3L2WA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and gs9137 (elvitegravir)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 101
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2wA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2wA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2wA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2wA03
1BIUA 2P1JA 1KHCA 2X35A 4Z02A 4JS4A 3K57A 3QERA 1VSJA 1LAWA 1J54A 4EP4A 4HCBA 3MP8A 3L2RA 5HRPA 4NS5A 2B8AA 1VRUA 2B5JA 3LDSA 1K6YA 3CM5A 2D0BA 4N4IA 1BIZA 1MU2A 5EU7A 4AHSA 3KK3A 4CJSA 3TAQA 1WJSA 3AVMA 2ITGA 3IS9A 1J9AA 1JXEA 2E6LA 3IG1A 4O55A 4HUEA 4BE2A 4FLUA 2QKBA 4KRFA 4NYFA 3OYNA 2HQXA 1IH7A 3VQAA 1B9DA 3DLRA 3LAMA 4I7FA 1G5VA 3OS0A 4TSXA 4AH9A 3L42A 4R5PA 3NH2A 2B4JA 1RNHA 3CFRA 4FM0A 3SV3A 2IC3A 3VQ8A 2LCCA 1GOCA 1RDDA 5JS2A 2PYLA 1L3TA 4KKOA 4CGIA 3M8RA 5J2NA 3L2VA 1TV6A 2VWKA 4GW6A 4E7JA 2X6NA 5SZTA 3V9WA 1L3SA 4W5NA 2WACA 3PFSA 5DK5A 3PX0A 5J2QA 4M45A 4DSLA 3D45A 4QQDA 1KVCA 4ZTJA 4CJTA 3AVJA 4IUPA 4FZZA 3OYCA 4IFYA 2NLUA 2RJDA 4Z0UA 2IGIA 4OVLA 4KHSA 2HHSA 3LGLA 1VSKA 1IKYA 2OYQA 4C8OA 4CFAA 4DTUA 3B6OA 4L59A 4KTQA 1LW2A 4B9XA 4DTSA 3L2WA 5HROA 1JLBA 4FCYA 4B9TA 3OB9A 4I9QA 4FJKA 4BDPA 1KSPA 3QEXA 1KVBA 3VQ6A 3LANA 2L8DA 1KVAA 1EX4A 1WN7A 3T1AA 3QETA 2CKKA 1NJWA 1TGOA 2JZ2A 3L3VA 1BQNA 3AVHA 4UQGA 3NE6A 2X78A 3SJJA 4C8LA 5KGWA 5IN1A 3M8QA 4RW9A 5I42A 1RT5A 1NK8A 4M3UA 1CZBA 3DLBA 4FK4A 2HVHA 4E7HA 3VQCA 3H6ZA 4DTXA 3LLRA 4CF9A 2YNIA 1UWBA 4IG0A 4W5OA 3RMBA 1LV5A 4FK0A 2Z1HA 4I2QA 3FDRA 3C95A 3F73A 1S9GA 2F8TA 4N4HA 3HK2A 4WE1A 2E6NA 3EYZA 3RR7A 1WNSA 4G1QA 3PY8A 3K5MA 3HP9A 1L3VA 4E7KA 1KLNA 2OZSA 2M1HA 1RBVA 1WSHA 4LD6A 1BHLA 1RILA 1S1VA 4MQ3A 3ZSXA 4CFBA 1RDCA 2HNZA 1JLQA 3KKSA 4FJHA 2BUDA 1IKXA 4NCBA 3QNNA 2ZE2A 4BACA 5C24A 1ZYQA 3V9XA 4LSNA 5HLFA 3ITHA 2L89A 3OMGA 4PL6A 3DLKA 3P1GA 4RW4A 4DMNA 4CJFA 2D0AA 4HUFA 3RMAA 1XHZA 4CE9A 4FVMA 1A5VA 3LAKA 4DU1A 1ZBIA 1ASUA 1GOBA 1NKEA 2IOCA 3TAGA 1HYZA 3PX6A 3MEEA 3CM6A 2X6SA 3M8PA 3H8ZA 2RO0A 1RBRA 1C0UA 2XRIA 2W42A 3ZT0A 3TAPA 4EZ6A 5D6XA 4CERA 3TAEA 4HCCA 1Z26A 1SL0A 4FJ9A 2P5OA 4YNQA 3LZIA 1FXXA 1LWCA 4CEEA 3LGFA 3KUFA 2YNFA 3S6WA 4FLYA 4DLEA 5J2PA 1QQCA 4B9NA 1LAVA 3CFOA 3UT1A 4OJRA 4RG8A 3M8SA 3SUQA 1XNIA 2EQJA 5D6WA 2OPSA 4FJXA 2A1SA 3DRPA 3HXMA 5CYMA 4ID1A 4J2EA 3O3FA 4DTOA 1TL1A 3MXJA 3V9ZA 1A5XA 1TKXA 3L3UA 4KI6A 2VYTA 4Z4FA 3DLEA 2X74A 2RHIA 4O0JA 3AO4A 4J2AA 4CHNA 1Q9XA 4CJPA 1X9SA 4KHYA 5KRSA 1T05A 3SQ0A 2ATQA 4DTJA 1W9HA 4E19A 4HUGA 3MEUA 4IUUA 2QXFA 3T3FA 1DLOA 4N41A 2YRVA 1LW0A 1LWFA 3QEVA 2F5KA 4AHCA 4FLVA 4B9MA 4M3WA 1S1TA 2HW3A 1S6QA 1WSGA 3U3GA 3PNWC 2DFEA 2KZZA 4B9UA 4KB1A 1SUQA 3OVNA 4CK2A 4DFMA 4Z4IA 3OYEA 3O4QA 3H08A 1BGXT 1CXUA 3ZSRA 3KLHA 3BDLA 4F2RA 1WSEA 3FEOA 3E9FA 2ZD1A 3AVFA 3LX7A 4CJWA 3SQ2A 3MEVA 3AVBA 5FDLA 1BL3A 2G8UA 4FLZA 3KD1E 4PWDA 3DLMA 3ZSOA 2MWPA 3RMDA 5KCHA 4RG2A 1H3ZA 2WOMA 1QS4A 4IUQA 3NDKA 1T03A 4YFUA 2QQRA 1TAQA 3MEWA 2D0CA 3TWHA 2AJQA 1EXQA 4FJGA 2K3XA 3AA5X 3ZT3A 1S9EA 3HT3A 4KHNA 3D0PA 1CZ9A 4W5TA 1J5OA 1YTUA 3ME9A 2YV0X 3S3MA 4Z4EA 1SV5A 2X4YA 4E3SA 1U47A 1S5JA 3CEYA 4II1A 1KCFA 1WAFA 3HP6A 4B9VA 1RDAA 4CEBA 2HB5A 3AVAA 3ZCMA 1BQMA 2YKNA 4E89A 1ASVA 2Y1JA 1OZ2A 1HRHA 3KIOA 4OKJA 4CF8A 3EY1A 4F2SA 5KGXA 3UIQA 4FJIA 4DF4A 2KQ2A 4CF2A 5E41A 4KTWA 3DB4A 4IG3A 4IKFA 1VSDA 3V1QA 4DS4A 1N6QA 1B9FA 3LP3A 3QBYA 4FLXA 2IG0A 2X4XA 5SWMA 4K8XA 3HSTB 2G8FA 2PQWA 3F70A 2P0KA 1Z25A 3NNQA 1XWLA 1FKOA 3LPUA 4O5BA 3RRHA 4BE1A 4ZTFA 1NOYA 4AILC 3KK1A 3V81A 5CZ2A 3EZ5A 1X9MA 3QIIA 3QEIA 1JXBA 5J39A 3KK2A 2HHVA 1KFSA 3LH0A 2GUIA 1NKCA 3AA4A 3HL8A 3ZT4A 3VQQA 1UOCA 2RKIA 2PYJA 5T7BA 4EP5A 1BCOA 2XK0A 3AO5A 2XO7A 3TANA 1N27A 5C6SA 3KJVA 1O1WA 3DYAA 5J2MA 3MEDA 1VSLA 2HNDA 4M3YA 2O4IA 3P8DA 4LH4A 2Z1JA 3ZSZA 1D9FA 4EZ9A 3AA2A 3V4IA 3C6TA 3CYMA 4CGFA 4E0DA 2D9TA 3OYHA 2GV9A 2LRQA 5D3GA 3NH0A 2HVIA 3NGZA 4HHTA 1QSLA 4CJEA 2ETJA 1J53A 1HNVA 2VG7A 3VN5A 4CJ3A 4DSFA 2OA8A 3SZ2A 3QIOA 2DTUA 3FLGA 3U3YA 4BDYA 1VSIA 3PUFA 4DFPA 4ICLA 3OYMA 4A4EA 1YVUA 5KCOA 4OPKA 4Y1DA 3L8BA 4CEOA 5FRNA 3SUOA 2DFFA 4CHZA 5J26A 4AHUA 3HVTA 3BGRA 2BIVA 2LVMA 1S1UA 1BI4B 2XY8A 3DRSA 4M3RA 3VQ9A 3ZT2A 4FZYA 2KW4A 4DU4A 1WJRA 2EQMA 2FBVA 3NBPA 5M9OA 3OS1A 4E7IA 4CJQA 3PMIA 5C25A 3U6FA 2G8VA 4CFDA 3SI6A 1NJXA 4KHQA 4CJUA 3BDPA 1ASWA 1KFDA 1S1WA 3LPTA 2DY4A 4NCGA 4FM1A 3AO2A 4FLTA 1QTMA 4C5IA 2RHYA 1VSMA 1BI4A 1NJZA 1BCMA 3V1OA 4OPJA 4N5SA 4L8RB 3V1RA 3HJFA 4RW8A 1C1AA 1NKBA 2EKOA 3DB3A 4DFKA 1S1XA 4FZXC 1RBUA 4AHRA 4CHYA 2RI5A 1NOZA 4A4FA 2LSNA 1C6VA 1WSIA 3QKJA 5D6YA 2YNHA 4BWMA 3K5LA 4I9LA 4A4HA 4FM2A 2YKMA 3ASMA 3QINA 2O4XA 3P83D 3WNEA 3ZSWA 4DS5A 3LWMA 2RHUA 3QJ6A 4B9LA 3DLHA 3K5OA 4KREA 1C0MA 3TR8A 4M3TA 4AHTA 3HYFA 3NGYA 1HYVA 2HNYA 4Q5VA 1SL2A 2KZMA 1Y97A 2BANA 1WSFA 4X34A 3OYLA 1TK5A 1N5YA 3WNFA 2E6MA 5DMRA 3O3GA 1HYSA 3OYIA 1XC9A 3MO8A 4CRIA 1CLQA 4FJ8A 3OS2A 5CZ1A 2I5JA 4CIGA 4CIFA 4W5QA 4KFBA 3RTVA 1B92A 4CHPA 1XI1A 3SPZA 4FYDA 4FU6A 1F21A 1WLJA 1X1PA 4B8AB 4ELUA 1I39A 