3OYFA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti l-870,810
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 109
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyfA03
5C6SA 4GW6A 1I39A 2CKKA 2RF2A 4F3TA 2HHVA 1S6PA 4Z4FA 3OMGA 4FW1A 4FU6A 2P0KA 3AVBA 4GMJB 5CYQA 1HPZA 4KB1A 4IKFA 3BGRA 4BD3A 2LCCA 2E4LA 2B6AA 3T19A 4OKJA 4JS4A 3NGZA 2G8HA 4FYDA 4M3YA 4CIGA 1Q8IA 1WSIA 4IUVA 2Z1IA 2X4YA 1Y97A 3ZEHA 4O55A 3H8ZA 2EHGA 5KI6A 3PUFA 4CHYA 1JLEA 1RT6A 2AJQA 4B9TA 1ITGA 5D6XA 4O44A 4FJ8A 2L3RA 3LGLA 1BQMA 1TKXA 2ATQA 3LPUA 3JSMA 5J2MA 4QVZA 3AV9A 5EU7A 1ZBIA 3QESA 1RT5A 3M8SA 2BIVA 1G5VA 4IUPA 1N27A 2I5JA 1KVAA 4CF0A 1ZBHA 3THVA 2HMIA 3Q1JA 4O5BA 5I3UA 3NF6A 2G8KA 4KKOA 4NCGA 4NCBA 3VQ7A 4CEZA 3SI6A 4O0IA 3DOLA 4DFKA 2X35A 3IS9A 1GOCA 3DLRA 2W42A 2JGUA 2JZ2A 3CG7A 4GY5A 4TSXA 4FZZA 2DIQA 3DB3A 2IGIA 4XIUA 3NH2A 2YNFA 3ITHA 2KW4A 1RT1A 2R5AA 2FBYA 4CEOA 4OVAA 3V9XA 4B8AB 2K3YA 1T8EA 3OS0A 1S1WA 1KFDA 2EQJA 2NLUA 2D0AA 1U49A 4B9LA 3NDKA 3RRHA 2XRIA 1RT3A 3QINA 3HT3A 4I7FA 2OZSA 5FRNA 3MP6A 2P51A 4CJFA 3SUOA 1WSEA 3EYZA 4B8CA 4CJVA 5FRMA 4DTSA 4HUGA 5HROA 1XWLA 4ELUA 2F8TA 1OYXA 3BDLA 3GOXA 4FLVA 4KHNA 1LWFA 5SWMA 1ZBFA 3O4NA 4N4HA 3LWMA 4JRPA 2XY6A 2FBVA 4DWIA 2VG6A 1RBTA 3V1QA 4F2RA 1J9AA 1BGXT 1C0MA 1NKCA 4M41A 3JYTA 3PY8A 4J2EA 4NCAA 1TL3A 2ZD1A 4FVMA 2GFUA 1RI0A 3OJUA 3EAEA 4FZYA 1WJQA 3L42A 3LDSA 1BIUA 3AA4A 1RDBA 4PY5A 4PQUA 2OPPA 3KLFA 3DLEA 3HP6A 3E01A 2X74A 3AA3A 3I0SA 4BE2A 5J1EA 1QSSA 1IKVA 3ZSVA 3V9ZA 3MXJA 2LSNA 4OPKA 3TWHA 3PX4A 4FZXC 1HMVA 1YTAA 4CFDA 2JTFA 4NS5A 4UC4A 3AO4A 3D0PA 4FJ7A 2YHAA 4KO0A 3F9KA 3T1AA 4E19A 4NZGA 4QW2A 1KTQA 4CJEA 3NH1A 1GOAA 4Y1DA 2P5GA 3LP1A 1BI4B 1RDAA 1RT2A 4RW6A 3NH0A 3QEIA 2X78A 3NTKA 4CF2A 3QETA 4ELTA 4CJPA 4BE1A 3E9GA 4LH4A 3U3YA 1SL2A 4C8KA 4H4OA 3QO9A 4IFYA 2HHXA 4IUUA 3ASMA 2HQEA 3AVFA 4DQPA 4ZTJA 4W5TA 3MO8A 3SD4A 1KFSA 1G15A 2Z1GA 4IG3A 1D9FA 1IKXA 4W5RA 2LVMA 2RI2A 3ALYA 1JL2A 1TAUA 1KHCA 5KH6A 1KCFA 4KHUA 1A5VA 3RRGA 2RI3A 3UT1A 3H08A 2A1RA 4DF4A 1QQCA 3U6FA 2KZMA 3RMAA 4B9SA 2XY7A 1X1PA 2PZSA 4IUTA 4C8NA 3T3FA 2PYLA 4FLZA 3RR8A 3MEUA 3LGFA 1VSJA 4IURA 1RBUA 3LLRA 1LWEA 4CECA 2BDPA 2EQMA 1RDCA 2O4XA 1L3SA 2GFAA 3OYLA 2RHIA 1RTHA 3G10A 4DTJA 2M0OA 1SL0A 2YKNA 3V81A 4C5EA 5KCHA 4AHSA 3OS1A 1BIZA 4BWJA 5HRNA 2KQ2A 1D9DA 4AHTA 2GV9A 4DTNA 3PMIA 1WSFA 3K5MA 1UAXA 4ZTFA 2E5QA 4CJWA 2P1JA 3DRSA 2IC3A 4OVLA 4FJLA 1HQEA 3OJSA 3DLKA 1ASUA 1WJSA 2X6SA 4BE0A 3MEDA 4G1QA 4H4MA 4KV8A 4CJ4A 5K14A 5KRTA 4N47A 4DTUA 2X4WA 3NGYA 5DMRA 4FLYA 4AILC 5J2PA 4DSEA 1BCOA 4OLBA 4IG0A 4CJQA 4N76A 3PMTA 1QHTA 2DY4A 2L89A 2RKIA 3ZSXA 1YVUA 4QOZB 3QEWA 1Z25A 1ASVA 3C94A 3TR8A 4E7IA 4L8RB 3DB4A 3OYJA 2HB5A 4CK2A 5FROA 3ZT1A 5J2NA 3SUQA 4ELVA 3OMCA 3K58A 2HQXA 1EXQA 1FXXA 3C4SA 2IOCA 1RBRA 2ZE2A 4W5QA 4DTMA 3QIIA 1VSDA 4CIFA 4CGHA 4HUEA 4DQIA 1NK9A 3HK2A 2FBXA 2GBZA 2XDPA 3AVCA 2RJDA 4DU1A 1Z26A 4EP4A 2NUBA 3HYFA 3OYHA 3QIOA 2PY5A 4FLUA 3ZT0A 4KTZA 1NJYA 4QQ6A 3ZT4A 4B9MA 3ULDA 2RHYA 2BGGA 1UWBA 3AO3A 3DMJA 3K2PA 2G8IA 2R5MA 4CFAA 4CFCA 3L2QA 2X6NA 2B8AA 2YNIA 4CJSA 3LH0A 3OYCA 5IN1A 1JL1A 1HNIA 2A1SA 2ITGA 2JLEA 4FM0A 1UA0A 1L5UA 4F4KA 4FK4A 3AVGA 2E6MA 1VSKA 4BDZA 4FW2A 4RG8A 4W5OA 1XC9A 1LAWA 1SKSA 1JLBA 2D0BA 1C6VA 4FK2A 1S5JA 3LZJA 3TI0A 1JLAA 2LTOA 3KUFA 2RHUA 2BE2A 3VQ5A 4DTXA 3QNNA 4DSKA 1LW0A 2YKMA 4FJKA 1HRHA 4M3XA 1YTUA 3NF9A 3I8DA 4KPYA 3ME9A 2DIGA 4NYFA 4E7KA 2BUDA 4IUQA 4CGFA 3P1GA 4DLGA 1BQNA 2YHBA 4DS5A 2PQWA 2XY5A 1Q9YA 4K8XA 2YNHA 3QIPA 4RW8A 3OYKA 3SQ2A 4BDPA 4M3UA 4GVMA 4PLIA 3DLHA 4B9NA 3HJFA 3VQBA 4KHQA 3SJJA 3ZSOA 3UWNA 4CJLA 3TAFA 3LZIA 1RBSA 4IFVA 1W0HA 4FLWA 4DU4A 4ICLA 3CFRA 1QS4A 3HPHA 3KKRA 1BL3A 2Q3SA 4IBNA 1HJRA 5HLFA 2HHUA 3ZSYA 4M42A 4A4HA 4HCBA 1KVCA 1C0TA 5HBMA 1LAVA 3QNOA 2Z1HA 4OJRA 5JS2A 3SZ2A 4B9VA 4KHYA 4DLEA 3PX0A 1QTMA 1TKTA 5E41A 3PV8A 2IAJA 4CEAA 4LD6A 3MEGA 3KKSA 4FLTA 4LY7A 3RMCA 3SQ1A 1LV5A 2G8FA 4LSLA 4KTQA 4N4IA 4KHWA 4DFPA 3NBPA 4DTOA 1J53A 1B92A 1DTTA 1BCMA 1VSEA 1VSIA 2DFFA 3OYIA 3AA2A 3CYMA 2IS3A 3LALA 3ZSZA 3QEXA 1T05A 3NE6A 3PNWC 1BHLA 2R58A 1MU2A 1ZBUA 3SCXA 5KE2A 4R5PA 1RT7A 1RILA 1RCHA 3ZCMA 4CJTA 4FLXA 3K5NA 1JLGA 2HVHA 4KI6A 2K3XA 3QLHA 3P83D 