3L2WA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and gs9137 (elvitegravir)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2wA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2wA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2wA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2wA03
3KTQA 2HVHA 3SV3A 2LRQA 4L59A 3C6TA 4OKKA 1SL1A 2FBVA 3NF6A 4ID5A 2EX3A 4KHWA 3HM9A 3AVKA 4RW7A 4EDUA 3MP8A 2D0BA 3DYAA 3KLHA 4CJVA 2D0CA 3QJ6A 2VG5A 3FEOA 1Y97A 4N5SA 2G8IA 2RPIA 3NHGA 3V9UA 3QEVA 3QEWA 4DFJA 4CHZA 4JS4A 4Z4CA 5I42A 1C1CA 3AVGA 2OPQA 4FM0A 2PY5A 3AVAA 4CESA 2O4GA 3LPTA 1YTAA 3KK2A 3QLHA 1XWLA 2RI5A 1EX4A 3VQ7A 1D9DA 2R5MA 3OYLA 2FBTA 3C95A 4DQRA 4BDYA 1U45A 1WNSA 4W5OA 4F4KA 4B9SA 1IO2A 1TV6A 1VRTA 3ZSXA 1H3ZA 4CJ4A 4FLTA 1I39A 1OZ2A 3TR8A 3DLHA 4KRFA 1J9AA 4AHUA 3NAEA 4KI6A 4Z02A 4CFCA 2GUIA 3SQ2A 4DQIA 1RT7A 4N41A 2FBYA 3ZT2A 3OYJA 1HJRA 3VQ5A 4PQUA 3M8RA 4DQPA 3KK1A 2QK9A 2DIGA 2VWKA 4E19A 3LP2A 2F8TA 4I2QA 4FW1A 4CF8A 4CJWA 1ASWA 4LD0A 3VQQA 3RR8A 1ASVA 3DOKA 2E6MA 4E1MA 4Y1DA 1C0MA 1NK8A 2DFFA 3QO9A 1B92A 2HVIA 4K8XA 4QAGA 2OPPA 3ZEHA 3CFOA 3HPHA 1VSLA 3OYDA 4AHTA 1TL3A 1NKEA 3OJUA 3WNFA 4PA1A 3OS2A 3OQ5A 4UC4A 2RF2A 4GMJB 3S3MA 4C8KA 5KH6A 2Z1GA 1ZBHA 3I0RA 4OJRA 4FW2A 1HQEA 2P51A 4YNQA 3LAMA 4DTRA 2YV0X 1S5JA 1QSLA 1WJQA 1SSFA 4FZZA 2OPSA 3QBYA 4C5EA 3DLBA 3OS1A 1YVUA 3TWHA 1JLGA 5KTQA 4IUPA 3SPYA 3V1RA 1L5UA 3TABA 4E7HA 1R0AA 1NOYA 2K3XA 3AVJA 4PLIA 1HYVA 4NZGA 2GFAA 4FJNA 3NTIA 3V1QA 3GOXA 3HSTB 2OPRA 1ZBFA 4M3TA 4DTJA 2HB5A 2NLUA 2XHBA 3DRRA 4OKEA 1S1UA 1NJWA 5C24A 4B9MA 3DLMA 3MEDA 2MWOA 4DSEA 4FM2A 2HW3A 4J2DA 3O3FA 4F2RA 3G0ZA 4KHSA 1BIZA 1EXQA 5J1EA 2RI3A 4DFKA 2X4XA 2Z1JA 5J2MA 5K14A 3L3UA 3ZT0A 3MEUA 2B5JA 5T7BA 4DG1A 1DTQA 3T19A 1I3AA 3NTHA 2RJCA 1VSEA 4HHTA 3S6WA 3P83D 3M8SA 1XC9A 1HQUA 4KHUA 2Y1IA 3ZT1A 4C8NA 4EP4A 3CFPA 2JGUA 4N56A 3SI6A 3K5MA 4QW2A 4N4HA 4FLZA 2BIVA 3SZ2A 3SUOA 2RJEA 2HQEA 4B9VA 2VG6A 1CXUA 2G8HA 3VQ9A 2IGIA 1LAVA 3L2UA 3QIOA 4LY7A 3LGFA 3RMAA 2K3YA 4O4GA 4CIEA 1L3VA 4EP5A 4CJRA 4FL6A 3JSMA 3FC3A 2IDOA 3DRSA 4I2PA 4QCLA 2D5RA 4EZ9A 4DSLA 2KQ2A 3DB3A 4CK3A 3OYIA 3Q1JA 1LAWA 1UAXA 4AH9A 3NGYA 1TAUA 1NK6A 3QETA 3BDPA 2BUDA 4FLUA 1REVA 4KAZA 4AHVA 1RTIA 3DLGA 2HHVA 3AO3A 2HNYA 4F8RA 1TGOA 4CJ5A 1MHNA 1BIUA 3MEEA 1RNHA 2PYJA 3HVTA 2XY5A 1RDDA 4H4OA 3QEXA 4FJ5A 1NK9A 4FK2A 1C0TA 3NE6A 4FJLA 2XK0A 3MP6A 1ZBUA 4MFBA 1UA0A 3VQBA 3QESA 3ZSVA 4JS5A 2Y1JA 1TL1A 2E5QA 2YNGA 3IS9A 3S3NA 3SJJA 4DSIA 2O4XB 5DK5A 1BHLA 2IOCA 2EFIA 1TAQA 2DTUA 1B9FA 4E7JA 1UWBA 2BDPA 5KRTA 4UQGA 4CJUA 3H08A 4A4GA 4IKFA 3FLGA 3L3VA 2W42A 1NKBA 4DU4A 4IDKA 4FK4A 1U4BA 4FLWA 1SL2A 5HRRA 5CZ1A 2VYTA 4E0DA 2XO7A 4HCZA 4DTXA 4LH4A 4ZTFA 1KRPA 4I9QA 5C25A 3QKJA 3PUFA 4LD6A 4CGDA 3M8PA 1HPZA 4CFBA 4AILC 3MXJA 1A5XA 2F8SA 2R7YA 3SNNA 2D9TA 3PO4A 3AO2A 4BWJA 4A4FA 4A4HA 4DTSA 2OZMA 3O3HA 3DB4A 4ZHRA 5D3GA 3DRPA 4FJHA 2R57A 3ZSWA 3P8DA 4CEOA 4KTQA 1SUQA 3K2PA 3QEIA 3OS0A 3ITHA 4CGFA 5KE3A 1IKWA 1BISA 2JZ2A 1RBVA 3NGZA 1HNIA 3K59A 4M3WA 3ZT3A 3LX7A 3OYKA 4CHOA 3CM6A 3VQEA 4CIGA 4E1NA 1HMVA 1TK0A 5HRSA 5SWMA 5HLFA 3V9ZA 1UA1A 2X74A 4CK2A 3KIOA 4W5NA 3EYZA 2GBZA 4FJGA 3ZSQA 3NF8A 3NH1A 4M45A 3KLEA 2ZE2A 2YRVA 1LW2A 4FJXA 3VN5A 1KVAA 4CEBA 2D0AA 4DWIA 1RDBA 2KZMA 2PYLA 1UOCA 2WOMA 2M16A 4AHSA 2KFNA 2HMIA 4B9UA 4NCGA 4KFBA 4OLBA 3UIQA 4PLLA 1EETA 1LW0A 4B08A 4OPKA 4GW6A 4DLEA 4CE9A 4CEQA 3V9XA 1MU2A 2GV9A 4CJEA 3SQ4A 3MXIA 2B4JA 4DU1A 4FCYA 4B3OA 5IN1A 3KK3A 3QINA 4II1A 5JS1A 4FZYA 3O8VA 4JRPA 3HVRA 1RBUA 2EHGA 3OJSA 4B8CA 4CEDA 3WNEA 3K58A 2KTQA 4F3OA 1NJZA 3ZSYA 2L3RA 2QKKA 5CYQA 3TARA 4C5HA 3LZIA 4PL6A 3KKRA 2YKMA 3F9KA 4WE1A 3OMCA 1FXXA 2PQWA 3MEWA 2CKKA 1NJYA 2LTOA 1NOZA 3WNHA 3L2QA 1GOCA 3AA5X 2Z1HA 3LANA 3SV4A 4IUTA 3M8QA 3OY9A 3NH0A 3B6PA 4CGGA 3E01A 2X4WA 1OI1A 2HQXA 1RDAA 4FJ7A 3C4SA 4CF9A 1RCHA 3C94A 3LP1A 2KW4A 4DS5A 4AHCA 3OYAA 3D0PA 5HROA 2EKOA 4IFVA 3TANA 4NS5A 3ALYA 1JLEA 1TKDA 1F21A 3V1OA 1RBSA 1SKWA 1N5YA 5FRNA 4Z4GA 3LALA 4M3UA 2RJDA 3SQ1A 4FZXC 5KI6A 4HVJA 3AV9A 4OVLA 1RI0A 4E7LA 2RKIA 5KGWA 4L8RB 2L8DA 1BGXT 2BE2A 2RI2A 2OYQA 1SKSA 1RTHA 1KFDA 3F73A 3KD1E 4QQDA 3KJVA 5FRMA 4CF0A 3EZ5A 4CF1A 3MEVA 1WSGA 3SPZA 4F2SA 3DLEA 5C6SA 4KB1A 4C8OA 3C6UA 3M9QA 3FDRA 2YHBA 3DOLA 4IFYA 3EY1A 4O44A 1NJXA 3AA4A 4PWDA 2DFHA 3AO4A 1D5AA 2A1RA 3L42A 2FBXA 1C6VA 1BI4B 4DF8A 3VQCA 3OYGA 2X4YA 3NGIA 3RMDA 4Z4IA 2XY8A 2WONA 4Q5VA 4OVAA 4OKJA 4A4EA 1KLMA 4N47A 1S9GA 2HNZA 3NBPA 4GVMA 4QQGA 2QQRA 4FLXA 2FC0A 3LWLA 3V9WA 4ELTA 1U47A 1SV5A 4HUEA 4M3YA 2LCCA 4CJLA 4Q0BA 5CZ2A 3PMIA 3HPOA 1VSDA 4KKOA 1X9WA 3IG1A 3IRXA 2ZD1A 4X34A 4ICLA 1IKYA 4FM1A 4KHNA 1O1WA 4N76A 1A5WA 1IH7A 5J26A 2DIQA 3SQ0A 1S1WA 4B9TA 3AO5A 4DMNA 1WSFA 2BKDN 2DY4A 2JLEA 1CLQA 4C5GA 1ITGA 2BANA 3LLRA 1RT2A 4IG3A 3AO1A 3CG7A 4I7FA 1T05A 1WAJA 2GF7A 4KTWA 3KKSA 3PNWC 4R5PA 3AVHA 4YFUA 5IAYA 5J2NA 3SUQA 3U3GA 1T03A 1W9HA 5KCHA 1IG9A 3I0SA 4ID1A 4C8LA 3PX4A 4Z0UA 1VSIA 3TI0A 1HRHA 3L2WA 2HHTA 3O4NA 1RT1A 1LV5A 5KRSA 