3OYFA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti l-870,810
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 109
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyfA03
2LRQA 2YV0X 1LV5A 4N47A 4BWMA 4E1NA 2IG0A 1N5YA 2PYLA 3LP0A 1JLFA 4KHWA 2I5JA 3MXIA 2FBXA 4B08A 3ZSOA 1NK8A 1RNHA 4DSEA 1RBUA 3NFAA 3CG7A 3NDKA 2FBVA 3SQ0A 3OYMA 2D0AA 4FJ7A 4CJQA 3CEYA 4ELTA 4F2SA 4FW2A 1TK8A 2PQWA 4DTXA 1B9DA 2G3RA 5C25A 3ZSVA 4EDUA 1BQMA 2P1JA 4QOZB 3PX6A 2PY5A 4KTZA 1VSDA 1A5WA 4KTQA 1KFDA 4Y1DA 3LAMA 3MO8A 1RDAA 5FRMA 3VQ8A 4CJ4A 2G8KA 3AVMA 1LAWA 3VQ9A 1RTIA 1TKZA 1U4BA 2MWOA 5JS1A 4B9UA 3KK3A 4FK0A 1WGSA 1WJSA 3V6DA 1VSFA 2NLUA 4ID1A 4CJKA 4I9QA 1JXBA 4NYFA 1DTTA 1X1PA 4IFVA 1C0TA 1G15A 2DIGA 2OZSA 2LVMA 1TVRA 4CHPA 1Q9XA 3NF8A 3DI6A 3CFPA 4DFJA 3KKRA 4CJLA 1UWBA 4DWIA 4CCHA 3HM9A 1FXXA 1H3ZA 4EZ9A 4DQQA 4DU4A 3WNEA 2RJDA 3LGFA 3AVKA 3HPHA 5E41A 3TR8A 3NCIA 3HP9A 2RHUA 4CJUA 4GW6A 3AO2A 4B9VA 2O4IA 2BUDA 5HRSA 4PY5A 5CY4A 3OY9A 4CJRA 2HVIA 3RR8A 3LZJA 4R5PA 3VQBA 2EHGA 3GOXA 2HW3A 4M3WA 4IDKA 3VQ6A 3DLHA 1UA0A 1IKVA 5J2PA 3LPUA 1L3VA 4BDPA 2HHSA 2RPIA 3OYAA 3ZSZA 4CEBA 3SD4A 3S6WA 4O5BA 4B9NA 1K6YA 2MWPA 1BIUA 3AA3A 3KIOA 4B9MA 1WN7A 3B6PA 3AVGA 3C94A 2BKDN 2BANA 3V9SA 1J5OA 3L8BA 2PYJA 1Q8IA 4FLWA 1KLMA 3OYKA 2BDPA 4FM2A 3LGLA 3C95A 3QNNA 4Z0UA 1NKEA 3HK2A 5KI6A 4BD3A 3SV4A 4CE9A 4KTWA 4LD0A 3V9WA 3SUPA 3LP1A 2IOCA 4B9TA 4HTUA 3M9QA 4FJ9A 4C5EA 4OKEA 1QTMA 4J2AA 1D5AA 2B4JA 3THVA 3C4SA 2E5QA 1HQUA 1IKWA 1T05A 5KGWA 3VQDA 2YKMA 2P5OA 1LWEA 4Z4IA 3U3GA 3BDPA 1C1AA 1XHXA 4ID5A 1IO2A 1QSLA 4C5IA 2HB5A 4CGFA 4FJ8A 2RKIA 4W5QA 3F9KA 1B92A 4BACA 3T1AA 4O0IA 4FLTA 1LAVA 2RJCA 2YNHA 4PUOA 4N4HA 4AHUA 4UC4A 4KHUA 3SQ2A 4CF8A 4DTPA 4UQGA 3CFOA 3PMIA 1HRHA 1NK4A 4H4MA 2W42A 1D9DA 1TK5A 2EKOA 4KO0A 2YRVA 1GOCA 1RT5A 4KPYA 3C6TA 4A4HA 4CGIA 1QS4A 4CEDA 1C1BA 4O0JA 4DSLA 3QETA 3OJSA 1NJZA 1JLGA 2IS3A 2A1SA 4Z4HA 2JTFA 3TAMA 2P5GA 3E9FA 3I0RA 1IKXA 2M16A 5J2QA 3OMCA 3O8VA 4CFCA 2ZD1A 1RT2A 2B8AA 3EAEA 3DRSA 5J39A 2P51A 4ZTJA 3MEVA 4HUEA 3T19A 3QESA 3PO4A 3OYFA 2F96A 4KB0A 4IUPA 4CHNA 5KH6A 4N5SA 2GFAA 4CESA 3V81A 1QHTA 2ATQA 5HP1A 2R57A 4BWJA 1J9AA 5FROA 3QERA 1KSPA 4M45A 1U48A 1MHNA 3AVAA 4N4IA 4FL6A 4PL6A 4CGDA 1XNIA 4CIGA 4L59A 2D0BA 1A5VA 4RG8A 4CFDA 2G8IA 4FLYA 1SKSA 4K8XA 3PY8A 1QSSA 3NF6A 3DLBA 3B6OA 3KKSA 1KVAA 4EP4A 3NH2A 3PFSA 3E01A 2NUBA 2KZZA 3ISNC 3NTHA 1SV5A 4FLXA 3LWLA 4CF1A 4W5RA 1OYXA 4B8AB 1TKDA 3KLFA 4FK2A 2KFNA 4DFMA 3HPGA 3RRHA 3SPYA 1EKEA 1JXEA 3HYFA 5CYQA 2YHAA 4CJEA 3ZT0A 2OZMA 3ME9A 2BGGA 4J2EA 2E4LA 2VG6A 3OYCA 4AHTA 5DK5A 3OYEA 3NGIA 3NTIA 1KLNA 3KLHA 3NBPA 1I3AA 1BQNA 2GF7A 4IUTA 1BHLA 3K58A 1CZ9A 1ZBIA 2E6NA 1FK9A 1Q9YA 3P5JA 3OJUA 4JS5A 4DTUA 4DS5A 2QKKA 1T8EA 3MP1A 1T7PA 4IKFA 3M8PA 1RDCA 5HRPA 5D6WA 2ITGA 3OVNA 1BL3A 5HRNA 1WSIA 5I42A 2RJEA 3LP2A 4Z4CA 3DMJA 2HVHA 2Z1JA 5J1EA 4KKOA 1RT1A 2QQRA 1HQEA 5CZ2A 1B9FA 3DOLA 2YNGA 3OS0A 5EU7A 1YT3A 1RDBA 1BGXT 3NE6A 4OPKA 4AHSA 3LALA 4KHQA 4KHSA 4LH4A 2DTUA 4M41A 1UAXA 5KRTA 2BE2A 4HCCA 3V9ZA 5HLFA 4KRFA 4OVLA 1ASWA 4DQPA 3ZEHA 1SL1A 3HT3A 4KHYA 4E7LA 1VRTA 3VQCA 2HNDA 5KCOA 2RI3A 4CJ5A 1NK7A 1TAQA 4F4KA 3QIPA 3M8RA 5D3GA 3MP8A 2F5KA 4DTRA 1U45A 1HYVA 1GOBA 1NK5A 2B6AA 4CEZA 4O44A 2QKBA 4M3XA 3LDSA 3QEVA 3V4IA 3DYAA 2D5RA 3META 4E7IA 3CM5A 2OA8A 2HHQA 3P83D 3KUFA 2EX3A 4RW8A 5J26A 2XK0A 3M8QA 1OZ2A 3OYGA 4BE2A 2RHIA 4A4EA 3V1RA 3QEWA 1TAUA 4LSLA 3TAQA 4NCBA 2OPSA 3FDRA 3HVRA 3KK2A 3AVHA 3WNHA 3AV9A 3ZT3A 3JSMA 2G8VA 2HHWA 3S3NA 2XY7A 4F8RA 2RHYA 1KHCA 1T03A 4E1MA 4NS5A 1SL0A 1NJWA 2O4XB 1Z25A 3I8DA 3AVNA 3LZIA 2LSNA 4RW4A 2E6LA 3A2FA 3ULDA 4C8OA 3AVLA 1L3SA 3MXJA 4DLGA 3U6FA 3DOKA 2DFFA 3VA3A 2FHDA 3FFIA 2KTQA 1BCMA 1KVCA 1RTHA 1TV6A 2D9TA 4FM1A 4DTNA 4RW9A 5D6YA 3QKJA 4KREA 1X9SA 3KD1E 2XY6A 4AHVA 4F3TA 3PUFA 2OYQA 4LY7A 3P8HA 4DMNA 4OVAA 4J2BA 5IAYA 2DFEA 3QINA 2X4XA 3TAFA 5C42A 4QW2A 2ZQBA 3O3HA 4JRPA 3KLEA 3RR7A 3NTKA 3DLMA 1C1CA 3WNFA 1HYSA 4DF8A 3S3OA 4NYNA 3MP6A 1JLCA 1TL3A 5C24A 4NCAA 3ZT1A 4FXDA 3O3FA 1WAFA 2Q3SA 1XC9A 3D45A 4IURA 4E7HA 3SV3A 3MEEA 1NOYA 1O1WA 4CIEA 2OPQA 3T3FA 4FLZA 3FEOA 4C5HA 1RBVA 4HHTA 3SYZA 3IG1A 1RT6A 2DAQA 2R5MA 4PWDA 5HRRA 1BI4B 3AA5X 3QLHA 3DB3A 1CZBA 5KCHA 3SUOA 1CXUA 4HUFA 4M3ZA 5KE3A 3RMBA 3AA4A 3OS1A 1KRPA 1VSHA 1WSGA 1SKWA 2M0OA 1C0MA 4RG2A 1QQCA 2X6SA 1NKBA 2GUIA 4DFKA 2GBZA 4FJNA 3PMTA 1N6QA 1S1VA 2Z1IA 5KRSA 1EX4A 4KB1A 1JKHA 4OLAA 4N41A 3L2VA 3SPZA 4OLBA 1SSFA 3BDLA 4LSNA 4KI6A 4M3UA 5I3UA 4FM0A 4F2RA 4EZ6A 2L8DA 3OA6A 3M8SA 1VSIA 4F3OA 4CJTA 4A4FA 4DLEA 4M3YA 3FC3A 3NNQA 2X35A 4B9SA 1TKXA 4DSKA 4E7JA 1EXQA 2DIQA 1CLQA 4CK2A 1IG9A 2FC0A 4CK3A 4DTMA 3EYZA 4OGEA 4CHQA 2VG5A 4PLLA 2OPRA 2L89A 4QQDA 2E6MA 2HNZA 1U49A 2HMIA 1RBTA 4W5TA 4CFAA 4DSJA 4ELUA 2VWKA 3MEWA 1VSKA 4DTJA 4E19A 1JL1A 3QEIA 5KE2A 1TK0A 2QQSA 1RT4A 2HHXA 4DS4A 2FBYA 3AVBA 4KI4A 4K8ZA 3ZSXA 4CGGA 1JLAA 2VG7A 4Z4GA 1SUQA 2JZ2A 5SZTA 3IAYA 3HJFA 4QVZA 2D0CA 4N4GA 2FBTA 4CJPA 3L2QA 1X9MA 2IC3A 3LWMA 