4E1NA 2XHBA 4DG1A 2LRQA 1NOZA 4O0JA 2WOMA 4HVJA 4M3RA 3KLEA 3VN5A 2DTUA 4Z4GA 2MWPA 1TKZA 4YFUA 2O4GA 1NK5A 2F5KA 3DLBA 4FK0A 4M3WA 2RHZA 4I2QA 3EZ5A 1NOYA 4PUOA 3FEOA 3V9SA 1JXEA 1HYSA 4KI4A 1LW2A 2R57A 4CF8A 3NNQA 4CEDA 3NAEA 4DF8A 3SUPA 4CGIA 5C25A 3L2WA 1XI1A 4DSJA 3ZT3A 5KE3A 2WACA 1CXUA 2G8WA 3F70A 3AO2A 3TAPA 3M9QA 1CZBA 1VSMA 3PFSA 4PLLA 1SV5A 4RW7A 2HHSA 1DLOA 3VQ4A 4CF1A 4Z4CA 3SNNA 4FL6A 1C1BA 3NFAA 3AA5X 4DQRA 1QSLA 3OS2A 3OYGA 3OYMA 3HVTA 3NF7A 4OKEA 1WSHA 4EZ9A 3SYZA 1CXQA 3AVJA 1SL1A 2XK0A 4C8LA 3LX7A 3C95A 4CJ5A 1DTQA 4X34A 3KD5E 4E7HA 4AHCA 2HHWA 2X4XA 2ZQBA 3DM2A 1T03A 1NJXA 2GF7A 3S3MA 2GUIA 3VQ6A 5HP1A 2QQSA 1WLJA 3TANA 2VYTA 1QSYA 4F3OA 3RWUA 4I9LA 4W5NA 5J2QA 3ASKA 3BDPA 4FJNA 3FDRA 3FLGA 3MXMA 5M9OA 2E6NA 4K8ZA 1C1AA 4JRQA 1Q9XA 4RW9A 3M8PA 4Q0BA 4O4GA 3VQ8A 3A2FA 4UQGA 1RTDA 2HVIA 5KCOA 1ZYQA 5CZ1A 2D5RA 1EETA 3NF8A 4PA1A 1L3VA 3O8VA 2MWOA 3CFOA 4LH5A 2EFIA 1IKWA 3NTHA 3ZT2A 4CEBA 2G3RA 4Z02A 3ISNC 4CK3A 1L3UA 4CJRA 1O1WA 1WJRA 1U4BA 4CERA 4Q5VA 1TKDA 2RN2A 1JLCA 1HQUA 3P5JA 1TK8A 4OKKA 3DLMA 3VA0A 1J5OA 3KLHA 4CEFA 3MXIA 1IO2A 4HUFA 1WNSA 3QEVA 1I3AA 3LANA 4QQGA 3V6DA 4FJMA 1JLQA 3E9FA 1N5YA 4N41A 3H6ZA 3L3VA 2RHXA 1S1TA 3NHGA 4F8RA 4CIEA 5C0MA 3SUNA 1N6QA 3AO5A 3OYFA 4ZHRA 3HO1A 4DQSA 4AHRA 4DU3A 3LYIA 4CF9A 1IH7A 4B9WA 1TV6A 2FC0A 4N56A 2EQKA 3ZSRA 3D45A 2RJCA 4DQQA 2VWKA 3F73A 2IG0A 4KTWA 3OYAA 3RTVA 2RI5A 1S1UA 2B4JA 3DI6A 3LAMA 3HVRA 3VQPA 4DTRA 1RNHA 4DSIA 3UIQA 2HW3A 3KLGA 4DFMA 1EKEA 2HHQA 3AO1A 5J26A 3DOKA 3IAYA 1MHNA 3AVHA 4CEQA 2VG7A 3CM5A 3M8QA 1D5AA 4PL6A 1UA1A 3QBYA 2WONA 3AVMA 5C42A 1J54A 4H8KA 4QAGA 1CZ9A 3MP8A 2OPSA 2F8SA 3MEAA 3DLGA 5JS1A 4EDUA 4HHTA 1IKYA 1X9WA 4FJIA 2YNGA 4Q5WA 3QEPA 3VQDA 3SPYA 1NK0A 5CIUA 4OGCA 3HL8A 4JLHA 2OPRA 3IG1A 4CGDA 1RTJA 4FM2A 1NJWA 3KK1A 3S3OA 3KLIA 4E1MA 4PWDA 1RDDA 1NJZA 3L3UA 2M1HA 3C6TA 3K57A 4CGJA 4BDYA 4A4EA 1RBVA 3HSTB 1TGOA 4HTUA 4DTPA 1WAFA 1RT4A 1YT3A 3B6OA 3MEEA 4FM1A 5KGWA 3SV4A 5SZTA 4KB0A 3V1RA 4FJ9A 3V4IA 4QQDA 4A4FA 1U48A 3LP2A 3ZSQA 3AVIA 4Y1CA 3KJVA 5IAYA 2OYQA 2BKDN 4FJXA 4BWMA 4LD0A 4E0DA 3L2RA 4C5HA 1BISA 2OA8A 4WE1A 3TAMA 1NK8A 1UOCA 2G8UA 2DAQA 1XHZA 3SV3A 5CZ2A 4CESA 3V9UA 1NK4A 4N4GA 1S1XA 1GOBA 4ID5A 4E89A 3O3HA 4Z4IA 2ETJA 1TK0A 2VWJA 4CHOA 1A5WA 1VSHA 4CCHA 3AVLA 3OQ5A 1KRPA 4CJ3A 4EP5A 2YV0X 5CY4A 2HNZA 3K5OA 1JLFA 1NK6A 3DRPA 3S9HA 3HM9A 4KRFA 3HPOA 1T7PA 1SKRA 1WSJA 3U3GA 4B9XA 4MFBA 4KAZA 1QE1A 1RTIA 3DRRA 4M3TA 3O3GA 3C6UA 1EP4A 3HPGA 5C24A 4B08A 1NK7A 2KFNA 1TAQA 2YRVA 3CM6A 1SKWA 4FJJA 1IG9A 3L2VA 2L8DA 3VA3A 2XY8A 2PYJA 4DMNA 1KLNA 2O4IA 3AVNA 3VQAA 4Z0UA 4EZ6A 3CEYA 1D8YA 3PO5A 4Z4HA 1EX4A 1S9EA 3DYAA 4NYNA 4CHNA 1NKEA 3OY9A 4CEEA 2KZZA 3KTQA 4I9QA 2M16A 1TL1A 1SUQA 2R7YA 3LP3A 1S6QA 1S9GA 2RO0A 1VRUA 3I0RA 2EQUA 3QKJA 3SQ4A 4E3SA 1WN7A 3RR7A 4I2PA 2G8VA 4FXDA 2E6LA 2XO7A 3O3FA 4C5GA 3L2UA 3CQ8A 2OZMA 4FJGA 4JS5A 2EX3A 5KTQA 1JXBA 3AVAA 1WSGA 1JKHA 4CJKA 3PO4A 2FBTA 1U45A 4KFBA 2KFZA 3OYBA 3S6WA 1HYZA 2Z1JA 4CRIA 1X9SA 1X9MA 3SPZA 2BANA 4MQ3A 3OYNA 4CGGA 3VQCA 3NGIA 2RPIA 1VSFA 3NTIA 2Y1JA 4DSFA 4FCYA 1U47A 3OYEA 5D6WA 2B5JA 2HNYA 3B6PA 1FKOA 4OGEA 1F21A 4CFBA 5HRSA 2FHDA 3OVNA 4N5SA 3WNFA 3K5LA 4J2AA 2QKBA 3LPTA 1W9HA 4C5IA 3VQQA 4A4GA 1VK0A 2QQRA 4L59A 4CHQA 3MEWA 5T7BA 1WGSA 3ZSWA 3IRXA 3MAQA 3SQ0A 1KVBA 4M45A 2IDOA 1FK9A 1U04A 4BACA 3OA6A 3VQ9A 3EY1A 1NKBA 2F96A 4Z4EA 2D9TA 3TAQA 1TVRA 2KTQA 4J2DA 1XHXA 3WNEA 4OPJA 4HCZA 3AVKA 2LDMA 5HRPA 4M3ZA 3K59A 1B9DA 5CYMA 5J39A 1A5XA 1XNIA 4CK1A 3V9WA 3MECA 3TARA 1ZBLA 3KK3A 3OYDA 3MEVA 4E7JA 4CE9A 1OZ3A 4AHVA 1REVA 3TABA 3FFIA 4CHZA 1K6YA 3KIOA 1FKPA 3P8DA 4DFJA 4DSLA 1S1VA 3LAKA 1BI4A 1HYVA 2RJFA 3S3NA 4CHPA 1CLQA 2P5OA 3TAGA 4KHSA 1C1CA 4ID1A 4B9UA 4B3OA 4RG2A 3L8BA 1R0AA 4FJ5A 2HHTA 3FC3A 2RJEA 4QCLA 3HP9A 3OB9A 2OPQA 5D6YA 1VSLA 3V1OA 1OZ2A 2VG5A 2QXFA 4AHUA 3HXMA 3MP1A 1KLMA 3KK2A 3PX6A 3RMBA 1WAJA 4CJUA 4IDKA 1VRTA 1B9FA 4C8MA 5KGXA 5I42A 4KREA 1H3ZA 4RW4A 1C0UA 4LSNA 2QK9A 3WNGA 2HNDA 5D3GA 3NCIA 3WNHA 2O4XB 4C8OA 2Y1IA 1SSFA 3QJ6A 3G0ZA 3CFPA 1LWCA 3O4QA 1L3TA 3RMDA 1TK5A 4J2BA 2QKKA 3VQEA 4YNQA 4II1A 1KSPA 4HCCA 4FJHA 3P8HA 4F2SA 4AH9A 2DFEA 5HRRA 4OLAA 4E7LA 1ASWA 1OI1A 2DFHA 3LP0A 4DS4A 5FDLA 3QERA 3LWLA 2D0CA 5KRSA 3META 5DK5A 1HNVA 3M8RA 3TAEA 2EKOA 3KD1E
