CMAA 1E4FT 3CFPA 2V1RA 4M3WA 1G6NA 3VS7A 3L9FA 1QS4A 3H35A 1P4WA 1GFCA 4CEQA 1FBQA 3LQQA 1VYUA 2P4TA 3A8LB 2WAQA 2FBHA 1XTDA 2QGGA 4C92B 3HOYJ 5L23A 2ZPGB 5KRTA 3ZN1A 4JKFA 4XOPA 3KK3A 1YIJQ 3MEGA 3WQUA 4IHVA 4QQDA 4PLIA 3CZ6A 3RSEA 3C18A 1Z9ZA 3IWZA 1BI3A 3QEIA 3JCMQ 3BG7A 1B7TA 4N0AA 4IUTA 1M90C 3HHGA 5KGWA 5CZ1A 1WSIA 5I21A 4DV0K 2P5VA 4OFHA 2FBTA 2KDOA 4DV4K 1BR1A 4CJPA 1ON2A 3MKWB 1JHFA 4OKJA 2RPNA 5GMKi 2PMZA 2ETJA 1SHFA 4KH4A 3P9CA 2ZMEB 3N0UA 3CFRA 3RDIA 1HPZA 4WF2A 2FF6A 2LG4A 1SVLA 1X4OA 3BGRA 2LRDA 2OU2A 3QAHA 4QQGA 1TT5B 2DNUA 3HVTA 3ZQFA 4H8KA 4IFYA 4F55A 4BRHA 1ORKA 1SAUA 4L0YB 5FWBA 1VZ0A 5GAOl 2IVPA 2Y0SN 3BLYA 1DKGD 4B08A 3IKMA 2PVDB 3DI6A 1HSTA 2AHJB 4JI1K 2Q3SA 3KLGA 5AQHA 4PCQA 3PLAA 2O7OA 4CD1A 2DY4A 3RQ4A 1Y8QB 2E2HJ 1TAUA 2BY0A 3C6HA 4IOCL 4J9IA 3W3CA 1YJ9I 1RT6A 5LJVA 3EGDA 3LANA 3PMTA 1YG2A 5HS9A 4M45A 4LF4K 1VQ5N 2YPRA 1E7OA 3HSCA 1FLIA 3JSCA 3HO1A 2XSJC 5DS9A 4KA4A 2W7NA 1XNRK 3L4IA 5ELZA 4DTOA 4A3IJ 2ZGWA 3CQ8A 1ETQA 1PD1A 4E9EA 4DB3A 2XI9A 2L9RA 1TWGJ 2W85A 3ULQB 2YT6A 1F21A 2VPRA 5D4SA 5KRSA 3CCMA 4OPJA 3MN6A 5LFAA 5I11A 1YYVA 2R4GA 4MO5A 5C2DA 4I6MB 3I58A 3K2AA 4RMOA 1NJXA 4ELVA 1FIAA 3IH2A 1AHDP 2E6NA 3ZT1A 2BVLA 4JK1X 1VIEA 4NYFA 2DL7A 4CC4B 1U04A 5LEKA 2HDAA 3ATUA 3V81A 3SQ1A 1JT0A 2FD5A 3CC2Q 4PJOA 4XTVA 5GAN5 1N3CA 1X01A 1P92A 4LIUA 4YIFA 3ASOH 4IF4A 4FYVB 2B9SA 5FW9A 3UA7A 3F10A 1VQ5I 3I59B 3QIOA 4FJJA 4ME7A 4IOAL 2RQUA 5BN8A 1LDDA 2N8GA 2R7SA 3GZNB 1ZSGA 2G9WA 4ISEA 1TP4A 3JSPA 2ZXIA 3RESA 2KYMA 4P9UA 3S1MJ 3TSZA 5KK1A 2YHWA 4CBXA 1TNSA 2QBYA 4IX7A 3AVGA 3OW2P 4JKGB 4H0PA 1JLEA 4CGJA 1JCEA 1V5EA 4N47A 4CVNE 4JDSA 3DLLA 1VTNC 2Z9OA 3BY7A 2W0ZA 1EQYA 1OCOH 2K3XA 3M56A 1X1BA 1XNIA 4VUBA 4BR2A 5F1XA 1PDNC 2KYBA 4WXCA 1JKQC 3L1AA 1EV7A 1M1FA 3CJAA 2L4MA 3F73A 3VQ6A 2LVSA 1AWOA 2B4JA 2QA4T 2OQGA 3SXYA 5IOZA 1HK9A 4RMNA 4RCCA 3BR0A 1PRLC 4R55A 2H94A 2X6NA 3ULEA 1S9HA 2MLKA 2QF7A 4RTXA 4PZJA 2FBXA 1LWWA 4BREA 1HF0A 4PJOE 1IN8A 2FPDA 2EKOA 3GPLA 2Q8KA 1EA3A 3DLAA 2OQRA 4LSNA 3VDXA 2L5QA 4E7LA 2CRGA 2KIQA 1GOBA 2EIKH 3BF1A 5CQGA 3RTVA 2WWYA 3LALA 1P4AA 3G25A 2GFUA 2J6FA 1XG7A 4ANJA 4DYRA 4K0KK 4J9CA 2KHMA 2Q1ZB 2O5RA 5LHIA 2OZUA 1KQ8A 2GX9A 3GFMA 1SD7A 1ZBFA 5FU7C 5DY9A 4CK2A 4II1A 4E1NA 3K5NA 5IXFA 5FB2A 4DEXA 4BE0A 4FASD 3C94A 3T1YK 4ITVA 1K0XA 3FR0A 1YITA 3MXIA 3ABMH 1YJ9T 1YTUA 2JA2A 1OCPA 4UHTA 3CCJQ 2ZSHB 4CGFA 2XK0A 2UXBK 1WSUA 1YHQA 2W57A 1QSLA 2HNZA 3ABTA 3PO3J 4I2PA 4DR4K 1RDWX 4LE9A 5GAMd 3KCCA 3ZMZA 3CI5A 2ED1A 4P1WA 5FLXO 3CCEN 3PUBA 2W41A 2K9QA 5K7HA 1FTTA 5CKDA 3OS2A 1BL3A 2GA1A 3BPXA 1EXQA 2OPRA 2X1CA 4EJZA 2HVSA 2VKHA 2J06A 2ISZA 3M3ZA 2GXBA 5AR0A 1CSKA 2EV6A 1D8YA 3M8FA 4BL0B 5IXBA 3U9DA 2NUPA 2CSOA 5KYWA 4KN4X 4C8MA 4KH1B 1JO8A 2XF5A 2XKOC 4IO9F 1XCVA 3PVLA 2VQFK 4DOVA 1N6QA 1QVPA 3PL8A 1JKPC 3HM5A 3DXKB 