4CHYA 3OYHA 3HL8A 3OMGA 2WOMA 2A1RA 4N76A 3AVJA 5DMRA 2P0KA 3L2RA 2XO7A 1MU2A 4HCZA 3TARA 3UT1A 5J2MA 1NK6A 4AH9A 4CHZA 3U3YA 3VQ5A 3CQ8A 2RI5A 3QJ6A 1KCFA 3MAQA 1YVUA 1TKTA 1IH7A 1ZBUA 4G1QA 1RBRA 3TAEA 1S9GA 1L5UA 3VA0A 2R5AA 1OZ3A 4HCBA 3SJJA 5FRNA 1WSEA 1XI1A 3G10A 1HPZA 4OPJA 3DRPA 1WLJA 4CJFA 1VSEA 1BCOA 1BI4A 4FJGA 3HXMA 1ASUA 1WJQA 4FLVA 1RI0A 3ZSRA 1VSMA 1A5XA 3H6ZA 1CXQA 3DLGA 4E3SA 4H8KA 4CEQA 1N27A 1SKRA 4ZTFA 5KGXA 1J53A 2YNIA 2M1HA 3QIOA 2XHBA 2YHBA 3AVFA 4E0DA 2GFUA 4DQSA 1U47A 3I0SA 2IDOA 3LLRA 3LH0A 3KLGA 3ZCMA 1RTJA 3K2PA 5JS2A 3OQ5A 1VRUA 3VQAA 4BE1A 4DG1A 1ZYQA 3QIIA 3DLKA 1RT7A 2LDMA 1JL2A 1WSFA 5C6SA 1W0HA 3KD5E 4I2QA 4FJJA 2F8SA 3K5MA 2XY8A 2EQJA 3S9HA 2YNFA 3RMAA 3NGZA 2JLEA 1HJRA 3ASMA 2VYTA 3DRRA 4FJIA 1S1WA 2ZE2A 3SQ1A 4QQGA 3TAPA 4KV8A 2G8WA 4DSFA 3AO4A 4J2DA 3PX0A 2KQ2A 2B5JA 3PX4A 2HQXA 4IUQA 2RI2A 1Z26A 2VWJA 3NAEA 3L2UA 3H8ZA 2KFZA 5M9OA 1HNIA 3L3UA 3ASKA 2IAJA 1S1XA 5IN1A 1DTQA 5J2NA 2X78A 2DFHA 3KLIA 3AO1A 4MFBA 3AVIA 1LW2A 2KZMA 3UWNA 4CK1A 4QCLA 3SZ2A 3OYIA 2LCCA 3SNNA 3KJVA 3LYIA 4FJXA 3OB9A 1ITGA 2RF2A 1RT3A 4IFYA 4CEFA 4N56A 3OYBA 1C6VA 2HQEA 4Z02A 4C8KA 3ZT4A 4BE0A 2EQMA 4JRQA 3Q1JA 3RMDA 3RWUA 2K3XA 4L8RB 5SWMA 1S1TA 3SUQA 2QK9A 2Y1JA 3SI6A 4AILC 4FZXC 2K3YA 2Z1GA 3SUNA 3E9GA 4FYDA 4CEAA 2LTOA 3CYMA 1LWFA 4NCGA 4OGCA 3ITHA 4PLIA 1OI1A 2OPPA 2Z1HA 2DY4A 1S6QA 3P8DA 3ZT2A 1HMVA 4IUVA 3LPTA 3K5NA 1RCHA 1L3UA 4ICLA 4C8MA 4PQUA 5T7BA 4CIFA 4W5NA 3AO3A 3MEAA 5KTQA 2G8UA 3G0ZA 2YKNA 5HROA 3L3VA 2L3RA 3FLGA 4RW6A 3JYTA 2RHXA 3VQ4A 1JLBA 4KHNA 2Y1IA 4GMJB 4FJ5A 1WAJA 3EY1A 4CHOA 4H4OA 2RO0A 4X34A 1GOAA 4O4GA 3VQQA 2WONA 2HNYA 3MXMA 3ALYA 4FLUA 3D0PA 3MEUA 4FZZA 1NK9A 3V9XA 2EQKA 5CZ1A 3TI0A 1LWCA 3VQ7A 3K5OA 3WNGA 2HHUA 2GV9A 4IG0A 3LAKA 1R0AA 3SQ4A 1D9FA 1VSJA 2EFIA 4CGHA 4CF0A 3QEPA 2X4WA 4DU1A 1TGOA 4A4GA 4LD6A 3V1OA 2RJFA 4FJKA 4DQIA 4DTSA 4JLHA 1KFSA 1TL1A 2QXFA 4DSIA 1UA1A 2F8TA 3IS9A 1RDDA 4KFBA 1J54A 2XRIA 3UIQA 1SL2A 4I9LA 4TSXA 1HNVA 2JGUA 4CJSA 1Y97A 3RRGA 4ELVA 1NJXA 2G8FA 1LW0A 1NKCA 1WJRA 2X6NA 4E7KA 4IUUA 2X4YA 4CERA 1BIZA 1ASVA 3AO5A 4B8CA 3QBYA 2XDPA 3LP3A 4CGJA 3TANA 4BDZA 1C0UA 1QSYA 4YFUA 2CKKA 2RN2A 4FU6A 4OKJA 3HVTA 2O4GA 3LANA 4OKKA 4Q5VA 1XHZA 3KTQA 2WACA 4IG3A 3O3GA 1VSLA 4CRIA 2ETJA 4CF2A 4B3OA 3OS2A 3DB4A 3K57A 4C8NA 1NK0A 4O55A 2HHTA 1KVBA 4FCYA 4ZHRA 4CF9A 3F73A 1S9EA 4II1A 4M42A 4FW1A 4YNQA 4CJWA 4IBNA 4AHCA 3CFRA 3TABA 1BISA 3VQPA 3HSTB 4M3RA 2O4XA 4FJHA 1X9WA 1JLEA 4W5OA 1FKOA 3NGYA 3QNOA 3PO5A 4HUGA 4CEEA 3OYLA 4PA1A 4LH5A 3DM2A 3KK1A 1EP4A 3ZSYA 2G8HA 1ZBLA 4Z4FA 1FKPA 1S5JA 1RBSA 1REVA 4JS4A 4DQRA 3EZ5A 1NOZA 4WE1A 3P1GA 4HVJA 3NH1A 2HHVA 4AHRA 4C8LA 5FDLA 4BDYA 5D6XA 3PV8A 3O4QA 2R58A 4CFBA 4DU3A 1YTAA 3L42A 3NF9A 3RTVA 1NJYA 3ZSWA 1G5VA 4Q0BA 3TAGA 3TWHA 3NH0A 2PZSA 1WSHA 3SCXA 4FJLA 1VK0A 4CJVA 1YTUA 1I39A 3F70A 3C6UA 3DLRA 1DLOA 2EQUA 2KW4A 4GVMA 2IGIA 1L3TA 3LX7A 4B9XA 3O4NA 4OJRA 1RTDA 1S1UA 4DTOA 1W9HA 1JLQA 3QEXA 1S6PA 4FJMA 4I7FA 3HP6A 3K5LA 1ZBHA 3HPOA 3V1QA 4NZGA 5C0MA 4RW7A 4KAZA 3K59A 2BIVA 4QQ6A 3MEGA 5HBMA 4DF4A 3BGRA 3QO9A 1D8YA 4I2PA 3S3MA 3AA2A 4B9WA 3VQEA 4DFPA 3NF7A 1WNSA 3OYJA 1UOCA 2XY5A 5K14A 3OYDA 2RHZA 5CYMA 4CEOA 4Y1CA 2X74A 4FK4A 1ZBFA 3ZSQA 4CECA 1F21A 3RMCA 1RILA 1XWLA 1HYZA 4XIUA 4CJ3A 1QE1A 3IRXA 3MEDA 3NHGA 3HO1A 4E89A 4MQ3A 4FVMA 2AJQA 4GY5A 3DLEA 3H08A 3CM6A 4M3TA 1KTQA 4Z4EA 1WSJA 4FZYA 1IKYA 3L2WA 3V9UA 2R7YA 4C5GA 1EETA 3VN5A 3PNWC 4B9LA 3MECA 4EP5A 1U04A 3AVCA 4Q5WA 4QAGA 3OYNA 5CIUA
chains in the Genus database with same CATH superfamily
3HGGA 4A3KJ 5EF6A 5I9EB 1LV5A 1K0SA 4F7UA 2YS9A 2IG0A 5AQGA 1KD1R 1V5GA 3IDHA 4B21A 3CVTA 3F0CA 4M75E 2O8FB 4NL3A 2QEXN 4LFCK 3KETA 3FHFA 5ICGA 4X1EA 1D3BB 1Q81R 4UV8A 5L3FA 4HNUA 2FZCB 2VLAA 4KITB 2DTHA 4GFBA 4N0AC 4DSEA 3HZ6A 4H0EA 3NFAA 2FYKA 3NDKA 1AWWA 1OCPA 3GO5A 5IYCJ 2D0AA 4FJ7A 4MO5A 1VQLI 3UKUA 5LJ5d 4J00A 3NAUA 2A0FB 1VUBA 1J7KA 4OMFB 1B9DA 1NE8A 5C25A 3ZSVA 4M78G 2LVSA 1MD0A 4XLEA 3QYHB 3CCMN 1VQPT 4QS7A 2L3QA 1VQPI 1R36A 2JPCA 4ETSA 4KTQA 3LAMA 3MO8A 4H03B 3LSPA 2R7DA 5FRMA 4B3XA 1YI2T 2RAEA 1MMNA 3AVMA 4A6EA 8ATCB 3VQ9A 1RTIA 1BI0A 4GV9A 1TKZA 4WCEL 1UHCA 2MWOA 5JS1A 2VQCA 1HNXK 3V6DA 1VSFA 2NLUA 2HVRA 3RBBB 2X6YA 2EIKH 5JMVA 2AKKA 5DM6L 2NOZA 3ZETA 5F08A 1Q7YO 1MMDA 1HR0K 3QYBA 4HF2A 1C0TA 1I6XA 2DIGA 4BJ6C 4ILGB 2OZSA 2H6BA 4FYWB 1D8KA 1W36C 1Q9XA 2UXBK 1Q7YC 4I09A 2DL3A 3DI6A 3FISA 3I55A 4A2AA 2RNAA 3X24B 2P9KB 2QA4T 3GBQA 1HPMA 2QA4I 4JV5K 1AHJB 3K7AJ 3WNEA 4EM0B 1HU0A 2RJDA 3HSFA 3BG6A 1BJAA 5ILSA 3HM8A 3MFKA 3F6VA 3R61A 3ZQCA 4CJUA 4B9VA 2O4IA 3JB9D 2ADUA 4NLCA 1GT0C 1G83A 3LQQA 1AWCA 2HHHK 4Y33A 4HX8A 1BKBA 3CQZJ 4DV0K 4HQEA 1O9SA 1BA1A 3OY9A 4CJRA 3C0BA 4DBHA 2NOEA 2HVIA 1TUDA 3VQBA 3GTJJ 4EIAA 1BBZA 3FIFA 1JEGA 2P5KA 3CCUA 2L9NA 5EZGA 2OPTA 4OIOF 2ZPHB 2EIFA 4M3WA 4IDKA 5GPCA 1IKVA 4XK4A 5J2PA 4BDPA 2XGEA 2KJCA 4FVUA 3CC7T 1VQ5N 2MG4A 4DV5K 1IUYA 2F2VA 5I22A 2YG8A 4LLLA 2Y9YA 1IUFA 4FSXA 2ZPEB 4O5BA 1MV3A 2XV4S 