chains in the Genus database with same CATH superfamily
1FN7A 3PQKA 2E4HA 5HDGA 1X3UA 2LT4A 4HF2A 1Y6IA 4EA5A 4JX6A 3K0SA 3S2DJ 3CC7T 5D6EA 5CKHA 4FJ8A 4U87A 1R9TJ 1QQIA 3WTUC 4EA4A 1TKXA 3OW2A 1AWJA 2O9LA 3K4MA 4PJOC 3F3XA 4H5WA 4KITB 4XK4A 2G8KA 2IW5A 4O0IA 1HKTA 3DLRA 2OBPA 3HI0A 3NH2A 1SAZA 2QSFX 3VTHA 5EZGA 4NLCA 2DPPB 5E3LA 4I7FA 3OR1C 3QYFA 2A07F 1QRYA 4ANJA 1XJWB 2W0ZA 1RBTA 2M8EA 5E1WA 1KG7A 4IJNA 1MUYA 2KE9A 1BIUA 3EL2A 4PY5A 1B4AA 1RAAB 2AO9A 1IZ6A 2J05A 2BE7D 1HSJA 2K5IA 2LMDA 4AFQC 3PX4A 1YTAA 3ZN1A 1SQKA 3CUOA 1IB8A 4KO0A 5AFUA 5AN4A 4Y1DA 1RDAA 1RT2A 1PYVA 3I56A 1WIEA 1HPMA 1XNQK 3AL0C 4B44A 1KQ9A 1Z91A 2H8HA 2CH4W 3G4SI 4HWIA 2PBIA 2HYJA 3SZPA 1GV2A 2R93J 3MEUA 1VSJA 3KPHA 1ORNA 5KCMA 4ENMA 5ILSA 4Z8AA 3HM5A 2ITMA 3LL3A 1C0WA 3EGUA 4H5VA 3KP7A 1ASUA 3RMQA 1K9AA 2I0NA 2X4WA 3BPVA 4OLBA 2LX9A 4IG0A 3PMTA 2IGMA 2OQGA 2Q8KA 4E7IA 2MAMA 3OYJA 2DMTA 3FXLA 3I9V2 1ZN2A 3BR6A 4MQ9F 4C30A 1VQNQ 4DU1A 4MNUA 4A3IJ 4RAYA 2DL5A 4OB2B 3ZT4A 2MCNA 1WYXA 1C6VA 3U8XA 5AQSA 5H2FC 5HNFA 3VQ5A 5AQIA 2E2QA 3ME9A 5KYWB 1JCGA 2QZ8A 3WGGA 2L9NA 2OV7A 3KK7A 4KHQA 4YOTA 3FX3A 1T6DA 5AQLA 2VUMJ 1FP2A 3HC7A 1K79A 4ITVA 5GANj 4OJRA 1UB9A 3PUBA 1YJWI 3ENHA 3FRNA 4FLTA 4IL6C 4F7UB 5KPZA 1I5ZA 4A54A 2L2OA 2CGPA 3M0RA 3G6EA 4IDHA 2AQEA 2VPLA 2K3XA 2DKGA 4DG1A 1SFKA 3CD6N 5CKDA 4CZZA 2EFNA 3M8EA 4JI6K 3W6VA 2V9KA 4MDBA 4RTXA 1TC3C 2VI6A 3IFRA 1XMQK 2DDBA 1ZLJA 4CF8A 4E9EA 5E20A 1WHLA 3F70A 2E34A 2P81A 1B72A 2DBMA 3PFSA 2OTLI 1D0ZA 2CZ6B 3VYRB 4UV9A 4BAYA 1A6IA 2ECZA 1KC8R 6PAXA 5CQYA 1W7AA 2P5KA 3I33A 1N39A 3DLLL 1DP3A 2BH1A 3EO3A 1VQ5N 4EGYA 1X2KA 5E3OA 4UQGA 1ZREA 1TXQA 1OCPA 2CUDA 2DXUA 1RLQC 3FJ5A 1L3UA 3H0IA 3I4NJ 2R7VA 3H35A 1RRSA 2E5ZA 2QBYA 4KHNA 3U9DA 1TK8A 4FJMA 4PFOA 1YI2Q 1IN5A 1F4KA 4LDXA 1X3MA 2VBXA 1OX9A 1ZUYA 1ON1A 5C0MA 3ZX3A 4BR2A 4UVBA 2BZ8A 2DL7A 4K41A 5EX5A 4CF9A 2M45A 2VLAA 5F1RA 2EQKA 2KP6A 4KTWA 5CK9A 3OH6A 2PUOB 3FMQA 1GXIE 1JGGA 1W7PB 3K4NA 2XRLA 1K73U 3N97A 3QEPA 4M9XA 2RQVA 2ME0A 4LF8K 3LA2A 1YLFA 3D6RA 2BBYA 1IV6A 2VOPA 1S72T 5D8LB 4M72A 2OYQA 5J4VA 1NEBA 3MVPA 1IRXA 1SVOA 1BC7C 3B6AA 4BQQA 3J7AF 1ABOA 1S1XA 1SD4A 1VQ6I 4FXDA 3VYSB 3HOSA 2GEMA 2F5DA 4JZ4A 3HPOA 1T7PA 1WJCA 4C2MJ 3TMOA 3FF5A 3C6UA 2VKDA 3OSVA 3O8GA 2MGQA 1HDPA 2VQGA 3J7YP 1K8AR 3P7NA 2LQ8A 3DYAA 1NKEA 3A5NC 1JTYA 3P38A 3F22A 2DXBA 1IGQA 3I0RA 1Y56A 1VAZA 2RK1A 1MSFC 3IAS2 2ZFWA 4HF0A 4OFAA 2CYYA 4HQMA 3AARA 1EQYA 3O3FA 2QEXA 3CQ8A 5GANd 2LR8A 3PO4A 2DXCA 3UF4A 1VFCA 3S6WA 2QQAA 2ESHA 3VQCA 3NGIA 3P9IA 1BB9A 2E1YA 2LBFA 2UUBK 2O8XA 2OUMA 1KA8A 5GAN3 1D0XA 1SEMA 4IEEA 3J7YJ 3CF5F 3OA6A 4KH6A 2F96A 2D9TA 3I55I 2EGAA 5HLGA 5HRPA 1M90U 3SAGA 2J6OA 1Y64A 4HDUA 2EJGA 2CQKA 1PP7U 3FIWA 4RBOA 3EH1A 1K73R 3DPUA 2YUPA 2VJJA 2P5OA 4RG2A 3F8FA 2HZTA 4KREA 2L3DA 3H5RA 1K9MU 4LIUA 4BH9A 4OLAA 3BTLA 3KP6A 2ATCB 5C6SA 3BZCA 4PJMA 4FW1A 1JXSA 3ZQIA 2B6AA 3T19A 4PK4A 4CHYA 2E2IJ 2DA2A 1DGKN 2E2OA 2EW3A 1KQSA 2E2HJ 4HSBA 3TREA 4KGXB 3R3LA 2ZGWA 1VQ7T 4IUPA 2BW3B 3DXKB 1KVAA 2HMIA 5GPCA 4O5BA 4U0YA 1IG7A 1NLPC 3CCLN 3B73A 2X35A 4Y15A 1T8EA 2LF8A 1FMVA 3OS0A 4KT5C 2NLUA 1YRNB 1OJLA 3KEYA 3CD6I 2EV5A 2P51A 1RI9A 2AKLA 4F2RA 1NKCA 3FMSA 3JYTA 5C15A 3EAEA 2EH3A 1RDBA 1WJDA 2VCPA 2FOWA 5AQTA 2L0KA 2HBMA 2R7DA 5J4YA 2HVSA 3O8HA 1KTQA 2EZIA 3RUXA 3SB2A 4LK1F 2OX7A 4IFYA 4UXNA 4XTXA 3M9AA 1VQKA 3BZ6A 3GW2A 2WTUA 2FE3A 4FASD 3ZFJA 1C0FA 2RI3A 2K9SA 4DF4A 4PDKA 2OJED 3VTIA 3LSJA 4CECA 2XIGA 2VWFA 2YRDA 5BR8K 3CF2A 3QDFA 5KCHA 3S1NJ 2KDSA 3HOVJ 4BG9A 1NMNA 3IUCA 5E8GA 4ENJA 1I6HJ 4G1QA 1P7IA 2QYOA 3ZYYX 2QWQA 4J01A 3HOUJ 2CREA 2RKIA 1YOVB 3ULEB 2FZGB 2MG4A 4RCCA 4ELVA 3WGIA 1FXXA 2P0QA 2E8AA 4CGHA 4B43A 4XRMA 3AAFA 1WJAA 2I7PA 3H3OB 1MMNA 4H5RA 4JJNK 3W6KB 1S3JA 3RZOJ 4CDGA 1RESA 1V1CA 3QOPA 1VQPT 4KMUX 1UA0A 5LJ3d 1D1BA 4RG8A 4W5OA 4UB6C 1OYIA 4JZ3A 3QOEA 2CSQA 5GAN4 3CC2I 3UPUA 3O8MA 2RD1A 2P4TA 4G12A 3GFMA 4BDPA 1LVAA 1GV5A 4C23A 3SJJA 3ZSOA 1X1BA 3OTOK 1RBSA 3ZMSA 4M42A 2H56A 4QS8A 2DA1A 2PJRA 2V9PA 4BR7A 3QNOA 3F0CA 2F48A 3VS6A 4MQVA 1TT0A 1HX1A 4P55A 1WGXA 2I5WA 4CEAA 2DA6A 1O3RA 3SXYA 2UZKA 