1U48A 4NCBA 1VSKA 3JYTA 3IAYA 1KVBA 4CEFA 3AA2A 5CIUA 4KB0A 2XY6A 1YT3A 1ASUA 3RRHA 4E89A 4CJTA 3HYFA 3K5OA 4DFMA 3KLGA 3ULDA 3ISNC 1VK0A 3LH0A 3F70A 4H8KA 4LSNA 4H4MA 3KD5E 4CECA 3OYCA 4XIUA 4AHRA 3PX6A 1T8EA 3OYFA 1JLBA 1S1XA 5HRPA 4DTOA 4W5QA 4CHYA 4RW9A 2YNHA 4E3SA 3WNGA 1BQNA 4BD3A 3AVIA 3AVFA 4CHNA 3I8DA 2HHXA 3DLRA 4PUOA 3TAGA 2OZSA 1VSMA 2L89A 2R58A 3THVA 1WSIA 1JKHA 4FJMA 3ZCMA 4CRIA 4BDZA 4NYNA 4DSJA 1VSJA 4KV8A 1LWCA 2EQUA 2ITGA 3CFRA 3MP1A 3VQ4A 4M3ZA 2I5JA 4FJ9A 3V4IA 1QE1A 4DSFA 1G15A 3DLKA 4IG0A 3NF9A 3TAFA 1RBRA 3LP3A 2E4LA 2RHZA 5DMRA 4KI4A 4HUGA 1CZ9A 4Q5WA 5HBMA 1SKRA 4HUFA 1GOBA 1RTJA 1TKXA 4IBNA 1Q9XA 1C1AA 3ASKA 3U3YA 1VRUA 1XHZA 1IKVA 1NK5A 5M9OA 3LP0A 3OYMA 2FHDA 2QQSA 5C42A 1HNVA 4IUVA 4GY5A 4CGIA 2RN2A 3DM2A 1B9DA 3LWMA 1N6QA 3VQAA 5FDLA 3HP6A 4CHQA 3EAEA 3BGRA 1KCFA 3OB9A 4CJSA 3HT3A 4OPJA 4HCBA 2G8FA 4DTMA 5C0MA 4QVZA 5EU7A 4CJQA 3RTVA 1BCOA 2RHXA 3E9GA 2PZSA 3SUPA 1RT3A 3KUFA 4OGCA 3LYIA 2GFUA 5J2PA 4QOZB 1WJSA 5SZTA 3NH2A 1J53A 4OGEA 2KZZA 4DTPA 1EKEA 1X9SA 3SYZA 1TVRA 4N4GA 2XY7A 4O55A 4M41A 4FLYA 3MXMA 2HHWA 1SL0A 1JXBA 1RTDA 3T1AA 3HL8A 4CHPA 5J39A 3V81A 4DS4A 4CFDA 1X9MA 1VSFA 3HK2A 3TAMA 2A1SA 1RBTA 2P1JA 4DSKA 4CERA 1TK8A 4KREA 2EQJA 1QTMA 4F3TA 4DQSA 1D8YA 5D6WA 1FKOA 2XDPA 1KTQA 3OMGA 1J5OA 2YHAA 3TAPA 1XI1A 4N4IA 3K5NA 2QKBA 1L3TA 3CQ8A 2RHYA 2ETJA 4FLVA 4KPYA 4O5BA 3AA3A 2F96A 4E7IA 3ZT4A 3HJFA 1T7PA 1WGSA 1RT4A 1Q9YA 3E9FA 2P5GA 3PY8A 3NF7A 3L2RA 3U6FA 4CCHA 3MEGA 1KVCA 2IG0A 3V6DA 1TKZA 5I3UA 1L3UA 3PMTA 1TKTA 4CGHA 2B6AA 3SCXA 3P8HA 3S9HA 4KO0A 4Z4EA 1J54A 2AJQA 3RMCA 3ZSOA 4JRQA 2OA8A 2F5KA 2LVMA 2O4IA 1BI4A 3VQDA 1OZ3A 1RT5A 3LZJA 4C8MA 4B8AB 3QEPA 1CXQA 1OYXA 5FROA 1QSSA 3FFIA 2X78A 1YTUA 4DU3A 1U49A 1ZBLA 3D45A 2G8KA 3UWNA 1NK0A 3OYEA 3O3GA 4FVMA 1S6PA 3G10A 4RW4A 3L8BA 4CIFA 4FYDA 3QNNA 3LPUA 4J2EA 2HNDA 2BGGA 1XNIA 4C5IA 3ZSZA 4KTZA 2VWJA 4O0IA 4E7KA 1JLAA 3MO8A 4CEAA 1HYZA 3PO5A 1KLNA 4FJJA 1RILA 1S1TA 3NNQA 4LSLA 3OYHA 2R5AA 2KFZA 3OYNA 4ELUA 2G3RA 2YKNA 5CYMA 2HHSA 3ZSRA 4BE1A 4FXDA 4W5RA 3OVNA 4KHQA 1KFSA 4DFPA 3ASMA 1RT6A 1WN7A 5HRNA 3AVMA 4DTUA 5E41A 3VA3A 1WAFA 4IUQA 1Z26A 4CFAA 4Y1CA 4MQ3A 3TAEA 3NTKA 1QS4A 3NFAA 3AVCA 1ZYQA 3K57A 3H8ZA 4HCCA 3NCIA 4J2BA 3HP9A 2IS3A 3OA6A 3HXMA 4BDPA 3MECA 4FK0A 4CEZA 1S9EA 4RW8A 3META 2M1HA 3DMJA 4EZ6A 3OYBA 3L2VA 3QIPA 3P1GA 1GOAA 4RW6A 2E6NA 3HO1A 1QQCA 4BE0A 3HPGA 1WSJA 1EP4A 1IKXA 3RRGA 2XRIA 1WSEA 2G8VA 2P0KA 4B9NA 2VG7A 4G1QA 3MAQA 1KSPA 1JLFA 1QSYA 3V9SA 5CY4A 4CK1A 2O4XA 1WSHA 3RWUA 4FJ8A 1L3SA 2YNFA 3PX0A 2JTFA 3PFSA 2LDMA 1WLJA 1X1PA 3VQ6A 2IC3A 2RO0A 4CJFA 1CZBA 4Z4HA 3TAQA 1C1BA 1NKCA 3QIIA 4BWMA 3KLFA 2RHIA 1KHCA 1K6YA 1S1VA 4OLAA 4KHYA 3MEAA 1JLQA 1JL2A 4BE2A 4B9XA 4ZTJA 1BCMA 1DLOA 1G5VA 2DFEA 3B6OA 2IAJA 4J2AA 1NK7A 1QHTA 2YNIA 2QXFA 4RG8A 1BL3A 4Z4FA 1FK9A 1HYSA 2NUBA 4DQQA 3SD4A 4DF4A 3RMBA 4FJIA 4B9LA 3UT1A 3QNOA 2Q3SA 4TSXA 2X6SA 4M42A 3AVLA 3LGLA 1JLCA 1XHXA 3O4QA 3K5LA 1BQMA 1RDCA 3BDLA 1A5VA 1ZBIA 4CJ3A 1D9FA 4BACA 4FU6A 2MWPA 1DTTA 4PY5A 4B9WA 3H6ZA 4CGJA 3NDKA 4CJPA 3CEYA 3P5JA 3LDSA 2ZQBA 1Z25A 3S3OA 3T3FA 2WACA 2HHUA 3PV8A 4IURA 2G8UA 2RHUA 1JXEA 4RG2A 2G8WA 2LSNA 3CYMA 5D6XA 5HP1A 2DAQA 5KCOA 4NCAA 2EQKA 1LWFA 5KGXA 1JL1A 2Z1IA 5J2QA 1TK5A 3A2FA 4DTNA 4I9LA 4CF2A 3CM5A 4ELVA 2ATQA 3SUNA 4W5TA 2X35A 1LWEA 4LH5A 2P5OA 4NYFA 1N27A 4O0JA 3VQ8A 4IUUA 5JS2A 4DLGA 4K8ZA 1FKPA 3ME9A 4M3RA 2B8AA 4M3XA 3DI6A 3VQPA 1S6QA 3LAKA 4FJKA 3QERA 2X6NA 3RR7A 1WJRA 2HHQA 4QQ6A 1VSHA 3AVBA 3KLIA 4JLHA 4HTUA 1W0HA 2E6LA 2EQMA 3VA0A 1C0UA 5KE2A 3AVNA 4CJKA 1Q8IA 1NK4A 5D6YA 2RJFA 4CEEA 2M0OA 1U04A
chains in the Genus database with same CATH superfamily
3JCMg 3SV3A 3C18A 2LRQA 2HDDA 4L59A 4ESRA 3ZL7C 4MDBA 3VTIA 2IA0A 1UG1A 4A62A 1X1CA 2FSJA 1J7KA 4JD2B 2EX3A 5FGMA 2KBTA 3HM9A 1OPLA 2VC1A 2A05A 6PAXA 1ZA2B 3R8EA 1LFUP 1PCXA 3E3VA 2VT2A 4GYIA 1TNSA 3JRDA 2D0BA 2O8DB 1ZARA 3VF6A 2IPOB 4X6AJ 1T3LA 1QKWA 1WLPB 3FEOA 4HXJA 4BQNA 4IO9L 2G8IA 1BU1A 3TGNA 5E26A 2BY1A 4IQ4A 4CW7B 1M1KC 4M75B 2QEXI 4EMHA 3WXLA 1KD1U 1SVLA 3SHFA 3LPTA 2LJ1A 4RAZA 3KK2A 4CZLA 3QLHA 3BZCA 3HGGA 1KONA 4UB6C 5B1AH 4A2AA 1YW9A 2RI5A 1GDTA 3VQ7A 1K8AC 3IRRA 4OINF 3OYLA 4LD9K 3LMMA 2PQ8A 3MCPA 4JLGA 2R7FA 4DQRA 4BDYA 3MCAB 2C6YA 3F6OA 2ZWHA 1PD0A 5KPRA 2BOLA 4DYRA 1R6RA 2YLBA 1W2BP 3JRHA 3H9NA 2DXTA 2ZM6K 2DX1A 1G3SA 4HNTA 1VRTA 2HMAA 4LDXA 2MSYA 1H3ZA 4CJ4A 3RR6A 4B09A 1QWEA 4EVIA 2EA2A 2KJBA 4UVAA 5FLXK 1OZ2A 1ZKGA 3TR8A 3DLHA 1FSEA 1TL8A 3N05A 3TO7A 3F10A 1U1SA 4CI0C 3NAEA 1PG5B 3BW1A 4CFCA 2RVCA 2O8FA 2GUIA 3S1RJ 3T9NA 3L1AA 4YOVA 1FOWA 2COZA 4I7HA 3BPVA 4IOCF 3OW2P 2FBYA 3QYBA 5F64A 4PQUA 3GW2A 1VQ4T 4NL2A 1AWJA 4XR6A 2HYGD 3F8MA 4CJWA 1I5OB 4M78A 1YFHA 1HW2A 4BC2A 5I11A 2YG9A 2XU8A 3WXMB 2HWVA 1Q81R 2SRCA 2DFFA 1RAGB 4JI0K 3RPUA 1B92A 2E88A 2HVIA 3FIWA 2QQBA 3PNYA 1DPUA 2K40A 3HGYA 2DT7B 2JWLA 3OOUA 3ZEHA 3HPHA 1T98A 3TQ7P 5M5WJ 3RBBB 2W85A 1KC8C 1JKPC 1VQLI 1RLPC 2OPTA 1IRXA 4LUDA 4C8KA 1M2VB 1W5CC 5KH6A 1Z77A 4G6QA 1N25A 