3L2WA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and gs9137 (elvitegravir)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2wA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2wA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2wA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2wA03
3EYZA 5HRPA 4OKJA 4DQQA 4CF1A 4JLHA 3HP9A 3NTHA 3CQ8A 1WSJA 2E6MA 4QOZB 5KTQA 3ZSQA 3CEYA 4QQ6A 1RCHA 4DLEA 4FJHA 3AVHA 2VWKA 2QQRA 3DB3A 3PMIA 4FYDA 2Y1JA 1H3ZA 1NK9A 4DFKA 5IN1A 3M8SA 3NF6A 1C1BA 2X4XA 2M1HA 2BANA 3VQ6A 4LD6A 1LWCA 1RBTA 3BDPA 5SWMA 4C5HA 3AVFA 4WE1A 2OPSA 3V1QA 3C95A 3KUFA 3SV4A 1KRPA 5KRTA 3HPOA 4HCBA 4RG2A 3LP1A 1FK9A 1RT5A 2G8WA 3LX7A 2IG0A 1C0MA 3P1GA 3HSTB 3QEIA 1CZBA 4DTNA 2G8KA 4G1QA 3LDSA 4E19A 4DSJA 4HVJA 4FLUA 4DSFA 4N5SA 4CGFA 3LALA 5J39A 1JLEA 4DFJA 4CHOA 4CJ4A 1L3VA 4O0JA 3SQ1A 1RTHA 1TKDA 5C25A 3H8ZA 5J1EA 3ME9A 3DM2A 5KGXA 2X35A 2KW4A 4AH9A 4C8LA 3F70A 4IDKA 4RW6A 3SD4A 2Z1HA 3ZCMA 3THVA 4E1NA 4E7JA 4LH5A 2ZD1A 2X6SA 3TAQA 3LGLA 1LW0A 3H08A 2XK0A 1IKVA 4N4HA 2DIQA 1N5YA 2LSNA 5C42A 3OYKA 5KCHA 1VK0A 2JTFA 3MP1A 1BHLA 3I0SA 1SV5A 3NFAA 1HYVA 1N27A 3OS1A 4FJKA 1FKOA 3V1RA 1TGOA 3TAGA 3MEDA 1JL1A 4B8CA 4B9NA 3MAQA 4FJXA 5C0MA 2XY5A 2KZZA 3QJ6A 3ITHA 3BDLA 1LV5A 3OB9A 3QEWA 4Z4CA 3K58A 1Q9XA 1VSIA 3V9UA 1VSDA 1IKWA 4MQ3A 1NK5A 3S3MA 4OKEA 2PZSA 3KKSA 4CGIA 3OYHA 3RRHA 2Z1IA 3K5NA 4DF4A 3AVCA 3TR8A 4FLWA 4FK4A 3SUOA 2HHUA 4F3TA 1NK6A 4BD3A 4N56A 3OYGA 1RNHA 2GFUA 3KKRA 1T7PA 1HNIA 1LAVA 4CJRA 3CFPA 3FC3A 2JZ2A 1RDAA 4LSLA 4KFBA 4IG0A 3HM9A 2MWPA 4LSNA 2X74A 1J53A 4F8RA 4K8ZA 2BKDN 3HO1A 4EZ6A 2FBYA 4C8NA 5J2PA 3QIOA 4OKKA 2RJFA 4B9VA 3TAEA 1JL2A 3IAYA 1C1CA 4NS5A 5E41A 1WN7A 4FJNA 3AVAA 5CIUA 4E89A 1QSYA 4Y1DA 1BI4B 4HUEA 4FM2A 4H4OA 2EQKA 4DSLA 5J2MA 5HRRA 3LGFA 2IGIA 3TAPA 4AHSA 4M3UA 2GF7A 1T8EA 3FDRA 3HL8A 4FZZA 4FJJA 3ISNC 2DIGA 3PX4A 2FBTA 3HPGA 3G10A 4DTOA 1BQNA 3DOLA 4E1MA 2EX3A 4FXDA 2JGUA 4NCBA 1EKEA 4W5QA 1JLGA 1KFDA 1BISA 3K2PA 4QW2A 2X78A 3JSMA 1NKEA 2OZMA 2HW3A 4M3YA 4C5GA 1DTQA 2L89A 2YNIA 3OS0A 3A2FA 4J2EA 2QKKA 4CJQA 2M16A 3NF8A 1X9WA 4QQDA 2WONA 1S1VA 3P83D 3ULDA 5KRSA 4M3WA 2RI2A 1X9MA 2DTUA 1VRTA 1KCFA 3TANA 1MHNA 1ZBIA 3OYCA 5D6WA 4CESA 3SQ0A 3WNHA 2QQSA 4BWMA 2ETJA 1OYXA 1NKBA 2A1RA 3ZSVA 1WAFA 1RTIA 4CEBA 1B92A 5IAYA 3QEXA 3PFSA 4JS4A 2D0AA 2ZQBA 1OZ3A 1RTDA 1SKRA 3OMCA 4AHRA 3SQ4A 2HQXA 4FJLA 2M0OA 4OPKA 4C8KA 4OGEA 3CM6A 1XWLA 2R7YA 2DAQA 4IURA 3L2RA 5K14A 4OVAA 3ZT4A 4DTSA 4KHUA 3M8QA 3H6ZA 1SUQA 2G8VA 3DLEA 4W5OA 3SNNA 3HK2A 4GMJB 3DLHA 4CJLA 3AVGA 2XY8A 3NH0A 3CM5A 1JXBA 4Z0UA 1JLAA 5C6SA 1QHTA 4KHQA 3VQEA 3ZSXA 3KLGA 4PY5A 4B8AB 4J2BA 1EP4A 3LH0A 4KI4A 4C8OA 3VQ9A 1J9AA 3ASMA 3MXIA 3LANA 1GOCA 3E01A 4FM1A 2RJEA 2R58A 3KK3A 1WNSA 3HP6A 2O4GA 3KD1E 2R57A 3OYFA 3V1OA 4DMNA 1C0UA 1LWEA 1REVA 2Y1IA 1U49A 3C4SA 2G8HA 4DTJA 3SUQA 3L2VA 4CK2A 3AA5X 3CYMA 4NZGA 3HYFA 4CERA 3S3OA 3ZT3A 1RBSA 4M3RA 4CGDA 4LD0A 1NK7A 4ZTFA 3OS2A 3OVNA 4OVLA 5KI6A 4JS5A 4E0DA 4Y1CA 2EKOA 2W42A 3NGZA 2AJQA 5HBMA 4DTRA 3D45A 4DQPA 1KLNA 3NAEA 2EHGA 2IC3A 3LAMA 4I9LA 4FJ7A 3L3VA 3SZ2A 4DSEA 2Z1GA 3JYTA 4KAZA 2F5KA 4DFPA 4O55A 5HRNA 4A4GA 3HVTA 3QERA 2ZE2A 1TAUA 4N4GA 1KTQA 2OYQA 2D0CA 2VWJA 3OYNA 3O3GA 4N76A 3ZT0A 4CFDA 4KHNA 2OPPA 2XRIA 2MWOA 1R0AA 2B8AA 2R5AA 2HVIA 4ELTA 2RI5A 4E3SA 4E7IA 3ZT1A 3VQBA 2PYLA 1WGSA 3NTKA 3ZSYA 4BE2A 4B3OA 2HHQA 3QIPA 1G5VA 3MEGA 1F21A 5CY4A 3NH1A 1ZBFA 4B9UA 4NCGA 3RMDA 1L3TA 3BGRA 1IKXA 1SL0A 3CFOA 1L3UA 2CKKA 4KTWA 2E5QA 4A4EA 1HQUA 4O5BA 1EETA 3K5MA 3OYEA 4LY7A 1TV6A 4W5RA 1TK5A 2L3RA 1DLOA 4FJ5A 2QKBA 4I9QA 3OYJA 2O4XB 1SL1A 3P8HA 4EDUA 1BI4A 3VN5A 5HRSA 4F4KA 4DG1A 2RI3A 4F2SA 4OLAA 4CGHA 3CFRA 1SL2A 4KHYA 1QQCA 3KK1A 3ZSWA 4KV8A 3P8DA 1UWBA 2F8TA 2QK9A 3I8DA 3PMTA 1S5JA 4Z4FA 1K6YA 4N47A 5HLFA 4CJKA 2OPQA 3VQ4A 3KLFA 2VYTA 3LZJA 4DFMA 3G0ZA 1SKWA 1NK4A 4DTUA 1TKXA 3AVKA 3QIIA 2E6LA 2LRQA 3RMCA 3L42A 1BIZA 3KTQA 1FXXA 1EXQA 3V81A 4YNQA 2PQWA 4F3OA 2Z1JA 1TK8A 3O4QA 2EFIA 3KK2A 3U3YA 1UA0A 5FRNA 2G3RA 3KD5E 1OZ2A 5T7BA 4HUGA 3MXMA 4ELVA 4B9XA 2YNFA 3AVLA 3F9KA 2RHYA 2KFZA 3U6FA 1HNVA 3PX6A 2HHXA 4CIEA 1J5OA 1DTTA 3VQCA 4HTUA 3FFIA 4B9LA 4I2QA 1S1TA 4IFVA 3AVBA 4I2PA 3O3FA 1GOAA 1A5XA 1NJYA 4MFBA 4CJUA 3OJSA 1C1AA 1FKPA 1WSGA 4QQGA 1U47A 5FROA 1D9DA 3HJFA 2FHDA 4E7LA 4Q5WA 3MEWA 1I3AA 3IG1A 5EU7A 4DQSA 2E6NA 3KJVA 3D0PA 3QEPA 3DOKA 1BL3A 3DLRA 2LDMA 4CJTA 4H8KA 4PQUA 4CFCA 1ITGA 1JLCA 5CZ1A 3TAFA 3V9SA 4NYFA 4DTPA 4PUOA 4CGJA 5HROA 5KE3A 2F8SA 4CJPA 3T19A 4FZYA 1UAXA 4OPJA 3NF9A 1RBRA 3SV3A 4IUQA 4L59A 4CF0A 4FM0A 3O3HA 3AA2A 4R5PA 4CK3A 3OYIA 4II1A 4H4MA 1RDBA 5KCOA 2EQUA 4EZ9A 3RRGA 4DQIA 1KVAA 3ASKA 3V4IA 3UWNA 4FLZA 1KVBA 2BIVA 1S9GA 3LYIA 2OZSA 3WNEA 5DMRA 4JRPA 5CYMA 2RN2A 4FJ9A 3TI0A 1NKCA 3UT1A 2HNDA 1RTJA 2A1SA 4BDZA 4DS5A 2G8UA 3NH2A 4YFUA 4NCAA 2RHUA 4PWDA 3QNOA 4CEZA 1RDCA 4CJ3A 2RO0A 3OYBA 3NGYA 4CEOA 1NK8A 3UIQA 1U04A 3VQAA 4DU1A 2DFHA 4QVZA 1TL3A 4PA1A 2RHZA 4KREA 4M45A 3AVIA 1A5WA 4CJEA 3DRRA 2RHXA 4KB1A 