2XRNA 3V8JA 4D5CA 3NE6A 3SCXA 2HR3A 2W1OA 3H1QA 1FBQA 3P83D 2DYBA 2BY1A 4CCNA 4UVCA 3FEOA 4EM1A 2M02A 5C25A 1T44A 4D5FA 1CXUA 1VSMA 4PLLA 1PD1A 1YW8A 2FMYA 3VS3A 1J75A 3X26B 5F04A 3OYMA 3WXKA 1EH7A 4EZ9A 2HYGD 3NQOA 2BEOA 2I10A 3GF2A 4XRFA 3HOTA 4IIOA 5GAOq 2GF7A 2MI6A 3CF5L 3CCUA 4BNCA 4HV5A 5DCMA 1LE8A 2A7YA 1VQ9N 3LH5A 2ESNA 4II2A 3FLGA 3OSSC 3WXMB 1RTDA 1R36A 3GE1A 4Y17A 1CZAN 4EIAA 4JI5K 2FXAA 4IX7A 2X6YA 4XTUA 4M74A 3CCSQ 3C65A 1KYZA 4OKKA 1IO2A 2NS8A 2LF7A 4MFEA 4KFCA 4LDWA 4LF6K 5FB2A 4EJZA 1PVSA 2LKXA 3LWFA 4DQQA 3EG0A 2HZYA 3F73A 1N5ZA 5KAIC 1G8XA 3UIQA 4BBSJ 2HHQA 4LC9B 1USSA 3HFOA 2R7OA 1VQ7I 1VQMQ 1PDNC 2WONA 3UA6A 3A5LC 2BOLA 2D0NA 4NXMK 3MEAA 1IKYA 1X9WA 1K4US 2G0EA 5CIUA 4OMMA 3KK1A 3HRMA 4BRNA 1MKMA 4FYYB 3KYDB 4JKGA 2L3PA 3QU3A 1H89C 3QPHA 2D1HA 3NVMA 1HSQA 3ZSQA 3KJVA 4FJXA 4YFKF 4WE1A 3TAMA 2E7XA 2RQRA 3QDKA 1GOBA 4ID5A 3O3HA 2W40A 3I3LA 1HKQA 4KRFA 1BL0A 3ZBDA 3QODA 3ZP5A 1RTIA 3LL7A 1MH3A 2LY2A 4M73A 3OS5A 3ID6A 3JREA 4Z0UA 2W24A 3J80K 4Y52J 2HSEB 2X3WD 2MYSA 3HG9A 1GL5A 2DPNA 4MDAA 2W6KA 4L5JA 4AWXB 3E5XA 4BU2A 3CCRI 4AFZC 4C5GA 4XQFA 2L02A 1K7AA 1DU0A 1M1KU 2XMFA 4WFBL 1M90R 1S9HA 3SZTA 1VSFA 5KYNA 2JT4A 3T1YK 2NUTA 5D8KB 3W3DA 1F21A 2R5ZB 4C8QD 4HG2A 1GXQA 2IDOA 1YJNN 4U7DA 4A6DA 3SEQA 4YOXA 1PRLC 1SVLA 3CCRN 2NVTJ 4QKUA 1LEAA 1FKPA 2X6XA 4DFJA 1P7JA 2KT0A 5IYCJ 3E6MA 1L3LA 2YUQA 4ID1A 1XX5A 2VG5A 3HUGB 1SPKA 4B9QA 3ZQGA 1MDMB 4JEPA 3ABKH 2PLYA 5JLWA 3M4YA 3O08A 1BYMA 1S5LC 1TK5A 4J2BA 4F04B 4E7LA 3JCMV 3LWLA 5DD8A 3DLLF 4YEJA 1TSFA 1I39A 1D09B 1QVUA 1M2OA 2K86A 1NGDA 1RI7A 4RUGA 3Q0WA 1WX6A 4IKFA 3RKXA 4KN7X 5K5OA 4JS4A 1KD1R 1EZZB 1GBQA 1Q8IA 2Z1IA 2W7NA 2QA4N 5KI6A 4CZJA 3LPUA 3JSMA 2XDBA 3AV9A 1OR7C 2PMHA 4B3TK 2ZJ2A 4J9GA 2CG4A 1I07A 2CV0A 1RUNA 2F2VA 3CG7A 2ASOA 2JWKA 4IOXA 2QWMA 4PJJA 5BREA 2OFKA 4A3FJ 2FBYA 5DM7F 1VQ5T 2Y9ZA 2BVLA 4D6WA 3CZ6A 1Y71A 4WCEL 4A2BA 2Z2SB 1BWFO 2YCHA 3MP6A 3R60A 4B8CA 3E7LA 5A2QK 5SWMA 1W2BA 1OCRH 2FBVA 3F8CA 1GFDA 2VG6A 1XQHA 3MCPA 4NCAA 2KRHA 2PZ1A 2HWVA 1RI0A 2Y4XA 3E9OA 2KYBA 1YS7A 3CCUT 4KH0B 5KYUB 2YU3A 3E01A 2PVGB 2QSHX 3UA7A 1Z77A 1E3OC 2AK5A 1HMVA 5DV5A 2DE0X 2WY8Q 3LFUA 5CHIA 3LP1A 1GCQA 4CF2A 4JKEA 2QEXN 2B9SA 2HHXA 3SK3A 1G15A 1D9FA 4W5RA 3KETA 4AIJA 4YFXF 2RE2A 2P5VA 2KZMA 4B9SA 2EV6A 5JMVA 4G7ZF 3P31A 4IIMA 3EKUA 2GFAA 3K2AA 3A5ZB 3CDIA 3TOAA 1LWVA 2H09A 2KQ2A 5IH2A 2MLGA 2PQ8A 3JCMb 3KFWX 3DRSA 3SHWA 1WPKA 4M7AD 4XONA 3DV8A 4HEA2 1Q81R 4KA4A 4XU2A 3TSWA 3SUQA 2F4OB 2HAXA 1XGSA 2CZ1B 2OAZA 3CC2A 3TSPA 4M3GA 3S16J 2LC2A 3P4IA 2NUBA 1LFUP 1OISA 2BTTA 2RHKA 2EFPA 2DERA 3LH0A 1QWEA 2A1SA 2E2PA 3AVGA 4YOUA 5EY4A 1A36A 1YWOA 3LZJA 3G71Q 3KUFA 4DYCA 4I2OA 3O9QA 4BBRJ 1HRHA 2L9VA 1BN5A 4I76A 5AFUH 2Y30A 3QWLA 1XNRK 2XY5A 4LE9A 4CUGA 2NOJB 4CJLA 3UWNA 1JTXA 5GANg 4DU4A 3ML6A 4QLCU 1P92A 3GNFB 1LCKA 1BL3A 3QP6A 3R61A 4BYYA 3IH2A 4AMCA 2QUFA 5HBMA 4ZZLA 3F9MA 4LNPA 1XG7A 2WC9A 4X9CA 4XLPF 5A2QO 2RVCA 1TWAJ 2AIRB 3M5AA 4XBFA 3M4OJ 2KJCA 2CS7A 4Y4RA 2DFFA 1G2BA 3M1FA 4M3BA 3PNWC 4E4HA 4L9NA 4R5PA 4ESRA 1Y96B 3QLHA 5FFXA 4HVJA 3GTMJ 5GAMf 2MH2A 3CLQA 1U6GA 2ROLA 4FK0A 4S05A 2V52B 2LJ0A 4KI4A 2R5YB 4L18B 1J2XA 5TGTA 3CJAA 4B47A 1DPRA 3CCMQ 5I2MA 3I9QA 3IHUA 4C92D 2OTLT 4XAXB 3QICA 4WXDA 2DA9A 2Y90A 4XLFA 2NOEA 3S3MA 1IHWA 1QHGA 4PZJA 1D5VA 2PN6A 2HEQA 5M9OA 1EJ9A 2WFBA 4DR5K 3WT0A 2HVIA 2D5RA 4LN2A 4FWRA 3GBTA 4CEBA 5IWAK 4M77E 2L7ZA 1TUCA 3O9SA 1FTTA 4M7AC 4IZZA 2E65A 1JLCA 3OV8A 4QT7A 1J5OA 3I56Q 4CCOA 1R1UA 3ZOBA 4D7MA 2DMNA 3K4JA 4B1YB 4IF4A 1O3TA 4DU3A 1TV6A 4DZJA 2VWKA 1MGTA 5AQZA 3DBRB 2D5VA 4MLHA 1S1UA 5ADXH 3NWSA 1JUPA 2IPQX 2NRZA 1XB4A 3JW4A 5JLHA 3ZL7C 4IO9F 3S17J 2O3FA 2IA2A 2EYZA 3DTKA 3WTYC 4QIWN 1CZ9A 3CCUI 2OPSA 1WH5A 1XUPO 1OX8A 3SLCA 3HTSB 2JMWA 1PUFB 4JLHA 4CGDA 4FM2A 2KMTA 4M7AE 4IHYA 1YQLA 2M1HA 3C6TA 1S7OA 3PO2J 4DTPA 5HVQC 3DFGA 4JAXA 3V4GA 4J9BA 2EBIA 4MDWA 1BISA 1K78B 2P9PA 1UFMA 2KY9A 1VQ5Q 3QPTA 2HFHA 3M5RA 3T1HK 1K6OA 3CHWA 4OAZA 2YRVA 5GP9A 1SKWA 4IJAA 4HZFA 4C2UA 1KQJA 3KE2A 3KXTA 2QAZA 2EK5A 3P39A 3ZMZA 3GZ5A 2Z3YA 3L00A 3ZQLA 1A0NB 1UCRA 2G8VA 2IS6A 4Y13A 1SANA 1D1AA 3CIPA 2VC1A 4M71A 4YY3K 5F2RA 3CXCM 1R7JA 4YDUC 1FTZA 1T33A 2GQQA 2X4JA 4BJ6C 