2Z1GA 2CGKA 1ZBHA 4AF1A 2P51A 2E7XA 3H3UA 1S5JA 3MWPA 3OW2S 1J9IA 1FY7A 4YOWA 1N3CA 2K85A 2LREA 2DOAA 2MFZA 4NOYA 5HL7L 3MDQA 3TWHA 4UNFA 5GJWB 4BRIA 2CQ7A 4BVOA 2XKPA 5KTQA 2BY2A 5GAHP 2QUFA 1RESA 4BHCA 5ELZA 5BR9A 3SPYA 1L5UA 2JWKA 5ED4A 3RZDJ 2NRAC 2VUBA 1T0HA 2ID3A 2CP7A 1VQMT 2WAEA 1NOYA 2K3XA 3J81E 2QTDA 3AVJA 5F08A 5LJ5j 1WCMJ 2HAXA 3SEZA 3JRIA 1WRJA 3KYLA 4OKEA 2XPVA 1NJWA 1XC5A 2FNPA 2GTOA 1AKHA 5C24A 2W6LA 3VGMA 2IGOA 2IVPA 3IWFA 2MWOA 3CMAQ 2CZ0B 4DSEA 3CCQN 5LJ5e 1B1BA 4P1WA 1LNWA 5C4JJ 3S2WA 2V8JA 4IHXA 3E5UA 4ITVA 2FYKA 5F1RA 2XGCA 1KU3A 1X1DA 1XGMA 4J9DA 1YLFA 2ZPEB 1WHHA 1I5ZA 2GUPA 2MA3A 1BDGA 2Z1JA 4BY7J 3DEUA 2AIRB 5BN9A 2X9DA 4OMYA 2EGCA 4CZIA 4GCVA 2F4VK 3D2EA 5M3FJ 1I3AA 4OMOA 3NTHA 4HX7A 3ZQGA 4GGGA 4FWLA 5B66C 1XC9A 4FASD 1ZG1A 3RESA 3CUQC 2PVDB 4UUSA 2L7KA 5A0GA 1AWOA 1QQJA 1KXPA 4X65K 5JMVA 3K5MA 1RI7A 1Z7LA 2VQFK 1YJNI 1ZBJA 3O9SA 3HRGA 4FLZA 3P7NA 4KNYA 2E5NA 2HQEA 4B9VA 5GAGP 2HQNA 3N4PA 1Q1HA 2HVQA 1GLAG 3TOAA 1LAVA 3RMAA 1MJ9A 3ABLH 1L3VA 4EP5A 2P9KB 2K3PA 3JSMA 1QBJA 3CVTA 2H6CA 1HNZK 4BHBA 1S72A 5BOXA 5AQZA 4QCLA 2KMUA 3P4IA 3DB3A 1YX3A 4BQLA 3SFZA 1LEBA 2IS6A 5BPIA 2NVQJ 2RQRA 4BXUA 2DTIA 2YSRA 3CESA 1J5YA 2EPFA 2BUDA 3VFZA 2HBLA 1Q7YU 2OTLN 4KAZA 1X1AA 1HPMA 1G3WA 2HNYA 5FO5A 5GAOm 3FISA 1GFDA 1BIUA 3QU3A 4MMKA 5AN4A 3OWTA 1S7EA 1NK9A 1OU8A 4FK2A 1C0TA 3NE6A 3M0RA 1M1KO 3KP4A 4MFBA 1OPKA 4XU0A 3RDVA 3I4MJ 4AIKA 2XROA 2KLOA 4D5FA 2AKLA 1Y8RB 3CP8A 4JS5A 3PTAA 4RM3A 2E5QA 3IS9A 4LF9K 2HSPA 5DK5A 1OU9A 4JKAA 1K8AO 1VQ6Q 3PVLA 1YI2Q 1CF7B 2EFIA 4CCKA 3O1BA 2QEXQ 1IV8A 4M78E 1UWBA 2BDPA 5HLGA 5KRTA 5LJ5h 2VWBA 4UQGA 4A4GA 2FF6A 1C0FA 4K0KK 2RK1A 1JI8A 3ID8A 2W03A 1NTCA 1XQSC 4OPAA 1BR2A 4AI5A 1E6GA 3BOQA 5BN8A 1M3QA 4BXXJ 3THWB 4FLWA 3GNFB 3GCMA 1Z6RA 2VYTA 4E0DA 1MMAA 2P9SB 4XRFA 4ZTFA 5ICCA 3PUFA 1ZH5A 1KEAA 4LD6A 3M8PA 4CFBA 2HMPA 1LB2A 4JQFA 2F8SA 3RSNA 4YIIA 4BGBA 3SNNA 2W57A 3ZETA 3PO4A 4EMSA 3AO2A 1A5JA 4BWJA 1N3AA 4A4FA 4A4HA 2I7PA 4DTSA 3UKUA 2DT6A 5BS6A 3QXEB 1MH3A 4LK1F 3DB4A 5GAOn 2KIQA 5J3BA 2YCHA 2IP2A 4ZDOA 3MHXA 4FJHA 3LSHA 2VXFA 2BH1A 3DKMA 5LD2C 2EZLA 3MN2A 3W6VA 1X43A 5CVVA 2NUTB 4N4OB 4DOWA 3K2PA 2KKOA 3K59A 3T1HK 3CC4I 4DEYA 4XORA 3KWGA 3ZT3A 2ESHA 3OSFA 1YITA 3BJOA 3TDUC 5D4SA 3CM6A 3HHTB 2A61A 2LX9A 3VQEA 4CIGA 4E1NA 1KQSM 2FF4A 4J6YA 1YHQT 4EM1A 1KK7A 1SG5A 2IS4A 4CK2A 1KC8O 1QCOA 2Y0SN 3KIOA 2ZGZA 3A8HB 3EYZA 2GBZA 4FJGA 3PNVA 2EZHA 1K4TA 4F04B 1FYNA 4CCLA 3D1NI 4M45A 1SRMA 4QIWN 5HY6A 1LW2A 2DT5A 2CGPA 3VN5A 2DLLA 4CEBA 1MH4A 2CQQA 4KMUX 2D0AA 4BR7A 4AYBN 2KZMA 2PYLA 1UAAA 1M3BA 1VQLQ 1IC8A 1KU2A 4NCGA 4W1UA 3MZYA 1YS6A 4DUYK 2NRHA 3BG3A 2PMZA 1EETA 1A6IA 1D0XA 1LW0A 4B08A 4GW6A 4DLEA 5F04A 1MU2A 3KZIC 4G8XA 5ICGA 4JJBA 2C06A 5C2FA 2V8KA 2YHXA 3T1YK 5M1QA 2LJ3A 3B73A 3QAHA 2B4JA 2E2QA 4B24A 4H4KC 2DA2A 4FCYA 4B3OA 1BJZA 3KK3A 2V6EA 4IHWA 3JRZA 3A5OC 2ASOA 2JRMA 4QPQA 5JS1A 3I55A 1T08B 4A5AA 2O8CA 1PVEA 1P7MA 3IH4A 1RBUA 1XMXA 4H5RA 4B8CA 1HC8A 3HKZA 4E47A 3K58A 4F3OA 4FT8A 1X2MA 2BXYA 4C5HA 4GV6A 5F27A 4S0HB 4LF5K 3J7AF 5KCMA 3LSJA 2YKMA 2QM3A 1YVNA 3A8GB 2PQWA 1NZ9A 4J83A 3MEWA 2XVCA 3PO3J 1NOZA 5EG0A 4BRCA 1W4MA 3L2QA 5A2QE 1OKRA 4HG2A 4MDAA 3LANA 3SV4A 4L9NA 2JSPA 3QBXA 5C12A 1QW1A 1VQ4N 3ZR8X 5BPDA 4M7DB 4J01A 4LF4K 2NNYA 3B6PA 4HKEA 3FMSA 1FN7A 3CPFA 1IBLK 1F36A 3I9V2 2X4HA 4EEFG 4BR4A 2EYYA 4FJ7A 2H56A 4E9GA 2LC2A 2VXZA 2CH4W 3LM9A 1P2FA 1I5LA 3JB9J 2HHHK 2RK2A 3LP1A 5JR3A 4DBRA 3D0PA 2V8IA 2EKOA 3PJRA 3H3VK 4XLAA 1RAEB 4K41A 4NS5A 3CCYA 4KIBA 4IIOA 1K78B 3BQYA 4JYAK 2ZXWH 1F21A 5IHKA 3V1OA 2EWNA 3VYSB 4DV6K 2CQNA 1SKWA 3CXCA 5FRNA 3G4SI 2EJGA 5I22A 2L0KA 4JKGB 5E8IA 2HKXA 3VW4A 3HYIA 1B7TA 4LB5A 1WYXA 3CCMT 3JTHA 2K3BA 3SDZA 4Y33A 2FXAA 4MZMA 3RUXA 2O6GE 1FYKA 1YJNQ 3CCLT 5KGWA 4L8RB 2KZVA 3CCET 4M6XA 3MKZA 2V1RA 1RTHA 1JQQA 1BYMA 2NAZA 3F73A 2FUG2 4ZJZA 4A57A 2ZXHA 1WSGA 1B59A 1B34B 4HX4A 2F2EA 4ORZA 4EMKA 1D0ZA 2QSHX 3K1NA 4HQEA 1VYVA 1HD3A 1UMQA 2PBDA 1SS6A 1ZC6A 3N5NX 1Q82R 4KB1A 4C8OA 3C6UA 1VQMN 1IN4A 4PJOG 4LF8K 3CBPA 3ZX2A 3DOLA 2NS0A 1R59O 3EY1A 5E3LA 4YPHA 1JJ6C 1MNEA 1OQYA 1U6ZA 2FF3B 2A1RA 3MCZA 5BRHA 2XRNA 2LCSA 3ZQQA 4DR5K 4C8QG 5LJ3f 1MGQA 1IXCA 2CH0A 4XH4A 2QCOA 4YORA 4M78B 2V9KA 4DF8A 2A69F 1WUAA 1SMYF 3NGIA 2E71A 4BROA 3I0TA 1O57A 2DFIA 4Z4IA 2FQ3A 1WPYA 2MOXA 4M7DD 2XY8A 2OUMA 2X0LA 3A5ZB 2HNIA 3ULQB 2WONA 2E5KA 4A4EA 1WI7A 1S9GA 4N47A 2HNZA 2YSQA 4FQGA 2VBZA 1AOYA 4J9EA 3SB2A 2FC0A 4D7MA 3BZ6A 1RAIB 1OMIA 1VUBA 4AM7A 1VFCA 5GPAA 3F6VA 2Z0WA 4M75C 4NC6A 4CJLA 3EFOA 3O5BA 3HFNA 1NJIU 3J80E 4KUMA 3SAGA 3L00A 2H3JA 3IRXA 3AG2H 1J3TA 3MD2A 2HBWA 4R56A 3OBYA 5DLQE 4M7AA 5TRDA 3CCJN 3QBWA 1ARKA 3AL0B 5AFUA 1IH7A 5J26A 3JB9I 1XG7A 1X19A 3SQ0A 2L01A 2ZJQF 4IO8A 3ULEB 3CCRI 3FHFA 5C3EJ 2DA5A 1L3LA 5CKBA 3AO5A 2EV0A 1CLQA 2HNHA 2KGTA 3CCQQ 4E9HA 1ITGA 4JK1X 2BANA 3SEQA 3T1BA 2FSNA 1VQPT 1SQKA 1N32K 1VQKT 4A53A 2CS3A 4AI4A 1RADB 1V4TA 3HFOA 3PNWC 3AVHA 1D8JA 4XN3A 5AQKA 3WU0A 1NGGA 3FLCO 3SUQA 1NH3A 1QVUA 1AKHB 1W9HA 