2KQ2A 2NLUA 4FJIA 3NGIA 4CEEA 3MEVA 3LP2A 3META 4OJRA 4FJGA 4KPYA 1WJSA 1RILA 4C5IA 2B5JA 2GUIA 2RF2A 2KTQA 1NOYA 4W5NA 2WOMA 3OJUA 3AVJA 3TWHA 2RHIA 4EP5A 4FLXA 4CEQA 5D6XA 3V9WA 4J2AA 4NYNA 3ALYA 1SKSA 3TABA 2DY4A 3LP0A 2HHSA 3NNQA 4Z4EA 5J2QA 4FJ8A 1U48A 2NUBA 3AA4A 4KHWA 2IDOA 2IS3A 2GBZA 1WAJA 4FL6A 4UC4A 3AO2A 2BDPA 2FC0A 2RJCA 2VG6A 4FU6A 3K59A 3DI6A 3Q1JA 4DU3A 5JS1A 2O4XA 3DRSA 4CHZA 3L3UA 1ASVA 4CF9A 3RMBA 3FLGA 4CJVA 3FEOA 1TKZA 2YHAA 4CF2A 4RW8A 1G15A 4OLBA 4BDPA 1HPZA 4AHUA 3LP3A 3RR8A 4ICLA 3DB4A 3ZSZA 4UQGA 4IUPA 1A5VA 1CZ9A 2HVHA 1L5UA 3TARA 5I3UA 3KLEA 4ID5A 4CRIA 5CZ2A 2X4WA 3S6WA 3ZSOA 1ASWA 4CF8A 1WSEA 4LH4A 2LVMA 4CHPA 3EZ5A 4E7KA 2WACA 4KB0A 2P51A 2G8FA 1JKHA 4RW4A 1XHZA 4OGCA 3QBYA 4W5TA 2YV0X 1ZBLA 1BGXT 3RWUA 3VQ8A 4CHNA 1UA1A 4AHCA 2KZMA 1WSHA 2D0BA 2XY7A 3LPUA 1JXEA 3DMJA 5D3GA 1XHXA 4CJFA 4ZHRA 3SPZA 3I0RA 3T3FA 3DLBA 4BWJA 1S1UA 3AO4A 4E7HA 3AO3A 1WJRA 3RTVA 4M3TA 3AO5A 4CFAA 1YVUA 4DSKA 1OI1A 5J2NA 1RBVA 2L8DA 1RT3A 3OYAA 3NCIA 5JS2A 3SQ2A 5FRMA 3MP8A 3PV8A 4CHYA 3HVRA 3DLGA 3S3NA 4FVMA 4IG3A 5KGWA 4CEDA 4ZTJA 4ELUA 2KFNA 2O4IA 4CHQA 3SYZA 3V9ZA 1BIUA 1C6VA 4O44A 1L3SA 1KFSA 1BQMA 4FK0A 4FLTA 3QKJA 4FW1A 1NJXA 1Z26A 4Z02A 3HPHA 4CJWA 2B4JA 1D5AA 4AILC 5I42A 4Z4GA 4B9TA 1VSHA 3K5OA 5KE2A 1NOZA 2P0KA 5C24A 5HP1A 1Y97A 2JLEA 3PY8A 1LW2A 3B6OA 4BACA 3KIOA 3KLIA 2RKIA 3KLHA 2FBXA 1ZBUA 1O1WA 3AA3A 3MEAA 4FZXC 4IUVA 1CXUA 3OYLA 1BCMA 4CECA 3ZEHA 3M8RA 1XI1A 2OPRA 3VQQA 2RPIA 3LWMA 3LAKA 4PL6A 4CJSA 2FBVA 4XIUA 3LWLA 4KTZA 3U3GA 1VSKA 2LCCA 4FLVA 3SJJA 2P5GA 1YTUA 1C0TA 2D5RA 2BGGA 1IG9A 4FJMA 2F96A 4HCZA 4DTXA 3PX0A 1Z25A 3DRPA 3NE6A 3K5LA 2OA8A 1U45A 1LAWA 3V9XA 4AHVA 3QNNA 1YT3A 3NBPA 1HQEA 3WNGA 3AO1A 3P5JA 3AVMA 2R5MA 2HHTA 1JLBA 1KVCA 3F73A 3EY1A 4IKFA 3VA3A 2G8IA 3QLHA 4F2RA 3M8PA 4KI6A 2BUDA 1XC9A 3HXMA 3OYDA 3AVNA 1XNIA 3C6TA 3OA6A 3S9HA 3EAEA 1HYZA 2PY5A 4CGGA 4A4HA 3VQ7A 3OMGA 4IBNA 2IOCA 3SUPA 1W9HA 2VG5A 3IS9A 5KH6A 2HB5A 2VG7A 1WSIA 4GVMA 4BE0A 3SI6A 4DF8A 4C8MA 1JLQA 4EP4A 4KKOA 1D9FA 1CLQA 5DK5A 4RW9A 2YHBA 2XHBA 2YKNA 4FW2A 2K3XA 1Q9YA 4J2DA 4A4FA 1WSFA 4DTMA 2D9TA 3DYAA 4RW7A 2DFEA 4Z4IA 1UOCA 4B9MA 1S6QA 3MEUA 3E9GA 1HYSA 3LLRA 3RR7A 3O8VA 1RDDA 3DLKA 2E4LA 2I5JA 4DU4A 1JLFA 1RT1A 3L2UA 3C94A 1GOBA 4IUTA 3HT3A 4M3ZA 3LZIA 3VQDA 1RI0A 3OY9A 1QSSA 3QO9A 4FCYA 2ITGA 4GW6A 1W0HA 3LPTA 2P5OA 3V6DA 4HUFA 3CG7A 1HJRA 1WLJA 4DQRA 4DS4A 3OYMA 3AV9A 2QXFA 1VSJA 4B9SA 4M41A 4CIGA 5CYQA 2LTOA 3M9QA 4N41A 2EQMA 1ASUA 2ATQA 3OQ5A 2BE2A 3MXJA 3VQ5A 1T03A 1NK0A 1S6PA 3SCXA 4K8XA 4DSIA 1RT4A 2DFFA 2YNGA 1KHCA 1J54A 1CXQA 3L8BA 3PNWC 1I39A 3K57A 2YNHA 4CE9A 2RJDA 4HHTA 1VSMA 3PUFA 4QCLA 1NJZA 1VRUA 1HRHA 3VA0A 1IO2A 1RT2A 2PYJA 3B6PA 3PO5A 3C6UA 1S1WA 3L2WA 4M3XA 1YTAA 1QSLA 3MEEA 4I7FA 2XDPA 4BDYA 4TSXA 4CFBA 4M42A 4CJ5A 1S1XA 4QAGA 2X6NA 4FK2A 2B6AA 4CK1A 4B08A 1QE1A 3PO4A 2GFAA 2EQJA 3QESA 1KSPA 5J26A 4KTQA 3L2QA 4GY5A 2HHVA 4O4GA 4RG8A 2YRVA 1B9FA 1TKTA 3NF7A 5SZTA 2IAJA 2K3YA 1HMVA 1NJWA 1N6QA 3WNFA 3SUNA 2Q3SA 1VSEA 3E9FA 4Z4HA 3NHGA 1SSFA 4CIFA 4C5EA 4Q0BA 4KO0A 3TAMA 3QINA 4FLYA 2HMIA 1T05A 4JRQA 1X9SA 4O0IA 4N4IA 1QS4A 4IUUA 2P1JA 3T1AA 4KHSA 3NTIA 1QTMA 1S9EA 4CEAA 2HQEA 2HNYA 4CEFA 1ZYQA 1RT6A 4PLLA 3ZSRA 1D8YA 1BCOA 4DLGA 1EX4A 1IH7A 3MECA 4PLIA 4X34A 1TVRA 4HCCA 4KRFA 1RBUA 2HNZA 1VSFA 2YKMA 3QEVA 3MO8A 1ZBHA 4CCHA 4B9WA 4BE1A 2XY6A 1MU2A 4IFYA 1KLMA 3SPYA 3ZT2A 1VSLA 1X1PA 3QETA 3O4NA 1TAQA 1WJQA 1TL1A 1TK0A 5M9OA 3VQPA 4DWIA 3IRXA 4ID1A 2XO7A 3DLMA 2X4YA 4L8RB 3NDKA 2HHWA 2GV9A 1IKYA 4AHTA 3RMAA 5D6YA 3MP6A 3GOXA 1LWFA 1RT7A 4Q5VA 1B9DA 1Q8IA 1U4BA 5FDLA
chains in the Genus database with same CATH superfamily
2W1OA 3EYZA 4DQQA 2M4GA 3R6NA 4BC3A 2DLPA 1SD5A 5GMKl 3HP9A 2P9KA 5AR0A 4M78G 3WODF 3NTHA 4H5WA 3S17J 3CMEN 3CWSA 3SBTA 4QOZB 1NTCA 4Z89A 5BR8K 1IG7A 3QXEB 3ZSQA 3M54A 3C6HA 2QKLB 4UB6C 2FG0A 4LB5A 3AVHA 2KR3A 3FX3A 1TS9A 4GLKA 2YG9A 4E9FA 4KDPA 5E3LA 2DA9A 1WYXA 3N5BB 1USSA 3WVDB 3MQ0A 1GUUA 2JA5J 4RGUA 3O80A 4E6KG 3LFKA 1AU7A 3CCRQ 2UV1A 1HKBA 2QM3A 2VBWA 2Y1JA 2FF6A 3CPWA 2CH5A 3J7AY 4ENJA 1DJ7B 4NQWB 4DFKA 2M8GX 5GAN5 1RRJA 3NMUA 1K8AO 3B8AX 3GL1A 1KJWA 1K4TA 1C1BA 4DCHA 2IEKA 1PSEA 5CCAA 5SWMA 1G4DA 1F5TA 4WE1A 3UA6A 3G0QA 3JRFA 3ZQ7A 3QRFF 3KUFA 1X19A 5AQQA 4GRIA 3PJRA 2QWNA 3LP1A 5LJ3f 1VQ4A 2P9PB 6AT1B 2R93J 2E34A 1W4SA 2G8WA 2X4JA 3E9OA 3QMLA 5DDGA 2P9SB 3HM8A 2ZJRL 3HSTB 1G3YA 5TGTA 5M3MJ 1M1EB 2RQVA 2G8KA 2IVNA 4G1QA 1UJ8A 4N5SA 2LF8A 4B3RK 4IHVA 2CYZB 4JJCA 1AWOA 3SQ1A 2DTRA 1M1FA 2CFXA 2E3IA 1K78B 4E6RA 2ESWA 1TKDA 1I6XA 3QSUA 4CYCB 2HWVA 2JN6A 4BS9A 3CUQA 4LB6B 3VF4A 4CZLA 3L1PA 1WNLA 1DGKN 4RW6A 3EFRA 2E71A 3SD4A 2Z1HA 3NEUA 2K40A 3CCMI 4RTXA 4B3AA 3MMVA 3TAQA 3ZQFA 3H08A 1IXSB 4IEEA 1VFCA 2HI3A 3CUQC 1TH7A 3VETA 1SVMA 3R6OA 1F9NA 1GT0C 4QT7A 1N5YA 5C42A 2ZGZA 3G6EA 3L0QA 1VK0A 4D1QA 3HOSA 2RN8A 1Y0UA 3I0SA 1SV5A 1W1WE 2ABKA 2CSQA 4A61A 3V1RA 3TAGA 1YJ9I 2NVTJ 3AG2H 2DPPB 2CH4W 4DOVA 1ABQA 3AGRA 1PYVA 3BJOA 4FJXA 1N9SA 2IS4A 2DI3A 