3AO1A 1LWEA 2KFZA 3IRXA 3ZEHA 1JKHA 2F96A 4UC4A 3A2FA 3P5JA 4FJMA 4M42A 4IBNA 5KE3A 1TK8A 2G8IA 2HHXA 3E01A 1IO2A 4Y1CA 4CHOA 4FJ7A 3PMTA 3O8VA 1FK9A 4CECA 2KFNA 2Z1IA 3HPGA 3VA3A 2RJFA 3SUPA 1IKVA 4DSKA 1NK7A 4PUOA 3OJSA 1WAJA 4DSEA 3TAMA 1VSFA 2FBXA 3VQ4A 5KTQA 4Z4GA 4PQUA 2GFAA 1ZBLA 4Z4CA 1TKTA 2IDOA 3V9UA 2R5MA 1RBTA 4OKEA 4QAGA 4CK1A 3M9QA 4F3TA 2JLEA 3FFIA 3KLEA 1QSSA 1U04A 3LALA 3AVGA 2G8WA 3OA6A 3OMCA 1JL1A 4OLAA 1ZBFA 3JYTA 1TK0A 3KLIA 1UAXA 1YT3A 4KO0A 5J1EA 4O0IA 3VQEA 4DFJA 2PZSA 1XHXA 4ELTA 4CGDA 1U48A 4DU3A 4O44A 4KV8A 3OY9A 1TVRA 1SL1A 2BGGA 2O4GA 4KTZA 3HO1A 1IG9A 2R57A 3AO3A 3LP2A 2QK9A 3KLFA 2XDPA 2RI2A 3NTIA 4FL6A 2ZQBA 2JTFA 2HQEA 3ISNC 3QNOA 1CXQA 3S9HA 3T19A 4F3OA 1W0HA 2E4LA 4C5GA 4FLWA 3G0ZA 1JLGA 4OKKA 2D5RA 3CQ8A 3S3NA 2L3RA 4IURA 4M41A 2GBZA 3SUNA 3TI0A 1U49A 3HVRA 4DG1A 4BWJA 4CJ5A 2JGUA 2NUBA 3O3HA 3QEPA 4CEFA 2G8HA 2HMIA 3WNGA 3TABA 2EQUA 1DTQA 1TKZA 1RCHA 1Q8IA 2OPRA 4K8ZA 4CCHA 4C5HA 1ITGA 4FJ5A 2MWOA 4LH5A 4LSLA 3DRRA 4JLHA 3AA3A 4RW7A 4E7LA 3NFAA 4JRQA 4DF8A 3NCIA 2HHQA 4PA1A 2IS3A 4CGHA 3L2UA 1A5WA 4CJKA 4KAZA 4O4GA 4KB0A 2FBYA 3ASKA 2XY5A 1HPZA 3F9KA 3RR8A 3S3OA 2RN2A 1RTIA 2YHBA 4LD0A 3NF6A 3HPOA 4OLBA 2F8SA 4QQGA 1EP4A 1G15A 1GOAA 3DMJA 1HQEA 3ZSQA 3I0SA 3QESA 3RMCA 3ALYA 3SPYA 3ZT1A 1C1CA 4KI4A 5HRSA 1VRTA 3KTQA 3B6PA 1HJRA 4IFVA 3NTHA 1KTQA 1BISA 3TAFA 3O4NA 4HCZA 1RBSA 2Y1IA 1SKWA 3K59A 3PV8A 4CGJA 2PY5A 3SCXA 1REVA 2RJEA 4DQQA 2RF2A 3MAQA 1RT1A 4C8KA 4DSJA 3LZJA 1EETA 3OYJA 4C5EA 2R58A 4IDKA 4H4MA 3VQDA 4KHWA 4B08A 1UA0A 1EKEA 4CIEA 1QHTA 3SQ4A 1VK0A 4E1NA 1RTJA 1U45A 1D9DA 1Q9YA 3RRGA 4QOZB 2OZMA 3PO5A 3OYAA 2M0OA 2HHTA 1RDBA 1OI1A 2EFIA 1HQUA 3K58A 2RHXA 3TARA 4H4OA 2KTQA 4E1MA 5JS1A 3KD5E 4DTNA 1NK4A 4OVAA 1SKSA 4FJLA 1TAUA 2FBTA 3MP6A 2QKKA 1S6PA 4W5RA 3MXMA 5C0MA 4DTMA 3AV9A 2QQSA 2EX3A 3LYIA 3WNHA 4GY5A 5HBMA 1T7PA 5C42A 1NJYA 1RTHA 4J2DA 4DQSA 3E9GA 2WONA 3DOLA 3VQ5A 1RTDA 5CIUA 4PY5A 3SD4A 4NZGA 2OPQA 1JLEA 4IUVA 3ZSVA 2O4XB 4Z4HA 1RT7A 4PLIA 2R5AA 5KE2A 3C6UA 3OYBA 2B6AA 4C8NA 4CJRA 3OJUA 4B9SA 4F8RA 2M16A 2VG5A 5KH6A 2P5GA 4CHQA 3VA0A 3K2PA 1NK0A 3RWUA 3QO9A 5HRNA 3SQ1A 3SNNA 1RT3A 3NAEA 4CEAA 4BD3A 4ID5A 4CFCA 1TKDA 2GFUA 4CEDA 1L5UA 5HRRA 2E5QA 3UWNA 2OPPA 1RT4A 4M3ZA 2A1RA 4CF0A 3AVNA 4J2BA 3QIPA 3DOKA 3K5NA 2BE2A 3NF7A 2LTOA 1I3AA 2VG6A 2VWJA 3G10A 1VSEA 2BDPA 1RT6A 2RI3A 1HNIA 4I2PA 3ULDA 4GMJB 4IUTA 1T8EA 4QVZA 2GF7A 4BE0A 1X9WA 2RJCA 2XY7A 1KLMA 3ZSYA 1NK9A 3V9SA 3EAEA 1WGSA 1JLCA 3P8HA 5KRTA 5IAYA 4M3XA 4DSIA 3CFPA 4DTPA 1NK5A 4FJJA 1JLFA 4EDUA 1RT2A 4N4GA 4CJLA 3QEWA 4B9WA 4CEZA 3PX4A 4BDZA 2Q3SA 2X4WA 4CGGA 4C8MA 2FHDA 5K14A 4CESA 3AVIA 4N56A 3IAYA 1L3UA 2DAQA 2BKDN 1WJQA 3META 3V6DA 1NK6A 4N76A 4FXDA 3OYGA 3SYZA 4FJNA 2RHZA 1WSJA 4MFBA 4HTUA 2G8KA 3CG7A 4F4KA 3LP1A 4B3OA 1D8YA 5HP1A 4A4GA 3MEGA 2K3YA 1IKWA 1SSFA 3C4SA 3MEAA 1MHNA 3AVKA 4OGCA 3FC3A 4OGEA 3THVA 1HMVA 3DLGA 4PLLA 1TL3A 3LP0A 2DIQA 4NYNA 4KPYA 4KHUA 3OYFA 4LY7A 1C0TA 3AVCA 3VQPA 2DIGA 2G3RA 2P51A 4DTRA 4CJ4A 4DQIA 3DI6A 1R0AA 4N47A 3PO4A 3I8DA 3QLHA 4XIUA 4DQPA 3NH1A 3LWLA 3MECA 1UA1A 4DWIA 3HM9A 2XY6A 4Q0BA 3VQBA 4RW6A 5CY4A 3KKRA 3JSMA 3NHGA 4HVJA 3MP1A 4DLGA 3NTKA 2YNGA 2EQKA 3HPHA 4GVMA 4B8CA 3OYDA 4JRPA 1FKPA 1RI0A 4Q5WA 3OYKA 1KRPA 4DQRA 2FC0A 2DFHA 2XHBA 1U4BA 5KI6A 4NCAA 1C1BA 4AHVA 3KLGA 1ZBHA 3NGIA 1SKRA 3SV4A 4QCLA 3I0RA 4ELVA 3AVLA 1JL2A 1OYXA 4ZHRA 4CEQA 2LDMA 4CJVA 3VQ7A 1DTTA 4CK3A 1QSYA 1YTAA 2HHUA 1OZ3A 3GOXA 1D5AA 3NF9A 2R7YA 4H8KA 2RPIA 2Z1GA 5CYQA 4JS5A 3MXIA 4QQ6A 3NF8A 2EHGA 4FK2A 1QE1A 5FROA 3L2QA 4FW1A 4CF1A 1ZBUA 5FRMA 4FW2A 1JLAA 3C94A 3Q1JA 4QW2A 5I3UA 2IAJA 2YHAA 1VSHA 2HHWA 3DM2A 3OQ5A
chains in the Genus database with same CATH superfamily
3QQAA 1VQKI 4EP4A 2EYYA 1YFHA 5FD5A 3G1LA 5HRPA 4C3HJ 3LDSA 2DFUA 1WJSA 4ABZA 3AVMA 1TW2A 1ZKGA 4AH9A 3NH2A 1VQPT 3KZBA 4OOIA 4B9MA 5LGNA 2F48A 1L3TA 4CGIA 5A2QE 2HXIA 1W4SA 3PFSA 4YIRX 4C92A 3D45A 4QQDA 3AKZA 3Q0UA 4WFAL 4F55A 3T7ZA 2NLUA 3OW2M 3CCSA 3LMMA 1NGNA 2YLCA 3V4GA 3IMXA 3L2WA 2O8KA 1VRLA 3I5RA 3G71T 4JJNK 1EX4A 2BBYA 1YIJA 2CT3A 3C18A 2NRXA 1R49A 2GTOA 4GVEA 1M3AA 3SEZA 1JGGA 5L3EA 2EWNA 2JPCA 2XDVA 3DJCA 1VYUA 4WE1A 5J40A 4H0OA 2V26A 2J06A 4FE7A 1HKBA 4LF9K 4MQ9F 2ZWHA 1FMKA 2HWVA 5D8LB 4Y4RA 4A3GJ 2FVUA 3ECHA 3BR0A 4CYCA 4DMNA 2JPSA 4KGZB 5FPNA 3CJTB 3GP8A 1VYTA 4HCKA 1VQ9A 2AT1B 2IA2A 5JMVA 1FXXA 1LWCA 3G4SQ 4RAYA 2CSQA 4X1VA 4DA4A 2EQJA 4F16A 1I1JA 4JI3K 5DM7L 1DKGD 2ZBKA 3DLEA 1X6GA 2LP0A 2QQ8A 2ZXIA 1EH6A 1RADB 2W41A 4PNOA 2P4TA 3PNWC 3HKZN 2JVHA 3VS2A 1TWBA 1M1FA 2JMCA 3EE9A 4UY8I 5E79C 1BL3A 1S8NA 4FT4A 5BN9A 3LW5E 2HU9A 2QQRA 4F04B 3CC7T 1IF1A 5AQRA 2CUJA 3UATA 2GXGA 4M74A 1WBBA 3CO7C 3CC7I 4DV6K 1OPLA 4B9VA 4CO8A 1OU9A 2CSOA 4CEBA 5M5WJ 4F2SA 3KIOA 4FT2A 4G12A 1VQ6Q 5LJ3j 2YX4A 3W6KB 2DTOA 1FKOA 1GXQA 1QNTA 3NHNA 5A0GA 1OFCX 2E4HA 4HLYA 4E7SA 2DA7A 1HQCA 2PYJA 3BR6A 2BW3A 3EG3A 3MEDA 5BMZA 3CCUT 2E1OA 4EZ9A 2GV9A 4HHTA 3VN5A 1YXQA 1BC7C 1RIOH 4ZJZA 2QQ9A 1NJIO 2JSCA 1KZHA 1N25A 