2P9SA 1NKBA 2BY3A 3A1YA 4G7HF 2CH5A 1VQPT 4XKWA 5JHFA 1O3RA 4XTUA 5L3DA 1ZHIA 1NG6A 2D1VA 4FSSA 2GBZA 2HSPA 3WEEA 5LJWA 1LB2A 1S72A 2RQRA 3PIOL 3I0TA 4KHYA 4KICA 3FDYA 3H9NA 3KLNA 2RF0A 2DTHA 5KVRA 4IVNA 2NS0A 3DF8A 2PJRB 1YQRA 1ZX6A 2CS7A 3CCEI 2X4WA 1MBGA 3CMMA 4E3SA 1WXUA 4LN2A 3RI4A 4RBOA 2XU8A 3HOXJ 3E5UA 3K6GA 2FRYA 2YRVA 3ZN0A 3G1JA 4L9JA 3R9PA 1VSDA 5D5WB 1PC0A 2H6BA 4WWCA 3JAME 3CCQT 3F8BA 1GDTA 2PU9B 2OV7A 1UGRB 3ZEUB 4EM1A 5KAFC 4A4FA 3K2PA 1WJFA 3SDZA 2YNIA 3QBXA 3R6SA 4H0EA 4LGWA 3JCMP 4ZYAA 2O61A 4IG3A 5IT9Z 1UHCA 1Z91A 1LOTB 3MN7A 1TC3C 3TAFA 3LCNA 4LD6A 2MW8A 4DKWA 4HVWA 5CKFA 2P81A 3CC7N 3JB9J 1T3SA 1S5JA 4F93B 2ZPBB 3META 1L0OC 1R0BG 2IC3A 3WNHA 2V9KA 5JLFA 2NZTA 3H36A 3L4QA 2LNBA 1HNZK 5J3BA 1YNZA 3ABKH 4A5AA 1KC8O 5ADXA 3LDPA 4FSXA 2RK2A 1LKXA 1Z25A 3IMXA 3KYLA 1A5VA 1QO0D 4Q4ZF 2HFHA 1V1CA 1LW0A 2E5NA 3ID8A 4M7DC 3VEYA 2KGTA 1BO5O 1W7PB 2EZKA 3AV9A 1B9MA 2A5YB 3OYGA 1T44A 5J1UA 4BH9A 4FISA 2P9KB 1QSSA 2BTTA 4OMNA 4AD9A 2CG4A 1VQKA 1UB4A 4CJ4A 2DW4A 4H0TB 3SQ2A 1P7MA 4CCHA 2E2JJ 2Y9YA 5CHIA 2LJ1A 1B34A 4GY2B 4B48A 3CC7I 3DCFA 1MV3A 3VENA 2VJJA 1HYZA 5DUIA 3AO2A 3ZQLA 3M7GA 2JTEA 3VSLA 3A0IX 4FK4A 3VS0A 4XRMA 4AG1C 2ESWA 3RVCA 4G6TB 1CQTA 4IHYA 5AN4A 3AA2A 3LP1A 1YJWN 1LV5A 3O3GA 3M0TA 3P38A 3JAMK 2O8CB 4O0IA 2ECCA 1YIOA 3SLCA 3H0HA 2MWOA 4NNJA 9ATCB 3IWFA 3MFKA 4YOYA 2MSYA 1D5AA 1F1ZA 3SHWA 1J54A 3COAC 2R5ZA 1NK4A 4IFEA 2HOTA 1VQ7A 3M3YJ 2DXTA 1AD5A 2KNBB 2FG0A 2DDAA 3ECHA 2Q1NA 4OLAA 2H56A 3THXA 3JREA 4CI6A 4IRIA 1JE8A 4IUVA 2GIZA 5J8CA 4MQ3A 2F4IA 2DETA 1H3ZA 5F0HA 3AT1B 4ON0A 1HXDA 1K9MR 4K41A 3LSMA 2Y4YA 1YJWI 4PJJA 5CKEA 3VS4A 1R58A 4CC7A 2Y30A 4KH5A 4KGVB 2DAOA 3OH9A 3KFWX 3A8MB 3ASMA 3QP6A 4BWMA 5CKHA 5CY4A 1TK0A 1YWOA 1FTZA 2EGEA 4B9XA 1WNSA 1IZ6A 2DPDA 1IHWA 1KRPA 4MO7A 2FPEA 2L89A 1X75C 4OGCA 4LDXA 1P6RA 2XB5A 3RTRA 4EGYA 3VQ5A 4A61A 3WQTA 4ZYHA 4C8QF 5HRNA 2AQFA 2VC0A 3PVQA 1YIJN 2ABLA 5ILVA 2CQXA 2W82A 5H6RA 1KD1R 2XRNA 4WX9A 2NOJB 4AF1A 1F43A 4EHUA 4JQFA 3OY9A 1STZA 3K4CA 4PIIA 5B1AH 3HSTB 1FSHA 1M1GA 2I0NA 4AHCA 4Z4HA 1FOWA 3RNJA 3E9LA 3I35A 3LZJA 1U8RA 2HQAA 3KP6A 2VWBA 1VSJA 1QHGA 2VOOA 1KG4A 4RW4A 4FM1A 4MFEA 3TSWA 3WUHA 4IRGA 4YOXA 2J5PA 3M58A 3EG3A 4MO4A 2VL8A 4BS9A 2COBA 1NK3P 1LJOA 3H9GA 2E70A 1LEAA 2ESNA 2CZ7B 3A03A 3E0JB 2RQPA 3HB9A 1A0NB 3NVMA 5GAN2 4M7AC 3BZCA 3I8DA 1ZGAA 4CJRA 3LSTA 4L5IA 5BREA 2VQGA 2LDUA 2ITMA 1K61A 1M9SA 4DTUA 2HDDA 4BRDA 1M1KO 1OPKA 2HZYA 3GOXA 4HCZA 4ZGJB 1YIJI 4DGWB 1D0YA 2E6ZA 1KD1O 2DMUA 4E89A 3KP5A 1QQMA 3LDQA 2LR8A 1C0GA 4JLGA 2HQRA 4PJOD 1RNLA 5B8HA 5CQEA 2E1YA 2OTJQ 2CWEA 1WX6A 3M5RA 3WU0A 1BOTO 4NC8A 3KZYA 2YG8A 3SAHA 2DTIA 3ZLJA 2LX7A 2Q0RA 1EBMA 3TAGA 3S41A 2V9VA 2E4HA 3IS9A 2K79A 3T1AA 4C92A 4CECA 2BW3A 2KL4A 1I6HJ 2YDLA 2V51B 1DTQA 1IV0A 2YKNA 3DM2A 1RRSA 1I3QJ 1T08B 4ELYC 6PAXA 