3L2WA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and gs9137 (elvitegravir)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2wA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2wA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2wA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2wA03
4QVZA 2VWJA 3V1RA 1TK8A 4N47A 1EKEA 3RWUA 3FDRA 3PMIA 3QINA 4DF4A 3SUPA 4EP4A 4Z0UA 2YHBA 4DQIA 4ZTJA 3LWMA 2HHSA 1RT5A 4C8LA 4IURA 1BCMA 4I9QA 2D0BA 2E6MA 3LP0A 2EX3A 4M41A 4IUTA 1LW0A 1REVA 4KHUA 3MEAA 3AVAA 1RBSA 3B6OA 3F73A 4QQDA 3NGIA 4RW8A 3T3FA 3VQBA 1ASUA 1TK5A 3D0PA 3OVNA 2YKNA 1G5VA 2B6AA 3ASKA 3TWHA 4E7IA 2RI2A 1EXQA 1XNIA 1C1AA 2K3YA 4M3XA 4Z4EA 3PMTA 2KZMA 1IKVA 3AO1A 4QCLA 4QQGA 3HVTA 4DSEA 2EKOA 3QO9A 4CK3A 4M3YA 4B9NA 2GFUA 1VSFA 1RBRA 2B4JA 4B08A 4DTUA 4J2AA 2XRIA 4FK2A 4DTPA 3RRGA 5I42A 2RN2A 4CGGA 4HCCA 1IKYA 3AVCA 5KH6A 3HSTB 3RMDA 1C1CA 4CJ3A 1ZBIA 2P0KA 2RF2A 5C25A 4CFDA 5KI6A 2IG0A 1O1WA 4N56A 3OJSA 4KTZA 1MHNA 4CJTA 1GOCA 3TAMA 1XI1A 4DTMA 4QAGA 1RBUA 5JS2A 3PY8A 4FM2A 1UA0A 5C24A 5C0MA 4FJIA 3OS0A 1YT3A 4HUEA 4OKJA 3OJUA 1Z26A 3NF9A 1DTQA 3LPTA 2RHXA 5J26A 1RT7A 5EU7A 4CK1A 3SQ4A 3TAFA 1VSDA 3CFPA 3META 3QKJA 1T03A 4JS5A 1Z25A 1B92A 3UT1A 1N27A 1J54A 1NOYA 3ISNC 2D5RA 2G8KA 5SWMA 3MECA 4DLEA 1UWBA 3ZT2A 1U47A 3L2UA 2QXFA 1RTDA 4L8RB 4FLYA 4FZZA 2YKMA 4AHSA 3KLEA 1IG9A 3VQ9A 1U49A 2IC3A 1IH7A 3LANA 3HP6A 1RTJA 2L89A 2PYJA 4CFAA 3ZT1A 2HHQA 4BE2A 1U04A 2FHDA 4GMJB 4DTSA 3V9ZA 2DAQA 5KGXA 3U3GA 1JLGA 3NNQA 3VQ5A 4HUGA 3MO8A 3V4IA 3LPUA 4W5OA 4CK2A 2IDOA 4FM1A 2F8TA 2DY4A 4FK4A 3AO2A 4DF8A 2HW3A 2XY7A 4LH4A 4CHQA 4TSXA 1D8YA 1C1BA 4KPYA 4OVLA 3ZSRA 3IS9A 3BGRA 2OZSA 3LALA 2BGGA 3QEWA 2G8IA 2XY6A 4AHVA 2R5MA 4C8KA 3L42A 2HNZA 3OYDA 3MEGA 2R5AA 1HNIA 2D0CA 3ZSOA 4H8KA 2KTQA 3ME9A 3KLIA 1FK9A 2OPSA 3VN5A 1LWEA 4KB1A 2M1HA 3TAGA 4IBNA 2X74A 4RW9A 1QSLA 4B8CA 1WGSA 2OA8A 3SPYA 1VRUA 5CYQA 4B9MA 3AO5A 1RT2A 3E9GA 4CHZA 1ZBLA 4OPKA 1WSGA 3S9HA 3ALYA 2F8SA 4AHTA 4IG0A 3M9QA 2HHTA 4NYNA 3VQ6A 3HO1A 4FJNA 3V1QA 2X4WA 1VSHA 1J5OA 1IKXA 3K5OA 5D6WA 1NKEA 3PV8A 3SQ0A 3PX6A 1XWLA 3H8ZA 3WNHA 2X35A 3AA2A 3F9KA 1EP4A 2G3RA 4O0IA 3DRRA 4CHNA 1NOZA 1X9SA 2Y1IA 3A2FA 2Q3SA 2BANA 1NJYA 3THVA 3FFIA 3V81A 2LTOA 1KVBA 4BWJA 4PQUA 1RT1A 3O3FA 4OLAA 2DIGA 3S3MA 2NLUA 4CEFA 2AJQA 5DMRA 4M42A 1KFSA 2QKKA 3DLBA 2IS3A 3OYNA 1S6PA 3HK2A 4O44A 3SV4A 1CZ9A 3SZ2A 1D9DA 1LWFA 2E6LA 4BDPA 3NGYA 2ZQBA 4BDYA 3FC3A 5HRPA 3IAYA 3CYMA 4PWDA 1T05A 3NH1A 3I0SA 3DLHA 1KTQA 3U6FA 1SL0A 4JRPA 1K6YA 4CJUA 2GF7A 4CJSA 4ZTFA 4CJKA 4B9XA 5J1EA 3NCIA 5KCHA 1I3AA 3NTIA 2A1SA 4B9SA 4FYDA 4J2DA 4KHQA 1N5YA 2YNHA 3SCXA 1GOAA 4E7LA 1NJXA 2Z1JA 3L2RA 1Q9YA 4W5RA 5KGWA 2E4LA 2OZMA 4EDUA 4E3SA 1NJZA 3CM6A 3CG7A 4F8RA 3C95A 3AA3A 5HP1A 4FVMA 1S1XA 2F96A 1U45A 3DOLA 4CERA 1J53A 3VA0A 2YNFA 3B6PA 1ITGA 5D6XA 3NF7A 4HVJA 2QQRA 1C0TA 4JRQA 3CFRA 4M3TA 3SUOA 3AA4A 4CECA 4DSJA 3CEYA 4KREA 5HRSA 4KB0A 3OA6A 4NZGA 2RHUA 5C6SA 3IRXA 3L3VA 4FJ5A 3ZSXA 3AVMA 4ELUA 3QIOA 4BDZA 1VSEA 4PY5A 3MEWA 4C8NA 4CEBA 3KLGA 3QEXA 1QTMA 5I3UA 2ATQA 3JYTA 3GOXA 4CJ5A 3OQ5A 4FLUA 1JLEA 3QEIA 4PLIA 1HYZA 1S1VA 1J9AA 2Z1GA 2EQUA 3RR7A 4EZ9A 3RMCA 2ZD1A 4IKFA 4FJHA 2RJEA 3O8VA 1BISA 4ID1A 3ZT3A 3ULDA 1WSJA 1YTUA 4II1A 3QNNA 2CKKA 4C5HA 1TAUA 4F2RA 2HHXA 3L3UA 4HCBA 3AVFA 4B9TA 3UIQA 2QK9A 3DB4A 1OZ3A 2O4XB 3PUFA 4BE1A 2GV9A 2G8VA 1HJRA 1NK0A 1WN7A 4FZXC 4FM0A 1BQMA 4H4MA 2F5KA 3FLGA 5HRNA 4NCAA 4KAZA 3FEOA 4CJEA 2O4IA 3ITHA 1RI0A 1Q8IA 1S6QA 4KI6A 4FW2A 4DSLA 2EFIA 3OYHA 3O3GA 3QEVA 2WOMA 2WONA 3NBPA 4CEEA 3QEPA 1RNHA 3ASMA 3K58A 3KK1A 1JL2A 2KFNA 3I8DA 5FDLA 3MEUA 1WJRA 3SPZA 3H08A 1B9FA 2DIQA 3QJ6A 2RHIA 1Y97A 4N41A 3G10A 2X78A 3CFOA 2FBVA 1F21A 1RT6A 4JS4A 1RTIA 4Z4HA 1ZBHA 3SYZA 3DRPA 4E7HA 4O4GA 3AVLA 3NF6A 4W5QA 4M3UA 3HP9A 4CEZA 3DI6A 5JS1A 2BUDA 3OYJA 1JXBA 3QETA 3NH2A 4Y1CA 4RG8A 3HJFA 4E7JA 1WAJA 2Z1IA 2QKBA 4AHUA 4CESA 1SL1A 3DLGA 2O4XA 5HLFA 2B8AA 3V9SA 5FRNA 4IUVA 3KKSA 1FXXA 1X9MA 3DLMA 3IG1A 3V9WA 4B9VA 3LGLA 3ZT4A 5KCOA 2HVIA 1L3TA 4A4EA 4Y1DA 2OPQA 3PO4A 4IDKA 4JLHA 2W42A 3LP2A 4DFKA 1TKDA 5CZ1A 3SV3A 1A5XA 4DU4A 3KK2A 4KHWA 4FJ7A 2X6NA 4DSFA 1CLQA 4CJPA 2EQJA 4AHRA 3RTVA 1TK0A 2X6SA 3LZIA 3TR8A 3D45A 3RRHA 4C5EA 4M45A 4CEQA 4FJ9A 1TL3A 4HCZA 4C8MA 4N4HA 3VQDA 4DFPA 3SJJA 4AHCA 3K5NA 2EQMA 3V9XA 2M16A 3QERA 1TV6A 4ID5A 4FJMA 2L8DA 3LWLA 3G0ZA 5K14A 3KLHA 4C5IA 1JKHA 5CZ2A 4FK0A 4F3TA 2Z1HA 3OYLA 4N76A 3OMCA 4QW2A 1BCOA 3LP3A 4ELTA 4YNQA 3SUQA 1CZBA 1WAFA 2YHAA 2R58A 3C6UA 3NDKA 5FRMA 4KO0A 4CIEA 3K2PA 4DTXA 4FJGA 1KSPA 5KE3A 2DFEA 2RJFA 3PX4A 3RMBA 1JLAA 4Z4GA 3M8RA 3VQ7A 1S1WA 4GY5A 4CFBA 3VQPA 2HHVA 4X34A 2LRQA 2MWOA 3UWNA 3K5LA 5KRSA 3HPHA 2ZE2A 3TARA 2RJDA 3DOKA 3AVHA 3VQCA 1VSKA 1VSLA 4LH5A 3KD1E 4NCBA 2RPIA 3MP6A 3LYIA 1QHTA 3NTKA 3AVNA 3AVJA 3OS1A 3T19A 3HVRA 4CGHA 2HNDA 3HPOA 4FJXA 4HHTA 3TANA 5M9OA 1EX4A 1VRTA 4N4IA 2R57A 3OYBA 3I0RA 3SQ2A 2DTUA 4KHYA 3HL8A 5IN1A 2IAJA 1I39A 3KKRA 2NUBA 4HTUA 4FLVA 2GBZA 4R5PA 2D0AA 2BIVA 