3OYFA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti l-870,810
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 109
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyfA03
4MFBA 1SUQA 4CJPA 2B4JA 3QEXA 3OYKA 4QCLA 4J2AA 1BI4A 3DLRA 3DMJA 2OZMA 2FBVA 2G8FA 2EQUA 4DFJA 2RHZA 3U6FA 2K3YA 1VSJA 3RR8A 2HHWA 1ASVA 3VQ7A 4IG3A 1HQEA 4C8OA 3CFRA 3OYJA 2HMIA 1RT3A 1ZYQA 4B9UA 4DTUA 1RBTA 1S1WA 4CJ3A 4KO0A 1TK5A 1IG9A 4E1MA 3BDPA 4LSNA 3QINA 2LVMA 1UA1A 4EZ6A 1TVRA 4CEBA 3PO5A 3ZSYA 3KK3A 1XNIA 4KPYA 3H08A 3RWUA 2IDOA 5CYQA 3OYNA 4BE1A 1Y97A 4CK1A 5D3GA 3LDSA 1RI0A 3AVBA 1GOAA 4LD0A 3HJFA 4DTSA 3C94A 1UA0A 3OYCA 1VSIA 1TL1A 2RJEA 3HSTB 4AHSA 4CJKA 4FK2A 4LD6A 1RDCA 4E3SA 4RW6A 4PL6A 1XWLA 3U3GA 4QOZB 3FLGA 2IGIA 3NDKA 3UWNA 4E7IA 3B6OA 3DI6A 3QNNA 3WNHA 4KAZA 1X9MA 1BQNA 1BCMA 4Z4IA 1BCOA 3OVNA 3QETA 2X4YA 3E9GA 4W5TA 4IKFA 3ME9A 1KVAA 4FLTA 1CLQA 4RG8A 4KHQA 2HVIA 2FC0A 3IS9A 1S1UA 1H3ZA 2X6SA 5KTQA 3AA4A 4CHZA 3M9QA 2XDPA 2G8KA 1L3VA 3LPTA 3FFIA 1VSMA 2RHXA 4FW2A 3RMDA 1TK0A 3HYFA 4DTJA 1HQUA 2X35A 1VSEA 2JZ2A 4UC4A 3V9WA 5FRNA 4H8KA 1RDDA 1WN7A 2ZE2A 4HVJA 5C25A 2M16A 3L42A 2OPPA 3C95A 1NK5A 3V1QA 2O4GA 4IUPA 1SKWA 2E6NA 1YVUA 4CFBA 3TAEA 3L2WA 1TL3A 5HRRA 2BUDA 5KGXA 4RW8A 1NKEA 4EP5A 1X9SA 3ZSVA 3KIOA 1RT2A 3AA5X 3AVLA 2RPIA 3DLEA 1XHXA 1WSEA 5IAYA 4OJRA 3AVMA 4CJQA 3QEPA 4BDPA 4Z4EA 4KREA 3V6DA 3F73A 3F70A 3GOXA 1YT3A 4I7FA 4DQRA 3PX6A 3SD4A 1NJWA 2LTOA 3DLBA 2YHBA 4OKKA 4DLGA 1KVCA 3SPZA 2GFUA 3OYIA 3UIQA 4I9LA 1QSLA 5D6YA 5T7BA 3HO1A 4RG2A 4DSJA 4FJXA 2FBTA 2A1SA 1KCFA 1IKYA 3SPYA 1BISA 1KSPA 1WJSA 4DWIA 5KH6A 1YTUA 3VQ8A 3NAEA 3TAFA 5J1EA 1C1BA 4LH5A 3OJSA 4OGEA 1C6VA 2OPSA 4QQGA 1W0HA 2D5RA 1U47A 3VQCA 1RDBA 1TKDA 5KE3A 3ASMA 1O1WA 4IFVA 3MEUA 2OYQA 3HXMA 2F96A 3VQEA 4DU4A 4N4HA 2QXFA 1JL1A 3NGYA 2BIVA 1JKHA 2WACA 4IUTA 4A4HA 4FVMA 3P8HA 4I2PA 2BKDN 4CJRA 3PV8A 3QO9A 4ZTJA 4C8MA 3KUFA 1TKXA 1G15A 3TAQA 3O4QA 5I3UA 4KI6A 3C6UA 1L3SA 1TAQA 4CGGA 4AHVA 2P51A 1VSHA 1HRHA 3CQ8A 2HHVA 1JLQA 1WAFA 2ATQA 4CFAA 1NK8A 1VSFA 3EAEA 3MXMA 3DYAA 4JRQA 4EZ9A 5K14A 4KB1A 3V9SA 1RNHA 4CRIA 1EETA 3C6TA 4O4GA 4TSXA 4CF0A 4B3OA 3LWMA 2VG5A 5KE2A 2KW4A 2I5JA 4M41A 4YNQA 3L8BA 4E1NA 3TANA 1RTHA 3ZT0A 4FJNA 1BHLA 3V9ZA 4BD3A 3MEWA 4IURA 2QQRA 3ZCMA 1U48A 1D9DA 3PMTA 1X9WA 3RMAA 4FW1A 1TAUA 1RTDA 4E7JA 4KB0A 4CJ5A 4KTQA 4W5NA 4IUQA 4B08A 1KFDA 1U49A 1S6QA 3SQ4A 1NK4A 1DLOA 3LP1A 4IBNA 3I0SA 4RW7A 3EZ5A 3QJ6A 3ZSZA 4DFMA 4NYNA 4FM1A 1JLEA 3QEVA 4CJ4A 3MECA 4OPJA 1J5OA 5HP1A 2YV0X 4CFDA 4KHNA 4Q0BA 3DB3A 1RDAA 1ZBUA 2KQ2A 3OYDA 4OVAA 1C0TA 3AVGA 3HPGA 4BDYA 1D8YA 4BE2A 4J2BA 2GFAA 4FU6A 4Z4HA 3AVCA 2G3RA 3CFPA 1A5WA 1JLFA 1J9AA 3MEDA 3L2VA 5DMRA 1BIUA 3AVFA 5KGWA 3V4IA 1EXQA 3MP8A 2L8DA 3M8PA 2OPQA 3HT3A 1SV5A 4GW6A 5C0MA 4CEEA 1MU2A 3K5NA 4Y1DA 3K57A 5J2NA 1QHTA 4IFYA 2G8UA 4LY7A 4LSLA 2HNYA 2X4XA 3LALA 4CE9A 3NBPA 2P0KA 1DTTA 3L2RA 4CIGA 2XHBA 2G8VA 2XY5A 3QIPA 4R5PA 3HP9A 3KLEA 3FC3A 1SKRA 3KK1A 3AVJA 3QIIA 2XY7A 2X6NA 4NCBA 2X78A 1WSJA 2PYJA 4NCGA 4JS5A 4PWDA 4FLZA 3NNQA 3L3VA 4QAGA 4X34A 5HRNA 2VG6A 3O8VA 3M8QA 3K59A 2YNGA 4CGJA 3V81A 3QBYA 1X1PA 3WNFA 2WOMA 4CEQA 5KRSA 2VG7A 4W5OA 4CGDA 3NGZA 1KRPA 3PO4A 5CZ2A 5CYMA 4FLYA 4EDUA 3Q1JA 3O3FA 1LAVA 3LPUA 3K5OA 3O4NA 4II1A 4PY5A 3ZEHA 1T03A 2P5GA 3DLKA 3VQBA 3DOKA 3LP2A 3VQQA 4ZHRA 2ZQBA 5D6WA 5HROA 4IG0A 1RT1A 4CERA 1Q8IA 1G5VA 4M3RA 1F21A 4L59A 3PX4A 2DTUA 4JLHA 4HTUA 2DFEA 3TI0A 2BDPA 1WSFA 2KZZA 5KRTA 2FBYA 3AVAA 3V1RA 3V1OA 4FCYA 2B8AA 2EKOA 1FK9A 1RTJA 4BACA 3OYAA 3NF8A 3B6PA 3K5LA 4DTPA 3BGRA 2GV9A 4DTRA 4ID1A 2B5JA 2QQSA 2D9TA 5KCHA 4FJGA 3O3HA 2E6LA 3ISNC 5DK5A 2IS3A 1ZBLA 1T8EA 1OYXA 1C0UA 4DMNA 2HNZA 1CZBA 2YHAA 1NJYA 3IAYA 4FJ5A 4CHPA 4CF2A 2HHQA 3OMCA 4C8NA 2D0AA 1VRTA 2VYTA 4CESA 1NK0A 2X4WA 1L5UA 3SV4A 3JYTA 4Z4CA 1S1TA 4KHYA 1S9EA 4N5SA 4J2DA 4C5EA 3JSMA 2E4LA 1KVBA 4WE1A 1U45A 5D6XA 4CJUA 3EY1A 5HRSA 1LWEA 1SL2A 3OYGA 2RHYA 3DLMA 4OKEA 3TARA 4C8KA 2M0OA 4I9QA 2JGUA 4FK4A 4KTZA 4FLXA 2MWPA 1JLBA 5I42A 3P8DA 2R7YA 3DLHA 2AJQA 2EFIA 3QERA 1NK9A 4DFPA 4B9NA 4FJ7A 4DLEA 2W42A 3S3MA 4FJ8A 2FHDA 4CHOA 4FM0A 2QKBA 1VSLA 4O5BA 1BI4B 4CEDA 4EP4A 1FXXA 3SI6A 1KLNA 1D9FA 2DIGA 2LDMA 5CIUA 2HHXA 1C0MA 1VRUA 1WSGA 4H4MA 4XIUA 4OGCA 3VQ4A 1LV5A 4N41A 4DSKA 2RF2A 4DG1A 3OS0A 1UAXA 3T3FA 3NCIA 1C1AA 4FJMA 2HNDA 1DTQA 3KLIA 3OYLA 5FDLA 3O3GA 4KI4A 2EQKA 3QEWA 3LP0A 2F8SA 1S9GA 1QS4A 3QLHA 3P83D 3LGFA 2XY6A 3LAMA 1K6YA 3PUFA 2G8IA 3L3UA 4KTWA 3L2QA 2EQMA 2R5MA 4OKJA 1RT7A 4N47A 3WNEA 4FM2A 1L3TA 4C8LA 4B9LA 3KKSA 4KV8A 4FJIA 1IKWA 1WJQA 4C5HA 2R58A 1OZ2A 2K3XA 2RJCA 3KLFA 4DSFA 4Z0UA 2PZSA 4F3TA 3MP6A 2OPRA 4QQ6A 4DTXA 3QKJA 1OZ3A 1VSDA 4CFCA 4DS4A 2LSNA 4DSEA 4A4FA 5KI6A 4CJVA 4E19A 4BE0A 4AHCA 5J26A 4HUEA 3AVNA 1I3AA 3IG1A 1TV6A 1T7PA 4QW2A 4B9WA 3AO3A 2BE2A 5JS1A 1HYVA 4A4EA 3DLGA 5M9OA 4Z02A 3ZSQA 2IG0A 2YNHA 4FLVA 4DQIA 4E7HA 4PLIA 5J2PA 2P1JA 3K2PA 4B8AB 3SYZA 3RRGA 3TABA 4IDKA 4J2EA 1XHZA 2P5OA 2XY8A 3PNWC 4FZZA 2HHUA 4B9SA 