4JX4A 1T3LA 2LVMA 1RAHB 4DU4A 1YHQI 2OAWA 1ZELA 2HQ5A 4QWQA 2EPDA 1VQ5T 3CJ9A 1G6NA 4JK7A 2KR3A 1E6GA 3LPTA 5EG2A 4KT0E 2DQRA 3HSFA 2HNIA 4H0EA 3PJRA 4DFKA 3RDVA 4A4FA 5CQGA 1T0HA 5GAEJ 4BRNA 4DS5A 4YOTA 3E2UA 2KZVA 2RHUA 3K5OA 5LHIA 5LFAA 2KRMA 3HRSA 3OS2A 5JLHA 2BZTA 4C92G 3C7NA 3P39A 4FYDA 3CCLI 2KFZA 1BR4A 3SUPA 4RCHA 1YJWQ 1F36A 4M3BA 4AG1C 2K3FA 1NG9A 4BUGA 3SHFA 3OMCA 4XLNF 1UAXA 4BXFA 2GQQA 2GGRA 4FYYB 3BF1A 1XPXA 2JNGA 4I7HA 2G6FX 3TI0A 4A5NA 2W10A 3SMSA 2R7RA 4BJ5C 2L01A 5D4RA 2DA4A 4CYDA 5BS6A 4M7AC 3H9JA 1OKRA 5DEQA 4JKGA 2BW3B 4JN4A 4DZPA 1QWFA 5H2FC 3ASKA 3F9KA 4EV0A 4LD0A 4EATA 2KROA 3W3DA 2X48A 3SPYA 3ASNH 1HKCA 3AAPA 4KI4A 4M77G 4IFVA 4CCNA 3TW7A 4HCZA 2Z2SB 2PY5A 4CGJA 4FYWB 3ZMVA 3WXMB 3PQJA 3DKYA 4HWIA 3VGMA 2X4HA 2X51A 3OYAA 1NJIC 3I9V2 4FHTA 4M78E 1RI7A 4PKCC 3TO7A 3HXLA 2EX3A 2PVDB 2F9WA 2LOOA 3COAC 5ED4A 1D4XA 4EMKC 2OANA 4F8RA 2GA1A 4M9ZA 1YJ9T 1UJ8A 2QEXT 1UFMA 3BROA 2F2WA 1YI2T 3TQNA 3JRHA 3EG1A 2A5WA 4AF1A 2E5NA 2B9SA 1I3AA 3GFMA 4PFZA 3VS5A 4C2UA 2QW9A 3SYTA 1ETVA 1WGSA 3P8HA 3U21A 1PUEE 1VQLA 1FY7A 1YRNA 3QEWA 2FHDA 3F22A 2ZPIB 1ABOA 1LNWA 4BQZA 1FNNA 4B3OA 3BE3A 4BY6B 5B5EC 1MHNA 4B23A 3DLGA 4ZYEA 4LY7A 3TPQA 4H5TA 5HKCA 3VUZA 1YI2Q 4D9JA 1F1ZA 1UA1A 1T8IA 1GL5A 4BYYA 1R7JA 4RW6A 3JSMA 1FKPA 1SMYF 4RS8A 4WXCA 1UHCA 2IGMA 4JP0A 1UCRA 1VQ6T 1WGXA 2OPTA 5F64A 1XNQK 2RQPA 2M4KA 5FROA 1UZCA 2WAQA 4HQEA 3DKMA 3DEUA 2HHWA 1RLQC 1BIUA 2COYA 1QPIA 4E2FB 3CCSQ 3DBHB 4H4KC 1Z1DA 1VIEA 3T5XA 2A05A 1B9DA 2W6KA 3D4VA 2IVMA 2B4JA 1BR1A 1VQOI 4FSSA 2LCCA 2YX7A 1GLDG 2VWKA 3R8EA 4W5NA 1SS6A 4UUTA 2AXLA 1C0WA 1RUWA 2PBIA 4F93B 1Y71A 2L8DA 3JR9A 3UKRA 2GZWA 1ZBSA 1D3BA 5DLOA 1TGOA 2FRWA 2VXZA 1NEBA 5L3GA 3CCSN 3A8YA 1KAYA 4QKUA 4W5OA 2PUKB 2COBA 4BY6C 4I2QA 3HK2A 3RSNA 4OPAA 2V6CA 2KRFA 1JLQA 3HKSA 2JUGA 1POGA 2QSFX 3P1GA 1YJWT 1PM3A 4CE9A 2HKXA 1IG7A 1LJOA 1NMDA 2A3SA 1H8KA 1Z26A 1H641 1I3QJ 3F8MA 1X3MA 3ZMSA 5J1UA 5D6WA 2PMUA 5HDKA 1TL1A 4Z8AA 1FT9A 1N78A 1IAWA 4J2AA 4CHNA 1Q9XA 4D7MA 2EW3A 3GTQJ 3VF2A 1S1NA 3SDZA 1ZG5A 3CCLT 3MMVA 3QDKA 1DP3A 2YUNA 2XHKA 1R23A 2DYIA 4L18B 2IBDA 4G9YA 1USSA 2NRTA 2NNYA 4AYBA 1K61A 5ICEA 4FLZA 3ZSOA 3J80E 4RG2A 1H3ZA 3IHUA 3NDKA 1Y96A 3CBOA 4EAHD 4OX9K 2DTRA 3GYHX 3ZBDA 5F2RA 4M6XA 1FJGK 2KMUA 2L3PA 5LMUK 1K79A 3EY1A 4O8UA 1WXUA 4NXNK 5CVRA 4PCQA 3CC4I 1VA7A 3H41A 2IG0A 5IP9J 2X4XA 3HSTB 4KISA 4KMFA 1VQOQ 4ZTFA 4M7AB 3VEOA 1ESVA 2ZCWA 1K73R 5CQEA 3BY7A 5AQIA 2TDXA 4XKCA 2O4IA 1UGRB 4JAXA 4M3YA 3P8DA 4B47A 1U2VB 4DNCA 5E1ZB 4DSFA 4CCKA 4ZGEB 4BDYA 4AC0A 4I09A 4CD1A 3IKMA 2HPMA 3M54A 2KBTA 3DRSA 2A07F 4M3RA 1YJNT 2WBNA 3P9KA 1ASWA 1E2XA 3GLLA 4FLTA 4OPHA 1H8AC 1QQIA 2GBQA 3URGA 1SMTA 1RBUA 1JXOA 3K4JA 2CU7A 2H6CA 2X0LA 3CCQQ 4CHYA 1K4TA 1YLFA 3QINA 3TR8A 2E60A 4Q5VA 3DLLF 2V1XA 1Y97A 3QU3A 4C30A 1N5YA 1QA6A 4KH0B 4S0HB 3G1MA 3OH6A 1XI1A 2CP3A 1T38A 3DU6A 2EYXA 1BBZA 3A2FA 3KP2A 1SFEA 2HYJA 4L0YB 4DBQA 1IKVA 1NK7A 4F7UF 1AHJB 3PO3J 1M2VB 1T39A 1OCZH 1U0JA 4JI6K 2XV4S 4BBSJ 1U5TC 1U04A 1EZZB 2V9KA 2HBJA 3I58A 4BGBA 1XHXA 4Y15A 4Y28E 4O44A 4A3JJ 5GP9A 2Z33A 5CCAA 4JKBA 2X85A 3KCCA 2VXEA 5CLSA 2A41A 4A5MA 3BR5A 1C0GA 2JWTA 3VMFB 3TCJA 2L9RA 2GBZA 1U49A 5DUKA 3IAS2 1JEGA 3AHUA 5FJ8J 1LEAA 4KRTA 2LT1A 1JJ2M 3MKYB 4M6VA 2RN2A 4U7BA 3ZSQA 4D7NA 2KISA 3SZPA 1IV8A 2K7LA 1BISA 1M1KR 5LMNK 2NWMA 3OWTA 3MPUB 4C8KA 4JPBW 4H4MA 2XUBA 3MN9A 2VVKA 3JAMK 3T8TA 3I5SA 4AFUC 5FPMA 4M78F 2J5OA 1VQ7A 2KXDA 2M7BA 3K58A 1ZLJA 2KTQA 2XGEA 4E1MA 4ZZDA 3F10A 4PKIA 4W5RA 2EYQA 2LJ3A 5IXFA 1PUFB 3CCYA 2Q1ZB 2E88A 2K27A 3LOCA 4M3DA 4PY5A 5FKKA 4KFCA 3SZGA 4LGWA 5GAHJ 3C6UA 4C8NA 4F7UA 4MFDA 2M16A 5HRNA 3NAEA 1VQ5N 3RERA 4ID5A 4KIGA 1T2KA 1XMXA 3UWNA 3O4WA 2ELKA 3AVNA 1E3OC 3IH4A 4XTYA 1F4KA 1A04A 3VYHB 4KBMB 3MJXA 2M9UA 2FXUA 2CWEA 3CJNA 3EAEA 4LG0A 2KIFA 5CVIA 4BG8A 1KG7A 1Y1WJ 3OL4A 4X64K 4FZYA 2ICWG 5DY9A 2DL5A 3BZKA 3E0JB 4FJNA 4BXUA 4MFBA 4M75G 2C0IA 2HFHA 1QP3A 3CQTA 4LDWA 2CDTA 1SSFA 1U48A 1V55H 2NVTJ 3GF5A 5LHHA 2CQQA 3BTCA 1B1BA 3K1NA 4BQQA 2F69A 2IEKA 3KKRA 3I0TA 1KD1U 3FR0A 3OYDA 1V4SA 4Q5WA 1OR7A 1EH8A 5FLXK 4YORA 1BJAA 1ETOA 2K5CA 1HF0A 2FMYA 1QSYA 1YX3A 2HKOA 3Q9VA 2WUSA 2IS4A 4H8KA 3HUGB 4QQ6A 1TYQB 1NGAA 3CCUN 4CIGA 4JS4A 3QERA 2O2OA 3PQKA 4LFCK 2VC8A 1WEFA 2B86A 4KA4A 4MZMA 2FQ4A 1VRUA 1R77A 2HHHK 2OTLA 1S7EA 1QKXA 3KK3A 2C6YA 1ONVA 3CCMA 3LAMA 1Y64A 5ILUA 2STWA 2ZJQL 4O3MA 1USTA 4KKOA 4E7JA 1JGSA 4CJTA 2JG6A 3JCMf 2PJRB 5E18F 3LGLA 2W00A 1FMWA 4C2TA 2VGNA 4RMNA 3S1NJ 4BDPA 1WOQA 3UPUA 3LDPA 4EGYA 4UVCA 1WN7A 4PZJA 1LCKA 1K9MO 3NVKA 2FF6A 3KLNA 1K8AU 2H3EB 2HYFA 1DGKN 4HSTA 3C6AA 3FDRA 1HSJA 1NJIU 2R5ZB 3R61A 1PCXA 2DXTA 2QK0A 3SBTA 2EIFA 1RDCA 4BACA 4LSNA 4A59A 3EUKL 1OH5A 4BRQA 4FVUA 4RW4A 4NB5A 4CJFA 4PJOA 4FVMA 2IOCA 1G3TA 2JTMA 1I81A 3H8ZA 4WFNL 4I6MA 2R7UA 2EJRA 2MD0A 4NLBA 3D1NI 2QWWA 1E7OA 1R1UA 2WWYA 4ID1A 1R5ID 2DK8A 4YOQA 4Z4FA 3EYYA 3K4CA 4Q47A 1B07A 3TOAA 2XKOC 2K5IA 1TYQA 1F5TA 5L8RE 5AR0A 4OMZA 4BNCA 2YCHA 4GV3A 3T3FA 4ZN1A 2ATCB 4FETA 4AHCA 2Q1NA 3FIFA 