4QW2A 1JUSA 1UECA 2ELKA 3G6EA 4NQWB 4E9GA 3QQAA 1Q7YR 3HFOA 2E1CA 2K5IA 2GOMA 3CPWA 3CQTA 3U9GA 1SG5A 3DOLA 3CC2N 2CH4A 4MIMA 4S04A 2FL7A 1ETWA 5F2RA 3OYMA 4FSVA 2COZA 4JKBA 5D7UA 1KFDA 1ATSA 5E41A 4A5NA 3O4QA 4CF0A 3GXOA 2XY5A 5IYBJ 4YELA 2O8EB 4OF1A 3CJ1A 1KAXA 2FSNA 2IS1A 2DT7B 2DFFA 4Y33A 3CXCA 4MMKA 5GAMe 2VCPA 3NBPA 4G1QA 4N76A 3JRDA 3EG1A 3FHFA 2B5JA 1T6SA 5GAN6 1YFHA 3RIRA 4BY9C 2FSJA 2Y0SA 1R7JA 1KQSA 1G3TA 2HPIA 2P5OA 5FO5A 4J9DA 1Q86O 4C92E 3LDLA 4FJMA 2QQAA 3CCLI 4BU2A 3HP9A 2E2OA 1TGOA 1LQ1A 1ZSZB 5JR3A 2CDTA 4CJEA 3TEDA 1ZLKA 3TAMA 4IHTA 2J7IA 4N0BA 1AT1B 3CC2I 2M0YA 2JSCA 3LH5A 1V5GA 3DEUA 3FZVA 3LX7A 3LAPA 1ITGA 3PIOA 2A6AA 4DTXA 2H27A 4RTTA 3N05A 1ETYA 4LNPA 4F7UF 2NYSA 4YPRA 1UFMA 3BY6A 4Q5VA 2IG0A 1WZOA 1HUXA 5GAN4 3W2VA 2Z2SB 2R5YB 3HRGA 3LWLA 4CJFA 2EYQA 2DODA 2JVHA 4CBWA 4I6MA 2H1KA 3BC8A 1JGSA 3VOEA 1MMSA 1YX5A 4DSIA 1JUMA 1Q86U 4KMUX 3JB9F 1UG2A 1VSFA 5GINA 1TOVA 5KPRA 2E1OA 1MHNA 3LSIA 2VOPA 4OMZA 4QPQA 2DPUA 4WK8F 3DTIA 4ZYEA 2L7ZA 4Q48A 4EZ9A 1VQMT 4JI8K 4JK8A 4DV7K 2KLOA 2JN0A 3H6ZA 1NMNA 1MBEA 3G4ST 4N4GA 4B23A 5KHDA 3GX4X 1BA0A 4DFPA 3TW6A 1NJIC 3WGGA 4CEZA 1UCRA 1XGMA 4UB8C 1P8ZA 3CCJN 4F92B 2EGAA 3C7NA 5J2QA 4FVUA 1RR7A 3KLFA 1JRIA 3LL7A 1XMKA 4JRPA 1Z67A 4FK0A 4JKGA 3I56Q 1W70A 3JRHA 5A0DA 1Q81C 5ICCA 4H03B 1JQQA 4M7YA 2VC8A 1YX3A 2P7VB 2ZWHA 4S0HB 1MMAA 1AA7A 1M90O 2EQKA 5ED4A 5KYYB 4B1ZA 1VRLA 4CCOA 2MD0A 2BE9B 5GAN8 3VEVA 1HKCA 3OL4A 3VPRA 3ZSRA 3K7AJ 3N4PA 2A6TA 3EKUA 5CPRB 2NRXA 2CP7A 2NRVA 3HSBA 2A3LA 3M8EA 4J7FA 2W25A 2H3EB 3OW2S 4C0DB 1KU2A 1KXPA 5C4XJ 3G3ZA 4BHCA 5CIUA 4A3LJ 4PJOG 3VF2A 3CCJI 3LSKA 1RT2A 2HSTA 5C12A 4FLYA 2ZBKA 3F9KA 3PO2J 4DBRA 2KEAA 1D8JA 2ZJ2A 2KP6A 4EPCA 2HMAA 1KA8A 2GFAA 1M90U 4BR9A 1JLQA 1XSVA 4AIKA 2WTEA 4ETSA 4A6DA 4PGGA 1QCFA 4HXJA 1NGIA 2G6FX 3S16J 4M72A 3B8AX 2DOFA 2MBFA 1XUPO 1IBKK 2I10A 1ITYA 5GAOq 3M1EA 2KZGA 1RI0A 3HYIA 1I1GA 3M0QA 3ZGKA 3L6QA 4KHWA 3CO6C 1YJNQ 3AY9A 3BG3A 5GANj 1U6ZA 3CCLT 4DU4A 4LFCK 5AQOA 1ONVA 3RKWA 1A5JA 1V54H 3FZMA 1B9DA 2F2XA 4B1UB 3F72A 1J5EK 2A07F 3CD6Q 5TRDA 3VQPA 3RYPA 3P8BB 1OQYA 3L2CA 2M0CA 3JAMZ 3HDDA 1VAZA 2L9SA 1ZBXA 2O2OA 1MMGA 3M6GA 4M71A 4B8XA 3SMPA 3OWTA 2IS2A 2QWNA 1UB9A 4WQ5A 1IUFA 3F8MA 4Y92A 4B9QA 1Q9YA 3L2VA 1OX9A 3TTCA 3CM5A 2KXCA 3G4SQ 1TTHB 3C2GA 3FB9A 3DXKA 3VS1A 5AQKA 2XSDC 3MXMA 1TYQB 3LA3A 1N3AA 2CS3A 3EYZA 2RV8A 2WSEE 3J7AP 1FC3A 1QVGM 1WSJA 2NOIA 3CUQC 1UA0A 3IQLA 1NJWA 1TWBA 1C1BA 2JMAA 3GTQJ 3J81O 3CCUA 2PJRA 4A0YA 3AL0C 4ZGEB 1HQUA 4O5BA 3VERA 1XS9A 2XHBA 2EV0A 1CXQA 2QGFB 3HI0A 1SMTA 2UU9K 3MMYB 3J7YJ 4X34A 1JLFA 3DXMB 4ESFA 2XY8A 2E60A 3BR2A 4EP4A 1DU0A 3CDHA 1UZCA 5D4RA 1TLHB 4FYDA 3K5LA 1JXBA 1WJEA 4PDKA 3VS5A 3GW2A 4Z2YA 1X2MA 3T8RA 2E2QA 2P0QA 1K1ZA 4KRFA 3G1MA 2IEKA 2O4XB 3VA3A 1TQPA 3QPSA 5CQYA 1RI9A 2NLXA 2A6HF 2EIJH 