4MZPA 4FYXB 1ON2A 5D8KB 2X6OA 5HS8A 3ITHA 2W10A 1ETVA 2MCNA 2CV2A 5DPKA 4DV6K 2EA4A 3IWZA 4IXAA 3LW5E 2L0AA 3S3MA 1NG7A 1KG2A 3KKSA 4BQAA 3J81O 3A5ZB 2WSEE 1Z67A 4CC7A 4AIJA 4A2BA 4MO4A 4DF4A 1I81A 5KAIC 1Y71A 1KAZA 3M0RA 4N56A 1NHAA 3OYGA 1NGIA 4A3EJ 2UUCK 2V79A 3UKUB 2GFUA 3KKRA 3CCJA 4FSVA 4JK1X 3CFPA 3OH6A 1E6HA 2G7UA 2KIQA 4J5YA 1D3YA 5IP7J 5J1UA 3CCUQ 3FK7A 4GXOA 4ZN1A 5A2QO 2VVKA 1OH8A 1ZG1A 2FZGB 2NZTA 2ED0A 1I1GA 4RB0A 2JW4A 2A6EF 1SMTA 3HO1A 4M3BA 3ULRB 2CW8A 2FBYA 5FPEA 1XSVA 2FNAA 3RCOA 1TWGJ 3RYPA 2YDLA 3FGUA 2BH1A 2RJFA 1EQYA 4B9VA 4Z94A 2NS0A 4A5AA 2JA6J 4CDGA 4RS8A 3OBYA 4Y1DA 4FM2A 2VQFK 4AYBN 3W2VA 1AWCA 2L0KA 4VUBA 5HRRA 3I59B 2IGIA 2EZKA 2E1CA 1T8EA 3FDRA 3HL8A 5LJ5e 5EYRA 3ISNC 5JLWA 2DIGA 3HZ6A 2E6ZA 3PX4A 2FBTA 3G10A 1NYFA 1BQNA 3DOLA 4E1MA 3UNGC 1VQ5A 3FIFA 4RB3C 2CG4A 4BL0B 4IOCF 3EFOB 2K3FA 2H6BA 4C92D 2QEXA 3OV8A 3SK3A 4IIOA 2F5CA 2QA4I 2FX0A 2X78A 3JSMA 1PD0A 5L3DA 2HYJA 3HRUA 3SHWA 1GVDA 4C5GA 1L3LA 1OQKA 2HTSA 1XQSC 2L89A 3I56I 2HVRA 3A2FA 4EMSA 1BN5A 2H3JA 1OPKA 1XGNA 3WTTC 1IN4A 2CSOA 1B59A 3REAB 2M16A 1R0BG 2P7VB 3SAGA 2IVOA 4EMKB 3FK6A 1SZ2A 1IBMK 1S1VA 3R6MA 1WRJA 2E60A 1Y96B 1R59O 1IJJA 3IAS2 5KRSA 2JJ9A 2DTUA 3WG9A 1B9MA 4PIIA 4M75B 4HNUA 2GWJA 4RTFD 2BY3A 2YX7A 1MHNA 1IDZA 3OYCA 2R7FA 2KHOA 3SQ0A 4BWMA 4UXNA 3HIFA 1KQJA 1OYXA 2A41A 4EM1A 1NKBA 3ZSVA 3CCLT 1HNXK 1RTIA 3QP6A 5CVUA 4CEBA 2ZNYA 4F16A 3X24B 1KU9A 4JS4A 5GAN7 4AM6A 2D0AA 1XDUA 1Y8RB 4JI7K 2PFUA 3CJBA 2L01A 1JJ2M 4YOUA 3ZGKA 1ZK8A 2JNGA 5C0YA 5CQGA 2KDSA 1NGBA 1X27A 4IO8A 1W7PD 1LVAA 1S3XA 1SUQA 4M75D 4W5OA 3O9SA 4CJLA 3AVGA 2IXSA 4KISA 5LL6Z 2ECCA 5LHGA 5C6SA 2E10A 2DJQA 4KHQA 2VYPA 5E1XA 3E1SA 2GUPA 4B8AB 2AHQA 2Y2ZA 2PAVA 4IWVA 3CQXA 2CW7A 3VQ9A 2E7WA 1XQPA 2A6AA 3INZA 2IPQX 5FLXE 2DOEA 2K9SA 2WAEA 2BHYA 1GOCA 1K83J 4FM1A 4AFQC 2HVSA 3TSWA 2P81A 2DFUA 3OYFA 3V1OA 1GVJA 3FHZA 4CUGA 1ZSZB 1REVA 1J5YA 3HDDA 3K1NA 1WEFA 2DA6A 4PFZA 3H46O 3EKSA 1SD7A 1IV8A 4X1VA 4J9EA 3DPLC 3ZQCA 1TUCA 1S22A 2E88A 3VOEA 3MN6A 4HVUA 2C0OA 3D5LA 5CVJA 2Q0OA 1RBSA 4IZ9A 1H8KA 1YJNT 3S32A 1H9TA 3BFMA 2JM9A 2DQLA 4LIUA 3G71Q 2WTEA 3A01A 2QG9B 4JS5A 2VJIA 3RNJA 4QVCA 2W42A 3X26B 4NB4A 5HL7L 4BY9C 2AJQA 1KQSM 4LITA 3H9GA 1T98A 3D45A 1BIAA 4DQPA 1KLNA 3NAEA 2EFOA 3F22A 1WZ2A 3FMQA 1A35A 1D1CA 3LAMA 1HSJA 5GMKj 1Q7YC 2XU8A 2R7QA 4EAHD 4IPAA 5D7UA 1KG1A 1JKRC 4IO9L 3KP7A 2ASMA 1S1NA 1E4FT 2F69A 1FYMA 1KQSA 3VESA 1I5LA 2PVOB 2V1DA 3TTCA 1PUEE 3QFUA 2XB0X 4KN7X 1DP7P 3OYNA 4FT4A 2Z1DA 3Q7CA 1BL0A 5AQVA 4M7AF 4MIMA 1IZ1A 2QQ8A 3UATA 4E7IA 3BPVA 3O9UA 4BQQA 3UA7A 2P5VA 1NGGA 4XM3A 1YJ9Q 5CE3A 4H0XB 3QIPA 3C2BA 3J81Z 4KH1B 3A1YA 3BG5A 1F21A 3AHUA 3CCLN 5CY4A 1JO8A 3NH1A 4J83A 4YIFA 1ZBFA 2DL7A 1JKOC 3VJPA 1L3TA 3CMEA 1SL0A 1Z91A 4JN4A 3O3KA 3DLLL 2HBMA 4N0AC 4KTWA 4C92A 3TQ7P 2HPIA 4NC8A 1YQLA 3SJMA 1EBMA 1QMCA 1QVFS 1XNRK 3C3WA 4O5BA 1EETA 3PIOA 1Y07A 3MD2A 3VPRA 4B48A 5A2QZ 2LQKA 5LL6S 4JD2A 4W5RA 1TK5A 1UGSB 1GLBG 1DLOA 4FJ5A 2P6SA 3FF5A 2CZ6B 5CLSA 4C0DB 2DTZA 3H35A 4RM2A 4OIQF 2JT1A 2D45A 3GDQA 4YPRA 3CJRB 3MCAB 4P5NA 3VN5A 4FVUA 3TO9A 4XLPF 3HSFA 2O8FB 2RI3A 4F2SA 1WKMA 4OLAA 4HDUA 3MK6A 1QQCA 1R00A 5LJ3e 2X85A 2DA5A 4HAMA 3DEUA 4M73A 1HJOA 1UWBA 2QK9A 1D5YA 3ID6A 3I8DA 4R0KA 1ZUUA 4PL7A 2E20A 1SRLA 3EFOA 3CETA 3ASNH 2GXAA 5FLVA 2HOSA 2CGJA 3EHQA 2KHMA 3NFCA 1SKWA 2EGAA 3NHNA 2PFBA 1JJ6C 1H3HA 4YG2F 2W85A 2LRQA 3L42A 2I7PA 2TCTA 1KG7A 4BUGA 2R7VA 3WGHA 4F3OA 3KNTA 3KFVA 1TK8A 4V2SA 3O4QA 4E7ZA 3CCSI 4RTYA 3KK2A 5FRNA 4EMKA 2EQIA 2D0OA 3QP5A 3BR0A 3ZMDA 1M8MA 1YJNN 1TT0A 3BZ6A 1BWFO 2QA4Q 3EUHC 3MXMA 2M4KA 2OBPA 4XN0A 1O75A 3UKRA 1W7PA 3V8LA 4XU3A 1OR7A 4BROA 1W2BA 2E5NA 4JX5A 1O3SA 3M8EA 1FYLA 4LUDA 3PX6A 2HHXA 2P4WA 1W0UA 1WCMJ 4O6JA 1J5OA 3I56Q 3CJ1A 2FXAA 1ZGJA 2DYIA 3FFIA 1JTYA 5K5RA 5CVVA 4AFUC 4WQ4A 4IFVA 3JS6A 1A5XA 3T5XA 1OR7C 4MFBA 4CJUA 2R7ZJ 2VKHA 1JTXA 3OJSA 2WAFA 3CHWA 3FXQA 2VBXA 1AD5A 3MWMA 2LCLA 2HSEB 3SDBA 1UUEA 5CKDA 1PU7A 1M90U 3CBOA 4M77E 1KC8R 5EEAA 2RK1A 2DJNA 4IRHA 3BLYA 3K70D 1O3QA 1QU3A 5GAMd 5EU7A 4M77C 1JKQC 2CP5A 3A8MB 4CZHA 3D0PA 3QEPA 1LPQA 1BL3A 1T39A 2LDMA 4NB5A 3VYTB 3ZBDA 1BDGA 1CZAN 5M5XJ 4PQUA 1JLCA 4JKFA 4PSWA 4CCJA 2D0QB 2VJJA 2KSSA 4EIAA 5CO7A 5HROA 2IVMA 3LDNA 3H5AA 3SQNA 3M3ZA 1VQ6Q 2XG8D 3J7AO 4G8XA 3EO3A 2Q8KA 2H56A 3NF9A 3DKWA 4HWIA 4IUQA 1SMYF 2H94A 2O9SA 2KEAA 2ITMA 4CF0A 5CK9A 4FM0A 3O3HA 3RSNA 1OKJA 1BJAA 3RZDJ 1YN8A 3KETA 1NLVA 3LM2A 2L2OA 3VEYA 4RMNA 1JCFA 2RK2A 1RDBA 5KCOA 2EQUA 4EZ9A 2ZPIB 4FWKA 1YJWT 3V4IA 5GANh 3GXOA 3T1BA 3EG2A 2KIFA 3HJEA 4FLZA 4RB1A 3RPUD 3CMAT 4PJOF 1FYKA 3GBQA 3WNEA 1YI2Q 2KQWA 3OW2M 1RESA 2E5ZA 2QWRA 3JAMZ 5TISC 3CCQI 3TI0A 1NKCA 1BBYA 1RTJA 2XD0A 2YCHA 9ANTA 1YIJQ 3E0JB 4DS5A 3SFZA 2QZ8A 4N9HA 2MD0A 3L4IA 1HKGA 1KC8C 4HG2A 3OW2A 1B9NA 2YUSA 1H0MA 4CCNA 5JFRA 2RO0A 2JRMA 2OF7A 5DEQA 2DEQA 1WA7A 5AQZA 5IP6A 4QS7A 1S72T 4XU0A 4XH4A 2DVJA 4QVZA 2EYYA 4PA1A 2ADUA 2XRNA 2LFBA 2M5WA 1X69A 1Y39A 4G7ZF 3DTIA 3BOQA 3CC4I 1M3CA 2HCKA 4UUSA 3E6DA 4AVPA 