3OYFA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti l-870,810
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 109
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyfA03
1J9AA 2Z1GA 4C8MA 4AHTA 4CEOA 3PX4A 1JLBA 1TAQA 1LAWA 3HVTA 5KCHA 3LAKA 3I0RA 2A1SA 3AV9A 3OS0A 1RNHA 3VQBA 1IKXA 1KVAA 3KIOA 4KTWA 4CJVA 5HRPA 3SNNA 4IUUA 4DLGA 2GF7A 2KQ2A 3LP1A 4OPJA 4B9SA 4E0DA 4KB0A 1WJQA 3BDLA 3LYIA 4DTOA 2RI5A 1KRPA 1IKYA 3RR7A 3P8HA 1T8EA 3AO5A 3UIQA 3NF6A 1JLGA 3SQ2A 5I42A 1IKWA 2KZMA 3HPHA 4NS5A 2EFIA 4QQ6A 1X1PA 3OVNA 3P8DA 2IOCA 3VA3A 4EZ9A 3AA2A 2DTUA 4B08A 4FLTA 4FJXA 4DTSA 3RWUA 2K3YA 3HT3A 2P0KA 4E7IA 2EX3A 3DLEA 3TAMA 2OA8A 5CYMA 2YNGA 4DTMA 3HSTB 1RT7A 4NCBA 3H8ZA 3PX0A 4NZGA 4UC4A 3IG1A 1JLQA 3WNGA 5KI6A 3V1RA 3LZIA 3SUQA 4N4HA 4FLZA 1HYVA 4IG0A 4CIGA 1X9WA 2VWJA 4OKJA 4DSKA 4FZYA 4NCAA 4CEAA 4E7HA 2D9TA 2VG5A 3QEXA 5C0MA 4M3WA 1SSFA 2IS3A 4DSIA 4O4GA 3DMJA 4BE0A 2W42A 4DU4A 3SCXA 3UWNA 2BIVA 3S3NA 3DLMA 1K6YA 4CEFA 1B92A 2O4XA 1XI1A 4KHUA 3ZSWA 4Z4IA 4R5PA 3QIOA 3O3GA 4UQGA 3OYNA 4M3XA 3MXMA 4PLLA 1A5WA 2RJCA 3LALA 3V9ZA 2LRQA 3UT1A 3SQ1A 3L2QA 4CEQA 2DFHA 4DSLA 3L2UA 2DIQA 2BKDN 1BIZA 1Q8IA 2OPSA 1RTJA 3I8DA 4M3TA 2LDMA 1LW0A 3OS2A 2MWPA 4A4EA 4AHCA 4DQIA 4FU6A 4XIUA 2DY4A 5IN1A 1LWCA 3TAPA 2QKKA 1BIUA 2BDPA 2OYQA 4ZTJA 3OYBA 1C0UA 1GOBA 1W9HA 1NOYA 3BGRA 4ELUA 4BD3A 5HRRA 2M16A 1SV5A 1KVCA 3DB4A 4I2QA 4CK3A 5KRSA 3ZSOA 4PY5A 1OI1A 1BHLA 3IRXA 4ID1A 5K14A 4E7JA 3VQDA 4CHQA 2Y1IA 3OYFA 2HHQA 3LX7A 4DWIA 3DLHA 2LCCA 4FJ7A 3QESA 2RKIA 4QW2A 4IBNA 3LDSA 4FJLA 1WGSA 3META 1S6QA 2ZQBA 4B8AB 5D6XA 1N6QA 1WSIA 4E7KA 2X74A 1N5YA 3NTIA 4QCLA 2G3RA 1KTQA 3FEOA 3ASMA 2L89A 1RDBA 4CHZA 3LZJA 1RTDA 1A5XA 4B9NA 4N4IA 4N4GA 3U6FA 1UA1A 4BWJA 1JXEA 5J2QA 1ASUA 4Z4HA 1YTUA 2HNDA 4YFUA 2HW3A 3V9SA 2HQEA 3AVFA 1S1WA 2BANA 2X6NA 4LY7A 4JS5A 3D0PA 1KLNA 4I2PA 3IAYA 1UWBA 1OZ3A 4OVAA 2YRVA 1JLEA 4RG8A 5HLFA 3NH2A 4EP4A 1XHXA 2VWKA 3AVKA 5KTQA 2G8WA 1S9EA 4Y1DA 4FK0A 5C25A 3C4SA 1TK0A 1HYSA 4DQPA 3PO5A 2VG7A 3MXIA 2RJDA 2QK9A 2KZZA 5C24A 2XK0A 3NH0A 1HQUA 3FLGA 2NLUA 4CHPA 4AILC 1SKWA 3SPYA 1U47A 1S1VA 4CF2A 1VSJA 4B8CA 2M0OA 2YNIA 1Z25A 2G8VA 4Z4EA 3V9UA 1TGOA 4AHVA 2OPPA 5FRMA 1MHNA 1VSFA 2P51A 4Z02A 3LANA 3PUFA 1C1BA 2XO7A 2KW4A 1H3ZA 5KH6A 1Y97A 4CGJA 1DTTA 4AH9A 3V4IA 4E7LA 3HP9A 4F4KA 4OLAA 3P1GA 1NKEA 3OYHA 2XY7A 3LWLA 2KTQA 4YNQA 1D5AA 4CF8A 2EKOA 1R0AA 2ATQA 1HMVA 1JLFA 3K58A 1U48A 3M8PA 2RHZA 1I39A 4IUTA 4DFJA 1TKDA 2O4GA 4BDPA 1TL1A 4IFYA 5J2PA 4II1A 5CY4A 4Z0UA 1X9MA 2RI2A 4HCCA 4RG2A 2X6SA 3NE6A 4W5RA 2EQKA 3O3FA 4QOZB 4KFBA 4KRFA 3HL8A 4OGEA 2B4JA 3NCIA 3L42A 2RJFA 3C6TA 3QO9A 3AO4A 3RRHA 3SUPA 3MP8A 1HJRA 1BI4B 4LSNA 4KB1A 2F8SA 3AVGA 3HO1A 1D9DA 3WNFA 3QIIA 1BGXT 4K8ZA 3CEYA 3OYCA 3FDRA 3DM2A 3K2PA 1CXUA 3DB3A 3DOLA 3KLEA 1Q9XA 1RBVA 4DQRA 3RR8A 3AO1A 3HK2A 3FC3A 3RMCA 2PY5A 4CJWA 1VK0A 3NBPA 3PFSA 3QETA 3SPZA 3NAEA 1QQCA 4KHYA 4DMNA 5SWMA 1QTMA 4BDZA 2WOMA 4Z4CA 4DFMA 1BI4A 3M8QA 1ZBFA 3AO2A 1C0MA 1WJSA 4B9UA 3JSMA 1ZBIA 1O1WA 4C8LA 2R7YA 1RBRA 3OYAA 1RTIA 3DLRA 1OYXA 3OJUA 4ELTA 3T19A 4CJLA 5J2NA 3V9XA 1WAJA 3VQ7A 4M3RA 3WNHA 3AA3A 3LP2A 4IDKA 3U3GA 4CGFA 3SV4A 1UA0A 4FYDA 2ZE2A 1EKEA 3HPGA 4DU3A 3Q1JA 1HPZA 1Z26A 4QQDA 3PNWC 3QLHA 3C95A 3G10A 2HMIA 1SL2A 5FROA 2RHXA 3OMCA 2A1RA 1S1XA 1IH7A 2ZD1A 5KCOA 5T7BA 2FC0A 3NNQA 3DRPA 4CJ4A 4KTZA 1IKVA 3M8RA 3V9WA 4DFPA 4FLUA 3SUOA 3PMIA 4QQGA 3GOXA 3TI0A 3QJ6A 1RT4A 4BE2A 1RILA 3OYIA 2YNHA 4NCGA 3C94A 4FJ9A 1C1AA 4CJPA 3DLKA 1UOCA 3OYKA 4MFBA 2DAQA 3MEWA 3ZSQA 3VQ4A 4DQQA 3V1QA 3V6DA 1Q9YA 3OJSA 3KLGA 1T05A 1BCOA 1EP4A 4FK4A 1RT3A 3NF9A 3KLIA 3T3FA 1WJRA 4RW8A 4C8KA 3LGLA 1CZBA 4LH4A 1BQMA 4CGGA 2D0AA 4CESA 4ZTFA 3AA4A 1L5UA 4FJNA 4CF0A 3KK3A 1J53A 1EX4A 1L3VA 1GOCA 2HHUA 1KHCA 4A4HA 3HYFA 4KKOA 4TSXA 3NF7A 4FM0A 3K59A 2CKKA 3AVAA 3K5NA 4DTRA 3DLBA 4FJGA 1LWFA 4CJ5A 1ASVA 4CEBA 3OB9A 1L3TA 2E6NA 2OPQA 2WACA 2HVIA 3L2WA 4J2BA 4CIEA 4PQUA 3H6ZA 2EQMA 2XHBA 4RW4A 1LV5A 2L8DA 3E9FA 3O8VA 2MWOA 1A5VA 5FDLA 3VQEA 3QNNA 1HYZA 1NOZA 1U4BA 1TVRA 3ME9A 2B5JA 1JLCA 4N56A 1J54A 3IS9A 3K5LA 2JLEA 1RDDA 3NHGA 2ETJA 3TR8A 4CCHA 3NTHA 4B9VA 2X4YA 2F96A 1XNIA 3ZSZA 5EU7A 1JKHA 4JLHA 3AVJA 4CFAA 2K3XA 3LGFA 1WSGA 2LSNA 4DTUA 1NK0A 4DF4A 3S9HA 1L3SA 2B6AA 3C6UA 3P83D 4A4FA 3ULDA 5FRNA 4KREA 4CJFA 1ZYQA 3KJVA 4DF8A 4F8RA 1JL1A 4CJTA 2FBXA 4HUFA 2R5AA 2GUIA 4HVJA 3SUNA 2ITGA 4Y1CA 4E19A 1F21A 1NKCA 2X35A 5KGWA 1NK4A 2G8IA 1WSFA 1QSYA 4FJ8A 5JS2A 5HROA 3L2VA 3NTKA 4LD0A 4CECA 4OGCA 4GW6A 3MO8A 1B9DA 4I7FA 3VQ5A 3SQ0A 3AA5X 4W5OA 1WLJA 3EYZA 3CQ8A 1TK8A 1TKZA 3KKSA 3S3MA 3L8BA 1D8YA 2G8KA 4B9LA 4IUQA 2HNZA 3ZT2A 1VSMA 1JXBA 1VRUA 4CF9A 4Z4FA 4FLWA 4M3YA 3NFAA 5JS1A 3F70A 3ZCMA 2Z1JA 3PO4A 1SKRA 2E6LA 2O4XB 4FJJA 4M3ZA 2OPRA 4JRQA 4PUOA 3LWMA 4FZXC 3CYMA 5D6YA 1SKSA 1VSIA 3M9QA 4RW6A 3VQQA 4DQSA 4N76A 4FLVA 1D9FA 1C1CA 1VSHA 4CJUA 3ZSRA 1IO2A 4CJEA 5DMRA 3HJFA 2L3RA 3CG7A 1ZBLA 4JS4A 3VN5A 2PYJA 1RTHA 3EY1A 1SL1A 4L8RB 3TAFA 3SD4A 1QS4A 