3ZSXA 2CKKA 3NH2A 4IUVA 3G0ZA 3TWHA 4DTNA 2ITGA 4M3UA 3BDLA 2RJFA 1QE1A 1WSIA 2GF7A 4CECA 4E89A 2VWJA 1WSHA 2R57A 2PQWA 1WNSA 3CFOA 3VA0A 3V9XA 4DSIA 1KLMA 1BL3A 5E41A 3ZT2A 3EYZA 3LAKA 2E5QA 1RBSA 1S1XA 3QIOA 3HP6A 4M3ZA 3CEYA 4FL6A 4B9XA 2RN2A 2A1RA 2F5KA 5IN1A 5C24A 2LCCA 2G8WA 3PY8A 3OS1A 1R0AA 3SZ2A 3VA3A 2FBXA 3LZJA 1RT6A 3LYIA 4OVLA 1RT4A 4N56A 4FXDA 3VQAA 4C5IA 1QQCA 2Z1HA 2RI2A 4ID5A 3HM9A 1HPZA 2IOCA 1SL1A 3LWLA 3NF7A 5SWMA 5CY4A 4Z4FA 2R5AA 4BDZA 4HUGA 4FZXC 4ELUA 3IRXA 3WNGA 3KJVA 1U04A 1CXQA 1LAWA 1NOZA 2Q3SA 3E01A 4CJFA 1BQMA 4CJWA 1HJRA 4YFUA 3LGLA 4CK2A 3OYHA 3TAPA 2DIQA 3UT1A 3AVKA 4FYDA 3KD1E 1REVA 2YKNA 4CK3A 1D5AA 4B9MA 4ELVA 2OA8A 4F3OA 4CEFA 4CJEA 3CM5A 1VK0A 4JRPA 1BGXT 1KHCA 5J39A 3SQ2A 1A5VA 3VQDA 3S9HA 4FJJA 4DFKA 1TK8A 3NGIA 4CJLA 1J53A 1VSKA 2Z1JA 2B6AA 4MQ3A 4DF8A 1UWBA 2HQXA 2ETJA 1SSFA 4M3XA 1RTIA 2D0CA 3RRHA 4QVZA 4CGIA 3SUPA 3OMGA 1T05A 3NH0A 3DRPA 3U3YA 4DQSA 3SUQA 3ZSWA 4M3TA 4Z4GA 5KCOA 3QESA 3NTIA 2KFZA 3LH0A 3DRSA 2EX3A 4FJLA 4DSLA 1EX4A 3P5JA 4FJKA 1JLAA 2KTQA 3K58A 3VQ9A 4IUUA 1ZBFA 4LH4A 3V9UA 3VQ5A 4O44A 4FLWA 4GVMA 4E7LA 3KK2A 2GUIA 1RCHA 1A5XA 3NTKA 3S3NA 4W5QA 4M3WA 1JLGA 2KFNA 3LX7A 1B9DA 4CCHA 2NLUA 4M42A 2L3RA 3KTQA 3FDRA 2HHSA 4JS4A 1WLJA 2IAJA 4DU3A 4CEZA 3OQ5A 4QQDA 1BIZA 3SQ0A 3OB9A 1SL0A 4CGHA 3CG7A 1LW0A 4AHRA 3NE6A 3QEIA 3OYEA 2VWKA 1QSSA 4N76A 2YNIA 5HRPA 4NCAA 1FKOA 3AO1A 3LZIA 1TKZA 3F9KA 2QK9A 3ASKA 3AA2A 2YRVA 4HCBA 1TKTA 4ICLA 3HVTA 5J2QA 2BGGA 4B8CA 3MO8A 5C42A 3MEVA 3DM2A 1RBUA 2DAQA 4NS5A 5FRMA 1GOCA 3I0RA 3MEAA 1SKSA 2Y1IA 3SNNA 4O55A 5CZ1A 4KFBA 2XO7A 4AILC 4OPKA 4Y1CA 3TAGA 3KLGA 5FROA 2O4XB 2RI3A 2D0BA 2RKIA 1HYZA 5SZTA 3OY9A 2MWOA 1RT5A 3SV3A 4FZYA 4B9TA 1S5JA 4FJHA 2RJDA 2BANA 4F4KA 2PYLA 3T1AA 2GBZA 2M1HA 4OLAA 1IKXA 1RBVA 3SUOA 5HLFA 3AV9A 1ASWA 4CHYA 2ZD1A 4I2QA 1WJRA 2RHUA 1WAJA 3AA3A 4E7KA 1LWFA 4Q5VA 1N6QA 4A4GA 5HBMA 4KHWA 4KKOA 3NH1A 3SJJA 4HHTA 2F8TA 3MP1A 4DTMA 1Z26A 1WGSA 3CYMA 3KD5E 3MXJA 3M8SA 1W9HA 3S3OA 4G1QA 1N5YA 3L2UA 3TR8A 3MAQA 3G10A 2LRQA 3META 1IH7A 1JXBA 1Z25A 4RW4A 3VN5A 4F2SA 3AO2A 2DFFA 3NF6A 1ZBIA 1Q9YA 4ELTA 1ASUA 3RTVA 3OYMA 1JXEA 4CEAA 1ITGA 4FLUA 3LLRA 2G8HA 4FK0A 4M3YA 1N27A 2RHIA 1EP4A 4AHTA 4CF8A 3FEOA 1HMVA 2NUBA 3SCXA 2JTFA 2X74A 3A2FA 2HQEA 1C1CA 3DB4A 1CZ9A 3MEEA 1B9FA 3P1GA 3ZT4A 4DS5A 1YTAA 1NJXA 2RI5A 3ZT1A 4HCCA 4Q5WA 1LWCA 4NZGA 4NYFA 4BWMA 4B9VA 4AH9A 4CJSA 4M45A 3ULDA 3ITHA 3S6WA 2YKMA 4KHSA 2DFHA 3HK2A 3OS2A 1RBRA 3ZT3A 3OJUA 3SQ1A 4ZTFA 1S6PA 3MXIA 3QNOA 5C6SA 3AO4A 3KLHA 4RW9A 3D45A 4K8ZA 3NF9A 4CIFA 2O4IA 4GMJB 4CHNA 4CJTA 3NFAA 2YNFA 1NKBA 3RMCA 4H4OA 4C5GA 2OZSA 4KHUA 3HPOA 4N4GA 3LANA 1KFSA 3OYFA 3NTHA 3DRRA 4O0IA 4DQQA 4HUFA 3ZSRA 1KTQA 3VQ6A 4GY5A 4OLBA 4HCZA 1IKVA 3HL8A 4PA1A 2O4XA 2EQJA 1RILA 2L89A 3H8ZA 3OYBA 1HYSA 1L3UA 5JS2A 1B92A 3ZSOA 2Y1JA 4CEOA 2XK0A 3D0PA 3PMIA 1J54A 4CF1A 4PQUA 1JLCA 1NK6A 1I39A 1FKPA 4CHQA 3PX0A 3I8DA 3LP3A 4AHUA 2Z1GA 3VQPA 3AVHA 3TAMA 3RMBA 3RR7A 1S1VA 4L8RB 4FJ9A 1OI1A 1MHNA 1NJZA 3H6ZA 3HVRA 1QSYA 4DQPA 1XI1A 4CGFA 1NOYA 1XC9A 4DU1A 4E0DA 3HPHA 2HB5A 2Z1IA 2XRIA 2HW3A 1HNIA 3OA6A 3AO5A 2IC3A 4N4IA 4O0JA 4PLLA 3E9FA 1UOCA 1EKEA 4CIEA 1HNVA 2PY5A 3ALYA 2JLEA 2HHTA 3AVIA 1NKCA 3K5MA 1JL2A 4BWJA 4DF4A 2QKKA 1IO2A 4K8XA 5EU7A 4CF9A 3M8RA 2WONA 3SUNA 3THVA 3NHGA 2KZMA 4KRFA 1ZBHA 1GOBA 3KKRA 1LW2A 1QTMA 3PFSA 1TGOA 4DTOA 4F2RA 2DY4A 5J2MA 4F8RA 4W5RA 2EHGA 1CXUA 3CM6A 3T19A 3DOLA 1Q9XA 2HVHA 4UQGA 1U4BA 2RO0A 3C4SA 1NK7A 2E6MA 3MEGA 4PUOA
chains in the Genus database with same CATH superfamily
2CUBA 1SUQA 4XLHA 4QCLA 2G8FA 3BZCA 2NS7A 1J75A 1Z21A 1TG0A 1ATRA 3CFRA 4EMKA 4WQ5A 2GZWA 4B9UA 4CJ3A 4E1MA 5F0HA 2A07F 2X4JA 1MW7A 1UGRB 4HW0A 2M8GX 4ANJA 1Q7YR 3FM3A 3H08A 4KFCA 2MCNA 3CO6C 1XQHA 3ZCOA 2QDYB 3CMYA 3ABKH 3PIPF 1LWWA 1BCMA 3BE3A 4W5TA 4IKFA 3J81O 2HVIA 4JDSA 2AQEA 2QASA 3RJPA 4HKEA 3URGA 2RREA 1WXBA 4C0ZA 3TDUC 3W6VA 1UJYA 1BUPA 3G2BA 3C95A 5HLGA 1LWYA 1SKWA 3RKXA 5HRRA 1MV3A 1IZ1A 3ZSVA 4OB2B 2OCEA 4ESRA 1FOYA 2PMZN 2R0QC 3CCUN 3EYIA 4NUBA 2GELA 2IS1A 1BR4A 5LHHA 1S72I 2FBTA 4GYGA 3JCMW 1VQ8Q 3N4PA 3VQ8A 3G6EQ 2WB1A 5GAN5 3LA2A 4QQGA 1G6NA 4RGXA 1D09B 3E6BA 4ZN1A 4NQWA 4F7UE 2MLGA 1AWJA 2VE8A 5GINA 1X4OA 1K8AO 1HNXK 3QICA 1L3SA 3JTGA 2E2JJ 3HHGA 4BNCA 2EFWA 1NK8A 3EAEA 1XN7A 2O2OA 4EZ9A 5K14A 3C6TA 4B3OA 5I9EB 3TANA 2I5JA 1KQSM 1FNNA 3H92A 3UF4A 3JRFA 4PJMA 4CJ5A 3HHHA 2ACJA 2NYSA 2CH5A 2I7PA 3KZIC 3KE2A 2IBDA 3OYYA 3ABUA 4KITB 3TDZC 1C0TA 3VU3C 3AVCA 1TWAJ 1RDUA 5BPLA 4CH7A 5KGWA 1GHCA 5FLXO 2LKPA 4FXDA 3L2RA 3HOSA 2OTJI 2D2WA 3ATVA 3FDYA 4FLZA 2HHSA 3K59A 4UV8A 1M1KO 4RM3A 1QVFP 2HBPA 3O4NA 2GA1A 3MCZA 4II1A 4I0BA 3ZEHA 4YPHA 1U6ZA 2KRNA 3I0TA 3G4SI 4C92A 1F21A 4M3RA 1T3LA 1SEUA 4RTXA 5BPIA 3BQZA 4WCEL 2LJ3A 4KICA 3GLLA 1Z9QA 1T38A 1IUFA 1FZPB 4XLAA 1O57A 1WHLA 2YHXA 2K5CA 4CF2A 5E3OA 1GFDA 3JRBA 1DU0A 5JLWA 2JS2A 2P9SB 3WT0A 1HYOA 1VQPN 3RTRA 2P0PA 2NRHA 4FK4A 1MMDA 4DFPA 2QKBA 3TGNA 3L9FA 4OGCA 2BHZA 2LT4A 4KGVB 