4KKOA 4FLXA 3ZSWA 1S1UA 2Y1JA 3EAEA 2X4YA 1CXQA 3E9FA 3DMJA 1TAQA 4Z4CA 4W5NA 3HXMA 1BI4A 1UAXA 4KHNA 4ELVA 1JL1A 3T1AA 1WSFA 1U4BA 1WJQA 2P51A 4A4GA 2LSNA 3KLFA 3LLRA 2HQEA 3VQAA 2XDPA 3LGFA 1MU2A 4DQSA 3QBYA 4IUQA 2XK0A 2I5JA 2E6NA 4CCHA 4OPJA 5FROA 1S5JA 1OYXA 1VSIA 2KW4A 4CHPA 3KK3A 1C0UA 3SUNA 4CGJA 1UOCA 5HROA 3DB3A 3HT3A 4LY7A 3VA3A 1U48A 1DLOA 1YTAA 2M0OA 3OY9A 2P5GA 4Q5WA 2DFFA 1BHLA 2R7YA 3QESA 4CEDA 3K59A 2XY5A 4CE9A 1ZBUA 3M8SA 4KTWA 3RMAA 1NK8A 4E1MA 2A1RA 4A4HA 4QQ6A 4DQPA 5E41A 2PQWA 4M3ZA 3ZSQA 5T7BA 3C94A 3LX7A 4O55A 1N6QA 3TABA 1QSYA 2EQKA 4DSIA 2KFZA 2RJCA 1BIZA 1RBTA 3EZ5A 1WNSA 4B8AB 2JTFA 1SSFA 5IAYA 2HQXA 1SKRA 1KLMA 2WACA 1XC9A 2FBXA 4RW7A 4DS5A 1JLCA 2E5QA 3ZT0A 2GUIA 4LSNA 2BKDN 4CJFA 3E01A 4H4OA 3WNEA 4CJLA 4K8ZA 4RW6A 1TGOA 1S9EA 4EZ6A 4OGEA 3VQQA 4FJLA 1NK5A 1T8EA 2YV0X 1S1TA 4E89A 4DFMA 4I2QA 1BQNA 3P8DA 3NGZA 3OB9A 4PLLA 1UA1A 3OYMA 4BACA 3AVGA 4OGCA 2RO0A 2EHGA 5KTQA 1KVAA 3MEVA 1Q9XA 2HMIA 3PFSA 1QS4A 1XHZA 3ZEHA 1RCHA 4CF2A 4CEAA 1ASWA 4FJJA 4OJRA 2ETJA 5CIUA 2VG7A 4DTRA 4O0JA 1ZBFA 5J2NA 4IG3A 3SD4A 3OYIA 2G8WA 1L3UA 4C8OA 1KLNA 1A5VA 1RILA 4RG2A 4LSLA 5J2QA 3OYGA 1NK6A 4CGDA 3JSMA 2OYQA 3ZSYA 3QLHA 1RT3A 3EY1A 4BD3A 4NCGA 2XY8A 2PYLA 1BL3A 3AVKA 1NKCA 3LAKA 2VWKA 4NYFA 3HPGA 4HUFA 4GVMA 4DWIA 3MP8A 1IO2A 1KVCA 4ICLA 2OPPA 1ASVA 3VQ4A 1WLJA 3O4NA 1L3VA 1TVRA 3MXIA 3DM2A 3SNNA 3L8BA 3KTQA 4A4FA 3MXJA 3O4QA 4XIUA 4MQ3A 2G8UA 3HYFA 3OYAA 3AO3A 4KI4A 4J2BA 2HVHA 1KFDA 4CJQA 2RHYA 3OYEA 3AV9A 4CFCA 3LP1A 1FKPA 3TAEA 3P5JA 3V1OA 3F70A 4B9UA 5KE2A 1C6VA 2D9TA 4K8XA 4FLZA 2OPRA 4OKEA 4FCYA 1SUQA 4DSKA 3K5MA 3TI0A 4WE1A 1RDDA 2P1JA 1H3ZA 3TAQA 2VG6A 4DU3A 1HYSA 1XHXA 3WNFA 4BWMA 3O3HA 4FLWA 1RBVA 3C4SA 3KUFA 4FXDA 3L2VA 4NS5A 2YNGA 3OYFA 3V9UA 5J2PA 2BE2A 4CIGA 3LDSA 4G1QA 3S3NA 3QIPA 3NH0A 4IUPA 1RDAA 3BDPA 4FL6A 4DTNA 3P83D 2PY5A 4LD6A 4LD0A 3MP1A 3LH0A 4KV8A 3NAEA 1L3SA 1RDCA 4GW6A 4N5SA 4PA1A 2HHWA 4F4KA 1HNVA 1T7PA 1W9HA 4RW4A 3V6DA 3NHGA 2G8HA 4CF8A 2BDPA 1HYVA 1LAVA 4Z4IA 3P8HA 2RHZA 2XHBA 4DMNA 3P1GA 1TKTA 1DTTA 2DFHA 1QSSA 1BI4B 4BE0A 4UC4A 1HMVA 2IOCA 1LWCA 3KD5E 5J2MA 4I9LA 4E0DA 1NKBA 2LDMA 1TL1A 1KCFA 1S9GA 4CIFA 1L5UA 3AVIA 3MEDA 2VYTA 2O4GA 1YVUA 4E19A 2IGIA 3ZCMA 4CEOA 4EP5A 1VK0A 1VSJA 1QE1A 1JXEA 2QQSA 4E1NA 4M3RA 3QIIA 1FKOA 1NK9A 3S3OA 1X9WA 2YNIA 4B9LA 1NK4A 3KJVA 2LCCA 4CF0A 2KQ2A 4DLGA 2JZ2A 2RI3A 4CHOA 4F3OA 1JLFA 3K57A 1RTHA 4AH9A 3L2WA 3WNGA 4DU1A 2MWPA 5DK5A 3U3YA 4Z02A 2HHUA 3QNOA 3MXMA 4O5BA 1NJWA 1OZ2A 4Z4FA 4QOZB 3NFAA 1HQEA 3M8QA 2B5JA 2FC0A 2G8FA 4MFBA 2JLEA 2VG5A 2RI5A 2YRVA 4OLBA 4PUOA 1W0HA 4IUUA 2ITGA 3DYAA 2RKIA 3NTHA 1R0AA 1IKWA 1WSHA 3BDLA 4YFUA 4FJ8A 4DG1A 3TAPA 4FJKA 3PNWC 1X1PA 3ZSZA 4DS4A 1LAWA 4CJRA 2FBYA 2JGUA 4CJWA 3MAQA 2X4XA 4CRIA 1BGXT 2P5OA 3PX0A 4OVAA 4KFBA 4KHSA 3OYCA 4DQQA 4W5TA 5D6YA 1B9DA 4C5GA 4Q0BA 2FBTA 4CJVA 3S6WA 2LVMA 2PZSA 1QQCA 3VQEA 2HNYA 2GFAA 1A5WA 1C0MA 1HRHA 4N4GA 1KRPA 1SL2A 4CF9A 3M8PA 1D5AA 3DLEA 1WJSA 3AO4A 3CQ8A 3EYZA 1SKWA 1BIUA 1SKSA 4FLTA 4DQRA 4J2EA 4CJ4A 2L3RA 4DFJA 1WSEA 4UQGA 3DLKA 1HQUA 3DRSA 4ZHRA 4E7KA 4FW1A 4OKKA 1NK7A 4L59A 5CYMA 2KZZA 1EETA 4B9WA 4FU6A 5SZTA 3SQ1A 4CGFA 4B3OA 4I2PA 1VSMA 3C6TA 3AVBA 3AA5X 5KRTA 3OMGA 1GOBA 3PO5A 3ZSVA 1JLQA 1SV5A 3L2QA 1LV5A 5HRRA 4CF1A 4DTJA 2K3XA 1D9FA 5J39A 4KTQA 3SI6A 3LZJA 3KIOA 3LAMA 3H6ZA 3VQ8A 2HB5A 4M3WA 4Q5VA 3DLRA 4DTOA 1G15A 4F2SA 3HM9A 5D3GA 1WSIA 1CXUA 1HPZA 1TKZA 4PL6A 4IFVA 1OI1A 2XO7A 1ZYQA 4I7FA 5C42A 1KHCA 3RR8A 1RDBA 4AILC 3MEEA 1RT4A 3CM5A 3OS2A 5CY4A 4IFYA 1JLBA 4KRFA 3OYKA 1LW2A 3NF8A 5HBMA 4CGIA 4FZYA 3Q1JA 3NE6A 1TKXA 4CHYA
chains in the Genus database with same CATH superfamily
3H3NO 4QVZA 2KIFA 1DUXC 2I0NA 2HOSA 2X3WD 2XICA 4BVOA 4Q47A 2HU9A 3VS7A 3W3DA 3PMIA 4DV6K 3H5RA 5JLWA 2MF2A 5AQWA 4DF4A 3F8CA 4Z0UA 4LFAK 3QWYA 4ZTJA 2PVOB 4FASD 3FLCO 5FJ8J 3HG9A 2GEMA 2A07F 2HEOA 1DP3A 1RT5A 1I6XA 4C8LA 5GPCA 3HOWJ 4I9QA 5HL7L 3CXCP 2E6MA 4M41A 4UY8I 2Q31A 4IUTA 3BCBA 4EVIA 4HVUA 1B34A 4F52A 1REVA 3AVAA 5CKBA 1RBSA 2O5RA 1QVGS 3JCMb 4JI8K 4RW8A 3BWGA 2V1DA 1KAYA 4I7HA 4C92E 3DPUA 4DJAA 2M1BA 5IWAK 4FX4A 3TEEA 3BR2A 5C4JJ 3J7AF 4U7BA 4ZDOA 2O0YA 3TWHA 4M75G 2RI2A 2QWMA 1N8RO 3ROUA 2M0YA 1C1AA 2XGEA 1PP7U 1X1DA 3H41A 1TUGB 4Z4EA 1IKVA 3AO1A 2ME0A 3CCVI 3NARA 2M0CA 3CUQA 3WGIA 2XI9A 2JVHA 3CP2A 3DPTA 1JKPC 4M3YA 3JRGA 5CKHA 3EGDA 1OEBA 5F04A 3BR1A 4B9NA 3VGMA 3WUHA 2OF7A 3I33A 2GQIA 1VSFA 4RTTA 2O8DB 2B4JA 1Z77A 4QIWN 3CMET 5HS9A 4J2AA 2DA9A 2VE8A 2EV0A 3SMPA 3RRGA 1HBXG 2RN2A 4PFPA 1KQSS 3CCMA 1SPKA 3RMSA 1ZELA 2I2LA 2QM1A 1DEJA 5BREA 1GCQA 1YJWN 3WE2A 4N0BA 3LWFA 5K7ZA 1W70A 2RF2A 1XCBA 3SMSA 3F0CA 2VXEA 1TNSA 5KYXB 2K57A 3GDQA 4P55A 4XTYA 1YQLA 4IPAA 4AG1C 3HHHA 4X9DA 2Y75A 4KTZA 2ZJRL 1XI1A 1Z1DA 4DTMA 1S3JA 4DR2K 5EEAA 2DEQA 2STWA 1VQPT 4AM7A 3VRZA 3UA6A 2COYA 1R5GA 3WE3A 3UPUA 1NG9A 3R4KA 3KEOA 1XMKA 4F9OA 2E60A 2FPFA 1VSDA 3CFPA 3QKJA 3J7ZO 5JHFA 5CHIA 2HKOA 2DK3A 1T03A 2FEIA 2H6BA 1A6IA 2MMPA 1Z25A 4IIMA 3UT1A 2CU7A 1NOYA 