4B9NA 1K6YA 2FXUA 2L02A 1X9JA 3IKVA 3P4IA 2IVOA 2HSEB 3ERED 2YX7A 4HT8A 3B6PA 3EH2A 2IPOB 3AVGA 1MSFC 1WHUA 1AWJA 4DKWA 4U0WA 3V9SA 1J5OA 2JUGA 2O9LA 2YUPA 4ELZC 1Q8IA 1ZUKA 1U3EM 3MHXA 2JVHA 1Z7UA 3LGLA 2XF7A 4Z0UA 1ETWA 1YITN 2OD5A 3HRMA 2QM3A 3HK2A 3LSTA 2ZMEA 1IRFA 1GXPA 3OS5A 3GNGA 4CE9A 3I9V2 3VF2A 3V9WA 3GTPJ 1M90C 3D2FB 4M71A 2XC7A 1WVRA 2I5UA 2XAHA 1VQMT 3DAWA 3SUPA 2LNHB 1QGPA 4HLYA 1U84A 3LP1A 2CW7A 2ZGWA 1TYQA 2V8JA 4MDXA 4FJ9A 4C5EA 4ZN3A 1XQPA 1QTMA 1S72A 3EH1A 3CC4N 5EDNA 2B4JA 2XPUA 2WSCE 4RGRA 2PFUA 1YHQN 1SAUA 1S22A 1D09B 1JUPA 3WEEB 1X3ZB 3H3ZA 5AT1B 4YEJA 2E5QA 2F9TA 3DPLC 3IUOA 1BA5A 3RSEB 2MF2A 3HUGA 3NQOA 1UFMA 2YKMA 2Z16A 1YJWT 2Y75A 2COYA 1OH8A 3THYB 1YJWI 4QS8A 1FMKA 2IW5A 4W97A 1IO2A 1PP8F 1QSLA 2FSJA 2HB5A 2HYFA 3BF1A 3I53A 1E3MA 1YS6A 2LDUA 1B92A 2QSFX 4O0IA 3GW2A 5JVGF 2H27A 4FX0A 4M77D 2JMWA 3K0LA 1S5LC 2RJCA 2DN0A 5A2QO 2DT6A 3JCMJ 3S32A 4N4HA 2L7ZA 1WJFA 4AHUA 1W2BP 1VQ9I 2JK3A 1LDDA 2XAJA 3A0BC 4KHUA 4A57A 5KPTA 1LMZA 2VC1A 1NGCA 5CVJA 2W42A 1UDLA 2VYPA 2JWTA 3M1EA 2DL7A 1YJ9N 2X4JA 4PGGA 2DNUA 2E5KA 3CCQI 2CV2A 2JZYA 4M7AB 3F5TA 3C6TA 4L5IA 2VXEA 2V6CA 3F6OA 4B4CA 4DSLA 2C06A 1XDSA 3OJSA 1NJZA 3JRHA 1JLGA 2D5VA 4HNTA 5CLSA 3E6DA 4Z4HA 2FOKA 5DY9A 2JTFA 3WXKA 1MPGA 4NB5A 5J2QA 2UU9K 3MCAB 4CSWA 5J3BA 4CC4B 2ZD1A 2GQVA 3O8HA 3I58A 3CBPA 4JZ3A 4PFZA 5J39A 1APLC 3FDYA 4KRTA 2KIUA 4FWPA 5E26A 4JRIA 2WADA 3KFVA 2KYBA 2FVUA 1XCBA 3DKXA 2BY2A 3G6EN 2HBPA 4KB0A 3K4CA 2E10A 2RK2A 1JHHA 4XIDA 3JRZA 4CHNA 4N5SA 2WWYA 4OB0B 2ATQA 4JKEA 4M7DG 5HP1A 5JHUA 3THKA 4PL7A 4AYBN 5FROA 3QERA 3IRQA 1NEBA 2VKNA 3QODA 1U48A 1AWXA 2O03A 4RGSA 4PL6A 5L3GA 2XASA 2KXCA 2RQQA 1SD7A 3M57A 2MBFA 2KLOA 4AM7A 4CFDA 5HDKA 1QSSA 3OWTA 3DLBA 2VPRA 4NDLA 3JRAA 1KVAA 1FYMA 4J6XA 1P4XA 3GVAA 1M2OA 2ECCA 2Y0SA 3LSIA 1X3WB 4X64K 4CCKA 1B3QA 5IOYA 4CF1A 4FT2A 5J6XA 2OAZA 1TKDA 1I1JA 4CZMA 4FK2A 4V19K 2KFNA 3RRHA 2LMJA 1QLYA 2P8TA 2E6ZA 4CJEA 3ZT0A 3PJRA 3CCLA 3H0GJ 2BGGA 2KNBB 3ONQA 3VW4A 4J2EA 3QDFA 1YW8A 1WEIA 3CJNA 2BZXA 3OYCA 4EHUA 1RNLA 3IQLA 5DK5A 1WPKA 2CYYA 3KLHA 1ZUUA 4R0KA 1Q1VA 3HOWJ 3U2RA 1S9HA 3NBPA 2VASA 4RTYA 4R56A 1I3AA 2BOLA 4JX5A 3DLLF 4HW0A 2Q2RA 3SAGA 5B5EC 2WV1A 3CIPA 4MFEA 2P4TA 1BHLA 2J6FA 5LMNK 2XDDA 2NYXA 2DYSH 1XUPO 4DTUA 1PCXA 5BS6A 3KX2A 1TWCJ 1R58A 1RDCA 3JCMc 5E1WA 3CMEN 3AFHA 5HRPA 3ZQ7A 1F4KA 5D6WA 2L3SA 2KIQA 4BR9A 1GXQA 5HRNA 5C10A 4EIKA 5I42A 2FZKB 1YFNA 1FOXA 3DMJA 2Z1JA 2A7YA 1KQJA 3ZMZA 4FTHA 1WCMJ 3H35A 1U8RA 1H0MA 5AQVA 1HQEA 3VGLA 1Z77A 4C0DC 2O8CB 5LJ3f 3O80A 2OTJN 2ZB9A 3VTIA 1V55H 1OVQA 3WVEB 2W24A 4XKWA 4AHSA 2H56A 3KE2A 5IT9O 4BGDA 4LH4A 2DTUA 2Q0OA 1J2XA 1J59A 3R1XA 5GAHP 1UAXA 5E20A 3NRVA 4BROA 2QEXQ 3FK6A 3ZEHA 1QP3A 1EIFA 2EYYA 4KHYA 3KZYA 4PFPA 5H6RA 3VQCA 1YI2A 4DA4A 1TQMA 1BG3A 4YY3K 4X62K 5GMKe 2HNDA 3IH7A 3DXKA 2E36A 2DQLA 4F4KA 3QIPA 2A05A 1T0JA 1LCUA 1K8KA 1J5YA 5KN9A 2V8KA 1U2VB 1Z91A 1GOBA 1NK5A 2B6AA 2QENA 4CEZA 3ZQIA 1YN8A 4HDUA 3CD6A 3CCMQ 1YW9A 3I64A 4M3XA 1ZLKA 1UG2A 1TQIA 5HS9A 5EEAA 2OA8A 4UUVA 1ZA2B 3KUFA 2OAUA 2JA2A 4F93B 2EX3A 2GTDA 1PU8A 5CR4A 2YSQA 4XAXB 2M51A 1N36K 1SFOJ 3M5AA 3BZ6A 4BKXA 2XK0A 4UY8O 1OZ2A 1UGVA 1WJ5A 4II2A 2RV8A 4OX9K 2CZ7B 3D6RA 4IOXA 1KG3A 2JVGA 1TAUA 1DP3A 3TAQA 3C6AA 5FPMA 4QTRA 2OPSA 3HRUA 1XGNA 3FDRA 2J06A 4HA8A 4XLHA 2P4RA 1QNTA 1WHJA 2AXLA 3EN9A 3JSMA 2Q97A 1JCEA 3RSNA 4D5CA 4LOCA 4YIIA 2G8VA 3MN5A 4GNIA 4B48A 1KHCA 2XGXA 4NS5A 3AVNA 1XN7A 3I5RA 1C0FA 3CC7A 2ZXWH 3LSGA 1UMQA 1G6NA 1VQ6Q 2MI6A 4LF9K 4C8OA 2NYSA 4VUBA 1MUDA 3GTGJ 2F5VA 5DEQA 2ABLA 1MW7A 4IHWA 4H0PA 2KTQA 4CYCB 3KYCB 1KVCA 3ZP5A 3GLLA 5KVRA 1KHIA 4AD9A 3CMMA 4O5FA 3FXRA 1KQSM 1DGKN 3QMLA 3QB0A 5F1RA 4A61A 3S17J 5D6YA 2MD5A 5AJ3K 1MBJA 2XY6A 1VOMA 1HKSA 3C7NB 2ZM6K 2F2WA 3PUFA 2FBIA 4LY7A 1OPCA 1KU7A 3N97A 4EV0A 1VQ5Q 3M56A 1QVGM 1KU2A 3KPHA 4AF1A 2DFEA 4D9JA 1B9NA 1VQMA 3RR7A 3NTKA 4D5FA 1KU3A 1RUOA 2DA9A 3WNFA 1JCFA 1Z0XA 3BCBA 3WTVC 1I5LA 4OB3B 3TOBA 4EEFG 4JKCA 3S3OA 3JV3A 1HYSA 4XOTA 3G71A 4PKCC 3F0ZA 3MP6A 2Z3YA 3ASOH 2FE3A 2X3XD 2HOEA 5AQXA 1ZUYA 2NVUB 3GPLA 1YITQ 3TSPA 4DZPA 4LGWA 2BZ8A 1P2FA 5AQKA 4JK9A 2M3AA 2E70A 4IURA 3MEEA 3U1KA 1XSVA 2DFIA 1R4MB 3EGUA 1ETXA 1KO9A 3FJPA 1NMDA 4CBXA 1CF7B 3VOEA 4MO4A 4EVVA 3I4NJ 3CC4Q 2QDLA 3M53A 4J7IA 2A68F 3CUQB 3JCMQ 1YHQQ 2D4WA 1VTNC 1LWVA 2J7IA 5KE3A 1M2VB 3HPWA 3VSLA 3AA4A 1QZ5A 2HBKA 4HVWA 2DZ9A 1WSGA 1P7IA 2HKOA 4LDWA 1SKUB 3DKMA 2M0OA 1QQCA 4IHVA 2DODA 5AQQA 4L5JA 3MZYA 4DFKA 3A1PA 1USTA 1B7TA 3PMTA 2Z1IA 1T98A 1EX4A 4KB1A 1JJ2S 1EJ9A 2ITMA 1T0FC 4A6DA 3O1BA 2Q8KA 3CC2I 5DLOA 4F2RA 3O4WA 1PUEE 3QO3A 4F16A 2A41A 4J9GA 3GBGA 3M4YA 5CO7A 1FIPA 2QZ8A 4WTOB 5AFUH 3FC3A 1B8IA 2P9KA 1TKXA 3RPUA 3TMOA 2DIQA 4M7AG 3RPQA 3CZ6A 4EJZA 1S6LA 4DOWA 3DBHB 5CKHA 5CQXA 4HYEA 3L00A 1YJ9Q 2XPWA 4CHQA 3ML6A 3MX2A 3TSWA 2PMUA 4XU0A 4E1JA 3COAC 5DTDA 3CMAI 1QKXA 1X2KA 2K5IA 2E6MA 1U49A 2HMIA 1RBTA 5LHIA 4GYIA 2I7NA 3BROA 2VWKA 4M7XA 2CGJA 4IZ9A 1XMXA 1BC7C 4PJOD 4A63B 1U6GA 2KEAA 3PO3J 