1R4NB 3LGFA 2XY6A 3KX2A 4PGGA 5FLMJ 2ASMA 1NM7A 2V8IA 4RKUE 3GLXA 1RT7A 1YRNB 1BG3A 1IKWA 1WJQA 1RC9A 2R58A 3NAUA 1X3MA 1DKGD 3M4OJ 5EX5A 4G7OF 4N4NB 4LC9B 1O13A 4BVPA 1X6OA 4DQIA 2CQNA 3K4CA 1VQMQ 4IL6C 2L3QA 4B8AB 2LNVA 4DUZK 3CMEI 4I6MA 2XAJA 1K73R 1QWFA 4M78A 2E6ZA 3FSPA 3PY8A 2RQRA 2LCCA 3OS1A 1WQ7A 3VA3A 3VERA 4OVLA 5C4XJ 1QQCA 3CETA 3RSEB 5SWMA 4JJDA 5J1UA 3QPHA 1UHMA 1M2VA 1NOZA 1QVPA 4JKBA 2Q2EB 3A02A 3BZ6A 1BGXT 4LF6K 3SQ2A 2HDDA 4BQOA 1ULYA 3K70D 1VQMA 3WU0A 2DYRH 4J6WA 1NMNA 1M90C 2CV0A 1Q86C 5GAOm 1NKUA 2PBDA 4GVMA 1AWCA 3C2BA 5IXBA 3S3NA 2LR8A 4G12A 4IO8A 2LBFA 3G6EN 3J80O 3FDRA 3EYYA 4M7AC 2R7QA 2M0MA 1NPRA 4D5CA 1I27A 1LW0A 1K9MU 3I5UA 2K9QA 3ZQLA 1WZOA 1SVMA 3MEVA 1XMOK 2XMFA 3OH9A 4AM7A 5KN8A 4M78E 2DXIA 4F52A 3A0BC 2LX7A 3RPUA 4R56A 3OW2P 3EEQA 5E1ZB 1M3QA 3GBTA 1XC5A 1IKXA 1ASWA 4C92G 3IHOA 1WBDA 1GCQC 3MXJA 3M8SA 4Y4RA 4LLLA 3X28B 2DFFA 2V9KA 5DY9A 1VQNQ 2N8GA 4R79A 1I1SA 3EGDB 1RDWX 4AFSC 4BY9C 4AHTA 2WTUA 3L00A 1QVGA 2M87A 1VUBA 4PJOA 1YIJT 3FXMA 2FF6A 1NJXA 2RV8A 2QTVA 3TW6A 4ZYGA 4MDWA 3M0PA 5GAOl 2WWYA 3HKSA 2DFHA 2FB7A 3MXIA 2DXBA 1SFEA 1TW2A 1K8AR 5DD4A 1FYLA 2HNHA 2YNFA 2LP5A 2ZXJA 4U67L 4MEYF 4N9HA 4B23A 4MQVA 4OLBA 1NG2A 2YLCA 2QCOA 2X51A 3A5LC 2XK0A 1M30A 1FKPA 1C0WA 1Y96B 1XJWB 3LP3A 4AHUA 1Z0XA 1KYZA 3K4LA 5IHIA 2W4SA 4BRFA 4PSXA 2CDTA 2I2LA 3IL2A 1QVUA 3A5NC 3DWLA 2OTJT 2E10A 4UY8I 1M2VB 3UA6A 4C0GA 4M3BA 1NLPC 4F2RA 4DTOA 5HK3A 1VOMA 2UXNA 1JJ2S 4ILHA 3MEGA 2CUDA 1OLTA 3QB0A 3WGGA 2FBVA 3EG0A 2HHWA 1VQPA 3K1MA 3ISPA 2UYTA 1WXTA 2DD5A 4A3BJ 4ORZA 1GLLO 4EM2A 4XNFA 3CXCA 3CPEA 4ISEA 1XWLA 1LDDA 3HSCA 4IEJA 1CLQA 3OHRA 1ZA1B 3WG7H 3HPWA 3TO9A 5K7ZA 2V8KA 3HBLA 1Y1WJ 3HUGB 2W40A 4JI1K 1VQLQ 3FMSA 1TWBA 5AQXA 4FQGA 3HXLA 3FISA 4K25A 1X3WB 2IGMA 2OANA 3AVLA 3FJPA 1ZXOA 3M57A 3JRZA 2LTOA 1VQ4A 4ZH4F 1YLFA 5AQHA 2A40A 3ENOA 3BR5A 3ZMDA 2V1NA 1KSPA 2KIQA 2O8KA 2M9HA 2HL3A 2OPSA 1E3MA 4LB5A 3MEUA 2YX7A 1HX1A 4QS7A 2QXFA 4IUTA 5A2QO 2KRCA 1BA1A 5ICGA 5BRFA 4C3IJ 1HRHA 3OL3A 1MMSA 5GMKj 4JRQA 3K7AJ 3N0UA 2W84A 4ENMA 2Y4XA 3CMAT 1KO9A 2LQKA 4BD3A 3ZCMA 2KDOA 2JOYA 4DHYA 3JAMK 2FJ1A 4C0DB 1BI3A 5CR2A 1B1BA 3ZSZA 3A0HC 1X2MA 2HBWA 3MX5A 1JEGA 3RPQA 1PP8F 2EYWA 3M0QA 1W4MA 3MEDA 4K42A 3K69A 4HVWA 2VWFA 2A69F 1R22A 3NBPA 1DTTA 5KVRA 1ABQA 1WSUA 3LDQA 4FWSA 1SVLA 1PD1A 4PWDA 1ZSZA 1P2FA 4KYWA 3DLBA 3JSPA 5BOXA 3VETA 1UHCA 2WOMA 5KRSA 4II2A 5CZ2A 2M0CA 3O3FA 1FN7A 1YRNA 2DMTA 3MQ0A 1ZBXA 4OX9K 1T03A 3DLKA 2AHJB 4AFQC 2M0YA 2NNWA 5BN8A 3PX4A 3ULEB 2EGEA 3T3FA 5TKYA 1P92A 3H6EA 2LLKA 1MDMB 4BR7A 1RAEB 1X3UA 1YQKA 4FPAA 5HL7L 3T1HK 2L02A 4WK8F 1XNQK 3TW7A 4DMNA 1X19A 3CCSQ 3IAS2 4CUGA 4CHPA 2O7OA 4O8UA 1S1NA 2LJ0A 1NK0A 2XHKA 2JSPA 3EPZA 3ULQB 2E4LA 1U45A 2OTLI 1YQAA 3L2CA 2Q8KA 3OYGA 3OW2M 4B4CA 1B8IB 5A2QZ 2DK8A 2QGFB 4FLXA 1ZSZC 5IT9O 1U84A 3JAMO 3CVSA 1Q81O 2F5FA 4HWIA 5CIUA 4MHGA 3BG6A 5EJCA 4N41A 2RF2A 5CVRA 3AG2H 4DG1A 3EKUA 4JRKA 3BDDA 5FWBA 5IOZA 3QEWA 3P83D 4M7AE 4JI6K 4CZIA 3PUFA 1OJLA 2R5MA 4Y33A 2CJJA 1KG7A 2XB0X 4BRDA 1QQMA 4WCIA 5J26A 3MMVA 1ORPA 3QWLA 2GWRA 2BE2A 4JKAA 3G1LA 4NO7A 5M9OA 4AG2C 3O6WA 1TWCJ 2NUTA 4FLVA 3TABA 4B9SA 4D1QA 3G0ZA 3BDLA 2GF7A 2H8HA 2ICWG 2IS6A 3ZT2A 3LSJA 4DZJA 3E19A 2XPWA 2R7ZJ 4R1HA 5IN1A 2CUZA 5KK1A 3TTFA 4KJZA 3LYIA 4N56A 5ICCA 1KIKA 3MKZA 5LJ5j 1Y64A 2ZSIB 4HF2A 4M77C 3RQ4A 1SFUA 3LSTA 3KD1E 5LJ3f 5EDNA 4JRPA 1VK0A 4BQAA 4MO4A 1J53A 4NLBA 2KQRA 5GJVB 1XG1A 1S72N 2Q97A 3KP5A 4LGWA 3HRUA 4UVAA 1UGQB 2HPMA 2NRWA 3NWSA 3KWIA 4FSVA 4MDAA 2KR3A 3CERA 2ZXWH 2BV6A 1FY7A 3I8BA 4EQQA 2NS8A 3AA2A 4C8QA 3BDUA 1CGPA 4UB6C 5FRMA 2KP6A 5CPRB 4E47A 1OPKA 4KFBA 2ZMEB 2EIFA 2F5EA 2A68F 4F4KA 5ILSA 4CHYA 4K43A 3KZYA 3C12A 4A4GA 1AEYA 2HDWA 5GAN6 1HW2A 1QHAA 4G1QA 3AAPA 2Y31A 3OOPA 1F1ZA 3EUKL 3KFWX 2KRFA 3NQOA 5LJ5d 1KC8O 2RI5A 3ZT1A 4DR2K 3CJTB 2NYXA 4M7AD 1NLVA 4CJSA 4M45A 3ULDA 1WPYA 5GMKh 4ZTFA 2VUMJ 2GXGA 3AO4A 1R71A 3IUCA 1EZZB 4CIFA 4PKHA 2CZ1B 4B3RK 3ZGKA 3QDFA 3OYFA 2NOLA 1T33A 5AQJA 4LLGF 1HJDA 1MUNA 3HL8A 2JW4A 2AS5F 1EWRA 3GFMA 3DPTA 3L6QA 2LZ6B 1VQ6I 3ABMH 3GW2A 4MDXA 3SQNA 2IVOA 3RMBA 3K4BA 5F08A 3M0SA 3Q5FA 4PLLA 1NGAA 2XGXA 5D8KB 5LJ5g 3F10A 1NEBA 5EU7A 3NHGA 5KHDA 3GNFB 1EH6A 5DCMA 3RZDJ 2EPDA 3GBQA 1CXUA 2EZLA 1U4BA 1YJ9I 3C4SA 3EG9A 4YOUA 1VAZA 4CJPA 3QEXA 1IUYA 1JJ2P 3TEEA 2K3YA 2ISYA 2MFZA 3BY6A 3DLLA 4BQZA 4IIOA 3QWXX 4I6MB 1K1ZA 2HMIA 3JB9D 4C8QF 2PMZA 4FE4A 4KO0A 3BDPA 2L9VA 1UA1A 1QQNA 2E8AA 1TVRA 1OEBA 4A62A 2ZJ2A 1YE9A 4LD0A 4CCOA 1KXPA 1QU3A 3CCRT 4LD6A 1OCCH 3QAHA 3H9QA 2GBQA 1ETYA 1X9MA 2BUPA 5J40A 1H88C 2ZJPL 4Y17A 3M9QA 3CC7Q 4MZTA 3CCMN 3PSFA 3ZX2A 5LY3A 4FVUA 1SMTA 2QENA 1V4RA 5D4SA 1ZN2A 1W2BA 1E17A 5KGXA 5HODA 1JJ2M 4XEIA 2RKHA 1SKUB 1YT3A 4MLOA 2VBYA 1RZ4A 4CC4B 4RWTA 5FFXA 5D6YA 1W6XA 4DWIA 4DV4K 1XDUA 3WTZA 4QPQA 3NAEA 1C1BA 4OGEA 1C6VA 5FPEA 1NBWA 2D5RA 2QQ9A 4ISFA 3F9MA 3VEXA 2VV5A 2NUZA 2F96A 1DDNA 3WU1B 4HX4A 4BB7A 1JKHA 1AKHB 1VQ8N 1YI2Q 3H3VK 3Q0UA 1YJ9A 3CC2I 5ED4A 4Z89A 3U4LA 4BY6B 