1SUQA 2EWSA 1IW7F 3VYUB 2P4WA 4RCBA 1K73C 1BGXT 3I55N 4P9FA 2Q2EA 2GIZA 3HOWJ 2KK4A 4XORA 2CG4A 4YOUA 1PJRA 3QP5A 4IUQA 1QZYA 4NXMK 4AM3A 4E70A 2V8IA 3CCRN 4KHNA 4OB0B 3H0DA 4AYBN 3FE1A 4BB7A 1GFCA 3QPSA 1EA3A 1TWCJ 4E89A 3NQOA 5E41A 3TSPA 1SQKA 4IG3A 4IKFA 4LFBK 1DT9A 3LP3A 4QVCA 2HYGD 1NG6A 2PQWA 1Z25A 1P7MA 3NNQA 3LPUA 1BIAA 3W2AA 4A3EJ 2LKPA 2E8AA 3QYBA 3EG0A 3REBB 2DT7B 3FWEA 1AKHA 1BJZA 2QENA 1Y6IA 2Y9YA 1VSLA 3O9SA 1VQKA 1NNEA 5D3GA 2D9TA 1FSHA 4IOCF 2MH9A 1GCQC 1YJNN 3PUFA 3L8BA 4Y1DA 4CW7B 3CMAI 2DFFA 1IZ6A 1A35A 5AQOA 2G8VA 3BG7A 3JSCA 1GXPA 3EQLF 1S1WA 2DY4A 2W84A 3BEXA 2VKEA 4JNEA 1N36K 4L8RB 4OIQF 2XRNA 3OL3A 2EKOA 4IO9F 4FWOA 3OIPA 2EIMH 5D6YA 1XB4A 2WSFE 3S2WA 4RGSA 1PG5B 4BRKA 5FU7B 1FYKA 4DK9A 3P9IA 1WSFA 3OYLA 2HF4A 1L0OC 3FDYA 1ACIA 2YUSA 4DQ2A 1N9RA 4IIOA 4B48A 4KFBA 3M1CA 4KMUX 1CKBA 1IREB 1I39A 3OYYA 5KE3A 1U78A 1IO2A 5KYNA 2IGNA 4QT7A 3SHWA 3LFUA 1X3ZB 3VQ4A 3S1QJ 1YIJQ 2JLEA 3GZNB 2QAZA 4E6KG 1YO5C 4EJYA 2E5ZA 4DU3A 3TSQA 1X58A 5GAGJ 4FM4B 1OJLA 2UXXA 1YF5L 4P96A 4XU2A 4JKFA 2FRYA 3KWGA 2LP5A 4BROA 3CF5L 2DRMA 3HBTA 3SUNA 1DU0A 3AG3H 2RA2A 4BWJA 4XOTA 2NUBA 2HMIA 4KIFA 2LT4A 1FPQA 3CMEA 3AA3A 3GWZA 3CPWM 3CMMA 1KQ2A 4V2SA 3L4IA 2BH1A 3RPUD 2ZGWA 4NO7A 3ZMUA 3TTCA 1GOAA 1MBJA 4L5JA 3C3WA 3PFYA 1P7IA 4I2OA 1KTQA 2XU8A 4JEPA 3LDLA 2QTVA 3LA3A 3J7ZI 4DSJA 2QWMA 1QHTA 3BTIA 2Z16A 1QZ5A 1D9DA 2ROLA 3LSIA 3CC7A 4M7DG 1X1DA 4YHHK 3MXMA 3M57A 1IN4A 4BR5A 2H27A 3CJRB 5BR8K 1K83J 3E9GA 4EJOA 4E4HA 5B8HA 2QSGX 2CUBA 2C06A 3QEXA 4IUVA 4Z4HA 3MWTA 1JUMA 2B6AA 3CHWA 5KN9A 4CEAA 3KYLA 3TSUA 1WJCA 3C7NB 1KD1C 1X9WA 3BUZB 1YW8A 3ZSYA 1K9MU 3FXRA 3CPWA 1IRXA 5IAYA 4M3XA 3D6RA 2LNHB 3FLCO 1L3UA 2E7XA 2RH2A 3HM5A 3ZN0A 5FD6A 5BPMA 3MEGA 2K3YA 3CXCP 5EZGA 2NOJB 3JSPA 2DIQA 2ZGYA 3MAJA 2P51A 1QZEA 4QS7A 4UV9A 3QLHA 4XIUA 3QZ5B 5CKDA 5GMKi 2WB1A 3HPHA 3SJHA 4RTYA 1JHHA 4A0YA 3DWLE 1AT1B 2VKDA 3CC4A 4DV5K 3K9TA 4CEQA 4X6AJ 5FPDA 5FLMJ 3K0SA 4J6YA 3KWIA 1X6BA 3C94A 4MMKA 3SFMA 4MZPA 4WCGA 5C4XJ 5EC7A 3K57A 3TVTA 4PFPA 5K5RA 2J7IA 2DMNA 3C2BA 4J5YA 3BQYA 4LDUA 1R59O 1OPKA 2LNBA 4MDXA 3A2KA 1YFNA 3A1PA 2HQXA 1P7JA 3TSZA 3T9NA 3CFRA 2EGEA 1UG2A 2NS8A 3KTUA 1RAGB 3SEQA 2VWBA 2NVQJ 3BLYA 3INZA 5J6XA 4IUPA 4IFYA 4KHSA 2DBKA 2VCPA 1W5CC 4KTQA 5HS9A 3M07A 1LW2A 3A5NC 3ER0A 2VJ4A 3OB9A 1WI7A 1YUWA 2O31A 3DLLL 4KUMA 1BIBA 5F0FA 3NE6A 3H35A 3AGKA 3MN7A 1NZ9A 2H1KA 4M7DD 1GLJO 1Q81O 4IG0A 2Y30A 4YOXA 1PP8F 1Q1HA 3IL2A 2NYXA 5J8FA 4BGAA 3VEVA 4BR4A 4HZFA 2XGCA 3QNNA 4JYAK 1U3EM 2QZ8A 1YS6A 3C2HA 2KYMA 1V29B 1A5VA 3CJBA 1A6QA 2RO0A 2W85A 4WXHA 2X4JA 4M63C 2ED0A 4YNQA 1VUBA 2KHMA 3AAQA 5FU7C 3QAHA 5J3LA 1W6XA 3MXJA 3AARA 1VQMN 2JT4A 3N0UA 3SDGA 3RMSA 4KHYA 3REOA 2DOAA 1RAFB 4FLVA 1Q7YU 1KJWA 2JSPA 3IRRA 5BNGA 3OYEA 4H03B 4RLFA 3AAFA 1VQ4Q 1BOBA 3R6SA 2XASA 2ASPA 3JB9I 3KD1E 3E6DA 4ENNA 1VAZA 2DL4A 3CCMT 1BU6O 1P4XA 3VJPA 1KYWA 3GZ5A 4IEEA 1EXQA 3HT3A 2CP2A 3CC2A 2DL7A 5FKMA 4HNTA 1YQRA 5HCKA 4QVDA 2OF7A 1Q86U 3CD6T 1WAFA 3K10A 4CF8A 1AOJA 2BTFA 2EAYA 4C1NK 2ZF5O 1QCNA 3F70A 5IT3A 4BE1A 2MC3A 2W6LA 2B63J 4A2AA 2BEOA 4M77D 2E35A 3JW4A 1Y8QB 3PIOF 1R36A 3KVGA 1BCOA 3AO5A 2E2IJ 4AIHA 3AA2A 3CYMA 2FZKB 4FYXB 1T3SA 2OA8A 1LPLA 1KEAA 1IJWC 1VSIA 3M3ZA 3QOEA 5TRDA 2NXNB 1XMAA 2JM8A 1BI4B 5LD2C 2KW4A 2FBVA 1E3HA 2WSCE 3LSGA 2QEXI 4LXCA 3PMIA 3SAGA 4A12A 3CXCM 3JRBA 2HQHA 2M34A 2DO7A 3K6GA 2PVGB 3V1RA 3CCSI 1TUGB 3HHGA 4J9FA 2V1RA 4E6RA 1HUXA 4A4HA 4FM2A 1P4AA 1MJAA 5AYFA 3IV5A 5CKFA 1VQ4N 2OZ6A 4IO9L 3ENHA 4AHTA 2JA7J 3AG2H 5IY5H 4BEHA 2LQWA 2KZMA 3UA6A 3VRYA 5EJCA 4RB3C 1D8KA 1CGPA 1PSFA 3PIOL 1E6HA 4CIFA 2DETA 3LSJA 1OVYA 3Q9SA 3NPFA 4UC4A 2IW5A 2G8IA 1HDPA 3SMPA 1XC3A 4XEIA 3ZQGA 2WBMA 1KG3A 4C92C 2JS0A 3FZMA 3T1HK 2VE9A 4LLNA 3CCJQ 1IDZA 4EQQA 1RFQA 3X20B 2O8EB 3KLEA 4KH1B 3SAFA 2WTUA 1HNXK 5GPAA 4KO0A 3DQVC 2YHTA 3PIOA 3NTIA 3T69A 1K9MR 3K1PA 3QNOA 1R0BG 1UFFA 3S9HA 2KHOA 3BTLA 4I98B 4FLWA 1YTUA 2P9UA 2ZMEA 1MKMA 2DMQA 1LWWA 2YXYA 4CC2A 2BVMA 3CC7Q 3FMRA 3HB9A 1TKZA 2GOMA 5BQTA 5L3CA 4C5HA 4DR1K 4PJJA 4JX6A 4LH5A 1QVUA 2K2VA 4JRQA 3NFAA 3R0AA 4PJ0C 4LLGF 3KP4A 2H1LA 1HPZA 2GLOA 4C8QC 1RTIA 3BJAA 2YHBA 3DMJA 3C0BA 2LMDA 4GKKK 2I7PA 1VQ9N 4F9OA 3NFCA 3OR2C 4ENMA 1T0JA 3O8HA 1PRMC 6PAXA 1DUXC 1REVA 2LRDA 4RAZA 3IFRA 3GNFB 4ESFA 3FXOA 4E9GA 3IP4B 2MF2A 4QOZB 1HPMA 1FWZA 1HQUA 3E6CC 3ABMH 1T44A 2QKKA 3C6HA 4AIKA 4DTMA 2EFPA 3LYIA 3WTVC 2P84A 3SD4A 4CJRA 5KYUA 3RR6A 5CO7A 1QZ6A 4CVNE 4DUYK 3CQXA 4UOBA 1O57A 2HVRA 2CQKA 3C7JA 2VG6A 5C12A 2OX7A 4GMJB 1YX5A 2V8JA 1XGSA 3PFIA 5LJ5g 3A0IX 3BR2A 5ELZA 5BPNA 2PMHA 2DQLA 3EKUA 1BKBA 3GIBA 2IJLA 4WK8F 3CFPA 3M0TA 4HLXA 1N8RU 4S05A 4N56A 1TUUA 2DAQA 4N76A 1W2BP 1V4TA 2OI3A 2CZ0B 2F2EA 5GAHP 2HCKA 4G9ZA 4NYNA 3RSEA 3R1XA 1VQ8Q 3Q7CA 4DR7K 4DJAA 4N47A 2XI9A 3FIWA 3ZPLA 2Q2RA 3VQBA 2EZIA 1RR8C 1G2BA 4M9XA 3HOUJ 4BAYA 3GL1A 2YU9J 1C1BA 1TBXA 1SKRA 5CR2A 3GEZA 5FKLA 2CP5A 1D5AA 2WB1N 2Z1GA 1ZSZB 2YHAA 3JAMO 5GANf 4Z02A 3K7AJ 5LRSA 4XQ3A 4KBOA 3GOIA 4FLUA 4HUEA 1SFUA 4A2UA 1IGQA 2CGLA 