4BRGA 3QZ5B 4M9SA 2L9SA 1W9HA 1WUAA 5IOYA 3CQTA 2HBWA 1WEGA 3WU1B 4CXFA 2KJBA 2CP5A 4J2DA 4G7HF 4JI8K 3TARA 1VQ9I 3MEVA 4L5IA 1T0FC 5JVGF 2FO0A 2ECBA 1LPLA 3J8AA 1ZSZC 2OI3A 1JKOC 4DOWA 2HHTA 3JSCA 2QM3A 1VSLA 2OZUA 2R7WA 3GBQA 3PX6A 4A12A 1WAJA 4IDKA 2EYQA 1YS6A 2E1CA 1C0UA 2HNDA 3I4MJ 3PVQA 2FQ4A 5CHZA 1FPQA 2ZJRF 3P8HA 1X2MA 4I02A 3TQ7P 4OMZA 4GW6A 2WUSA 4B1UB 1VQNN 1EFNA 4J6YA 5AQUA 2P0KA 5L3DA 1PU7A 5CAIA 3BTIA 2YG9A 3A8GB 8AT1B 3ZEHA 2AJQA 2ZF5O 4CCMA 3J80E 3QESA 2BIVA 4CF0A 1VA7A 1BIAA 1QBJA 4LGWA 1W0UA 1WWXA 4F7UF 1E2XA 3F10A 2QXLA 5M1QA 3HT3A 3C0BA 3SDZA 3ULRB 5FRMA 2RNAA 4XH5A 3EHRA 3CC2N 1NGIA 1VQ6T 3GF5A 4A0XA 4GLMA 2RMOA 1YXQA 1A31A 1WBBA 1VQPN 2K9NA 4CJ7A 1WJQA 3FIFA 4EHTA 1WVRA 3OIQA 1RDWX 3HTVA 3LW5E 3REAB 2AHJB 4RMOA 1Z21A 3MCZA 3ZXSA 2V1XA 3F9KA 3T0YA 4FE7A 3CERA 1N3AA 4LD5A 1LEBA 2HDDA 3I55Q 1CSKA 4R8HA 4JYAK 3TEDA 2LVMA 3HKSA 3DLAA 4JI1K 1H8AC 1A5VA 3VUBA 2NUPA 2P9LA 2YX7A 2I8DA 3CCMI 3HOYJ 3VYHB 4DTJA 1BI0A 5KHDA 1Q95G 3W0LA 3ABUA 3H36A 4FJLA 3M57A 1KQ2A 2JN6A 1BW6A 4HNTA 2DMPA 3Q3SA 5ICCA 1QMCA 5M1OA 1KC8C 2IVOA 5LEJA 1ARKA 3WG9A 3C94A 2CP7A 5AZJB 4CK2A 4M77A 4EVVA 2JSPA 2P9UB 1O13A 1JHFA 5C4JJ 2O8BB 3MAJA 5DS9A 5DM6F 3C0CA 3EH2A 1ZBJA 2W6LA 1WHKA 3MEXA 3KP4A 2CW8A 1FP1D 2D0BA 1JU5C 1HJDA 2W84A 1LW0A 5L3GA 2MABA 3J7AP 4E7KA 1RRJA 4DS5A 1K73C 4RW8A 3OYKA 3VESA 4XRSG 4AIKA 2R7QA 2EZHA 4QSHA 1QS4A 4AFUC 1HJRA 4GV3A 1OEBA 3VYTB 1T08B 4IEJA 1ODDA 3U21A 4DLEA 2CZ0B 1UUEA 4DFPA 2HQNA 1ZARA 4DTOA 4Y7NJ 1J53A 3OYIA 4JN4A 1HQCA 5FPDA 2P9PB 3O6WA 1ZK8A 1JO8A 1RILA 1RT7A 3ZCMA 1KQSM 4A3CJ 2HKQB 1DU6A 3C1DA 4HF1A 5LJ5e 2RHZA 3FK7A 4I2QA 2KHMA 1ZG5A 1EWRA 5IHIA 4YOWA 3J7AY 2A40A 5CE3A 4ESFA 1ZG1A 3BR2A 2HKNA 3JCMe 3LWIA 4BRFA 1X1DA 4H03B 2VKVA 3VQ4A 4O6JA 4CD1A 3X28B 5CQXA 1RR7A 5DYMA 1NJXA 5HP1A 3DWLE 1Z67A 2QQSA 5J2QA 1NG2A 3BDPA 1ZG3A 2JUFA 4DA4A 1ZC6A 5ILVA 2JMAA 2HBKA 1L3VA 2MWOA 3L6QA 2NVUB 4CJRA 1OCZH 2R7TA 5LJ5j 2TRTA 2XPUA 3VSLA 1M8MA 1ZRCA 4CZCA 2V8JA 3NARA 3CMEA 1S1TA 2QDYB 1BW5A 2ZKZA 2EWNA 2XICA 2BUPA 3CCQN 4EM2A 3HVRA 3S2WA 4DFMA 3RR6A 3FLCO 5KPRA 3G25A 2A6AA 4BJTA 1JJ6C 3MD2A 4M3EA 2HQAA 3GEZA 5I21A 3QBYA 4Q48A 2A41A 2P4RA 5JS1A 4JRKA 3EYYA 1G3TA 3RBBB 4C0ZA 5GAN7 5IP9J 2NYXA 2HNIA 1LOJA 5DTDA 4JJDA 3K9KA 3JCMf 4C5HA 5GAOp 1NK8A 4BHBA 3OIOA 4OFHA 1WHGA 1S1NA 3QU6A 1VSHA 2XPVA 3CP8A 2HNZA 1JLFA 3ZQ7A 3DPTA 2FBHA 4DGWB 2HOEA 4A3GJ 1TW2A 1IG9A 3L2VA 4HX4A 3WEEB 2JA2A 1WEFA 4A57A 3V7RA 1Q7YC 3Q0VA 2E36A 2DXTA 2PFBA 5AZJA 3IV5A 3QKJA 1WN7A 1DUXC 1UZCA 1R22A 1NNEA 1IO6A 1JJ2A 3AVAA 1YJNI 4A3LJ 2E10A 1U45A 1SEUA 3T69A 4BI4A 1YIOA 4FWLA 3OYNA 2RPIA 2CP6A 2FUG2 4F91B 3K5LA 2W00A 4B3RK 3VQQA 3JRBA 2QQRA 5T7BA 2HGCA 2ZSHB 2IGNA 4BRDA 3AAPA 2HXIA 1UGSB 2KLOA 2YLBA 2NLXA 2DFUA 5J39A 3OYDA 4RLFA 1LJOA 3DEEA 1BI4A 2RJFA 4DV3K 3TW6A 3JRZA 4B3OA 5DM7R 4FJ5A 2GBQA 3FC3A 3LQRA 3D2FA 3IQLA 3K9TA 3HXMA 3KK2A 1W2BM 1VRTA 2JVVA 1M90C 2HDCA 2X85A 3WNHA 1TUGB 3KX2A 3PFYA 2ZNYA 1UDLA 4ZZDA 2DFEA 4EW4A 3F0ZA 5GAHJ 5KRSA 3M8RA 3ASOH 2RF2A 3CQXA 1HPZA 3K7AJ 1H9TA 2JHNA 5BR9A 5J1YA 3JS6A 1K9MC 3O1WA 1WZ2A 2K57A 2Q0RA 5J2MA 1VTNC 1JKQC 4OIPF 2FRYA 1EA3A 3U9GA 3M0PA 2QDLA 2R7SA 4OB3B 4B3MK 4NCGA 1WFWA 4YHHK 3SI6A 3GZ6A 2GXAA 3EE9A 2W25A 3OA9A 1YTYA 1OPLA 5BRDA 1RT1A 2R5AA 1KFDA 3QINA 4GKKK 4CJVA 1S6LA 2M34A 2D6FA 4M7DG 3QYBA 4WFNL 5LD2C 3CCSI 5LJVA 3ONQA 2LD5A 1R5HA 3REBB 3UKUB 3E0JB 3BR1A 4RB2C 1U0JA 1YQAA 2JQ7A 3TOBA 2ZPFB 3THKA 4OFEA 1AHJB 1YW9A 4II3A 3NH1A 4M78D 5KK1A 2CV2A 3TO6A 2XC7A 4XU3A 3CC7I 2PJPA 4E1JA 4IUUA 2A08A 1KFSA 9ATCB 4M3DA 3Q9SA 2NS7A 3F21A 3CMMA 2NZTA 3X20B 2GAUA 3RR8A 3TVTA 1DP7P 2MD0A 4ELZC 2DL4A 2E1ZA 3OYLA 3G10A 4M78E 3PT9A 3D5LA 3JCMP 3U1DA 2NOHA 4KBMB 1FNNA 2MMPA 5LRRA 3HTUA 5IT9Z 5K14A 2ME6A 3CC4I 2FL7A 5IXBA 1IAWA 4NBQA 3TR8A 1I4K1 2Y69H 2HQXA 1W7PD 4CIFA 1P4AA 2DD4A 3QMLA 3VS5A 4MZTA 1YQRA 2DZ9A 1NJYA 3JAMZ 1E17A 3V42A 3EUHA 2QM1A 4CFAA 2YNIA 2KIQA 4V2FA 1JL1A 1HXDA 1XDSA 2EIKH 3DU6A 3BDUA 4C1NK 1QQMA 1N8RC 1S8NA 3THYA 3P1GA 1BQNA 1OCCH 2M9UA 2B63J 2C0TA 3CCRQ 3RYPA 1TWBA 1KU7A 2QWLA 1HJOA 1AZEA 3G2BA 1MBEA 1TQIA 2MIOA 5AQMA 1BOBA 5DM6L 4LY7A 5GAOl 3AG1H 3M0SA 1SFEA 1ILYA 1X43A 4DBFA 4F7ZA 2DVJA 4DV1K 1UHSA 4JPBW 