2F5CA 2K86A 4HNUA 1ZBSA 1Q86O 4IURA 1U48A 2V26A 2Q0UA 5E26A 4F7UA 4KB0A 1W4SA 3CCMA 1P59A 1GLCG 3EO3A 4IBNA 3QEVA 2EV0A 3X20B 5HKCA 3BG5A 1ARKA 1TLHB 1D3BB 1EXQA 3SUPA 2JUCA 1N36K 4PFPA 4YFNF 4HF0A 1ZELA 1C0GA 2Q31A 1PM3A 5L3BA 1WDXA 1SRMA 3WNFA 1KRPA 5KYYA 5LLQA 1M1KR 4X64K 3QP6A 1XMKA 2WSFE 3AY9A 2E41A 3OIOA 4FX4A 4DQ2A 3VQQA 4AQYK 1RT1A 1KK7A 2VYPA 2BDPA 1WSFA 2FBYA 4I09A 3RR8A 3T1BA 3BGRA 1NGBA 5GAN7 5DK5A 1H641 4A3CJ 4ZYDA 2YHAA 3JYTA 3CPWP 4XU2A 1FJGK 5D6XA 3ZQGA 1KYWA 4BRPA 4C8KA 1J3TA 4EHUA 2JGUA 4GBQA 5GPCA 3QERA 1WEFA 3S3MA 4PUSA 1C0MA 2P9IA 4BU2A 1APLC 3E9PA 1K0SA 4C2UA 1QS4A 3FZVA 1RRQA 3C6AA 3QXEB 1PU7A 5AQQA 4EA4A 3KKSA 4B24A 1K76A 2BZYA 3RQIA 4PHTX 2HZDA 3AVNA 3CCMT 1BB9A 3BEXA 1E3HA 4B1VA 4NXMK 2XROA 2F4MB 1Z1DA 3W3DA 3CESA 3THXB 1Y8RB 2V52B 3O9RA 1B7TA 5FPDA 4U0WA 3FXJA 1VQNT 1FEXA 3CQXA 5LJWA 2VWJA 4FJ7A 2D1XA 4JUVA 2BBYA 3ELKA 2JMAA 1P7JA 1H8AC 2DODA 3LDNA 1OCOH 4HQMA 5M5YJ 1K9MC 2P5VA 4XL9A 2CGKA 4JLIA 3PIPA 4JAXA 3IRXA 4B1RA 1U04A 3S14J 1HXDA 3CCVN 3QSUA 2YKNA 4B9MA 2XHIA 4JI4K 4AYBN 4LF7K 1QVFS 1VQ9N 1Q86U 1HW1A 2HQXA 1RTIA 2KRHA 1ONVA 4U7DA 3SUQA 2PUKB 4IZ9A 2PG4A 2KTQA 1QKWA 1EJ9A 1ZBFA 4LH4A 2LP0A 1T8IA 3KK2A 1TYQA 5E84A 3SQ0A 4AHRA 3QPLA 4M75B 3VRYA 2YU3A 3F9KA 2R4GA 4ICLA 5C42A 3DEWA 4ENKA 1XDSA 5CZ1A 2J6KA 2XO7A 2X48A 2QA4A 2K5LA 2L9SA 3GZ6A 3FRNA 5F2RA 2DL3A 4ZGDB 1IGUA 3T1AA 3M8EA 3SUOA 4E7KA 4IHXA 2RNJA 1H9GA 3G71A 5GANd 1KGSA 4ZYEA 1JXBA 3AO2A 5CKDA 4FWMA 4BREA 2CW7A 2FF4A 2E35A 5ILUA 1W0TA 5CJ9A 2HQEA 4E7SA 1I50J 1YJNN 2DOFA 1TBXA 2D6FA 4C8QD 4AH9A 2VXEA 5GAMj 4HBLA 1U5TA 1W70A 1S22A 2R5YA 1RBRA 2FEIA 5E18F 2JJ9A 3D45A 5GAGJ 3P31A 2DMQA 2DOAA 2KRSA 3I0WA 2KT1A 3IV5A 1DJ7B 5AQPA 5E1XA 2DILA 4OMZA 4II3A 4CEOA 1J54A 2XC7A 4FHTA 1I39A 4NNJA 4CHQA 1PU6A 1DGWY 5A0DA 1YJNT 1U8BA 3RR7A 4ZDPA 2NAZA 1JB0E 1A35A 2G7HA 2RN8A 1NJZA 5AQMA 4YFKF 3PSIA 3CUQA 1BW6A 1XPXA 4CIEA 2NRAC 2PY5A 2UUAK 1TUUA 3K5MA 2QKKA 2BZ8A 2WONA 5MLCQ 3CC4N 1ZBHA 3PQKA 2IW5A 4Q5SF 5J2MA 5HS7A 2ATCB 3OYKA 2OZMA 3DF8A 2HWVA 2DA1A 2DFIA 3SXYA 3CJ7A 3SLCA 1S1WA 1IG9A 4M7AG 1B34B 4EZ6A 2ED1A 2XPUA 3RR6A 3OR1C 3OGDA 3RWUA 5GAOn 2IDOA 2RC4A 3UKUA 2KRMA 3UPUA 4C23A 1DGRM 4RW6A 4PL6A 1VF9A 3UWNA 1SPKA 1Q7YC 4PSWA 3OVNA 3QETA 4J00A 3AA4A 2ZJRL 5GADJ 1MDUB 2V75A 2ZGZA 1D1BA 3I56I 3V9WA 4M7DC 3ZBDA 4HVJA 1NGFA 4Z2YA 3LFUA 3CC2A 3FHZA 4FWKA 3QEPA 4PDKA 3CJBA 2PU9B 2X6XA 5DD8A 2YHBA 2VOOA 5TRDA 4I9LA 2GXBA 3JCMQ 3SPYA 3I5RA 3JCMg 3TSZA 2EYQA 5DM7R 4HOBA 4B09A 1O1WA 5AQTA 1W5CC 3UR3C 3H5RA 4MEXF 4F91B 5CQGA 1UGSB 2BKDN 2D8HA 3S2HJ 1R8OB 2L01A 1Q7YO 2A28A 2F9TA 3TBIA 2FSJA 2QWNA 3JRIA 3PVLA 5F27A 4HXJA 3EE9A 2RQUA 1VQ6T 1EETA 4O4GA 1VQ9A 2KFDA 2VG5A 5KE2A 2UUBK 3ZT0A 4C3JJ 2Y0MA 3F8CA 3V9ZA 2ABKA 1X9WA 1QMCA 1NK4A 4FYYB 3EZ5A 5AQIA 4F3QA 1J7KA 3MN7A 1USSA 2GFAA 3GTQJ 2PVOB 3CFPA 1YS6A 2CP2A 2PJRB 3N4QA 3VUZA 1IJJA 1QKXA 1VQ4Q 4YOQA 2QWMA 3CCEA 5H6QA 1MMAA 3WG9A 5GAOq 4F17A 3EFRA 3HP9A 3KLEA 2EZHA 4NCBA 1WJ5A 4RLQA 4UUVA 3BW1A 2Z9OA 1N9SA 4CGJA 4FLYA 2V9VA 2DOEA 3K4KA 5FU6B 4HEA2 1EFNA 2E60A 1XC3A 3FXUA 4OMNA 3ZR8X 2QBYB 4FCYA 3V1RA 2W41A 2EKOA 3K5LA 4H4KC 3WXKA 4MMLA 1VQPI 1UAAA 1JHHA 2KISA 2CQ7A 1C0UA 4MDBA 2HHQA 2ZGYA 2X4WA 2XG8D 3L4IA 4JZ4A 2CSQA 1KVBA 3JCMX 2A0FB 4YOYA 2ZJPF 5HRSA 3TARA 3P8DA 1PCXA 2W42A 4X0GA 1UFMA 1QCOA 1KLNA 5LGTA 2HBKA 2RQPA 2DIGA 3O9QA 1GVDA 1PUFB 3LA7A 4E9EA 1LVKA 3VUBA 4XTYA 2ZJQL 4DV5K 1C1AA 3IHUA 3WGHA 3QJYA 2H1KA 2DK3A 2A5WA 4DCHA 3LP0A 3KYCB 1YXQA 3DWLE 4P5OA 4OKJA 2CMPA 3IWFA 1AT1B 4B1WB 1YCYA 4J9GA 2RH2A 3RUXA 4F3TA 1R59O 4CGZA 4C0DC 4CFCA 2L4MA 1M1FA 1KAXA 3VSKA 3VYRB 3DLGA 2X1DA 1VQ8A 2IG0A 3ZYYX 3G1OA 1Y71A 3I54A 3I56A 4M78D 3FZMA 3W2VA 3X2QH 2JM9A 2MOXA 2R57A 1GRIA 1FOXA 2L3PA 1PKSA 3LAKA 2HR3A 2RN2A 2DRKA 4XK4A 4A0ZA 1JRIA 3MZ8A 2HYJA 2QG9B 2IOCA 5AQNA 3SHWA 4WQ4A 2O5RA 4YFUA 3TAPA 4A63B 1SF9A 2CFXA 1IO6A 3QZ9B 4WFAL 5GAMe 2L2PA 3S1MJ 3CMEA 1UWBA 3RRHA 4M3TA 1SZ2A 1WX6A 2KHOA 4CSWA 2ZXHA 1XNRK 3ZL7C 1WI9A 2NLXA 4M77B 3O8GA 4YIRX 2IAJA 4NB4A 3HTSB 1KG5A 3MDQA 2E1MC 2YG8A 4NCAA 1VZ0A 3M59A 3ZMVA 3CC2N 1D1CA 2YRVA 3MO8A 4TV7A 2I5UA 3VS0A 4JD2A 3CCQQ 1B9MA 2RKIA 2MWOA 1RL2A 1U8RA 1FBQA 4NOYA 4AC0A 5LL6Z 2P5LC 2JN0A 5DYMA 1WJRA 1WAJA 3DLLL 4Q5VA 2O3FA 3EKSA 4KKOA 3VF6A 5B1AH 2OU2A 3CYMA 3V8LA 2XAHA 2E2OA 2GQIA 2RA2A 2DMUA 2RHKA 4JKCA 3ENHA 2YX4A 4MFEA 2LY9A 4UNFA 3GO5A 2ZMEC 4CD3A 4GFBA 5HNHA 1B9FA 2ZPBB 3M4YA 4NC7A 4Q4ZF 1BN5A 2R7WA 4B9VA 4CZJA 4LF8K 5F64A 4M77D 2K40A 4PJNA 3GBGA 3QPTA 4E1JA 2BTTA 1YJ9T 1U1TA 4AIAA 4C5GA 4UVBA 3GF2A 3Q0VA 3W2WA 3SAFA 1O3QA 4U88A 4PJOF 4AFZC 5FB2A 1HYSA 3UKUB 1JLCA 3PX0A 2NVTJ 2WA0A 4A4KA 3EQLF 3GPLA 2Z1IA 4L5JA 3K9TA 1BR1A 3D5LA 1PRMC 2ZPGB 1JI8A 4JI5K 2XF5A 1JCEA 4CVNE 1JJ2A 4CF9A 3WHBA 3D5RC 1UHWA 3DPLC 1MPGA 1ON1A 2LBFB 1ATSA 3SAHA 2R3SA 1H9TA 2V1QA 3N5BB 4UXNA 2JWTA 1BOTO 2KFZA 2F7TA 3HFOA 1ASVA 4XR6A 3Q3SA 2VWBA 2NZTA 4H5WA 4DTUA 4GLKA 1QCNA 3I58A 2LH9A 1LUJB 2LVMA 1BDGA 2FVUA 2DL7A 1QQOA 2X4HA 3HOWJ 4KPYA 1ZKGA 3R0AA 3NFCA 