2EGAA 5EVZA 2BY3A 2XHIA 3WE2A 3IRQA 2QWNA 3VEZA 5TKYA 1ZLKA 1MJBA 3TW6A 5J2QA 3WTTC 5KK1A 5GAMh 1KU9A 4A5AA 2M4GA 1XCBA 2RE2A 2DXUA 5HROA 1JLBA 3LSRA 2X9HA 4J6XA 2O5RA 1KVBA 1WPYA 4JUVA 1XG7A 2HSTA 2JRMA 3J7AP 3E7LA 4A2BA 5I42A 2L3QA 4DTXA 3W0LA 2PEXA 1ZC6A 1KHIA 3F73A 1JBMA 1O9SA 3CMET 2KXCA 2M1HA 4U87A 4LD9K 1IHWA 2M0YA 1S1VA 1SPKA 5K5QA 4CZJA 3H9NA 1WHUA 5DUIA 2Z5UA 2EGCA 2L89A 4PL6A 1RRJA 3QUIA 3CCEI 2KDSA 1GOBA 2D1HA 3TDZC 1ZSZC 3R9PA 1M2VA 2V8KA 2VPRA 4EZ6A 2W42A 3ZT0A 1X9JA 3TAEA 1YIJI 5F27A 3KUFA 1VQLN 4HNVA 1JCGA 4B9NA 4RG8A 3CFOA 1OV3A 2BE5F 2QWOA 1ACMB 4AI4A 4BVPA 2QA4Q 2QG9B 5LJ5j 4HVVA 2DZ9A 1FBUA 4IFEA 4MLHA 2DT6A 2AIRB 3L00A 3BR1A 5KVRA 3HRGA 3OVNA 3KEYA 2P9SA 4J8OA 4PWDA 4JLIA 1I8FA 3WU1B 2D0CA 4K42A 4GO1A 1V5FA 4JKHA 1QHHD 2OTJI 2GQIA 3TP3A 1GCQA 2YSRA 2CZ7B 5LJ3h 4CZIA 1RC9A 5KNLA 1CSKA 5JVGL 1OPCA 3VU3C 4DS4A 4XLCA 1N6QA 3K70C 4C0ZA 3E19A 5C3EJ 2FX0A 4AILC 3HYIA 3V81A 1MZBA 3L4QA 4TV7A 4NUBA 4XLHA 3HPWA 2A7YA 2UV1A 3CPEA 2NOLA 2PUOB 4PSWA 2Z1JA 1D9FA 1F9NA 3BY5A 4J9IA 2K4BA 3NGZA 2JXBA 5BRFA 3FLGA 1YVUA 3BJ6A 1ORPA 2J6OA 2F5VA 1P92A 4EVVA 1DJ7B 2EQMA 1FX7A 1KIKA 1KK7A 3S16J 3QWYA 1MBFA 3HGYA 4C5IA 3SFZA 2O8DB 3V1OA 3EDPA 5IPAA 5D5WB 1R8OB 4BH9A 1UUEA 2RI5A 5GAMf 1MDUB 3H46O 3HOTA 2F4OB 4BR7A 1O3SA 5GAMe 3JREA 3I5UA 4J7IA 1LDJA 1D1BA 4MDBA 2GQVA 1E3PA 2MPXC 2YPRA 3WXLA 4LUEA 4GBQA 4OB3B 3ZEHA 2HD0A 2QSHX 1Q82C 4CHOA 4DUZK 2OA4A 4EW0A 4XLFA 2RJFA 1FBQA 1YHQT 1VSFA 4XKWA 2GFAA 2IVPA 4B43A 4RTUA 2GXBA 4DV1K 3WTZA 2ZFUA 2E19A 3VOVA 4AWXB 1NLVA 4FWKA 2HVQA 2P4RA 2XDPA 3KLFA 2W24A 2KZGA 3T19A 4DR3K 1W0HA 1XTAA 3G0ZA 2L3RA 4IURA 1QW1A 1OQKA 3PL8A 3QEPA 4RLQA 2E6ZA 3JCMg 5AFUH 3RQ4A 1B34A 4CCHA 2UXCK 1ITGA 4KDPA 2PG4A 5TKWA 4FJ5A 3HBLA 4RW7A 2M87A 4E7LA 1VF9A 3PIPL 3A01A 4KB0A 2FBYA 1U8RA 4QS8A 4MLEA 3UKUA 4MGRA 3NF6A 1D8JA 1G15A 5HRSA 4B21A 1HJRA 2CUZA 5E1XA 4QIWN 8ATCB 3A5ZB 3MN6A 5J3BA 2DI3A 2LC2A 2FPFA 4C5EA 3VQDA 1YRNB 4B08A 1YCYA 3P9CA 2KP6A 5AQLA 2O8DA 4RB1A 1FYMA 4OVAA 2EJFA 1Q18A 1GLCG 4IZ9A 1D5VA 1BG3A 3HKZA 3RKYA 3BDDA 2YJEA 1NJYA 3RDIA 2V79A 2AO9A 1JLEA 1PKTA 2JA2A 3OYBA 2XAFA 3ELKA 2PI0A 2EQIA 3QO9A 2LTPA 4V19S 5FKOA 1DU6A 3LCNA 5GTIC 2NUTA 5BN8A 2VWJA 5E8GA 4CCOA 2M8EA 1HNIA 4BL0B 2Y4XA 3WVEB 2GWJA 3WEEA 4JKAA 5DCFA 3IAYA 1PU6A 2IVWA 3RJPA 3G4SN 2V9PA 2VQFK 1SRLA 5BREA 3KHYA 3AVCA 5HL7L 5LJVA 1TS9A 3T8RA 4Q0BA 1W7PB 3HZ6A 1WVRA 3BP8A 2ZJRF 1QP2A 3QXEB 1YS7A 4FSVA 4D1QA 3SEMA 1S72N 3VEPA 3SV4A 2UZKA 1HKSA 1JL2A 1D3BB 1ON2A 1BI0A 4JS5A 3GPLA 1V1CA 1AKHB 3M6GA 2XPWA 3L09A 3CCJT 5I9EB 3JCMc 5I3UA 1W7PA 1ZBXA 2WV0A 1VQPI 1J54A 2L9SA 1IB8A 2X6WA 3H92A 4FL9A 3O9RA 4NS5A 2B8AA 1K6YA 3CM5A 3L1PA 4AHSA 5GANj 1TTYA 4ZN3A 1JXEA 4O55A 2V9VA 1XTDA 2FL7A 1J2XA 2K57A 2ECCA 5LLQA 3TKYA 3KX2A 3VQ8A 1RDDA 4YFNF 4H5NA 4CYCB 5DK5A 2OQRA 4UV8A 2KJBA 3I3LA 2PMZN 5BRHA 3CC2T 2LVSA 4C8OA 2DA1A 2HEOA 4B9XA 2FSJA 1YJ9Q 3L2CA 1KSPA 3SXYA 1XSDA 3M7GA 2YRDA 1NJWA 3K4LA 1BI3A 1UB9A 1ZR4A 2A28A 1FOXA 3FZFA 4FK4A 1KG4A 3VQCA 3CJ1A 3H6ZA 2HKQB 3IKTA 3PVQA 3A8GB 1LV5A 2FSKA 1D1AA 1KU2A 2F8TA 2JQ7A 3U1DA 2LLKA 1RGIA 3PY8A 4P5NA 1KLNA 1B8IB 3K69A 3I56I 1AZEA 1Y07A 4NCBA 3VESA 1LNXA 3A4CA 3FXQA 5LJ3e 4NQWB 1XHZA 3R3LA 1RDWX 3TP0A 1QVGS 4DU1A 1ZBIA 1NKEA 4YELA 5LJ3f 1M90O 4WCIA 2A36A 4HCCA 1VQON 1YITT 1SL0A 4JD2B 4ZGJB 2NS7A 3M55A 4OJRA 2IIRA 2A1SA 4OAZA 2YS9A 3V9ZA 3B8AX 2RHIA 2YR2A 4HX8A 1O7FA 2P9NA 4WFBL 1KA8A 2F5KA 2VT2A 3U3GA 1RACB 1U2VA 1OU8A 3BDLA 3J80K 1FMVA 1PHTA 5IOYA 2NUPB 1XD7A 2ZPBB 2AJQA 1WXTA 2RN8A 1S9EA 3TEEA 1Z6TA 2KEAA 3CESA 3CCRI 3CD6I 3CCUA 4E3SA 2DXBA 1NGDA 3OSGA 3S8PA 4WQ4C 2QCOA 3G0QA 3PNTA 2ZC2A 5GAN6 3WTSC 4XONA 2VQGA 2RHKA 4K8XA 1XMKA 3CUOA 1E3MA 2DJNA 1NOYA 2JJ7A 4R56A 3H5RA 2LNVA 5GADJ 2NOHA 2QGFB 2L9VA 3LH0A 3E9PA 1KFSA 1TTHB 4PJOG 2DLLA 3HL8A 3IQLA 1RKWA 1MUYA 1JE8A 2XO7A 3FHFA 3OS5A 2Q0OA 3ID6A 4MLOA 2LRQA 1M5Q1 3WTWC 2YG8A 1J53A 1MW7A 4OMLA 1RAEB 3D2EA 2V52B 4PDKA 3OSVA 2E2QA 1I6XA 2VE8A 3ZT2A 4DR4K 3JCMW 1WJRA 3OW2A 4ISEA 2E5KA 1NJXA 1KFDA 1IXSB 2RHYA 4E9HA 1C1AA 3D2EB 2RAEA 3KP7A 1WSIA 3QDFA 1M8MA 1HKQA 2FXAA 3J7AF 3OYIA 5DCMA 1WNLA 3VEWA 1ZSZA 5IHIA 3ATUA 4IL6C 3AO1A 3WODF 5GPCA 4B6MA 3A8OB 3HFOA 3O8VA 3E1YA 2Z1IA 4DSKA 3MZHA 4J9EA 1YQLA 1RESA 1XDSA 3TAMA 4CUGA 1T0FC 4Z4GA 1ZBLA 4F3TA 1LMZA 1VQLQ 3OR1C 7AT1B 3RKXA 1A5JA 2M30A 5FLXO 2E4LA 3E97A 3I55T 3WT0A 5M1KA 4DG1A 4B3TK 1OYIA 2OQGA 2VB6A 3ECOA 1KQSA 1OLTA 5GMKl 3O9UA 4E47A 2GNCA 4WTOB 2HHSA 3F8NA 3L2UA 5DM6L 4LG0B 3MCAB 3VKIA 2DDBA 3PLAA 1NH3A 3WHBA 3I0SA 4Y7NJ 5GAOq 4XKVA 4AVPA 3JS6A 2SEMA 4D6WA 5K7HA 3LWHA 2E5LK 3ONQA 1X2NA 1EETA 3UKGA 4IEIA 3CCVA 4C8QD 3ABUA 4PFOA 4E1NA 1WEGA 1Z6RA 5CYVA 2EIKH 2ZGZA 3LA2A 3AV9A 2IVOA 1TWGJ 1HCRA 2YU3A 3LWIA 2D5VA 1N8RR 4XH5A 4Z6YA 3FM3A 2CO5A 1X2MA 4S04A 2EV0A 5AQUA 5GAN5 4JKCA 4CFCA 3OGDA 1BUPA 3O3KA 3QIPA 4XRFA 4C92F 4CI6A 3K1MA 4IUTA 2MC4A 2IA0A 3MD2A 4OMQA 2GCXA 5IOZA 1NK5A 2CH4W 3HTUA 2I5WA 1B34B 2YHWA 5EZHA 2GXAA 3DEEA 2YT6A 4YPRA 2XKPA 4D8KA 4F4KA 2WTEA 2RNGA 3JTHA 1HMVA 1FIAA 