2E5ZA 2M0MA 2JMAA 3CWTA 3N4PA 1RT4A 2VBZA 4DS4A 1YNZA 1G99A 2KR3A 2FBYA 3AVBA 4K8ZA 2R7VA 2VG7A 4LD5A 3IAYA 2H94A 2D0CA 1VIFA 4CJPA 4RAZA 3Q0WA 2E34A 4BR2A 1MZBA 5FU7C 3PSFA 2MC3A 1N9RA 3G6EQ 4A3LJ 1LKXA 2CW0F 3OYHA 4IZZA 3OMGA 3CCEN 2WUSA 4KULA 3QDRB 3A0IX 2A1RA 5DMRA 4IEEA 3QOPA 3DKYA 2O8BA 5J2MA 4E2FB 4C23A 3L09A 4MLOA 3HZJA 1XC3A 4AH9A 3U3YA 5FD6A 3VQ5A 5LBQA 3CCVT 3CCVI 2HZTA 3UA6A 2H09A 3CQYA 4ZYAA 3VRYA 3CPWM 3AT1B 1GLFO 4EJOA 1ZLMA 4OFEA 4C8QD 4M77B 1MBGA 4LUDA 1E3OC 5GIOA 4W1UA 2LYCA 2K3FA 1YXQA 1UCRA 1OZ3A 1X27A 2K27A 4YTLA 2ZXHA 4A3MJ 2WSFE 1W5CC 1ZG5A 1HPZA 4BC2A 3DRPA 1WLJA 4DR2K 3CCST 4CJFA 5BRHA 1VSEA 1G3TA 3CCSI 1QZEA 3CCJA 3GBTA 3HXMA 2NVXJ 2VWFA 1RI0A 2ZFWA 4OMZA 1GCPA 5GANg 4CZKA 1A5XA 2O8EB 3H6ZA 1CXQA 1VYVA 4JI2K 1HKQA 4E3SA 1LNWA 2RQPA 2YRDA 1QVFA 3THYA 4LF6K 1A6QA 2GOXB 1A0NB 4B22A 3I56T 5K7HA 2GGRA 1E0EA 4OF1A 4JD2B 3S15J 1XOVA 2XMFA 2JJ9A 4HF1A 2GFUA 1IN8A 2DYRH 3ZYYX 5E84A 2IDOA 3LLRA 3CJQB 4KYWA 3KLGA 3EEQA 2DXBA 3CXCA 1F1ZA 3JCMP 3JRCA 1S3XA 5GAGJ 2K40A 1Y8QB 2KVQG 2IGOA 4DG1A 3QIIA 3DLKA 4U88A 2LDMA 1JL2A 5C6SA 2NRHA 4JI6K 1WH5A 1NBWA 3J7ZI 3ZXSA 3ZMDA 4C3IJ 2CP3A 2CSQA 3DTKA 4BRHA 1ETQA 2X6WA 4EMKB 2EQJA 3CMEQ 3S9HA 2HQNA 3TO7A 1K9MO 1JKPC 1Y96B 4HBLA 1H92A 3BC8A 1CQTA 2O8DA 3QXEB 5LL6Z 4AU7A 4XQ3A 2QKLB 4BR4A 1HJRA 3ASMA 3D7SB 1PKSA 3BTJA 4NB4A 2OQRA 1VQ7N 1H88C 2DVEA 2VYTA 2W40A 1HYOA 4XLFA 2HXIA 2I8DA 3H3OB 4UXNA 2H1LA 4E6RA 2XIDA 1GLLO 1IGNA 1BB9A 1R5HA 2OTJQ 4DSFA 3PX0A 1R22A 2P84A 2Z0WA 3PX4A 3ZMUA 2RI2A 2Q0UA 4LNPA 4CCMA 2M87A 3GZ5A 2EJRA 5M9OA 3G4SI 1UECA 3ASKA 1WBBA 5H20A 2XF6A 2GLOA 2IAJA 1RRJA 3K1PA 5LJ5j 5J2NA 3UKGA 2RREA 2WTUA 3M5RA 2R5YB 1KFZA 3KLIA 2E2QA 4YDUA 2TDXA 4C9YA 3OHRA 4QCLA 9ATCB 4FL9A 4FYYB 3OL3A 3QHSA 2GQQA 4IFYA 1RT3A 3I54A 1NBEB 1MNMC 3ZT4A 4O3MA 5AQFA 2CH0A 4AT1B 2FBHA 3BZCA 2R7QA 4LF5K 1X43A 2E2NA 1SAXA 2CUJA 5D5UB 4BY1J 5D8KB 2XROA 1JTYA 4KMFA 2MD0A 3FMQA 5ERIA 1X4PA 2FJ1A 1QVUA 1JRIA 4U7DA 3WU1B 4FYDA 4NC7A 5GJWB 3DEEA 1LJOA 3FRNA 5GANd 1R71A 4NOYA 1VQ6I 5C4XJ 5GAN8 3KTUA 1R4NB 1H9TA 3JS6A 3MMVA 2Z1HA 2DY4A 3QPTA 3ZT2A 3CTAA 4FM4B 1HMVA 5KYXA 2AT1B 4IUVA 2RD1A 4FOIA 4CCNA 1JUSA 2YHTA 4I01A 4CIFA 2HR3A 3AO3A 3RYRA 5KTQA 3G0ZA 2LZ6B 2X9DA 5HROA 2KP6A 5D6EA 2NOBA 2RHXA 5H6QA 4UHTA 1TNTA 3VQ4A 5CVIA 1JLBA 2EPFA 3JRIA 3M0TA 3ZQHA 1DU6A 3WG7H 1F9NA 2DPUA 3EY1A 1PRLC 4CHOA 1ETVA 4X34A 1GOAA 3IV5A 1Z9CA 3LMMA 3LDOA 3I55N 1K79A 2XG8D 3W6JB 1S7AA 4J8FA 2A07F 3GDQA 5LL6S 1Z9ZA 2HOSA 5CZ1A 4DQ8A 2E4HA 2DO7A 5HK3A 1LWCA 4PJJA 3VQ7A 2ZBKA 2HHUA 2VBXA 3J81E 4F7ZA 4CI0C 1O4XA 3CJCA 1D9FA 3IAS2 4CGHA 2X4WA 2EBIA 3QEPA 2YSRA 3AAFA 1N8RO 2FPDA 2RJFA 1OR7A 4FJKA 1XC5A 1ILYA 2DRKA 2PUKB 1KFSA 1VIEA 4KH4A 2F8TA 4KFBA 1J54A 4BG9A 4KFCA 1TUCA 2UUBK 4XLNF 3UIQA 4I9LA 4M75G 3TQ7P 3JCUC 5M1QA 1A6IA 5GAMe 4TSXA 4G6DA 3OH6A 3WXIA 1X2MA 3M59A 2JUCA 1ZREA 4YOTA 3VFZA 1A5JA 2P9NA 1Y39A 3M0UA 2X4YA 2L2OA 4ZGDB 2XB5A 3AO5A 5L23A 1YQMA 3TDUC 1F1BB 3FJ5A 3QWXX 4UB6C 3CJBA 3HTUA 4BDZA 3GTMJ 3JB9G 2KMUA 2FX0A 1QSYA 4WF2A 2CKKA 1VHXA 1KQ2A 2ZPIB 1TZLA 3THWB 3NWSA 1IC8A 2K9NA 4RCCA 4BEHB 4K25A 1RUWA 1K83J 4IO9F 4C1NI 1SVLA 1YJ9I 3KTQA 5J8FA 2W04A 4IO8A 3VUZA 1GBRA 2A5YB 1VSLA 4CRIA 2KFDA 3REAB 2HZDA 4D7MA 1NYGA 4HQMA 4IJAA 1FJGK 4J01A 5L3BA 1SD6A 5HDNA 1HW2A 1MSEC 2J6OA 3V8LA 2HBLA 4C8NA 1NK0A 4ZDLA 3BG3A 4O55A 3GE1A 1VQNT 2HHTA 3VU3C 1VQNI 4WF9L 4A93J 2VKEA 4ZZLA 4I98B 2DBKA 1S9EA 2XGDA 4II1A 4IBNA 2OTLT 3VS2A 3MMYB 1WGXA 2E2HJ 6AT1B 4WXCA 5EYRA 3VQPA 1SVOA 2QM1A 2CS7A 4D8KA 3UF4A 2LSOA 4IO9L 4UNFA 4B47A 4ORZA 1FKOA 4X66K 2VUMJ 3QNOA 3PO5A 5IH2A 4BNCA 4Y52J 4CEEA 1ULYA 2DA7A 1RGIA 2HD0A 5TRDA 2NOGA 3WXLA 3E6MA 1C0WA 1EP4A 3ECHA 4CYCA 1W7PA 3ZMVA 4JS4A 5CVUA 4Z6YA 4BS9A 2EH3A 2DBMA 2VL8A 2YLCA 2G6FX 1K9MR 2CUBA 3B6CA 4C8LA 4DYRA 5D6XA 1P4AA 3O4QA 1I81A 1EV7A 2CGPA 1T0FA 4Q47A 3C7NA 4CBWA 3NF9A 2PI0A 2C0TA 1NJYA 3ZSWA 1SD5A 4D6WA 3FR0A 4KGXB 3EUHA 4DUYK 3WGHA 3TAGA 3TWHA 2IIMA 2HCKA 2L2PA 2DYBA 4DUZK 3SCXA 4C92D 4FJLA 2RQUA 4E6KG 4YOWA 4JOMA 1Q82C 1DP7P 4BUGA 5GMKm 2A42A 5GAOl 1DLOA 4II3A 4XOPA 2X51A 1D3YA 4RMNA 4H4KC 1I50J 2YUSA 2FSKA 3LX7A 1OKJA 4B9XA 3PTAA 1JJ8C 2W6KA 3QSUA 3G0QA 3RESA 1M90U 2IS6A 3QJYA 1S6PA 2O9VA 4LG0B 4GBQA 3ABTA 3UR3C 4XICA 5BREA 3HP6A 3K5LA 2OZ6A 4V2GA 2VPLA 1FMWA 1N8RU 2HNHA 3B02A 3WE3A 2O0YA 3BQZA 2M4KA 2J5PA 2DBBA 2GUPA 3I56A 1CF7A 5I2MA 4QQ6A 2STTA 3SQNA 3CVSA 4Z89A 3HHHA 1DUXC 2EB7A 2KRHA 3EDPA 2ZSIB 3QO9A 4IXAA 2DRMA 5EZHA 3WG9A 3LCNA 3AA2A 2ICWG 1KXPA 2KMTA 3TKYA 3U4LA 3BPVA 3SFMA 4GDFA 3SWNB 3GTOJ 4I2OA 1ABQA 2HMAA 4M78D 4CEOA 1UG1A 4BRAA 2NNWA 4FT8A 1LFPA 3O5ZA 3TOAA 3H92A 1YIJT 1YIJI 4XU2A 3H0DA 2IVNA 3HBLA 3QOEA 4CECA 5LRRA 3IUCA 3OSFA 1K73O 5LJ5e 4PJOB 4IVNA 1T8IA 4HNVA 2DERA 2FQ3A 3HO1A 5DCMA 1YQKA 1K73C 3TPQA 1AKHA 4GY5A 2CWEA 4AFZC 2NS0A 2KJBA 4CA0A 2V8IA 2NOFA 4Z4EA 3SZPA 2BHZA 5HL7L 2IXSA 4RAYA 2LP0A 1IKYA 2DD5A 3L2WA 3DV8A 1X6BA 5IY5H 4C5GA 2DJNA 2VUBA 3M3ZA 3VN5A 3PNWC 4B8XA 1BM9A 4KMUX 3CUOA 2DPDA 3GX4X 5A0DA 