4CK1A 2LRDA 3J7YP 1UA0A 4K11A 1WQ2A 4CJKA 1U2VA 1KU2A 1TWGJ 4PKIA 1VQOI 1KVAA 4M9ZA 1K78B 3H1CA 1H3ZA 2M45A 1J9IA 2CT4A 2E70A 2DRMA 1E3OC 1T0JA 4D8DA 1NGNA 3CCEN 1I94K 2QXLA 4B1UB 1KC8R 1NKEA 2Y4YA 2LD5A 2CV2A 5AQGA 1RT2A 2RAEA 4OJRA 2BH1A 4Z4EA 1QVGS 3F73A 3GOXA 4ZYHA 4RG2A 3AGKA 5LJ3g 5J1EA 4LH5A 3VPRA 1U47A 5I2SA 3GZNB 2F5TX 2OYQA 2Q36A 3CCLT 4OO1J 2EFPA 1MBKA 3A5MC 4RAFA 1R7JA 1J6ZA 2W04A 1TAQA 1GXPA 1VSHA 2OTLQ 4CFAA 2GWKA 4RM2A 3QO3A 2FMYA 3ZQQA 4CRIA 2CW0F 1OU9A 1TW3A 1F5TA 4UOBA 2DERA 1NJIC 1DU6A 3IKTA 3I0SA 4RW7A 2ASPA 4DR6K 3AVGA 2DX1A 1G99A 3SFIA 2OC6A 4BUPA 3C0BA 1UELB 1NNEA 1T2KA 4M75F 2CW8A 4D6WA 4BRCA 1WI7A 3L3VA 3TO7A 2VBWA 5FKMA 4JHDB 2QF7A 4CA0A 5CYMA 1XMQK 2JT4A 4PY5A 4C3HJ 1ZG5A 5HROA 1LOTB 3B02A 2CG4A 3H9NA 2DMPA 2B8AA 1FK9A 3B6PA 1GBQA 2IS3A 3VYTB 3HRMA 2QSFX 3ASNH 4CESA 4IHSA 3JSMA 1W0UA 4OIPF 2KIUA 5BRDA 3N05A 2FNPA 1YIJI 4CHOA 3R0JA 5GP9A 3HEFA 1FXXA 3SI6A 3Q7BA 4HZFA 2JRMA 5DM6L 4CCJA 1DTQA 2QA4T 2GWJA 4J9IA 5CVIA 2F8SA 3I35A 1WNLA 1UEBA 3LAMA 2PMUA 2EQMA 4FM2A 1A6IA 3LMMA 4DNCA 1YW8A 4E70A 4DEYA 2YUPA 1E6GA 4B48A 3LAJA 3OV8A 3ZQCA 1OZ3A 3E5XA 1GVJA 2LSNA 4PJJA 2DKGA 1I3AA 4DBFA 1WH7A 3JTHA 1J59A 1VQKQ 1OX8A 2VBZA 4Z02A 3R60A 3SDBA 2CV1A 2FQ3A 2EYZA 4A2AA 3PT9A 1CKBA 3ZMZA 1VQ7T 4JKEA 4YDUA 5HNFA 3THYB 2HXOA 3LZJA 4WXDA 2DQLA 4KIBA 5C12A 1SEMA 3SEQA 2IPQX 4BDZA 2W25A 4GRIA 1SD6A 4H0TB 1WHJA 3NRVA 4CK2A 3UT1A 4N0AC 1D5AA 4BRQA 4CEFA 4CJEA 1CZAN 1A5VA 4CJLA 1FMWA 4FYXB 1W5TA 4MTEA 2D0CA 4M3XA 3LSIA 3L7WA 1HSJA 3JW4A 1H0MA 1T05A 1V5FA 3U9DA 3R61A 2O8FB 1RUOA 4R8HA 5B8HA 2WC2A 4NLCA 3U21A 2FEZA 2K4BA 2KT8A 1KQSP 2OD5A 4PJOD 3EHRA 2J6OA 4NB5A 3F5TA 1V5GA 2M30A 3CCQN 3P39A 3LZIA 3LA3A 3DAWA 4EMKB 2Q0OA 1KHIA 3I0RA 1GOCA 3REAB 4AILC 4V2GA 5I21A 4RCHA 5FO5A 2ME0A 2GBZA 2M1HA 4ELZC 3HYIA 2QWQA 3DXMB 2ZD1A 4C92F 1N6QA 3F8BA 2HTJA 2QGGA 5DS9A 4GKKK 1YP5A 2BY3A 2UXDK 4FK0A 2ZZDA 1N27A 2PN6A 4GO1A 3JCMV 4M63C 4A3JJ 4LFUA 1U5TC 3ZT4A 1WEGA 1U5SA 1LWCA 4A57A 3F3XA 3VFZA 1A5JA 3ZT3A 2CP0A 1X58A 3QNOA 2H1LA 5M1FA 4ESBA 1IN8A 4J9BA 3R4KA 4LOCA 4CYCA 3FIFA 5KYNA 4N4GA 1GCPA 2JSCA 4EGZA 3DTKA 2DBMA 3A8LB 2R5ZB 2Z1DA 1QP2A 4AVZA 1BWFO 3JR9A 1W36C 3S32A 3D7EO 4RGUA 2F9WA 3M8FA 3PUBA 4M4ZA 2E2HJ 1I6HJ 1MHNA 5FKKA 1ETKA 3AO5A 3HBTA 4YOTA 2YJFA 4L5GA 4AM6A 1HNVA 4B43A 3I55I 5LJ5h 2ID6A 2XPVA 4W5RA 1TL8A 1U1SA 2CRGA 4BDPA 5H2FC 2GUPA 1XGSA 2VUBA 1NGCA 3DMJA 4F55A 3H3NO 3EFOA 1X4PA 3OH6A 1N8RC 3WTUC 2E19A 3CO7C 4C1NI 4WX9A 2XASA 4OPAA 1YHQI 2QQ8A 2EYXA 1MA9B 3G6EA 3WODF 4CEBA 5JMVA 4KHPK 4JK1X 3D5SC 1Q81U 3OYNA 4BE1A 1WZ2A 3QDRB 1OR7C 1GOAA 4IRHA 1IN5A 4DR1K 1X01A 1VSIA 4A0YA 1YHQQ 4BY1J 4KAZA 1Y96A 1FYMA 3J7ZI 1LDKB 4QS9A 3WXLA 2XRLA 2K02A 2MH2A 5IT3A 3LL3A 1R58A 1NGEA 4BXXJ 4FT4A 2EIMH 2WFBA 2W0ZA 2E6NA 1TL3A 1XQOA 2CQQA 1SHFA 2BVMA 3ZLJA 1WSEA 3C6HA 2KKZA 4GY2B 1YQRA 3SFMA 5M1KA 1GDTA 1W7AA 1Z7LA 2RE2A 2V4JC 2GCXA 1F4KA 3VKIA 1V76A 2NUPA 4F7UF 2GXAA 3O80A 2BVLA 3P8HA 1NH3A 4ZTJA 3D2FB 4KI6A 2GA2A 2XI9A 2P51A 4WQ5C 1OYYA 3UNGC 3TL4X 4C92E 2MC4A 4N4OB 3V9SA 1PWTA 1KQJA 4YNQA 3L8BA 4FJNA 4IJAA 4Z8AA 3AG3H 4DOZA 4DJAA 3SQ4A 2Z99A 4LJZF 2KY9A 3I59A 3H0IA 4Q0BA 1QVGM 5EC7A 2ZPIB 3OYDA 1IRXA 2QAZA 1ZH5A 1IDZA 4KDPA 2O6GE 1G3YA 2OAUA 1BIUA 5FKLA 3OR2C 1T3SA 3LWHA 2E71A 4G6DA 2ID3A 1TT0A 1LEAA 2XY5A 1AU7A 1XGNA 5EEHA 2YG9A 1Q81C 2K9MA 2JPCA 3O8VA 2OJED 1OYIA 3LPUA 3DEEA 4AT1B 4OFEA 2YDLA 2DTUA 4L59A 1ZSZB 1YI2T 5KRTA 3QU6A 3V1OA 3J81E 2JA8J 3IQLA 5F1RA 3O3HA 3M53A 2JJ7A 2HNZA 3IAYA 2KJCA 3WGIA 2CGLA 2VYTA 3VGMA 5HVQC 3NWTA 4KH6A 1VQ5T 5CQYA 4Z4CA 2L2OA 3BFMA 5FU6C 2EJFA 4KHYA 4N5SA 1QRYA 2X3XD 3THWA 1XQSC 3LSMA 1FJLA 4OKEA 3CBOA 4KTZA 2L7ZA 3M7GA 3CCMQ 3N4MA 2H27A 1BI4B 3CXCP 2LDMA 2HHXA 4O6JA 1VQKN 1FOKA 3I55N 3H9JA 3OS0A 1D8KA 1UAXA 3CC4I 4BC5A 3KLIA 1RFQA 3N97A 2COYA 3CLOA 3A01A 2WADA 4FT2A 1G3WA 2G8IA 1YX3A 4D8KA 1YJ9Q 3ZETB 3G4SN 4C5HA 2QK9A 3QUIA 4OMYA 4OPHA 3BC8A 1Y39A 2QEXA 2HEOA 2DE0X 4AHCA 3WEEB 3WQTA 4ZZLA 3DXJF 2QWLA 4DR4K 1K83J 2EFOA 2NRRA 3C65A 2P1JA 4IHYA 2XY8A 5M3MJ 1SANA 1QE1A 3V9XA 2MGQA 3X26B 2F5KA 1M27C 4BUGA 2KJBA 2HNIA 1K79A 3BG3A 3RZOJ 2FBHA 2P0WA 5GMKe 4HUGA 4FZXC 4ELUA 3EETA 1AWXA 4CJFA 1HJRA 5D5UB 3TO6A 3V7RA 1REVA 4CK3A 1TUGB 1K4SA 2HU9A 4PFZA 1XMXA 1FP2A 4PK4A 2K3FA 1S3XA 2VJ5A 4GCVA 1BIBA 1IG8A 3GTKJ 1S72Q 1MGQA 4M75E 2GLOA 2JA7J 4CC3A 1FTTA 4M74A 4M3WA 1Y0UA 1WHHA 1MZBA 4K2EA 3VV0A 1YI2N 3V4GA 2EGCA 3KLNA 4IXAA 2ROTA 4N76A 5H20A 4WXCA 1QW1A 3TPQA 1IXSB 1C6VX 5FKNA 3O4WA 4C0FA 3VYSB 4V2SA 4XICA 2GNCA 4CW7B 2QEXT 3CC2Q 3GFLA 2LMJA 4O55A 4A54A 5EGOB 3SV3A 1YNZA 4J8FA 4OLAA 2OBPA 1IXRC 4MTDA 5HLFA 5EGOA 1LWFA 4C8QG 2FL7A 3D7SB 3FXLA 5EF6A 4G9ZA 3HDDA 3G10A 2A05A 5IOYA 4CZMA 3BF1A 3O5ZA 4BS9A 1Q9YA 2JPBA 2ZNYA 2CT3A 2E1YA 1S9HA 3ZMSA 4FLUA 2DLLA 1LJ9A 4JQFA 4RGRA 2A3LA 3QYGB 3R6OA 1OULA 1Y7XA 2RVCA 2VODA 2VPLA 3P1GA 3RMSA 4RA2A 3ER0A 4HCCA 2BE5F 3CMAN 2ZCWA 4BWMA 1ETXA 4D7NA 3MZHA 3KLHA 1U78A 2Y30A 4K8ZA 4GVEA 2QWOA 3PGGA 3NFAA 3I53A 4BXFA 2VPRA 3WTWC 