3I55Q 2F5TX 1VFCA 1SFOJ 3CCQT 4RTZA 4DQPA 2K3PA 3THXB 2XRLA 5CY4A 4JRPA 4J9DA 1H9GA 2QVOA 5FKNA 2KE9A 1LB2A 2DTZA 2N8GA 3I71A 1TC3C 1WHJA 4UNOA 2ESHA 2Z1DA 1OZ3A 1B9NA 2VV5A 4OB2B 3L2QA 3KFWX 1YIJT 4EVIA 5KQ8A 5CHIA 1YI2A 1ATSA 5C44J 3MP8A 4GFBA 4KN4X 2E3IA 1BIZA 5DTDA 4U7DA 3HRUA 1GHCA 1QCFA 3IS9A 2K9GA 4NYFA 1G5VA 1ULYA 1DDNA 2HOTA 3A8HB 1GOCA 4B1XB 2PYLA 3CCMQ 2HAXA 2EQRA 2PFBA 1L3SA 1X27A 1S3JA 3RKQA 3FXKA 4PL7A 4DTUA 4A0XA 2XSJC 4U0WA 5FPEA 3G1OA 2I8DA 1S5LC 4ENJA 2DA5A 1ON1A 3L3VA 4C8LA 3SJJA 4IRIA 5IN1A 2LMJA 2FD5A 2B7EA 5I22A 1WYXA 4XU0A 3F0ZA 1STZA 4HF0A 5C0YA 3RR7A 4G1QA 4NC7A 3TO9A 1B3QA 4O5FA 3BT9A 3ZQCA 3ZSXA 5C24A 1NM1A 5F0CA 1G4DA 5HLFA 2LQNA 3DLKA 4IX7A 3R60A 1L3LA 3LAKA 1JKOC 3TAGA 4RUGA 2OAZA 3NVMA 3KFVA 3GXOA 4RTVA 4YIFA 3LZIA 3BG6A 1MDMA 3CJ7A 3I56A 2NZTA 3KEOA 3QO3A 1KD1O 2FNPA 1IXDA 3HXMA 1KG6A 1KQSP 1A5XA 4B24A 1S72I 1K1ZA 3UKUB 1ZN2A 3AO4A 5IT9E 1WFWA 1XG1A 1TU0B 3RYPA 3SDBA 3GVAA 4QLCU 4I76A 1X01A 4HUGA 4GKJK 2QA4T 3H3NO 4CD3A 3CIPA 1K73U 1YP5A 2EV5A 1P90A 2ZD1A 2ECZA 2MK5A 1R1TA 1BYMA 3OH9A 3CDIA 4A3LJ 3V8KA 1W2BA 2CUEA 2KSSA 4JJDA 1WPKA 3BW1A 1KFZA 3CWAA 1WSUA 1NJIR 1B59A 4BRDA 1OZ2A 5LJ5d 2K7AA 3Q3SA 3WU2C 4KTWA 3BG5A 2JUCA 1OH8A 4QPOA 3PT9A 1XWLA 5F08A 3MCPA 1VQPN 3OW2S 3KK2A 2HPIA 3MHXA 3MKLA 3T0YA 1VQ7N 5LGUA 3CUQA 4CGFA 4BVOA 2HVIA 2ETJA 3J81K 4CJ3A 3ZMTA 3JB9D 3NARA 4F7UB 3SZ2A 2GX9A 2LSOA 2DMUA 2F1LA 5DD4A 4M72A 1YHQN 5M9OA 2H8RA 2IPOB 2GTJA 2KQWA 3PIPA 4NCGA 1QTMA 2O61A 1QQNA 2E20A 4RW8A 1XSXA 1SEUA 4L5EA 1MDMB 1S1XA 4BRIA 3U4LA 4RGXA 3CERA 1NOZA 4BGDA 3K5LA 2HTJA 4KITB 3RI4A 2F2XA 3JAMZ 1SHGA 1TUDA 3S2HJ 4XTZA 2ZNZA 5HVQC 3BCBA 3QBXA 2BANA 3UNGC 2ZSIB 1KQ8A 3KYCB 2BGCA 4LF8K 2E3HA 4W5QA 4A53A 5A2QK 2WAEA 5EOYA 4HT9A 2VJ5A 2VI6A 2ZJ2A 3VSLA 4DBRA 1I5OB 4Z4CA 3V9UA 4PKGA 2BZXA 5LBQA 3M9QA 4FQGA 3OA6A 1MNEA 3JYTA 2L7KA 4XLPF 2CW7A 3AG4H 3BCAA 2RPNA 3CCQN 4NC6A 1YOVB 2R57A 1UHWA 2QK9A 3CWTA 1IJJA 4C23A 2YX6A 2V6EA 4KIBA 4AUXA 3U9GA 3K9JA 1PVEA 3Q7BA 3CDLA 5LEKA 5D5XB 1T6DA 2CS3A 1MSEC 1UJYA 4DF8A 3WGHA 2GWKA 4V2GA 5GAN7 3G1JA 2DYRH 2VXDA 4E9EA 4QQGA 2DO3A 1Y7XA 3QESA 2KFDA 4CC7A 5JR3A 5E3NA 2K9NA 1RT1A 3K4KA 4KHWA 2E36A 3A8LB 4J8FA 3OBYA 3CCQI 4B3AA 2VASA 4CHUA 1Q95G 3RRGA 3PO5A 2HHTA 3TARA 2HMPA 4ILHA 2Y90A 1YJ9A 1K8AR 1P6RA 1REPC 4U67L 3P7NA 2ACJA 1HYOA 2RV8A 2R5ZA 3PVLA 2F4VK 3JRZA 4YEJA 5CIUA 2HMAA 2OTJT 1RNLA 2STTA 3EGUA 3ZSVA 2CZ6B 2EBPA 3DF8A 5KH6A 3K2PA 1O3RA 4I0BA 1I94K 2GFUA 5FU6B 1VZ0A 1K78B 1O13A 3HTSB 4X65K 2IA1A 3BQZA 4IXCA 4MO5A 4YY3K 4RGRA 4DOWA 1XN7A 4I2PA 3N97A 1KLMA 3LA7A 2MSYA 4ILJA 1JJ2P 1QO0D 4DSIA 2E64A 1YIOA 4CJLA 4BDZA 5EYRA 3AVIA 2P5KA 1IBLK 1NYFA 3META 3BG9A 2BE9B 4VUBA 1NK3P 3THVA 1CZAN 4BY9C 3OYFA 3FMSA 1BA5A 1WH5A 1ITYA 1W7AA 3FXUA 1WH7A 2VUBA 3K0LA 1PC0A 1TUCA 1YJNA 2EQKA 2YNGA 4L5GA 1Q81R 2FA5A 1ZBHA 3AY9A 3E6BA 3HOYJ 2RK1A 4N4NB 1OYXA 3WGGA 3MZYA 2J05A 2HHUA 1Z3XA 4XRSG 2DERA 2E1YA 1ORKA 4BQOA 1BB9A 3R2XC 4WQ5C 2IAJA 3OQ5A 5FLXE 1BBYA 1ZQ3P 1QPMA 5CKTA 3CBMA 4DCHA 4N4IA 5EU7A 5IYCJ 3W2VA 1XQSC 3EYIA 2R7ZJ 2EJ9A 4HW0A 2W03A 4M78G 1I5LA 2DVEA 4ATOA 2ASOA 4JI5K 3F21A 3V9WA 4J00A 3RUXA 5C2DA 5DV5A 4OFHA 4F17A 4K41A 2OTLI 2JVVA 1IKYA 3R4KA 4E9FA 1HKGA 3HOVJ 1YJWI 4M71A 3BOQA 4XR6A 4IIMA 4IHXA 4BC2A 4BG9A 3H0HA 1FOYA 4PJNA 2BE7D 1H89C 1VQKT 4CF9A 1DGWY 4CCJA 4GV6A 2A6AA 2ZPGB 1M2OA 2IVNA 2Z1HA 3LM9A 3S15J 1P8ZA 5MLCQ 3HP9A 1MD0A 3FHNA 3EN9A 1NK2P 4YTLA 1WSHA 3CXCS 2HNZA 2D0PA 1IKXA 4FPBA 2ZE2A 1MH4A 4ZC3A 2DJQA 3CZ6A 2M0CA 3CMEN 3GBTA 1JO8A 3VF4A 1YJNI 1QVGA 3CM6A 4C8QA 1MPGA 1C0UA 2RQTA 3S2DJ 1BOTO 2QGGA 4DLEA 4KUIA 1XNIA 1JRIA 3DRPA 4M73A 1YTYA 1BOAA 1VQ7I 4EW4A 1NWKA 4IDHA 1M90R 3H45C 3SWNC 4IHTA 5M5YJ 2CGJA 2F5CA 1C6VX 1LW0A 3PUBA 3L0QA 3QEVA 3JB9F 1RR7A 3FM5A 3G25A 3ULEA 3FEOA 2YHXA 4BHPA 3SQ2A 5AZIA 4CBWA 2G8UA 3DLLA 1GVDA 2YLBA 2RGVA 1NLOC 4WXDA 3O9TA 2CMPA 2Z3YA 3AA5X 3A0HC 2F9TA 2RNAA 2MH2A 4IOXA 4G6TB 4CA0A 1UJ0A 1S5JA 1EFNA 3DXMB 4OIRF 3VPRA 2YKNA 2DPUA 2Y1JA 4KHQA 4P9UA 3KPHA 5KGXA 4DF4A 2YSQA 3I64A 1ZBJA 1MGTA 3THYA 3L7WA 3CF5F 1W2BM 1BA1A 1R58A 1MV0B 3A02A 3ZT4A 3ENOA 3CMEQ 2XK0A 5JLFA 5J2MA 4BRLA 2HNDA 3ZSZA 3V4IA 3HG9A 1E0EA 3UB5A 2O6GE 2WV1A 4YRVA 4CEOA 4A3FJ 3F72A 1ETQA 1XGMA 4HDVA 1S1UA 3VQ9A 1YITI 2GTDA 3NBPA 3J7ZO 2FSWA 1AA7A 1U3OA 1FEXA 4KYWA 3VB2A 1JJ2S 4N5SA 5IHKA 5H6QA 2HQRA 4C9YA 2BHYA 4I9LA 3EG2A 1W97L 1WHMA 3M58A 3I0WA 5LY3A 5F04A 4KH4A 1KQSS 2HNYA 2XDBA 1LFBA 3WXJA 3WNFA 2O0YA 2PQ8A 2DF6A 4A63B 5FWBA 3M0PA 4OMPA 1IUFA 4BC5A 3WE3A 1IBKK 1K8AO 3CC2I 1S72T 1KAXA 3TEDA 2AP1A 2MLGA 2KPMA 2YI1A 3CD6N 1TKTA 3TSWA 5HK0A 3O6BB 2VUMJ 1U6GA 3FFIA 5DD8A 1TK0A 1YE9A 3GDQA 3I54A 5KHDA 5HLTA 2A61A 4A69C 3DKWA 3J80Z 4QPQA 2RI2A 1VQOT 1V5GA 2P81A 4M75E 1WUAA 2NUPA 1Q82O 2JT1A 1QRYA 4C5GA 2D5RA 4CJ5A 1TQPA 3OMYA 3U2RA 1IUYA 1RCHA 4U88A 2G0EA 2KGTA 1NTCA 2CH6A 2ESWA 3HC7A 1OULA 2HHQA 1WBDA 2IS3A 1BW6A 4BHBA 1J5YA 1B4AA 2A68F 5CKBA 1K4SA 3BDUA 4XH1A 1WFXA 1TWFJ 2K02A 1FLIA 4JDSA 2LX7A 3LFKA 3PV8A 2AKKA 3SCXA 2Y48A 1ZRFA 3CJQB 