2D5RA 4AHUA 5C42A 3T1AA 3MEUA 4IURA 3MAQA 4G1QA 3KLHA 3F73A 3CFRA 3L3UA 2M1HA 1T03A 1N27A 3ALYA 1JLAA 2E5QA 3S6WA 1U45A 2VG6A 3DLGA 2GBZA 4LH5A 3VQPA 1CXQA 2GV9A 3KUFA 1LAVA 1CZ9A 3DOKA 1NK5A 5CIUA 4KO0A 4IUPA 2HHVA 2EQUA 4RW7A 1KVBA 1RT1A 1TKXA 1I3AA 4IG3A 2OZSA 3ZSXA 1SL0A 1G5VA 3LP0A 1B9FA 1W0HA 2YHAA 4BE1A 2DIGA 3I0SA 4FLYA 3RMBA 1XHZA 4BACA 3B6PA 3SYZA 4I9QA 4QVZA 1VSKA 4AHRA 3CFPA 3ZEHA 4W5QA 4DS5A 2YV0X 3KD1E 3L3VA 3ZT1A 4HCZA 3PX6A 4FJMA 4PL6A 4OKEA 3OYGA 2JZ2A 4PLIA 4C5IA 4CRIA 5KGXA 4GMJB 4W5TA 1S5JA 3B6OA 4FLXA 4DTPA 3TAGA 4FJ5A 1RDCA 3NGYA 1G15A 3OYEA 1IG9A 2R5MA 3O4QA 4M41A 3KLFA 3PMTA 1UAXA 3AVCA 4CJKA 1NK6A 2QQSA 1RI0A 5HRNA 2Z1IA 4CEZA 1NKBA 1EXQA 1WSEA 4IFVA 5M9OA 2WONA 4CE9A 4KI4A 2Z1HA 1FKOA 1HNIA 5HP1A 4CHYA 4IKFA 1XWLA 3DRRA 4MQ3A 2HQXA 3OMGA 5D6WA 3A2FA 3NDKA 2X4XA 3ZT4A 4DLEA 3KTQA 2O4IA 1VRTA 4DTXA 3OYJA 2RF2A 4CJQA 2XY5A 3ITHA 1QSSA 1ASWA 4H8KA 4KHWA 4C5GA 4KPYA 4FL6A 3QINA 3SZ2A 1RT2A 4EDUA 1U04A 3MEEA 4FJKA 2BGGA 4E89A 4PA1A 1X9SA 1QE1A 1LW2A 3VQCA 1S1TA 3CM6A 3RMDA 5HRSA 2PYLA 4JRPA 1KCFA 3ISNC 4C8NA 3KK1A 2DFEA 4BDYA 4FW1A 2XY8A 2RPIA 1RBSA 3EZ5A 4E1NA 4K8XA 4M42A 1S1UA 3CM5A 3MEDA 3ZSYA 3QEPA 4Z4GA 4O44A 3OA6A 4B3OA 1GOAA 4OJRA 3S3OA 3QEVA 3THVA 4H4MA 3OYLA 3VA0A 3L2RA 3DI6A 4DSJA 4KAZA 2R57A 3TANA 1TK5A 5E41A 1ZBHA 2DFFA 2QXFA 1KSPA 3RRGA 2XDPA 4A4GA 2F5KA 2FBYA 4J2AA 2AJQA 4ID5A 3RTVA 2PZSA 1HQEA 1VSDA 2Q3SA 2X78A 3NGIA 5J26A 1ITGA 2RHIA 3FFIA 4O0JA 4CHOA 2RI3A 4RW9A 4IUVA 3QEIA 4C8OA 4E3SA 1RDAA 3HP6A 2PQWA 2P1JA 2GFAA 1NK8A 4HUGA 2RHUA 3OQ5A 4ICLA 3MXJA 4OKKA 3P5JA 4CK2A 1ZBUA 1LWEA 3SI6A 4HCBA 3MP1A 2IDOA 4C5EA 3OS1A 2IG0A 4F2RA 4FXDA 2RJEA 4O5BA 2HHXA 3SQ4A 4KV8A 1HRHA 4FZZA 2HHWA 1RBTA 4KHQA 2LTOA 3MEAA 3VQ9A 4FM2A 4BWMA 3AVNA 1L3UA 4Q0BA 4NYFA 4ZHRA 3G0ZA 4CJ3A 1BQNA 4CFCA 4FK2A 4C5HA 4ELVA 2YKNA 3LP3A 3MEVA 4O0IA 1YT3A 3PV8A 2IGIA 4KI6A 1RT5A 4FVMA 4DFKA 4B9XA 4LSLA 3M8SA 3HM9A 4Q5VA 4CF1A 2NUBA 3QEWA 2P5GA 3V1OA 2JTFA 5J1EA 3F9KA 4CGHA 4F2SA 3NF8A 2JGUA 4EP5A 2F8TA 1YVUA 3KKRA 1C0TA 2VYTA 2YHBA 3MP6A 3AVLA 4E1MA 4CHNA 5SZTA 4HHTA 3OY9A 3AO3A 2E6MA 2KFNA 1BL3A 3AVHA 4OPKA 3E9GA 2EQJA 3LH0A 1VSLA 2XRIA 3DRSA 4QAGA 1EETA 3NH1A 1TL3A 5KE2A 2GFUA 1RT6A 4W5NA 2D0CA 2LVMA 4I9LA 2X4WA 5CYQA 3VQ6A 4B9TA 4N41A 2Y1JA 2FBTA 1REVA 3QERA 3O3HA 3RMAA 3H08A 4DTJA 1KFSA 3K57A 1TV6A 3AVBA 1WAFA 4X34A 1S9GA 4KTQA 1YTAA 2I5JA 2YNFA 5HBMA 4KHNA 2HHTA 4OVLA 3PY8A 4CFBA 3K5MA 4FCYA 4FW2A 1NJYA 1JL2A 3QKJA 1S6PA 2P5OA 1KLMA 3TARA 4M3UA 1C6VA 1QHTA 1QSLA 4H4OA 5CZ1A 4GY5A 4N47A 2FBVA 1MU2A 3LPUA 1FKPA 4M45A 4CJSA 5C6SA 4CJRA 2XY6A 2G8FA 3BDPA 1WSHA 4CGDA 4DTNA 4F3TA 2HB5A 3QNOA 4J2EA 3SJJA 3KD5E 1NJZA 3O4NA 3ZSVA 4EZ6A 3TAEA 3OYMA 4Q5WA 1WSJA 2OZMA 3WNEA 3SV3A 4CEDA 2KFZA 3QIPA 3OYDA 2RN2A 4GVMA 4FJHA 1FK9A 4CEEA 3NGZA 3U3YA 1DLOA 5J39A 3V81A 1BCMA 2RHYA 5KRTA 3TAQA 2HHSA 2YKMA 4WE1A 3HPOA 3HVRA 1J5OA 1OZ2A 5I3UA 5CZ2A 1NK7A 1NJWA 4DU1A 1FXXA 1KFDA 2QQRA 5KE3A 3D45A 1XC9A 3ZT3A 4CK1A 5D3GA 2RO0A 3VQAA 3VQ8A 3K5OA 3JYTA 2BE2A 1U49A 2QKBA 1WNSA 1TAUA 4B9WA 3MECA 1NJXA 1WN7A 4CIFA 1HNVA 5DK5A 4B9MA 3MEGA 4DSFA 1RBUA 2G8UA 2IC3A 3QBYA 1BISA 2FHDA 3EAEA 2E4LA 2IAJA 3DYAA 3CFOA 1RCHA 3LAMA 4KHSA 3HXMA 4FM1A 3LLRA 4LD6A 4OLBA 2BUDA 3AVIA 2D0BA 3KK2A 4AHSA 4O55A 4CFDA 1SUQA 1VSEA 4N5SA 4HTUA 3TWHA 2G8HA 2R58A 3LPTA 4F3OA 2HVHA 3TABA 1CLQA 1DTQA 3AVMA 3E01A 4CGIA 4DSEA 4J2DA 4DS4A 1TKTA 2EHGA 4HUEA 3ZT0A 1T7PA 1NK9A 2B8AA 4DG1A 3ASKA 4NYNA 5J2MA 4PWDA 5IAYA 4L59A 4FJIA 4CERA 2HNYA
chains in the Genus database with same CATH superfamily
4RTXA 4M77C 3WEEA 1KYZA 4FWOA 1LAWA 4YIFA 4FLWA 3F72A 3X24B 3ZR8X 4K2EA 3H6EA 5GJVB 1VIEA 1T6CA 3M1CA 4N9IA 1T8EA 4H0VB 4E7SA 5BQTA 2CV1A 4LMYA 3OMYA 2KI7A 3QXEB 3K4CA 2HVQA 3O9UA 4HDUA 1GLBG 3WNGA 1SKUB 2L9NA 1SHGA 2X9HA 2QCOA 4FT4A 1GCPA 4DU4A 3CJQB 3UWNA 1TAUA 4C8QA 3HOZJ 4KT6A 3JAME 3PM1A 1B1BA 5GJWB 4PKGA 1YITN 3UT1A 1WFXA 1QVGS 1NBWA 1X19A 4CEQA 1MV3A 2E2OA 4ON0A 2CW8A 2DIQA 3O4WA 3F9MA 1U5SA 2NXNB 3IRRA 1D0YA 3BUZB 2AP1A 4FL9A 5IHKA 1RAEB 4Z6YA 1C0UA 2Z0WA 4RMNA 4BVOA 1SV5A 3GO5A 2NUTB 2PVOB 3DXJF 3OYFA 3EE9A 3CCVN 3HGGA 3TO7A 4V2GA 1ZH5A 4B48A 2DRKA 2P9NA 1F43A 4N4GA 1JKOC 5GANd 3S32A 4JKGA 3CCRT 2VWKA 4C92E 2STWA 4FK0A 3LCNA 5LBQA 2FU4A 3KK7A 1WJAA 3TQ7P 1V5GA 4S05A 1NPPA 2YRDA 4BQZA 5EG2A 1SF9A 5L3BA 3TU4K 1VSJA 2P5KA 1E3PA 2PQ8A 4ZDPA 4VUBA 3EN9A 3WGIA 2XVCA 2HKXA 3V4IA 3S14J 1B4AA 3BG3A 1OFCX 2C6YA 3OYHA 3EYYA 3KE2A 1GFDA 3OS5A 1P7IA 3PIOF 5EZHA 3O3FA 1WCMJ 2Q2EB 3U2RA 5E1ZB 3RRHA 3GTQJ 1Y56A 2NOHA 3A01A 1BGXT 1IB8A 2M45A 1QQOA 4YG2F 3F6VA 4RTZA 3VODA 1VQ9Q 4JK7A 5CK9A 3B8AX 1HU0A 3FXRA 3DLRA 4ATOA 5JMVA 3PNYA 4FYDA 1N75A 1EKEA 1YCSB 3ZQIA 2Y0SA 4XNFA 2CGJA 1DUXC 1WX6A 2FC0A 3DRPA 3TTFA 5KQ8A 2V26A 4K42A 2JT1A 4RB2C 1SAUA 4CJPA 1OCOH 3ZSQA 1M9SA 3F5TA 5J1RA 2W04A 2NOIA 4ZTFA 4UV8A 2JA7J 1VQLA 2XASA 4BQOA 2ME0A 4JKDA 1APLC 4WCEL 1K76A 3CDLA 4CIEA 1GVDA 3E9FA 4RS8A 2LZ6B 4EMKB 5LJ3e 1M2VB 1NOZA 3H0HA 3KX2A 2P9SB 3NTHA 3AAFA 