5IH2A 5JICA 4O0IA 1XB4A 3K0LA 3M3YJ 3M3ZA 1YHQT 1B92A 2Y0SA 4PQUA 4CBXA 4PIIA 1NK6A 1NG9A 2EINH 3NARA 4CXFA 3EUHC 3HVRA 2V1XA 3P9KA 3H41A 1B59A 3B6AA 3GFJA 4ASNA 2IC3A 3ZETA 3EG3A 3U23A 1BU1A 5BREA 3CMEQ 3ML6A 1RLQC 2ESWA 4KRFA 4H0YB 4CICA 1YJWI 1MJ9A 3K1NA 1M1KU 5AZJB 4KA4A 1QTMA 1TGOA 2EHGA 5DTDA 4GNIA 2ESHA 2JVVA 1J5YA 1LWVA 1I5LA 3M6GA 3VOEA 4MO5A 4IOCL 3TSWA 2V8JA 2WC9A 2ZB9A 4XKWA 3ZQFA 3J7AY 3J7ZO 2RM4A 2VBXA 3ONQA 3THWB 2YWWA 2M4GA 3LSGA 2YSRA 1V29B 2LNHB 4AD9A 4QOZB 1I5OB 2BY0A 4RTUA 2X85A 4RMNA 5DUIA 3E9GA 4ILJA 1SQKA 2ZMEA 1Z3XA 2XDPA 1VQ4N 1QNTA 4KBOA 1VSMA 5K1YA 4FW2A 4O5FA 3QG1A 2Z33A 1N8RR 1R1VA 2W85A 2X35A 1AKHA 3HL2A 1RDDA 2ZE2A 3ULEA 4QLCU 2O4GA 4CFBA 3K6GA 2A5XA 1TNSA 3KIOA 4CHUA 4JD2B 2RPIA 2E34A 3E9LA 3VW4A 1K6OA 1ENHA 3G71T 3S1QJ 1IKYA 1BISA 1MUDA 1KZHA 1D5VA 1GV5A 2VVKA 4O5VA 3FKJA 1TKDA 1WJAA 3AGRA 2GIZA 3RYRA 2KROA 4I2PA 3HKZN 1XGMA 3WE3A 1LQ1A 4K41A 3M1EA 2JA5J 1WPKA 5GAMh 4IQ4A 4XBFA 3MXMA 1DIZA 1K8AC 4L8RB 3M56A 1R36A 4AWXB 2JUGA 4E1NA 3PIOA 1BHLA 2YRCA 4OB1B 3DLAA 4NL2A 1FIAA 4E7JA 1TQMA 4B08A 1AZEA 2KLAA 1S6QA 3RPUD 5LJ3h 3H9GA 3MECA 5CAIA 4X62K 1XUPO 4JNEA 2MI6A 5M5XJ 1NLOC 2KVQG 4EEFG 1V4SA 4Z4HA 3U9GA 5IT9Z 3AVFA 3A03A 4M3EA 4KH5A 1B34A 4B47A 1P7IA 1X43A 1IXDA 5A2QK 4ENJA 3NVMA 3J81Z 2ELJA 4MZMA 2PYJA 2QQAA 1I3QJ 4X34A 5ERIA 4F7UG 4WFBL 1Z9CA 2KIMA 3CJQB 4B8XA 1IRZA 5L3DA 4JJBA 4PJOG 2ZQBA 5D5WB 3H3UA 1MMNA 1UGVA 4RCBA 2XIGA 1DT9A 1RKTA 3CWTA 1WA7A 3KVGA 1WBBA 1UHFA 1ZBLA 3X24B 5GAOp 3K70C 4FJ5A 3CF5L 3TSUA 3SV4A 2A61A 3FIWA 1PDNC 4C5EA 4DR7K 3JRGA 4WE1A 4KRTA 1FX7A 3SYTA 1Q86R 1JTYA 2E1CA 1VHXA 1NK9A 4B9NA 4DLEA 1OQKA 4FM0A 4B44A 2GTOA 1GXQA 3CCJT 3LM2A 2DXUA 1VRLA 4DSKA 4XTWA 4PL7A 2HNDA 5BS6A 1X6BA 4HVUA 1MNDA 4B3TK 2VQCA 3L3UA 5LJVA 3WNEA 1NU0A 1JGGA 1K73O 1ORNA 4DSFA 1OZ2A 1N8RU 2CP6A 4PJOE 2YCHA 2M9UA 1IHWA 4AM3A 1VSDA 4DS4A 3IG1A 3I5SA 1ZSGA 5IHKA 1A04A 1Q18A 4KN4X 1I1JA 1O7LA 2DPPB 4GV6A 3JRDA 3QU3A 3ZSXA 4KIFA 4IUVA 1CF7B 4AVPA 3GP8A 4M9SA 1WSHA 3LOCA 1IG7A 2GOMA 4A53A 3EYZA 1NYFA 1KQSA 5D6EA 2Y9YA 2A1RA 4FL6A 4HV6A 1MH4A 3O5BA 1RT4A 2I5WA 4CI0C 3HM9A 2DMNA 4FPBA 3ZPLA 4JK8A 3TCJA 2UXXA 2P9IB 2Z2SB 4D7MA 4F3OA 4ELVA 3FKIJ 5CE3A 3NVKA 1KHCA 3OSGA 2YX6A 1VSKA 5AIPA 3CCMI 5BRHA 3L4QA 3NH0A 1SMYF 2QTDA 2HQHA 4Z4GA 3I3LA 3VEVA 3KYDB 1EX4A 2I0NA 2C0TA 3HOXJ 2KFNA 5AQFA 4S04A 2E3HA 4CEZA 5M5WJ 1SL0A 2KHMA 4JEPA 1IV8A 1SAUA 2RB6A 2BGGA 2DYSH 4LF5K 1GBRA 3I0XA 2DAQA 1SKSA 3HG9A 4FL9A 1ZLKA 4OMPA 1RRSA 1YJWA 2NVXJ 5SZTA 4FZYA 4FJHA 4JX6A 3FMRA 2CFOA 3M9AA 1HKTA 1Z91A 3AV9A 2QYZA 3HKZA 2KZVA 4KMUX 3ROUA 3NH1A 2GOXB 2R7OA 1VQMN 1Z26A 1WGSA 3E5UA 3CI5A 3LAPA 1ZBIA 5GAEJ 1P4WA 2UXCK 3VF2A 5B1BH 1ASUA 1JXEA 1ZHFA 2DJNA 1EP4A 1K9MR 3F0CA 2GM4A 3FM5A 3CCYA 3DB4A 3CMEN 2G0EA 3S41A 4DV7K 1RIOH 4LK0F 1K61A 3IP4B 3JB9G 4I01A 1G4DA 5JLHA 2QZ8A 4P9UA 5IP6A 2FF3B 1F9NA 4KHSA 3SQ1A 5FWCA 5C6SA 4LG0B 3CCLI 2ECCA 3B8AX 1NKBA 3L09A 3WUHA 4XU3A 1BA0A 4HCZA 2O4XA 3OYBA 1HPMA 1WIEA 1K73U 1EF4A 5BPNA 2Z1GA 1UHSA 3TAMA 4FJ9A 2FOKA 2J7IA 3R1XA 5LJ3e 3HPHA 1ETWA 2CH0A 4BY6C 3ECOA 1YJ9N 3PIOF 2RQQA 1NKCA 3CBPA 2YI1A 4LFCK 4DF4A 3UATA 4EV0A 3QWYA 5LHIA 2K27A 1MDMA 2D8JA 2JMCA 3CC4Q 1N6AA 3T8RA 1UB4A 5EG0B 5GANg 3CMMA 2O8BB 3L1AA 4DBQA 2MW8A 2CZ7B 3REOA 1B3QA 1KD1O 1M4ZA 3MD2A 2B0LA 2RHZA 3A1YA 4RAZA 3EG2A 3SB2A 3VB2A 2TCTA 3C7JA 3OYJA 1XSVA 4A5MA 4PJOB 1PG5B 5LFAA 1RBTA 3TU5A 3H0GJ 3SZTA 1MJBA 4LSNA 3S8PA 1VI0A 1REPC 2EKHA 1D0ZA 3PO5A 5E3NA 2D0QB 3DXMA 3VENA 3EGUA 3J8AA 4DTSA 3OYCA 3K9JA 2RJEA 1BYMA 1I81A 2F4IA 1ACIA 4P5NA 3CD6Q 4E7IA 2K3BA 2JT1A 3J80K 4G6QA 2FC0A 1QA6A 2E3IA 3LPTA 2P8TA 2LT1A 2XF6A 4HTLA 4JKGA 2OPPA 3DP7A 3K9KA 1MBEA 4J5YA 2P9UB 4PL8A 1BIAA 4OOIA 1OVYA 4XLPF 3L2ZA 3AVMA 1CKAA 3BJOA 4YOVA 1ZG1A 1NJWA 4NL3A 4IOAF 4WF9L 5D4RA 3JCMc 4RB0A 3QHSA 2DAOA 1KA8A 2HFHA 2ZSHB 1KQ1A 3MPUB 1W7PA 1RDBA 1ERDA 3HXMA 2CS3A 1HKBA 2XD0A 4FVMA 2V51B 2GGRA 1Q82C 1JKRC 1TKXA 3SEMA 5I3UA 4M75G 3VS7A 5K7FA 3HOUJ 5CR4A 3CCQA 2DA5A 2MD5A 2HOAA 5KYWA 1YG2A 2HDAA 2HQRA 3G6ET 1YCSB 1D9DA 2P4RA 5HLHA 4CYDA 4YDUC 3UKRA 3RMAA 1ZR4A 2PTKA 4GXOA 1QP3A 2E88A 5CHZA 1WFWA 4PGHA 5D8LB 5TGTA 3FB9A 3DB3A 3EUHA 4BDYA 1AA7A 4KUDK 3HIFA 1XTAA 3GYHX 1U49A 1SV5A 3CC7N 4M77G 2FA5A 2HQAA 3JXUA 3LALA 4CE9A 2G8VA 2WAEA 5I22A 1NG7A 2VXZA 2HKXA 2HTSA 2VG7A 2O03A 3L1PA 3VTHA 1QBJA 2R5ZA 1FP1D 4UY8O 4BROA 3TMOA 4BBSJ 3HB9A 2H56A 1V55H 1E3PA 2YU9J 4X1EA 3CC4A 5KQDA 1T0FC 5F1JA 2GV9A 2B5JA 1I5ZA 4M3GA 1BBZA 2EW3A 1TUDA 1S7AA 3HTUA 3MWMA 5AIQA 4C8QE 1S9EA 2YRDA 3DTIA 2JTMA 5AFUH 2NVQJ 1IN7A 1N5ZA 2MWPA 4FM4B 2YUNA 5L8RE 3BR2A 3WTVC 1G2HA 1RADB 4A0XA 4A6EA 4XIUA 1JHFA 1E6HA 1LV5A 3ATUA 1JBMA 1UFFA 1HUXA 4NC8A 2W6KA 2EQKA 3WTSC 2FRYA 3LL7A 1VA7A 3QP5A 3TKYA 4KTWA 5JI6A 3L2QA 3HRSA 1NJIR 4B9LA 1Q1VA 3F8FA 4Z0UA 2HF3A 3QKJA 4DOWA 5D5VB 1FSHA 4HUEA 3C0CA 3VODA 4A5NA 3F22A 2DTIA 4NDLA 2NVYJ 5LRRA 2JA6J 3R6NA 3DLLF 5CKHA 4OMQA 5CKTA 3A5ZB 1A6QA 3H0DA 2R7VA 5JVGL 1WNSA 2PQWA 1QCFA 1BA5A 1YWPA 5E41A 1WJBA 3G71Q 