2VLAA 3BPXA 4EEFG 1GV5A 2R58A 4KICA 3T1BA 1U45A 5HLIA 4P1WA 4AM7A 3HSBA 1I50J 4H0TB 5JS1A 4H4OA 4XK4A 2KDZA 1S6PA 1QVGP 5KPRA 2DAOA 1NGGA 1G3SA 5JLWA 5DLQE 1XOVA 4O5VA 3ZL7C 2GOXB 3VA0A 1VQ5I 3CVSA 2DM1A 4CEDA 4A3MJ 2OTLN 2OPPA 4M3ZA 5I2SA 2DPNA 5FU6C 3E3VA 2KLAA 2WSEE 2LTOA 3G10A 2ZXJA 3KXTA 1YYVA 1T8EA 1ZUYA 5JHUA 2FO0A 2V1DA 2XY7A 5AQFA 2CP6A 4FT8A 3DPUA 5CR4A 5FWCA 5BR9A 3ATVA 4CGGA 1VHXA 1V4RA 1HBXG 3CG7A 2DTHA 2DEUA 1X3WB 5HP1A 1RLPC 1IKWA 1P4WA 3C4SA 4OGEA 1AWWA 2NVYJ 3EE8A 4BREA 3EEQA 4B3SK 3D5RC 4CJ4A 4DHYA 1FP2A 3TMOA 1S9HA 4UXNA 4GVMA 2MFZA 3ZGKA 2XHBA 3OOUA 5A0LA 2V1UA 4D8DA 2FYKA 3VQ7A 1LOTB 1ATRA 1I1SA 2RPIA 4FK2A 1ZBUA 2E12A 4P55A 2X35A 2KRSA 3FF5A 1JB0E 1H1VA 5BPDA 5AZJA 2E1MC 4A3CJ 2JHNA 2QWQA 2B5JA 2KI7A 4A6EA 4DOVA 4CJSA 1Z3YA 1MH3A 1OYWA 4R5PA 4YFKF 4JV5K 3DCFA 3CC4Q 4DW6A 1K0XA 2HSEB 4GW6A 2X6NA 5HOOA 2F5FA 2WACA 3PX0A 1X4PA 4ZTJA 3LDNA 4B3RK 4FZZA 2HDDA 4JRKA 4Z0UA 4WF2A 5CVJA 1VSKA 3SLCA 5H1SQ 4L59A 4JKEA 4FJKA 1U06A 5ILSA 3JRIA 4LLLA 1D0ZA 3ZN1A 2E10A 4DQ8A 2NOIA 1Y39A 4LFUA 2BY1A 4M7AE 1U9OA 1CZBA 3DLBA 3W2WA 4A0ZA 5C2FA 2HBPA 1UWBA 3JSOA 2COZA 3RMBA 2EZLA 2KRCA 1N5ZA 4FK0A 4NDLA 2DLPA 3QYFA 2JW4A 2EKHA 3QBWA 3M59A 4K25A 5DM7R 1BHLA 1RILA 4IVNA 4FJHA 4X9DA 4FWMA 2FU4A 2FG0A 1QVFS 3VWBA 3J7YJ 1N32K 2K9SA 1NGFA 1V3FA 3RMAA 5LJ5h 1Q82U 3ESWB 4ZZLA 2DXIA 1LE8A 3CCMI 4MDAA 5D4SA 1HR0K 2XVCA 4D5CA 3LDQA 2R5YA 5D8KB 4OMMA 2RDPA 4CERA 1AWJA 4ZDOA 4FJ9A 5IYBJ 3S6WA 1TSFA 4M7AD 3HGGA 2QA4A 3M8SA 2OPSA 1PVSA 4FJXA 3CCEQ 4MHGA 3L3UA 2PJRA 4KGXB 2VYTA 1FP1D 1ZXOA 2Z0WA 2H09A 3MEUA 1NKUA 1LWFA 4JJBA 2WY8Q 2VWFA 2XIGA 1HLUA 3HFNA 2Q8KA 3O4QA 2ZMEC 4FIBA 3LX7A 4XLEA 3MEVA 1E4FT 3T1YK 5E17F 2L3SA 3I35A 5KCHA 4WQ4A 2W1OA 1NYGA 3TWHA 4ZH4F 3QG1A 3D0PA 2KT8A 2XF6A 2YUPA 1SV5A 3OIQA 5L3FA 1CF7B 2MYSA 4FASD 4EJVA 2XPUA 4F52A 1OVQA 4PJOB 4CZFA 3GO5A 4ENKA 2A3LA 1VSDA 3E5UA 1IG8A 1W5SA 2L54A 2P0KA 4O5BA 4LF6K 4EGZA 5DM7F 3JB9J 5HDNA 1T6CA 4IHSA 3X28B 3FB9A 4RAGA 1O3TA 5T7BA 1XQOA 1NGBA 3RBBB 1O1WA 3FBIB 2RKHA 5C15A 2P7CB 4B4CA 2NRZA 2AHJB 3NH0A 4AU7A 2ZPEB 2UUBK 1A31A 2DE0X 3RMQA 1EQYA 3EUAA 5KCOA 2NVUB 3HVTA 2UXDK 2BIVA 2XY8A 1LFUP 1W4MA 3KLOA 2AQEA 3LWFA 4LIVA 4FX4A 5K7FA 3N4MA 2M3AA 3ID8A 3JCMV 1NGHA 3CP8A 1QBJA 2KIMA 4ME7A 2I0NA 2IXSA 2BY0A 3WNEA 3ZSWA 4IEJA 2DMOA 3QJ6A 2L3DA 3PNYA 4M3TA 4Y17A 3NGYA 2RQUA 4N0AC 4NBQA 3HRTA 2E6MA 3HEFA 2ME6A 2HNHA 3MO8A 2KT0A 3SPZA 1WLJA 2D1KA 2A42A 3ZLJA 4BXXJ 1GT0C 1Y8RB 4FJMA 3CC7N 2L2PA 2IT0A 4FJ7A 3I4NJ 2UXNA 3M8EA 4DYQA 3CPWP 2IDOA 3IH7A 2G7UA 3MN2A 1IO6A 2FEZA 3HJEA 3IWFA 1Y0MA 3FFKB 3IH3A 2NLXA 1N34K 3FK7A 3VYGA 1IG9A 4FL6A 3ISNC 5M3FJ 2FJ1A 1NGIA 5ICFA 4JRIA 3TABA 4GV9A 1HLVA 4PGHA 1I1GA 3I56T 3J7AY 2OPRA 4D5FA 3V7RA 2QEXA 2EB7A 3EETA 4JLHA 1R5GA 4CJKA 1WIEA 4CCLA 3BF3A 3KEQA 2P8TA 1E17A 1HXDA 2FMLA 3PIPF 1WEIA 1VQOA 1R5HA 1JCFA 3C1DA 5B1BH 2E1NA 1Y0NA 4M78C 5AIQA 3M3YJ 3F0CA 2HVSA 5B1AH 1H92A 3MAQA 1FOKA 2V1QA 4JKDA 2LY2A 1RDUA 4NL3A 1EKEA 4CZLA 3W6VA 1ZLMA 2AZSA 1QCOA 3JB9G 2HQAA 3FSPA 1Z0XA 2KYBA 4QSHA 1WCMJ 2Z9OA 3I0XA 2RB6A 4II3A 2Q31A 4OU0A 2L7FP 3WTXC 2PJPA 2XF5A 2CV0A 2W82A 4H5VA 4F91B 4N0BA 2Y31A 2QWPA 2D2WA 3AFHA 1MIJA 1UECA 2LCSA 5IT9O 1LCUA 3K5NA 2BE2A 2V75A 1YQAA 2WA0A 4EA5A 1VSEA 3ZETA 1B72B 3ULDA 4JK1X 4QVZA 3DXKA 4M6YA 1WDXA 4HQMA 4FWNA 1JLCA 3RQIA 1VQ7Q 2X4WA 3QICA 5ICGA 2D0OA 4LJZF 3V6DA 4PUSA 3G6EI 2RHZA 2O01E 4HNUA 3DXMA 3G71Q 1D0YA 4JZ4A 4GRIA 3A0BC 2VC1A 3DXKB 3F2KA 3LP0A 3BC8A 4KHUA 3F6OA 1SVOA 2KRNA 2O3FA 1BN5A 4ZYDA 2FBHA 3MP1A 3NTKA 3X26B 4A54A 2P0QA 5KI6A 3FHZA 2G9WA 4KH5A 2ZM6K 3J7AO 4ELVA 2FUG2 3NEUA 4ON0A 4M75D 3GOXA 5E26A 3JCMh 1SKWA 3KNTA 1ETXA 1EIFA 4MEYF 3J7YP 2VKVA 4EMHA 3KP3A 1PUFA 2XIDA 1HW1A 2YJFA 4LDVA 3CCLA 2RQRA 1W5TA 2WY7Q 1X75C 4RTFD 2ITGA 2Q0UA 1OCCH 2M7AA 3VQAA 3ZXSA 1PU8A 1ZREA 1W7PD 1RNHA 2A6TA 5IP6A 5GAOl 4XTVA 1I27A 1UGPB 3CBPA 1UDLA 1BI2A 2FZGB 3C65A 4OVLA 1D5YA 4YFXF 1FSEA 3JRDA 2DA3A 1M3QA 4I9QA 4BBRJ 4RMOA 1NBEB 3BWGA 4G6QA 1FTTA 4FWRA 3CCJA 4X62K 3HDDA 4CZCA 3EL2A 3M8QA 5KPZA 2Q36A 3RCOA 5IT9Z 2HVHA 3ZOBA 4E7HA 2JA8J 2YNIA 1ZA1B 5K7ZA 3IKVA 3G4ST 1R9TJ 3ULRB 2DODA 1L3VA 3M53A 2QWRA 1KYZA 2Y0MA 4WCEL 3CI5A 3M8FA 5JVTA 3CWSA 3ITHA 2K4YA 6AT1B 2D0AA 1BK2A 4BRFA 4FX0A 2F5DA 1V54H 3BTJA 1EBMA 3K2AA 3MEEA 2X6SA 1RBRA 3CCJI 2NAZA 1YVNA 3TDUC 2C0OA 2W40A 4B1UB 4GDFA 1MMSA 3PE0A 5CYMA 1FTZA 3EZWA 4D0PA 3LQQA 5HNHA 1ZR2A 2ATQA 3L9FA 4CZEA 4IUUA 2Q2EB 2QA4N 1SSHA 3SAHA 3VERA 2ME0A 2GEMA 1YG2A 1AVZC 4B3MK 1YN8A 5AQXA 1EWRA 2DTIA 3ZSRA 3AVFA 1SVLA 3HHTB 1K6OA 4BQAA 3AVBA 1IGUA 3DLMA 3G6ET 1X6OA 1MUNA 4A6DA 3MEWA 2W4SA 2L9NA 5GJWB 2M9HA 2V1NA 4JI4K 2LQ8A 3NMUA 1KCFA 2QEXQ 2VGMA 2CFXA 3ZCMA 3PTAA 3U8XA 5AQGA 2JM9A 5LHGA 1FZPB 2UUZA 3DXJF 4UHTA 3GFIA 1VQKN 2HKNA 4BQNA 2XG8D 3KK1A 1KQJA 3EZ5A 3QEIA 1JXBA 2BY2A 5J39A 2HHVA 2L0AA 4ORZA 3MVPA 1NKCA 3CPFA 2MBFA 1OCOH 4PIIA 3V42A 1HJDA 3MFKA 2HSPA 2L02A 4JKGB 4M75A 1M1GA 4WWCA 2M8GX 3ZCOA 4AFSC 3C6TA 1LUJB 3VSKA 1TT0A 4C8QF 3JTGA 2DTUA 1GLLO 3OYMA 3CCVI 4AHUA 1SF9A 