1Q86O 3ENOA 4PUOA 3VFZA 3HSFA 5GAMe 3QFPA 4G7OF 5FD5A 4RW7A 4OIOF 4FVUA 1VQ4A 1F36A 2KPMA 3E6CC 2A61A 3T8TA 5EOYA 3ZEUA 2EBPA 1S72A 2KRNA 1Z0XA 3D5SC 2ZQBA 3CPWA 1RFQA 1KG2A 1QLYA 4I9LA 4HW0A 1ACMB 1SHFA 1UHWA 4JRQA 3LM9A 3VOEA 2IPOB 2P9SA 4M7DE 3FXJA 3DKWA 1IKWA 3OL4A 5M1FA 2XI9A 1PP8F 3OBYA 4M75G 2GA1A 5LMNK 1YG2A 4HUFA 3QEVA 5LMUK 1JT6A 2COBA 4AI5A 1IN7A 1N8RR 3DP7A 1Y96A 5DCMB 3HO1A 4J6XA 3E9LA 2DAOA 3ZSRA 3D45A 3C7JA 4KHYA 1SD6A 3RTVA 2B4JA 3VQPA 4FYWB 1W5CC 1UECA 4CYCA 4A6EA 3FZKA 4HVVA 1VQ5A 3VB2A 1ZRDA 4PL6A 3U9ZA 1UA1A 4YIFA 1C6VX 1Z1DA 4RTFD 4HAMA 3FK6A 5GANe 2PVDB 2UUAK 3CMEI 1NK0A 4BKXA 2Q31A 4PWDA 3AAQA 4M3FA 2ZGYA 2ZBKA 2K9MA 1YT3A 5SZTA 2NOBA 1PSFA 4YG2F 2DT6A 3EG9B 4RAGA 2PBDA 2GIZA 2XKOA 3L1PA 2H27A 1XMXA 3AG2H 5LJ5g 2XHCA 2QASA 5E1ZB 3M59A 3H6EA 1KRPA 2YV0X 3K5OA 3LAJA 2HYFA 1WB9A 1QVPA 4N4OB 1EP4A 2R3SA 2O8DA 2PJRB 3AG4H 3H1VX 4ZN1A 2HHHK 4C0FA 2RNJA 1YWPA 1VQOT 1GLAG 4IZ9A 2CH4A 3LP3A 5CYVA 3DBHB 4X6AJ 4R79A 5B1BH 2GELA 2XO7A 5I11A 2QW9A 2EX3A 3TP0A 4ESBA 3VETA 4CRIA 1TT5B 4CGGA 4DJAA 1N9SA 5IT9E 4CFBA 1FBUA 3MK6A 3VEYA 4BUPA 2HS5A 1VK0A 5LGUA 4Q5SF 3IRXA 4M45A 1NKBA 2KI7A 2LDMA 1XNIA 3IDHA 3KK3A 3HHTB 1YI2T 1U06A 1NJIO 3LMMA 3ZQQA 4EGZA 2RQUA 1XTAA 1BIBA 3VU3C 2COWA 4C9YA 2DA3A 1HYVA 1RETA 5IYBJ 3FE1A 1OZ2A 2ZM6K 4ZC3A 2NVYJ 1T6SA 1AA7A 2OCEA 1YJ9I 1Q82R 5KYUA 4FWMA 2QKKA 1NWKA 3OWTA 2VBZA 3I71A 4DS4A 2DFHA 4A0YA 1VQ6N 1KU2A 1E7OA 3META 1I1SA 3K6GA 2CKKA 4Y3OA 1WFXA 1I6XA 4C3JJ 3THWB 3BGRA 1VQ6Q 2GQVA 1IG8A 1NH3A 2KRFA 5E1XA 4BRHA 1GFCA 4O55A 3WODF 1RT6A 4L5EA 3SWNA 1GT0C 4H0OA 1XN7A 2CUZA 2HNHA 3A8YA 4XORA 4KT0E 2CMPA 1TWFJ 3BJAA 5E26A 4ZYHA 4WQ4A 3I55T 5AIQA 2K3YA 1R00A 2F2EA 2DQLA 3FKIJ 3KP2A 4A5BA 3I56T 2HSPA 1XWLA 1YRNA 3BDLA 4A5MA 1LWFA 2ZJPL 1QVGS 2RN7A 3O2PE 2ZD1A 1WI3A 4HKEA 3R0AA 1FYLA 3HP6A 4KUMA 2CUEA 4UUTA 1MDMA 3I0SA 1MMGA 2BW3A 4C8QF 3IRRA 3V9ZA 3JCMX 4NZGA 2KAFA 3NH0A 3NTKA 3QETA 5JR3A 3CJRB 2KZGA 4N0AC 2VBYA 3ZR8X 2KR3A 1Q81C 3GYHX 1H88C 2JK3A 4NDLA 9ANTA 4IUTA 2R5ZA 3LGFA 1QZEA 4B22A 1LWEA 2NUTB 3GFIA 1RTHA 2UXNA 2M0OA 2E88A 4AHSA 2WV1A 3S8PA 4BUGA 3W2VA 4H4MA 3CXCA 1R8OB 5TISC 4CZLA 2R7UA 2KL4A 2VONA 4BC3A 1YVUA 2GCXA 2NNWA 2P84A 3IL2A 2M2EA 3CJCA 4FJ9A 3HK2A 1OYWA 2FBXA 2RH2A 3CCST 1LDDA 2DRMA 3CCJA 4OO1J 4RTVA 2LBFB 4FM0A 5IN1A 1HNIA 4KIBA 2B0LA 1U9OA 4DUZK 4HQEA 3M56A 1M5Q1 3O3KA 1VQ4T 3DKMA 3C12A 4DTXA 2Q0UA 4DSKA 3C2GA 3REOA 2M7BA 2OFIA 1V4SA 2DIGA 3IKMA 3TTDA 1AKHB 2PQWA 4GVMA 3HJFA 4JKGB 3E6BA 2DEQA 3CFRA 3JB9G 2HHUA 3ZSYA 4NC6A 2IVNA 2VODA 3G6EQ 4L0YB 2IAJA 3FHNA 3MFKA 2G8FA 3TSQA 1B92A 3AA2A 1KU9A 1VI0A 4D8DA 3A0BC 2IS3A 3C18A 1WHJA 3OW2P 1QZ6A 1RCHA 4I6ZA 4XOTA 3EHQA 4HCKA 4E9FA 2D0QB 2HKXA 3VPZA 4M3WA 1VQ6A 4FISA 2R57A 4DF8A 4E2FB 5FLXE 3RERA 4DSJA 1UGVA 3CXCS 2G8WA 2QA4Q 3MN9A 5KPTA 4NO7A 1GCPA 2YLCA 2QQBA 1LE8B 3H3VK 2LRDA 4MO7A 3D2EA 4FPAA 4IPAA 5FKNA 2NXNB 1T03A 4NC8A 2O2OA 3D2EB 2GUIA 4IOAF 2J06A 3T7ZA 4YOYA 1UJ0A 2E41A 2HVRA 3I55N 4O4GA 5J1RA 1B3QA 5E18F 3RSNA 2XGEA 1EETA 1FLIA 2VIXA 2NOFA 2G3RA 4Z02A 1UG2A 1U2WA 4LG3A 1I8FA 3I0XA 4L5GA 4P9UA 3DLMA 3KLHA 1I3AA 3EUAA 4ZNXA 2HOSA 2AXTC 2RHXA 2X0LA 1PU8A 2A69F 1VQPQ 3DQVC 1BA0A 5GMKh 4B4CA 4N56A 1YITQ 2FEZA 2I5UA 2M0MA 3KLGA 3AO1A 3DOKA 2K85A 4CC4B 5GAGJ 1Q7YR 1FOYA 2MD5A 1GLNA 4FJIA 4OIRF 1YFHA 3IG1A 4J19A 1RDDA 2CH5A 1NJZA 5ADXA 1Y1VJ 1RC9A 3JCMh 4KB0A 4A4FA 2FBIA 3I53A 1DDNA 3LP2A 1Z3YA 3AT1B 4BWMA 3GZNB 1M3HA 2LMJA 1UOCA 1NK4A 4X1EA 5H20A 3WUHA 3PNVA 4F7UA 2CO5A 2V1RA 3URGA 3RESA 4DK9A 5C24A 1H641 1T0JA 4IXCA 1BJAA 2P0WA 5FU7B 2XY8A 3VEVA 2FRWA 4M7DB 4ZN3A 3F8NA 1SFXA 3AY9A 4FWQA 3KTQA 3GO5A 3ULEA 2M87A 3F72A 3RPUA 1W70A 1X27A 4PJLA 1U2VB 2MSYA 5FWCA 3SFZA 3SBTA 1HYZA 3CCUQ 2ZXJA 3BR3A 4PJ0C 1YIJI 3NTIA 3OYEA 2H8WA 4M6XA 2Z99A 1QVFM 4DR2K 2UXXA 4L59A 3PO3J 3JAMK 1I81A 1KVBA 5D5UB 2YG8A 1NK3P 1XHXA 3AVKA 2XGCA 2YUSA 1EF4A 2QEXT 1MJ9A 2O88A 2LNBA 5GTHC 3LSTA 2KK4A 1VQLQ 4ABZA 4XN3A 3P8DA 1T56A 4DSLA 2OU2A 3UDCA 4ASNA 1I5LA 4BI3A 2WB1A 1QZYA 3OB9A 5HKCA 3V1OA 4AHUA 2XGXA 4D1QA 3JRGA 4CJUA 4LSNA 1E3PA 1SSFA 3O4QA 3P8BB 1OU8A 4YNQA 5CKTA 4BY7J 2AS5F 2LNHB 5AQHA 5HRRA 2JT1A 1U84A 4EJVA 2HBLA 1DIZA 1KC8U 4XRSA 4HVWA 2A37A 1HA8A 1H9GA 