3AT1B 1S1XA 3HP6A 3QIOA 4M3ZA 5GAHJ 4U87A 1NBEB 2E1HA 4M78G 2LCSA 2HKQB 4M3DA 3HJEA 4UHTA 2QSHX 4XH4A 5CQEA 2P7CB 1R5GA 1SD5A 2AO9A 3KJVA 3E01A 2IVMA 5IYBJ 2OA8A 1YW9A 2FRHA 2XGEA 1YFHA 3UB5A 1N39A 1IBMK 2QA4I 2ETJA 2XDVA 1IXCA 2DO7A 2STWA 1EBMA 5F1XA 2Q2EA 2XIDA 1SAXA 2EX3A 1W2BM 1OCTC 3VQ9A 3CJNA 2OCCH 3JAMZ 1IGQA 1A5XA 2HKNA 3K4NA 3LX7A 3VMFB 1W2BP 1M9SA 4KH0B 1BIZA 3R9PA 2P5KA 2YNIA 1FYNA 1KC8U 1FKOA 1RR7A 3ASKA 4CCNA 3K0SA 4JI7K 3IDHA 4M7AA 4EJTA 2MLKA 2SRCA 3TEDA 1D5YA 3SNNA 4BRGA 4M78F 2O4XB 2HZYA 3OY9A 4J19A 3ZMTA 3VYHB 3SFZA 2D45A 2PYLA 2ZFUA 3GCMA 4Q48A 3PNTA 3S3OA 1KC8C 3META 2XGDA 3NF6A 4IHVA 5AJ3K 2FBIA 2RHIA 5IPAA 2HOSA 1IV0A 2CUFA 2KYBA 1CZ9A 1O75A 1XTDA 3ENBA 4PKCC 5FU7C 3JSCA 1KG1A 4GLMA 4CZCA 4XU1A 5J3LA 2H3JA 1PSEA 3HSFA 1XSDA 1IRGA 4OWRB 1M1KC 1YHQN 1FPQA 3H36A 2EILH 4OAZA 1WUAA 4BHCA 3CPWM 5GTHC 3HPOA 4HUFA 3E3VA 4OU0A 3VQ6A 3IKVA 1IKVA 3MN9A 3GUDA 3A0IX 3PMIA 2ESNA 5FD5A 2BE9B 2ETHA 3LCNA 3NPFA 1Q82U 3QQAA 1OI1A 1D8JA 3CCJN 2EV5A 4DU1A 1OR7A 1E0EA 3JB9I 4BG8A 4RTYA 3AVIA 1HKSA 1IO2A 1YQLA 3M8RA 1OISA 3Q9SA 1QZ6A 1X1AA 2CP5A 3CM6A 1LDJA 4UQGA 2RO0A 1NK7A 4J2AA 1BI4A 2HBMA 3CPWA 1O4XA 2BZXA 4I98B 2VGNA 2QEXN 2OQGA 1N75A 4F92B 2HBLA 5LHGA 3IC7A 3M8JA 4A3IJ 1IJWC 1YI2I 2M7AA 2O31A 3IH4A 3WVDB 3DI6A 4GDFA 2MC3A 3FZKA 2V9PA 4B1ZA 3ZQIA 4CHZA 1YAGA 1UB9A 4BRLA 1Q1HA 4UC4A 4H8KA 1WN7A 4M72A 5C25A 1K8KA 4YELA 2IIRA 3TAEA 4H5TA 2BUDA 2EQRA 3JV3A 3THKA 1K0XA 3DLEA 2LF7A 2KL4A 1WFXA 4L9TA 4L9JA 2Z5UA 3VYUB 3EZWA 3SD4A 3T1YK 1T95A 3CDHA 4BRNA 4OKKA 2GFUA 5AT1B 2RDPA 4WWCA 4I2OA 2CSIA 2J5OA 3OJSA 2FG0A 1W0HA 3UA7A 4QSHA 4IFVA 2A6TA 5C15A 1OU8A 3O9SA 3HHTB 4XRSA 1VQNI 4C8MA 1G15A 2PZ1A 2P81A 1FOWA 3AL0C 3NMUA 3H5NA 4X65K 3HOZJ 2FU4A 4IHWA 3WQUA 1ZQ1A 2M4KA 1VQNN 2AZSA 3GL1A 1PKTA 4BVOA 3E1YA 5LGUA 1VQOT 1FW6A 2YUQA 1K4US 5GIPA 5HP1A 2YV0X 1LJOA 3HRTA 4JJNK 5AQLA 2O88A 3DU6A 4FU6A 4XRMA 2D1VA 2L8DA 2OPQA 4CEEA 2D4WA 1J09A 1ITYA 1E2XA 1BI2A 3FC3A 3ZQHA 4ESJA 1NGHA 3UDCA 3AVJA 1Q82O 1YTYA 1LE8A 2IGKA 3CBMA 3QBYA 4CEQA 3NGZA 4CGDA 1M3AA 2XAFA 3Q1JA 1MH3A 2IA2A 3VEYA 2E1OA 2UWMA 1ZRDA 3DOKA 2COZA 4YHHK 4R55A 3CCSN 3BTJA 1BO5O 4HTUA 2HL5C 4M71A 4BACA 3OYAA 5C4JJ 3RKWA 2JWLA 1OYXA 2K5IA 5GAN3 2ZM6K 4YG2F 5FLXE 1T0FA 1VQNA 3H5AA 1VQMT 2LQWA 2K57A 1U0JA 3EY1A 2HYFA 2EWNA 1GV2A 3LDPA 4C1NK 2R7YA 3DLHA 4M7AB 2ASOA 2UU9K 1ZRFA 3ZMUA 3VQ4A 4XTUA 3IH2A 1JO8A 1DP3A 1N77A 4OIRF 4ELYC 3LSHA 1NGJA 3IH7A 1LCKA 3QLHA 2XB5A 3E6MA 1GCQA 1NYGA 1KU9A 2F8TA 3A01B 2CGHA 2DTRA 2GQQA 2VC0A 1N3AA 2RQWA 3E7LA 4A4FA 2ZCFB 1GUUA 3ULRB 1UG0A 5IP9J 2EVRA 2TDXA 4FIBA 3G4SA 2IRFG 1PHTA 4GGGA 1IN4A 2AXLA 2OX7A 3NH2A 2ITGA 2RJFA 2B9SA 4C92C 2KBTA 1KLMA 1BL3A 3AARA 2JQ7A 3A98A 4N0AA 3CEYA 4B9XA 2PJPA 2MYSA 4EW0A 3A8HB 3VQAA 1KQ9A 1WHKA 3BG7A 2V1UA 2EA2A 4WF2A 4DV0K 1ZR2A 3EGXA 2PBIA 4DKWA 1CXQA 3OYHA 2ABLA 3ZEUA 4H0EA 5LD2C 1X75C 2OTLA 2L7KA 4ZN3A 3NGIA 2EIJH 3RDIA 2QVOA 2CS7A 2X1EA 4OFAA 4IZZA 4BC4A 3QESA 4MLHA 3CP8A 1RAHB 3UE5A 4AIJA 2HKOA 3V9UA 4O44A 4DV6K 3TP0A 3S2DJ 3CZ6A 2JXBA 2DTZA 1WI3A 1RCHA 2GTDA 3BY5A 2V6EA 4CCHA 5ADXH 3OB9A 4CGHA 1I0CA 3BPVA 3ID6A 1RAIB 5D5XB 4FYWB 3HVTA 5J2QA 3DM2A 1RBUA 3Q0WA 1QZYA 3AAQA 4OPKA 4Y1CA 2ELKA 2X0LA 2D0BA 5JHFA 2FXAA 3J7AF 4W97A 4KUMA 2LNBA 5GMKi 1VQ5A 5GANe 1YX5A 1IH7A 1QVFM 4RW4A 2R92J 4XLCA 2VOPA 3G71I 3OW2A 4JKHA 4CZKA 3H0FA 3ERED 3K4JA 4M3YA 3BP8A 2DT6A 2X74A 3C2GA 2NRTA 3JCMf 1VFCA 1UECA 2HVRA 1YTAA 2HYGD 2P4WA 4Q5WA 5C44J 2LKXA 3ZRGA 4CJ7A 1H89C 1SSHA 1JKPC 3ITHA 1RGIA 4AIKA 2QM3A 2YKMA 3O8HA 4DYQA 1F36A 3UKRB 1WHMA 4RW9A 4B9QA 4GMJB 1VQOQ 4JBAA 5K7HA 2HEQA 1U3OA 4ILGB 5JLFA 1ZK8A 2BXYA 2BW3A 4F7ZA 3DPUA 3H8ZA 3DKWA 2NOHA 1IBLK 2ZFWA 5B3SH 3ZSOA 4XOTA 1KD1U 2Y1JA 3GX4X 1R77A 5JHUA 2XU8A 3I8DA 4JOMA 4YORA 5GAN8 4KULA 4IEEA 3GZ5A 1T08B 3AFHA 1P6RA 3FXQA 1EO1A 4XORA 1QQIA 2XRIA 3FZLA 4O0JA 4ZC3A 1C0FA 3E9FA 2YHWA 4PNOA 2E5KA 2YXYA 3HSEA 2HF4A 4BWJA 1CSKA 4XSXF 3FWEA 2H6CA 1ZTRA 1NZ9A 2VT3A 4ZGEB 2P9UA 3PFIA 2HVHA 2P9NB 2IS2A 3K1PA 4Y92A 1WQWA 2B4JA 5CYVA 5LJ3d 4IG3A 3CCLQ 2HOTA 1OFCX 1QPIA 4IJNA 1FTZA 2FX0A 4UUTA 3JCMP 3CD6A 2FXUA 1HLUA 1Y97A 3VEPA 1VQ7N 1G8XA 5GAGP 4QIWN 3U3GA 1Y0MA 4R0KA 2XVCA 3LDLA 1BQNA 5TKWA 4LE9A 4FLTA 4H0OA 1P8ZA 4BG9A 4DTJA 4DR3K 1TUCA 3G6EI 3V1QA 3L2WA 1HCRA 3CCJI 1RRJA 3FXKA 7AT1B 2Y48A 4NQWB 1VQLI 1J5EK 4DK9A 5EOYA 1EH8A 1QSLA 2A1SA 5KH6A 1W5SA 1RKWA 4O8KA 3K2ZA 4CC2A 2K9SA 4EW4A 3O9TA 4CJRA 1BW5A 1FSEA 3KUFA 2D0OA 2EZKA 1TXQA 2HMAA 1ZHIA 3INZA 3OOUA 1VQPT 3DXKA 5GAEP 2HHVA 1WAFA 3ESWB 5FLVA 1XCVA 5GAMf 2JHNA 1JQQA 2EYYA 3PMTA 3J7YJ 3F6OA 2E7XA 5EEGA 3M5RA 3QJ6A 3CCVQ 2KDSA 2WBMA 1XQPA 3KP7A 4BC2A 4BE2A 2YPRA 2FD5A 1V1CA 2CYZB 2ZJQF 3GVAA 5DMRA 3QZ5B 1MU2A 3JAME 4GYIA 1QHTA 2DLPA 4QS8A 4LSLA 1UMQA 2W24A 1OX9A 3CCRA 2HAXA 4D9JA 2L0KA 2XY7A 3MKLA 1HA8A 2X78A 4NCGA 3KFVA 4A61A 4L9NA 3RI4A 2GIVA 2GQVA 1VQPQ 1V54H 2DYIA 5BN9A 3LSRA 3FMQA 2DVJA 4BJTA 3VQBA 4FOIA 1UGPB 3TOAA 2JMWA 1S3JA 4M6XA 3FZFA 2KZZA 5HS9A 3KNTA 3SDGA 2RQTA 2F5DA 2QQSA 