5BQTA 5SWMA 5HY6A 1FBSA 1XDUA 3JRHA 5F08A 4HEA2 3L2UA 4LK0F 2QXFA 2CT3A 4L8RB 1QRYA 3BZKA 4FL9A 1U49A 4LDYA 3M56A 1YQKA 3LANA 3HP6A 5F2RA 3G73A 3CCLA 1K9MR 2QWPA 1TH7A 2PYJA 1YJNI 5FU7B 5LLQA 5F0HA 2FHDA 4P5OA 1N39A 4P9FA 3CCJA 3V9ZA 1KYZA 3CC2I 2O8DA 3ZXSA 4H0XB 3CC7N 4H0YB 3KXTA 3ENBA 2DA5A 2GX9A 4CJ7A 1D09B 3G71N 3G1LA 3L1AA 5C0YA 2OAZA 2V7YA 4BI4A 3CD6N 2DDBA 4E9EA 1X2QA 3KETA 3LPUA 2KRCA 5CR2A 3GTKJ 2L9SA 2CT4A 2HW3A 2PMZA 4E9FA 4KPYA 2L4AA 1KG7A 1QQNA 1AA7A 3CCRN 3ZMZA 1BUPA 3ZL7C 1TC3C 4A0XA 3AG2H 3IS9A 5KYXA 1SD7A 3EGXB 1BC8C 1XMOK 3VYTB 2VXFA 3LSGA 3F23A 2BGGA 4F7UG 2G8IA 4E70A 2RPNA 1SG5A 3I4PA 1FP1D 2RN7A 4GXOA 3G6EI 1X3WB 2HOEA 4BBRJ 4IOCL 2KNBB 4C8KA 6PAXA 4B9QA 3L42A 3M0PA 4A3KJ 2XUBA 2QASA 2D0CA 4PSWA 4H8KA 1MMSA 1TTHB 1LWEA 4KB1A 3KX2A 3CJNA 3QPHA 1JXOA 2QLZA 2AK5A 4B8CA 1WGSA 3VOVA 5FLXK 2KQWA 5CYQA 1I6HJ 1RT2A 2V6EA 1OKRA 1A6QA 3ALYA 2JA2A 4LF6K 1FTTA 3DCFA 2HHTA 4FJNA 2LF8A 3V1QA 3IV5A 4ZH4F 5LEJA 2X4WA 3G1OA 2PFUA 2E2NA 1IKXA 2KEAA 1TU0B 4YTLA 2DOFA 2DNUA 5IYDJ 2L9RA 3PX6A 2NUZA 4P9UA 1UG0A 5TKYA 2W24A 3H8ZA 3DU5A 1WJAA 1M30A 3DEWA 2LZ6B 3AA2A 2M7AA 2ZPGB 4Y91A 1EP4A 1YI2N 2G3RA 3G1MA 2RGVA 4IHSA 3E9OA 1Q86U 4MQ9F 3VGLA 2LT4A 2F1LA 1NJYA 1JUSA 2LRDA 5D5WB 1SRLA 1K79A 3LSMA 3QFUA 3HFNA 3QOEA 1YRNB 3E5UA 2BW3B 3D7SB 1KVBA 4LMYA 1QVFS 1RT1A 4PQUA 3PT9A 3CJCA 1G59A 3SDBA 2NLUA 4CEFA 2AJQA 1WJFA 1IDYA 2RQPA 3ECOA 4PSXA 5C2FA 4M42A 3EGXA 1JEGA 4ELZC 1PRLC 2KRSA 2QKKA 2W40A 4ESFA 3A8MB 2QWNA 3OYNA 3DLLL 2HYJA 1S6PA 1Z3XA 3O2PE 1OH6A 2GCXA 3M8EA 1CZ9A 4H0VB 1LWFA 5ILSA 1NEBA 1U1SA 4LOCA 3S8PA 2Y9ZA 2HCKA 1V3FA 3CMEQ 2BY2A 3OBYA 2O9VA 3I5RA 1T0FC 1E17A 2FF4A 4BYYA 4ILHA 1K0SA 1T05A 3WTYC 1SKUB 2V8IA 1SL0A 1O3RA 4JRKA 3GO5A 2Y9YA 2RQWA 4JLIA 2GF7A 3BDUA 1VYVA 1T44A 3AHUA 2IP2A 4JBAA 4ZTFA 1SVOA 2E88A 1LWWA 1QHAA 4B9XA 2DFIA 3NCIA 1Q81U 2M02A 4CCJA 1AHJB 1SS6A 4JYKA 4OFAA 2KKOA 1VQ9N 3N05A 3LSPA 4VUBA 5B1BH 4B9SA 1WEFA 1ZG3A 3W2WA 9ATCB 2CP2A 3KZBA 1B8IA 2UXNA 1VQPQ 3C0CA 3F10A 1FYKA 2E4HA 1VQ4N 4XLEA 1Y07A 4IHXA 2IA2A 3GEZA 1UHMA 2W82A 1WHKA 2DD5A 4AVZA 3CG7A 2XHCA 2L01A 4F8RA 3C95A 3AA3A 3FXKA 1T3SA 2F96A 3JB9G 1JT6A 1DJ7B 1YRNA 3HOVJ 3DOLA 2HBLA 5IH2A 2BW3A 4IWVA 4RGXA 2X6XA 4IX7A 3T0YA 3RPUD 4PKIA 3GX4X 4WF2A 2KIQA 3ONQA 3QICA 2D5VA 1DQUA 3RKQA 3UATA 3M0QA 3SUOA 4I6MB 4BG8A 5GJVB 3IH7A 1ZR2A 2ZJPF 5M3FJ 3CEYA 1KQ8A 2Q1NA 3MCAB 5HRSA 5KQ8A 2NOHA 4NZGA 5C6SA 2LNVA 3VU3C 2UXXA 3CPEA 3IUCA 2F5TX 2L7KA 2WAEA 3A8HB 3A1YA 4XEIA 4H5VA 2LKXA 4BDZA 4YIFA 4C8NA 5B66C 2V8KA 2Q0RA 5L3GA 5IT9K 2KE9A 3M7GA 4I76A 1QVPA 4FYVB 5DM6L 1VTNC 3J7AO 4RGUA 2KRFA 2YCHA 3OQ5A 1JUPA 1VQ8A 2HWVA 1JCEA 2CUJA 1V4TA 4BHCA 3WXJA 3DKMA 4FJHA 2QEXA 2RJEA 3ZT3A 4GLMA 2YWWA 1NZ9A 4DR6K 1IV6A 1Z0XA 2XSDC 2D0NA 4LUDA 1TAUA 3DTEA 5F64A 1YCSB 5DCMB 2P9LB 2W6LA 2EJ9A 1WHLA 2X0LA 4FOEA 4JI7K 1W36C 3J81E 4B9TA 4AT1B 5L3FA 4A54A 3UIQA 1IO6A 3IFRA 4AIDA 1OJLA 1X69A 2K4BA 4A3JJ 1PWTA 2GV9A 2Q1ZB 1WN7A 1NK0A 4FZXC 4XORA 3S2HJ 4H4MA 3TTCA 2Z16A 3JXUA 2F5KA 5HRNA 3HSEA 3VDXA 3SLCA 1JO8A 5CVVA 2E6ZA 4GBQA 1Z7LA 1LE8B 2OTLA 5AQJA 4C3IJ 4CZJA 3FEOA 1NU0A 1KU2A 3SFMA 3MN7A 1KZHA 3BY6A 1YITI 3AT1B 1BOTO 4DYRA 4IHTA 4EJZA 5CCAA 1S6QA 4FW2A 4UNOA 4A69C 1VQNA 4IHWA 2V52B 4BRQA 3OIPA 2V1UA 3MN5A 2EFIA 3OYHA 3VS2A 1ZLMA 2JUFA 3T69A 1SEUA 5J3LA 4LF9K 3HOYJ 2FPEA 2VGNA 1TYQB 1LEAA 1B72B 3VEVA 2VGMA 3JB9D 1FSHA 2P5KA 4AQYK 1WJRA 3SPZA 1GXPA 2F5DA 3QJ6A 1Y97A 5EOYA 3JB9I 4IDHA 3HBTA 2FBVA 3TREA 1F21A 2C0OA 4ZC3A 1XPXA 1NJIC 2P4WA 1GBQA 3SYZA 5GAMe 2DA7A 3DRPA 4H03B 2FB7A 1BK2A 4X9CA 4M7DB 3NF6A 3I56A 5DCMA 2P9LA 2W48A 3H35A 2JMAA 3AL0B 1W0UA 3OYJA 4Y1CA 3WTWC 3VS0A 4E7JA 2VJIA 3TW6A 2VBZA 3H3UA 2W0ZA 2Z1IA 1WJBA 1VQ7A 3F22A 2R7RA 4JLGA 1WOQA 1W2BA 4CESA 1IAWA 5JMVA 2KDSA 1UB9A 5FPEA 2HQHA 2R5ZB 1YFNA 2CQKA 1MDUB 4IUVA 4HQMA 1X43A 2YRCA 1X9MA 1XDSA 4O6JA 4HX4A 3SWNB 4B9VA 3LGLA 2ASMA 3EO3A 3CVTA 1Z7UA 3QP5A 3DEEA 5DDGA 1B07A 2EV5A 1JU5C 4IDKA 4JLHA 3C7JA 2W42A 4BRIA 5CZ1A 2WC2A 1YYVA 2RV8A 4DU4A 4M75E 1U06A 4RTWA 3GP8A 1KQ2A 2XGDA 4FHTA 2BTTA 4AHRA 2WAQN 1HR0K 3LSHA 5HLIA 1TK0A 1WRJA 4KNYA 5LMUK 4C0ZA 3CCUT 5J6XA 3J7AY 4HCZA 4DFPA 3TTFA 1WQWA 3HL2A 2QWLA 2GGRA 1TYQA 2V51B 3QERA 1B72A 2DMTA 5J4VA 3GTMJ 2YLCA 4ZYHA 4QLCU 3QDRB 3G0ZA 4JUVA 2SEMA 3CUQC 4C5IA 5M5WJ 1JKHA 1QKXA 4C1NK 3TQNA 4F3TA 4A3GJ 4FSXA 1X1CA 3I9QA 3OYLA 4N76A 4QW2A 2J6FA 4ELTA 4YNQA 5J8CA 1H8AC 2IVOA 2QWRA 2YHAA 2HXOA 1XQHA 4CHUA 5M3MJ 1QMCA 1HDPA 1Z05A 5KK1A 3VS4A 4DTXA 1KSPA 1TW2A 2DVJA 1KYWA 4XOPA 4JK8A 4M7DA 3VMFB 4DV3K 2EYWA 2FMYA 2F9TA 4Z4GA 3CJ7A 1G4DA 1JBMA 2VQEK 4M6YA 3WHBA 3H1CA 2HHVA 1WSUA 2E1NA 3K9JA 5JHUA 4UV9A 1FIPA 3CCET 4FWPA 3ZR8X 1GCQC 1KD1O 4U87A 1SD5A 4FE4A 2C0TA 3CDIA 4MFDA 4RGSA 1NMDA 3M55A 2FBKA 1D3YA 1Y0MA 3HKZN 4ZYEA 3TU4K 4MDAA 3ABLH 2AZVA 2YT6A 2EFQA 3AVHA 4UVAA 3CUOA 2A69F 3O80A 4M78F 1VSKA 3DPLC 1N36K 1VSLA 1J3TA 5DLQE 1KG1A 4Y17A 2XAFA 3O8HA 5AQFA 2RPIA 1L3LA 1ZGAA 5E8GA 3OS1A 3T19A 4BAYA 2O9SA 1WXBA 3CJRB 4ORZA 3FSPA 4HHTA 4ANJA 3WG7H 3OYBA 