2VB6A 4JKHA 4QAGA 4BH9A 1OLTA 1NG7A 2AKLA 3OYNA 1OCOH 2EV6A 2EFPA 4LLGF 2WV0A 4HVVA 3H46O 5E8GA 2LRQA 2MGQA 3R8EA 2E1OA 1VQON 3ZPLA 3QG1A 4JZ4A 2JA6J 1XDUA 1M5Q1 5CKEA 3R4KA 1VQ7Q 1G3SA 1N75A 1WEGA 3L6QA 2K9MA 5IHKA 3LDPA 3VF4A 1N5YA 4QPQA 2L0AA 3LP0A 2QQ9A 1JLFA 3BTLA 1SRLA 2P0WA 2O2OA 3MXIA 5DDGA 4EGZA 2OA4A 4AG2C 1NK8A 3UATA 4C8QB 2KBTA 1KA8A 1XD7A 2P9PA 2KIMA 3SFIA 3OYMA 4EATA 4CJQA 2VV5A 3CEYA 1ZLJA 4HXJA 3CO7C 1TK8A 1M90R 2W41A 4DTXA 2FZGB 1JKRC 2G3RA 3R9PA 4KBOA 3SJHA 2A28A 2KKZA 2KPMA 4GV6A 3HKSA 3E5UA 1QQIA 1N8RR 2JNGA 2ISZA 1BUPA 4MLEA 2O5RA 1VSDA 1A5WA 2DPNA 1T6CA 3EFOB 1R00A 3JB9J 3WQTA 2I5WA 1VQLN 3BDUA 1T0HA 2CUEA 3ABKH 4BQZA 1RDAA 3DXMB 1WQ2A 1SSHA 2P9SB 3EFSA 3NHNA 1AZEA 4CJ4A 4JAXA 4H0OA 3FKIJ 3JXUA 1LAWA 2DA3A 2K7AA 1P4WA 4MZTA 4QSHA 2DXIA 5GAOq 3HOYJ 4M77A 3KK3A 1VQPN 1KG7A 5LJ5h 3M4OJ 4I9QA 4ASNA 4PK4A 3UPUA 5CR2A 2HGCA 3HSRA 4DBRA 3HI0A 1G15A 2IBDA 3IC7A 1TVRA 4CHPA 2OBPA 4A5AA 3L1PA 2A37A 3ASNH 3KKRA 2L5QA 3VTHA 3KLNA 2BTTA 1UWBA 2O8EA 2STWA 4CCHA 4IRGA 4E4HA 3HM9A 2O01E 5BN8A 4J9IA 1H3ZA 3EZWA 5EGOB 4XU1A 5FW9A 4EZ9A 4DU4A 3MKLA 5HLHA 3A5LC 3TO9A 1GLJO 4LLNA 3LGFA 3AVKA 1TTHB 2V1XA 1GBQA 3CF5L 5E41A 3NCIA 1WKMA 1GFCA 3B8AX 2P9LB 3Q3SA 2GBYA 3HRSA 4G6QA 3S16J 1UE9A 3CERA 3BR3A 2P9UB 2AZSA 5HRSA 1J0RA 1FBSA 3MKDA 2FMLA 1WOQA 3PL8A 4X9DA 2PVDB 5AZIB 4PY5A 2QA4N 4PKGA 2IRFG 1KAZA 2AQEA 3RR8A 5LJ3g 1EH6A 1ZN2A 1XSXA 5GAOp 1ZG3A 4PGHA 1YRNB 2RM4A 1BI3A 1T3SA 2C0OA 2AZVA 1FOKA 2PBDA 4MNUA 3VQ6A 3DLHA 1K78A 1OU8A 1L3VA 2HHSA 4EMKA 2QWRA 4HKEA 1K76A 3ULQB 1Q95G 4XTZA 1ACIA 4OFHA 3I55Q 5TKWA 3IHOA 2DEUA 2OJ2A 3KIOA 1BIUA 5M5XJ 2LCSA 4B9MA 1WN7A 4B1YB 5M5YJ 4HSTA 3C2HA 2OAWA 1ODDA 2C6YA 3FMSA 1HBXG 5BR8K 1ORNA 2IP2A 1SG5A 4Z88A 3TO6A 4FLWA 2E12A 1E4GT 4GLKA 1A36A 3C95A 2CFXA 4KIGA 2NNYA 1NKEA 2E1MC 3UNGC 2KYMA 4N4NB 4HX4A 1L3LA 3LQRA 2BE5F 2KE9A 1QQMA 1K8AO 2BW3A 2LF8A 3IAM2 5B1AH 1ZHIA 5F0FA 3E9OA 5BPLA 2NZTA 1SFUA 2D0NA 3C6HA 4A3BJ 3M9QA 2KRFA 2B7EA 1QP2A 1K8AC 4F7UF 4NL2A 3QYGB 2R5YA 2LBFB 3THVA 2Q36A 2MLKA 1KGSA 1RAHB 1HQUA 1X6GA 4HWIA 1E6HA 4M7DD 4XSXF 2GZWA 4RTZA 3Q9SA 1Q86C 2KLAA 4Z4IA 2ZXIA 2A5WA 4LDXA 3BDPA 1QVFM 1KK7A 4C5IA 3EE8A 1GCQA 2OTLA 2BVMA 2GIZA 3H0FA 1VQ4I 4FLTA 1RZ4A 1VQKT 1RLQC 1X3UA 1ARKA 2LQNA 1BR4A 4IHXA 4JYAK 3BPXA 1XB4A 3SQ2A 1K1ZA 1YJWN 5K5RA 3CXCM 2FF6A 4XKVA 3H9QA 2MFZA 1PJRA 4AG1C 1M1EB 3PMIA 1WHLA 4OAYA 1D9DA 3N05A 1WJDA 5F04A 4RTVA 4XTVA 5LMUK 2M45A 3OOUA 2EKOA 2HBWA 1RT5A 3LM2A 3RMSA 3F10A 4A5NA 3E97A 2RB6A 1VQ9N 3ZEUB 2DOFA 4CEDA 1C1BA 1WA7A 2RH2A 3L2CA 4O0JA 2CW8A 2HKNA 4DW6A 2FEZA 1BA0A 3J7AP 1V5EA 3IRRA 2IS3A 4F52A 2P5VA 1R1VA 3S14J 3E9FA 5LJ3d 5AQOA 2VT3A 2ZJRL 1WIEA 1B1BA 3FX3A 5GTHC 2GCXA 2B8AA 3A8HB 2PMZN 3PIPL 3J81Z 2P51A 4ZTJA 2F1LA 3QQAA 3BJ6A 1OQYA 3DEUA 5KYNA 1VQ8I 3VKIA 2CT3A 2ZWHA 2EGEA 2FSNA 1ZK8A 1DEJA 2H3JA 2OFIA 2GFAA 2AO9A 1M1KC 3V81A 2ZO4A 1ZX6A 3CPWP 1R9TJ 1MWMA 3CCRA 3P9IA 1J9AA 1U5TA 4JRKA 3ZLJA 4XKCA 4M45A 4HV6A 1MHNA 3MKZA 1OISA 3EYIA 3ER0A 5F0CA 4FL6A 4IXCA 4CGDA 2LCLA 2BVLA 5KAFC 4ISGA 3OR2C 8AT1B 1Y1VJ 2D0BA 2Z5UA 4ENMA 5J3LA 3SBTA 2WAQN 3R6OA 3SEZA 3CP8A 2JM8A 4B6MA 5CQGA 2F7TA 5GAOm 3NF6A 4R1HA 1I4K1 3W3DA 4I6MB 2XB0X 3PFSA 2JN6A 3E01A 1KJWA 1LWWA 1WXBA 1ZQ1A 1IDZA 1YF5L 4M3BA 2LK2A 2ZJPF 4W5RA 1RRSA 3IHUA 4PCQA 1BJZA 3QFUA 2NUPB 1I27A 2M2EA 4WQ5C 3ZN1A 3A0HC 1NTCA 2RE2A 1WWXA 5A0LA 2YHAA 2OZMA 3A01B 3EGXB 3MJXA 3SLCA 3C3WA 1YJNT 5KQDA 3VYSB 2E4LA 3E5QA 2VG6A 1YJNI 5EG2A 2VT2A 4BEHA 2NRZA 3D5RC 5CHZA 4BB7A 1WJBA 4DV2K 2WBMA 5LLQA 2VGMA 1FPQA 2GF7A 2NOLA 2PEXA 2YI1A 3WTSC 1YWPA 1IN7A 3BWGA 1CZ9A 1FYNA 2FXAA 1NG6A 2V75A 2E6NA 4JI0K 3RYPA 1Q9YA 3JR9A 1KU9A 3OJUA 3FK7A 4DS5A 1ZARA 3SFZA 1T8EA 4XNFA 4C30A 1BO5O 4U0YA 1FTZA 1W2BA 5KPRA 3OVNA 1NGFA 5MLCQ 4CCJA 1WSIA 4XTYA 4F04B 4CI6A 4C92B 2XHKA 3PSIA 4PDKA 3X20B 3H5AA 4Z4CA 3QYEA 1SVMA 2DL8A 2NAZA 5JI6A 5E17F 1GL5A 1LEBA 1R23A 2PU9B 1VA7A 5CZ2A 2FSWA 3OS0A 4NBQA 1YT3A 4CZCA 3JCMf 4X1VA 2XGCA 1RDBA 3W6KB 4A3JJ 1VQOQ 3F23A 3LALA 2F2XA 1WNLA 2EQRA 1FEXA 1TC3C 3VEWA 3C1DA 4HCCA 3V9ZA 4DQPA 2EIJH 1M3AA 4HZFA 2CFOA 4IOAF 1IXSB 3PQJA 3PIOL 3T5XA 3O9TA 1WSUA 2LTPA 2YHWA 2RI3A 3OL4A 1NK7A 1TAQA 5BN9A 3M8RA 3A5OC 1ETKA 5D3GA 2D8HA 4L9NA 4EA4A 2CDTA 1ZSGA 2EFOA 3N5BB 3VMFB 4LDUA 3ISPA 4WX9A 3HBTA 1YWOA 2QKBA 2G0EA 4AFSC 4M78B 2HU9A 5CQEA 3GLXA 3LDSA 5D7UA 3G2BA 5M1NA 4A3IJ 3DYAA 3J80K 4ESRA 2BE9B 4LG0A 3BG7A 1BWFO 2YU3A 4E7IA 1G59A 5D4SA 2JTVA 2Z2SB 1W0TA 2DFUA 2K9QA 4RW8A 2PVOB 4XU3A 3U23A 1GVJA 3RVCA 3K4LA 1CZAN 5BPIA 1XMQK 1ZH5A 1TP4A 3OYGA 5EX5A 5GINA 3D4VA 3TQNA 2RHIA 2MMPA 1VQPQ 2KRCA 4XN0A 3GF5A 3GF2A 2SRCA 3QEWA 3DF8A 5DYMA 3BP8A 3DTEA 5E3NA 4LSLA 5GAOn 5AIQA 4AI5A 1XMAA 3LAJA 1G3WA 4F7UE 2XKOA 5GANj 3AV9A 4RS8A 3ZT3A 5FB2A 2AA4A 5AQZA 2OZUA 1SFEA 4M63C 2JS2A 3S3NA 1IBKK 3T1YK 3OA9A 1TW2A 2RHYA 1QVPA 2L54A 1T03A 4E1MA 1JJ2P 1NJWA 1Z25A 3I8DA 1OH5A 1UUEA 4G7ZF 1BOTO 4DCHA 3LZIA 4RW4A 3ID8A 1W4SA 5KAIC 4PJOA 3A2FA 1UHMA 3KHYA 1H8AC 3U1DA 4ESFA 5I11A 2R7FA 