3VS4A 2F9WA 3I0SA 3EG9A 1FTZA 1HKGA 5C2DA 1E4FT 1D8KA 4Z0UA 4M77A 4EHUA 4JX4A 3AGRA 3KP3A 5KRSA 1UECA 5B1BH 4QS9A 4LF7K 1M90U 1ERDA 2Z99A 1LJ9A 3IAYA 2F48A 1LMZA 5KAIC 1QQIA 3ZX3A 2JMCA 3KZYA 1IJWC 4ZDLA 2NOFA 1KQSP 4CJTA 4ZH4F 3HYFA 3W6KB 3I9QA 4FM4B 2GCXA 2VL8A 4HAMA 3PVQA 3CI5A 3ZN0A 4FYXB 4IJAA 4G9YA 4U7DA 2CGLA 3KX2A 2JTMA 5IOYA 1MUDA 4XU2A 5HRPA 1S1XA 2O2OA 4FE4A 4CHYA 2QBYB 4RW9A 5HS9A 4NQWA 4XKBA 3SYTA 2E2NA 1VQ9A 1T56A 1BQNA 2KT8A 1I81A 3NHNA 3BTIA 2EV6A 2E2PA 1QPMA 2HHXA 2QM1A 3ZQ7A 1NK2P 2ROTA 2Q2EB 3JCMW 3L4IA 3M4YA 1VSMA 2L2PA 2R58A 3GFJA 2KRSA 3M55A 3JRGA 3CQYA 5FPDA 3THVA 1OVYA 1JKHA 4RAFA 1DDNA 5DD8A 4NYNA 1R4MB 4LMYA 1BW6A 2K5CA 4K42A 5AQSA 5FLXE 5AZJA 3P38A 4HSBA 2DA4A 4LLNA 3V4IA 2EGAA 1HOMA 1K0XA 1WXTA 1WI9A 1QVGP 3U4LA 2PNIA 2G0EA 4KICA 2NVUB 1IZ1A 1S5LC 5CKHA 2WY7Q 4A3DJ 4IG0A 4KBMB 4IOAL 1RBRA 3L4QA 2W1OA 1XS9A 2PVOB 5AT1B 2OTJA 2M0YA 1CZ9A 4Q5WA 2IBDA 5GINA 3C6AA 2DOEA 2GOXB 2CUDA 4IBNA 4B44A 1Q9XA 1C1AA 3DEWA 1P8ZA 4HX8A 2DYRH 3HOXJ 3U3YA 2DQRA 4DA4A 4FYVB 1U5SA 4BC3A 3TEDA 3EH1A 1GV2A 1IKVA 1NK5A 5M9OA 2LRDA 4AVPA 3BCAA 1GLEG 5C42A 1HNVA 3S16J 4IUVA 3FZLA 3M0QA 2HTSA 2PI0A 4AM3A 4MQVA 2K9MA 3LWMA 4CCJA 2JWTA 2BTTA 1YF5L 2L9VA 1K9MU 1BR4A 2BE5F 1T0FA 4KT6A 2VODA 3EAEA 3GDQA 4EJZA 1EIFA 1KCFA 4CZHA 3HOUJ 4CJSA 3HT3A 4HCBA 5D8KB 4AFUC 3Q0WA 2QWLA 3G4SQ 3SUPA 3PIPA 3JAMK 3FHGA 3GTMJ 1KFZA 3GL1A 3TQNA 4AIJA 2GFUA 5J2PA 4QOZB 1SD5A 2ZJRF 4OGEA 2KXCA 3S8PA 3B8AX 3CWSA 4IDHA 2DU9A 3U9DA 3PIPF 1U2VA 3N4MA 4AM6A 1ZXOA 1M3HA 1J2XA 4DV1K 1GL5A 1TVRA 2XY7A 2JS2A 3VUBA 3E66A 2ZXJA 2HHWA 4UY8O 1SL0A 1N9RA 1GLBG 3ZX0A 3I35A 1JXBA 2VKVA 3T1AA 1RTDA 3CF2A 2OI3A 1J09A 3M57A 4CFDA 1X9MA 3GFMA 2V1UA 4RTUA 1OH6A 1VIEA 3G1MA 2DYBA 3GWZA 3WTUC 2QVOA 1RAHB 4CC4B 2KKZA 4GV3A 2CQKA 4CERA 1TK8A 4KREA 1QTMA 3MKWB 4C92D 3RYPA 4F3TA 1AWWA 2OD5A 1OLTA 2MG4A 5JLXA 2XKOC 1S6LA 1SVOA 3PFYA 4M7AE 1M1GA 4DQ8A 3RKWA 4FX4A 4L5GA 1OVQA 3U8XA 4L6V5 1XI1A 1RUOA 3THYA 4IZ9A 2MBFA 1NKUA 3M1FA 1L3TA 3CQ8A 4KGVB 2ETJA 4KPYA 1IN5A 4E7IA 3OIQA 2J7IA 4FHTA 3CPEA 4YOUA 3G71A 3S2DJ 2KAFA 3GZNB 3WG7H 2F2VA 5K7HA 1Q9YA 2LDUA 3SK3A 5KYWA 3PY8A 5F6FA 2AT1B 4FSVA 2IG0A 3UKRA 3RYRA 5I3UA 2VJIA 1TKTA 3LWFA 5IT9K 3CQXA 4XN0A 2EQIA 2JA6J 4I6MA 3BZKA 1X3ZB 1DKGD 2OA8A 1YBYA 2HBPA 3VEYA 2JN6A 3CC2A 3M54A 1BG3A 3NEUA 4CC7A 3WE2A 3VQDA 1JUPA 3TSUA 4M77E 2KRNA 3F8CA 3GUDA 4QSHA 1MBEA 4B8AB 3S1NJ 3TU5A 1U6GA 3QEPA 2KROA 2E3HA 2XAJA 1M8MA 3CJBA 1Y07A 2V7FA 2D1XA 2I0NA 1MD0A 1LQ1A 1WQ2A 5AQPA 2X78A 3GLLA 4RLQA 1VQNA 3E9PA 4DU3A 1ZSZC 5BRFA 1O4XA 4PJOA 2Y31A 4BBRJ 1MBKA 1DGRM 2O8CB 3FXKA 3EN9A 2RE2A 4Y15A 2RQQA 1S72T 1VQ4Q 3G10A 2PUKB 3R2XC 4RAGA 4C8QA 2GA1A 4QT7A 4C3HJ 2F5VA 3EL2A 3O9TA 4GNIA 1YHQI 4C5IA 1NWKA 3L1PA 4JKHA 4N0BA 1SRLA 4JV5K 4O0IA 3E2UA 3ASOH 4C2MJ 2BVMA 1JLAA 3MO8A 2O8EB 5EG0B 3HOWJ 2EB7A 4CEAA 1YE9A 1GLCG 1QNTA 3QWXX 1R0BG 3WQTA 3WXKA 4LDVA 2QAZA 4A54A 3OYHA 4L3QA 2IPQX 1XDUA 1HBXG 2AHJB 2BE7D 2GQQA 4V19K 2XDVA 3KPHA 5KQDA 5GAEP 3MEXA 3ZSRA 1P4WA 4PKGA 2BVLA 3SZPA 5FPEA 4B3RK 3OVNA 1Q82C 1YJ9A 1JGSA 3J7YJ 2ZKZA 1T2KA 1G99A 5HRNA 3EHRA 3JCMb 2ZFUA 4DTUA 2VQGA 4OFEA 3LFUA 3AKZA 3NTKA 1YN8A 1QS4A 5I21A 3NFAA 4KBOA 1ZYQA 3K69A 3K57A 2Z3YA 5TJJA 5AQTA 4PFZA 2JN0A 1OPCA 2DERA 3HUGA 1QKXA 2E3IA 4H0TB 4E4HA 4AC0A 4BRNA 2BTFA 4R55A 3DJCA 4PKHA 2VOOA 2H3GX 3CCVA 3UDCA 5FU7B 1KGSA 3C2GA 2ADUA 3G6EA 1YS7A 4DR7K 1ABOA 5FKNA 2E2JJ 3GX4X 1VYTA 1VQMQ 2L3SA 5J8FA 2KDOA 3FXQA 2QQAA 4WFBL 5K7FA 1XNRK 1ZG5A 1WQWA 2QWNA 3L2VA 1OFCX 3P1GA 2A08A 2D0PA 3M4GA 4HQMA 4MDWA 1FW6A 2KZGA 2L9SA 2DTHA 4BE0A 3HPGA 1EP4A 5HCKA 4AD9A 1AZGB 2P0KA 1TYQA 1JTYA 3BR5A 3MAQA 1KSPA 1JLFA 1QSYA 3V9SA 2LOOA 3VSKA 4EMKB 5AQNA 2ZPIB 5C4XJ 1V5EA 1Y1VJ 4FJ8A 2D1KA 3PX0A 3PFSA 2XB0X 5D5UB 3M1CA 3X25B 2RO0A 4CJFA 2JHJA 1QLYA 3ISPA 2EFWA 1W70A 1BK2A 5EC7A 3VS5A 4O6JA 2VC8A 2ATCB 2YU3A 1VQ8A 1QVPA 3VEZA 4JYKA 4BWMA 5LJWA 5GTIC 4YFNF 3CMEA 3Q0UA 3RMSA 1UHWA 1JLQA 2K9LA 4RM2A 4ZTJA 1NMNA 1BCMA 2G9WA 1G5VA 4B1WB 2IAJA 1XPXA 4V2SA 4FWKA 1QHTA 2OBPA 5EY4A 3VDXA 2QXFA 1ATSA 4RG8A 4YDUC 3NWTA 3R9PA 2H09A 3WTYC 4C9YA 5IY5H 2YHTA 1TUYA 3CC7A 1HYSA 2ZPBB 5KYUA 1EQYA 2LF8A 3VEWA 4DF4A 4RGRA 3CCMI 2RMOA 3UT1A 1TU0B 5FPNA 5ADXH 3CCLI 4KUDK 4TSXA 2CP3A 2I8DA 3CCEI 3EFOB 1MBFA 2YU9J 2QA4A 3BTLA 2O9SA 3I56N 1VQ5N 1RDCA 2KPMA 3ZP5A 4UVCA 1VQOA 1SAZA 1R1VA 2R7VA 4PY5A 1SD4A 2JTVA 2KHMA 1XMQK 4B9WA 2ETHA 4A61A 2YUSA 3ESWB 4XKWA 1IUYA 4BRQA 2X1EA 3I55T 2ZXIA 3FMRA 2CGHA 4L9JA 2HHUA 3CJNA 3QUIA 2PAVA 1IXRC 4IURA 2G8UA 2QKMB 1Q81U 1XQOA 4GV9A 4OMLA 1JXEA 3CHWA 4RG2A 4HF1A 4CZEA 2G8WA 2F5DA 2JG6A 2F5TX 1MWMA 1E2XA 2ZGWA 2BZYA 2JT4A 2HOAA 4A3IJ 5KCOA 2KLAA 2PLYA 5J2QA 3VYRB 4BYYA 3A2FA 2FX0A 4I9LA 3U2RA 2ATQA 1TWGJ 1QA6A 5GANd 1XMAA 3J8AA 1XGNA 4M78C 4BRLA 2X35A 3GLXA 1NG2A 4U88A 2D8JA 3UPUA 2K6DA 4NYFA 3OR2C 1N27A 5FPMA 4IUUA 5JS2A 4RBOA 2C0IA 3EG0A 2RQPA 3ZMUA 5J1RA 4UOBA 3LAJA 4OIPF 1N8RR 4C8QE 2WB1N 3QERA 2X6NA 1I1GA 4XAXB 3S17J 1Y0NA 4QQ6A 1VSHA 3T8TA 3HOZJ 2CSOA 1P92A 4JLHA 