1G99A 5GMKh 5C25A 3DPTA 2VPLA 3I59B 1M1EB 3ZMZA 1HDDC 4MTDA 2P0PA 3J8AA 3HJFA 3DU5A 2PAVA 1NKBA 3DB3A 2PNIA 4F3QA 4Z2YA 4BWMA 3QKJA 3ASMA 4Y33A 3P83D 2HL5C 3JCMQ 5H20A 3ZX0A 2BTTA 2TRTA 2H3JA 1IZ1A 4FJ8A 4BRGA 5KAIC 1WJFA 1FC3A 4ESJA 1F21A 4BRCA 1F43A 4BJ6C 3WTUC 4Y91A 1LDKB 2O9LA 2DNUA 4Y1CA 4M7YA 5ADXH 2M0MA 4L5IA 3R6OA 4RTXA 3G6EQ 4OKEA 3OHRA 1YT3A 2ZJRL 3WG7H 1WJAA 2P9IA 2ZXWH 1KC8C 3OA9A 4A3IJ 1W36D 4BY7J 4M75F 1BL0A 5AQSA 3O3HA 2AK5A 2VBZA 1QLYA 1YW9A 3B73A 3NCIA 3GTKJ 4PA1A 4MEXF 1A5WA 2FZCB 2K79A 4CBUA 4O4GA 2L0KA 3RR8A 3CC2Q 3BG3A 4OLBA 1PRLC 5IYDJ 1OEBA 1W0TA 4HVUA 3A5LC 1TXQA 1C1CA 1VRTA 5GANd 3TAFA 3MWMA 4UNFA 1BI1A 3JCMX 1ATNA 2RJEA 3EHRA 2ZCFB 1NMNA 4AD9A 2X3XD 5F0HA 3VS1A 1RTJA 3E9OA 4IHYA 1WHKA 4HA8A 4DTNA 1HOMA 4NLCA 2PBDA 5LRRA 1J5EK 1IGNA 1KU7A 2LQKA 3WNHA 3M0UA 5HBMA 4MMLA 5C42A 4RGUA 4J6WA 3PM1A 1RTHA 3I4MJ 1RTDA 2D45A 2OPQA 2PVOB 2NOEA 4L6V5 3RWUA 1NK0A 4EJZA 1M90C 5LGTA 3M4GA 4IRGA 1TT5B 4BS9A 2RC4A 2W7NA 2HTSA 1VQ4T 1ZQ1A 3DLAA 2JMWA 2GA2A 1RT2A 4N4GA 1W2BS 2ZFWA 2CH5A 4UUVA 2CV2A 1NK6A 3PNVA 1CF7A 3LP1A 1WQ7A 2MIOA 3X25B 5E3MA 2DOEA 3O8GA 4L3QA 2PX9A 2JK3A 1TL3A 4AQYK 1IBMK 1AEYA 1JKRC 2LF7A 2DCEA 3LWLA 4KUDK 2ZB9A 3ZR8X 4F92B 5HS8A 2XY6A 3UDCA 3U1KA 2DK3A 4HVJA 2LH9A 1Z7LA 1X1AA 1YHQA 4NCAA 5F1JA 2RQQA 3FJ5A 3M0RA 3DTKA 4XOPA 5CVVA 3I0RA 3AVLA 2R7YA 5KYUB 3NF8A 1VQ8N 4CJPA 4FW1A 3N05A 1N3AA 3DM2A 1QU3A 3AL0C 3LDOA 3H5NA 2C0TA 2HBKA 1SVMA 1IHVA 2R3SA 4XBFA 2O8EA 3TAQA 3HSRA 3BZCA 1LEBA 4JI2K 5EY4A 5FFZA 1KD1R 2IC3A 1SD4A 2OYQA 3L2VA 4A3KJ 5SZTA 1X2QA 3D5SC 3CCLN 4M45A 1VQ6N 2GWRA 2VN2A 3OYCA 4PK4A 5KYYB 2ZZDA 2R7SA 2JTEA 1WLPB 3QFPA 5GTHC 2JN0A 2VYPA 3T1AA 3M5AA 1OYYA 1J09A 4E7ZA 2OZUA 1YJ9N 1VQMI 2P5VA 4XAXB 2F2VA 4UB6C 2E1ZA 2ID6A 2RN7A 1IDYA 3C95A 2ELHA 3CJAA 3K5MA 2V51B 1RBVA 1CQTA 4LD6A 3KKSA 2BUDA 5LL6S 2LFBA 3RTRA 4F7UE 4HUFA 4FO0A 1ZARA 1DPRA 3ASOH 1VQMA 4BQLA 2IP2A 1QVFP 2XRIA 1BM9A 2QYOA 1M1KO 3M1EA 2RQWA 1KC8O 1LAVA 5F0XA 4IF4A 3E9LA 4C8QE 2VKNA 3I56Q 2E70A 2X74A 4ZYGA 3CXCA 4OINF 3M1FA 1XC5A 4Y13A 4DTJA 1PP7U 2QXFA 2HBWA 1ZGAA 3CWUA 1WSGA 4EHUA 1DEJA 4KB1A 4KJZA 4IJNA 4F2RA 2KIQA 2M51A 4OFEA 2JMAA 4JK8A 1Z7UA 2K9QA 4AM6A 3RMDA 4BC4A 3H0GJ 4BHCA 2XB5A 3GLXA 1M30A 3ME9A 3K2ZA 4IJAA 2X4YA 2A37A 5JVGF 1XDUA 3BJOA 1AWOA 1ASVA 1ZGJA 4IQ4A 4CF2A 2E7WA 3DB4A 3GTOJ 3H0IA 2G8FA 4ELZC 5D5UB 2CSIA 1OH6A 1B9MA 1O75A 2VL8A 3DBLB 1ZUUA 4Y92A 3AA4A 1UOCA 3MKWB 1KQ9A 2OBPA 4LH4A 2W0ZA 3Q5FA 3C12A 4XICA 1KU3A 3IC7A 1JUSA 2ADUA 4CBXA 4CJEA 1N33K 4W1UA 2UXBK 2PTKA 1MBHA 4K11A 3QIOA 3ABLH 3QHSA 4OWRB 1YCSB 3PSFA 3DPLC 2QUFA 1WHLA 4FISA 4IHWA 5GMKj 2LZ6B 2VJJA 4XMYA 4DOZA 3HSEA 1OCRH 2K9LA 1UGSB 4UUSB 3SBGA 1T56A 2LSNA 1T95A 2MA3A 2XSDC 1YI2N 2O4XA 5GAMj 1RAIB 1LE8B 2CH4A 1R4MB 1QQOA 1HYVA 3EO3A 3H6EA 1SL2A 4HEA2 4X34A 1GLBG 1WB9A 5DMRA 1ZK8A 3THWA 3D2FA 1R0CB 2R7WA 2BZ8A 2I5JA 4JBAA 2LG4A 4CZKA 4IZZA 4M7XA 2UUAK 4FU6A 2KLOA 1LWEA 2QDLA 4FPAA 4M78B 2HHXA 1YBYA 1K73O 4G7OF 5KTQA 4PQUA 1MNDA 1AOYA 3ZQLA 2G8WA 4ETSA 3HZJA 3AT1B 4R8HA 3CTAA 4DR2K 1XSVA 4B44A 2BGGA 2O4GA 4GGGA 1NLPC 2JTFA 3EG9B 4LB6B 3O9QA 1JLGA 1Q7YC 4DR6K 2G7HA 4MO7A 5HLGA 1ZA2B 3ULQB 2JGUA 4N0AA 2EQUA 2D1XA 2EA2A 2XAJA 2R7VA 5CVUA 2CGPA 3DRRA 5LEJA 4LUDA 2KKOA 4U0VA 1NG2A 2RVCA 3L2ZA 4KAZA 2NYSA 1NEGA 1O4XA 2IIMA 2LK2A 3S3OA 1T6SA 1EP4A 2D0NA 3G4SA 2QQBA 2J4RA 2EBIA 2O8CB 3B6PA 4J19A 5GAMg 2CGKA 1RBSA 1SAUA 4XNFA 4ZYHA 2RF2A 1NM7A 3OYJA 2XDDA 1IXCA 3QPTA 3BZ6A 2F4IA 2H56A 1VK0A 1M9SA 1ARKA 3WXKA 5EGOA 1QWEA 1DIZA 3KD5E 3K70D 5D6FA 5M1OA 1M1KU 4YOYA 1KO9A 3ABTA 2JA6J 5GADP 1T7PA 2NVXJ 3HUGA 1U9NA 5KPTA 3UIQA 4FTHA 5KE2A 3OJUA 2H8WA 4DKWA 2BYVE 4XSZF 5GAOn 1XMQK 3V7CA 3ZP5A 4CF0A 2ECBA 1XUPO 2LC4A 2BDPA 2VODA 2XAUA 1NGCA 4G8XA 1OR7C 1B8IA 1H9TA 4EM0B 3B6CA 5AJ3K 2BUPA 5DYMA 5K5OA 1NK9A 5KRTA 3IWZA 4DTPA 3JB9H 1JLFA 4EDUA 4IOCL 4B9WA 2DEQA 3HI0A 4CDGA 4EMSA 2VQCA 3TQ7P 5TGTA 3F8CA 2KAFA 2QYZA 3SQNA 2K40A 4HV6A 1WSJA 2A5XA 3EKSA 1JJ2A 1D8YA 4IOAL 2GUPA 4A62A 3MEAA 4OGCA 5GAOm 1ERDA 4PLLA 4C8QG 3CO6C 1XGOA 2EILH 2X6XA 1X1BA 3DI6A 1PKSA 3ZX2A 3MECA 4BRHA 3M4OJ 2JJ9A 5DS9A 5GAN3 3CCET 2B0LA 3GBGA 3B02A 5EG0B 4I6MB 1EV7A 1UTIA 2RF0A 1Q86C 3KLGA 1YITQ 4JQFA 4QCLA 3AGRA 2VQEK 4RA2A 4ZHRA 5HODA 2D0QB 4C1NI 3NF9A 3UKRB 1QGPA 3UR3C 4EJTA 2O88A 2VKHA 4QW2A 3RIRA 2P9LA 4UVBA 2E2NA 2OFIA 4L9JA 2P1JA 4JX5A 3A8MB 1PU7A 1VSJA 1R00A 1KXPA 1H3HA 4DIQA 3L2RA 1R71A 4DV4K 3DKXA 1GBRA 2D0BA 3G71I 1J9AA 2QKBA 5EGOB 2WAFA 1IH7A 2DBBA 3OS0A 4TSXA 1BC8C 2RREA 3SV3A 3VETA 1M3BA 5JS2A 3I53A 3M8RA 2LF8A 1SD6A 2HDWA 1IV6A 3AVJA 3I33A 2ED1A 2GM4A 3H1CA 4X66K 3CCUI 3CD6A 3VS4A 1S3XA 3LL3A 4RTTA 1WKMA 4NNJA 4OMYA 3VQ6A 3LANA 3A01B 2OV7A 2EIJH 5KCMA 2D1VA 2D6FA 3WUHA 1NK8A 3TU4K 1FYNA 4XSXF 5GAN2 3FBNB 1FJLA 5L3DA 1S9GA 1WNSA 1WX6A 2OZSA 2MAMA 1AZGB 2A40A 4B1RA 1Q7YO 5AQWA 3OSFA 4L0ZB 2L4AA 3F9MA 5GAN8 1D0XA 3CCRQ 5F1XA 4BY1J 1FBSA 2H6BA 1UELB 3M8PA 2XGXA 3QDRB 2P5OA 2X6OA 4N4OB 5EG0A 1K9AA 4FLYA 3CD6Q 1Q81C 1VQNI 1ZH5A 4J2EA 4HRIA 2EJGA 3VUBA 4XKBA