1WX6A 1LOJA 2O8EA 3W6KB 5GAMf 1TP4A 5M1FA 3LP2A 4OJRA 4F7UG 2QXLA 4FJGA 1WJSA 3KYLA 3FSPA 4C8QF 3AG4H 2ISZA 4C5IA 2DODA 2M51A 2B5JA 3ZEUB 3J80O 4XKCA 3S16J 3PVLA 2KTQA 1NOYA 2WOMA 1JKPC 4D7NA 3AVJA 1Z9CA 3ZETA 1AVZC 2XAJA 3KLOA 3R61A 3C7NB 5KVRA 3BJ6A 4CEQA 4LF6K 5FPMA 2FEZA 2AK5A 1GLEG 2MC3A 4LLGF 1Y1WJ 2HHSA 2HFHA 3RMQA 4FJ8A 4YPHA 2E65A 3AA4A 2I5UA 3N0UA 4KHWA 2IDOA 2LKPA 2VUMJ 2GBZA 2KP6A 3V8KA 3BQZA 3BR6A 3AO2A 4OO1J 4DV1K 1K0SA 1U6ZA 4KJZA 3LM9A 3DI6A 4DV0K 3VUZA 4AM3A 1VQNI 3F8FA 1ZR4A 4HCKA 3BZCA 1ASVA 3RMBA 4EM2A 3FLGA 2RF0A 3IUCA 5GAOl 1VQPA 2YHAA 2WC9A 5IOYA 3FBIB 3CMMA 2D1KA 4YIIA 2OAZA 5C2FA 2ZC2A 4MFDA 4PKHA 1GLAG 4XLHA 4OLBA 5E17F 5E3NA 3CF5F 3LAPA 3FKJA 2ZB9A 2HBKA 4DUYK 3LP3A 1KD1C 3DB4A 3GG4A 3QYHB 4IUPA 1CZ9A 4M6XA 3B02A 1QCNA 4LFUA 3RBBB 3G4ST 3IHOA 4CF8A 1HYOA 2CGHA 2FO0A 2CWEA 2EYQA 3EHRA 4FL9A 1YJWN 5AZIA 1LPLA 4RW4A 1QA6A 1QQMA 3CMAN 1U5TB 1WQ2A 2TRTA 3RWUA 3VQ8A 4CHNA 1P7IA 3CQYA 4KH6A 4LDYA 1UA1A 5E26A 4CCLA 1ZLJA 2HGCA 1K1ZA 3HGGA 2HU9A 3KZYA 2DO3A 4I09A 1BR4A 3GTOJ 3DMJA 4ZYAA 2H8RA 3GTGJ 5DLOA 4ZHRA 3EN9A 4TV7A 1SD4A 2XHCA 4CZGA 2V52B 5H1SQ 3HBLA 4HVWA 1QRYA 2YJEA 4E7HA 2VC8A 2EPDA 3CCSQ 4JHDA 1LCKA 2RNAA 4AM7A 2KI7A 2EFWA 3AO5A 2X9DA 4WF2A 1OI1A 1ABOA 1O7LA 4BR2A 4EMHA 4RB2C 1RFQA 1FW6A 3OYAA 5FRMA 3SXYA 3X2QH 3A8OB 2HQ5A 3ID8A 2EIKH 2MYSA 3H0FA 3EG9B 4CHYA 3CCVT 3JCMc 4DYQA 3S3NA 4U67L 4OB1B 2GQQA 1C0GA 2YLBA 4XLEA 1F4KA 4FVMA 4IG3A 1K6OA 2OA4A 5DD8A 1WEIA 2E35A 2O4IA 2A28A 4WCGA 1XJWB 2RNGA 3FBNB 1YLFA 1AA7A 4FE4A 3CCLA 2EZIA 4O44A 1HKCA 1KFSA 1HLUA 4H0EA 4FLTA 2EVRA 1YQRA 5EEHA 1X3UA 5CKHA 4WF9L 4CJWA 1D5AA 5I42A 2AXLA 3I5UA 4I02A 1U1TA 1VSHA 1ZBXA 3HOTA 3K5OA 3KP2A 4F55A 2RQQA 2P0KA 2LY1A 5LJ5j 3VYSB 3PY8A 2UXDK 2B86A 3QZ9B 5M1QA 2RKIA 2FBXA 1JT6A 1O1WA 4Q4ZF 1EWQA 5GAHP 3GFMA 3OYLA 1X75C 3ZEHA 1VQKQ 2CU7A 2E41A 3M8RA 3FXRA 2EAYA 4N4OB 2OPRA 2DYRH 4FYWB 1I6HJ 4CJSA 2V1UA 3LWLA 2C6YA 4RA2A 3U3GA 3VW4A 1VSKA 1SD6A 2STWA 3KP4A 4PK4A 4ATOA 5JVHL 3SJJA 4M7DF 3H3OB 4B1XB 3GX4X 1RAAB 4FJMA 3WE2A 2JN0A 3LL3A 4DTXA 3PX0A 2OI3A 3NE6A 3G4SN 2F4IA 3AFHA 3K5LA 2OA8A 1XQOA 2D5VA 3F0CA 4MLHA 1YT3A 3AO1A 5IT9E 5LMUK 2Y0SN 1G8XA 1I50J 2OTJT 1OPCA 2G8IA 3M8PA 4A3KJ 2OC6A 3JB9F 1FTTA 3CCQQ 1JJ2P 1QZ5A 3THWB 2DN0A 2UUBK 1XNIA 3C6TA 2FQ4A 1YRNB 3S9HA 2CRGA 3EUAA 4IHXA 4OOIA 3D4VA 1M4ZA 1YJNA 4A4HA 3U2RA 3CWTA 3I55T 4JNEA 1PM3A 3J7YJ 1W9HA 1NGJA 1OCOH 4JI3K 5LY3A 3IS9A 2XB5A 4PKGA 2KAFA 1WSIA 4DF8A 3RSEB 4I0BA 3D1NI 4C8MA 3CC4Q 2RE2A 1D9FA 3J80Z 3FHFA 4KMUX 2MH9A 2AXTC 3CCJI 4B1RA 3ZLJA 3THXB 3PGGA 2IS1A 2M30A 2JVGA 1C0WA 2F2VA 1VQLI 4WX9A 1BUPA 5FGMA 1Z3YA 2JQ7A 2YKNA 3R6SA 2K3XA 1Z6TA 3CCVN 1WSFA 2D9TA 2O8KA 4RW7A 2P8TA 1VQ8I 3LFUA 1TXQA 4B44A 3JCMh 2K9GA 2E64A 2KT1A 2OQGA 3E9GA 1HYSA 4N4NB 2AZSA 2CUJA 4A3CJ 5CR4A 3DLKA 5IYCJ 1MA9B 4WFNL 3CMYA 3LL7A 2VLAA 1BR2A 5CKFA 4XSZF 3JXUA 1R36A 1ZARA 2V26A 1OVYA 3VGLA 2VQCA 4BHBA 2K9QA 1KGSA 3S1QJ 5E18F 2FF4A 1JXSA 1RAFB 5JVGL 1IHVA 1VQ5I 3FWEA 1OPLA 4HUFA 1VIFA 1HJRA 5BN9A 4DQRA 3M57A 1VQNQ 2QEXI 2KNBB 1BBZA 2O8DA 2DXCA 3NARA 1VSJA 4A3DJ 3P9IA 1U9NA 2JXBA 4M41A 4ENNA 2PJRA 2K2MA 3EPZA 3Q0WA 2VWBA 1NYGA 2KIMA 2EQMA 3A0HC 2JMAA 2DOFA 2RQPA 1ASUA 1T6CA 4X9CA 2M1BA 3IKMA 1M2VA 2R3SA 2AO9A 3GW2A 3OQ5A 3VOVA 1NK2P 4CD3A 2ZMEB 1T0JA 1PUFB 1VQ7T 1S29A 4CCMA 3VQ5A 3GTPJ 1NK0A 1OU9A 1ULYA 3EDPA 4HSTA 2LY2A 2HL5C 5GAN2 2QLZA 4Y3OA 1MH3A 2DFFA 3RDIA 1SS6A 2YNGA 2G9WA 2VIXA 3PNWC 2QYZA 2D1XA 2Q2EA 3LSKA 4CE9A 1RIOH 3I8BA 3PUFA 1NJZA 1IJWC 1R22A 1WOQA 1X3ZB 4AFZC 1RT2A 4CSWA 4OMQA 2PYJA 5FLXO 2F6CA 3SWNA 5GAMe 3KXTA 1S1WA 5KAFC 4JKGA 3S2DJ 2HZTA 3ABKH 2HS5A 3SHFA 3GEZA 3GLXA 3J8AA 2PVGB 1N5ZA 2YU3A 1TW3A 4CJ5A 3W2AA 3I55N 4BRKA 3SWNC 4QAGA 4CK1A 1YITA 5DM7L 2LD5A 1QE1A 4A57A 2K02A 2EILH 3F8MA 1KSPA 5J26A 2IT0A 4M7AG 4UV8A 4FM4B 1B9FA 2DDBA 5F64A 3S2WA 1E0EA 3R9PA 1KYWA 2UUZA 2IAJA 3R2XC 1TUYA 1Y8QB 4JBAA 3VEVA 2OQRA 4M9XA 4EPCA 1I8FA 5HLTA 1C0FA 3WNFA 3SUNA 1IN6A 4KIGA 1VSEA 3SFIA 3CC7I 3E9FA 2O0YA 1KIKA 2KDZA 3A8GB 5GAN8 5LJ3j 3T7ZA 4C5EA 2IVWA 2VBYA 3OMYA 3JRIA 4J9GA 4Q0BA 4FLYA 2HMIA 1T05A 4FX0A 3RKWA 5J6XA 4JRQA 1X9SA 1P4XA 4O0IA 1RAGB 2VOOA 4N9IA 1UJ0A 2X9HA 1B3QA 5CYVA 3ZQLA 4XN3A 4MDXA 4BEHB 1HNZK 3CCRT 1RT6A 1M9SA 4PLLA 4M78A 3ZSRA 3K0LA 1D8YA 1VQ4Q 1BCOA 1K8KB 4DLGA 1IH7A 3MECA 1LMZA 3O1WA 2LQ8A 1MWMA 4M9ZA 3OL4A 3QEVA 1VSFA 2JJ7A 2E3HA 2R7TA 2EW3A 1WQ7A 4CCHA 1NJIR 2A36A 4ANJA 1IUFA 4XOPA 1S8NA 2W84A 2ZJPL 4UUTA 3LWFA 4M78C 1WVRA 3LSJA 5HODA 2E2QA 2ZPGB 3I35A 5GP9A 1GRIA 1J6ZA 3O4NA 5I9EB 3CPEA 1XG7A 2VT2A 2CT3A 3DKYA 3VB2A 4EA4A 3H9JA 5FKNA 4DWIA 2Y9YA 2M9UA 3CD6I 3QG1A 3FXKA 4CZJA 4B24A 2HHWA 1MMAA 2X6WA 2LVSA 3RMAA 2A3SA 5FB2A 4H5NA 2A05A 3GFIA 3CPWS 4F17A 1ZBSA 2EINH 1JT0A 1VQ7N 2LT1A 2R5ZA 3CMAA 2EGEA 1YRNA 5L3EA 2DU9A 5AQYA 5FWCA 1YG2A 1WSJA 1SRMA 2EPFA 1AEYA 1NNEA 1T3VA 3EQLF 1B8IA 2EYWA 4QQ6A 1RCHA 2W25A 1KK7A 4EATA 4EVIA 4ENKA 1IUYA 2HMAA 2V1QA 4GKJK 4DNCA 1H89C 3D2FB 1MWKA 4JP0A 2HEOA 4CH7A 2O8BA 4BQNA 1ZUYA 4M3DA 4XORA 2E12A 