2XGDA 1D1CA 1W0HA 2E6LA 1ZK8A 2P9IA 3VA0A 1C0UA 2VYPA 2L9RA 2QK0A 3LH5A 1Q8IA 5C10A 4J6WA 4NQWB 4M74A 1T3SA 1KIKA 2DL8A 3D2FA 3HHHA 4DEXA 5GIOA 2Q1NA 5HLIA 1PD1A 2B86A 3KTQA 1EJ9A 2LBFA 3SJHA 3RKQA 4IPAA 1BA1A 1VQPI 1Q86O 3C6TA 3COAC 1RPWA 4OKKA 3WTZA 2FBVA 4F7ZA 3L09A 3ENBA 2CUEA 2CFOA 5FU6C 2YX7A 1VQKI 4ID5A 3WU2C 4KHWA 2DK3A 2E20A 1O3QA 3AVKA 3NGPA 2HQAA 1NGNA 1U8BA 2O7OA 2O9VA 2HQHA 5AQUA 3CBMA 3W2AA 2EJRA 3KLHA 5LEKA 4X9DA 1FMKA 4YELA 3DBLB 5EDNA 4N5SA 3P39A 4OP0A 3IUCA 2JPSA 5GAN4 2RPIA 3V9UA 1YHQQ 3M5AA 1GUUA 2COBA 4K11A 4CHZA 4M9ZA 1C1CA 1JCEA 4KFCA 4ENJA 4CESA 2VN2A 2O4GA 3ZYYX 3DKXA 4IO9F 4C0ZA 1Q82O 3M53A 2MPXC 4B1XB 1AZEA 2I10A 4YG2F 1WVRA 3OIOA 3CW7A 4KULA 1D1AA 4EFHA 2UUAK 4X0GA 2VOPA 3R4KA 1RACB 3J81O 4YOTA 4F4KA 3DAWA 5LJ3j 2W25A 4DZJA 3FSPA 1G8XA 4B3XA 5CVRA 1SD7A 2K02A 4A3LJ 2Y69H 2RC4A 3AAFA 1ULYA 4EQQA 3ZSXA 1LVKA 2DBMA 4A3KJ 2KXDA 1TWAJ 3DEEA 3EGUA 5DCMA 1JJ2M 4KRFA 4XONA 4ESBA 2CP5A 1J9AA 2FE3A 2D2WA 3E5QA 4KI6A 4Z02A 4EIKA 5IYDJ 2XC7A 5LJ3e 2H1LA 1EA3A 3PIOA 3ZT2A 2YT6A 3BTJA 1KG4A 3OYJA 5KYYA 3R6SA 1NK3P 3VQ5A 3M8RA 1OOTA 4DQPA 3KK1A 2QK9A 1X58A 4E19A 2F8TA 4FW1A 4UNOA 4CF8A 1T6SA 2OX7A 5IT3A 4BQOA 2JT1A 2Y48A 3JRCA 4E9EA 4PJNA 3RKXA 1ASVA 2E6MA 3FGUA 3VOEA 1QZ6A 3R60A 2YUNA 4Y1DA 3RZOJ 4CZJA 5CCAA 1UGQB 1UG0A 1X4PA 3MN7A 3N97A 4QAGA 1K8KA 4M71A 3VRYA 4XSXF 2E12A 4KH1B 4E9FA 1TL3A 3CCUN 4XMYA 2ASPA 2CV2A 2QTVA 3H1CA 4HNVA 3OBWA 4CBXA 4PA1A 3BR1A 3OS2A 4UC4A 2RF2A 2KE9A 4GMJB 4HEA2 2KHOA 3RSEA 5KPZA 3CJCA 3QPSA 5GPCA 3KE2A 4OJRA 2R7DA 3LDLA 1ZBXA 3LAMA 2NZTA 4PK4A 1WJQA 1SSFA 2A42A 4FZZA 4BI8B 4P9FA 5TKYA 3J7AP 4C5EA 3ZBDA 3OS1A 3R6OA 2P84A 1V4SA 3MFKA 4L5EA 2JA5J 2JA7J 2HPMA 1XUPO 1YOVB 3A1PA 2ELKA 4IUPA 2QDYB 5M1PA 3HOVJ 3G1JA 2RM4A 1FPQA 3V1RA 3TABA 1NGBA 2QQ9A 5IP7J 3INZA 1YQMA 1XQHA 2E1NA 4E7HA 4PSXA 5GAN8 1BM9A 3HTUA 1K76A 5GANg 2NOIA 1HYVA 1JXMA 1LFPA 2HBMA 3HJEA 3NTIA 4I6MB 2RQWA 3GOXA 3HSTB 2OPRA 3BF1A 1ZBFA 2ECCA 3VJPA 2HB5A 4JNEA 3JSCA 3TEEA 2M34A 2KQWA 2UUZA 3DRRA 1VQ9T 1YQLA 1W7PD 4B9MA 3DLMA 3V7CA 2E64A 1Y8QB 1I6XA 1Y39A 4FWOA 2FSWA 3QHSA 2W10A 1SFUA 4BY9C 2HW3A 4J2DA 3D7EO 4EHTA 5A0LA 1ONVA 1NEGA 2O61A 4RLFA 1P4AA 2Q36A 3GTGJ 1LKXA 3RDIA 4Y7NJ 4PJOB 1E4GT 5J1EA 5DUIA 5B5EC 2X4XA 4XKCA 3AARA 2GLOA 5ERIA 5K14A 2NLXA 3ZT0A 4C0DC 5LJ3h 1VQ7N 3CJ7A 4BJ5C 3MEUA 4C8QB 2EFQA 2VB6A 3TSWA 1MJBA 3UNGC 1U3OA 4DG1A 1JCGA 2ZJQL 4WCIA 2OTJT 5GAN3 3A5MC 5JLFA 2ZMEA 3L0QA 1S9HA 2ECZA 3I54A 1TW3A 4DYQA 4BQZA 3JB9F 2NVYJ 4ENKA 1IDYA 3ERMA 1H9TA 4N56A 1XN7A 4WTOB 2Z2SB 2L3PA 1Z3YA 3KEQA 1KD1C 2BIVA 3G1LA 3QYHB 1UELB 2RJEA 3BR2A 4CH7A 2VG6A 1BJAA 4IX7A 1CXUA 1LOTB 4XTZA 2IGKA 3GF2A 4DV7K 1ZRCA 4LY7A 3UB5A 2HKOA 3C2BA 3LGFA 2NWMA 2DMOA 3JXUA 1FYMA 4XH1A 5J4YA 1SKUB 2FRYA 5AQLA 2E60A 3CUOA 1BOTO 5CQYA 4I2PA 4FSSA 2D5RA 5E1WA 4DSLA 1FLIA 4GKKK 4CK3A 1UJ8A 3Q1JA 3CMAA 3CF5L 1LAWA 1UAXA 2XF6A 4AH9A 1GT0C 3NGYA 4JI6K 3QETA 1P7IA 4F92B 4HF2A 3QDRB 3BY5A 2DL3A 3VERA 3CXCS 2ELJA 3AO3A 4IRGA 1K9AA 4EW4A 2P4RA 4FYYB 4ON0A 3G2BA 1TGOA 1MHNA 5GAMj 1S72I 1RL2A 4IXCA 2HU9A 3BJ6A 3UF4A 3MEEA 2VGMA 4HCKA 1RNHA 2PYJA 3KEYA 1ZSGA 3QEXA 1WHKA 3FZMA 2P81A 5DYMA 3ZLJA 1B72A 4FWSA 3O08A 3MP6A 5J6XA 1HLUA 4JDSA 2CO5A 3KHYA 3RI4A 4XBFA 1BKBA 3ZSVA 4XLEA 3J81K 2YNGA 4BRFA 4HSRA 3EZWA 4DSIA 4CYDA 1RI9A 3HRUA 3ZMDA 1EWQA 2IOCA 1K61A 1DEJA 4XK8E 3T8RA 4CJUA 3H08A 4IKFA 3GG4A 1MMSA 3L3VA 1NG6A 3ZQIA 2D45A 2LQNA 3WVDB 2CSQA 4IDKA 4RWTA 2DYSH 4BGAA 4I02A 3I56Q 3G71T 2EYWA 2WTUA 1EH6A 3E19A 4HCZA 1KAYA 3CMMA 1IG8A 1WBBA 3C0BA 2JJ7A 4JRKA 4AILC 1T39A 3NMUA 1U5TA 5IT9E 2RPNA 2R7YA 1Y1WJ 2IGNA 2FSKA 1R71A 3GVAA 4I2OA 3Q3SA 4CICA 2DE0X 2OZMA 2CW0F 2CMPA 3H0GJ 5KYUB 1W1WE 3BG7A 1ZR2A 2P0WA 2R57A 2Y0MA 4XLCA 5A2QO 3ZSWA 4ISFA 3CC2T 3P8DA 3NFCA 1IJJA 4NC7A 4KTQA 4CHUA 3X2QH 1SVMA 3ITHA 1BISA 3JCMP 2FB7A 4LIUA 4M75F 5LHHA 4GY2B 4FL9A 1JJ2P 4E70A 3CPWM 4PGHA 4CHOA 5BMZA 5HDNA 1I1SA 1HNXK 1VQNT 4XTYA 5SWMA 1NLOC 1UA1A 3FXMA 2RQUA 1X01A 2B0LA 3WUHA 2F2WA 1MNDA 3ZSQA 4J19A 3HM8A 3MZHA 4NL3A 1IRFA 3KLEA 1UGVA 2Y75A 1YITI 2HFHA 4EMKC 2Z33A 1X6BA 4FJXA 2ZSIB 3W3DA 1VQ6A 4FIBA 1YI2A 2ZJRL 4B22A 4XU3A 2O0YA 1RDBA 2WOMA 4UHTA 3PIPL 4AHSA 2CP0A 2KFNA 2LNBA 4EMGA 5LY3A 4OLBA 3UIQA 3IKTA 2K7AA 1KQ8A 1OISA 1KHIA 2PTKA 1X75C 4CE9A 4CEQA 1M1EB 3MN9A 3Q7CA 3ATUA 2GV9A 4CJEA 3SQ4A 2J6OA 2FZGB 3MXIA 3F8NA 2I5WA 3RIRA 1EFNA 1KYZA 3GIBA 5GAMh 1UCRA 1I27A 5IN1A 3HRMA 5M5YJ 1YJ9T 4WXHA 2QG9B 3QINA 2LD5A 1PU7A 1P59A 4BC4A 4F93B 1VOMA 3CCSA 2EHGA 1P90A 4EA5A 3WNEA 3QPHA 1WXUA 4WQ4A 3BEXA 2CGJA 1M2VA 3LZIA 3M7GA 3V8KA 1NM1A 3KKRA 2NUPB 1DP7P 3JRBA 4J9IA 4HLYA 4FPAA 4WE1A 2QKLB 4ASNA 2HQRA 2ELHA 1BIAA 1WI3A 1FXXA 5F0FA 2UZKA 2IVMA 2CKKA 3I55I 4DW6A 1PNJA 3CCVT 1BOBA 4RGSA 1MJAA 4PJLA 2HQ5A 5FKOA 4II2A 2RN7A 3G6ET 1HKSA 1R49A 2WTEA 4M7AC 1Y57A 4IUTA 5GP9A 2FNAA 3F0ZA 2M8EA 3SMPA 1N34K 2LBFB 2HI3A 3OY9A 2STWA 2DL7A 4JP0A 3DKWA 2RKHA 4CGGA 2OANA 1Q7YC 2X4WA 3DLLA 3M1EA 2QWMA 3FX3A 1OEBA 2YLCA 4CF9A 1YIJA 2J6FA 2M0MA 4AHCA 2FEZA 5HROA 2YX4A 