2QXLA 4M6VA 1PU6A 4C2MJ 2I7NA 1IGUA 4HUFA 5A0DA 5K1YA 1K4SA 4BI3A 1A31A 1WNLA 2X3WD 3HBLA 5HLGA 4MTDA 3Q9SA 3BDUA 5AZIA 1YJWN 5J4YA 4IO9L 1MPGA 3ZCMA 1KQ8A 4JJCA 2R5ZA 3JCMb 3CC2N 4JRQA 1N5ZA 1ESVA 2CQ7A 3M9QA 4M7DG 2YSQA 2QZ8A 3ELKA 2KYBA 4FWQA 3DLLA 1NE8A 4LC9B 1FTZA 2MD0A 2FZKB 1LDKB 3KLNA 4GRIA 1ETOA 2VBZA 4KO0A 1LWYA 4FPAA 2DERA 4CI6A 3M9AA 2M87A 5E17F 2COWA 1G5VA 2DIGA 1ZREA 4BJTA 1K9MC 2ECBA 3L3VA 2JZ2A 4FLXA 3M1FA 4AIJA 4LOCA 2EYQA 3GW2A 2F1LA 2OTJN 2M4KA 3M0SA 1HNIA 5HP1A 3WG9A 4MQ3A 3CPWP 2A0FB 1VRTA 4CZKA 1VUBA 1MJBA 1IUYA 5CVRA 3VESA 4WQ4C 3W6KB 4C8NA 4BDYA 5GPCA 4E1NA 3VDXA 4Z4GA 1PD0A 2JW4A 2FBHA 2RQPA 2Y2ZA 1QPIA 2E65A 4WYBA 5E18F 2F5KA 1TL8A 3RUXA 1QA6A 3FFIA 3DTIA 4IUVA 2PG4A 2HVSA 1Q81C 4XBFA 3E1SA 2F6CA 3M53A 1XDSA 2AT1B 3GBGA 4BY1J 1B72A 2LQWA 5AFUH 2VKDA 3M8SA 4F2SA 4M77A 4JAXA 2VYTA 3KP4A 3AVHA 1MMSA 4A3LJ 1NM1A 1S6LA 5DPKA 3H08A 3OHRA 3CMMA 1S9GA 3QP5A 3ONQA 3GG4A 3TARA 2RQUA 4Y0WA 2GX9A 1NJZA 5KHDA 4JKBA 1RDUA 4G9ZA 2AO9A 1WHUA 1WSJA 4KN4X 4Z88A 5J8CA 2OC6A 3MD2A 3I0WA 2HHSA 2XPWA 3DKYA 3TAQA 2E5NA 2AXTC 2E1MC 1YJ9N 1X1DA 3DQVC 4YOQA 3SDGA 2PJPA 1RCHA 4OLBA 2BUDA 4CFDA 2P81A 2ZPEB 4AC0A 3E01A 4CGIA 1JTXA 4DS4A 1VQ9I 1YAGA 2LT4A 4HUEA 1T7PA 1W36C 3HFNA 5J2MA 4XRFA 4CVNE 4ZYDA 1EV7A 3FZHA 2PJRA 4LF6K 4I6ZA 2JK3A 1O75A 4L8RB 1V4SA 4B9SA 2RM4A 2L01A 2RQWA 4LDUA 4RAZA 2OD5A 2HDAA 2CQXA 5DV5A 4QQ6A 3H3ZA 2FSJA 3AA2A 2O8DA 3HT3A 4EM1A 4KUIA 2EJ9A 3CMEN 3W2VA 3DKMA 4HBLA 1XOVA 3SUQA 5KI6A 2JRMA 4FVUA 4PKCC 2F4OB 2A5XA 4FTHA 2FPDA 2V8KA 2N8GA 2BIVA 2O3FA 3LFKA 1NLVA 1EH7A 1LWVA 3MXMA 1NGEA 2ECZA 2AZSA 1X58A 3QU3A 1RTJA 2ZCFB 2Y0MA 1Q95G 4A4EA 2IGOA 1Y0NA 2DY4A 5F04A 4XLEA 5J1UA 4OFEA 5M1NA 3OYBA 1KQ0A 4BD3A 1KVCA 2KJCA 3ENHA 1OI1A 5I2SA 3EH2A 4DR1K 3W3DA 1MH3A 3CCST 1UG0A 4LN2A 4NO7A 1MZBA 4OMOA 4G7OF 4X64K 1Z9CA 5GAMj 3CETA 2SEMA 5H20A 3I55T 3CCET 4C92B 2G7UA 2H1KA 1BG3A 3LA7A 5GAGP 4AYBA 2HHHK 5GANj 3C4SA 2DT5A 2K7LA 2AHQA 4AILC 4CHPA 5ICGA 1WZ2A 1TGOA 4MMKA 3CF2A 3PUFA 1FN7A 1NGBA 1H3ZA 2HDDA 2PMZA 3R4KA 2LJ1A 1VAZA 3LWLA 2KTQA 1D5AA 1WH5A 3L4QA 1IV8A 3K4JA 4IX7A 4D5FA 3QO9A 4V2SA 1IN4A 2V7YA 5MLCQ 5FPMA 1KSWA 4I76A 1YJNA 4FWPA 2HOAA 4DMNA 1VQON 5C4JJ 3H3UA 4B9UA 5LGUA 2H3GX 4C8LA 3WU1B 1QVTA 4BG8A 2EA2A 4C2UA 3CBPA 3LP2A 1HSJA 5JI6A 1JEGA 3IAM2 1CSKA 1I94K 1LFBA 4M7DC 3DXKA 1O9SA 4LF7K 3SEZA 3N05A 1OISA 1OMIA 5M5WJ 3OJSA 1EP4A 1KO9A 1RT3A 2A69F 1YTYA 1W1WE 1QMCA 3KK3A 2GCXA 2DDAA 1L3VA 4JV5K 5KN8A 3HYFA 3AVAA 2DQLA 1VQMT 2WACA 1QHHD 1IBMK 2UWMA 5AQIA 4DJAA 3QNNA 4DKWA 2QG9B 2VKNA 4MO5A 2O8BA 3F8CA 4BJ5C 4HYEA 2CP3A 2MPXC 4OPHA 4JJNK 4A4FA 4JN4A 1WDXA 1FW6A 1AWWA 3NGPA 1I1JA 4F8RA 3SUNA 1BU6O 4J9GA 4E9FA 1MV0B 1YX3A 3PIOA 1J6ZA 1QPMA 3M5AA 1X1BA 1GRIA 3S3MA 3KKSA 1VFCA 4EIKA 3UATA 1G83A 1W2BS 2LKXA 1R5GA 1SKSA 4C3JJ 2E12A 2AZVA 4E6RA 1C1CA 4HSTA 3OOUA 4CJEA 2CW7A 4CZJA 2EINH 2BE7D 1H0MA 2HR3A 2IJLA 3A8GB 3QWYA 3T1AA 2EVRA 3MZYA 2Q0RA 3DXMB 3L3UA 1N27A 4WWCA 3FZMA 3SHFA 2KHMA 4LNPA 1YI2T 1FBUA 1JE8A 3KUFA 1IV0A 3M58A 2KIFA 5EGOA 4IG3A 4OAYA 4OB2B 4H0EA 4FLYA 3RBBB 3MN2A 1TTHB 2BZXA 2SRCA 4FWNA 1VQ6A 5LJ3d 5KGXA 4W5TA 2F2EA 2TCTA 4XRSG 4RTYA 1IG9A 4I01A 4A3JJ 5FU7B 1Q86U 2Y0SN 4AFZC 1TWHJ 4FETA 5KYUA 2X4XA 3QINA 1X9SA 3HOSA 1KCFA 4PHTX 2YCHA 4FW1A 5EY4A 3SWNC 1PJRA 2UUAK 3OA6A 1JBMA 4H4MA 3I53A 4CYDA 2LFBA 4KUMA 3DPTA 1BI3A 3G3ZA 4D7MA 3RTVA 3EQLF 4I0BA 5AIPA 4Y28E 2R3SA 5HK3A 2W84A 3CMEQ 1GHCA 3V7RA 3MAJA 2FPFA 2CYYA 4CK2A 3BT9A 4NC6A 1ZYRF 2FG0A 3FHGA 3IUOA 3MEAA 1NGDA 4ZHRA 3BROA 1LEAA 1RT5A 4Q5VA 4QCLA 1EO1A 4XH4A 4II2A 3MKZA 4E4HA 4EJZA 3CCYA 2KRHA 1M27C 4Z94A 1YUWA 2LR8A 2R7UA 1R00A 4CYCA 2E1YA 1S72Q 3I55I 4HG2A 3HSFA 2P5OA 1J5EK 4QLCU 1QSLA 1VQLT 5CZ1A 2OBPA 3BDPA 2P84A 3D2FB 4EZ6A 5IP7J 1OV3A 2OZMA 4A2BA 3RSNA 3OYDA 4FJHA 4CEEA 1BCMA 1NEGA 1MDMA 4K0KK 4R79A 1XC9A 1XMAA 1X4OA 2LNBA 5EJCA 2RREA 1H9TA 2G8UA 3B73A 2IC3A 2VN2A 1BISA 2E3IA 4ELYC 2FF3B 3WHBA 2IAIA 3JR9A 2CZ1B 1GBRA 4HTUA 1SVOA 2M8GX 5ERIA 1YP5A 1WI3A 1OH5A 1MWKA 3S1NJ 2A3LA 5IAYA 3M55A 1OH8A 1MIJA 2VPLA 3PX4A 1JLBA 3VQBA 4NDLA 4KTWA 3SFMA 1WOQA 2GF7A 2KQ2A 3LP1A 1TTYA 4U0VA 3LYIA 2CZ0B 1IKYA 2JA8J 3ZETB 3UIQA 1LDJA 2DTUA 4M7AF 3A1PA 2OA8A 1RLPC 1KQ1A 1W5SA 3FK7A 4NCBA 3BE3A 4NZGA 1HYVA 4DSKA 2VWJA 2P9LB 2QF7A 5F0XA 2KT0A 1TXQA 5BREA 2O8FB 3G2BA 2HOTA 2RJCA 4BGAA 1P4WA 1GVJA 1M3CA 1KK7A 3L09A 4AWXB 1RAAB 1P6RA 1KG6A 4NC8A 1VQKT 4CZEA 2G6FX 4AHCA 1JQQA 4PJOA 4UB6C 2KRSA 1WPYA 2JJ9A 3JRZA 2CGKA 2QBYA 3R1XA 4I2QA 5KRSA 2H6CA 2HDWA 2X85A 1HR0K 2EFWA 2Z3YA 1ORNA 4B44A 2OCEA 2DJIA 4DWIA 1SSHA 4IBNA 3CMAQ 2LRDA 5D6XA 2M9UA 3E97A 4M75G 4CHZA 5JVHL 4HZFA 5FD6A 3J7AO 3JCMe 3PT9A 1OCRH 5D5WB 4LIVA 4LY7A 4M7DA 1KLNA 3CCLA 1UWBA 3B6CA 4DR7K 5KTQA 3SJHA 2HNHA 4DQPA 1YHQQ 2O8CA 2H3EB 1IF1A 3NH0A 4DR3K 3SPYA 4CF2A 4Z02A 2J5PA 2DA7A 4IOXA 5TKYA 1DTTA 4YNQA 3CC7T 2NUZA 3O3KA 4IFYA 4II1A 3CC7Q 4WQ5C 3NE6A 4KRFA 2NRXA 4YFXF 3SUPA 1HKBA 3AVGA 2HOSA 1YHQT 3QIIA 2XKPA 3M8JA 2JUGA 1VK0A 2IA0A 4KHYA 3IKVA 2XGEA 