1D4XA 3CC2T 3DCFA 1CZBA 1OKJA 1R5ID 1OCRH 4F04B 2IPOB 1UDLA 5CKFA 1S1TA 3R8EA 2WY7Q 1BC7C 2P6SA 2Y9ZA 1SL2A 4XRFA 2WAFA 2RHYA 4E9FA 2WV1A 1OYWA 4IDHA 4FJ8A 2VKEA 4EP4A 3M1FA 1RUWA 3O6BB 4E7ZA 1VRUA 1W7PB 3QPSA 4OFHA 1YITQ 4U0YA 4S0HB 2D0NA 3M55A 4YRVA 3GEZA 5FDLA 4FSXA 1WLPB 2O8EB 2VKHA 5GAOr 1L3TA 3QODA 5AFUA 3G7ZA 4D5FA 3KLFA 1X2NA 5KYYB 4DTXA 1E4GT 2MABA 4XLEA 3SK3A 4J6YA 2CP3A 4P1WA 5TISC 3AO3A 1HYVA 1DP7P 3ZN1A 1WWXA 3PNVA 4BEHA 3NGPA 3D2EA 1X1DA 3F8NA 1Z9ZA 2ECBA 3KCCA 1XX5A 1S8NA 4A3MJ 3RRGA 4I99C 1U3EM 2D0PA 3TWHA 2JN6A 4OP0A 1Q7YU 3OW2S 3E5QA 2Y69H 4BRAA 4EIAA 3E2UA 1EH7A 3S15J 3FK7A 1MKMA 2O8DA 4F7UB 4N0BA 3LQRA 3VS5A 1O3TA 1U9OA 1N9RA 5DV5A 2V6CA 3MVPA 4LN2A 4EHTA 2K4YA 5LJ3j 2R7SA 4M75D 3CM5A 4C92D 1OCPA 3M54A 2OA4A 2PAVA 3S9HA 4FJJA 4JK9A 2B6AA 4DF8A 3BTLA 3CJRB 2YUOA 1X3NA 3U3YA 2IVNA 4MQ9F 4C8QC 5DM7F 4FJKA 1YO5C 3DBLB 2VL8A 3WU2C 2ITMA 4E7LA 3SBTA 3WEEA 4MGRA 3AL0B 2YR2A 2NLUA 3KTQA 4DU3A 3AAFA 4P55A 3W6JB 1TKZA 2JZYA 3SMSA 1LOJA 4HCBA 1TKTA 2W10A 3RERA 3EE8A 4A3DJ 5EZGA 3MEAA 3KLGA 3BG9A 4RMOA 2MK5A 4OMFB 2F2WA 3E9OA 4KIGA 4I2QA 3SJJA 1VYUA 4HHTA 4DTMA 3V8JA 5J6XA 4FTHA 3EGDA 1QZZA 4W1UA 4ELTA 1BJZA 3ZFJA 5GAMd 3A2FA 1N34K 5AN4A 2P9PB 4XTVA 4CBUA 4KNYA 1OV3A 2C0IA 1ZUUA 1HDPA 1PNJA 3RSNA 1NGDA 5M1QA 5K5QA 3MWPA 2W03A 3CCUQ 1FIPA 4PCQA 2MPXC 3KEQA 1TU0B 3BJ6A 2O4IA 4CHNA 2BY2A 4CJTA 3RMCA 3CQYA 2CZ0B 3Q7CA 4DQQA 4LFBK 2Q1ZB 1VQ5N 1MUZA 1O3SA 3CF5F 2YHTA 2E5ZA 1GL5A 1IZ6A 4LIUA 5E20A 3D0PA 3CXCS 3QBWA 3CJAA 1R5HA 3VWBA 1YF5L 3H6ZA 2NS0A 2NOJB 4CGFA 1NOYA 5CK9A 2MH9A 4FX0A 1SRLA 4BL0B 2QK0A 2JLEA 5F0XA 2NNNA 2CREA 3PFSA 2R7DA 1OKRA 1BJAA 1R6RA 3DOLA 1MSFC 4QPOA 1PP7U 4V2FA 2LQ8A 2ZKZA 3CUOA 3DLRA 3SHFA 2M8EA 1IGNA 3U6FA 3JCMd 2EBPA 4HAMA 3BQYA 1OPLA 3TQNA 2ZO4A 3CCST 2O9SA 4I0AA 1M1GA 2P7VB 1VQ6N 3QINA 4ZDLA 4MMKA 1XNIA 3OBYA 4OINF 1YS7A 1H92A 3CCVI 3OA9A 5E1WA 3JCMh 4E3SA 1HNZK 4EM1A 3O8MA 1UJ8A 5BQTA 1YOVB 1M90O 2DI3A 1L3VA 1YYVA 1T6SA 3HYFA 3VDXA 1VSEA 3I55T 2JZ2A 1U5TB 4OAYA 3U1KA 1NK5A 1YWOA 1X9SA 5J8FA 4EVIA 4XN0A 1OPCA 1YIJQ 2NUPB 2MF2A 4U7BA 3V42A 4DLGA 3H0HA 4EMSA 1D3YA 3BTCA 4LF4K 3O9UA 3LNQA 5LGNA 2DPNA 2DEQA 4J7FA 1VTNC 3G25A 3ID8A 3CIPA 3CCSI 3NHNA 1JL1A 5JVGF 2PFBA 2VQEK 1JT0A 3QO9A 4IVNA 4EFHA 3FZHA 1RAGB 4CGGA 2ZPEB 4ENNA 3HC7A 2DL5A 2ADUA 1AD5A 5ICFA 2VXDA 3GMEA 3G1JA 5HCKA 5FLXK 4TSXA 3CVTA 3VGKA 3LWMA 1GT0C 2VJJA 2I8DA 3QBXA 3REBB 1TAUA 2EJGA 4TVRA 1RTDA 1VQ7I 3D2EB 2CP7A 1DLOA 4Y0WA 3LP1A 4M7DE 5A2QE 4CI6A 2R7RA 4M77E 3HOVJ 2XF7A 3CUQB 4CFDA 2CH4W 4J2BA 4QTRA 2COBA 4FYVB 1A5WA 3R6MA 4G6TB 5AQKA 1X1BA 1JT6A 3R2XC 4IFYA 4CIGA 1YQMA 2FPDA 3BZKA 3BTIA 2L9NA 2H8WA 2VG6A 2BE7D 2YNGA 3AHUA 5GANf 4P96A 2LSOA 5HLIA 1RAFB 3PQJA 2A3ZA 4BQNA 3LP2A 2RN7A 3P7NA 1HW5A 1ETQA 2DFEA 2F2EA 1YVNA 3TVTA 2D9TA 4MIMA 3ASOH 3V8KA 5BR8K 1YIOA 2O8FA 1VRTA 3G4SQ 1WJFA 3P38A 5KN9A 1X3ZB 1B8IA 3D0SA 3RNJA 1VQKA 2HVQA 4A12A 1K8AU 4CJUA 3T7ZA 2AJQA 1JLBA 1ESVA 4DEXA 3PTAA 4LDXA 2FHDA 2X6YA 3GNGA 4YOWA 3J80Z 2DT5A 5BPMA 3MKYB 1I4K1 2I7NA 4V19S 3TTCA 1VQLT 1Y8QB 4RTZA 1AWWA 2ZC2A 3WXIA 1BR2A 5LJ5e 4XKBA 2STTA 2JK3A 2W57A 2PZSA 3MP6A 2LY1A 3KETA 5J47A 2IAIA 4U0VA 2JTEA 1GLDG 1YJWN 4PKGA 4RAYA 1XS9A 4DIQA 5JLXA 1BC8C 3ZSQA 2LY2A 1AOYA 3SBGA 3G4ST 2AA4A 1FC3A 4IDKA 3C18A 2CKKA 4E89A 4CECA 1WJCA 3CMAQ 3VA0A 1WJEA 4DSIA 5J4VA 3GTJJ 5DUKA 5AZIB 1RBSA 4JI2K 1W36D 2FNAA 2UXBK 4B3AA 5LL6S 2PI0A 3VEWA 1B07A 1SL1A 3CWSA 5CY4A 2GBYA 3FBNB 2VQFK 3OIQA 3VPZA 1T6CA 4CJWA 2OTJQ 3HSBA 2FZKB 1ZBJA 3A8YA 4C92B 3FHNA 1NK3P 3DEUA 1TK8A 3GG4A 1YI2A 2K5FA 3DRPA 1M5Q1 5KNLA 1RLPC 5KCOA 3NTIA 4DSLA 3P5JA 5EYRA 4DV3K 1ZARA 1HNWK 2OQRA 4ZZDA 3VQ5A 1Z6TA 3NTKA 4RB1A 5LMNK 4XQFA 3CCLA 3EHQA 1WLJA 1U2WA 4MLEA 2ZBKA 3CG7A 3OYEA 2MG4A 4BI8B 2C06A 3MWTA 2QBYA 5AYFA 4ON0A 4BHPA 2QLZA 1QLYA 1K9AA 2J06A 2RK1A 4RTWA 1HYZA 3M1CA 4EMGA 3HUGA 2K6DA 4ABZA 1LFPA 1Y6IA 2VI6A 1PRLC 4IO9F 3H1QA 1H8KA 3U9ZA 4F2SA 4X1VA 1VQLN 2SEMA 1J0RA 2EBIA 2HMPA 5J3BA 4A5AA 2EV6A 4L5IA 1POGA 1M3CA 3T8TA 4DW6A 2JTVA 2NOIA 1GLAG 4A3KJ 4FISA 2QQBA 4L9VA 2F4OB 4FE7A 3VEZA 4RAGA 3C7NA 2DXTA 1TC3C 2RNGA 4B21A 4ZGJB 3CCQT 5IXFA 4RTVA 2OFKA 4EMHA 3NF9A 2L9RA 5KPTA 4JHDA 2H6BA 3LANA 4CC7A 1KU7A 3S17J 1YITT 2DA9A 5AQVA 1T6DA 3VS2A 5J4YA 4MO7A 3SEZA 1LNWA 5EG2A 3HRGA 1G3SA 3E66A 1VQ5Q 1FBSA 3I55Q 1XC9A 1X27A 5EVZA 2HW3A 3E6DA 3JRAA 1R9TJ 4JV5K 1JJ8C 1RNLA 4CZZA 4M7AF 4Y91A 2IEKA 4BRMA 4DR5K 4MNUA 4K8XA 3W0LA 1UJ0A 3THVA 3CDIA 3MEXA 3KKRA 3LH5A 3T69A 2UUZA 2F69A 1H1VA 2AHQA 3KK1A 3P8BB 2Y75A 2WSCE 5BR9A 2EQUA 1WHUA 1VSJA 4A3EJ 1IN6A 4BHBA 1CF7A 1ZYQA 5AQUA 2R93J 1AZGB 5C2DA 3MK6A 4BH9A 2LJ1A 3KK3A 1TTHB 1VQMI 2Q1NA 4LD9K 1VQON 3OMYA 3C94A 3GFIA 1JGSA 4M7DA 1HSQA 1TL1A 1WYXA 1YIJA 2BEOA 2K9LA 5GTIC 3FLGA 4PJ0C 3C2HA 2OJ2A 3ABLH 2KKOA 4Z4IA 3PO2J 4LXCA 1S1UA 1HOMA 4AFUC 2VJ4A 3ZQ7A 4I6ZA 2KK4A 2CSOA 2RHXA 1ZGJA 1SD7A 3MMYB 1NHAA 1YVUA 3QFUA 4NXNK 4RW8A 1NMDA 1K78A 2DJQA 3RKQA 1NEGA 4KT5C 2XHCA 4XH1A 1TOVA 4PZJA 1KVCA 1BM9A 3OYIA 5AQYA 5FLXZ