1T6DA 2L54A 3MMVA 3ALYA 1JLEA 1TKDA 2DXIA 4BB7A 2P4WA 5D6EA 5AIQA 1KD1O 1BI1A 3VYTB 1IF1A 2DZCA 2HDWA 1VQ8T 3M8EA 1GLJO 4JN4A 3C7JA 2K9QA 1TWFJ 2Q97A 4FZXC 1CKAA 2KEAA 1YFNA 2KL4A 3CMET 3CLOA 4M77C 1V4RA 3AV9A 2UXCK 4IF4A 4M3BA 2I5UA 4N9HA 4BC5A 5KYNA 2RKIA 1KO9A 4ZN1A 2L8DA 5IXFA 3VEVA 2Q1ZB 4DIQA 4HNUA 4XTWA 3KD1E 3KJVA 3FBNB 4CF0A 3EZ5A 1QVFA 1ETQA 4FWPA 2FU4A 3MEVA 1TT0A 3SPZA 4F2SA 3FF5A 1YJWN 1KG3A 1QQNA 4Z89A 5F0CA 2QA4T 2LT4A 1LCKA 2HGCA 3M9QA 4NB4A 1W2BM 3S1MJ 3SFMA 2YHBA 3CP2A 4HRIA 4B48A 1VQOT 4JOMA 4I98B 2WV1A 2BZ8A 3O80A 4PWDA 3MMYB 2OAWA 2DK8A 3CPWA 2ITMA 3QZ9B 3L42A 1ZGWA 2Z1DA 1T95A 1S72Q 2WBMA 1K9MR 2HZDA 1C6VA 1BI4B 3BTCA 4MZTA 3OW2M 4OIOF 1ZBSA 8ATCB 2XD0A 1R5HA 3BT9A 3S32A 4DOZA 2K5LA 4CC2A 1WH7A 4MQ9F 1KLMA 5H6RA 4UVBA 2OAUA 3NBPA 4F7UA 1HX1A 2GWKA 2Y30A 1P4XA 1Y6IA 2HXOA 3CWUA 4AT1B 1KAXA 2QSFX 4G6DA 3LWLA 4ELTA 3A03A 1U47A 3M9AA 1R00A 1SV5A 3E0JB 1H641 2LCCA 1N39A 1NG9A 1ETYA 2D8HA 3PMIA 3JCMf 4UUVA 3F2KA 3RSEB 3WU1B 3ZN1A 1H8KA 1ATRA 3R0JA 4OMNA 5F0XA 2XSDC 1X9WA 1BW5A 3SDBA 1IDZA 4DKWA 2VCPA 4ICLA 2VKDA 1IKYA 4FM1A 2IXSA 4KHNA 1O1WA 2VJ4A 2J5OA 3CC4T 1YUWA 2VJJA 5IPAA 3RMQA 3AAQA 5FLXO 2KJCA 3V8JA 4CVNE 4UUTA 1G3TA 1MPGA 2STTA 3QU6A 5DY9A 4ILJA 4DMNA 4PL7A 2GQVA 1E3HA 5K5RA 3WTSC 3PL8A 3GXOA 5FJ8J 4C5GA 1H9GA 1T0FC 3R0AA 3LM2A 2LCLA 1CF7A 3K1MA 2R93J 3JB9H 1R7JA 3AO1A 3CG7A 3R1XA 1T05A 1WAJA 5B8HA 2GF7A 5E79C 1TG0A 4KTWA 1WHJA 4YFUA 1GCQA 5IAYA 1NBWA 3THWA 4G6TB 3F8FA 2GOMA 2LFBA 5GANj 1VQ7Q 2V9PA 1IG9A 4WWCA 2ZO4A 2P7CB 4C2UA 2P9SA 1E7OA 2CSIA 1APLC 2ZJPL 2K9GA 3K6GA 3A8LB 2HOTA 1IXDA 5DM7R 3O4NA 2WA0A 1RT1A 1LV5A 3C2HA 4JUVA 3R3LA 5HVQC 2QEXN 1U48A 2NOBA 3O6BB 1XG1A 4CGZA 1UGRB 5CYVA 2F4OB 2R0QC 1FBQA 1ZG3A 3AA2A 3I4NJ 3NWSA 4KB0A 2XY6A 1MV3A 4JI8K 1YT3A 4ZC3A 2NUTA 1JCFA 1V29B 2H27A 3EYYA 2TCTA 1NYFA 1JRIA 4CCNA 2QWQA 1OH8A 1QWFA 4H4MA 1M5Q1 1Z9QA 3PX6A 5IP6A 1T8EA 3OYFA 1JLBA 3TU4K 2JVVA 1XB4A 5L3EA 2FVUA 3A5LC 1GVJA 2E1YA 1TUCA 3AVIA 1I8FA 4P5OA 2VBWA 2YX6A 3TAGA 2OZSA 1ZHFA 2L89A 4MGRA 5GAOq 3EKSA 3CCQA 1WSIA 4FJMA 3C1DA 3ZCMA 3VKIA 2QF7A 1VA7A 4OPHA 1IN8A 4BDZA 4DSJA 2ZGYA 3SJMA 1DUXC 2DN0A 3VMFB 1LWCA 4FT2A 5GADP 2F9TA 1VQ9I 4M3ZA 2DO7A 1BI0A 2R7UA 2YHWA 3KP7A 4Z94A 3BE3A 4DUZK 5GAEJ 3DLKA 2P9UA 1W2BA 5JVHL 2JNGA 4A4KA 1FMWA 3TAFA 1R4NB 1NHAA 3J80K 3QWLA 5H20A 3LP3A 2XASA 4F52A 1Q7YO 2EAYA 4BJ6C 1GXQA 2ABKA 5DMRA 4KI4A 2X6OA 4B4CA 4L5JA 2KDSA 1I3QJ 4CBUA 2HVSA 1B8IB 2I7NA 3DPUA 2NRZA 3EHQA 3A2KA 5LGNA 4B3AA 1JU5C 1RTJA 2PUOB 1TKXA 1VQLN 4PFPA 5DPKA 2C0TA 3C12A 2GTDA 1EO1A 3J81Z 2RREA 2EH3A 2EKHA 2OTJI 1B72B 1MKMA 3LP0A 5KAFC 3OYMA 3EE8A 4TVRA 3X26B 4M4ZA 4CGIA 3DM2A 1B9DA 4DBHA 4DV3K 3VQAA 3O2PE 5FDLA 4CHQA 1POGA 3UR3C 3BGRA 3OB9A 2OJ2A 5JHFA 4OPJA 4DTMA 5C0MA 4CJQA 3RTVA 2L7ZA 3E9GA 4K2EA 3H0HA 2PZSA 4QS8A 1FWZA 3KUFA 3EO3A 4OGCA 5LEJA 1S7AA 3E7LA 3LYIA 4M7DA 4DV2K 4AVZA 5HNHA 3SDGA 4RCBA 1VNDA 5LGTA 5SZTA 1YWOA 3J7ZI 4HZFA 5GANh 1J53A 5IYCJ 2OTLA 1NJIC 3TVTA 2EA4A 4KISA 4DTPA 2IEKA 5HDKA 4M7DF 1WHMA 2XHIA 4H0PA 4O55A 4V2GA 1XSVA 4WK8F 4D1QA 4F7UE 1D4XA 4XKVA 1EZZB 1VI0A 4Z2YA 1K78A 2X6YA 4CHPA 2J06A 2GM4A 5J39A 1U5TB 3V81A 2CH6A 4DS4A 2CDTA 2A68F 2M2EA 2LJ0A 3TAMA 2DJIA 3TW7A 2GXGA 3T5XA 1IGUA 1X1BA 2P1JA 5CE3A 4ME7A 2E8AA 4JKGA 4DCHA 2JSCA 1GXIE 4HDVA 2UU9K 1RABB 3H5RA 5D6WA 1OV3A 5KVRA 1KTQA 3OMGA 1DT9A 4KDPA 3N5BB 3M3ZA 4P9UA 1OULA 2COYA 1TWBA 2HZTA 2QI2A 1X4OA 3BJAA 1MIJA 1D3BA 2FLOA 1S8NA 2RHYA 4O5BA 1HSTA 2ZPFB 1B34A 2D0OA 3SEMA 2ACJA 4VUBA 3UATA 1Z6TA 3KP6A 1GLNA 3GTJJ 1WGSA 5FKMA 1XQPA 2X3XD 1TLHB 2P5GA 3CCRT 1F1ZA 3L2RA 4CCHA 4HSTA 1M90C 3V6DA 4F3QA 1L3UA 1YJNN 3PMTA 1HJDA 3GBTA 2B6AA 1ILYA 3SCXA 3EKUA 2QXLA 3LQRA 4RTFD 5EZHA 4ZYHA 1KA8A 4JX6A 3BWGA 2F5KA 3G71I 3QWYA 4CZFA 3REAB 2LF7A 1M2OA 5HK0A 5BREA 4RS8A 4X1VA 4BEHA 2XDBA 4BUPA 1OCRH 2KFDA 3NRVA 3LA7A 1OYYA 3J7ZO 4M78F 3VB2A 1H0MA 4LK0F 4IQJA 2DMQA 3CC2I 2RV8A 3D45A 3RNJA 1OH7A 2G8KA 3UWNA 1NK0A 2DXUA 3E97A 1KG2A 4JHDB 1HA8A 2Y0SA 3HEFA 3HB9A 1S3JA 1S6PA 3CO7C 1ZHIA 4CIFA 2D0NA 1PP8F 4J2EA 3CMAT 3K4KA 3H35A 4PSWA 2BGGA 1VQNI 4AMCA 3A8OB 3ZSZA 1ACMB 4AYBA 2VWJA 1GRIA 4LFCK 2F69A 2WV0A 2KRFA 3A0IX 3VV0A 3LSIA 3L9FA 3ULEA 4RCHA 2P6SA 2PJRA 2E19A 1AT1B 2P4TA 1KLNA 4FJJA 1FT9A 1RILA 4NHJA 3SHWA 4UXNA 1LJOA 3NNQA 1O7FA 4LSLA 4RMNA 2R5AA 3DTEA 3VSLA 1JUMA 4ZNXA 4PGGA 2ZFWA 4C0GA 1QO0D 1UJYA 2ZCWA 5CYMA 3K9TA 4FXDA 4G9ZA 2W82A 5J8CA 3JCMQ 2K2VA 4DNCA 1RT6A 3P31A 3W3CA 4PL8A 1TW2A 2GXAA 1D3YA 3I71A 2JS0A 1N8RU 3IAM2 5E41A 5DTDA 4MQ3A 2LX7A 3AVCA 4EV0A 3H8ZA 5KNLA 2NRWA 1P7JA 3M56A 1K9MC 1ORPA 4J2BA 3WTXC 1ACIA 3VPRA 1YJ9I 2IS3A 3G1OA 4A3BJ 1YJWQ 4ETSA 3P9IA 2KI7A 3FZVA 3AAPA 5F1JA 3GEZA 3ULRB 1FP2A 3LNQA 2A6AA 3A01A 1O75A 4BY6B 1FTTA 2LH9A 4RW8A 1XX5A 4O5VA 4EATA 2M1HA 2LMJA 3MX5A 4EZ6A 1RIOH 2V4JC 3DBHB 3M3YJ 3CC4N 1VQ4A 2MGQA 2ZBKA 4AG1C 4RW6A 2Q31A 3KP2A 1HDPA 2XAFA 3CCVI 1IKXA 3OL4A 3EFRA 4Y92A 5LHGA 1WSEA 3G6EI 3JW4A 2K9NA 3O9UA 5EZGA 4CK1A 4JJNK 2QBYA 3K0SA 1WSHA 5L3BA 2EFPA 2XF5A 4M7DE 5L3GA 