3WXKA 3JREA 1RBRA 1RTIA 1WJCA 1OYXA 2CUZA 3U23A 3OSFA 2HQRA 3QLHA 2DBMA 1B8IA 5KCOA 3CJRB 5EC7A 1NLOC 3CCJT 3DLKA 4GV6A 4A59A 4CSWA 3LL7A 2CYZB 4A3IJ 2UU9K 2HHUA 1MNDA 1I81A 4FM0A 4M75E 4DTRA 3DLBA 1WH7A 1KU7A 5FKLA 2XAQA 4KUDK 3GZNB 2QENA 1R0CB 2AA4A 1LV5A 3LSJA 5ADXH 3O9QA 3FIFA 2DE0X 1QVUA 4M7YA 4N56A 1RI7A 3F8BA 4UVBA 4FWLA 2J6OA 1XNIA 4M7AC 3ZP5A 4PSXA 2JPCA 1Q7YC 4BRKA 3SYTA 3PQKA 1N25A 4Y1CA 3MJXA 1NH3A 3R3LA 2ZGYA 2LQ8A 2P5VA 5HROA 3L2VA 4NUBA 4XQFA 3NTKA 1XCBA 4FQGA 1TKZA 3TP3A 3CCUN 5D5UB 3ZT2A 4F93B 2HCKA 1JXBA 4M3YA 5JS1A 3SWNA 2LX7A 5AQGA 4FJJA 4MQVA 2WV1A 1KG3A 1BIBA 2EFOA 3WQUA 4BRLA 2K2MA 1N78A 3VN5A 1RTHA 2HQHA 2JA2A 1VQKI 4B1RA 3HTSB 2K9QA 2Q1NA 3RYPA 1U45A 3F22A 3N4MA 3GZ5A 1KZHA 5CIUA 1I50J 1V55H 2Z2SB 1WXTA 2DTZA 1ZA2B 3SAGA 1AWXA 3LA3A 4HQEA 2EJRA 2ZMEA 2Q97A 1VSKA 2F2WA 2QSHX 4FJMA 3K1NA 1Y7XA 2L2OA 1RDCA 4HX7A 4MGRA 3PMTA 4BGDA 2DL8A 2M1BA 4CZZA 1YNZA 4CEZA 4EMGA 3OW2P 3S6IA 4CE9A 4KI4A 1KG7A 4CHYA 5ICEA 4NQWA 1KD1C 3E3VA 3GYHX 2HQXA 1VQKN 3P9CA 2YX6A 4BVPA 2O4IA 5HS8A 1WJ5A 4HT9A 3BCBA 4CZLA 4FM4B 5E1XA 1WJFA 4M75A 3VPRA 3NMZC 4EJTA 4HWIA 2P9PB 1Q82C 2KRCA 4CZCA 2MIOA 3SB2A 3VENA 2K02A 4XRMA 3OSGA 4DQ2A 2P9LA 1M90U 5K5OA 1ITGA 3ZMZA 4O0JA 4Y4RA 2JWLA 4MDXA 5JLXA 5KYWA 2RHUA 4M63C 2COBA 3QYHB 4FXDA 4BROA 2RC4A 2IEKA 1JJ6C 4EEFG 3EG9A 4IJAA 3JB9F 1N32K 1BQNA 1JUSA 3GMEA 2CQKA 1U8BA 1KU3A 2DRMA 3MMYB 1C6VX 1FNNA 1I4K1 1VQ4N 3BR5A 2X1CA 2HSEB 2X6OA 3VS7A 4QPQA 3RMAA 3PY8A 3CCMT 2KXCA 4RGXA 4GYIA 3H1CA 3CCQN 1T0FA 2R7WA 5M3MJ 5ED4A 4RDUA 3JRAA 4OX9K 3K9JA 1H92A 4CEDA 3H0DA 2V1RA 5GAOl 5KE3A 3ULEB 2Y4YA 2FRHA 2QKBA 1WN7A 3W6VA 3P8BB 3A0BC 5CPRB 1TUCA 3AVIA 4DZPA 3C2HA 2DEUA 4PJMA 1SG5A 4KH6A 1IXRC 2HFHA 5A0GA 1PU7A 4GYGA 3M8EA 1R23A 2DMUA 4RAYA 2VJIA 3ASKA 2F9WA 2MF2A 3VS5A 2W42A 4FJIA 1NG2A 4B23A 1J9AA 2FRWA 1TAQA 4PL8A 2XHIA 5KCHA 2A1SA 5HRPA 4C92G 2M7BA 2O9VA 2VC8A 2W03A 3OVNA 4MIMA 1MW7A 3JCMJ 2ZAEA 5LHHA 2HBWA 1RT7A 2EV6A 1JLQA 3CCJI 1Y6IA 7AT1B 1X9WA 4ILHA 3EFSA 3RDVA 3DLMA 3BQYA 2OZUA 5LJ3h 2QA4I 2CP2A 1WSUA 2W0ZA 3I4MJ 1PU8A 2DFHA 1LNWA 1M1FA 2OX7A 1BJZA 3PLAA 2RDPA 3KBGA 3Q5FA 2BDPA 1G3WA 3CCQI 4JHDA 3I5UA 2NAZA 4D8DA 2CSIA 3VYRB 3BR0A 2O03A 3RSEB 1X1CA 1XS9A 4L5JA 4XN0A 1K4TA 3EHRA 3R0AA 2BZTA 2CV2A 2GWRA 5L3FA 1XQOA 4JBAA 1JUMA 3WTYC 4D5CA 2CT3A 2ENMA 4YOYA 3CTAA 3AVKA 2EIJH 3JCMX 2EJGA 5C25A 3QPLA 2KZZA 2M02A 3A5NC 4X1EA 2KDOA 1RZ4A 2M0OA 4IOAF 3A5OC 4M78C 3CCEN 3P1GA 2QWOA 1OPKA 5H1SQ 4CF8A 1HNXK 2DT7B 1W7AA 3G4SI 1TKDA 1YJNT 5DDGA 3H3NO 1KC8U 3CCMN 3SBTA 4QOZB 4OU0A 1SAXA 1E0EA 3HL2A 2EQIA 2NVUB 4JI8K 3OYCA 2DJNA 1TU0B 2R7TA 3E9OA 3QETA 1V5FA 5KAIC 2HZTA 3CC4A 1PVEA 4PJLA 1QO0D 2JSCA 1N3AA 1UHMA 3CF5F 2C0TA 1YX5A 4C92F 5FO5A 2EILH 2ZSIB 3PIPA 2A40A 1XTAA 5EZGA 3GOXA 4F7UA 2FXUA 1SEUA 1K0SA 1OPCA 1WYXA 1S72I 3O9TA 2CS3A 2FMYA 5L3EA 1OPLA 2COZA 3I55A 4BC4A 4JKEA 1Q82O 1NG9A 3MWPA 4J9CA 4M77F 4CJ5A 4IPAA 2OPQA 3LSKA 3HI0A 3W3CA 1RI9A 5CKBA 4BR0A 1R5ID 4S0HB 3WHCA 3K5LA 4LFAK 4HT8A 1OCCH 4YELA 2X4YA 5IT9K 3ZSZA 2GELA 1BBZA 1M2OA 1HDPA 2DK3A 5FRNA 4M9SA 5EYRA 4K41A 5H2FC 4HRIA 4OF1A 4ILJA 1W1FA 3GOIA 1J09A 2XAGA 1QSYA 4BBRJ 3IKTA 2E2HJ 2OTJQ 2GBQA 4M75C 5HOOA 3AKZA 3VQ5A 4B9LA 2YX4A 1PUFB 5FFZA 1ATSA 2QWQA 1IZ1A 1BJAA 4KH0B 3PO4A 3HBTA 3MWTA 1JJ2S 1IRZA 4IHTA 2DMNA 3REBB 2CUBA 4X6AJ 4JS4A 3D5RC 1JJ2M 1YQKA 2D5RA 3I55Q 3JB9G 4P5NA 3A8OB 2R5YA 5CKFA 1LJ9A 4IHVA 2E41A 1I5OB 1GCQA 2VG6A 4CBXA 1OX8A 5JICA 5DUIA 3CD6I 3CXCP 2VT2A 1QVFP 5CR4A 3L2CA 2QUFA 3RMBA 3QPTA 3G0QA 1VQ7I 2L7MP 3BC8A 4BRGA 2R7ZJ 1S72A 1JCGA 2ATCB 3CQTA 2X51A 4HCZA 3JCMV 4MO4A 1MNMC 2KXDA 1G15A 4E7ZA 3HUGA 2VQCA 1B07A 1VQPA 3JCMW 4IKFA 3DRRA 3HDDA 2IW5A 3NDKA 4X1VA 5F0FA 3ZRGA 4FJKA 1K6OA 3ZQGA 1T0FC 4JRPA 4E9EA 4BAYA 4LE9A 2GXAA 1NPRA 2D0OA 1TW3A 3E2UA 4B6MA 3FXJA 1PRLC 5AONA 2H94A 4A4GA 4J2AA 4XN3A 4ID5A 2JQ7A 3CUQA 1M90O 3HKZN 1M3BA 2EIFA 3PSFA 2Q2EA 4HQMA 3JRFA 1SFUA 4M77G 3O6BB 2QGGA 1Q7YU 1Z77A 5FJ8J 3JAMZ 5EG0B 2JTFA 4J8OA 4CGHA 1M90R 3C0BA 1BA5A 4RTVA 3QOPA 3CCJA 2CRGA 2K40A 3I56T 1VQ5T 3M3YJ 2X1DA 4ZGDB 2Z33A 2HOEA 2XGCA 4KN7X 3QKJA 1ZQ1A 2HYJA 1S8NA 2ED1A 3C18A 1P4AA 2HB5A 2YG8A 3KD5E 3CD6Q 2BY0A 3R2XC 2ZKZA 1FBSA 3OYMA 2F5TX 3SQNA 2KK4A 4MZMA 3V81A 5KRTA 2FYKA 1X9JA 2GOXB 4WE1A 3HPOA 1TW2A 1ZLJA 2NOLA 1VQ8T 3CERA 4CK1A 4I98B 3GDQA 1PSFA 2V9VA 2BHZA 3AARA 3QBYA 1BWFO 2JA6J 1NTCA 2W57A 2ED0A 2G8HA 2R58A 2V9KA 1WEFA 4H5TA 3G6EI 1DTQA 1EWQA 4HLYA 1K0XA 3AVMA 4DSEA 1XGNA 5AZJB 4RM3A 1SFXA 4IRIA 4DG1A 1OR7C 3O80A 5FPEA 3M54A 3HVTA 1N6QA 3SNNA 4IUUA 2DFIA 1ZUUA 3GPLA 2NOGA 3URGA 3VGKA 2ECCA 3BDLA 1H8KA 1XQPA 1LCKA 2KZMA 3AAQA 1X1PA 4FLTA 4FJXA 3NHNA 2UZKA 3BY5A 4UC4A 2QI2A 1AKHB 1RAGB 3SCXA 4M78A 2OTLN 1GV5A 2X6XA 2G7HA 2MGQA 5IP9J 1YITQ 3J81E 2QLZA 4DR6K 3H5NA 3INZA 3CCRN 1X2QA 4PJOB 2MH9A 2P6TA 1VQ8N 4RB3C 2E2JJ 2GQVA 1MJ9A 4C92D 1YHQI 5L8RE 1OOTA 5H6RA 1FX7A 5GPAA 4XRSA 4EJYA 4P1WA 1W9HA 1PYVA 3HM5A 1TUDA 4PY5A 3VQDA 2BOLA 1Y57A 3QRFF 4QS7A 3CPWS 2V79A 3META 2DXTA 3LMMA 4BB7A 