4BD3A 4CZGA 2LQKA 4FYDA 1LB2A 2X4YA 3FM3A 2EHGA 4EJUA 4BQNA 1NPRA 4B9TA 1NPPA 5D6XA 1FY7A 3BJOA 3EGDA 2E12A 2WV0A 4L6V5 1Y57A 2G6FX 3M8SA 2CH0A 2RK2A 3THVA 5I3UA 4NCBA 4LF9K 1U1TA 1R4NB 1E3MA 1GRIA 2J5PA 2JW4A 3ITHA 3V9XA 2FF3B 3CWSA 3S15J 1MGQA 2E5NA 1O9SA 3G6ET 2CP2A 1WXTA 5GINA 5JVTA 4YOQA 3EYZA 1K9MR 2V79A 4OOIA 2EQIA 4F7UE 3O4NA 4DWIA 3A02A 5BRFA 4QWQA 4DW6A 5JHUA 4CC7A 1WDXA 2DXIA 1MMAA 2DO7A 4DYRA 3DLEA 5EJCA 4XKWA 4KUIA 1LVKA 4PKGA 2VKEA 1QKWA 4PFPA 1IJJA 3SBGA 2JTFA 1XMKA 3VOVA 2K79A 3MKZA 2NRVA 3GXOA 1BKBA 3CCVT 4ELTA 5CR4A 5IP6A 3L0QA 4W5TA 1YAGA 2O03A 5FKLA 2RI2A 1FT9A 2RF0A 1RDUA 1OH8A 4AVZA 2OC6A 3UT1A 2JM8A 3CCET 3E1YA 1M1KR 1QVTA 5H1SQ 2LJ1A 4DTNA 3K5MA 4CCLA 2F5TX 4CJWA 2R92J 2IC3A 2Z16A 4N47A 1J9IA 3WHBA 3BCAA 7AT1B 4CJQA 3OIPA 1QHTA 3ZSXA 1KG3A 3DB4A 2HB5A 1K4TA 3ZT1A 2OTLN 4ILJA 4X66K 2FX0A 1QU3A 3OYHA 2DMUA 2O8DB 3CCEI 2EA4A 4KULA 2R5MA 1ETKA 1MWMA 4CJSA 5L3CA 1L5UA 4J7FA 1LFBA 5F08A 1XC9A 2UWMA 1ZAOA 4FK2A 2Q97A 1R0CB 2QWOA 4FJKA 1QVGA 5K7FA 2AT1B 3I8DA 4KPYA 4HT9A 5CVIA 2BZXA 3QIPA 1W36C 2FVUA 4ICLA 2MC4A 1U3EM 1VQMI 4BQOA 3L09A 2V1DA 5JS2A 3ECHA 3PX0A 5B66C 3H0GJ 1OQKA 3C3WA 2KHOA 3RMCA 2CP3A 3HB9A 2EVRA 4CYCB 1VSEA 2WB1N 4LJZF 2JS2A 3S1MJ 2EB7A 1M3AA 1M1KO 3BCBA 1FEXA 2LQWA 4CJTA 4NHJA 2CGKA 2V9VA 4AYBA 4A63B 4HA8A 3HRSA 5AQNA 3VGLA 4A2UA 1HW5A 2MWPA 2BE5F 5AYFA 3VV0A 4YFUA 3DLBA 4AG2C 3M3ZA 5K1YA 3VS4A 4TVRA 3CLOA 2QENA 3PIOA 3EYIA 3F5TA 2NRTA 3BJ6A 3WTZA 1HDDC 4CEDA 1H1VA 4HTLA 4OIQF 2P9SB 1G83A 4LUEA 1CZBA 1APLC 1VIEA 2VGMA 4BJ5C 1VQ9T 1HC8A 3MZYA 1QSLA 3AA5X 3NAUA 1HUXA 3HVTA 1T3VA 5HDNA 1Z6RA 1TQMA 2WAFA 4CZFA 4DZPA 4E9HA 1UG0A 3C95A 1QQOA 2CV1A 2ZWHA 2LY9A 4JX5A 3CUQC 2IS1A 3ZEUB 1NBWA 1AOYA 1Q9XA 2QEXQ 1B72B 1USTA 2F5CA 4M78F 2O61A 1JXMA 4YTLA 4CERA 4OB0B 3GDQA 1TKDA 3CCQA 2I2LA 4CEFA 2KKOA 3LANA 4LOCA 1NJIR 1JLQA 3E9FA 2W10A 3L3VA 3CMAT 1Y07A 3RPUD 2QEXI 1KG6A 2JJ7A 4M7XA 2M5WA 2HW3A 1X4OA 2HOTA 2JA7J 4CEQA 2VG7A 2ICWG 3M8QA 3VGMA 2O8FA 3QRFF 1TU0B 4RB1A 3MP8A 4E7SA 2FPDA 3RIRA 2YNGA 4DEYA 3VWBA 1VQ9A 3LA3A 2V4JC 1YJWT 3L3UA 3RZDJ 3QXEB 3B6OA 4A69C 5KYWA 5HDKA 3THYB 5EF6A 5IAYA 4UVAA 4EMKB 2DFIA 2KQWA 4AIHA 1Q82U 3QBXA 3V9UA 4E89A 4PJOB 4PJOG 1A5WA 2NRHA 2UXBK 2DJZA 2VJ5A 3HSRA 3GNGA 3SQNA 2QKMB 2K4JA 4XOPA 2BHZA 1W4SA 3TO9A 3SJHA 2CW7A 3AKZA 2R7ZJ 3EUKL 3JRCA 4XK8E 3PO5A 3OY9A 5C10A 1KG1A 2IGKA 4BHCA 1G3WA 1N78A 3RR7A 1KFZA 5KQ8A 4AM6A 5BPIA 4IVNA 3CWUA 4XEIA 4NB5A 4CCKA 4Q4ZF 4JDSA 4JS5A 5B1AH 4M75E 3SAFA 4FX4A 1JKHA 5D4RA 4IEIA 3GTOJ 3MN7A 2A6EF 2P9KB 1X9MA 3H41A 3FFKB 4MQ3A 3MKDA 5GAMd 3CQYA 2NVXJ 2VB6A 2WBNA 3K70D 3CESA 4OGEA 2FOKA 3OVNA 3WNFA 2QF7A 3QAHA 1GVDA 4ORZA 4V19K 5CYMA 3MECA 4JNEA 1YI2N 1S29A 3I64A 4RGXA 2GX9A 3K9JA 2KDZA 3LAPA 3H5AA 3KP5A 1YJNT 2QXFA 4B3XA 2BHYA 4V2GA 3IUOA 4C92F 8ATCB 3WNGA 2OAWA 3QJ6A 4CICA 4HNUA 4AH9A 4ISEA 2OF7A 3HYIA 3KD1E 5HLIA 4XLEA 3S1QJ 2VASA 2PTKA 1VQ5I 4XN0A 2DILA 5LL6S 4CIGA 2EYYA 4EV0A 3ZQCA 3ID8A 1ITGA 4HV6A 1Q86U 1Z6TA 3MMYB 3BUZB 1ZBHA 2CGJA 3NF6A 1QVGM 1BI3A 1HKCA 1MUNA 5C2FA 5GPAA 4H0PA 2ZPGB 3BZKA 3IH3A 1I1JA 2EZKA 2DTOA 3LDPA 4K42A 3EG3A 1U49A 3J7ZO 3DCFA 4AIAA 5F1XA 1VQNA 2B86A 5HOOA 3BG6A 1AOJA 2RQTA 2IXSA 2W41A 4E47A 5AR0A 4J7IA 4QTRA 2C06A 5J1EA 2Y2ZA 1FSHA 5IXFA 1VQ7N 4NS5A 4UC4A 1L0OC 5JLXA 1GXPA 4G8XA 4I09A 3IH4A 1BI4B 1YHQA 3SWNC 5EG0A 2OANA 2HQEA 4DQPA 4ZTJA 3H0FA 3SD4A 1IDYA 4A61A 3K2ZA 4F7UG 2P6SA 1Z05A 1YVNA 4KICA 3MCAB 5J8FA 2ROTA 1LCUA 3RRGA 2A1RA 2O8KA 1YIJT 4JKDA 1QHHD 1R49A 4IURA 3PNYA 3H9NA 5HLTA 1KO9A 1WJBA 3M8FA 5HRNA 4AHTA 3LDOA 1TBXA 1I1GA 2FNPA 2BYVE 1HQEA 1LMZA 1R4MB 2BZYA 4FLYA 5DM7L 1Z7UA 4FETA 2L89A 4C1NI 1ZKGA 2RM4A 5C0YA 2VJ4A 3KYCB 1EXQA 4BVPA 3O5ZA 3WVDB 3VRYA 1IV0A 4DEXA 1YBYA 2D0PA 2LCLA 2HEOA 4J6WA 4WK8F 2ZPEB 3VSKA 2A6TA 2G8IA 3RNJA 4FOIA 1I0CA 2X6NA 1K9MO 2B8AA 3HDDA 2YS9A 2XAGA 3MN2A 4F4KA 2JWLA 3CC7Q 1A04A 2FG0A 3BF3A 1MMSA 3LSPA 2ELHA 1YJWQ 1X19A 1XS9A 2DW4A 1S7AA 5L3FA 4RTWA 4B9NA 3DLHA 2CFOA 3WGHA 1T2KA 4E6RA 3VQBA 2JTVA 2VQHA 3BFMA 4BC4A 3TSUA 4A4HA 1LAVA 1WQ2A 1KAYA 2PX9A 3W2AA 1ZHFA 3NMUA 5KYXA 3ECOA 4KHWA 3SQ1A 3NBPA 1T95A 1BCMA 1KAXA 1TS9A 4F55A 3QEXA 4PKIA 2YHWA 4H0YB 5CVVA 2HVHA 3CC4T 2DODA 3U2RA 4RCHA 