1WX6A 3FFKB 3DOKA 1IXCA 1TLHB 5FGMA 4JN4A 3V4GA 2FHDA 5AQJA 2QA4Q 3DBRB 4TV7A 3T8TA 3QZ5B 3S1RJ 2DCEA 2D9TA 4WCIA 1JB0E 4DTNA 3GCMA 3KZZA 4UUSB 4FASD 4E7SA 4IX7A 3MAJA 2VE8A 3QKJA 3TDZC 1KD1O 1UGPB 4DNCA 4F3TA 3RKQA 5D5XB 4BRIA 1M4ZA 4KUMA 5LEJA 5K5QA 2ED1A 5GIPA 4OVAA 4J2BA 1QMCA 1ZBJA 1KD1C 1GHCA 4M7AD 4FWNA 4ESBA 3FXKA 4FE7A 2X4XA 5C42A 3CP2A 3O3HA 3ABLH 1NPRA 3JTHA 1FZPB 3KYLA 4FETA 1Q81C 5AQRA 2HSTA 3QBWA 3Q0UA 4P1WA 3G1LA 3CCUT 4CCOA 1X1CA 2F4VK 3CCUI 4YFXF 2ELKA 5BR9A 1RAEB 1EZZB 3CC7Q 4J7FA 4YELA 4FT4A 4C8QA 1KQ8A 3VRZA 3EUAA 1WAFA 3VYRB 2Q3SA 3LA2A 2EA4A 3HJEA 4A5BA 2IA2A 1NJIO 1HNZK 1QZ6A 3SXYA 2BHYA 1NOYA 3I0XA 1O1WA 4QVCA 3SHWA 4AMCA 3FEOA 4C5HA 1RBVA 2HQ5A 2FOWA 1SEUA 3SYZA 1I8FA 1RL2A 2DAQA 4F17A 2XDBA 3E1YA 4UV9A 4PWDA 5HRRA 4A3EJ 1BI4B 3AA5X 3QLHA 4CZZA 4RWTA 3N0UA 1VQKA 5F0HA 4BI8B 2Y31A 1YQLA 3DXMA 3HOTA 3QPSA 3S93A 3OS1A 1Y8RB 1VQMQ 1JKQC 1C0MA 4E70A 3VV0A 2VQHA 2YT6A 1BW5A 2GBZA 2PMHA 1D0XA 4FJNA 3HKZA 1S72T 1YX5A 2A08A 1S72I 2JVVA 2EWNA 4N41A 1RIOH 1NGHA 3SPZA 1RLPC 4OLBA 3DP7A 1SSFA 1FBUA 3SK3A 4KI6A 4YFNF 3DCFA 4E47A 4B1XB 2BH1A 1IBLK 1KIKA 1VSIA 3T9NA 3CHWA 3KZBA 2K7LA 5LGUA 3CO6C 1IXRC 3NNQA 2X35A 1YJWQ 1HW1A 1HLUA 4E7JA 1EXQA 3C12A 5EGOA 1CLQA 4D0PA 4E9EA 2DW4A 2DXTA 2DETA 2LKXA 4DTMA 3CC2N 3EYZA 3F8NA 1JCGA 3WGIA 1ORKA 4Q48A 3K70C 2L89A 2MH2A 2K5FA 1MBFA 2L9RA 4P96A 1VQ9Q 2HNZA 3LSMA 1R8OB 2HWVA 4W5TA 3OBYA 3DJCA 4ELUA 1VSKA 3K9TA 5TJJA 2ATCB 3X2QH 2L9SA 1TK0A 4BRCA 2QQSA 4ZN1A 1YRNA 1OJLA 3I0TA 2OF7A 3CMAN 4ZYEA 3VWBA 4KI4A 1SMYF 2JM9A 5GAN5 4XM3A 5GAHJ 3ZSXA 1JLAA 2JZ2A 5SZTA 4L18B 1KYZA 2CT4A 2QSHX 1ITYA 3RQIA 2BGCA 2X48A 5FPDA 2Z33A 2XAQA 1TWFJ 2LC4A 2EYZA 1Y7XA 4Q5SF 2IC3A 2RHKA 4PNOA 4KIFA 3SEQA 4Y92A 1QPIA 2QTDA 3LWMA 4DHYA 1P8ZA 5EJCA 3HL8A 2MIOA 4FSSA 4RBOA 3V7SA 5KHDA 5FLXE 1OYWA 4M7DB 3VEXA 4BC5A 1MU2A 1IBMK 4HTLA 4OB1B 1UB9A 2LY1A 4CHZA 1KZHA 1KCFA 1YVUA 3WVDB 2CGLA 1FYKA 1WXUA 4O8UA 1TKTA 2V9VA 3NMUA 1RBRA 3QPHA 3C2GA 4LG3A 3LDQA 4JJCA 3DU6A 2IVPA 4J9EA 4G7HF 2V51B 5FRNA 1WSEA 1XI1A 3CCVN 2LBFA 3O08A 3FBNB 3WUHA 2DE0X 1FSHA 1X75C 4XTUA 2QQAA 3ZX0A 2Q1NA 4OU0A 5E18F 3VS6A 1PUFB 1SHGA 4D8DA 4FJGA 2QWMA 1WJQA 4GVEA 3P8BB 3U9DA 1RC9A 2LJ1A 5BPDA 2A6AA 1VSMA 1K61A 4WK8F 5F27A 2LX7A 5M3MJ 1ON2A 4CEQA 4B3TK 1LFUP 4Z8AA 5KGXA 3MN6A 1X2NA 4F9OA 3FLCO 3CCSN 1IV8A 2M1HA 3QIOA 2XHBA 2YHBA 2FB7A 3DLAA 2QEXA 3AVFA 4E0DA 4DQSA 1U47A 1QKWA 4CXFA 2ID3A 3LH0A 1IZ6A 4NXMK 5JS2A 4GCVA 1TTYA 4JKFA 1WEFA 1LVKA 1VRUA 2DX1A 3KP2A 1NGGA 2CJJA 1DT9A 1ZYQA 5KK1A 1RT7A 3CCLI 1P90A 1JHFA 2V26A 2XAFA 4KNYA 1W0HA 2DK8A 3ENOA 4I02A 3ZEUA 4AVZA 3CCMA 2XY8A 3RMAA 3V7CA 1R77A 5CK9A 2H3GX 4A5MA 4BVPA 1HNWK 2JLEA 4JX4A 2VKHA 3JCMV 2VQEK 4NNJA 1S1WA 2DYIA 2JN0A 4NQWA 3JB9H 3GFJA 4LDVA 4IL6C 4KV8A 4KIBA 5FPNA 3HM5A 2LT1A 2G8WA 3AO4A 4IHYA 1R0CB 3ZX3A 5GANe 3ABMH 2KQ2A 2B5JA 3GTLJ 1K7AA 3MPUB 3ZBDA 1UHWA 4PIIA 5IXFA 4WWCA 3VS5A 1Z26A 4C0GA 3JAME 2XAGA 2VWJA 2DL5A 1FWZA 1N3AA 2ME6A 3LDLA 3H8ZA 3FZHA 2GELA 2GOMA 1HNIA 2COBA 1Q82U 4LC9B 3CWAA 2DA2A 2EINH 4NHJA 4BHCA 1IXDA 2DA5A 1DTQA 2OANA 1Y6IA 4HF0A 3NARA 5DM6F 1EWQA 1OX9A 4MFBA 3SMSA 2JA7J 4FIBA 2KZMA 3K70D 3SZ2A 2LRDA 3LA3A 3G4SN 5GAEJ 1V3FA 3LYIA 1USSA 4J9FA 1ITGA 4CEFA 4N56A 2FO0A 4FJXA 3OYBA 1NJIR 4DR5K 3BF3A 5JLHA 3I59B 1RI9A 4U87A 4BE0A 2EQMA 1R1UA 3RWUA 3N4MA 5FKMA 1YI2I 3C18A 3PVLA 3PIPA 1RDWX 1YOVB 1ZTRA 4JKGB 3WHBA 4ZDOA 3D2EB 3SI6A 5FJ8J 4FZXC 4MDWA 1NGIA 1K6OA 1XTDA 1QCOA 4CZHA 3T69A 2Y4XA 1VQ5A 4CEAA 2BY0A 2LTOA 3CD6T 3CYMA 3CD6I 2NUPA 4OGCA 4NCGA 1YCSB 3VYTB 4M75D 1CGPA 4HSBA 4ISEA 3NGPA 3G1MA 2DKGA 3A01A 4MMKA 5FLXK 3EGXA 1J09A 2EAYA 3LPTA 1RABB 1M3QA 3K69A 3K5NA 2O6GE 3ZQGA 1XTAA 4OIRF 3E2UA 4PQUA 4W5NA 3D5LA 4M3FA 3MEAA 3TW6A 2JXBA 3J80O 1VQ6N 1YITA 3L3VA 3L2ZA 1NGAA 3TCJA 3C2BA 1XSDA 4JLIA 4KUDK 3EYYA 4O6JA 5GANh 2Y1IA 4GMJB 4IEIA 2NUTB 3ZN0A 3HSBA 1NWKA 2DU9A 2PBIA 5EG0A 1OV3A 4DYQA 4KISA 1TWAJ 2MC4A 1GV5A 2RO0A 3CC4A 1E2XA 3UE5A 1ZHFA 2WONA 2HNYA 2JTEA 1W5SA 1YHQA 4D7NA 4FLUA 4J9DA 4ITVA 4C92A 3D0PA 3LH5A 3BEXA 4FZZA 2JOYA 3CC7I 3V9XA 2QQBA 1O3QA 2ZF5O 2R3SA 5AQYA 2ED0A 1YFHA 4LK1F 4EVIA 2WA0A 2AHJB 4OPHA 3U8XA 4IG0A 1ONVA 4JHDA 1R0AA 5F0XA 4BBRJ 3GFIA 1O13A 2ZFUA 1BI1A 1VSJA 1RAGB 2EFIA 1MBHA 3OIPA 2R0QC 3NPFA 4CH7A 3EG2A 2PN6A 3HOVJ 2YJFA 4LD6A 3V1OA 5DPKA 2QTVA 3JREA 2R7XA 1QBJA 2DXCA 4DQIA 5HCKA 1AWOA 4JLHA 3FXOA 3TEEA 4DR4K 4BQAA 4NLBA 4DSIA 1UA1A 3E5XA 3EETA 4LB6B 4H5NA 4DV4K 1LNXA 1PHTA 4Y28E 1DPUA 5DM7R 1SL2A 3H9NA 4F14A 1VQMI 1TQPA 2VXZA 1HNVA 2NRXA 3DBLB 3G71T 2JSCA 4ELVA 4EMGA 2A6EF 1NJXA 4FWQA 2G8FA 3G71I 1LW0A 1NKCA 2QGUA 2X6NA 4E7KA 2NRVA 2D1HA 1OCZH 2ENMA 4M78A 2KZGA 2CP2A 1MDMB 2YU9J 3K4BA 1TNSA 2A3ZA 2CH4A 1OPKA 1G2BA 4B8CA 3AAQA 3VEZA 4MEXF 2DTOA 3L0QA 1GLAG 1VAZA 3QYFA 4CGJA 5BQTA 2HQRA 1C0UA 3FHNA 5HDGA 2RN2A 1NEGA 4RCHA 2JJ7A 5AZJA 4IEJA 1I0CA 1PP7U 3L7WA 2O4GA 2VKDA 1XQHA 3AL0B 1MKMA 4YOUA 3LANA 4OKKA 4Q5VA 3JAMK 4GY2B 1KQSS 1FY7A 2P7CB 3TGNA 3PIOA 4AIHA 4BRNA 2JWLA 1HQCA 1N77A 