4XL9A 3SZTA 1AZGB 4KT5C 4N4IA 2DILA 4AMCA 2BW3B 2HNDA 2HQEA 5C44J 3FMQA 2LG4A 4B9QA 3J7YP 4M7DF 4PJ0C 1XCVA 3RPUA 1JLEA 4DV2K 3E1YA 2K9LA 3S16J 5CVUA 1VQ5A 3UA7A 1H641 2YUQA 3MXIA 2EAYA 3BDDA 5C24A 4DCHA 1XMXA 5GAHJ 1SKWA 4G6QA 2KDSA 1DEJA 4G8XA 4Z4EA 1W0TA 3MCZA 2VWFA 1FIAA 2FBIA 3WQTA 2KPMA 4KGZB 1K73R 3HHTB 4ZYHA 3BG5A 3RZOJ 1IN5A 2O4GA 3BQZA 1IXSB 2RN8A 2V9PA 2HTSA 5I9EB 1XSXA 1U06A 3KPHA 3N4QA 3L00A 3TEDA 4KB1A 1YJWI 3TSZA 1D9DA 2LOOA 3K2PA 4HXJA 2RH2A 2UV1A 3RR8A 2O5RA 4CJWA 2H8HA 3K0SA 5B8HA 3M8QA 3OWTA 3TO9A 1ZSZA 1YQRA 1GLCG 2R7YA 3OJUA 1K1ZA 4HF0A 2XHKA 5FFXA 3VQ7A 3SV4A 5C4XJ 4PNOA 2W4SA 5FU6B 2Y69H 5FD5A 3C95A 3G10A 2IIMA 2RHXA 3OMCA 1YCYA 1UHFA 3EGUA 3LDOA 1S3XA 3KP3A 1JHFA 1UOCA 3OYKA 5AQOA 1VQ6N 1DT9A 1W7PB 4HTLA 1BCOA 2KZVA 4O8KA 4BXXJ 2O8CB 1G3TA 1V3FA 3ENBA 2AIRB 1GCQC 2DW4A 1AZEA 1JUPA 3VEPA 3JB9I 4YHHK 3QG1A 2KY9A 2LKSA 1JLCA 5BRHA 1YLFA 1Z7UA 4QKUA 5EU7A 5DCMA 3ZYYX 1G3YA 2K3XA 4DTUA 2E20A 3KVGA 2DPDA 5GADP 3KYDB 2IS1A 1ZK8A 3RVCA 3DU6A 1VQKQ 4A61A 1JJ2A 1TQPA 3BF1A 1NK4A 3HRSA 2HGCA 5HY6A 4NOYA 4BRDA 5EEHA 4U7DA 1EA3A 2K86A 5J1YA 4A6DA 4BY6C 2JOYA 2UUBK 1VRUA 1RL2A 4JX4A 1XC5A 2NOBA 5JLFA 5GANg 2QWLA 3CYMA 2YSRA 1ETVA 2OTLA 5K7HA 1VSHA 4KISA 4CZHA 2A3SA 3SD4A 4XM3A 4C3HJ 3MAQA 4PJOF 4PJOG 3KLOA 2EWNA 1ZELA 3K6GA 2LF7A 3DOKA 3VTIA 1I6XA 1F1BB 2UUCK 3ID8A 3FMRA 3HC7A 4DV7K 5AQPA 4DS5A 2KYMA 3ZEHA 3OA9A 1GFCA 1X2KA 5M1PA 4U0YA 5D5XB 5IOZA 3CCUQ 3GFJA 2LSOA 3EHQA 4Y7NJ 2D1XA 1RI0A 1M5Q1 3CD6N 3CO6C 3A8LB 2CV0A 3ZX2A 3Q0UA 2PUOB 1J3TA 4NL2A 4BS9A 2J6FA 3E66A 1QSSA 4O3MA 4KPYA 3VRYA 3FSPA 2Y48A 5GAN8 2DTRA 1S1TA 3CM6A 3S2HJ 2XY8A 3MEDA 1I27A 3CJ1A 4EVIA 4A2UA 4YIIA 2HXIA 5ADXA 3A01B 1ZBHA 2XSDC 1KSPA 1N9RA 3CC2T 5IP6A 3CCUI 3FFKB 3CCSA 3RQIA 2A07F 2YUOA 4KIBA 2IBDA 2BTFA 1DP3A 2IDOA 2EV0A 3FBIB 4Q48A 4NC7A 4LF8K 4IL6C 2MH2A 3G0ZA 1VQKA 4M7AA 4YOVA 1NJIU 2YKNA 2A6EF 1Q7YO 2DJQA 4DFKA 2DZ9A 2V52B 5GTHC 3AAPA 3MP6A 2JMAA 1M3AA 4BY6B 4JI0K 3RR6A 2ZPHB 4B9TA 4A3EJ 1YN8A 3AG4H 3VRZA 1X6OA 3J80E 1WAFA 4B47A 4O5VA 1IN6A 1OU8A 2CREA 3K69A 3CP8A 4CJRA 3J7ZI 5C6SA 3QNOA 3SJJA 3CPEA 1SVLA 3TAEA 2OU2A 3SDZA 3LAPA 2DLPA 2ACJA 1U84A 1FK9A 3NGZA 1R22A 2LX9A 4PJOD 2CH5A 2M4GA 3P9IA 4C0FA 1FXXA 1T0HA 3F0ZA 2V7ZA 4A54A 1DPUA 4E1JA 2QEXQ 4CXFA 1UUEA 2KMUA 1IDZA 1YJWQ 4KIGA 3FRNA 3RIRA 3TABA 1SC7A 2GXBA 2QK0A 1N8RU 3F23A 2JS2A 1NK9A 1B9NA 1MBJA 2PN6A 3G6ET 2Q2RA 1RR8C 1WVRA 3S1QJ 4OPJA 3H41A 2ZSHB 4FO0A 3BLYA 2RI5A 3UF4A 5I42A 1JLGA 2EFIA 2W40A 3O9SA 4MLOA 3BPVA 3JCMc 1VQ9N 2XG8D 4DTMA 3DLAA 1R1VA 3ATUA 4HOBA 4F55A 4N4NB 1QHGA 4UY8I 4F3QA 4NHJA 5LRSA 2B7EA 4M6XA 4MO7A 3S3NA 4JUVA 1IXCA 2X4HA 4KHUA 2KFDA 4DIQA 3O3GA 4XK4A 1U5TA 3OYNA 3LSRA 4PLLA 5GAOp 2KJBA 1VQ4Q 4EFHA 3G4ST 3QAHA 2EZLA 4HA8A 1Q8IA 2JMWA 3QOEA 4M3TA 2QYZA 1FYLA 2F2VA 4DQIA 4H5WA 5FWCA 3M1EA 2E64A 3S2DJ 1BB9A 1GOBA 3M4OJ 2NVXJ 2M16A 5JR3A 4JK8A 1WWXA 4OB1B 3MWMA 1IO6A 3QESA 2RKIA 4LF4K 1S6QA 3DBLB 1TWCJ 1QU3A 5TJJA 3O1BA 2R7VA 3CCVT 1ASUA 3G4SN 3AVFA 2JMCA 1X4PA 2X6NA 3VW4A 3CCVQ 2OJ2A 4E6KG 3LSTA 5KK1A 3G71Q 4KA4A 2RJDA 2VASA 4ZGEB 1UB9A 1XGMA 4G6TB 2WAFA 3OIOA 1RFQA 3A4CA 1X75C 1S9HA 2YNIA 1IREB 2O61A 4AHVA 1SEMA 1WLPB 5KNLA 3FKJA 2K79A 2EV5A 2OPPA 3SAFA 2BYVE 2W24A 1ZAOA 4L6V5 1STZA 3RNJA 4CZFA 1YJ9T 4XTXA 1N6AA 3G1OA 2D8JA 4ENNA 2RNGA 3BTCA 3C6AA 4UOBA 1FMKA 2VKVA 1JCEA 1CXUA 3VSLA 3AO1A 3HK2A 2CT4A 3SHWA 5K7FA 2LP5A 2BHYA 3X26B 4IDKA 3EGXB 3T8RA 3HPGA 3A2KA 4V2FA 4BQQA 1T39A 1V5EA 1S1XA 2A1RA 4FLUA 2JXBA 1VQNQ 4KITB 3C94A 1JKPC 4DQQA 3V1QA 1K83J 4ORZA 2Y9ZA 2QGFB 1ZR4A 3TOBA 3QZ9B 3WE2A 1OCTC 1YIJA 1I6HJ 3QFUA 2CS7A 2EZKA 1XNRK 4YIRX 1YJNI 1VQ9T 1F36A 1QVFM 3ME9A 1YFHA 1VYTA 3EPZA 1KAXA 1JKHA 5LFAA 2BTTA 1JB0E 1UDLA 2YXYA 3MKYB 2KMTA 3MVPA 5IY5H 2NNWA 3ZOBA 1B8IB 1EF4A 1H1VA 3PIPL 4ZZLA 2WA0A 3T7ZA 1RRJA 4C30A 1K61A 2DEQA 4KTQA 2W82A 2NRTA 5BRFA 1HW5A 1POGA 1QVPA 1TYQB 2EK5A 4N0BA 4E47A 2L0KA 5LHGA 1Z05A 2K7AA 1K8AO 2DK8A 3K1PA 5E3LA 3CCEA 4N76A 4JLIA 3IV5A 3E6CC 3TAFA 5FWBA 2E10A 1T03A 1UFMA 3MN9A 3S6WA 2RQTA 1NJIC 1LAVA 1NK5A 2MCNA 4IUPA 2OZSA 5L3GA 2P5LC 1YW8A 2P9NB 4I9QA 3L2ZA 4OKEA 3E5XA 4MMLA 1QZEA 3HOUJ 1VQMA 2BUPA 3TMOA 1S5JA 3VEZA 1MBHA 1U3OA 3ERED 1TH7A 3JRDA 1HW2A 4X65K 1NHAA 3CCVI 1NK2P 1R77A 5LJ5e 4IFVA 2Z1HA 4J9BA 4M7AE 1IRGA 2CJJA 3A2FA 3K70C 4A12A 4C92A 2RF2A 2RKHA 2XY5A 3U9ZA 4IOCF 3EUKL 4OMNA 4LDYA 4B3OA 3HB9A 2NOJB 2DYBA 5CVVA 2HL5C 2VV5A 4V19S 1BA1A 4M78D 5AQLA 3I5SA 4A0ZA 3QDRB 4LD9K 3MCPA 3CMET 1HQEA 4PFPA 3ZEUB 2HPIA 2RNJA 3WGHA 2PEXA 4HVVA 4CJ3A 5HL7L 1NGCA 1XGSA 1OYWA 2IGIA 2HWVA 3BZKA 3DPUA 4HNVA 4DBHA 4CF1A 2HPMA 4M72A 2HYFA 1KFZA 4EJVA 3AVLA 2I2LA 2JVGA 3EFOB 1MUYA 1A6QA 4U88A 3KFWX 2CP5A 2XROA 3O3HA 1QVGP 3LDPA 2V75A 4DW6A 3Q0WA 2Z99A 2YJFA 3LWFA 5F1RA 4CCJA 4DK9A 3LPUA 4CGDA 3CUOA 4M78G 4IOCL 1WZOA 1R5HA 3UKRA 4JRIA 5BPDA 1WPKA 1X6GA 4I99C 4IZZA 2HKQB 4ZC3A 2FLOA 4DU1A 2ESHA 1KFDA 2MLKA 2P9KB 3JSCA 3WTWC 4EJUA 1HCRA 2EBIA 4S04A 2XMFA 3FGUA 3MEGA 4DSFA 1RBUA 3I0XA 2C06A 1VSEA 