3RWUA 1KSWA 1L3SA 3QYFA 1WLJA 1VF9A 2V1XA 1B3QA 2Q2EA 2XRLA 3MQ0A 4LDYA 5LJ5d 3CVSA 4EGYA 2CV0A 3J7AY 5D4RA 2AXTC 3LA2A 3K4NA 1RKTA 2JQ7A 4GRIA 3FM3A 3PE0A 2PX9A 4OAYA 4N0AA 3TCJA 1IHWA 3KFVA 3CO6C 2IT0A 2YR2A 1S1VA 4XEIA 1BB9A 2JM9A 5IHNA 1TUUA 2KIUA 4BE2A 3Q5FA 1U0JA 2JMWA 4A69C 2MLKA 2DFEA 4AU7A 4HPQA 2XGXA 4C92A 4FYWB 2Y9ZA 1VQ6T 2DVJA 3TDZC 1YI2T 2MD0A 1VQ8I 1BL3A 2E34A 1FK9A 1XDSA 5A2QZ 5M5XJ 4XIDA 4F7UB 4DQQA 3CMEI 4HBLA 5D6FA 3QNOA 3JRFA 2Q3SA 1NJIO 4M42A 3AVLA 3W2WA 4LG0B 4Y13A 4CC3A 4WFAL 2J05A 1TS9A 1VQMA 2YUOA 3K5LA 1U78A 3A5NC 3VS1A 1A5VA 5HS7A 4AIAA 4CJ3A 1D9FA 4BACA 1DGWY 4FU6A 3CC7I 3SAHA 1DTTA 2B7EA 4BREA 8AT1B 2FMYA 4CCMA 1TQPA 1OCCH 2K5IA 4CGJA 4A5BA 2V1DA 3OH9A 3CETA 2L9NA 3HM5A 3FHZA 2IIMA 5JVTA 3NVKA 3CCST 1SFKA 2QA4I 2GELA 2WACA 1GLFO 5J4VA 3H3ZA 1VQOI 3H1QA 5F0HA 2JUCA 1JKQC 2DMUA 1WFWA 4H5NA 1LVAA 2K57A 1KG7A 4F14A 2QQ8A 2OFKA 3CYMA 5D6XA 2YS9A 2DAQA 5TKWA 3KZZA 2EQKA 1LWFA 2Z1IA 3REOA 2E1ZA 3WGIA 3QFPA 3CM5A 3KETA 2A3LA 4D7NA 1X3MA 2ROLA 2EIFA 3SUNA 1IG7A 3VENA 1RAFB 2K86A 3IC7A 2CREA 2JUFA 4YOYA 5F1XA 1CKBA 3LWIA 1M90O 1Z7UA 3G4SN 4DLGA 4NXMK 2CUBA 3WQUA 3ENOA 1YIJT 4JEPA 3CCJA 4M3RA 2EIJH 5KN9A 2B8AA 3GF5A 2BEOA 3DI6A 1R58A 3UKGA 3X24B 4BRGA 1S6QA 3LAKA 4A5MA 3QDKA 2NYXA 3RR7A 3CD6A 3Q9VA 4Y91A 1WBDA 4V19S 2HHQA 2M87A 1D5YA 1PJRA 1ZRFA 4G94A 2LT1A 3AVBA 3KLIA 2DBBA 3M8FA 3OR1C 4FWRA 4DQ2A 1XTDA 4S04A 2PFBA 4I99C 1GV5A 4ISGA 3G71Q 5KE2A 3IWZA 4CJKA 2M4KA 3SQNA 4NDLA 1UUEA 2W0ZA 4XLPF 2M45A 1NK4A 5D6YA 4JI3K 2RJFA 1NGFA 2Z16A 3L6QA 2CJJA 4XTXA 1U04A 3QO3A 3LL7A 4EPCA 1RC9A 4BR2A 2M30A 2V6CA 4KUIA 2L3QA 3PNTA 1VAZA 1M1KR 3OS5A 1IRZA 3CC2Q 2RA2A 4H0EA 3FK6A 2YRDA 2F5CA 2VPLA 3OIPA 2A37A 1EH7A 2K5FA 1JEGA 3NQOA 4EDUA 3MP8A 1NM7A 1M9SA 3DYAA 2KYMA 4II3A 4R8HA 1K8AR 2XDDA 2VG5A 4JZ4A 2ZNYA 2AXLA 3KVGA 2AKKA 1W5TA 3HPWA 3QEVA 2P9UB 4Q5SF 4DFJA 3H5NA 2Y9YA 2FA5A 2WAFA 1J75A 1BIBA 4JS4A 4Z4CA 1LPLA 1K73U 2UYTA 2XGEA 1K6OA 3TL4X 4FM0A 2DMNA 2PY5A 1DU0A 3AVAA 1EH8A 3FMQA 1YTAA 3WGGA 3FK7A 2ZCFB 2CT3A 1KQJA 1QVGM 4A6EA 1EX4A 1N9SA 2GBYA 2EYQA 4AFZC 4TV7A 5EYRA 3HRTA 3K70C 2EQRA 2ISZA 4NUBA 2IVNA 4XQFA 1WNSA 1T6CA 2IS2A 5GAN7 3HBTA 4W5OA 2A5YB 1I94K 1K9MO 4H5VA 4L9VA 5CR2A 5AQVA 4B9SA 1IO2A 2AS5F 3NPFA 3E6MA 2IW5A 5LJ5g 4IEEA 5C0YA 2Q2RA 3CCRN 2O8EA 2R5ZA 2ZMEC 4AHUA 4IRIA 2M9UA 5TGTA 1ATNA 3SQ2A 3ABUA 4XK4A 3R61A 4N41A 1YJ9Q 3JRAA 2YJEA 1QMCA 1HJRA 1JKOC 2VWKA 2CV1A 5GTHC 3FB9A 3LP2A 3GNGA 4I2QA 3VEXA 3KLOA 4MO7A 1ASWA 4LD0A 1S3XA 3VQQA 3DLLL 2IIRA 2ESNA 4C92E 3LA3A 1KC8R 5H6QA 5IYBJ 4MO4A 4E1MA 2QLZA 4ENMA 4LUEA 4LD5A 1NK8A 3S2HJ 5CHIA 1FNNA 2HL3A 3QO9A 2L7MP 1CZAN 4BRAA 5FFXA 1CSKA 3CFOA 4LXCA 2KT1A 3JCMe 5CQEA 3OYDA 2E1HA 1NKEA 2FG0A 4A12A 1XTAA 5ILVA 1D5VA 4M78G 3SBGA 1X2KA 1MUYA 2RB6A 1Q81C 3F72A 5IXBA 3VS2A 1N6AA 1PM3A 1IW7F 3F23A 4FW2A 3F3XA 4KITB 4C23A 1UEBA 3GTQJ 4YNQA 4LLLA 4I76A 4DTRA 2YV0X 2NOGA 5EF6A 5FLXZ 1ZLMA 2HF4A 2OPSA 2OC6A 2VASA 1D3BB 5E1ZB 2LQKA 3QG1A 3JCMJ 3FXJA 4GFBA 2P5KA 2H8RA 3SZGA 1YVUA 2RF0A 1ORKA 4YIRX 5BQTA 5FLVA 2AQFA 4CI6A 1IUFA 1VQ8Q 3JAMO 5AR0A 1A6QA 2H94A 2V75A 3QYEA 4XLHA 3TPQA 2A6EF 1R0AA 2QTXA 4MLEA 4NZGA 4FJNA 2M51A 5MLCQ 5C15A 1SAUA 4DTJA 3O8MA 1KQSA 2FMLA 3RKYA 1BC7C 1QQMA 4A59A 3JR9A 4J9CA 4RB0A 3MEDA 3A02A 2E1OA 1QHGA 3VGLA 3JCMX 1WJAA 1ZGAA 3HTRA 4BEHB 3PGGA 1QZEA 3CCQT 2XKOA 3RTRA 4Y0WA 1JT6A 4H03B 4FM2A 2R7QA 2FRWA 3U1DA 3MVPA 3U9ZA 4F2RA 3G0ZA 2AP1A 2IJLA 1BIZA 2Q8KA 1F5TA 1EXQA 3WT0A 5LRRA 4WFNL 1VQOQ 4DR2K 4DR6K 3OH6A 3REBB 4BY1J 2DDAA 1YG2A 5LJVA 3G3ZA 5T7BA 1OYIA 3FE1A 4JK9A 3T19A 4I0BA 3CJQB 2IA1A 2E1CA 4HHTA 2CZ1B 2DL4A 3S6WA 1KZHA 2OQGA 3P83D 3M8SA 4KHUA 2VJ5A 2Y1IA 2XIGA 3QB0A 1QVGA 3ZT1A 4C8NA 2BZXA 1VTNC 4EP4A 1IN6A 3HSFA 3KEOA 2IGMA 2HOSA 2PJRB 2EYXA 1ZGJA 4CZGA 1VRLA 2R7RA 2EBPA 2CUJA 5IT9O 4N4HA 4M7AF 4A5NA 3SZ2A 3SUOA 2E5ZA 2DTOA 2W40A 2CZ6B 1FEXA 3JCMh 1ZLKA 3DXMB 4KN4X 3QIOA 3L2UA 5CVIA 4P5NA 2K3YA 4O4GA 4CIEA 4OMMA 3HBLA 3FC3A 2OA4A 1ZSZA 3IP4B 3DRSA 1ZYRF 4IFEA 1ZREA 3CC4Q 3WG9A 1GBRA 4EZ9A 2NS7A 3GTOJ 4NO7A 3OYIA 3CTAA 5FKKA 3C6HA 4BI3A 2M7BA 1TAUA 5F2RA 2OQRA 3BDPA 3QSUA 1R5ID 1RETA 1REVA 4AHVA 2OTLT 2HHVA 4J8OA 4G7HF 1R9TJ 3OSGA 3V7RA 2MMPA 3CF5F 1Y7XA 3A01B 4M63C 3DP7A 5I2MA 3HVTA 4H4OA 3DLAA 2CH5A 2DETA 3BR0A 4E6RA 4M77F 3BPXA 3CMAI 1OCZH 2R7TA 2YRCA 1UA0A 2FEIA 4IZZA 1SFEA 3VQBA 3QESA 1KG6A 2L7FP 3O5ZA 3Q7BA 4B3MK 2Y1JA 1E17A 1QVFS 3TP3A 3V42A 3IH7A 4LDWA 1LDDA 3SJJA 2I2LA 6AT1B 2QWRA 2LKSA 4MO5A 2GNCA 1L0OC 1JO8A 4QKUA 1MBGA 1TAQA 2KY9A 2DTUA 1B9FA 2HR3A 4OB1B 3VF2A 4BKXA 1SHFA 1G83A 4LDUA 2Y4YA 4NLCA 4CO8A 1UFMA 2GA2A 1YRNA 2DZ9A 1X3UA 1NKBA 1ETKA 3URGA 4DU4A 4KH6A 1U4BA 3CPWS 3KZBA 5HRRA 3I5SA 2HBJA 5AQOA 5CZ1A 5GMKj 1WHUA 1D1BA 2XO7A 1S29A 2CRGA 4RTYA 1KRPA 5C25A 4IL6C 1NMDA 3ABMH 1HPZA 4C92B 2XAGA 1FOKA 3IMXA 5ICFA 4A3EJ 5E3MA 3MXJA 2DOFA 1IO6A 2LKXA 1A5XA 2G7UA 2XMFA 4PHTX 3KP5A 5ICEA 1QRYA 4JI1K 5GMKe 4KH4A 2RQTA 3O3HA 2JW4A 4ZHRA 5D3GA 3DRPA 2WC9A 4HYEA 3CDHA 3OSVA 2V9VA 1X2NA 1M4ZA 3W6JB 1BU6O 