3FMRA 3HFOA 4OMLA 2DTUA 2JRTA 4OB1B 3CCSI 2BVMA 2FZKB 5E20A 3FR0A 2R7DA 1UMQA 5GAN2 1RACB 2NUBA 4FLVA 2GBZA 1YO5C 2P5VA 4IRGA 2NVXJ 3WGGA 1CKBA 2R7FA 2R7QA 1A31A 2EWNA 3GXOA 2NVTJ 3A2KA 4RCHA 1HLVA 2K9MA 1BI4A 2JW4A 4ELVA 4DZJA 4BH9A 3VS1A 2LSNA 1WBBA 3KLFA 3BR0A 2LLKA 1V29B 2X6WA 2Q2EA 4FOIA 1R36A 3VQAA 1RABB 4BY7J 1WJDA 4I09A 2F2VA 1J75A 3UKUB 4DUZK 4A5AA 3QBYA 4IUQA 5CR4A 3CJ1A 2QDLA 2XK0A 1YF5L 4OMYA 3W6JB 1TWAJ 2G7HA 1D8JA 2V79A 5EG2A 2HNHA 2EPFA 4JX4A 3CMEN 2OAUA 4C8QE 4HT8A 2DI3A 1U2WA 1R4MB 3LOCA 1PD0A 1WYXA 1DLOA 1XQSC 2KYBA 2HDCA 3A0HC 5FD6A 4KH6A 3WXLA 3BOQA 4BRKA 2B0LA 2FXAA 4C2TA 3PO3J 3QESA 4CYCA 4CEDA 5EZGA 1IBLK 2F2XA 4PJOB 1E7OA 2XY5A 1PG5B 1ZBUA 4CE9A 4KTWA 3RMAA 1NK8A 1O9SA 4A4HA 5TKWA 1UGRB 2AP1A 1FY7A 2HS5A 2PQWA 1YP5A 1XGMA 3X28B 3PTAA 2P5LC 3EHRA 1XQPA 1PP8F 4XU3A 4BNCA 5CO7A 1VQPN 3C94A 3LX7A 5KYUA 4O55A 4G9ZA 5CKDA 1YHQA 3TABA 5FU7C 3IQLA 4C0FA 3FXOA 2ZKZA 5ILUA 1NBEB 4JK9A 4U67L 5JLHA 2M9HA 3EKSA 4F93B 3FZHA 2ZBKA 1IBKK 1W97L 2RJCA 3O6WA 1RBTA 1K7AA 2L0AA 3UB5A 3G4SA 3OMYA 4J9CA 1VZ0A 5LJ5j 4XLCA 2JTFA 1IRGA 1E6GA 2HQXA 3T5XA 4RB3C 2QA4A 3CCUQ 2KR3A 2WACA 3TPQA 2ETHA 2FBXA 4QPQA 3WTSC 2K5FA 1VQMA 2YR2A 4LSNA 2HYFA 2RQUA 4M9XA 4KMFA 3UKUA 2DMOA 3E01A 3MQ0A 1NG6A 1BBYA 4CJLA 5GMKm 4K8ZA 2K5IA 4EZ6A 2DJZA 4ITVA 1NK5A 1S1TA 3GBGA 5GAN7 4DFMA 3B02A 1BA1A 2BHZA 1IXSB 3OB9A 1LFPA 4PLLA 3H0IA 3BTCA 1IV8A 3OYMA 4Y13A 1M3QA 3AVGA 2RO0A 3CQZJ 2FNPA 3O3KA 3PFSA 1XHZA 3EYIA 5AQNA 2FSWA 4FWRA 5E3OA 1MUYA 1IGQA 3AKZA 5FWCA 1QHHD 5KQDA 1UE9A 2IIMA 2CGJA 4PJOA 3OYYA 3CCEQ 1Y96B 1XUPO 4IL6C 3OH6A 4DTRA 2ATCB 3NHNA 1YIJA 4CD1A 7AT1B 3O8MA 2MAMA 1L3UA 4C8OA 2G9WA 4AU7A 4RG2A 3KZYA 3K4BA 1WEIA 4UV8A 2DA6A 1QP2A 1FSEA 4PK4A 1GHCA 5FPDA 2OYQA 1KC8R 4BU2A 4OB3B 1RT3A 4IZZA 1T98A 3RR6A 1ZHFA 2FA5A 1S22A 2XRNA 4CZHA 3F8NA 4K2EA 2PYLA 1LOJA 4EVVA 1MUZA 3QMLA 1NKCA 1SANA 1S5LC 3C3WA 2QK0A 4ZDPA 2JSPA 1EZZB 1QBJA 1AWXA 1UFMA 2E64A 5D4SA 4PKHA 1KVCA 2OPPA 1I5ZA 1FW6A 2DPDA 4G7HF 1J2XA 1SAXA 3MHXA 3Q9SA 1WXTA 3MXIA 2DO3A 4MTDA 1NGGA 3SNNA 3L8BA 1LPLA 4B1ZA 3S6IA 3MXJA 2PJPA 5M1OA 1X3MA 2G8UA 1BI3A 3TSZA 3OYAA 2YJFA 3GTQJ 4ASNA 5HKCA 2CYYA 2HGCA 1W7AA 5M5XJ 3CPWP 4H5TA 3GTGJ 5ERIA 3G25A 4KUDK 3OW2S 3AV9A 1WGXA 3CCQI 3ZMUA 3DU6A 3AFHA 1OVYA 1J5EK 1FNNA 3L7WA 1IHVA 3V1OA 2K40A 4V19K 5KE2A 4WCEL 3PIPL 3S41A 4YOVA 2AQFA 2D9TA 2QW9A 2JOYA 1Y96A 2K9NA 1R5ID 1WZ2A 2OPRA 4OKEA 4JX6A 1RDDA 2P1JA 4JI5K 1I0CA 5DY9A 4JQFA 2ASOA 2RREA 2CQ7A 4YG2F 2K85A 1XNQK 3KYLA 4KBMB 1V55H 4FLWA 2DA1A 2DLLA 4HDUA 2EB7A 4NS5A 1VQ6T 2FOWA 3OYFA 3V9UA 2AT1B 3HTUA 2BE2A 2F5VA 4A63B 5IXFA 2ZJQL 3IH3A 3LDSA 5JLFA 2HSPA 4CZGA 1C0FA 3J7YP 1W5TA 3ULRB 4EJWA 2YX6A 3HGGA 1GLNA 3TSQA 3MP1A 1RDCA 3I55T 1VQ6A 3REAB 4F4KA 3ENOA 4NUBA 4K11A 4A3EJ 1KG5A 4XRFA 5GAOm 4FYWB 3JSOA 2G8HA 3FB9A 5KVRA 2CV0A 1B9MA 1LAVA 3OS5A 2RHZA 2UUAK 2EGAA 3VEWA 3JCMP 4FWKA 1TKTA 5GAOn 1QSSA 2MA3A 3BG6A 4BE0A 2IOCA 1W36D 3KD5E 4JNEA 3CC4T 4E0DA 4BRLA 1KCFA 4OAYA 5BPNA 3EETA 3TEDA 5F1XA 4CIFA 2DDAA 2IBDA 2ZGZA 4K41A 4E19A 2E2JJ 3VEYA 4CEOA 1S72I 3RSNA 1I50J 1PRMC 2I5UA 4LFBK 1YJ9I 3BDDA 1JXEA 3E1YA 5GPAA 1TG0A 3CC4A 4IRIA 3WTZA 3RDVA 1P7MA 3A0IX 2O2OA 2D1HA 4MZTA 2VKHA 2VQLA 2E2IJ 2L2OA 2M7BA 1J9IA 4XK4A 2YNIA 2HTJA 3KJVA 2LCCA 3ZX0A 1OQYA 3M8FA 4Y0WA 2RC4A 2GTDA 2BY0A 5I2MA 3SFIA 3K57A 5HLHA 3SHWA 4E2FB 3E66A 5CHZA 2P9NA 2MWPA 5DK5A 4L9VA 5AZIB 3QNOA 3Q7BA 4O5BA 1E6HA 3A8LB 2X1CA 4Z4FA 2HXIA 1YIOA 3NFAA 4M3BA 2QQ9A 1HQEA 1K78B 3M8QA 4M78B 4QTRA 1PD1A 5AQVA 2K2MA 3M4YA 1XMXA 2VG5A 2QWQA 4DOVA 4ELYC 3GZNB 3DYAA 2FF3B 2ZO4A 2KBTA 2V4JC 4DR5K 1E3PA 2J7IA 1HDDC 5HDKA 4ZDLA 3PVLA 3CMYA 4G7ZF 4IOXA 2H1KA 1U3EM 5D8LB 1K9MC 4DG1A 4E47A 3ZSZA 4M77F 1YX5A 3A8YA 2DOEA 3RCOA 2FBYA 1HKBA 2DXBA 2JVVA 2R5YB 1J6ZA 1PUFA 2CGKA 4CRIA 3CC2A 3EGUA 5AQTA 3FIFA 1HU0A 1BA5A 2FO0A 3Q7CA 3LDLA 1Z21A 3SQNA 4KHSA 2L3SA 4DKWA 4D7MA 5KAFC 4W5TA 2O8CA 4JK1X 5LGTA 5D6YA 4M7DC 2KGTA 1SEMA 2RN8A 4B09A 4YOUA 4OMNA 1S7OA 2MIOA 3AL0C 1UUEA 4XU1A 2B9SA 3KK7A 3LDNA 4JRIA 4B22A 4CZIA 2ZJRF 5AQZA 1KG4A 1G6NA 3DBRB 1G3WA 2DM1A 1T3VA 4Z8AA 1M2VB 5ICFA 3ER0A 2HNYA 3HM8A 1ENHA 1C0MA 3CWUA 3K9TA 1HRHA 1JGSA 2IAIA 4HSTA 1BIAA 3CIPA 4B1YB 1PVSA 4U0WA 1UG1A 4ZZDA 5TGTA 4YHHK 5K5OA 4CF9A 3DLEA 5GAGP 1WJSA 4OX9K 3J7AP 1SKWA 1SFOJ 1G3TA 3OGDA 2PJRB 1WSEA 4JKGA 1AWJA 2MBFA 3DLKA 1WFXA 1QA6A 4C8QD 1HQUA 4E7KA 3MJXA 2EINH 4RGRA 2FQ4A 2UUBK 2CP0A 3T1YK 2KJBA 3HKSA 2VXZA 4IHYA 3C6TA 1NLPC 2QQAA 5KRTA 1JUMA 2GA1A 4GO1A 2CS3A 1GOBA 2E5ZA 2ZXHA 1JLQA 1SV5A 3TOBA 1LV5A 3D1NI 4CF1A 2E5KA 1D9FA 4KTQA 2XGXA 3KIOA 5HK0A 3QYEA 3O5ZA 1VQ6Q 1HKGA 3H6ZA 3A0BC 4BL0B 1IZ1A 2R7OA 4GLKA 1G15A 5D3GA 1WSIA 1CXUA 4BC2A 2V26A 5D8KB 4JJNK 4RS8A 1UGQB 2A68F 2JWLA 5GAHP 1RDBA 1N3CA 3WTTC 3CCUN 3MEEA 5MLCQ 1KQSM 3B6CA 3I55Q 1FOKA 1IDZA 3V7CA 1K9MO 2RQVA 2MLGA 5B1AH 1FP2A 2C06A 2NNWA 4KRFA 3OYKA 4OMZA 3BG5A 5FLMJ 2GXBA 1SVMA 3VS5A 2LR8A 2HNIA 1VQKT 3LSKA 1TK8A 1W4SA 4N47A 3THXB 3S16J 3V8KA 1EKEA 5AZJB 3BFMA 3O9SA 3RWUA 4A3CJ 2LBFB 