4O6JA 3HIFA 4FTHA 2E2PA 3T0YA 1USSA 1X58A 5K14A 3S14J 1ABOA 3KLOA 4LD0A 1U2WA 1AHJB 1HPMA 4B6MA 1VSEA 2GBQA 2VKEA 2P9UB 4L5JA 1QHAA 4HX7A 4AWXB 2VPLA 3PO5A 3PX6A 4BRCA 2QEXQ 1VQ6T 4EIKA 3LM9A 5FU6C 2HXOA 1WOQA 2ZCFB 2DMNA 3CCQN 2DVEA 2DQLA 3P9KA 4BWJA 2VC1A 4DYCA 1R0AA 2DOEA 3NF6A 3CCRQ 4AHRA 4R5PA 1Z3XA 1O1WA 4R8HA 2P9PB 4YDUC 1QQIA 3ABLH 3M8SA 1K9AA 4Z6YA 2EA2A 4BUGA 3A8YA 4BXFA 2BE7D 4CZHA 1X1DA 4CZEA 1LDKB 2K9GA 2E34A 3IAM2 3KX2A 1VQ8A 1QVFM 2BZYA 1UDLA 3CBOA 3DKMA 3V4GA 2KMTA 4J00A 5AQMA 4XLHA 2JUGA 1WHKA 1WNLA 1MJAA 4FJGA 4PY5A 4F4KA 2P5LC 1HKSA 1Y6IA 2KW4A 2Y9ZA 4DQ8A 2L7KA 1LAWA 5AZIA 4M4ZA 2I7PA 1A35A 2O4GA 2NNWA 1GOAA 1Z3YA 2R57A 2BVMA 3S8PA 3HZ6A 2DYIA 2ZSIB 2O8CA 1QBJA 3LFUA 3HJEA 4KIGA 5KYUB 1YI2A 1HYSA 1R4MB 1NK2P 1KK7A 2QG9B 4HSBA 3IH4A 2FMYA 4XLNF 4HRIA 3EN9A 4FWLA 4B9VA 2XC7A 5FLXE 5BR8K 5TISC 5GANd 5J1YA 3CMEQ 1H3HA 4M6XA 3H0DA 2K9SA 3Q5FA 2STWA 4YY3K 4LIVA 4M3FA 3EFSA 3BUZB 1B1BA 2B7EA 1YCYA 4C92D 5ERIA 1NU0A 1RZ4A 4ELUA 3VRZA 3CMAQ 2G8WA 3PQJA 2RQQA 1EFNA 2R7DA 1MBFA 2RHYA 4EJWA 5HLHA 5M1PA 2EAYA 3V8JA 1HDPA 3V9UA 4XTXA 2CUBA 3QPHA 4QS8A 3KK7A 1IH7A 3MKLA 3O5ZA 1S3XA 4F17A 2XIDA 4FPAA 2ZPIB 2X4YA 5JLHA 2OTJN 3P9IA 1IGNA 2ZJPF 2GUIA 1SZ2A 4ESRA 5CVJA 2M9HA 3J7AF 1PRMC 5FU7B 1AOYA 3VB2A 4UUVA 4BRQA 2X48A 1IDYA 1UHFA 1SVOA 1K73O 1S1XA 2D0PA 4R1HA 3SYZA 2KE9A 6AT1B 1XHXA 3E5QA 3CC4T 2I5WA 2YNGA 4M78A 2P5KA 4I0BA 1S1VA 1IG9A 5J47A 2HS5A 2P5GA 1TKTA 1ZRDA 2EGCA 3GE1A 4Y1CA 4LSLA 5IHIA 1VQNA 1WVRA 3K9JA 1IKWA 1Z7LA 1LWEA 2CUJA 4XSZF 2DX1A 2NVQJ 2RJCA 2VQHA 3EGXA 3LGLA 4N9HA 1PD0A 2NRWA 1C1CA 3OQ5A 1T39A 3T19A 3LDSA 4ZN1A 2OTLA 4M3RA 2BY1A 3GZ5A 1VHXA 3SD4A 4OKEA 1JTXA 3MKZA 3TDUC 5FLXK 5GAHP 3D2FB 1TK8A 2A3SA 3AARA 4A5BA 4NZGA 3FXMA 2V26A 1VQOT 4NUBA 3AFHA 4DTPA 2WAFA 5C0YA 5DM6F 2ABKA 1KCFA 2KKZA 4DSEA 2JK3A 3ENOA 3BOQA 4I02A 4HEA2 4A3JJ 2OPPA 3U8XA 2HD0A 2WA0A 3CCMQ 2KPMA 2E6LA 2CH0A 4I2OA 3WTXC 3EHQA 2YUOA 2PG4A 4E7ZA 2M16A 4M78E 5FRNA 2HSEB 4XAXB 1BUPA 1VYVA 1M5Q1 3BPVA 1OZ2A 4ZZLA 2ESHA 4IKFA 1Z21A 3S17J 5CYQA 1FOKA 1CF7A 2NUZA 3MEDA 3OYJA 4LD5A 5LRRA 4W5NA 2Y1JA 3I55A 2ZJRL 2J5OA 2F5EA 2RI3A 1W0TA 3D4VA 3KK1A 4V19S 3OBWA 2HDCA 3GMEA 2D8JA 3MN2A 2A0FB 4FJHA 1XGOA 1QW1A 4XKVA 4K8XA 4ILHA 1WQ7A 4BY1J 2BHYA 3J80O 1FWZA 1CKBA 4QVCA 3U1KA 4DV5K 4C8KA 1LE8A 3LSGA 4DTJA 2E41A 4KGXB 3P8HA 1BR4A 2ROLA 7AT1B 2R92J 1BG3A 1XNQK 5BMZA 2RPIA 4ABZA 4YOTA 2E35A 3WHBA 3MEUA 3CCYA 3IH7A 4LITA 4KUMA 4JX6A 2D4WA 2P9LB 2LX9A 4FU6A 4DSFA 1ABQA 4CZIA 2K02A 3QEVA 1ZRCA 2QKMB 3EE9A 3MP8A 1C0MA 4XTYA 2P51A 2JZYA 5H2FC 4ZGDB 4CJVA 1BIZA 2Z1HA 1HD3A 2GXGA 3D0PA 3E1SA 3WHCA 2P9NA 4RUGA 3G73A 1ZGJA 2KQRA 2H6CA 3I56N 1LFBA 2CYZB 4CH7A 3JSOA 3E9FA 1Z9CA 4CGZA 4Y4RA 5J4VA 5HLTA 1UFFA 4ZHRA 4Z89A 4BI8B 1X43A 1RCHA 4GGGA 4FWKA 3HL2A 1T0FA 4QCLA 2RHIA 2NOLA 1K76A 3JRZA 