1ACMB 4ITVA 1RZ4A 3M0PA 5IN1A 3M8SA 2NNYA 3H3VK 4A54A 2X4XA 1IBKK 3HOUJ 4YY3K 4ON0A 4EHUA 2SRCA 4LD6A 3ZX3A 4YHHK 3BDPA 2VBZA 1YW8A 1MUYA 5IHKA 2YRCA 1NJIC 2PQ8A 5LBQA 4KT6A 3VODA 1KHIA 2C06A 3SV4A 5AQKA 3KFWX 1TW2A 4IOAL 2LH9A 1FK9A 3FZKA 3CCJQ 1F36A 2GBYA 1MMSA 4RBOA 3LX7A 1C0MA 4KH5A 1YBYA 2SEMA 3OW2P 4DZJA 3ONQA 1QVFM 3ABUA 2YXYA 3N97A 4DSJA 3K2AA 2I7NA 4HVJA 2K2VA 4CGFA 3LALA 5J39A 4DFJA 5IXBA 4QTRA 1GL5A 1FP2A 1ZREA 4LJZF 1WXBA 4LG0B 3E6MA 4KUDK 3H8ZA 3I5SA 1R9TJ 3LSGA 2QBYB 3U8XA 3LA2A 4IX7A 1QKWA 2KW4A 4AH9A 2IPOB 1LE8A 4C8LA 4EA5A 3Q0UA 4IDKA 4M3EA 2ROLA 1P2FA 4E7JA 3CCRN 2X6SA 2EBPA 1EH8A 1G3WA 2VCPA 5IWAK 1W36D 1X1DA 3MFKA 1OYYA 2J05A 2DIQA 2QASA 4XL9A 2YLCA 2KJBA 1VQ5Q 2DA2A 3OYKA 4FISA 2LYCA 4GNIA 2HOTA 2HAXA 3VPZA 1UELB 1Y57A 3QPHA 2QEXQ 1BHLA 5D4SA 4M75E 4BR4A 3CJAA 3NFAA 3F72A 1N27A 3OS1A 3K4LA 4G6TB 2CZ0B 3AY9A 2Y9ZA 3MEDA 4B8CA 2MA3A 3MAQA 4PJOG 1VUBA 2PJPA 3OOUA 4BGAA 3QYEA 4XRFA 4BY7J 3G4SA 2NS8A 4MMKA 3R1XA 1LV5A 4JYKA 3QEWA 3LNQA 3V9UA 4MQ3A 3E5UA 5GANf 2LLKA 2P4TA 4CGIA 1HKTA 4LGWA 3J7YP 3K5NA 2JSPA 2DPDA 2GXBA 3TR8A 5GAGP 5L8RE 2ZO4A 2E8AA 2W6KA 4BD3A 2ZXIA 1RNHA 3BWGA 1JI8A 4OMZA 4J9DA 4IRGA 4B3SK 2VXFA 1PVEA 1RDAA 3DEWA 2O2OA 5FKLA 5DUIA 2ZXJA 4O3MA 4IG0A 3HM9A 4PKCC 2EJRA 4PJJA 1KC8O 2MWPA 3TSPA 4LSNA 2X74A 1J53A 1RR7A 4K8ZA 4C8QG 1IV0A 3BDUA 1TNSA 4C92F 3I3LA 3JCMX 4ILJA 1X9JA 1KQ0A 3DU5A 1MJAA 3SEZA 4NS5A 5E41A 1NEBA 3AVAA 5CIUA 4HUEA 3SZPA 2K3BA 1HX1A 4H4OA 3QB0A 5KYYB 4C0FA 3U9ZA 3LGFA 3CCVA 1G59A 4M3UA 3P9KA 3M4YA 4FJJA 1QZEA 3MZHA 5ILVA 3QU3A 3O9TA 3CZ6A 3HPGA 4MHGA 3N4MA 1EFNA 3LSRA 2QCOA 3TO6A 2P84A 2WADA 3A03A 1G2HA 5HK3A 4NCBA 1NJIU 1EKEA 2EFQA 4PJOB 1K8KA 1HW1A 4BHCA 5KYUA 1KFDA 3K2PA 3CC7Q 3VYRB 5IY5H 4L9JA 4DR7K 4JK7A 2JTEA 3TREA 4IEJA 4M3YA 1N36K 1J59A 1I07A 1KQ9A 3E5XA 2MI6A 2YNIA 2PMUA 1J9IA 1M3HA 2KISA 4U7BA 3NF8A 4FPBA 3RMSA 2WSCE 5IXFA 1HW5A 2JK3A 4F14A 4JI0K 2MMPA 5AQPA 1XCVA 1B72B 3P83D 1Q86U 3FZMA 2VXZA 4M3WA 3TDZC 1BI2A 1U2VB 4HOBA 1WI9A 3K4KA 1VRTA 3HRMA 1Q81R 3TKYA 4I6MA 1Y1VJ 1KA8A 5AQFA 4OFEA 2ELHA 4BJTA 1J5EK 4DV5K 1ZBIA 2LDUA 4EMGA 4CESA 3WNHA 3BUZB 5AQSA 1WH5A 2ETJA 2WAQN 3GNFB 4CI6A 3O6WA 2Z3YA 2BTTA 2L3DA 3KPHA 3KYCB 4RAZA 2AA4A 3ZQQA 1SEMA 2IS2A 1U84A 1ZRFA 1B92A 3WGIA 1SEUA 3PFSA 4KGZB 2BZ8A 1UFFA 4KGXB 1OZ3A 3QQAA 5J40A 1YAGA 1RTDA 3OMCA 2UXCK 2P5LC 3SBGA 4BI3A 5HOOA 3WU2C 1STZA 4K0KK 4HW0A 4OGEA 3VDXA 1XWLA 2DBMA 2Y48A 1V4RA 2RNJA 2DYBA 2DAQA 5FO5A 3L2RA 3JSCA 4DTSA 4KHUA 1T6DA 3DLEA 2LJ0A 1TSFA 5IT3A 2BVMA 4WQ5A 4IOCL 3IH7A 2P0QA 3NH0A 3CM5A 1JXBA 1C6VX 1UHCA 3SDZA 4ELZC 1JLAA 2QGUA 2CGLA 3DBLB 3VQEA 3CCMT 4LF5K 4PY5A 3I55A 3RYRA 3NGPA 3MWPA 5BQTA 4BRCA 3P31A 4WQ5C 4C8OA 1TTYA 4DHYA 3CMEQ 2CH4A 2IGNA 1VQPI 3QYFA 4KA4A 3HOWJ 4RUGA 5KYXB 4RTTA 1G99A 5DYMA 1BA0A 3KK3A 4YOYA 4K43A 4Y52J 5AQLA 1YJ9T 1SHGA 1BIBA 2V6EA 4OIRF 5JICA 4PFOA 3UE5A 2G8HA 1HK9A 4YTLA 2R7DA 4LLNA 4OFAA 1E17A 4LG0A 2GTDA 4PL8A 1T2KA 4AQYK 1U8RA 4CK2A 2LKSA 1JGGA 3BTIA 3CYMA 1KQSS 2OAUA 3N4QA 3ZT3A 2O8CA 4M3RA 4H0PA 2V8IA 5JVTA 4UNOA 3SLCA 3FDYA 4XLCA 4LUEA 1NK7A 2ZJRF 4ZTFA 2F7TA 1QNTA 5HCKA 2P7CB 3FM5A 5KI6A 4DBQA 1CSKA 2OTLI 4E0DA 1TWFJ 5KCMA 2EKOA 2FPDA 2A5WA 1WJCA 1NH3A 3KTUA 1VQ9I 3AL0C 4B4CA 4I9LA 2DMNA 3L3VA 3SZ2A 4Y17A 3CO7C 5DM7R 3JYTA 4KAZA 4NUBA 2K57A 4MFEA 4A4GA 1HPMA 3EGUA 1MMGA 2FSNA 1KTQA 3VEXA 3BR2A 1CGPA 3MKWB 4FHTA 1YHQA 2UXNA 2D0CA 3SMPA 2F4VK 3TP3A 4M7DG 5FD6A 1QZZA 4CFDA 4KHNA 2OPPA 2XRIA 2MWOA 2VC1A 1R0AA 2R5AA 2KXDA 1VQOA 4E3SA 4A2AA 2BXZA 3R8EA 4L5GA 3CDLA 3VQBA 2OZ6A 3BDDA 2L5QA 3A02A 3ZSYA 1ZN2A 1AZGB 4B3OA 2HHQA 2JUFA 4CZFA 4FOIA 5EZHA 2DJIA 1VQ7A 4B9UA 3RMDA 5FWBA 1YFHA 2CFOA 1IKXA 3KHYA 3CFOA 3CCEI 3KEOA 4G9ZA 1R0CB 2XF7A 2QA4T 3OYEA 2FSWA 3TL4X 5A0GA 4HSRA 2V1RA 2X3XD 2XDBA 1PU6A 1MPGA 2L3RA 2QKMB 4XR6A 4JQFA 2A0FB 4I9QA 3OYJA 5KNLA 2MK5A 2MH2A 3WTZA 2W04A 1SL1A 4UB8C 3F21A 4ZYHA 2FQ3A 3GTQJ 5BPIA 4F4KA 1WJDA 2OUMA 4CGHA 2D0NA 3CCMN 4KHYA 2FRYA 2JM8A 2OU2A 3OR2C 3ZSWA 2EIFA 1KXPA 4AT1B 4OB2B 5KK1A 3P8DA 5F0CA 3DF8A 4B1UB 3CC2A 1O3TA 1WXUA 1K6YA 2YHTA 3GNGA 2RQRA 2FPEA 4IQJA 2DERA 2E5KA 4XRMA 4CJKA 2KIUA 1W2BS 5LJ5d 3S14J 2J6KA 1QHAA 2BEOA 4M7DB 2N8GA 5TKYA 2QW9A 4A3FJ 4P55A 1BIZA 4GYGA 3TOAA 3I0TA 1FXXA 1ZXOA 1EXQA 1LJ9A 3ZOBA 4BR7A 2TDXA 3JCMf 2PQWA 3V81A 4O5FA 3VGKA 3BR5A 2MABA 1CF7A 1E6GA 4LMYA 3ZCOA 1UA0A 4L5JA 2G3RA 3D5SC 4J00A 3KD5E 1RL2A 1Q81U 3MKLA 1SVOA 5DD4A 3PNYA 2YU9J 1MUDA 4HUGA 3HOYJ 3F9KA 4M7XA 4P5OA 3CCRA 1OYWA 2KFZA 4PHTX 2RPNA 3U6FA 4A0ZA 5DCFA 5GMKe 1MBGA 4F92B 4CIEA 1Q82R 1DTTA 1TOVA 1MBJA 3VQCA 5FD5A 3D0SA 2CGKA 1U3EM 4I2PA 1NJYA 4KGVB 3CLOA 4PUSA 1KU2A 2P9KB 1R71A 1C1AA 2J5OA 4WK8F 1SSHA 4J01A 3W0LA 3CQTA 2LTPA 4HX8A 2PN6A 3SAHA 2L7KA 4E9HA 5FKMA 2OCCH 1I5ZA 4LFCK 1QPIA 5GANe 1QBJA 2FHDA 5EXWA 4LK1F 4MO5A 4CICA 1I3AA 5LHIA 3VS3A 5D5XB 4AIAA 1W6XA 3JB9D 1TC3C 2E6NA 3KJVA 2X6XA 3DOKA 1X6GA 3DLRA 4BQZA 2VXEA 3FZFA 4H8KA 2FF3B 1W5TA 2K5CA 3L7WA 3K1PA 5DUKA 5JLHA 3RKXA 4PUOA 1NMNA 4S0HB 2L7ZA 2M7BA 2YS9A 