4EJOA 2ZGWA 3U23A 1EFNA 4FVUA 4RTXA 2CH6A 3D7EO 1IV0A 3GL1A 4DQIA 3LWMA 2HHSA 1Y0NA 1HA8A 4M7AF 4NB5A 2DQLA 2OX7A 3EFRA 3UF4A 1T0HA 3K4NA 3CMAA 2QENA 2EX3A 5GTHC 1V54H 2OTJT 3WVEB 1FMWA 1TWCJ 4XU2A 4FWOA 1QQOA 3QPLA 3EE8A 4YRVA 2L5QA 3GNFB 3CCEN 4QQDA 3NGIA 3S2DJ 2XF6A 5BRDA 4BREA 4PDKA 4MO4A 3O9QA 3VQBA 3FE1A 4Q48A 3N97A 1S8NA 2BEOA 1BC7C 4MDBA 3CCJI 1BI2A 3ASNH 4XTWA 1EXQA 5C3EJ 4AFZC 4OMMA 5JVGL 2K3YA 3I54A 3KP5A 5KHDA 1K9AA 2EFWA 1WJCA 2KZMA 1WI7A 1NGFA 2FYKA 2OPTA 3HTVA 3L6QA 1IRFA 2AHJB 1P90A 1HD3A 2HMAA 4B21A 3KEQA 3CBPA 4DGWB 3DLLF 2WY7Q 2F69A 3H9JA 4QS7A 2K6DA 5J4YA 3JB9H 2O8FB 1BU1A 2FD5A 3ZPLA 4MEYF 2IT0A 3RPUA 5FLXO 4HCCA 5AZJA 4MO5A 4BHBA 1GLAG 3BQYA 2A37A 2Y4YA 3ZMSA 3RIRA 1IKYA 5KH6A 4DV5K 3HSTB 4C92B 3RMDA 2EZKA 3IAM2 2ACJA 2FX0A 3SXYA 3D5SC 3IC7A 4CFDA 1M2OA 4OAZA 2IG0A 5AQHA 1UEBA 1O1WA 2A40A 3ZEUB 3FXQA 4CCLA 3OJSA 3U8XA 3TAMA 4QAGA 1RBUA 3PY8A 1Y0UA 2H8HA 3HSFA 5C24A 3J81K 3OS0A 2VXDA 3IMXA 2ZJ2A 4HUEA 2W25A 1J09A 1Z26A 3NF9A 2ZSHB 3LDQA 3LPTA 2MC4A 1YX3A 3RMQA 3RQIA 2JHJA 4PJOC 1UZCA 2M8GX 3META 2FBHA 4LNPA 3LAJA 2HVSA 4XLHA 3K4KA 5GAMj 3TBIA 1J54A 4FSVA 1WPYA 2D5RA 4F16A 1UWBA 3ZT2A 1U47A 2K79A 3BTIA 3M58A 1RTDA 3UDCA 3FMQA 1H89C 4FLYA 4XMYA 3VEPA 4A2BA 1W1WE 2VB6A 1AHDP 3A5MC 4BRFA 2HOAA 1M8MA 2XHIA 2FBIA 1B7TA 4D0PA 4O8KA 3LW5E 4YIIA 2DE0X 2DPPB 4CFAA 3ABUA 5K5QA 2KXDA 1U04A 4RAGA 2ZCWA 3RVCA 3VFZA 1CKAA 2UWMA 4HVVA 4N9IA 3F72A 2KLAA 4H4KC 1QVFM 3K2ZA 3OOPA 2O8FA 3VQ5A 1I5LA 2F2WA 3MO8A 4RKUE 4W5OA 4G12A 5L3DA 3JCMe 1RDWX 4PL7A 1QZEA 4KULA 4DF8A 2XY7A 4CHQA 4TSXA 1GDTA 2FL7A 4R79A 2CREA 1J7KA 3ZSRA 2O3FA 1D0XA 1VQLT 2OU2A 2XY6A 1V1CA 2QSHX 1OCRH 4EJYA 4JKCA 2D2WA 3HYIA 2HNZA 3OIOA 3VUBA 3UKGA 2R5AA 2VPLA 3WXIA 3ME9A 3S1NJ 1ZC6A 1FK9A 4MNUA 1VQOQ 3LQRA 3KP2A 2YHXA 2NOGA 2X74A 1EIFA 1QSLA 4ESBA 1VQKQ 4FQGA 4UUSB 3HSBA 1VRUA 3JRIA 3HPWA 1SF9A 3BR6A 4G6DA 1PU8A 1IXDA 3NEUA 1ETKA 2DT6A 1JKQC 2UU9K 4XH5A 1WSGA 3W3CA 3F2KA 3REBB 2DJQA 1X01A 4AHTA 2GIVA 4IG0A 3M9QA 1R58A 4CI6A 2O8EA 3VQ6A 3AG4H 5J1YA 3HO1A 2MC3A 2XF7A 4LK1F 2GBYA 3GPLA 4UB8C 2FUG2 3OIQA 4BR2A 2OTJQ 1LUJB 3SQ0A 2ELJA 5FWBA 1XWLA 1KJWA 1X4PA 5AR0A 5EEGA 3F9KA 3EG3A 4M3EA 2HBKA 2ME6A 1U5SA 3DRRA 2DBKA 1X9SA 5LGUA 4J19A 2F4MB 1AOYA 3CXCA 1LMZA 5ADXH 4I01A 3AAFA 2BUPA 1HLUA 1YJWT 5CQGA 4P96A 3V81A 4ESJA 1QNTA 2GWRA 2CSQA 4LG0B 3O9TA 4OLAA 4GV3A 1ZRCA 4AC0A 4HNVA 2E2PA 4HRIA 1FMVA 2PLYA 4O44A 1QQIA 4J01A 1HNXK 3O9UA 2QEXI 2E6LA 1HPMA 2E10A 1U84A 5AQYA 2J5OA 1C0WA 4R56A 4BDYA 3CJ9A 4DQ2A 1ACIA 2IRFG 3VENA 3IAYA 1R22A 4ENNA 3NH1A 4UUSA 3I0SA 4F7UF 1KTQA 3U6FA 1K6YA 4CJUA 4Q5SF 1QVGA 1GVJA 1ZGJA 1FN7A 4CJSA 2WA0A 1SD4A 4CJKA 2NRAC 1P7IA 3PFYA 3OH9A 2V1XA 2OTLI 1PDNC 1WIEA 1T95A 1FX7A 1MMDA 2A1SA 3K10A 3CO6C 1M1GA 5EF6A 4FYDA 4KHQA 4PFOA 3NAUA 3U1DA 2VBXA 3FXRA 1NK3P 2IVMA 4KT6A 5E79C 3L2RA 2Z1JA 1Q9YA 5FB2A 4W5RA 1VQNI 1N75A 2CYZB 2KDOA 1RUWA 2PFBA 1NJZA 2A36A 4M7DG 3CM6A 4KHPK 4A6DA 2CSOA 1OX8A 2VKNA 3H92A 1S1XA 5GADP 4KITB 3ZGKA 3CC7A 4LG0A 1ITGA 4UY8O 2KZVA 3G71A 2YUPA 3FM5A 4XKCA 4JRQA 3CD6A 4DYQA 3CFRA 4M3TA 1KQSA 3E1SA 2DYBA 4B3XA 3ZCOA 3P9KA 2EZLA 2VIXA 4KREA 2QG9B 1YOVB 2RHUA 2AO9A 3FWEA 1FTZA 4B1RA 2ZFUA 5I11A 3FMSA 3CCRA 4FJ5A 1NJIR 3ZSXA 5ADXA 1NH3A 1VSEA 4PY5A 1Z9ZA 2GUPA 4MMLA 4CEBA 3KLGA 1YLFA 3WODF 3EEQA 3N4MA 2IPOB 1K73C 5GANd 3GOXA 3JYTA 2K3BA 3I55N 2RQTA 5AQSA 1VQ7I 4CJ5A 2F7TA 3I59B 4HSRA 1X3UA 1XGNA 2CUBA 3RMCA 2ZD1A 4IKFA 4ID1A 1BISA 2ZSIB 2D8HA 2K9SA 3CWAA 1ZA1B 1M3BA 3LSRA 2IJLA 2HHXA 4HCBA 4B1WB 2Y31A 2LCLA 3AVFA 4B1XB 1IZ6A 1VQLQ 1F43A 2ISZA 3CZ6A 1AD5A 2VWBA 2D0OA 1OZ3A 3PGGA 2HL3A 1S29A 2G8VA 1M9SA 4DA4A 3I8BA 1BQMA 5M1QA 2QF7A 4NB4A 2ZNZA 1VYTA 1KU7A 5CVUA 4EGZA 2ECBA 1UELB 4F14A 2ITMA 4M7AB 1UECA 5C15A 3BPVA 2W84A 3X25B 3I3LA 3BQZA 3ITHA 3DTIA 4X62K 1RI0A 1YI2A 4KI6A 4CC3A 3E6DA 2HZYA 2E1CA 4HG2A 2B7EA 5HK3A 2JMCA 4A3LJ 3O3GA 1XSXA 1ZLKA 3NBPA 3ZQFA 3QEPA 4BRCA 1RNHA 5GMKe 3ASMA 3K58A 4M7DD 1JL2A 5EXWA 4DB3A 3KWGA 2XAUA 2F9WA 2P9SA 4LDWA 1MNEA 2YG8A 3BEXA 3JB9F 2NRTA 4ON0A 1WBDA 4A53A 3H08A 2YX7A 3F6OA 1CGPA 2DIQA 1H641 4N41A 1LNXA 1K9MU 3KPHA 3RBBB 2MSYA 3I59A 4N0AA 4LG3A 4MMKA 2X78A 3CFOA 4A6EA 2ID6A 1YJWQ 1RTIA 1ZBHA 1MKMA 1ZRDA 4JI3K 1KHIA 4E7HA 4WQ5A 3N4QA 3I53A 1VQ9T 1UHSA 3DI6A 4DUYK 3SBTA 2BUDA 2EIMH 1GL5A 4AVPA 4B6MA 3GF5A 1ONVA 5EYRA 3KLNA 2HFHA 2QKBA 2EBIA 3CQTA 2DK5A 5E26A 2WSFE 4ZZLA 1BW5A 2NRZA 2XRLA 1HJDA 2HMPA 4BQAA 2QVOA 2IGKA 1VQ9A 5GIOA 3F21A 2LOOA 5DS9A 2OPQA 3PO4A 1WVRA 1JJ2S 4WWCA 3MD2A 1S7EA 1OYIA 2NOEA 2VQHA 3TDZC 1JI8A 2XC7A 4F17A 3SV3A 3BF3A 1VQ4A 3PE0A 4OIRF 2EILH 1O75A 3KK2A 2GWKA 4DSFA 1K8AC 4CJPA 1B59A 3C6AA 2X4HA 4X65K 2EQJA 5I21A 3CCVT 2X6SA 4U88A 3D45A 4M45A 2DL4A 3HEFA 3U9DA 2JPSA 2ESNA 5CVJA 4N4HA 3KNTA 4BEHA 1DKGD 4AHCA 3KCCA 3M0RA 5E84A 3PQJA 2JS2A 2H3EB 2M16A 1QVFA 2RK2A 1TV6A 4FJMA 3A4CA 5CKTA 1KC8C 1S1NA 1F1BB 2L8DA 1GV2A 3KLHA 1JKOC 2YSRA 2CGHA 3CQYA 3M4GA 2PVGB 3TCJA 1Y1VJ 3P9CA 2Z1HA 3HDDA 5AQKA 1BCOA 3LP3A 3M1FA 2L3PA 4B47A 2JXBA 2R58A 3HTSB 