1I81A 3LP3A 2WB1A 1XGNA 4CZMA 2KRNA 2XASA 3HSFA 3EUKL 1FOXA 2AHQA 1D9DA 3DFGA 3CJ7A 1Y7XA 2L7FP 3MCZA 2EZHA 5F27A 3SCXA 3GFLA 3GTGJ 2L0AA 3GNGA 2IIRA 2XF6A 5FKMA 2NRZA 1L3VA 3H45C 2W84A 1ASUA 2D1HA 3FXJA 3QP5A 4RG2A 1NKEA 5EGOA 1K78B 1T05A 5HROA 4OP0A 2IIMA 4HX4A 2QW9A 2ZGYA 5DMRA 4CE9A 4V2GA 3ZMDA 1YITQ 2NOZA 2UXNA 4AM7A 3I56I 3LP2A 1WKMA 2BE5F 5BR9A 4EIAA 1RDUA 1YHQQ 3UT1A 4LUDA 3CEYA 4QKUA 2DLLA 1RTDA 4BRFA 3E6BA 4OVAA 3CJQB 1CZAN 3NTKA 2PMUA 2HNYA 3BY5A 3K1NA 1VQKT 3F5TA 4AYBA 1OYIA 2F48A 4KUDK 1F4KA 3DB3A 5GJVB 3PIPL 2HHQA 1B3QA 1ESVA 5DM7L 2AO9A 1JJ2M 1YJNN 2O8KA 1NK7A 2QTXA 4KHPK 2L9VA 2EWNA 2L9NA 2DT5A 1U3EM 2RI5A 2LF8A 3PY8A 4FK2A 3DLGA 1LWYA 4XQ3A 1RT3A 4CZJA 4FXDA 4ATOA 2NWMA 2ZMEC 2UWMA 1DIZA 3C6TA 3CD6N 3M1CA 1CKAA 5GMKm 2EIMH 4QWQA 4DR7K 3GF5A 3SK3A 4PKCC 2ECZA 5KYYA 1YS7A 4PFPA 5M1FA 3C65A 1S72Q 2O9VA 3B73A 5LJ3j 1U06A 2X85A 1KQ1A 3EUAA 3V8KA 3G4SN 1ZELA 1NH3A 4DV2K 4CXFA 4KAZA 2TCTA 2HR3A 5CHZA 1JJ6C 5LJ5f 2EX3A 4RTFD 3D5RC 4FM0A 1YJNI 1TWHJ 3IAS2 1RESA 4MMLA 1WPKA 4DTRA 2MABA 2QYOA 2YUPA 5I22A 4FT4A 3M8QA 1I3AA 2H8WA 2PMHA 2X0LA 1IAWA 4CZFA 1QVGP 2FXUA 3MP1A 1RT1A 3A5LC 2XY7A 3M8JA 3OYAA 1U2VB 1NG9A 3VW4A 3EYIA 1ZBJA 1H92A 3CJNA 1W97L 3MCPA 1EP4A 3BP8A 1W7PD 1H1VA 1RBTA 4B24A 2MH2A 5IN1A 2QA4A 4CGIA 1HA8A 3HRMA 2RQWA 2F4MB 3NGZA 1Z1DA 4FWRA 3K4LA 1NHAA 3GWZA 5BRFA 5HRSA 3DU5A 3HOTA 4M7AF 2OA8A 3DKXA 2GF7A 5E8IA 3GUDA 3KUFA 3S9HA 5GAN7 3FKJA 3ISNC 2P9IB 1RUWA 3CCVT 4CEBA 2KT8A 1JKOC 4E6RA 3VTIA 1M8VA 2D5RA 2C06A 4E6KG 5GANe 2QEXN 2LVMA 4IZ9A 4KKOA 1MSEC 1AEYA 4XRFA 1IG7A 1J5YA 4ENKA 3LPUA 1KZHA 3MWPA 4J2DA 2PUOB 2YS9A 3FGUA 3ESWB 1FN7A 1DLOA 2X6WA 2KQWA 1TYQA 3CCRN 4XM3A 4BRGA 3SPYA 3JCUC 1NJIO 1DT9A 2Q31A 1H8KA 3MZHA 3KD5E 3FXKA 3QSUA 2V7ZA 4CHNA 3MEAA 2VQLA 1YJ9A 2PJPA 4TV7A 4M75B 4C8NA 1RBVA 1P7JA 5H20A 2HCKA 2LKPA 3CVSA 1MH3A 3WU2C 3OYHA 5KN9A 3ERED 3BJAA 4BNCA 3F21A 1PVEA 2FF4A 5AONA 2ECBA 4D8KA 4BDPA 5LBQA 1TL1A 3WT0A 2QSGX 3KXTA 3ZCOA 2DZCA 3TAPA 4I0AA 4KTQA 3EAEA 1C1AA 3I9QA 1S1WA 1T8IA 2O4XA 1L3SA 4DV6K 2HTSA 1OMIA 2UZKA 5BPIA 1M3HA 1VQ7Q 2A40A 1YVUA 2K27A 3CCRI 5ICGA 1ZC6A 4UOBA 4II3A 1VQPA 5B66C 2IPOB 2FBKA 1LDJA 1FYKA 5HY6A 1Q81U 2VT3A 1WHHA 3EFOB 3AA3A 4PGHA 3M4OJ 2LZ6B 2P9UA 5K7ZA 3NHNA 1RLPC 1JCGA 3QEPA 3CMEN 2XAQA 3L8BA 2HB5A 4QQ6A 1K8AR 1EF4A 1W2BS 1G8XA 4XLFA 4FYWB 3DOKA 4A3KJ 3QWLA 4U7DA 2JPSA 1HJOA 2E6MA 3T5XA 4ASNA 3GTPJ 2XKPA 1WH5A 5ECAA 2FVUA 3CMAN 4M78D 2YUQA 3VU3C 2DK8A 1KG6A 1NGJA 2NNNA 3CCQA 1WI7A 4HCBA 3M9AA 1RTHA 3THWB 2WAQN 1XCBA 1TQIA 1CXUA 1MU2A 3W2WA 1DGKN 1A04A 1D3BB 4YHHK 4ZZDA 5HP1A 2YNHA 1FSEA 3OL3A 2M4KA 1W5CC 2RJDA 3KYCB 1MH4A 4M3BA 3CMEI 1K8AO 2DRMA 4BRLA 1OV3A 2F5TX 1X9JA 1SRMA 4JRQA 2LT4A 1YVNA 3BEXA 4Z8AA 2GCXA 5E20A 2E64A 1WH7A 3QRFF 4CCKA 1XC3A 2PMZN 2DIQA 1IN4A 3DXJF 3AVKA 3V9ZA 4JPBW 4N4OB 