4CF2A 5AQLA 4JDSA 1TH7A 3G6EA 3F3XA 2DK3A 4RM3A 4BC4A 3KLOA 2F5EA 1QVGS 1KVBA 1BW6A 4GGGA 4ZHRA 2ZKZA 4R79A 2V6EA 4FW1A 4CJWA 4G8XA 4M3DA 4HT9A 4AYBA 1M8MA 4AHCA 1FSEA 2F5CA 3DPTA 1W2BM 2RDPA 1E3PA 5KCMA 1WHHA 2O3FA 3HSTB 4BL0B 4IWVA 2DZCA 1TS9A 5J4YA 3CC2Q 5CCAA 3KCCA 1X9WA 1JLEA 1ZC6A 1VQNN 3TP0A 5CHIA 4RTWA 1T44A 2NOJB 2QGGA 2VQLA 3GXOA 3OYLA 4J9CA 4I0AA 2JUFA 4LH5A 3TU4K 4K43A 1RAIB 5LJ3j 1ZBLA 1FKPA 3CCET 4EMSA 3RZDJ 2A3SA 1U2WA 3NWTA 3VS0A 5K1YA 4UUSA 2XRLA 2K85A 3CMAQ 3QBXA 4BDYA 4A54A 3PV8A 1OULA 1LUJB 1FX7A 1OU9A 2M8GX 2D0OA 2RGVA 3FWEA 1YQRA 3RTVA 1U9OA 3OW2A 2M9HA 3QU6A 4AIDA 3M0QA 4WQ4A 4B3MK 4H0VB 1RKWA 1WSHA 1S3JA 2PQ8A 2CQKA 4J19A 1W36D 2LR8A 2DF6A 4CJVA 3A8MB 2M9UA 4MTEA 2UUZA 2VKVA 2JPBA 3QWLA 1YO5C 1WXTA 4B43A 2HDCA 3BLYA 2KW4A 4GVMA 3R6MA 3O4NA 2E1NA 1P7JA 2HBMA 4A59A 4OWRB 1S1UA 2HYJA 1X1BA 2E60A 2XHCA 2O88A 3QEXA 4YPRA 4JLGA 2UXCK 2M0CA 5FFXA 3WT0A 2NS8A 5B8HA 3VGMA 4RW7A 3ZETB 3QU3A 3ATUA 3RDIA 2EZIA 1WUAA 3A5ZB 3CMEA 5EY4A 1D0ZA 4C2MJ 2VQFK 3RKXA 2HSPA 5GMKi 4DR1K 1J5EK 2HEOA 4DF4A 1RRQA 3O8MA 3CCVQ 2M4GA 1IV0A 3JTGA 2RVCA 3TL4X 5ICFA 1UOCA 3ZGKA 4OMQA 3OYDA 3J7AO 2M7AA 3KXTA 1MUZA 3SDGA 2OTJA 1XMOK 3L4QA 2OCEA 4M3GA 4FK4A 1WZ2A 4OB2B 3ZSQA 3S1NJ 2L7KA 4FOEA 1Z6TA 3CCSQ 1KC8O 4CZLA 1KAYA 4XIUA 4CJ3A 2RA2A 3IRXA 5A2QE 3CCJT 4FWSA 3CCJI 4P5OA 2DTIA 4DV7K 3Q5FA 3DLEA 1YIJN 2PAVA 2R7TA 1CKAA 2KXDA 5DLQE 5M5WJ 1M9SA 3I56Q 2W03A 4HV5A 2RQWA 2ZPBB 3TSZA 1WSJA 4XRSG 2VBWA 1ZRCA 3VS1A 3HSEA 3V9UA 1JT6A 1EETA 5DD8A 3BDDA 4YDUC 3MECA 3LWFA 4EP5A 2QWOA 2P7VB 3AVCA 3CI5A 4Q5WA 2EQIA 3B73A 5K7FA 5ILUA 2QYOA 4EHTA 1H89C 2KDOA 3WE2A 3ZQLA 2PLYA 2YV0X 4N47A 3BR2A 1WDXA 5AR0A 4BWMA 3CPWS 5LJWA 3HHGA 3TU5A 2PYLA 4MHGA 3PQKA 4B9QA 1I07A 2MYSA 2MLGA 3CDLA 1MMGA 2ZMEB 2FBXA 1EFNA 3T7ZA 3AG4H 4I76A 2NOHA 3ZSOA 2EKHA 5EVZA 5FLXZ 5HLIA 3FM3A 4ON0A 2V7FA 1OPLA 3O6WA 1X6OA 2CP0A 2COWA 4M4ZA 4MZMA 2CG4A 3SQ0A 5B3SH 3AARA 2KI7A 2NWMA 3J7YP 4F2SA 2EV0A 3KNTA 2ZNZA 4K2EA 3HSCA 2P4WA 3X28B 4EDUA 1BQMA 2DL4A 2P1JA 2OQGA 4M7DA 3RKWA 3PX6A 3HTSB 4DGWB 3JCMW 4L9JA 1T2KA 4KTZA 5CVVA 4ANJA 3KWIA 4PJLA 4N9HA 1IJJA 3CBOA 3EHQA 3VQ8A 4Y15A 3G4SQ 2G8KA 1RETA 1UJYA 5F1XA 1U4BA 4B9UA 4NUBA 4FK0A 3AG3H 2F5TX 3E1SA 1HKGA 4ID1A 5AQNA 1JXBA 4NYFA 3O2PE 2JWKA 1Y0UA 5DCFA 1OCRH 4IFVA 2XU8A 1JBMA 1ZSZB 1UGSB 5CPRB 3S2DJ 4Y0WA 4P55A 4EFHA 1K4US 2ZXJA 4DFJA 4CJLA 4JKDA 3E7LA 4XTXA 1FXXA 4DQQA 3HYIA 2EJ9A 5C4JJ 1PU6A 2VGNA 4RKUE 4AQYK 3TTCA 2KGTA 1UG0A 3HPHA 2JT4A 1WFXA 2ASMA 2DA1A 4LITA 4ILJA 2RHUA 5GAMg 5BNGA 4GW6A 3AO2A 4ENJA 2BUPA 5JFRA 1OR7C 3H1CA 4L3QA 2V1QA 1LQ1A 2V52B 4B3AA 4KH1B 4RB0A 2CH4W 3FKJA 4ILHA 2YCHA 1IW7F 3A4CA 5C2FA 2LKSA 3VYGA 3EFRA 3JCMg 1KC8U 5GAOr 4PUSA 2ZGZA 1F5TA 2ZGYA 4Y13A 3EPZA 3JB9F 2GEMA 1BR1A 4Y17A 4XRSA 1WLPB 3KP5A 2RPIA 1A31A 3ZSZA 4CEBA 2K2MA 2R5ZA 4JUVA 1HXDA 3VETA 4S04A 2FRWA 1I5OB 5GTIC 3BT9A 3JAMZ 3A8LB 3U9ZA 2BKDN 2BANA 1KSWA 4XLCA 2HF3A 3C0CA 3URGA 3MCZA 2DMTA 3FZKA 5AQTA 3L8BA 1GXIE 2PYJA 2DI3A 3H45C 4A0XA 3OYKA 1QA6A 3QNNA 5IT9E 1IO6A 4BGBA 2HBJA 2KT1A 2O8FA 3GZ6A 3OOPA 2FU4A 1NNEA 2YHXA 4BD3A 3PNYA 5KI6A 4H0YB 1D3BA 3ULRB 4KTWA 4LD0A 2DVJA 4UY8I 2V9KA 1B4AA 4HTUA 2D45A 4OKEA 2VJ5A 1ZQ3P 2W57A 5TISC 1DU0A 3H0IA 3BCAA 3I5SA 2F2EA 1ATNA 1NMNA 4M75B 3G3ZA 1AEYA 3HRTA 3C4SA 5LJ3e 4E7ZA 1H1VA 1IKWA 3VEVA 5FU6B 4HOBA 1VYUA 3HXLA 2EFNA 1WI3A 3AG1H 2WSEE 5GAEP 4O5VA 3KP7A 4IF4A 1R5ID 3LFKA 1ZAOA 1C1AA 1XHXA 5LEKA 4ID5A 3BR0A 1NKUA 2EYWA 4M3EA 2UUAK 4FJ8A 3D2EA 4QKUA 4N9IA 3F9KA 4BACA 3MX5A 1TUGB 4PKIA 1JQQA 2L01A 1LAVA 1J3TA 4BRFA 3CETA 2YWWA 2LT4A 1OMIA 4XLAA 1U78A 4UC4A 3NVKA 5BRDA 3OV8A 2KK4A 2QDYB 3QP5A 1WPYA 4UQGA 4N0BA 1NK4A 1EO1A 3EUHC 3M54A 4ZYGA 3K0SA 2D1KA 4ATOA 4EM1A 1VQ4N 2QKMB 3JSCA 2YRVA 3CCEA 4NO7A 4IRIA 3E66A 1Y57A 4M77F 1QCNA 4EJUA 4A4HA 1NK3P 3CPFA 4J83A 3SDBA 1KC8R 3VPRA 1Y1WJ 2KISA 1MH4A 3W3CA 4F7UG 3TEDA 3ELKA 2WC9A 1SZ2A 3LSHA 4J9BA 4EGYA 2DTZA 4FO0A 1ZGWA 3QWYA 1VQNQ 1UELB 4BHBA 1H3HA 2FG0A 3I0RA 3JCMd 3O8VA 4CFCA 2NUTA 1LFBA 5LJVA 3EAEA 1WZOA 1BR2A 2H8RA 4R8HA 2YPRA 3OYYA 3DQVC 3MEVA 1QWFA 3QESA 3OYFA 5J1RA 2CSOA 2C0IA 3DXKB 2P0PA 5GMKl 1T6DA 5KH6A 3AKZA 1BN5A 2G7UA 2N8GA 4LB5A 3HOSA 4CESA 1QHTA 2WB1N 4BY6C 1XNRK 1OFCX 1IDYA 3ZX2A 4A0YA 5LJ3h 1VQ8N 3FZLA 3FXLA 4AIJA 2KZVA 5L3CA 4L59A 1A5VA 4RG8A 1M3CA 1MGQA 2A6HF 4K8XA 4IQJA 1EF4A 3PY8A 3B6OA 3KKSA 4BI4A 3SAHA 1UB4A 4LIVA 3D2FA 2NUBA 2KZZA 1MH3A 4HAMA 1RKTA 3NTHA 1NGBA 1SV5A 4I99C 1WB9A 2HKXA 2A3LA 1B59A 3LWLA 1Y71A 2GX9A 2QTXA 5K7ZA 4K42A 4YOYA 3VYHB 4P9UA 3WEEA 2V4JC 3F8CA 1MDMA 4KT0E 2X1CA 5C15A 1JXEA 4AIAA 1K4TA 3RSEA 5CYQA 2PVGB 5DV5A 4AVPA 3X26B 4D1QA 5M1PA 1Y64A 3A5NC 1OH6A 3QPLA 4M73A 5IT9K 4RMOA 4AHTA 1KLNA 3RJPA 4AFQC 3I56I 3G73A 3N5NX 2DEQA 4B3RK 4J6WA 1N34K 3CWSA 2DLLA 2NVQJ 4QPOA 2RPNA 5FLVA 3JCMX 3K4NA 1YJNN 1FK9A 2HPMA 2E19A 3P5JA 2XUBA 1M1GA 3E19A 1TXQA 5DS9A 4IKFA 2ASPA 1K4SA 4JI1K 3E6BA 1B34B 1HJOA 2IA0A 1YIJQ 1IN4A 3FXMA 2M1BA 5CVRA 5AQUA 2L0KA 1W7AA 2W1OA 2WY7Q 2BTFA 5HLTA 1RR8C 