1SRMA 3C6UA 2X6OA 5FRMA 1HC8A 3K2PA 4FJGA 4PJOG 3LQQA 1JTXA 4HAMA 2COWA 2DFEA 4J9GA 2RJFA 1HSQA 5FKMA 1JLAA 2W41A 3CESA 2FF6A 1QWEA 4M75B 2C6YA 4PJNA 4CFBA 1RAIB 3GW2A 4M78E 3ZX2A 3UR3C 1T0FA 5D6EA 5EGOB 2MWOA 3EG9B 3UWNA 1MZBA 1R5HA 3SYTA 3HZJA 5KRSA 2Y0SN 2QGUA 1BWFO 2GWJA 1TWGJ 2RJDA 3PL8A 4BR9A 1N25A 3D2FB 3WQUA 3VQCA 2F2EA 3SEZA 1VQON 1O3SA 1MJ9A 5FKOA 2RQRA 4CBXA 2KLOA 1ZARA 1Q1VA 1VQKN 2YRDA 4X0GA 2MW8A 3MP6A 3LYIA 3PUBA 1QHTA 2FOKA 4YOWA 1O57A 3AVJA 3BR5A 2E1YA 5LRRA 1YHQI 2JN0A 1U8BA 2FU4A 1S3XA 1YJNT 4CGZA 4CGHA 3A01B 4HV5A 4M63C 4X1EA 4BHPA 3C18A 3BG7A 3HPOA 4FJXA 3TANA 4HWIA 1EX4A 2GZWA 4TVRA 2KMTA 2XKOA 1AZGB 3EE9A 1KQ9A 3G4SI 4ILGB 2BZYA 3HL8A 4QVCA 2QA4I 1USSA 4ZYDA 5AQMA 3IWFA 2IAJA 1I39A 3KKRA 2D0AA 4JI2K 4C9YA 1D3BB 1JXMA 4FLXA 1X6GA 1WQ7A 5GAOq 2VN2A 1S1UA 4EM0B 3Q0UA 4YELA 3E9FA 3RKYA 1KC8O 4G9YA 5LL6S 2EAYA 2CWEA 5JVTA 3H45C 4IF4A 3VSKA 1UAXA 2QGFB 4KHNA 1JL1A 1WSFA 1U4BA 5E3MA 2DPUA 3A8OB 1YTYA 4C92C 4J00A 3LLRA 1BR2A 4E4HA 2XDPA 2ELKA 3LGFA 1NPPA 2Z5UA 4PJ0C 3EG9A 1VUBA 4F04B 2DETA 3TL4X 3PIPF 3I56N 1O3TA 2DTHA 3BT9A 4PJOD 1GFCA 2I5JA 4CCHA 3RI4A 4OPJA 5FROA 3VERA 4R55A 3JAMZ 1OYXA 2J05A 4Z89A 1C0UA 5M1NA 5F1JA 3SUNA 4EIAA 2JUCA 1X4OA 1UOCA 5HROA 3DB3A 2A5YB 1RLQC 3SDGA 1LCKA 1U48A 1YTAA 1YIJI 3RYPA 4V2FA 3IKTA 1VQ9Q 2P5GA 2WSEE 1NGIA 4BS9A 3BJ6A 3D0SA 3VODA 1VFCA 4BXFA 2NOIA 2YS9A 5LJ3d 1K4US 3DKYA 2V8JA 3T8RA 5A0LA 3JAME 3KLOA 4DV7K 4K0KK 1A04A 2WAQA 4DQPA 3EG0A 1XTAA 3CDLA 4KBOA 4BRHA 3ATVA 1MH3A 2LFBA 1POGA 4C23A 2WTEA 2MPXC 1WDXA 4A12A 5T7BA 2ABKA 3QJYA 5FLVA 5HCKA 3C12A 2CW8A 3GYHX 4G6QA 2C0IA 3OSVA 3R3LA 4MZMA 1WQ2A 5DEQA 1WNSA 4XIDA 1USTA 2DTIA 3H9QA 3CCVQ 3M5RA 2E65A 4HLYA 1SSFA 1OU9A 3M0UA 1KLMA 2W03A 3L9FA 2WADA 5AFUA 4ENKA 2XDVA 1VQ5N 1RLPC 3S2WA 4LUEA 3LWHA 1ZX6A 4OIPF 4H4OA 5M1FA 2YLBA 5D7UA 3DF8A 4RW6A 1TGOA 4OGEA 5L3EA 3VQQA 1WHHA 4FJLA 4XKWA 3OW2M 1XGSA 4XRSA 5LL6Z 1BQNA 2MLKA 2QQBA 3CVSA 3THYB 5KCMA 3LDPA 3HKZA 4OGCA 3QWLA 3MEVA 5GAMh 1QS4A 2WAFA 5F27A 4WFBL 1H3HA 4O5FA 1RFQA 1BN5A 3MMYB 3LSTA 1RCHA 4CF2A 4CEAA 1ASWA 2LREA 2UUCK 2ZXJA 3VJPA 3VYSB 5GANh 3S17J 4FJJA 3JS6A 1HKQA 5IXBA 1X75C 5GAN8 3X24B 4C0GA 2ETJA 4YORA 5CIUA 1OMIA 1EQYA 3HBLA 4XH4A 4O0JA 1VQLN 1ZBFA 3JCMX 5J2NA 3D5LA 2RNAA 5CKEA 1NYGA 2ABLA 2IGMA 2G8WA 2OAWA 1ETVA 3PIOF 1KLNA 1Z67A 1A5VA 1RILA 4CO8A 4B43A 2DERA 4LSLA 3OYGA 4H0PA 4B44A 5KN8A 3JSMA 4A0YA 3ZSYA 2LSOA 5H20A 1VQ6I 3TP0A 4D5FA 4AYBN 4NCGA 2YG9A 3HXLA 2RDPA 1I81A 3AVKA 1DU0A 2RD1A 3BY7A 4HNTA 4C8QA 4DWIA 3TVTA 3Q3SA 3M8JA 5KPTA 1IO2A 2COZA 1NWKA 2IS4A 1YJNQ 2WTUA 1OYYA 4RAYA 1WLJA 4ZGJB 3VS6A 3CLQA 4UVCA 4FETA 1TVRA 4HT9A 4J8OA 1GLFO 1WHMA 3DM2A 2VV5A 3O5BA 2LQ8A 2DXCA 3KTQA 1OYWA 1LQ1A 3GTPJ 4A4FA 1MUDA 1ZAOA 4XIUA 3L09A 2DL3A 3HYFA 4KI4A 4RLFA 3QFPA 4J2BA 3GIBA 3THYA 4S0HB 2HVHA 1XOVA 2KHOA 3LFUA 1H8KA 4UOBA 2QWOA 1UGVA 4CJQA 2RHYA 5CYVA 2AKKA 2L7FP 5D5XB 3CCYA 4CFCA 1JGGA 3CC4I 1G83A 4C1NI 2XDBA 2NOFA 3TAEA 1UG2A 2GNCA 2JJ7A 3CMEA 1X2NA 5K7FA 3E9LA 4U7DA 1IBMK 3G6EQ 2KL4A 1C6VX 5GAMf 4CDGA 5J40A 5HVQC 2NNYA 4FLZA 5B5EC 2Z9OA 3FHZA 1AWWA 5FLXE 4BR7A 1RRQA 4DSKA 2QI2A 3TI0A 4DV1K 2O7OA 5GANf 5FD5A 5C2DA 3TAQA 2VG6A 3VB2A 1W2BM 4FWMA 2VC1A 1AVZC 2YHYA 4PJMA 1H92A 1YITT 5FO5A 4DR3K 4BWMA 4DCHA 1M5Q1 1RBVA 3C4SA 3MCPA 3E2UA 2V9KA 4FXDA 4HNUA 4A5MA 2YNGA 3QQAA 5J2PA 1VQPA 5D5VB 5EVZA 4CIGA 2RE2A 1PUEE 3QIPA 3HOSA 2PMUA 3W2AA 5LMNK 2L4MA 5ILVA 4F3QA 1RI7A 1U5TB 1TSFA 1IRZA 4OF1A 4CZLA 1L3SA 5FPMA 2IGNA 4N5SA 4PA1A 2HZTA 4XLNF 2K9LA 4AI4A 1T7PA 1W9HA 1SD6A 2O9LA 3CWSA 4HZFA 3BPXA 2KT1A 1OCTC 1IN8A 3OV8A 4H0OA 4IRHA 4FYYB 2BDPA 3RSEB 5BPLA 1HYVA 5GTIC 3P8HA 4XTUA 1ORNA 1YAGA 2E2OA 1VQMN 2XHBA 5AONA 2DFUA 4LF4K 2JQ7A 1OV3A 3AG1H 5GINA 2GQVA 4IO9F 4UC4A 3M57A 2UXBK 2O01E 1LWCA 2DZ9A 4FM4B 3KWIA 1TL1A 3QP6A 3DV8A 2K4YA 4N0AC 3E97A 1S9GA 1L5UA 5EJCA 1X3NA 4QWQA 1YVUA 2CGPA 4NC8A 2IGIA 4WQ5C 3I4MJ 4EP5A 3WEEB 5BOXA 4Y7NJ 4D7NA 1VSJA 4AFSC 2WY8Q 4DNCA 3R6NA 3KYDB 3TP3A 2DZCA 3IHOA 2ZPHB 3K4LA 4NC7A 1YS6A 1FKOA 4M78D 4BC5A 4TV7A 4JV5K 3DKWA 1NK4A 4JKDA 4CF0A 1HQCA 4HXJA 4NL2A 2KQ2A 2JPBA 2JZ2A 1WXUA 4IEJA 1JLFA 1T39A 4KYWA 2Z99A 5IHNA 1E4GT 1JHHA 4A61A 1U5TA 2ELHA 3T1HK 1NJWA 3H0DA 3A5LC 4QOZB 3VOEA 4RTYA 3EFSA 4M77E 2KXCA 2DW4A 1K61A 2KKZA 2BTFA 2YRVA 2AQEA 2CH4W 2P9IB 4OINF 3DTKA 4IUUA 3FZVA 3IUOA 3ZLJA 2QBYB 1SMTA 5TJJA 1R0AA 1NKUA 1EH8A 3KYCB 1IKWA 5D4RA 1WSHA 3BJOA 2WB1N 1HW5A 2EIJH 4HKEA 5FU6B 4HVWA 1Y57A 1WJ5A 1J0RA 2P4TA 3TAPA 4KIFA 4CYDA 4EHTA 5BPMA 4HCKA 1LAWA 4FE7A 2X48A 4CCNA 3MAQA 3BG9A 4CA0A 1RI9A 2X4XA 2P5OA 4M6XA 5CE3A 5EC7A 5FKNA 2VKDA 1VHXA 1ILYA 5IP6A 3CJAA 3H36A 3OYCA 2CUZA 3DKXA 1ON1A 3WEEA 4DR1K 1B9DA 2IGOA 2FBTA 1G99A 3S6WA 3I71A 1MSFC 3CLOA 1YS7A 3H3VK 2GFAA 3CMAI 3Q5FA 4DOWA 4DOZA 4NXNK 3ERED 3MWPA 5FPNA 2BOLA 2YUOA 2STTA 3CO7C 3M8PA 4KH4A 3CF5L 2E71A 4XAXB 4F91B 2LDUA 2CDTA 4BI3A 2M0MA 4HDVA 1ZQ3P 4UQGA 1OPKA 3WXKA 1JRIA 4ZHRA 3E5XA 4BGDA 2FSNA 4FW1A 1U9OA 2OTJI 3CCST 1SHGA 1LVKA 4AG2C 2ECZA 4B9WA 4FU6A 1EETA 