5HLIA 4NL2A 3CMAI 5M5XJ 2AQEA 3REOA 1WFXA 3WXMB 5KYUA 2FNPA 1BM9A 3TW7A 1IRFA 3O3HA 1VA7A 2KIUA 2HHUA 3HJFA 1S22A 2HTJA 3ZETB 3FXRA 3QDFA 1DU6A 2LDMA 1U49A 3AVIA 3RMCA 4HCKA 3NF7A 1I6XA 1QNTA 4ZN3A 4Z4EA 3O80A 3UKGA 2NOHA 4F3QA 4PUSA 2M4GA 1IRGA 2MCNA 1UGVA 2VG5A 4CHYA 2LMDA 3GTLJ 2DD4A 1NEBA 4A54A 1J2XA 3LP0A 4ESJA 4KHQA 1NGGA 2G8FA 1NGBA 1VYTA 1H9TA 4I9QA 1NE8A 2R7RA 2EJGA 4CO8A 2TDXA 2E5QA 1NGCA 3DKWA 1TWFJ 2P84A 2LBFB 4UNFA 4ZYDA 3WXLA 4M77C 4MDAA 1TUDA 3CCMN 1HR0K 1WSEA 3V4IA 3S2WA 2LRQA 2F2VA 3NNQA 1VSHA 4YORA 2DA7A 3H3UA 2YLBA 1KQ2A 3T69A 3J81E 4W5OA 4ENNA 5I42A 4EEFG 2QQRA 3K10A 3D2EA 1RC9A 3G6EQ 2OFIA 4GV6A 3QO3A 1GRIA 4LFBK 3CBPA 2XRLA 2VLAA 4BQZA 1P4XA 1BU1A 1BJZA 2ZXHA 4NYNA 2NAZA 3T8TA 3FM5A 1IRZA 4HX8A 1PKSA 1MUYA 1WXBA 3LSJA 4AFSC 2HVIA 4I7HA 4A2UA 1X6OA 1XSXA 3NCIA 2VQEK 4BDZA 2ZPHB 1KJWA 2ZKZA 1KLNA 5BQTA 2Y2ZA 1XQOA 4KV8A 1HC8A 2BUDA 4PJOF 2HAXA 4A0XA 3E2UA 2R7TA 3CCMI 3TQNA 1S7OA 5KI6A 3TABA 1JXSA 4H5WA 1BI4B 1NZ9A 1JLAA 1ETXA 1W0HA 2M30A 2UUBK 3E6CC 5JLWA 2XKOA 5BRDA 3QDRB 1XSDA 4CYCB 2D0OA 5KCHA 1KG1A 2DTRA 4H5VA 3G7ZA 1MKMA 2AKKA 3LL3A 3ENBA 4EMHA 3D2FA 4BAYA 3OMYA 4GYIA 2HOSA 2VE8A 3SEMA 3CC4N 2WACA 1OU8A 2LT1A 3AVLA 4NB4A 5HOOA 4K11A 2X9DA 4HLXA 5FPNA 3CUQB 1RBRA 2V9PA 3QETA 3UPUA 2G8HA 2V8KA 4H5RA 3ISPA 4I98B 5FGMA 4XK8E 2HF4A 2CP3A 1NK6A 3ZQGA 1DUXC 5BOXA 4NBQA 4D8DA 3EKSA 4LF5K 4M78G 4A3DJ 1ZN2A 2RH2A 4EFHA 2AIRB 2CGHA 1R6RA 1BGXT 1M2OA 1RAIB 1Z26A 5KPZA 1SL2A 2P0WA 3RERA 1SL1A 3ABUA 1S3JA 1X27A 2L02A 3FLGA 2SEMA 3O1WA 3J81K 1XG1A 3K58A 1E17A 1OULA 3LWFA 2G7UA 3GFIA 3SFIA 4FLZA 1UE9A 2OBPA 2FPFA 4B9TA 1YITN 4C2UA 5HK3A 1I8FA 1LUJB 3K59A 3I54A 4HHTA 1YHQN 4BGBA 2CU7A 2W40A 1IKVA 2BOLA 1KTQA 1VQ9T 1W4MA 4CK1A 2MF2A 3QUIA 1S6LA 1WLJA 5GMKl 2VIXA 5AFUH 4BJTA 3H92A 2KZZA 1WGXA 2O8DA 1RDCA 3I4PA 2HPMA 2F2WA 4AQYK 4AU7A 2HU9A 2VB6A 5GTHC 4A5MA 2DJNA 3ZMSA 1VQ4T 4M7DA 1B07A 4FJXA 4AHSA 5GMKh 2YCHA 3I33A 3S6WA 1BDGA 2Y4XA 3AGKA 1LFUP 4OB1B 2DL8A 3CCST 1R23A 2AJQA 3DV8A 4Q47A 2BHZA 2KDSA 3QYBA 3O1BA 3DPUA 4MNUA 4QS7A 5J1EA 4RTUA 5HBMA 3SWNB 3BDLA 4Y7NJ 4LUEA 1ATRA 1ZAOA 1S72N 2P6SA 3DU6A 2VWFA 5LJ5d 5J6XA 3FFIA 1YHQI 4BR5A 2A28A 5FPEA 1YAGA 4D1QA 4K43A 1XDUA 4CC3A 1D9FA 3IDHA 2HF3A 1JLBA 4FIBA 3P83D 4GCVA 2DJZA 3S15J 1X19A 4AH9A 2Q2EA 3QESA 4HNTA 1WJCA 1Y1WJ 3EGUA 3AO5A 3L2QA 1RRJA 1X9SA 1XHZA 1AZEA 2JJ7A 1QZEA 4X65K 4PA1A 4F52A 4PL6A 3HOZJ 3I71A 3EE8A 1G5VA 2EKHA 1BOBA 4M7DE 1JB0E 1YW9A 4CIEA 3K9TA 2FU4A 2HI3A 3TU5A 2XD0A 3WU1B 4OMPA 5EG0A 3BR3A 3P8DA 4MTDA 3CJCA 3F9MA 3BCAA 3ZCMA 3LZIA 2EZIA 1S72I 1NGFA 1IW7F 3HXLA 4CHZA 4GY5A 3WG9A 4DR5K 4FJ5A 4CF8A 1JUPA 1R59O 4FWNA 2CH6A 4U0WA 1MBJA 1EH7A 2KXDA 1YO5C 2E1NA 5LJ3g 4B1YB 3LNQA 5IHNA 2OX7A 5KH6A 4DUZK 2CQQA 2D2WA 4ID5A 5FDLA 3OSFA 2DTZA 3LAJA 3QIIA 4YOUA 5LY3A 2XO7A 1JXMA 4F7UG 1IXSB 