3REOA 1UCRA 1WJEA 1WHUA 3T19A 1UAXA 4KUMA 2QA4N 4ISFA 2PMZN 1REPC 2WV1A 3PM1A 1WLPB 4QPOA 2IA1A 2ZPBB 3E66A 4L59A 2ENMA 2KE9A 3HHGA 5C4JJ 3AA2A 4AFSC 4CK3A 5J47A 3BPXA 3OYIA 3WVEB 1BYMA 2WB1A 4II1A 3OSFA 4Y13A 2K79A 3E6CC 1OCTC 4H4MA 5CAIA 3H0IA 1EF4A 4OP0A 1W5CC 5AFUH 3H6EA 4CBXA 1TQIA 3KWGA 1Q82C 5K7FA 3CVSA 2ZCFB 1JUMA 1KVAA 3WTXC 4C0GA 2ROTA 4F7UA 5K7ZA 1KVBA 2EYZA 4F7UE 2J6OA 1VQPQ 5KN8A 3IQLA 1BI1A 1DU0A 3CUQB 1MBHA 3H1VX 3VRYA 5LGNA 1MMDA 4OX9K 1U2WA 3EUKL 3A98A 1OU8A 3MN5A 2YI1A 2EBIA 4BDZA 1LOTB 4IXCA 5IHNA 4B22A 1N32K 2A37A 2O88A 4EJZA 2P9UA 3CJTB 4JPBW 2F5TX 1W70A 4QVDA 1WPKA 2JRTA 2C0IA 1WFWA 4CEOA 3UIQA 4DU1A 1TL3A 1U78A 2J4RA 4RWTA 4KREA 2XDVA 2BHZA 2J06A 1ZH5A 4C9YA 2ZXHA 4JJNK 3QWXX 4F7ZA 5GAEP 2NUPA 4KB1A 1DGWY 1FJLA 3TMOA 3TEEA 2HYFA 4NO7A 3KX2A 1QVUA 4FJIA 2MLKA 5DLQE 3NGIA 1LWWA 2H1LA 1QQNA 3META 2YUOA 1EIFA 4M74A 3OYYA 3CCUI 3ERED 2L54A 5I21A 2YHWA 4ZZLA 4J9BA 3CCYA 1GLNA 4W5NA 3IP4B 3OJUA 2RHIA 4EJYA 1UGVA 4OMYA 4LN2A 1YITI 2ZAEA 4FOEA 3F23A 3EG3A 4J2AA 2LBFA 4NYNA 1GV5A 5C44J 1RUNA 1QVFP 5EY4A 5GJVB 1QVGA 3LP0A 1IN5A 4ESRA 3EH2A 4Z4EA 1ATNA 1U48A 5LEKA 3F8NA 3RVCA 5DY9A 1WFXA 3OA9A 3UKGA 4UC4A 3QWYA 3FB9A 2CP6A 5F0XA 4FU6A 3O4WA 3F8CA 2KY9A 5KPRA 3K59A 1WJBA 3ISPA 5GTHC 5JS1A 4LIVA 3L00A 2IVPA 3DRSA 3WU1B 4CHZA 3GF5A 3L3UA 3CCST 1N8RR 3L4QA 2K86A 5KYWB 1QVTA 4BG8A 3HOXJ 4CF2A 3R0JA 1N75A 2ZJ2A 1D3BA 5BS6A 2A7YA 4JKHA 3EETA 2GXGA 5IT9Z 4BDPA 1IC8A 2CUZA 4OMFB 3CCLQ 3GZNB 3VSLA 2MPXC 3RKYA 1PDNC 4UVBA 5J3LA 4HTLA 1RABB 1SFXA 1TBXA 2XICA 2UYTA 4C3IJ 3AT1B 5I3UA 3TARA 4R56A 3KLEA 5LJ3d 1QPMA 2X0LA 3CWUA 1S5LC 3H1CA 2QWOA 1ASWA 1WSEA 5FKKA 2FRHA 5DV5A 2XGCA 1MBFA 4CCOA 2RH2A 1GXQA 2P51A 1HF0A 3ZFJA 1MKMA 1P7JA 2CUDA 4OGCA 3B73A 5K5QA 3VEOA 2VI6A 3QBYA 4JI5K 2K4YA 5HLGA 1NEGA 4A59A 3S93A 1BGXT 1ZG3A 1HW2A 5B1AH 1NJIO 1U8BA 1Q82U 3S41A 5AZJA 4HLXA 4G6DA 1J09A 2JG6A 2KZMA 4GV9A 2BGCA 3Q9SA 2LC4A 1I0CA 5D3GA 4CJFA 3RESA 3I0RA 1TWBA 4H0TB 1VYUA 2M8EA 2BXYA 4F9OA 1S1UA 4KBOA 4UY8O 3AO3A 5F6FA 3T0YA 1O3RA 4BRFA 4BC4A 1Y64A 1NKUA 1X4OA 3BTJA 4ILHA 1SG5A 2NUZA 1N8RC 4BRIA 3IWFA 3K9TA 1QKXA 2IP2A 2E2IJ 3FXJA 3CPWM 1D09B 1S3JA 3MP8A 4J9CA 1QP3A 1FOYA 2BZTA 1T0HA 1GV2A 1R1TA 3HVRA 3DLGA 2EZLA 2AHJB 4L0YB 3FXMA 2O9LA 2W0ZA 4X64K 1WBDA 2CH6A 5KGWA 3ASOH 2M0MA 3CF5L 4V2FA 1JXOA 1UTIA 4RCBA 2X4HA 3P7NA 3ULQB 3M7GA 3ER0A 4AIHA 4CHQA 3P38A 1Z7UA 4BC5A 3GTMJ 2M2EA 5GAOp 3CCQT 5B5EC 1C6VA 1GLJO 2Y90A 1RAEB 4FK0A 3QKJA 4CC3A 4MLEA 4Z02A 4UV9A 5TRDA 3GOIA 1B34B 4AILC 3VS0A 1ENHA 2PUOB 4Z4GA 1P9QC 1MZBA 2JTVA 5HP1A 1Y97A 3HUGA 3B6CA 3LAJA 1A5JA 2GTJA 1LW2A 4C1NK 2FLOA 4BACA 2VKVA 2KZGA 4DV2K 3X25B 3A0BC 1RNLA 3KLHA 3OSGA 4BBSJ 3A5MC 1YWPA 4JX4A 2A40A 4HXJA 3AA3A 4F91B 5LJWA 4FZXC 2R7XA 2PUKB 3G71I 2BW3A 1AT1B 3UF4A 3DJCA 1PD1A 3CC4T 5I2MA 2MGQA 2A07F 3VQQA 4J6YA 3ZR8X 1G2BA 4C92G 1LEBA 3LWMA 2E1HA 3MHXA 4KICA 1E7OA 4PL6A 3JV3A 2FBVA 1FSHA 3CCMA 3FRNA 4X65K 3P4IA 5IP9J 4FO0A 4M78F 4KTZA 3IDHA 1PP7U 3QOEA 3FM3A 4FWLA 5F27A 1C0TA 4HDVA 2D5RA 2BGGA 1IG9A 5ICGA 1G6NA 4I0AA 1P92A 1Z25A 1ORPA 3A01B 4EGZA 4JI4K 2DPUA 3JCMe 2DMOA 5JI6A 3TSZA 3M5RA 1HQEA 3WNGA 4EJVA 4BR9A 4F52A 1UJYA 3A1PA 1JLBA 1KVCA 2F4OB 5I22A 4IKFA 3VA3A 2DQRA 4KI6A 3EGXB 2BUDA 1P8ZA 4U0VA 4HPQA 3HXMA 3OYDA 1H92A 4A3BJ 2O3FA 1U9OA 5LJ3h 2DD4A 3I64A 2LJ3A 1FBSA 1HYZA 2XDDA 5AQTA 1HDPA 4BB7A 4CGGA 3VQ7A 4JUVA 1M27C 2IOCA 4OAYA 1VQNT 5B3SH 2ID6A 2QDLA 2JSCA 5KH6A 2A42A 2YWWA 2VG7A 4GVMA 3VTIA 1DUXC 1MDMA 3TVTA 3OIQA 4MZMA 3GFLA 3LA7A 2PBIA 2X51A 4FWQA 4RGSA 1CLQA 4ZN3A 1F1BB 4RW9A 1WHGA 5HDKA 1ETQA 4RCCA 1FOKA 2XHBA 3VS6A 3NAUA 1PKTA 4M75G 2PNIA 2LX7A 1TZLA 2OX7A 4C92B 2CGPA 4AF1A 4Z4IA 4A3GJ 1YE9A 1MJBA 4YFNF 3MEUA 2QSFX 1N8RU 4MDBA 3LCNA 1TLHB 3HTSB 3AAPA 4WXDA 3LLRA 4JD2B 2DOAA 1D0ZA 2FOWA 1E4GT 3O8MA 1Z77A 5AQIA 2K5IA 2I2LA 1N34K 1YITQ 4BRMA 1ODDA 2E4LA 4CZIA 6PAXA 3ESWB 2I5JA 1JLFA 5KYWA 2K85A 4AU7A 5HS9A 2LSOA 3JB9J 3CCQN 1YXQA 4NLBA 1DPUA 3O5BA 3KK7A 3JRBA 3HT3A 1XMQK 3FMSA 3LZIA 1D8JA 1HDDC 1RI0A 1QSSA 4QWQA 1A04A 4FCYA 2ITGA 2VQEK 4QKUA 4GW6A 2NWMA 1W0HA 3V6DA 3TU4K 4NLCA 2P9LA 3CPFA 4DS4A 4NBQA 2PMZA 3OYMA 4E9EA 2DYSH 3PIPA 1YQAA 1X3MA 1WDXA 1Z7LA 3D7EO 4NC7A 4PJNA 2QQBA 3CC4N 5DM6F 2LTOA 2E1YA 2LRDA 3THYA 1Y7XA 3ATVA 2VGMA 3M9QA 3TU5A 1PRLC 3OTOK 1UFMA 1PWTA 4A3JJ 2ATQA 3S1NJ 4BI8B 3W6JB 4M72A 2BE2A 1YX5A 1KO9A 4YRVA 2GIVA 3M1CA 4XAXB 2V8JA 4ETSA 5D8LB 1T03A 1D8KA 1S6PA 3IKVA 2BV6A 5CPRB 4K8XA 1APLC 4AI5A 3L2ZA 2NLXA 3UKRB 1W7PB 4DSIA 5A0DA 4M7AE 4HVVA 3EL2A 2GEMA 3L8BA 5C12A 1K8AU 4JLGA 2YNHA 3QPSA 2FBKA 3PLAA 4HA8A 4PDKA 3GTJJ 1VSMA 4QCLA 3EEQA 4A62A 1K73R 3VA0A 1FX7A 4M7AC 4I2OA 2FRWA 3F9MA 2Q36A 1V29B 4ESJA 2BOLA 1VYVA 2FSJA 1NGFA 5CKBA 4H4KC 1Q81O 3KZZA 3C6UA 4BRLA 3VSKA 2JVHA 1ZA2B 1QZYA 4Z8AA 1QSLA 4RTVA 3MEEA 3PNVA 3VS4A 4JI8K 3KE2A 3FJPA 4KNYA 1WHHA 3CJ9A 5LJ5g 3OSVA 5C3EJ 2KQRA 4CFBA 3R60A 3VKIA 1VQNN 3WHBA 3CMAQ 2X6NA 2AKKA 1M90R 4Y7NJ 1VQ6I 1YOVB 3M58A 2X1EA 4ZDLA 4XTWA 3SYTA 1IBLK 3PQKA 2RD1A 4GY5A 1K7AA 1XOVA 