3GE1A 4CGFA 3EYYA 4HYEA 2KRHA 4ZNXA 4BB7A 1E3HA 4I2PA 2P9IA 5LJWA 2AZSA 4C92G 2H56A 1HKCA 3AVBA 5E17F 3OMGA 2QBYA 3O8GA 2M30A 4JEPA 2FVUA 4K42A 5LJ3h 1K8AU 2XKOC 4FPAA 2XROA 3L2QA 5AQRA 1YITQ 4DTJA 5J39A 3SI6A 2CUDA 3M1EA 1XJWB 4GY2B 1T8IA 2NRWA 4BJ5C 3JTGA 5HODA 4Q5VA 3DLRA 4DTOA 4N4NB 5CKFA 3HM9A 1EA3A 1O13A 4F7ZA 4OPHA 4PL6A 4FO0A 1RAHB 4I7FA 1KC8U 3CCVN 4GVEA 4FTHA 5C42A 2GA2A 2D1KA 3OW2A 4AILC 4F55A 3ZQ7A 3EUAA 2V9VA 3NF8A 4DYCA 3M0TA 3R6SA 3JSCA 3CBMA 3Q1JA 1TL8A 1DT9A 2VWJA 4M7AE 3V1RA 3J81Z 4J7FA 3QWXX 3FDRA 3V8JA 2R7UA 3IRQA 1OCPA 4LD9K 5LHHA 4EP4A 2YHBA 1YN8A 1ESVA 1ZGWA 3R60A 4IURA 3GLLA 2AS5F 5TRDA 2D0BA 4BGBA 3OL4A 3K1MA 2ISYA 4Z2YA 1EBMA 4G7OF 3OTOK 4K25A 5A0GA 3L4QA 4LF5K 1FWZA 1IJJA 4B1VA 3WT0A 4BC4A 2VKEA 2DL8A 5LEKA 3JREA 3O6BB 1T2KA 3SJHA 3AGRA 1R77A 4HTLA 1LDDA 1IN6A 3TW7A 3D0PA 1Q86C 2YKNA 1G5VA 2B6AA 3ASKA 1IJWC 5KYNA 3RQ4A 4E7IA 5J47A 4KICA 2O6GE 1E3OC 1XNIA 3KP7A 4M3XA 1RAAB 1NGHA 2K2VA 3KHYA 5LJ3f 5LBQA 3MPUB 4A3MJ 5GAN5 4RLQA 4C92D 2EA4A 4Y4RA 3QB0A 2M9UA 4I6MA 3DJCA 4IQ4A 2GFUA 2JJ9A 4L18B 2HI3A 4KMUX 1H1VA 5AIQA 1YJNN 4B08A 2L2PA 3O1BA 3EG2A 1Q7YC 4DTUA 3M3ZA 4BXUA 4ZYAA 2XRIA 3CBOA 3CC2N 4DTPA 2JA8J 5I42A 2COMA 1UJ0A 3L0QA 1A5JA 4BY9C 2JWKA 1D4XA 2Y69H 2A42A 4CGGA 3AY9A 4WFAL 2WWYA 1NK2P 4YFKF 1UTIA 1OH7A 2LCSA 1UB4A 3RNJA 5FGMA 1ZBIA 2P0KA 2JA7J 5C25A 1KG3A 5I2SA 5GMKj 2VONA 2JMWA 4QS8A 2NZTA 1VF9A 4IEEA 4B3SK 4CJTA 1GLLO 1X2MA 2KRMA 1V5EA 5C0MA 4FJIA 1EWQA 3G6EN 2DL7A 1LOTB 2LJ0A 4QVDA 4AIHA 4ME7A 1TXQA 1MMNA 1MUNA 1DTQA 3LMMA 2RHXA 5J26A 1TUYA 4JI0K 1IB8A 4YPRA 2D0QB 4LN2A 4MO7A 1HCRA 1GUUA 1KA8A 1LE8A 1B92A 4GYGA 1GFDA 3QDFA 4J9DA 2G8KA 3MECA 1V4SA 4CCOA 3SBGA 5L23A 3VEOA 2CW0F 4A3DJ 3ZN0A 5FW9A 1P8ZA 1FC3A 4FZZA 2YKMA 1AOJA 4AHSA 3KLEA 1IG9A 3VQ9A 4E1JA 1IH7A 3JCMW 1RTJA 4Z94A 5GAEP 2XIDA 4J9IA 3L4IA 1SAZA 3PNTA 2QYOA 4KFCA 2HHQA 2K9GA 2V9PA 4GMJB 4KH5A 4DTSA 3OSFA 4AFUC 3CCSQ 2DAQA 4RBOA 2JT4A 5KYYB 1X58A 1I4K1 4C8QC 5KGXA 3U3GA 4QSHA 3NNQA 4FWLA 2COBA 2RM4A 4FT4A 2DBMA 2DQRA 3ZETB 1N78A 4HUGA 2LY9A 4XN0A 4IHVA 2M45A 3CCUA 2CZ6B 4DEYA 3PSIA 1YJWI 1R71A 4FM1A 2F8TA 5L3BA 4XKBA 2DY4A 1IC8A 3AO2A 1BL0A 2LH9A 3BY5A 3ZBDA 2F5EA 3CCQT 4OVLA 2QQ8A 1ZK8A 5CPRB 2P0WA 3BGRA 4I0AA 4JD2B 4KIBA 1ZBXA 2HSEB 3F0ZA 2ZC2A 3VPRA 5C10A 4CBWA 2PI0A 2EBPA 1H9GA 1NGJA 4Y33A 1JQQA 1IUYA 5BS6A 1G2BA 3MEGA 1M1FA 2R5ZA 4GKJK 2V1QA 3LDOA 2PVDB 2OFKA 3ZN1A 5M1PA 2OPSA 2HDAA 2Y48A 1HYOA 2XPUA 1NJIO 3FZKA 1DPUA 4IBNA 3SWNA 4X66K 4UVBA 3DEUA 1UCRA 4LIUA 3A5NC 3MCZA 1GLJO 1R0CB 4XQFA 1RL2A 2CH5A 3SPYA 1FZPB 3JCMQ 2DMPA 1SSHA 3NVMA 3AO5A 3CCEA 4CHZA 1ZBLA 2DJIA 3SAFA 4OPKA 3V7RA 3S9HA 4YPHA 4HA8A 3BUZB 2VUBA 1YE9A 1Z9QA 4I02A 2DEUA 2YI1A 1SZ2A 4AIAA 2YJEA 2ESWA 2ROTA 1VSHA 1NG2A 4M7XA 3K5OA 2RQQA 2NS0A 5J1UA 3CC7I 3QRFF 3GVAA 3PV8A 1D1BA 2WBMA 1IHWA 3G71I 5KYYA 2RHKA 3DWLE 1M3CA 2X35A 2FE3A 3CD6I 3BTJA 3I5SA 3NMUA 3M54A 4DW6A 2NOZA 3M5AA 4LXCA 4O0IA 2LC2A 3ZETA 4J9BA 1GLBG 2Y1IA 4J83A 2Q3SA 3FXJA 2A61A 2IW5A 2BANA 2HVQA 3J80Z 1UGPB 1BB9A 3CCRI 1X9JA 2WV0A 3CETA 4BWJA 4E6RA 3MZHA 2BXYA 4ENJA 2DIGA 4KIGA 5DMRA 2N8GA 4JD2A 1K73R 2DN0A 1P6RA 1Z6RA 3DLBA 2LD5A 2IS3A 2HKQB 2NNNA 4GV9A 3HK2A 1S72T 2HDWA 4F7UE 3SV4A 5BPIA 3J80E 4CC4B 5LD2C 1KIKA 4KN7X 2NVYJ 2K5LA 1YJ9T 4R8HA 2JA5J 1KSWA 4BDPA 3NGYA 2ZQBA 4EJTA 2V7ZA 3FC3A 4NDLA 3HOXJ 1YQAA 5HRPA 5DM7L 2GM4A 1STZA 4BC3A 2L02A 2BY1A 3VYRB 3DLHA 2OCCH 3HSRA 5EY4A 4JRPA 4ATOA 2MH2A 4GGGA 2IIRA 2HPMA 5AQLA 3QPTA 4J9FA 5D5UB 2D1XA 2TDXA 3KP3A 1JKRC 3VSLA 2Q97A 3PO2J 3VTIA 1EO1A 1PNJA 2W4SA 5C12A 4RAFA 1ORPA 1H88C 1I8FA 1NLVA 1I3AA 1N8RC 3NTIA 1WWXA 2Z2SB 1HUXA 3JV3A 2CZ0B 1R1VA 1B34B 3Q0WA 1N5YA 2YNHA 3QYGB 1HNZK 5A2QO 1GOAA 4E7LA 4B1UB 1X6OA 3FK7A 1YI2I 5KGWA 2E4LA 3QO3A 2IXSA 2OQGA 1YWOA 1N77A 2ZPFB 1BYMA 1U5TC 4E3SA 2VL8A 2J6OA 2AXTC 2VLAA 1Z3YA 2M4KA 1C0GA 1YCYA 1VAZA 1OR7A 2DCEA 5HP1A 4FVMA 3E6BA 1U45A 3GBQA 1XG1A 2YNFA 2JPCA 5D6XA 1Z9CA 3CUQB 1YITN 3ELKA 3K9KA 4J8FA 3HOZJ 2MH9A 5K7HA 3EGDB 4JOMA 4N9HA 4D8KA 2CJJA 2DO7A 3AA4A 2PBIA 3S1QJ 4DSJA 3C2BA 4II3A 3OL3A 1WH5A 4CBUA 4EM2A 3IRXA 4DR7K 3L3VA 4XL9A 3IKVA 3E0JB 3FJPA 1D5VA 3E3VA 4PJLA 3AVMA 4ELUA 3EPZA 4AIJA 3MEWA 1G3YA 2DRKA 5IY5H 4M3FA 5HNFA 1KQ1A 1QTMA 2JTEA 2F5CA 5LJVA 2HPIA 2ATQA 1ULYA 3JRZA 2CQNA 1QZZA 3E7LA 5IHKA 4QS9A 2VUMJ 2DA4A 4K43A 4A2AA 1JLEA 3QEIA 3INZA 3CDHA 4Y52J 3SEQA 2R7ZJ 2EH3A 2P0QA 4EPCA 4EZ9A 1KAXA 3DP7A 3O8VA 4DQ8A 5GMKi 4II1A 2R92J 1REPC 3QNNA 2F6CA 2CKKA 1VQ9I 3HB9A 3CCQQ 4F2RA 4JX5A 1BA0A 1WI9A 4EA4A 2QZ8A 1AWCA 5KPRA 4M7AD 4KH1B 2ZCFB 2XASA 1HSTA 1OVQA 2QK9A 3VYGA 3ERMA 3DB4A 1YG2A 1VQ4I 2QGGA 3K2AA 2EFPA 4XLFA 2O4XB 3PUFA 1JJ2M 1ZR4A 4LJZF 1HJRA 5I22A 1B1BA 1DIZA 1K8AR 3JAMK 3M59A 1K6OA 2R93J 2FRYA 2E5LK 2E1ZA 4N4OB 2W85A 2E70A 4KAZA 3GOIA 3GZ5A 1VIFA 5AT1B 2NRHA 3I0XA 2O4IA 1RAGB 4H5RA 1S9HA 2EW3A 3JRFA 2GTOA 2YPRA 3T7ZA 1SAUA 1Q8IA 5L3CA 3F8BA 2QDYB 3CPWS 5M5YJ 3QU3A 3QEVA 4EQQA 3CCMT 1NMNA 2WOMA 3IAS2 4CEEA 2CUFA 5FU6C 2TCTA 3J8AA 4M7DF 3ESWB 2MFZA 2RF0A 1QVGP 