1ZQ3P 2KLAA 4B9UA 4JAXA 4OO1J 3NFCA 1OKJA 2A61A 4G9YA 1ZREA 2DILA 5LJ3f 1OH8A 2RMOA 1RABB 2XAUA 3ZSQA 1TV6A 2DMQA 1XX5A 5F0FA 5HDNA 3JB9G 4CESA 1ARKA 1IKXA 1J9AA 3JV3A 2WV1A 3OTOK 3MXJA 1IJJA 3IRRA 3CCUQ 1VQKN 1BISA 3DTEA 3P5JA 4HT8A 3HK2A 1K9MC 2DM1A 2FXAA 4AIAA 1N9SA 1VQMA 4CJQA 4DMNA 1IC8A 2K3BA 1Q82R 3I0XA 1T03A 1J59A 2EK5A 4RB0A 3V1QA 1OCCH 4RWTA 3M4YA 5L3BA 1S6PA 2P1JA 2CW7A 1ZSZC 4M9ZA 3BZ6A 4OMQA 3EYYA 4MEYF 2KTQA 1OU9A 4B8AB 4EVVA 3HG9A 3OA9A 4D5FA 1SKUB 2DERA 3LYIA 2ZFUA 3J80E 3I5RA 3NAUA 1RR8C 3JCMg 2PY5A 4JX4A 1AKHA 1M1KC 3RWUA 4IDKA 4NXMK 2QM3A 3FKIJ 5D5UB 3BTLA 1KD1C 1SKSA 4DV3K 2XB0X 2QI2A 4C5HA 3CPWP 1WIEA 5IWAK 1MUDA 3VS2A 3PNVA 2IA0A 2P6TA 3L2RA 1SMYF 2F8SA 2DA4A 3ME9A 4M7AA 3JCMf 1VQ7N 2LCSA 1SV5A 5E17F 2RN7A 2CV1A 4NB5A 1F1BB 3CWSA 2QKKA 1O3TA 1OFCX 2O31A 4KGZB 4CI0C 4B9MA 2YHTA 3EETA 2OUMA 1JU5C 1RKWA 1HLVA 5ICEA 1ZA1B 2DMOA 2P9IA 3G1OA 2CFOA 4A3CJ 1DP7P 3OJSA 1KQSP 2VYPA 3TTDA 5IT9O 4XONA 2BY2A 3TWHA 1KFSA 1YBYA 3KZBA 2A5XA 1Z6TA 1WJ5A 3L7WA 3HKZA 3W0LA 2GLOA 2HVHA 1VQ8Q 4E7HA 1OYWA 4N56A 3C6UA 2ED0A 4DQSA 4DQPA 1B72B 4BQAA 4IOCF 4DR1K 3SUOA 1FPQA 4M3XA 3KVGA 4PSXA 3RDVA 1SPKA 3AAQA 4O5FA 1UG0A 1OYXA 1HDDC 2JT4A 3CCLA 2XDBA 3SJJA 2O8FB 1SRLA 5KCOA 4W1UA 3KEYA 4M7AE 3O9QA 5AQPA 2LCLA 4C0DC 2J4RA 2CQNA 1IRXA 1HYOA 4FLXA 1FEXA 3X28B 4JZ3A 3NPFA 1YI2Q 3CLQA 2XPWA 3OR1C 4DSJA 1BI0A 1M1EB 3J80K 1TK5A 5DPKA 4GLKA 4X1EA 4FOEA 4MZPA 2PZSA 2WBMA 1Q7YC 1VQLI 3GL1A 3FSPA 4CGDA 1D5VA 1BWFO 1MUNA 5BPMA 1C0UA 2CYYA 2FHDA 4FOIA 1LWVA 5KQDA 3VQAA 2QTDA 4U0VA 4IOAF 4Y91A 5AQFA 5I2MA 1BC7C 5EZGA 3EFOA 2L3RA 1ORPA 1M4ZA 1HNWK 1RDBA 4M63C 4JLIA 4UUSB 4I2QA 2GV9A 3KZZA 5J2PA 5FPMA 4BRIA 4DJAA 2WV0A 4M3DA 3DEWA 2JG6A 4M75E 3PT9A 4M6YA 4HDVA 3PFYA 1JLGA 2NNYA 4BHBA 3VA0A 4OWRB 3SI6A 4HF2A 3V7CA 3CP2A 3DJCA 5C42A 3DYAA 3QFUA 4AG2C 4HUFA 3E9OA 4BRPA 1K8KB 1H8AC 4AFZC 3B6CA 3S6IA 2NUTA 2HMPA 1RAFB 1NPPA 3EZWA 3ID6A 3LWIA 1Y96B 1DPUA 1QHHD 2F5VA 2JGUA 5LGNA 3VUBA 2MWPA 4KPYA 1DGRM 5LEJA 2WAEA 1YW8A 1D3BA 3NWTA 3GO5A 1HJDA 4ISGA 2PUKB 4AMCA 4ELTA 3OSVA 3G6EN 1O7FA 4X6AJ 4FJ9A 1S1UA 1XDSA 4DZJA 4RB3C 1VQNQ 3L3UA 2CMPA 3D7SB 4C92F 4EGZA 2M45A 4EJYA 2V6EA 3B6OA 5HRPA 1QVGA 4IIOA 1VQ6A 5AQIA 3AVHA 1FBUA 3ZL7C 5BRHA 2M8EA 5DCMB 3HP6A 3L00A 2L0KA 3FXOA 3NGIA 5LD2C 4L18B 4FLWA 2XY6A 1OI1A 2OTLQ 1MJBA 5GAMj 3J81Z 1VK0A 1EO1A 3NF9A 4BB7A 3GG4A 1YXQA 1NYFA 3NTHA 4MHGA 4XH1A 2PEXA 3Q9SA 4HDUA 1ZBHA 4IL6C 1KSPA 1BIUA 2ITGA 3U3YA 4BUPA 4PKIA 1CLQA 3R6OA 4GVEA 2R7VA 4FVMA 1KVAA 4M3ZA 3OS1A 1GFDA 1PHTA 2VKVA 3HBTA 3G1LA 2VKNA 3UA6A 3JCMb 4AFUC 2F5KA 2RHKA 1N27A 1OCZH 3R8EA 2IS4A 2FZGB 3WE3A 3G6EI 1SEMA 1UHSA 3HVRA 2HMIA 4JJBA 3LGFA 1X69A 2ID3A 2B6AA 3AAPA 4LD9K 3G71T 1KU7A 1J53A 4CHPA 4QTRA 3NFAA 3I55Q 3ALYA 4U67L 1X3ZB 4TSXA 3OV8A 3PMIA 1AOJA 4J9GA 2A7YA 5SZTA 3TCJA 3GF2A 1TVRA 