4J7IA 3L9FA 1XTDA 1CLQA 1P92A 3CMAT 1GBQA 4H0XB 4PDKA 2AQEA 3TOAA 1UJYA 4M73A 2O8XA 2HNYA 2AKLA 3I0RA 3AV9A 1I5LA 3MN6A 4DLGA 4B3RK 2KEAA 5DM7L 3DKWA 1RUOA 3TSPA 3I56I 2ID3A 1YRNB 1JGSA 1ZBJA 3HPHA 3TREA 3EG2A 3TTCA 1ILYA 2VIXA 2UXDK 4E7IA 4JKFA 4R0KA 1R6RA 2X6YA 2E6ZA 2FMLA 2D9TA 3E5QA 1YE9A 1FZPB 1GXIE 4GGGA 3ULRB 3D7EO 3BCAA 1K9AA 1USTA 2RNAA 3J7AP 2M7AA 2P8TA 2L0AA 2Y4XA 1TUUA 1FP1D 3ZBDA 3VUZA 2LDMA 1DP7P 4YY3K 3VEVA 4GDFA 1R36A 3E9LA 4Z2YA 3ASOH 3D2EA 3DB4A 3CDIA 4CYCB 2FX0A 4HSRA 4M3GA 2GLOA 1F5TA 2WC2A 3W2WA 1ULYA 3HKSA 2GQIA 3D2FA 2LC4A 3U8XA 1JXEA 1S1WA 4OVAA 4BH9A 9ANTA 3NH2A 4IHWA 2CQQA 2G8WA 4Y1DA 3QMLA 2H09A 3V42A 1RLQC 3VS4A 1Z0XA 2UXBK 4J9HA 1UMQA 2H6BA 2V6EA 1Q86C 1Y97A 5AQJA 3DLLF 1D1AA 3Q0VA 5KN9A 4IRGA 4EV0A 5C2FA 5CYVA 3B6AA 1I39A 4XTUA 3V7CA 4RG2A 2X6SA 4KJZA 1Y96A 3GLLA 1VQ5N 3C6TA 2PMHA 4BY7J 2VUMJ 3D7SB 3VB2A 1YI2Q 5GAOm 2W25A 2BZ8A 3FDRA 3DOLA 3KLEA 2JN6A 3VYGA 3RMCA 1VQPQ 2YU3A 1KG2A 1ZBFA 1C0MA 4M75D 3O8GA 5HS9A 1ETYA 1YHQN 1JKRC 2NYXA 3HHHA 3CVSA 2FZCB 4ABZA 2DA5A 5F2RA 2ZB9A 1MBGA 3Q1JA 1NYFA 1TQMA 1I5ZA 3TEEA 1WQ2A 1S72T 2F4VK 4OB0B 3V9WA 4ZH4F 4CZGA 2JS0A 4FJ9A 1IN8A 2ZCWA 3FK6A 1YHQA 5AQHA 3DWLA 2OUMA 1D5YA 3E9PA 1D3BA 3CCLQ 2CFOA 3LGLA 1WGXA 2D0AA 2NS8A 3CWAA 2E7XA 2QA4T 5E84A 1BO5O 2L02A 3CMEI 2P9IA 3K59A 4I02A 4UXNA 4R56A 2E6NA 4A3DJ 2FEZA 4H5RA 1XGOA 3A8YA 2YR2A 4EPCA 1KD1R 2B5JA 2XICA 1RDDA 3AFHA 3NHGA 4CCHA 3LGFA 3KEYA 2YJEA 5AYFA 2E70A 4BRCA 3TW6A 1FTTA 3AGKA 1JT0A 4CJTA 4B24A 5GAN3 2DJZA 1VQ4A 3ML6A 4GW6A 1B9DA 4JNEA 1D8YA 3L8BA 2L9RA 4KNYA 2A28A 1C0GA 4M75F 4CC2A 3SAHA 3SEMA 2OPRA 5LL6Z 2J7IA 4LDWA 1K8AU 1RRQA 4Y92A 2DO7A 4XTZA 3RZDJ 4PJOC 1SANA 1VQLQ 3BG9A 4PUSA 2K4YA 2YUSA 2OTJA 4G1QA 5CVJA 2DCEA 3IRQA 1PP7U 1RR7A 2E5QA 1E6HA 2GV9A 2WFBA 2HHVA 4RW7A 1RT1A 3PGGA 5K5QA 3K70D 3I0SA 1AA7A 5DUKA 1Y1VJ 4QPOA 1ZRDA 2VJJA 4DA4A 1JJ2P 4DR2K 4RGRA 2KVQG 2ROTA 1UGSB 4F14A 4CCMA 1UJ8A 3BR2A 1SS6A 4GBQA 3ZT4A 2X0LA 1W4MA 5GMKh 4ESFA 1HX1A 2NNNA 3VQCA 4RCCA 4FIBA 1E4FT 3EZ5A 2DFEA 3KFVA 4KH5A 3THWB 4UNFA 2O8FA 5B1AH 4FYYB 3L2RA 1TK5A 2FA5A 2ZXWH 2NUPB 1TUGB 2HAXA 3HP6A 4FE7A 3OIPA 2JJ7A 3MN7A 2QQ9A 4HCBA 3TKYA 4O5BA 4ITVA 3VTHA 2HHWA 5FW9A 3V7SA 3C65A 1L3UA 4C5HA 4B8XA 4AG1C 2VUBA 1IJWC 4ZYAA 4FPBA 1IW7F 4BQLA 3HOWJ 1V54H 3CJ9A 1BL3A 1NWKA 5EF6A 2XGDA 2RQQA 5BPMA 2XAHA 3RPQA 3MPUB 2HS5A 5AQTA 1BUPA 4E2FB 4C0DC 1HJDA 5E3MA 4W1UA 1YTAA 1SRLA 4FCYA 3JV3A 4BU2A 2JPBA 2LNVA 2ZXJA 1ZR2A 3KCCA 3I3LA 5CLSA 1D3YA 2G8FA 4CC4B 3FJ5A 1VQ6I 3WEEB 5HODA 5K7ZA 3ZSVA 3KETA 3SFZA 1UELB 1VQ8I 5GAN5 1H9GA 3U3YA 3OTOK 1TUYA 1WFWA 4D8KA 4BNCA 2OA4A 3FXQA 3OW2S 4M6YA 3CC2I 3FHZA 2M51A 2E4HA 3K5OA 5GAN2 5LJ5f 3H5RA 2C0OA 1KQ2A 3H9QA 3E7LA 2PAVA 2FHDA 3LAMA 1MD0A 4Y3OA 1UGRB 2NUTA 1KQSS 1W36D 5I2MA 5CR2A 3ISPA 2NRZA 5AQRA 4K11A 1TKTA 3ZT0A 1YIJN 3F8FA 2O8KA 1FLIA 2KT8A 5C12A 4M77D 3LAKA 3D0SA 2YHYA 4AIDA 1IGNA 3UR3C 1WJQA 4XONA 3A8HB 3TVTA 1BN5A 3HSEA 2OAUA 1Q82U 2YUNA 3P8DA 2IOCA 1G8XA 4DZJA 1TSFA 1BDGA 3LW5E 1VQPN 3AT1B 2VXFA 3HEFA 3DLEA 2L3DA 2JPSA 3VPZA 4HNUA 5BOXA 1UHCA 1XQHA 1EJ9A 4EA4A 1K7AA 2H27A 5JFRA 4RMOA 4UUSA 2IS3A 1BR4A 3I71A 2UXNA 1IDYA 3FB9A 3KP5A 3M07A 1PNJA 1MSEC 2QQAA 1LPLA 1GLFO 4U67L 4XTYA 5BN9A 2BKDN 3CC2A 2B86A 4R8HA 4XIUA 4UHTA 3HOVJ 4BR4A 4ENJA 1KXPA 2OYQA 3QFPA 4U7BA 5FPNA 2Z9OA 2P9PA 3RMSA 1BHLA 3IRXA 1B59A 1N5YA 3ZMVA 4BRFA 3CCRI 5KCMA 4B9NA 3I0TA 2I5UA 5EX5A 5J2QA 3DAWA 3MQ0A 2OI3A 2MBFA 1EQYA 4PIIA 3M3ZA 3D0PA 2OTLI 2DZCA 3HTUA 3MMVA 2JG6A 2DK5A 3IWFA 1XDUA 1T6SA 2H3JA 5HVQC 3D6RA 1HQUA 1U47A 1TT0A 2X3XD 1DPRA 1Z25A 1NBEB 2YDLA 1LE8A 1VSFA 2XO7A 2CUDA 2LMDA 3BJ6A 2EFPA 4H03B 1Q1HA 4B1XB 1QGPA 2EKOA 1ABQA 2PVDB 1LJOA 4W5RA 5L3CA 1HLUA 4IF4A 4N9HA 3HXLA 3CEYA 3I9V2 4YRVA 2PY5A 3NBPA 3O8MA 4NQWB 1LCUA 2XIGA 2CZ6B 3OOPA 2RHKA 1VQMQ 1WAJA 3U3GA 1Z26A 2F4IA 1B34B 3ULEA 3GCMA 3ZN1A 4PGHA 2P6SA 1HKGA 1MDUB 3ZLJA 2CGLA 2HVRA 2D4WA 5GANh 3CC2Q 1B72B 3V6DA 4UNOA 4B3MK 4EMKA 3T3FA 1YITA 2P9SA 3P39A 4ZNXA 2PUKB 4FJGA 3MK6A 2O7OA 5J6XA 3MFKA 4RW4A 5FDLA 1HYZA 1MNEA 3K7AJ 2DOEA 1WJEA 1H3HA 4M7AD 4P9UA 1E17A 4BY9C 2I7PA 4B9VA 3CXCA 4RBOA 5KPZA 5A2QK 1ZSZB 4ILGB 3I59A 4KDPA 2YI1A 3IH4A 1QVFS 4CJFA 4XU3A 2ELHA 3WG7H 2R5ZB 3Q7BA 2GUIA 1LNXA 5M1OA 5F08A 4CA0A 3J81K 4FSXA 3KZIC 2YHXA 2CP7A 1WLJA 2G8KA 3V8KA 4DYCA 3TSUA 3F70A 3IQLA 1BC8C 4B3XA 3LWMA 1Q81O 3CCEQ 4AD9A 1D9FA 2RGVA 1PWTA 2K5CA 3THYA 2OANA 3FXKA 2DPUA 1FJGK 3THXB 2DTIA 5LJ3f 1F1ZA 1FIPA 2MOXA 3LA2A 4YFKF 4M7DD 4AU7A 2R93J 4A93J 1X2NA 1P7JA 1KVBA 1TKXA 1OLTA 1WB9A 2J6KA 3AY9A 1R7JA 4M4ZA 3VS1A 3LSIA 3R6SA 5ILVA 2JT4A 2O88A 3PX6A 4PL6A 3OYGA 4PLIA 2LLKA 4P55A 4D7NA 4XK8E 1VQ4T 2FNPA 2EBPA 3O4QA 1F9NA 1UAXA 3AVCA 4IXCA 1WEIA 5J8FA 4KHPK 1H8AC 4MFEA 1EFNA 3TL4X 1FOKA 4JDSA 4H8KA 2WBNA 3ATVA 1MH4A 5HDGA 3MEEA 3ZPLA 2GWKA 1QE1A 4XSZF 2OQRA 3ISNC 2UXCK 3X25B 1IGQA 3O6WA 4BQAA 5BPIA 4DSJA 4M3FA 3G4SQ 4Y33A 2XDPA 1U6ZA 1NMDA 1ODDA 2X78A 1W7PD 1T33A 2GFAA 3VEXA 3VF2A 3ZFJA 4HVWA 4B1UB 2CZ7B 3H35A 4F2RA 