2YRVA 1TKTA 3J7ZO 3DTEA 1FLIA 5SZTA 1M2OA 1HC8A 3M0SA 3K4BA 1ZGWA 3M59A 2Q3SA 1B34A 1QHGA 1LNXA 3E9LA 3ABMH 1R4NB 4M77D 1XSDA 1SFKA 4KO0A 3TAMA 4FWNA 1YI2I 3CXCS 1XUPO 1X43A 1IG8A 2GZWA 2LR8A 3IUOA 2WTUA 1OYIA 2P1JA 1YIJI 5FPDA 3T1AA 7AT1B 2HNYA 1T3SA 3MCZA 3K6GA 2B9SA 1EX4A 1Y56A 4F04B 4Z88A 1ZRCA 4X34A 1F43A 3DP7A 1WHMA 3JAMO 1ZTRA 1TU0B 1K73C 1RKTA 4KRFA 3VUBA 2VE8A 2HNZA 2YKMA 2H27A 4BAYA 4B9WA 5F08A 4BE1A 2XY6A 2X6YA 4E4HA 2F5VA 3FFKB 1KLMA 4XQFA 3CJ7A 2NVUB 1ETXA 1VSLA 2FBHA 1X1PA 1TAQA 1WJQA 3O5ZA 5F1JA 3MVPA 1D1AA 1V4TA 2XO7A 2X3WD 3DLMA 3CCJT 4GDFA 1M90C 4LOCA 3DEEA 1VQLT 1IKYA 4AHTA 5D6YA 1HU0A 3MP6A 3GOXA 4EQQA 3EGXA 4H0VB 2PLYA 4Y0WA 5EGOA 1RRQA 1UB4A 1U4BA 2GCXA 3O1BA 3K69A 4RDUA 1I1JA 3URGA 5GPAA 1YHQI 1DU6A 1VQ8T 4HT9A 4OKJA 5HRPA 3TTFA 4CF1A 4UUSB 4JLHA 4LG3A 2ZPFB 2DM1A 1ATSA 3M9AA 4G7OF 2O8EB 3F6VA 1IV6A 1VQOI 4DV3K 2R7OA 2RQTA 4E7SA 3K1MA 4II2A 2KRFA 4E9GA 3HFNA 4BR0A 5IH2A 4DLEA 4KRTA 5GANj 1GXIE 2KPMA 3O6BB 3A5OC 1R1UA 4HF0A 3DB3A 1KQ8A 5E1WA 4BVPA 4N0AA 3ZETB 2GA1A 3GP8A 2PU9B 3G4SQ 4CBUA 4ORZA 1H3ZA 4BY6C 1D0YA 4YELA 1X3WB 4FYYB 2V51B 3HB9A 2NRRA 3PVQA 4KFCA 2OJ2A 2DMTA 2E19A 3NF6A 2H3EB 4F93B 2VKNA 2GOXB 2BANA 2QEXT 4CZZA 1LWCA 4QLCU 3WTVC 3HKSA 3A8LB 3CLQA 3ZPLA 2VN2A 2OFIA 4ZGEB 3C95A 2M34A 4E47A 4S04A 3UR3C 5HLIA 4HCBA 3HPOA 4RG2A 3VU3C 2DT5A 2HOAA 4A4KA 4CZKA 2FPFA 3J7AP 1DDNA 2EK5A 2UZKA 3QEIA 1CZBA 4MQVA 1YNZA 1NU0A 1KZHA 3WQUA 4E19A 4FLUA 4DSFA 1B1BA 2RC4A 3BC8A 5GAHJ 1DPRA 4PGGA 4PJOE 4O0JA 5LFAA 3I58A 1N77A 3LQQA 2NVXJ 3LA3A 3CC2I 3L6QA 5GIOA 4RTUA 1TTHB 1NZ9A 4WCEL 3ME9A 3DM2A 5KGXA 2M45A 4JI6K 4HNVA 3IL2A 4PJOC 3H0HA 5KPTA 3F70A 1PP8F 1WJAA 5ADXH 3ZCMA 2QVOA 3DXJF 2AQFA 4LH5A 2ZD1A 2CP3A 2RDPA 3LGLA 1NM7A 3CUOA 2HBLA 3M8FA 4ZDPA 2XK0A 1IKVA 3MN9A 3ZRGA 2YRDA 4N4HA 3EUHA 1IGNA 4DYRA 5AZIB 1NBEB 1R4MB 1NGHA 2LSNA 2ZZDA 5KCHA 1W2BM 3CESA 2I8DA 3MP1A 4U88A 3ZX0A 3LSTA 1HYVA 4O8KA 3CIPA 4G7HF 1TGOA 1FBUA 4V2GA 3DXMA 1JB0E 1K73U 3OSSC 5KN9A 3M6GA 4B9NA 4CZMA 1NK3P 2HOEA 3U23A 4C8QE 3CCJN 5C0MA 2XY5A 2KZZA 4J9HA 1U5SA 3QJ6A 3IFRA 3BDLA 2LC2A 1VQLN 3W3DA 2VONA 3OB9A 3K58A 1Q9XA 1VSDA 4G94A 1IKWA 1NK5A 3WUHA 4JHDB 5C4XJ 4C8QC 3JCMP 4OKEA 2AS5F 1M1KR 1T56A 2CDTA 3CC7T 3D2EA 1VQ8N 1JEGA 3PSFA 3CQZJ 1PG5B 1Q82O 2AQEA 2V9PA 2Z1IA 5GADP 4A3LJ 4M77A 1ETKA 3AVCA 1Z1DA 1B6AA 5LJ3g 3SUOA 2HHUA 2COWA 1NK6A 3NVMA 1ACIA 1IRZA 3L1AA 3E6BA 3IV5A 1T7PA 2EJFA 1HNIA 1LAVA 4CJRA 3FC3A 2JZ2A 4PJ0C 1MDUB 3QU6A 4LSLA 1IHWA 4CI0C 4KFBA 4A6EA 4M3FA 4QPQA 4BVOA 2E1OA 2KYMA 5J8FA 3IH4A 3DWLA 4XLNF 2L7MP 5HS7A 2WFBA 5AT1B 3DWLE 3DKXA 1ZQ1A 4F8RA 1Z0XA 2OANA 4EZ6A 3P39A 1WHJA 3ULEA 5J2PA 2O9VA 1OKRA 5GINA 4X66K 1OH5A 2IIMA 3TAEA 2VQHA 1JL2A 3IAYA 1SPKA 1VQKI 3EGDA 1WN7A 1QSYA 2DTOA 2M7AA 1PRMC 3WE3A 3V42A 1AKHA 3CD6T 4AHSA 2GF7A 3BCBA 2D0PA 4IFEA 1J3TA 1ZLKA 4FZZA 2LOOA 2VGNA 2BZXA 5EEGA 2KDOA 2ZWHA 2FJ1A 3VYUB 4DA4A 2ZFWA 4AMCA 3SAFA 2DL5A 2HYGD 1O4XA 4KMFA 4CZCA 3I55Q 2EX3A 4FXDA 3I53A 2JGUA 1VIEA 5C15A 4J9FA 4W5QA 5AYFA 2LP0A 4QW2A 4NDLA 1SAUA 3R4KA 1XGMA 2HW3A 1MNMC 4YOWA 1KQ2A 1BOAA 5HDNA 4NL2A 4AYBA 1M1KC 4NOYA 3KP5A 3CF2A 4J7FA 3MZYA 5E79C 3OS0A 1VAZA 4XTYA 2STTA 2QKKA 1X9WA 3OR1C 2V1NA 2HZDA 3D5RC 2FOKA 3TQNA 2WONA 3HBTA 4ISEA 1R5HA 1TYQA 4ZDOA 3PSIA 2E1NA 2RI2A 4WXHA 3CPWP 3MPUB 2KRNA 1XD7A 3EE9A 1OH6A 4V19S 4JJDA 2XSJC 2CT4A 3DPUA 1U6GA 2DMUA 3K4JA 2NRZA 4GY2B 3GYHX 2QQSA 1KG3A 3O9RA 3SFMA 3T8RA 2W41A 2Q0UA 2P9IA 5IAYA 1R23A 3QFPA 2L9NA 4M6VA 5BR9A 3G1JA 1HLVA 4PGHA 3BEXA 5LLQA 3EYIA 4AHRA 1BOTO 3KWIA 3SQ4A 1TT5B 5AONA 1LWVA 4FJLA 3CC7N 4L5IA 1YHQQ 2EZHA 3B6AA 1ESVA 2R7YA 4IURA 1VA7A 3TSQA 5K14A 2G8VA 1VQOQ 4A5MA 1F1ZA 2QF7A 1XTDA 1PNJA 1MMNA 4GMJB 5HK0A 4Z0UA 1HNWK 1NGNA 1OEBA 4RGRA 3WXIA 4ZH4F 1Q1HA 4LD5A 5ILUA 5EG0A 4J2BA 1VQ7Q 4M63C 3O08A 3LH0A 1I27A 4B3XA 1J9AA 3DU6A 1Z6RA 3ASMA 3MXIA 5D5VB 5J4VA 2G0EA 3I71A 2CUFA 2DXUA 2XVCA 3E01A 2RJEA 1HOMA 2R58A 1WGXA 2ZJQL 3Q9VA 1DT9A 1WNSA 2O4GA 2Q1ZB 3KD1E 5GAMh 2R57A 1C0UA 2Y1IA 1U49A 2LNBA 2Y4YA 1K79A 3C4SA 4DTJA 5M5WJ 2ZNZA 4AIKA 1N8RO 3CD6N 3V7SA 3X20B 3IHUA 1X2QA 4IDHA 2A6TA 2JVVA 1ZELA 4M7DE 3AA5X 5EZGA 4EVVA 1BC7C 2O8DB 2VB6A 3KYDB 2Q0RA 3WU0A 1OV3A 1R77A 2V8KA 3G1MA 4XU2A 4M7DC 5BN8A 2LKXA 2EJGA 2PJRB 1QQOA 3E3VA 2QTVA 4Y1CA 1Q18A 1MUNA 4P1WA 2ZFUA 1TWCJ 4A5BA 5HBMA 2E2OA 4DTRA 1RAIB 3CC2Q 4A12A 2DX1A 1M2VB 3BY6A 3M56A 2EHGA 1ETWA 3WG7H 2IC3A 4A3IJ 1K4US 4FJ7A 1BA5A 3JB9I 4D8KA 3VV0A 1MV3A 4DSEA 4KT0E 2ZKZA 3J7AF 4BR5A 2DTHA 4Z2YA 1VQMT 2XROA 3BT9A 1WHKA 2ZE2A 1WB9A 3LSHA 4B23A 3FHNA 3C12A 4QS9A 2QI2A 5LGTA 4LDUA 4YOVA 2R5YA 1GBQA 1M1KU 2NNWA 4B1VA 5AJ3K 1KAXA 2H3GX 2Q2EB 3O3GA 3ZT0A 4CD1A 2LY9A 4GCVA 2B8AA 2HVIA 4GGGA 4C3HJ 1PKSA 1S72N 5BPDA 3K10A 3JW4A 1EO1A 2KMUA 3ZT1A 2PYLA 1WGSA 3SWNB 2R7SA 2QM1A 4JK9A 1RACB 2KFDA 2RKHA 2KLOA 1U06A 3BQYA 3MZ8A 3MEGA 3J81K 4JKGB 2E7XA 4XNFA 1H1VA 3M4GA 3N05A 3M55A 2W82A 2OPTA 3BGRA 1TQPA 2O01E 4A53A 4H5VA 2HKXA 4JOMA 1SAXA 5KPZA 2CKKA 4GLMA 4W1UA 2KXCA 4A4EA 4HKEA 1HQUA 2NOEA 4Y92A 1NG2A 