3HXMA 1XPXA 5HLGA 1VQLT 2ZPEB 5LJ5e 5C4JJ 1RACB 2X6XA 5EC7A 4KI4A 5AQUA 2JTVA 3MX2A 3VYHB 3EO3A 3PIOF 3K5MA 5IYCJ 1IGQA 4DLGA 1FYLA 1U8BA 1UJ0A 3Q9VA 4M7DD 1FW6A 2RVCA 3DAWA 1IO2A 5L3EA 1NLOC 2GGRA 3VQ9A 2EQMA 5LL6Z 1MSFC 2J05A 5LJ5h 3K0SA 4IRHA 1FBSA 1TG0A 3VESA 5J2MA 1KQJA 4HF0A 3ZOBA 1RTIA 1BL0A 3SQ4A 1BC8C 3EFRA 1NG7A 4CZGA 4MFDA 1N6AA 2Z1IA 2OAUA 3ZX0A 1ZLMA 3SEQA 3A5MC 4LOCA 5HNFA 2H8RA 1NTCA 2X4HA 1IXRC 5AQXA 1SFXA 1DPRA 4L9TA 2GEMA 2EFQA 4LFAK 1ZBLA 4CYCA 1Z9QA 3NMZC 2DL3A 3WXJA 5FD6A 2EHGA 3LDNA 2L3QA 4EMKC 3WNFA 3VEOA 3TAQA 1ZYRF 1HSQA 5H6QA 2QTVA 3H9JA 4PHTX 3PTAA 5GADJ 3CUQA 3D5LA 1RGIA 1G15A 3CC4A 4DIQA 4Y3OA 1CZBA 4AM6A 2XROA 1T0HA 4ZDOA 2DK3A 3ZSYA 3F2KA 1BI2A 4J2EA 3S3NA 2WADA 2OAZA 2CO5A 2IVOA 1RDDA 4NLBA 1YQAA 2MFZA 3V9WA 1QZZA 3KZIC 2CP5A 3A4CA 3L42A 2VYTA 2E88A 3SV3A 2TRTA 3BW1A 5BPLA 4B9NA 1ZG3A 4KH0B 4HQEA 4DCHA 2NOGA 3CW7A 2HXIA 4XN3A 1U5TC 1A31A 2KISA 5I9EB 5JVHL 2ZXJA 3F8NA 3VS6A 3QEWA 2OZ6A 2VWJA 4DWIA 1T7PA 4E7KA 4GV3A 1P59A 2ME6A 2HQ5A 2YRDA 1VQOA 2OZMA 2NLUA 2HWVA 4NC6A 1R71A 1V29B 3ZX3A 3VQ8A 5AQRA 4WFNL 3CQZJ 4CEEA 3Q0UA 2YHBA 1ZR2A 2YWWA 4E70A 4K42A 4F16A 3IHUA 4FLVA 3MD2A 5K1YA 1AZGB 1QPMA 4FWOA 3WTVC 5AQTA 2RNGA 2A1SA 1ODDA 3FK6A 4BQOA 3V9XA 2GTJA 2MH9A 3R6NA 1QTMA 5EYRA 2FO0A 2AK5A 1D4XA 3RMQA 4YDUA 4MZMA 1BI1A 2FE3A 1YCSB 3HOSA 1G3WA 2F5DA 3SZ2A 1HSJA 3WODF 3ZSWA 4OIOF 5BPNA 5A2QZ 2HEQA 2W6LA 4PK4A 3FJPA 4HKEA 3RSEB 1F36A 2DAQA 2YHYA 4XU1A 1UAXA 4LB5A 4DFMA 2HNDA 2Y69H 3QDKA 1NKUA 1XMAA 3CCUN 5LRSA 4UY8I 3TSUA 3FHNA 1SC7A 2P4WA 2K2VA 3QYGB 2NS8A 1QP2A 2IAJA 4KT6A 3DMJA 2DL4A 4M7AD 5TJJA 2F8TA 1I1JA 4RA2A 1ZH5A 1VQ5T 4UUTA 5DYMA 5HS8A 4BR4A 4OFAA 3X25B 2EQRA 2D45A 2W42A 1REPC 1JL2A 2P7CB 3R6MA 1FYNA 3OR2C 3NH1A 4RDUA 5DCFA 1HQCA 2NRTA 2M87A 4XOTA 3MZYA 4PJMA 1ZXOA 4EHTA 1N77A 5EEGA 2R93J 1RRQA 3TO9A 2QA4Q 4EJVA 5GADP 3THYA 2HBWA 3FZFA 4L9NA 1PSEA 4M7DG 2PQ8A 2BE2A 4PQUA 4WTOB 3OYBA 1E3OC 2XMFA 4JRKA 4FL6A 3J7ZI 1T6DA 3JTHA 3CF2A 3ZFJA 4RS8A 1QE1A 3EGDB 4KRTA 5JVGF 5AIPA 2EYYA 3CCUI 3QJYA 5A0GA 4BG9A 4CRIA 3A01A 3S2HJ 1JXOA 1Q8IA 2W00A 4XICA 2CP2A 4WQ4C 5EU7A 1XJWB 1TQMA 4IJNA 2OJ2A 1C0FA 1BW6A 3REAB 2D1XA 3MMVA 1NJYA 2DEUA 1SD5A 1MIJA 2STTA 2M9UA 2KMUA 4M75D 1NLPC 1N8RR 3EPZA 3DQVC 1PP7U 4X9CA 4BC2A 2HW3A 1CGPA 1K73C 3ZT3A 4M77B 2RF2A 2H09A 2I5UA 4MQ9F 2FSWA 3S3MA 2EYXA 2QWOA 1YJ9Q 4I01A 4KBMB 3FMRA 3P1GA 3O6BB 4L9VA 1E0EA 5BNGA 4CFBA 1VQ8N 3VUZA 3FF5A 4BROA 4RGRA 1K6YA 5A0LA 4GNIA 3JAMO 2HBMA 3KKSA 3RBBB 4PJOB 4C5GA 2F9TA 1BN5A 1C0WA 5M1OA 1NKCA 4AUXA 4HF1A 4RTWA 3W6KB 3PNYA 2YSQA 1U3OA 1J6ZA 2X35A 2HNIA 4ZTFA 3BJ6A 2BGGA 3O9SA 3FMQA 5GIPA 1QZ5A 1GVJA 1PP8F 1KC8U 1N9RA 3QWXX 1IUYA 3OYNA 1N8RO 3L2WA 1PNJA 5FPDA 1XQHA 4FZYA 2QBYB 2FRHA 2EQUA 1WHLA 1TBXA 1RT5A 2GQIA 2LYCA 1FP2A 3ZYYX 1Q9XA 1NPRA 1YI2N 1VQPQ 4UXNA 1WCMJ