3T9NA 2FQ4A 1SAZA 4NXMK 4DQ8A 4CBWA 2IP2A 2P0WA 3L1AA 2LTOA 4Q0BA 1W6XA 2W48A 3LP3A 4O0IA 3J8AA 3J81Z 4RWTA 5CQGA 4B9XA 5TGTA 3HM9A 3V1OA 5J1EA 4EP5A 2MAMA 2XAUA 3OBWA 2D1VA 1JI8A 1VF9A 4EJOA 1B34A 3M0QA 2KFNA 1TT5B 2EQJA 3O5BA 2GAUA 4I9LA 3VQ6A 2Q0UA 5CYQA 2AHJB 4LFUA 4AFQC 3CQYA 2GIVA 1XQSC 4AF1A 1WXUA 3PSIA 3I35A 1K4US 1BC7C 4F7UB 4RAGA 2DM1A 5I11A 5DM7F 5ILUA 1MU2A 5HKCA 2A42A 1HKQA 4RGUA 2NZTA 5CQXA 3TSWA 1EZZB 4BHCA 1YIOA 4A5MA 2PFUA 4WXCA 3ZQQA 3EH1A 4F7UF 4L3QA 3WU0A 2RD1A 3LSGA 1O7FA 3U1DA 3DYAA 4FM1A 1SMYF 3K4BA 3ABKH 2D6FA 3G71A 2ASMA 4DOWA 3E6MA 3GBQA 2Y30A 1E4GT 4C8QB 2B0LA 2DOAA 4CERA 5AQNA 3M4GA 4C8MA 2Q0OA 3I64A 2LT1A 4C8QF 3ABTA 1WIEA 3RR7A 4Y17A 4NS5A 3S17J 1BI0A 3I58A 3RWUA 3HOYJ 1HKSA 4X9DA 3RYRA 2LJ3A 4NB5A 3V1RA 4LDVA 4N4HA 5AQVA 2D1HA 4NXNK 4FX0A 2ICWG 5J3LA 1R0BG 2FSNA 1KQSM 3K4NA 4EM0B 1T2KA 2J4RA 1NGIA 1V1CA 3HGYA 3ENOA 4IVNA 1XMOK 5D6FA 2LCLA 3LALA 4HX8A 4D0PA 3HFOA 1USSA 1EH6A 2MD5A 2E36A 1BIZA 3ID6A 4CUGA 3IAS2 3I8DA 1HC8A 5AQXA 1OQKA 3K1MA 1M3HA 1PRMC 4KRTA 2YPRA 1OKRA 3CPWM 1LKXA 2JWKA 1VQ7A 2RK2A 1TS9A 1FP2A 2W7NA 3EG3A 3D1NI 2NS7A 1MMAA 2Y1IA 2L9SA 4E9GA 4GO1A 1OYYA 2M0MA 3GNGA 3CJBA 2NVQJ 4Z4HA 3MCAB 1T3LA 3H0GJ 2O01E 4E9HA 1S9EA 4KBMB 1AKHA 3QP6A 2VG7A 4EMKC 2R5YB 4OWRB 2NLUA 3VS0A 4KREA 2I10A 2G8VA 3IMXA 3KNTA 2NWMA 3JRHA 2P51A 1QW1A 1HBXG 5FLVA 3FLCO 4CGJA 1J5YA 1DGRM 3HTVA 4JYAK 4JK9A 4V19K 4JJBA 3SZGA 4LG3A 4J5YA 4Z0UA 2VPRA 3COAC 1WHKA 1NK8A 1Z9ZA 3BOQA 2ABLA 2AK5A 2IXSA 3WNFA 3K0LA 5KVRA 3E19A 3J7YJ 4DR4K 5AFUA 2L3SA 1B7TA 5SWMA 5GAOq 1WJSA 2L4AA 3I4PA 4RB0A 3CC4Q 3H3OB 1HPZA 1N3CA 3ZL7C 2A68F 1NK3P 2E2IJ 3G4SA 1B9MA 1YITI 3PIPF 1O4XA 2COMA 1NKBA 1RUWA 1RT4A 4M78F 2YNHA 4NCGA 5ICFA 2RN7A 2DOFA 1HSTA 4FX4A 2Z16A 2ETHA 1BOAA 1W70A 4JKAA 2CKKA 5HCKA 3J80K 4NL3A 6AT1B 2HVIA 3CC4I 4HVUA 2DPNA 2K9MA 3S1RJ 1ZQ3P 3B02A 2ZM6K 3JRGA 5AQQA 1G2BA 1XX5A 2NOZA 1W2BP 2QQ8A 5AZJA 4JKHA 3U9DA 4EIAA 4EM2A 3S9HA 3DWLE 1KD1O 2KIUA 3P83D 3VF4A 3KJVA 4J00A 4FYWB 1U2WA 3WUHA 2R4GA 3TSQA 4I7HA 4XMYA 3DV8A 4LFBK 5GMKm 5KGWA 3HHGA 3CBOA 4X9CA 5J40A 2ZXIA 3TCJA 4CECA 2BBYA 3MO8A 2HXOA 3JXUA 1TK8A 3M5RA 4KH4A 2A7YA 1VYVA 1QKXA 5F0HA 2MI6A 5HNFA 2FB7A 1SKRA 1NJIR 1R49A 3T1YK 4EATA 1ETWA 4FZXC 1VSIA 2DETA 4ANJA 2XV4S 2UYTA 3BWGA 1GUUA 3TGNA 1U5TB 1SL1A 1HPMA 3RTRA 4AHUA 3MEUA 4AIHA 1TWBA 3CO7C 3SJMA 3F73A 4L5IA 2QTVA 2WADA 3VS2A 1MUDA 3CJCA 2ESNA 2HKOA 1UJ0A 1CKAA 3IHOA 4FSVA 4KT0E 3WVEB 4DV3K 4QVZA 1UZCA 2KAFA 2K27A 3NWTA 3ZT1A 1ON2A 3H0IA 1K78A 3OYEA 4XKVA 3RCOA 4L9VA 3AHUA 1EXQA 4M3DA 1FKOA 1LQ1A 3O8HA 5D6WA 3L4IA 2QSFX 3C1DA 4CD3A 3H1VX 1ETXA 5K5RA 1U04A 4PA1A 2MK5A 1ETKA 4DEYA 1GV2A 3HZ6A 2KHOA 4LF5K 4FWKA 2JNGA 1S1UA 3FZLA 5AQZA 3WU2C 9ATCB 2GWJA 4RTUA 2ADUA 1Y8RB 3ZQFA 2QASA 4EVVA 1O57A 1U6GA 2EZHA 5E41A 3PE0A 1ZKGA 4XSXF 4AVPA 3VJPA 1S7EA 4J6WA 1U2VA 3H46O 1R8OB 2MYSA 2JHJA 4HUGA 1LWEA 3MP1A 1QCNA 2GNCA 1UEBA 4FZZA 1RBTA 4DV6K 5JVGL 2LQNA 3BJAA 3PV8A 1YJ9Q 5EDNA 5FKMA 4LSLA 5GAEP 3BR6A 2VT3A 4HHTA 2DYIA 3RPUD 1ZUKA 1P4XA 4BC3A 3DJCA 5F64A 3E9GA 3DRSA 2JM8A 2L2PA 5ILSA 1FT9A 1RT6A 5GANe 1YIJI 4Y15A 1HOMA 2HMPA 3RKXA 4DUZK 2I5JA 3WTXC 4KHNA 1YW9A 1QZYA 1QQNA 3AG2H 1KLMA 1BOBA 2DVEA 4N47A 5LHIA 4YPHA 4B09A 1AOJA 3GVAA 2CH6A 1VQ5Q 2KROA 4JI2K 2HEQA 3S15J 1GXQA 2ZNYA 2YKMA 4JKCA 1OZ2A 1NK7A 3RERA 3QPHA 1WNSA 4B9WA 1NJXA 3BTIA 2E71A 4JD2A 1P9QC 3VUBA 3CFOA 4O5FA 2G0EA 4LD6A 3V8JA 4MLEA 3DBRB 2MC4A 5E3OA 4C8QE 1T08B 5DCMB 2YU9J 1CGPA 3EKUA 4FASD 3ERMA 3L1PA 4H5NA 3KYLA 2Q36A 4HEA2 4Y52J 2KNBB 1OX9A 3JB9J 4KB0A 1E7OA 1YRNA 5DY9A 3ABMH 3SQ2A 4H0OA 5GAMf 4BR7A 4YOTA 4O8UA 1AHJB 5B1BH 4ENMA 4HDVA 2EX3A 3ZMSA 4A0XA 1YITT 1KU9A 5F6FA 2JA5J 3QBWA 2EYYA 4NCAA 4NNJA 3JRBA 2H8RA 4ISGA 4PKHA 4X66K 1OH7A 2QTXA 3R6OA 5LL6S 2E2PA 4DSIA 1HW1A 4KMUX 2P4RA 4N0AC 4M74A 3FIWA 3QIOA 2L7ZA 4IO8A 3ZQCA 3V9ZA 2XDDA 4XLFA 1VA7A 2OPSA 1TP4A 4F92B 3S8PA 2PFBA 5GAMg 4W97A 1RC9A 4ELUA 3IH7A 1JJ8C 1UG2A 2XPVA 1HQCA 2XKOA 1K8KA 3CZ6A 1BL0A 3I55N 4CHQA 4YORA 5M1QA 2ZGZA 1VRLA 2XGXA 1HXDA 2JTVA 1V76A 2A61A 1XSDA 3GFLA 1RIOH 2NNYA 1SPKA 1XSVA 2ISZA 2MFZA 3BR3A 1KC8O 5I21A 3FWEA 3BPXA 2FNAA 1UGQB 3P9KA 4EP4A 4BRPA 4AI5A 4HV5A 1U3EM 2BXYA 4YOUA 3FLGA 2H8WA 4GV9A 3KXTA 1S1VA 4B8CA 1QP2A 2O8EB 5C2DA 1Q81R 2CUFA 5D8LB 4A57A 4JX6A 4J83A 2ZO4A 2P9KA 2K85A 4OOIA 2HF3A 1U48A 3J81O 2A37A 4IUTA 2PLYA 3TTDA 3J7AY 1J0RA 1X9MA 2A6TA 3MKDA 1E3OC 1QP3A 3MKLA 2P9UB 3MX2A 4B22A 1VQNA 3G71I 4A2AA 1ZLKA 3FC3A 1U1TA 2DO3A 4G9YA 3ZQLA 2ZZDA 2FF6A 3BF3A 2EGAA 3LFUA 2WOMA 1QTMA 1RESA 2ESWA 3DEEA 1IRFA 4FYXB 1WI9A 1V29B 4F52A 2W41A 3PUBA 4NB4A 3M8RA 8ATCB 2EWSA 2FPEA 2DYRH 3OYIA 2A6HF 3CC4N 2R7OA 2PU9B 5EEAA 2E3HA 3EUHA 2LVSA 3KLGA 3U4LA 3CC7A 1FJLA 2K6DA 3R8EA 5EOYA 2JSPA 5HLHA 1J75A 1EX4A 1OULA 1AVZC 2A36A 3RESA 1ASVA 3SXYA 2EA4A 2A6AA 2EQMA 2EPDA 5FLMJ 2L8DA 1SQKA 4DNCA 1ZRCA 4BRIA 3EYIA 5F1XA 1U4BA 2VVKA 5CQYA 1VQ7T 1J54A 2GXGA 2F96A 1U0JA 2R7FA 2LSNA 1OQYA 2QWRA 2B6AA 3C6UA 3GNFB 1KD1U 2VC0A 2DKGA 4BYYA 4BC5A 5IHNA 