3V7CA 4L3QA 1KFZA 5A2QK 1IXRC 4FETA 4DGWB 2HDCA 1RUWA 2O4XB 1UECA 2H1KA 4EDUA 1VQ4I 1KEAA 1QP2A 4LDXA 4FASD 3CFRA 1SL2A 1JHHA 2W03A 2PMHA 5LRRA 4BRAA 1EWRA 4KV8A 1T44A 4OB0B 1N33K 3VENA 2F8TA 2W24A 4C0ZA 1BOBA 3PMTA 4Z4FA 1R5ID 4WTOB 1ILYA 4N47A 1I5OB 2OPQA 2PEXA 3KLFA 2VYTA 1BB9A 4OU0A 4M78B 4JKAA 1M1GA 3GCMA 1PCXA 3I9V2 1NK4A 4DTUA 1TKXA 3AVKA 3BE3A 3QIIA 3RMCA 3BW1A 3ZL7C 3CJNA 3EFSA 4CJ7A 4YNQA 3HSCA 1MNEA 2ZM6K 2CQXA 2Z1JA 3M1FA 1K4SA 1SFUA 1BI3A 2EFIA 3U3YA 2M0YA 1B07A 1R1VA 1OX9A 3I9QA 1KG4A 2ATCB 3G6EI 1OZ2A 1NG9A 4V19K 2YSQA 1GFDA 1IB8A 1UHFA 3HEFA 4UHTA 3ZQIA 4MMLA 3AVLA 1GCQA 2RHYA 3GF2A 5J1YA 1HNVA 1ETOA 3A8YA 3ENHA 1FZPB 4JKDA 3FZVA 3CP8A 3QZ5B 1UZCA 4HTUA 2K9MA 2NUTA 4IJAA 4B9LA 4I2QA 4M78D 1S1TA 2RAEA 4LF8K 3AVBA 3SB2A 2R5ZB 1GOAA 2K4JA 1GCQC 1VQMN 4JZ3A 3Q7BA 1OMIA 2F1LA 5GAN3 5D5UB 5AQUA 4MTDA 3QICA 1IGQA 2EFNA 4YOQA 4FWRA 1EH7A 1B8IB 4DZPA 4LDVA 1VQPT 4Y91A 2KVQG 1U47A 5FROA 2ASOA 1QWEA 4DR3K 3I0WA 3HJFA 2L3QA 2Q2RA 5GAGJ 3HI0A 1JXMA 1SKUB 3MEWA 1VQLA 4DQSA 4EW4A 4MNUA 2JA7J 4I7HA 3GPLA 2O8BB 3MEXA 2PVDB 4FE7A 1GHCA 2VE9A 3TBIA 4A69C 4AIDA 1VQ8A 1ITGA 4BQLA 3V4GA 5CZ1A 3EKUA 3TAFA 3V9SA 4II3A 3OGDA 2C0TA 3ENOA 5F2RA 1K61A 1X2NA 1X3NA 2RVCA 2XAFA 1DGRM 3K4NA 1T95A 2ESHA 5I2SA 2F4MB 2EA2A 4CJPA 1K0XA 4FZYA 1U1SA 4OPJA 2OTLT 5CHIA 1RBRA 2IJLA 1EH6A 3CJQB 3SV3A 3HPWA 3DLLA 1HA8A 2K5FA 3LSPA 3CDHA 1VQ9T 2DETA 1FP1D 3UB5A 3H9NA 2H09A 3S6IA 3OS5A 1VTNC 3PQJA 9ATCB 3RRGA 4DQIA 1Z9QA 1T33A 2E1MC 4L5EA 1KQSP 2NYXA 1FBQA 3JCMQ 3ASKA 3VFZA 4CW7B 1ZQ3P 3NMZC 2OZSA 3Q0VA 3GIBA 4BJ5C 4JJBA 3JAMK 1LE8B 3C7JA 2ZPHB 4ENMA 2JZYA 2ME0A 4A2UA 2HNDA 1T08B 1YF5L 2FE3A 4JAXA 3CW7A 2A1SA 4IIMA 3JTGA 3I4PA 2O61A 1YX3A 3NH2A 1VZ0A 4XK4A 3QNOA 1M30A 2A68F 4RTWA 4CEZA 1RDCA 2GIZA 4OMPA 4XH5A 3TPQA 2VOPA 1KU7A 3OYBA 1MH4A 2KRHA 1U04A 3VQAA 4DKWA 2OAWA 3CCET 2MD5A 2DFHA 4I76A 2RHZA 3AGKA 4K11A 2BY0A 1BK2A 2YPRA 4M45A 5ICCA 2CP2A 3AVIA 1A5WA 3JCMV 3QDFA 4J8FA 4BGDA 3DFGA 1GCPA 2KQ2A 3FJ5A 4M4ZA 1QVGS 2NLUA 2DKGA 2QQ9A 4BBRJ 1UE9A 2FVUA 3G2BA 5AFUA 1QVPA 4CEEA 2CMPA 2K3PA 1X6OA 4EW0A 2NRXA 2OTJN 1RILA 3GZ5A 4L0ZB 2GUIA 1AZEA 4ZYGA 2XIDA 4BREA 2CP0A 3TWHA 2NOLA 1Y0NA 1IN7A 4PSXA 1P90A 4EP5A 3S1RJ 1K73O 2IW5A 4FLXA 1Q7YR 2JHNA 4NQWA 3V9WA 1I3QJ 1VQPN 3RTRA 1SKSA 1JJ2A 2O6GE 4WXCA 1A0NB 3NNQA 3EYYA 5BMZA 3HOZJ 4BJ6C 5J2QA 5KQDA 2NUBA 4Q48A 3JRAA 1NE8A 4A63B 5GIPA 2KL4A 2P9NB 3G25A 2IS3A 2JHJA 4EHTA 2DAOA 4FL6A 2A5YB 2FC0A 2FU4A 2P9PA 4ZJZA 4CZEA 1M90O 3CC7A 3N5NX 2XF6A 4FWPA 2HSTA 4DU3A 2O4XA 1MGQA 2P9SA 2PZ1A 1FTZA 1JUSA 3ZN0A 1UEBA 4EM0B 3FEOA 2WUSA 4M9SA 5EDNA 1IO6A 2IS6A 1ZA1B 4E1JA 3F6OA 2JTMA 1IGUA 4XH1A 5D6EA 3SZTA 1RLPC 2GM4A 2LMJA 4XKVA 1G15A 1HBXG 2OTLN 4AHUA 1K78A 1H8AC 3RR8A 3KLNA 2BE9B 4ICLA 4CYCA 2FD5A 2I5WA 2DZCA 1NGCA 5L3FA 1W2BP 1VQ9N 3OL3A 3ROUA 2COZA 1L5UA 2Z2SB 5CR2A 5MLCQ 2UXBK 4BGBA 3F10A 5KYUB 3PNTA 2M87A 1FNNA 3CXCM 4LH4A 1ZLMA 2NRAC 4CHPA 1CQTA 3KZIC 3EZ5A 4BHPA 4WWCA 2A5XA 5GAMg 2KKZA 1X1AA 1YYVA 2MC4A 1N3CA 3LDQA 3PIPF 2G8FA 2EIMH 2KMTA 1V5FA 1JKHA 1WPYA 2LQNA 4XOTA 2QSGX 2GWRA 2CREA 4W5TA 3CD6A 2XRLA 1ZBLA 2HDAA 4HX4A 3CXCA 3W2WA 4PJLA 1XN7A 1ERDA 3MX5A 2XHKA 2VL8A 3O8HA 4RAYA 1HXDA 3CCMQ 2HF4A 2HNIA 1QCOA 1WSHA 2JOYA 2JPSA 2D0BA 2XY7A 1JXEA 5FW9A 1XHXA 2CQKA 1QHHD 2ZF5O 4MEXF 2JWLA 3SPZA 1UAAA 3NQOA 1DEJA 1R5GA 4I6MB 3DLBA 4FT2A 4OFHA 4HT8A 2ISYA 1S7EA 2E1ZA 4BWJA 1YJWA 4BU2A 1Q86R 1BG3A 1IF1A 2D8HA 1MD0A 2DLLA 3PFIA 2HBPA 3H41A 4IHTA 2M9HA 4A5NA 3JRGA 2NRWA 3CCEN 1WJRA 4M3TA 2QWLA 4QS8A 3AG1H 1V5EA 4I98B 3U4LA 4ZYEA 1YVUA 2D2WA 1XMXA 3G6EQ 3KZBA 5J2NA 1YP5A 1XSXA 1YS7A 1RBVA 3JCUC 1RT3A 4L6V5 3SQ2A 5C10A 4EGYA 3UKUA 3IKTA 2BE5F 2MSYA 4ASNA 3VF6A 5D6FA 1K9MR 1D0XA 1X58A 4H0YB 4CEDA 5CQEA 2AP1A 1S72A 2OCEA 2K5LA 3IAM2 4OMNA 4PNOA 4ZTJA 4FSXA 5KYNA 3CMEI 4C92E 4ZGJB 3Q5FA 1YCYA 4D6WA 5GANd 1BKBA 3HXLA 1YUWA 4L18B 5K5OA 2VQLA 3TEDA 3SYZA 3MN2A 2DMPA 3IC7A 3V9ZA 4G6QA 4C92C 1L3SA 1ZAOA 1XPXA 4S05A 2DJZA 2XIGA 1IXDA 3HPHA 1UGRB 4B9TA 3I59A 5KE2A 2HBJA 4UVAA 4XEIA 5HY6A 4QIWN 3KP3A 3KLIA 1JQQA 4Q47A 4XBFA 2K27A 2V7FA 4PCQA 3C6AA 1UHSA 3MEAA 2KJCA 1E2XA 1ZRDA 4IUVA 1ATRA 1BCMA 1OOTA 1RLQC 4CECA 1N25A 2R7UA 2EYXA 3BTLA 3I5RA 2EB7A 4KULA 1XI1A 4HYEA 3HOVJ 3AARA 4BXUA 1Q86C 2I0NA 3LAKA 4YORA 1B4AA 1BU1A 2GA2A 5GAOn 1IXCA 5KHDA 2MAMA 2LCCA 2OV7A 4IHYA 3CCUT 2O8CB 2DXIA 4DR6K 2P5GA 4P9FA 2FMLA 3AL0B 2F96A 4LXCA 1J7KA 5K7HA 4OINF 3REBB 3QO3A 5BPLA 1A31A 2D6FA 2X48A 4JRIA 1U45A 1LAWA 4XRSG 3V9XA 1Y96A 3ELKA 4AHVA 2L9VA 4DR5K 2Y69H 3QNNA 4JKEA 1NLPC 1K9MC 4DR4K 3BG9A 1FEXA 3JCMW 1YITT 4K2EA 2R5MA 3E9PA 4M75A 3QBXA 1ZBJA 3F73A 3EY1A 3P8BB 4EMKC 4F2RA 2D1VA 2V9VA 2CP7A 3BP8A 3HC7A 1XC9A 2DA3A 5HKCA 2QWWA 1PJRA 2RREA 1NMDA 2FYKA 2NOBA 4I99C 1LDDA 2HNHA 3AVNA 2F9WA 1XQHA 3LWIA 3ABLH 4B21A 4M75C 4B09A 4KH4A 4J6XA 3GTLJ 3HZJA 2LNVA 4CCKA 1OVQA 1M8VA 1QW1A 4IBNA 5FLMJ 5FU7B 2LJ1A 3OIPA 3SUPA 4IVNA 3H5NA 1QCFA 4WQ4C 2EV5A 4UUVA 1Q7YU 1OULA 2VODA 1QWFA 2Y0SA 4AVZA 2HB5A 4BE0A 4MZTA 4IJNA 4KYWA 3CBPA <