4M7AA 3LP2A 3WTYC 4C3JJ 2A36A 5CJ9A 1U5SA 5J1EA 3PLAA 3OMYA 1WJEA 3MEXA 4KKOA 1RT1A 2QQRA 1JI8A 3S6IA 3KVGA 2VBYA 4KGZB 3OIOA 3DOLA 2QASA 1ETOA 1FOWA 2YNGA 4IIOA 3K9JA 2MCNA 5EU7A 1K9MC 2E7XA 2EZLA 1ABOA 2K86A 5LY3A 2TCTA 1BGXT 5IP6A 4M77C 5EC7A 2LJ0A 3NE6A 4KHQA 4M41A 4EW0A 1W7PD 2R7SA 3EQLF 1HLVA 1Z67A 4M74A 2ETHA 5KRTA 1YIOA 2QVOA 3H1VX 1MNDA 3RTRA 1UJ0A 4IOCF 1VQLT 1SL1A 4OOIA 3HT3A 3GOIA 4E7LA 1EQYA 1VRTA 2AP1A 3H3VK 3PE0A 3IH2A 1MIJA 2IPQX 5KCOA 4CJ5A 5J1UA 2D2WA 5IHIA 4BRMA 4RB1A 4BXUA 1JXSA 1OQKA 2L9VA 1MMSA 3MP8A 1POGA 4B1VA 4L9VA 4GKJK 1U45A 3VS3A 3LOCA 3BJAA 1ZRDA 2V7YA 3CPWA 4KUIA 3MKWB 4C3HJ 2D5RA 3GZNB 4IOCL 1T56A 1PWTA 3CM5A 2O7OA 1WJCA 1LDJA 2NRWA 5J26A 1A04A 4PSXA 4BE2A 2VOPA 3ZOBA 4A4EA 2D8JA 1EH8A 3V1RA 1B07A 3Q7BA 4HEA2 4WYBA 4EMKC 2E41A 3S2HJ 2HQAA 4NCBA 1B8IB 2VIXA 5AQHA 3HVRA 2OC6A 1MJBA 5FO5A 3RQ4A 4FYXB 4Y4RA 3JRFA 4E9HA 4UUTA 4JX6A 2DMPA 5A2QZ 1NM7A 1JJ6C 1TL8A 2HHWA 1IB8A 5GAN6 4PL8A 2JPSA 3A2KA 5GMKj 4AWXB 3M7GA 4WXHA 5JR3A 2OI3A 2OV7A 3PO2J 1SL0A 2WAFA 2O4XB 2LSNA 5CAIA 3UB5A 2E6LA 3ULDA 5HODA 1V54H 1L3SA 2JRMA 4G7OF 3U6FA 1GLCG 2DFFA 1D1BA 1LPLA 3VA3A 2ID6A 2JHJA 3RKYA 3FFIA 4RM2A 2EA2A 2YUOA 2L7MP 4BRLA 2A69F 5GAN2 1TV6A 1VF9A 4I0BA 4I6ZA 2D1VA 4UNOA 4C2TA 1X9SA 4AHVA 2YG9A 5KQ8A 2I2LA 2OYQA 4DR6K 4OMNA 4DMNA 4BVOA 1KG1A 3OW2M 2FUG2 5I21A 4M77E 3TREA 5HNHA 5IAYA 1R7JA 2LQKA 2JS0A 3QINA 2ZQBA 4JRPA 3M1FA 4OMMA 3DLMA 1JXOA 2O8BB 2O8CA 1QW1A 3ESWB 3M1CA 1MBEA 1GCQC 1YX3A 2E88A 1M90O 1JLCA 3NFCA 2W25A 1NK2P 3EL2A 5JLXA 3ENHA 4XEIA 2FBKA 4A0ZA 3DWLA 4NCAA 2KQWA 3GG4A 4FXDA 3O3FA 4K41A 3I35A 3O9RA 2QYZA 4E7HA 1N8RC 4CIEA 3CCUN 1N32K 4ENKA 2HNIA 2LJ3A 3IG1A 1RT6A 2DLPA 1Z05A 2R5MA 4O8KA 4DV1K 1KQ9A 3DB3A 1P9QC 1CZBA 5KCHA 4HLXA 3SUOA 1U2VA 2K4YA 9ANTA 2JHNA 1RI7A 2DJZA 3RMBA 4H0XB 3DTIA 3M6GA 2L4AA 2F4OB 1MUNA 3C65A 3I4PA 4RG2A 4XH5A 2X6SA 1NKBA 1UHFA 4K0KK 1N6QA 5D8LB 5KRSA 1X3NA 1VQ9T 2AS5F 1BU6O 4OLAA 3L2VA 1HSQA 2FF3B 5D5VB 2CREA 3CJ1A 4U0VA 3BDLA 4LSNA 1ZSZA 4KH5A 4JEPA 4FM0A 4JI4K 3PT9A 4EZ6A 2L8DA 3OA6A 3M8SA 2L3DA 1Q7YU 2DT7B 4ISFA 1P92A 1OYIA 1WQWA 5KPZA 4DLEA 4M3YA 5F2RA 4DZJA 3I0WA 3CCQT 2EWSA 1S72N 4EJWA 3JRDA 1PSEA 3M4GA 1U5TC 1IG9A 4CK3A 2WAEA 1RADB 1VQ4Q 4L6V5 3WODF 2O8DB 5JVGL 2OPRA 3FHGA 2OTLI 2W6LA 1VQKQ 5FKKA 1OCCH 2PZ1A 2L3PA 2Z1DA 3OSVA 4YOVA 3TP3A 5B66C 1TOVA 5AQPA 2ABKA 1B6AA 1NGEA 4CCLA 2V9PA 2K3BA 3O9QA 1BOBA 4ESJA 2P9IB 3QEIA 4BREA 5AN4A 3IKMA 1PSFA 4RTTA 2HS5A 1JJ2A 5ECAA 3HEFA 3AY9A 2HL5C 2L4MA 1O57A 1AOJA 1FYLA 4IFEA 4CGGA 1ENHA 1IRZA 1SUQA 5FD5A 2JG6A 1IHWA 1W5TA 4QVZA 1LB2A 1HSTA 3F8BA 1MDUB 3L2QA 4PJOF 1X9MA 1R6RA 1WJAA 3GL1A 5IT9Z 2JT1A 1ORPA 1IHVA 2NRAC 3WGGA 3ZRGA 2P6TA 3RI4A 4Y91A 2I7PA 3R2XC 4N76A 2P0KA 5GPAA 1JGSA 2XO7A 1QVFS 1UZCA 4BG8A 3TARA 4HCZA 3UT1A 4KA4A 3AHUA 5HKCA 2HI3A 3GNFB 2NNNA 2CV1A 1VQ8Q 1YG2A 3VUBA 5TKYA 4GV3A 1NLVA 1XS9A 4XTWA 2Q2EB 3QJ6A 3MAQA 4C0DB 1D8JA 4CD1A 1I1SA 1IH7A 1ZBUA 4G1QA 3TAEA 3CXCS 3VA0A 1SPKA 3HTVA 2V1RA 2IIRA 3CCRT 4HCBA 3CCRI 3CESA 3SJJA 1NM1A 2ELJA 1BK2A 4OPJA 4JK7A 4M75A 4HDVA 1WFWA 1RFQA 3O5BA 1FTTA 4JKAA 2D0PA 2OUMA 1BCOA 4U7BA 2K9GA 1VRLA 4UB8C 1ASUA 3FMRA 4WXDA 3CUQA 1SS6A 4RAFA 3LSRA 4C8QF 2UYTA 4LFUA 5KYXB 3JSPA 4BR7A 2LD5A 3G7ZA 1M2VA 3DLGA 2HDWA 1VQOA 4H8KA 3J81K 3LSKA 2LF7A 1N27A 1Q7YR 1SKRA 4ZTFA 2BE7D 4JK1X 5GADP 1JU5C 1V76A 3EG0A 1ZA1B 4RTFD 2DQRA 5L3EA 2KDSA 2MH9A 1YYVA 2GQIA 4BR0A 3T1HK 3O9SA 3I0SA 1M3HA 2K2VA 3J8AA 1AU7A 1FN7A 4BU2A 3ZCMA 1RTJA 2YRCA 5KYWB 1OEBA 3OQ5A 2RN8A 1W70A 1PG5B 3DXJF 1IV6A 3QDKA 3VQAA 5HVQC 4BE1A 4FQGA 1ACMB 1YJNQ 4RDUA 3V7RA 3IWFA 2Y0SN 3BJOA 4BRDA 2VVKA 2CMPA 2LMDA 5AONA 4BRQA 2QWWA 2F8SA 4GYGA 1Z9QA 2CP6A 5CKFA 3K5MA 1KQ0A 2E3HA 3QFPA 3K2ZA 4ZZDA 3FF5A 3ENBA 1HKCA 3DLLL 2PG4A 2R7WA 1VQLA 1HCRA 1ZR2A 4NC8A 1VZ0A 3CCLN 3DRRA 2DPPB 3I8BA 1LOJA 2K79A 2ZE2A 3SQ1A 1T3VA 5J1YA 4FWRA 4QQGA 1REPC 3VS4A 2H8WA 1VQPA 4J2DA 1GV2A 1R5GA 1MJ9A 3D5SC 2HQXA 2CUFA 4KT6A 2E64A 2BBYA 1BDGA 4YFKF 4ENNA 3PNTA 2DOAA 5AQMA 2DMUA 2RNGA 5E79C 1ESVA 4J5YA 1BIAA 3HRGA 2XKOC 2MAMA 2QBYB 3SWNC 4GKKK 1S1XA 1OX8A 1ATSA 1RACB 2P9NB 5JVTA 3M0RA 3CJ9A 1LW2A 3O8GA 3KJVA 3CQTA 4PJOC 3VPZA 1C6VA 2W0ZA 4OFAA 4Z02A 4C8KA 5C3EJ 2IS2A 2WY8Q 2QA4A 1HSJA 2LX9A 3Q1JA 2A5XA 4FWKA 1XGMA 3DPUA 3VF6A 2IGKA 2QK9A 2QW9A 3SUQA 3G25A 3TW7A 4C1NK 3GFLA 1U8BA 3F2KA 2Y1JA 1M27C 2KY9A 1M1FA 2K3YA 2COMA 2Z1GA 3CF5F 4LD9K 2I0NA 3ATVA 4A62A 3SUNA 3HOXJ 1SC7A 3BZKA 3E9GA 3ZQQA 2ROTA 4F92B 4N0AA 1JTXA 2CQNA 1GRIA 5M1FA 5E1XA 4IHSA 1PC0A 1A35A 1LWFA 1YI2N 3H36A 4KT5C 3Q0VA 4PLIA 3GEZA 1JKOC 2OPPA 3ERMA 4X6AJ 2V79A 3P8DA 2XSDC 2CGKA 3TTFA 1Z21A 4XRFA 2CP7A 3ZL7C 3HG9A 4R55A 1RCHA 4QIWN 4ICLA 3CD6N 2BYVE 2K4BA 2R7UA 1IN5A 1OKRA 1KQSP 4JD2A 2YKNA 3H3NO 2KSSA 3FLGA 4C8QC 4RW6A 3JYTA 1W7PB 1YTYA 4DOVA 2J6KA 4FJ5A 1QVGP 3AAPA 3EG3A 1VI0A 1NLPC 1B34A 2QF7A 1AT1B 4J8OA 1BYMA 3PFIA 3VQQA 1LVAA 4JJDA 3W2VA 3KWGA 2QK0A 5GMKh 3MXMA 2ZCWA 4RTUA 2RMOA 1NK9A 2EQKA 1Y96A 3Q7CA 3TI0A 2VONA 4FSVA 3CW7A 1RDUA