2KFNA 2BZXA 5FDLA 1T33A 2E35A 1QKWA 3B8AX 4LDUA 1I1SA 4YFXF 5GJWB 4KISA 1B9FA 2PX9A 3BE3A 2RHIA 1FJGK 1QCNA 3G10A 3ZQCA 2OI3A 2KI7A 3A98A 1RT6A 4JS4A 4ZN1A 2XKPA 3JCMh 3T9NA 4GFBA 5LHGA 2EGEA 3FRNA 3AVLA 3C65A 4XLAA 3HP9A 4CEZA 2J5PA 5JS1A 4EIKA 2MD5A 2EFNA 3CJBA 1IN4A 3HJFA 4WQ4A 1QPIA 1ZG1A 2PTKA 4EAHD 4AHUA 3DBHB 2XMFA 2XSJC 5EG0B 1S72Q 3ZRGA 2O4XA 1IUFA 5DPKA 2B8AA 1BDGA 1YJ9Q 5FRNA 3ECHA 3KKSA 1ETOA 1QHGA 3DLMA 3IG1A 3V9WA 1IGNA 4WK8F 1OKJA 1N9RA 2NOBA 1KQSP 1KU3A 4NXMK 1L3TA 1WHUA 2XD0A 3K70C 3CCLT 3TGNA 3LP2A 4DFKA 3NGPA 3GUDA 3IL2A 3CCJT 4YOTA 1B6AA 4PKGA 4FJ7A 2X6NA 4B3MK 2P9UB 4R1HA 4ESRA 4IOAL 3QYFA 1TWFJ 2A5XA 4WCIA 4LB5A 3MFKA 1IG7A 5GAN3 4HF1A 3RRHA 1QQJA 1MV0B 2FZGB 2SRCA 2O88A 3TO6A 4C8MA 3QYBA 1Y8QB 3SJJA 1NGBA 3CI5A 3M0SA 4XRSG 3KZZA 5E3NA 5DD4A 1NGNA 3CQXA 2EQMA 5AQQA 1PC0A 1QLYA 4ID5A 1E0EA 4M75D 2KT0A 3HHTB 1YVNA 3LWLA 5K14A 5JFRA 4X64K 1B9NA 4BY6B 1WUAA 3ML6A 3PJRA 4FK0A 2NVQJ 3T1BA 2Y4XA 4JI1K 3CCSN 4YOQA 4RCBA 4NLBA 2HD0A 1CZBA 1WAFA 1NPRA 1Q82R 5IYCJ 3NDKA 3V4GA 4FX0A 5GAEJ 5KNLA 2UUZA 1BR4A 4MDXA 2P9PB 2DTZA 1FJLA 1U6GA 3PX4A 3RMBA 1RNLA 1TUDA 2ZMEB 3I55A 2VI6A 3TO9A 3M8RA 3VQ7A 3JCMf 2DMNA 3LM2A 5IOYA 4GY5A 4GNIA 3VQPA 4OMQA 1MSEC 1QZ6A 5EG0A 2LK2A 5ECAA 4BROA 1RUNA 1AWOA 4X34A 4MLOA 1EJ9A 2DYRH 1MBHA 1QCOA 3W2VA 5IOZA 4LITA 4RB0A 4NQWB 5E1WA 2MCNA 2QSGX 3UE5A 3I58A 3K5LA 1RKTA 3KP6A 5GAN6 5DM7R 5KPZA 3TOAA 3HPHA 2HSTA 3F6VA 4BQNA 1KFZA 3GFLA 4C8QG 2YXYA 5LJ5d 5LY3A 4LH5A 3QZ9B 4IJAA 3QXEB 3QHSA 2P9UA 3DQVC 3ZX3A 3JW4A 3U21A 1P2FA 3P38A 1ODDA 1G2HA 3AVNA 1TTYA 2W7NA 4DHYA 1K76A 3HVRA 3RPQA 1B8IB 3GTOJ 1GRIA 4OMFB 2X85A 2H8RA 5M9OA 1VRTA 4FPBA 3GWZA 4PIIA 2R57A 4OOIA 1JT0A 3I0RA 3SQ2A 2K3PA 3HJEA 3KFWX 1X19A 1FLIA 5IN1A 3GZ6A 2VODA 3WTVC 2FNAA 3FISA 3AAQA 3ULEB 5GAOr 1TT0A 1DP7P 3NPFA 2HYGD 2BIVA 4B24A 5AYFA 2DYSH 3ZSWA 3SEMA 2XG8D 2Y1JA 2P9PA 3COAC 2X4YA 1CXQA 2K27A 2ZMEA 3DMJA 4Z4CA 1F9NA 2GOXB 4W5NA 3I4NJ 3HXMA 1ITYA 3E5QA 4CICA 3CXCM 3CCMQ 4XICA 1AZEA 1Y64A 3T1AA 1MJBA 2EJGA 4A4GA 3CW7A 3TSUA 4F92B 1Q7YU 2O03A 2JNGA 2LQWA 2QSFX 4NQWA 4PJOF 1LNWA 3BP8A 2JS0A 3EKUA 2XVCA 1VIEA 4ZYGA 5GAMg 2E6NA 4H5WA 2ZNYA 3BROA 1S5JA 4LFCK 2KW4A 3D6RA 4DV2K 4CHPA 1QVFP 1OISA 1VA7A 1NJIU 2M8EA 5GANg 4CGJA 4CZKA 2BVLA 5CAIA 3BCAA 4LY7A 1TQIA 1R9TJ 3OY9A 3SWNC 3H46O 1YUWA 4Q5WA 1Y39A 3MKZA 4J7IA 4D9JA 1UFFA 4H5NA 3I5UA 1BHLA 2CQQA 3HI0A 3WU1B 1V76A 1JTYA 3K59A 3MDQA 3M8SA 5AZIA 1QVGM 2Z33A 2A1RA 2K5CA 1O4XA 1NM1A 2L7MP 4QQ6A 1LVAA 1M90R 1K78A 4M78A 1ZREA 4IZ9A 4Y3OA 2LMDA 2VJ5A 3CERA 3CCLQ 5M1KA 5HLGA 4PKCC 1U3OA 3ULEA 2RNGA 4M72A 1QSYA 3E9PA 3JRAA 2XF5A 2LP5A 4DSIA 3CCJQ 4KGZB 4A3FJ 4M74A 5DUKA 4D1QA 1VOMA 3PSFA 3EZ5A 3AGKA 2JN6A 2AXLA 2NLXA 1VQ8T 5IAYA 4QT7A 3K4CA 2R4GA 2M2EA 2R5YA 1SKRA 1XC9A 4BG9A 3UKRB 4RW7A 2QEXT 5GMKh 1JLCA 2E5QA 1VRLA 1ZYRF 3ZT0A 5ED4A 3JB9J 1ORKA 2VQFK 2KJCA 2IEKA 4PGGA 3VRYA 2NUTB 2BKDN 4M7YA 4CJFA 2E8AA 4L5EA 1MH4A 3WNEA 1KXPA 5F0CA 5E3LA 2A5WA 1PVEA 3CMEI 4X6AJ 1ZLJA 1VQOT 4LLGF 1F1ZA 1MV3A 4EM1A 3AG3H 4IOCF 2ZPBB 3NGZA 2JG6A 1M1KR 1M2VA 4CZZA 4DBRA 1UA1A 4J6WA 2HTSA 2QM3A 5KTQA 5HNHA 5HS8A 4BQLA 2HR3A 2OC6A 2Y0SA 3S93A 3MX5A 1Q9XA 2QTDA 2HMIA 5AN4A 3G1JA 2OTLT 1JJ2A 1ZHIA 4XKVA 1T08B 1VQOA 4EEFG 1OPLA 3CCQN 3AARA 2IA1A 3MVPA 4L9JA 3T8TA 4OJRA 4LF7K 2PJRA 1VQKA 4MIMA 2WSCE 3H0GJ 1IW7F 1VQNT 1VQPI 5BRHA 2OUMA 4IG3A 3SD4A 4FWSA 4EATA 3GFMA 2EZIA 3NVKA 3OYIA 2BH1A 1ZN2A 3EFOB 1NEGA 5E1ZB 4A57A 3C0BA 3TO7A 1TQMA 4C3HJ 1MBGA 4EMSA 4RTVA 1G3SA 3HZ6A 1OFCX 1HW2A 4B3TK 3SK3A 3QLHA 3MKWB 5J8FA 2EVRA 3X20B 3EY1A 2XY8A 4RM2A 4OIOF 2OTJA 1BL3A 4OMOA 1FYNA 2HF3A 4NHJA 5EDNA 3LAKA 1QO0D 1W4MA 1OR7C 1ZBJA 1T0JA 4GVMA 2OBPA 4BBSJ 3UKRA 4ICLA 2D4WA 3L1PA 3VQ4A 3OWTA 3O4NA 5CVRA 3I56T 3DFGA 2NUTA 2LT1A 2P6SA 4HV6A 4XSXF 2ZGYA 2Z1DA 3KP4A 1VQ7T 3O4QA 1KD1C 4EA5A 1APLC 1QPMA 2LKPA 3LL7A 3IKMA 3AO3A 1NBWA 1XC3A 1KFDA 3THXA 1YFHA 1OLTA 3OYEA 1ETQA 5AJ3K 4CW7B 2LBFA 3HRGA 2DOAA 3EQLF 1QZ5A 1LPQA 2AIRB 3HHGA 4L5GA 5GANe 4YDUA 1FKPA 1LJ9A 4AIKA 3PVQA 4JJCA 2JHNA 1FYMA 1QVUA 1TUCA 4BJ6C 3IP4B 2H8WA 3CF5F 3GTLJ 2MG4A 3O1WA 4RTUA 1SUQA 1WJEA 1S72N 2R7TA 4XR6A 4X1VA 3EFOA 5DLOA 1YJ9N 2BZTA 4DU3A 5FKKA 1SFKA 1HYSA 1FBQA 2CP6A 2UYTA 2GOMA 1XHXA 2VYPA 1FPQA 3WNFA 1ACMB 3V7SA 1BIBA 1WB9A 3Q0VA 4BRDA 3A03A 3KUFA 4DBQA 3L2VA 2CRGA 4XTZA 3PLAA 3C7NB 3M3YJ 1N8RU 3GMEA 2CGLA 2IVPA 3S3NA 3NH0A 4IUPA 3BDPA 2HBJA 4RTZA 4DTNA 4EW4A 5CQYA 3U1KA 3C2HA 4ISFA 4LLLA 1VQ5T 1KQ0A 3FGUA 4LD6A 2L0KA 1JJ6C 3U9GA 2FQ3A 3U4LA 3P39A 4RA2A 1AKHB 4Y28E 4RW4A 4G94A 3VEZA 3P31A 1ZSGA 2HF4A 3NHGA 5DUIA 4WYBA 3HRMA 4Z4IA 5KN9A 1VQ5A 3J7YJ 2NOLA 3LCNA 3P1GA 5ICEA 1EF4A 4OFEA 2VVKA 3ASOH 1DTTA 2EZHA 2A3SA 3WG9A 2CSIA 1BI4B 3FXUA 3TDUC 5DM6F 5TISC 4C92A 4L5IA 4UXNA 3REOA 2LNBA 2RH2A 2RMOA 3J7ZI 2QXLA 4I9LA 4FWQA 1VQ8Q 2LDMA 4H0TB 1QVTA 2EWSA 1ATRA 3WU0A 1OH8A 1R1UA 3AVIA 3MEDA 2Q2EB 2VYTA 4CVNE 2QEXQ 3ZEUA 2M87A 1P4XA 2LQNA 2DLPA 2NRXA 1R1TA 1I5OB 2OA4A 4UB6C 4BRAA 3EUKL 1T56A 2O61A 2KRNA 4WQ4C 4OFHA 3JCMJ 2GLOA