1QWEA 2JWTA 1KJWA 4PSWA 4XICA 1Q86R 5JS2A 1X27A 3GL1A 1O7LA 4JOMA 2IA2A 4I7FA 4I2OA 4F7ZA 4RA2A 2O6GE 2DX1A 2LMJA 1VSMA 3WGGA 3IL2A 1VQ7Q 3F8MA 3NFAA 2Z1JA 1FBQA 2V8IA 4QVDA 4KGVB 1Q7YR 2F7TA 4EJWA 2NRVA 3PO2J 4RW6A 5AQYA 4LG0B 2DMOA 5FLXO 3D5LA 2KBTA 1IO2A 4MDBA 3QWXX 2DF6A 2IS6A 2XB5A 5FLXE 4WXDA 3VGLA 4M75B 4YDUA 3GFIA 1WJBA 1FYMA 2VXZA 1TG0A 1X3ZB 2WUSA 2E7WA 3J7AF 3E0JB 1PG5B 5GAN4 4JI7K 1JKQC 3N5NX 4BACA 3SYZA 2YV0X 3KEOA 4CRIA 1J2XA 3B6OA 4M41A 2ISYA 4JYKA 3KLFA 4XKBA 3G1MA 1AWOA 5HRNA 3H9GA 4WK8F 1VQ9A 4BJ6C 4WXHA 4IQJA 2EGCA 4F16A 3C7NA 4KHWA 3G7ZA 2JTMA 4FL6A 1IC8A 1LW2A 2BY3A 1M90C 2PYLA 6PAXA 2NRHA 2X6WA 3ZSYA 3QEPA 1WBDA 4LXCA 1YJWA 1ATRA 3QYEA 2IS2A 4KBOA 1ITYA 3CCSQ 1YOVB 3WODF 1AOYA 4ESRA 1VSDA 4CHOA 2VL8A 1U8RA 1VQMN 4A3KJ 2P9IB 4BRQA 3LM2A 3JB9H 1NNEA 1QZZA 4IWVA 2NYSA 5J3BA 4DV0K 1NKUA 3T1HK 4FK2A 1CKBA 2WBMA 2OTJI 1WI7A 3VYHB 1FSEA 3F8NA 3QEWA 1X01A 1R1TA 2JGUA 3K9TA 3CCSN 2ZJQL 5GIOA 3I9QA 1XMQK 1ONVA 1EETA 1OU9A 2DBKA 5KE2A 3HSBA 3PNTA 3QERA 1HJOA 5KYWB 4YEJA 2EGEA 5HBMA 2IGKA 2KIMA 3M0TA 5BPNA 2EW3A 3PIOL 5ECAA 4GY5A 1KEAA 2WAQN 5BS6A 5DCFA 2KFZA 1CZAN 4N0AA 4QT7A 1QKWA 1DLOA 4AQYK 1WRJA 4CO8A 1N8RC 5I3UA 4AI4A 1RACB 2QQRA 5GAN6 1WHJA 3ZT3A 1BOTO 2BH1A 3OBYA 1OR7A 1XPXA 2O8EA 4ZN3A 2DBBA 3TWHA 4IEEA 3WTVC 2RQRA 4DYQA 4UY8O 1Q18A 1HYOA 1DIZA 2FO0A 3GF5A 1BR1A 2XUBA 2ZGWA 1MUZA 1RRSA 1I1GA 4LB5A 1Y0MA 2D8HA 4LLGF 2CSQA 2NVTJ 4A63B 4BGBA 1KRPA 3CPWA 4IEJA 3NF6A 4FHTA 3CCUA 4PJNA 4OPAA 1BKBA 1W7PA 2VQFK 3HSTB 2QA4A 3JSPA 4A62A 4IG0A 2CH0A 4BL0B 1KC8R 5H6QA 4E7HA 2ID6A 2VG5A 3UA6A 5JHUA 3S93A 3ZSWA 3JB9D 3DLLL 1KC8C 4M3XA 2NUPA 4XU2A 3KP6A 4HF2A 1FYNA 3MDQA 2IA1A 2WV0A 3CCLT 3OS2A 2L5QA 4K43A 5GAHP 3VS3A 4C8QC 4XH1A 2QKMB 5TRDA 4LJZF 1B3QA 5CKTA 4WFBL 1J7KA 3ZSOA 5K14A 2V1QA 3EKSA 2HHQA 3LX7A 1IV6A 3CWTA 2LCCA 4GLMA 2WAEA 2F9TA 5E8IA 1KTQA 4C8QD 4J19A 3OL4A 4IRHA 2QTDA 1UA1A 3QWLA 4MEYF 4BWJA 1YTUA 5KYYB 3CCMQ 3BP8A 1N77A 5HLFA 1D8JA 3EGDB 1T3SA 3CCEI 5AIQA 2E1ZA 1W5TA 2MMPA 1HYSA 3IH3A 3W6JB 1NGNA 3SEQA 1F4KA 2M34A 1O3RA 2E8AA 4LITA 3KZBA 2ZMEB 5FRMA 3PFIA 4E7LA 2OCCH 3T5XA 2DXBA 3ZETA 5CHZA 2PTKA 4BDPA 3D4VA 5J2PA 2MLGA 4KFBA 1X1AA 2B4JA 3NCIA 3AO4A 1HJRA 3IUCA 3GTPJ 4K8ZA 2FOWA 4EW4A 1TLHB 4YOXA 1QQCA 5KAFC 2YLCA 3TW7A 4BDZA 1YYVA 3G71T 3OYAA 4GVEA 3O5ZA 3AA3A 3C7JA 1UA0A 1G99A 5GAMh 4ZGJB 3CXCM 2KSSA 4PZJA 5T7BA 2ZD1A 4CJ4A 3SUOA 3C7NB 3P38A 5C15A 1LUJB 3EL2A 4FT8A 3QDFA 3I8BA 4M7AB 2DAQA 2CQNA 1VTNC 3EG9B 1KAYA 5BN8A 5LGTA 3BY7A 3KLIA 1FOYA 1UHSA 2K3BA 3QYFA 1KHCA 1M8MA 1ORPA 3I5RA 5M1FA 1G4DA 5L23A 4C3IJ 3NWSA 1IRXA 1BI2A 1LEBA 2W85A 3N4PA 5JLHA 2PBIA 5GIPA 4HX4A 3ULDA 3BW1A 4XTWA 3CVTA 4C8QG 1ZYQA 3OW2A 1PHTA 2DQRA 2PNIA 3C3WA 4LD0A 3AA5X 3CQ8A 2E1CA 3HSRA 5LJ3g 4XTVA 5LJ5d 2E6LA 4RCBA 3T8TA 4UUSB 2VQHA 3PNVA 1D0XA 3KP2A 2BY2A 3QPSA 1NGJA 4C1NI 3CCUT 3CG7A 1KAZA 3GP8A 2YS9A 3M0RA 1NU0A 4TVRA 3ZN0A 4IJNA 4LDXA 5GP9A 1REPC 3R61A 2EQUA 5EXWA 1BM9A 3A0IX 1M8VA 2GBYA 3VERA 1NEBA 3THKA 1VQ7N 1HKTA 4OMPA 5F27A 1SD4A 4DTPA 3ASNH 2QAZA 2HQAA 2QQSA 1M30A 2OAZA 3V4GA 1IHVA 1ON1A 1XWLA 1RNLA 2X48A 4XAXB 2QWPA 1YS6A 2HZYA 3ITHA 3FF5A 3NVKA 3SZ2A 3HSCA 2E35A 3LL3A 1K79A 2FEIA 1A04A 3NPFA 1HLVA 2ZNZA 1NJIO 4PQUA 5HDNA 2RPIA 4M42A 1GOAA 4P96A 2QGUA 3ZXSA 3THVA 4UVCA 1UG1A 3VA0A 5DTDA 3DI6A 2FXAA 1NYGA 2VONA 3RRGA 2X1EA 3CC7I 3VEYA 1YIJQ 2CP6A 5J26A 2P0QA 2JUCA 2PQWA 2EB7A 4M7DE 3EFRA 2DAOA 2WSEE 1LWWA 3CCJQ 3OS1A 2XDVA 2KGTA 3KYCB 5IXBA 4KHQA 4KGXB 3U21A 3LSMA 5IPAA 1YF5L 5GMKi 3VYTB 4CFCA 1X3NA 4ELVA 2BY1A 3MEVA 1GLAG 1GXPA 1ACMB 2F8TA 1YVUA 3M57A 2YHBA 3UE5A 3O9RA 4BQNA 4QAGA 1AWCA 1D8KA 2GFUA 2D0CA 3P31A 3F3XA 3K57A 2XB0X 4AFUC 3CJAA 2YNFA 4OVLA 4CFBA 2DL5A 3NARA 1QHTA 5DM6L 4H4OA 2OJED 4DTNA 1L0OC 4J2EA 4CDGA 1D3BB 3REOA 4M77E 5A2QE 2RN2A 3CD6A 5AQUA 1U9NA 3MZHA 1WKMA 3J80Z 3VV0A 3GTGJ 5CZ2A 1QRYA 2DMPA 5A2QO 3W2AA 1Q82R 4BI8B 3ZCOA 5LEJA 4B9MA 3C12A 1ZUYA 3KK2A 1MSFC 1DU6A 4Q4ZF 3WVDB 3LPTA 3WXMB 2V1DA 4HAMA 3X2QH 1FPQA 4ESJA 1N8RR 1VQPI 2TRTA 1YXQA 4NYNA 1RPWA 2DTHA 2Z1GA 2VB6A 2PX9A 4CJVA 1IKXA 3IKMA 2KP6A 3A03A 1ZTRA 1PKTA 3P7NA 1YIJT 2V1XA 3VYUB 3RDIA 2FRYA 5A2QZ 4B08A 1U5TC 2MG4A 2E1OA 3GZ6A 2FZGB 4QS9A 3G6EN 2WSCE 4XH5A 3IG1A 4FLZA 4RTFD 2KR3A 3QEXA 1SSFA 4BE0A 1R0AA 4KICA 1S72N 1XI1A 3CC7N 4AT1B 2QDLA 2KQRA 1YJ9I 4FT2A 1ZHIA 4UQGA 2F69A 3I33A 3CCVA 4IOAL 2FBKA 3L2QA 3H0FA 4C9YA 3I54A 3RQ4A 1LW0A 5DD8A 4IFEA 2QKKA 4PJOE 2VXDA 5M5YJ 2EJFA 4JLGA 2XRLA 2HBJA 1WHLA 4XR6A 3A0HC 5E79C 3GE1A 1UECA 1Q81U 2M3AA 3UB5A 2A3ZA 1WGSA 2W6KA 1R4NB 5JLWA 3NTIA 1VQ5I 1T44A 4JI3K 2CP0A 3U6FA 1LFUP 4M78E 5FU7C 3GTLJ 1KQSP 1XG1A 4JS5A 3UKRB 1OZ3A 3NVMA 3O08A 5L3DA 3QZ5B 3IDHA 1BR2A 3ULQB 2DNUA 1YVNA 2GTOA 2EPFA 3QHSA 4G7HF 1T3VA 2AKKA 1C1BA 1PM3A 2KW4A 5E1WA 4PL7A 3IFRA 4OLAA 1S5LC 1TZLA 4X62K 3EG1A 1SFKA 1TC3C 2F5DA 4GXOA 2ATQA 2EIMH 5IWAK 5CY4A 4HCCA 4B1WB 3CWSA 2H1LA 2IVPA 5IXFA 3G25A 3OR2C 3G73A 1SRMA 3R60A 4DQRA 1MDMB 1NGFA 1HA8A 3SMPA 1ZBSA 4ETSA 4OFHA 4DFMA 4CW7B