3QEIA 3OS0A 4CGFA 5KE3A 1IKWA 5KYXA 2JZ2A 1WZOA 1EWRA 5CO7A 1HNIA 2X1CA 4M3WA 5EGOB 2A6TA 3A0BC 3K70D 3ZMSA 3ZQCA 2KK4A 2AA4A 1QP2A 3OL3A 4BY6C 1QVTA 3OYKA 1RKWA 2EINH 4JBAA 2WAQN 2JZYA 1YHQN 2RH2A 1G2HA 3H46O 3JB9D 3V9ZA 3QPLA 2HVRA 2GXBA 2DM1A 4BGDA 1Q81O 2FBIA 1HW1A 3J7YP 1MGTA 1YNZA 3KYDB 2ZE2A 2V26A 4UB8C 1W7PA 5GAMf 2ZPHB 1BI3A 1IRGA 4HT8A 4GYGA 1KVAA 4D6WA 2O9LA 4DWIA 5EJCA 4DR3K 3PSIA 4M73A 1UOCA 2YI1A 2M16A 2UV1A 2OJED 1O3RA 4YDUA 2HMIA 4B9UA 2X1DA 3I0XA 1YCSB 3O3KA 2P9NA 4PLLA 3T0YA 4IOXA 4C30A 1M8VA 2MIOA 2UUCK 4QVCA 1VQ6I 3V9XA 4JJDA 3N0UA 3I56A 3WTWC 1YI2I 3LDOA 1QZYA 1VQ5A 1IREB 2V7ZA 4DR1K 3FR0A 1O9SA 4M3GA 2DRKA 1LE8A 3DV8A 2R7ZJ 4Z6YA 4EJUA 5CKTA 3PQKA 4RTXA 2XAQA 4R0KA 4JI7K 4FX0A 3OJSA 3I8BA 4CEDA 1QZZA 1U84A 2KTQA 1NJZA 2KT0A 2CW7A 2A3SA 5K5QA 1DU6A 4PL6A 1RR7A 4AIHA 3GPLA 1SEMA 2UXBK 2HEQA 3F9KA 1FIPA 5CKDA 3OMCA 3HOSA 2NVXJ 2VPRA 3ML6A 3CCSI 4DB3A 2LTOA 2FQ4A 4BJTA 2WFBA 3VYGA 1R1UA 1GOCA 3NARA 3JSPA 4YFKF 3LW5E 2Z1HA 2C0OA 3BDUA 2MYSA 1J5EK 3M8QA 1GBQA 2IAIA 3H0FA 3NH0A 3E01A 1RUNA 2AK5A 1XCVA 4PJ0C 1RDAA 5GMKh 2DA7A 2GQIA 3IH2A 1RCHA 4RTTA 4WQ5C 3C94A 1NLPC 3IDHA 4LNPA 2WB1A 2DXCA 3TANA 1TNTA 2HTJA 3VS0A 3OA9A 2DJQA 5GADJ 5CQXA 4I6ZA 1W0TA 4F91B 1GCQC 2BW3A 4Z88A 1RBSA 3IFRA 3LALA 1W2BS 1YIJI 4OAZA 4M3UA 2RJDA 2D5VA 2NRVA 4HVJA 3BUZB 1TC3C 2DODA 3L7WA 3CCRQ 3CCMN 5KPTA 4EA4A 2F5FA 3ABKH 1ZUUA 4EVVA 1RI0A 3CCLN 4E7LA 3CCEN 2ZPGB 4M75D 1BGXT 2BE2A 1SKSA 2HDCA 3KTUA 3VS6A 5HOOA 4J9HA 3KBGA 4L0ZB 2NYSA 3BFMA 5FRMA 1KU7A 4CF1A 1W97L 3LL3A 3ZQLA 2M8GX 4KIFA 4PJOF 1M27C 3I3LA 2OCEA 3VETA 3ASNH 1HK9A 4MEXF 3HSRA 5C6SA 2R5ZB 3F22A 2JPBA 1K83J 4C8QF 4H0XB 3FDRA 2W6KA 1NJXA 1LCUA 5FLMJ 3AA4A 5J3LA 3TO6A 1AHDP 2DFHA 3AO4A 5M1FA 1Y56A 4LB6B 1D5AA 5GAN6 4K25A 3THKA 4M3FA 4RTWA 2GIZA 1BUPA 2P0QA 1YTYA 2BGCA 1SFOJ 3VQCA 2EBIA 2PEXA 3OYGA 2GAUA 2P0PA 2X4YA 1Z9ZA 1U9NA 1VYUA 2H3EB 3RMDA 5EEHA 2R7WA 4I09A 2KISA 2K4BA 4RMOA 3FBIB 3FKIJ 3A8YA 2KVQG 3I33A 3SZTA 4OMZA 1DGKN 1BOAA 3BY7A 1RNLA 3G7ZA 4OVAA 2VBYA 1KAZA 3QICA 2EIKH 2LY9A 2FBHA 4GVMA 1N33K 1BN5A 1X2QA 4WCGA 2X6WA 4B21A 2FZKB 4KMFA 4M3YA 3IHUA 4Q0BA 5CZ2A 2VE9A 2GWRA 2V79A 2V1NA 4PUSA 1VSDA 4KKOA 2LQ8A 3I64A 4CBWA 5TISC 2HF3A 2M3AA 5JVGF 1F9NA 4OU0A 4N76A 1DIZA 4XL9A 3I58A 3CCJT 4C2TA 5FFZA 1OH5A 4NXNK 2VVKA 2QSGX 3HL2A 1S1WA 1PKSA 1TBXA 3BG5A 2PG4A 3OYYA 3CD6T 3LDQA 3PQJA 2DA9A 3QP6A 2BKDN 4RB3C 1NG7A 2JLEA 2A6HF 2YUPA 4IEIA 3E1SA 1FIAA 1I1JA 1VQPN 3KCCA 1RT2A 4IG3A 3G73A 5BRDA 1ZQ3P 3O9RA 1YITT 1VQKN 3D5RC 3DTKA 4HWIA 4M7AG 2HBKA 2KRCA 3FWEA 1OCPA 2EILH 2EV5A 3CCUA 3EGXB 4R5PA 2KNBB 4M7DC 1Z0XA 1G2BA 2M5WA 1NPPA 5HK3A 2P7VB 2VIXA 3U3GA 1T0JA 1TZLA 5KCHA 4HVWA 1GFCA 5AFUH 4ID1A 4XOPA 4NB5A 1U1TA 4CCOA 2FBKA 5FD5A 1VSIA 3GTLJ 4J5YA 2Q0RA 1WPKA 1MWKA 3MN6A 5LMNK 1UDLA 1OR7A 4NCBA 3WEEA 4RKUE 1VSKA 2BXZA 4M3DA 4IEJA 4CEFA 5CIUA 2ZJPF 3JCUC 2YJFA 1ASUA 4H0YB 1G3YA 5DM6F 4YTLA 1QHAA 4AUXA 3UE5A 4E89A 1MSFC 3K5OA 4FVUA 4PCQA 3JTGA 3ULDA 1RAAB 4IVNA 1VK0A 3F70A 1HCRA 2E2IJ 4H8KA 1PRLC 3EE9A 4JX5A 2SEMA 3VPZA 4LSNA 3KD5E 4M77G 4CECA 4XIUA 4AHRA 4QPOA 4GLMA 2DO3A 4DTOA 1UGSB 4W5QA 1ZUYA 1MDUB 3H6EA 1ON1A 4BD3A 4HLXA 4CHNA 3I8DA 3CXCM 4GXOA 2ISYA 5CJ9A 4PUOA 1RFQA 1N77A 5GMKi 1A36A 2VGNA 5ECAA 4Q48A 4ZGDB 2K79A 2DTZA 3FZFA 4KV8A 5KK1A 2EQUA 1PUEE 3MP1A 5BPLA 5GAHJ 3FM5A 3DXJF 3O8HA 4QS7A 1YWPA 2I5JA 2E6ZA 4FJ9A 4JLIA 2VQLA 2DPUA 1E0EA 2DMTA 1ZSZB 5JICA 2GEMA 3FDYA 3CCQI 1DQUA 2PJPA 3ZMTA 4EAHD 1VQ7A 5AQYA 3NF9A 2VI6A 4IWVA 2P9LA 3D5LA 3CCSQ 3DQVC 3HG9A 2HSTA 2E4LA 5DV5A 4ZDPA 4D8KA 4DBQA 5AZIA 4PJOE 2YHYA 1ETVA 5FB2A 1SKRA 1F4KA 4CXFA 2WBNA 4HUFA 3CLQA 4A3MJ 1HYOA 3DU6A 4B1VA 5BPNA 4R79A 3GYHX 2QYOA 3ASKA 3K4BA 2R7SA 4U7BA 3A0HC 1WB9A 1XHZA 5GANf 2NUPA 1ETWA 3EDPA 5AJ3K 4GY5A 2RN2A 2ZSHB 1ESVA 4WX9A 4OFAA 1N6QA 4OIRF 2HCKA 4Y17A 1M1FA 4XSZF 5DLOA 2FJ1A 2WADA 2G8FA 1J0RA 4QVZA 5EU7A 3VS7A 1Z3XA 2RHXA 4ENNA 3SXYA 3AL0C 1WEIA 1MMNA 1SZ2A 2ED0A 3C0CA 3CZ6A 1YIJQ 5K5OA 1MDMB 4HTLA 1M30A 4Y3OA 3CJAA 1MMGA 2KMTA 1V5GA 4KA4A 3NH2A 1N75A 2PMUA 1YRNB 4ZYDA 2KZZA 5I2SA 2CP6A 1P9QC 1BL0A 2DA1A 1X9SA 1WQ7A 4LF6K 3ZCOA 4B1UB 5D5WB 1A31A 2K2MA 1I6HJ 2KQRA 5GAGJ 2CH4A 4DJAA 2XF7A 1VSFA 1UB9A 1HUXA 3HK2A 2F7TA 1OCTC 2OTLI 2GZWA 1HDDC 1H3HA 4CZZA 2A1SA 1RBTA 3RQ4A 1T38A 4W97A 4A0ZA 4DSKA 2R7XA 2EQJA 3MJXA 1D8YA 4EM0B 5M3MJ 4A3FJ 2HKQB 5D5XB 1FBSA 5KYXB 3C7NB 4PKCC 4LGWA 3CJ1A 3OOPA 3K5NA 2JMAA 1FOXA 3JV3A 5DM7F 5GMKl 4X64K 4FLVA 2E36A 2N8GA 2VBXA 3AA3A 1WJDA 2H8WA 1USTA 3ZT4A 4MLOA 3HJFA 3NVMA 1H88C 3JAMZ 4EIAA 3GBGA 3WVEB 2VQHA 5ILUA 1O3TA 1W7PB 3MEGA 4BQQA 3VUZA 1KVCA 1TKZA 4IIMA 1T44A 2PVGB 4A0YA 4YOXA 3AG3H 3TKYA 2JHNA 3P8HA 2EJFA 2EWSA 3WODF 1ABQA 2LZ6B 4KO0A 1J54A 2AJQA 3RMCA 1AHJB 3FZHA 3N4QA 4ILGB 2OZUA 3ZSOA 4A63B 2LVMA 2O4IA 3I59A 2DTRA 1BI4A 2P9NB 2OU2A 1IBMK 1RT5A 2DCEA 2WSCE 2M7AA 3LZJA 4C8MA 2W24A 4FOEA 4BAYA 1HR0K 3PIOF 4MFEA 2JTEA 2DQLA 3ZPLA 3SFIA 4N0AC 2TDXA 2ENMA 3PO2J 4EM2A 1Q86R 2DA3A 1N5ZA 1CXQA 1UB4A 1OYXA 3V4GA 5FROA 3CDIA 4QVDA