2WA0A 1ZA2B 4QVDA 3VN5A 2JM9A 2F5KA 2AKKA 2X1DA 3JAMO 2DL8A 3NEUA 3QWYA 4I99C 3FSPA 1XQOA 3CWAA 4ESJA 4NLBA 4AI4A 3AO2A 2P0PA 1OLTA 3NRVA 1OV3A 4MTEA 3TQNA 3O9UA 3TU5A 3OS2A 2EQRA 1V5EA 1O3SA 1DPUA 3GPLA 2CSIA 1ATNA 1IBMK 1AWXA 2C0OA 1G3SA 2QA4I 4Z89A 3DM2A 1MNDA 1G4DA 2HHWA 2RPNA 2VYTA 3OR2C 3RWUA 4W5NA 1MBFA 3ASKA 2ZXWH 3MXMA 3M8PA 2XGDA 5JVGL 2FBKA 3CFOA 3ISNC 1MV3A 3HPWA 2GM4A 4B9MA 3P5JA 3G1JA 3ZMUA 4M77G 1ON2A 5LJ3f 1BA5A 1OU9A 1HCRA 4XR6A 2MOXA 3H0DA 3UKRA 4ATOA 1XI1A 3VEWA 2RI5A 3I56I 2FSJA 3H5NA 1SS6A 5LY3A 2DLPA 3U1KA 1JUSA 1MHNA 5AQVA 3MX2A 5FLXK 1UE9A 5C42A 2QK0A 4W97A 1J54A 4QAGA 5GJVB 2DJQA 3SFMA 2XPWA 3L7WA 1GBRA 3PSFA 5FLMJ 3HL8A 2QKLB 4A3KJ 1I27A 1U3OA 1YCYA 4PHTX 3K57A 4DV2K 4MZMA 2JA5J 3GMEA 4PJOD 3R6MA 3LNQA 4EIKA 4FM1A 4IOCF 3I5UA 3M58A 3CD6T 1KGSA 4RMNA 3L2RA 4AUXA 2G8UA 3IC7A 2DI3A 5JFRA 3O9TA 2E5LK 1XMOK 4GFBA 4EP5A 3A8HB 5CY4A 2Y0MA 1SKRA 4OU0A 3GTGJ 5CKEA 4FJJA 2O8BA 2PYJA 4NB4A 3VEZA 3BG5A 1KG4A 3HHHA 4CHNA 4M77B 4GNIA 2EIJH 2E6ZA 5DLOA 1HD3A 2XU8A 3RCOA 4ZGEB 1E6HA 4RB3C 1X2NA 4P1WA 1VQLN 2ASMA 1X9SA 4M7AA 4OMFB 4G9ZA 2JRTA 1MZBA 4DSFA 5LBQA 3U4LA 5D6WA 2ETHA 1W97L 3LPTA 2P9LB 2NUPB 4PSWA 1LFPA 2DTIA 1VQ8Q 3OL3A 5F27A 5IPAA 3D1NI 3CPWP 3E97A 1FWZA 1QNTA 1WI7A 1YIJQ 4DQ8A 2O31A 5B5EC 4RTTA 1ZBLA 1DEJA 1W1WE 3PM1A 3N0UA 1REVA 2VXFA 1Q1HA 4GDFA 2ZMEC 1NE8A 5A0DA 1QHAA 3L8BA 2OPQA 2GWJA 1NOYA 5K7ZA 3LQQA 1U5TB 3MHXA 4HXJA 4BR0A 4C8OA 1KHIA 4II1A 4MEXF 5TRDA 4IFEA 3FHZA 4M7DD 3FM5A 3CCMA 3SFIA 1J3TA 2ZPHB 4K2EA 3QYHB 1NEGA 2K9GA 2RV8A 2XF5A 3NGPA 3AVBA 4GMJB 1NGFA 3EPZA 3KZBA 4KISA 4M3YA 3NVKA 1ETXA 2K5LA 3AHUA 5AQQA 5A0GA 4QVZA 4J83A 3GX4X 1WQ7A 1N27A 2F2WA 3SHFA 4XQ3A 1K0SA 4FZZA 1N36K 2YX4A 2KW4A 4Z6YA 5E3NA 1X3WB 1S1WA 2EQJA 3HJEA 1RT3A 2Q36A 4CC2A 1HF0A 4HUGA 4MMKA 5IP7J 4JRPA 3I4PA 3HBTA 2GQIA 3I5SA 1BGXT 4XICA 2DQRA 1GHCA 1YITT 3OJUA 1SMTA 3AA4A 1YJ9T 1TUDA 3CJ9A 4NXNK 3UNGC 1W2BP 3MXJA 4OPKA 4M7AF 5J3LA 4EEFG 4CJEA 2P5GA 3M1EA 3D7SB 2J6FA 3CCQT 1CQTA 3ASMA 2FNAA 4FWNA 4ISFA 3CCJT 3CC2Q 3FZLA 4IG3A 1K76A 1R23A 3ZGKA 5KH6A 3HSBA 5BS6A 1W2BS 1K8AO 3RVCA 2L2PA 3RMAA 1UG1A 3A8LB 2F9TA 1X1PA 4OINF 5LJ3h 1YHQQ 1RBUA 3LLRA 4KGVB 4O8UA 2R7XA 3KVGA 3VEOA 2KIFA 2QYZA 3OS1A 1T3SA 1WSFA 5L3EA 1UAXA 1VQPA 4BHPA 4OVLA 4KIGA 4J2EA 4KV8A 4BE0A 3KWIA 1QSSA 4AILC 2JZYA 2RQQA 2LFBA 1NMDA 4NQWB 1WI9A 4D7NA 2DMQA 3A03A 2HXOA 3JCMJ 2DJNA 2A05A 2VUBA 5J2NA 3OMCA 3K58A 3I35A 4DQIA 1VSDA 3A0HC 4MFDA 2RJDA 3GTJJ 3HYFA 2PY5A 1KYWA 2W48A 3ULDA 5F0CA 3AO3A 3SEZA 4CFCA 3L2QA 3K10A 2ITGA 3R6SA 2E1OA 3CD6A 4FTHA 1TL8A 5LHGA 2OTJA 1POGA 5C3EJ 3TI0A 4WWCA 1K78A 5AIPA 4EFHA 2F1LA 5KQDA 4DV0K 2A42A 1VQ7Q 4BGAA 1Q9YA 2O8CA 2XSJC 3CMAN 2L01A 2TDXA 3N5BB 3LZIA 4IFVA 4BY9C 5HLFA 1PD0A 4JX4A 2ZPBB 3TO7A 4MZPA 2Z1HA 3SZ2A 4B9VA 1P2FA 5E41A 1QA6A 3H45C 3CMAI 1VYVA 2AQFA 1AD5A 1XQPA 4LSLA 4LFBK 1QVFP 2K2MA 4JUVA 3DLLA 1ZLKA 1QPIA 2MW8A 1M8VA 1KQ1A 2I7NA 3H9JA 4UUVA 4HT8A 2YHXA 1ZSZB 4DUYK 2HL5C 5BQTA 1D4XA 1NZ9A 3ZETB 2DTUA 1Q82O 1SD7A 3O80A 4FWOA 3V9SA 3KLOA 4BS9A 2GTOA 3ZT3A 3E3VA 3HTRA 4CF1A 4UY8O 3CO7C 4A53A 3CCVI 3HRGA 2IBDA 4OKEA 2Q2EA 4BROA 2VPRA 3K70C 1SD5A 1GLEG 2IT0A 4CD3A 1DJ7B 1DTQA 3JXUA 1WHHA 2J6KA 2X4XA 3WXJA 3DJCA 1LDKB 4OWRB 2STTA 3G7ZA 3JSPA 5ED4A 4HX7A 2WSEE 1ZA1B 1IJWC 1YNZA 5M3FJ 1Q86C 3A2FA 3S41A 2IRFG 2P6TA 1ZTRA 2EFIA 3HHGA 2R5YA 3PJRA 1HQUA 4GXOA 2FQ3A 4GGGA 1RAIB 3H6ZA 4FYXB 4F8RA 4J9EA 2VXDA 5GAOn 1KQSP 2RJCA 5JICA 3FZVA 4CZMA 4OMNA 2HCKA 3LAMA 4LLNA 2JTEA 2DRKA 2BY3A 4HHTA 4Q5WA 3CJBA 4BRKA 1IGNA 3BROA 2Z9OA 3OHRA 3OOPA 1AWOA 5M1NA 5IT9O 2KTQA 5M3MJ 2LTPA 4M75D 4HNVA 4HPQA 1XSDA 1GVJA 1ZHIA 4OMYA 2HL3A 1VF9A 3CDLA 2VWJA 5GAOr 4IRGA 4CJ3A 3P9KA 2GIVA 3FHGA 5GAEP 5F6FA 2DK8A 2L8DA 4FT2A 5ECAA 4JBAA 1N33K 5HS9A 4HLXA 1BA1A 1LNWA 5BPMA 2EQUA 3L4QA 1FIAA 2X1CA 3CCQI 3KNTA 2DCEA 1IRZA 3G4SA 4ZJZA 4OX9K 1FOXA 3JCMd 5DPKA 4RB0A 2M4GA 3B6PA 3LWHA 2OTJN 3M7GA 3N5NX 5HRSA 1JXOA 4BR4A 3FB9A 3VW4A 4VUBA 1P7MA 4G9YA 2JPBA 3H3UA 3TAQA 2DYRH 1YHQT 2QSGX 1IHVA 2HSTA 4E7JA 2RQWA 1B8IA 4KT6A 4PJNA 1DGWY 5IOZA 3BY7A 3J81Z 2HZDA 4UV8A 3MP1A 5KGXA 1TUYA 5D3GA 3AGKA 1U6ZA 4NC7A 3RMDA 3RSEA 2O8EA 1LQ1A 1X75C 3LP0A 4A59A 4MMLA 3TAEA 3EGXA 3HRTA 4C0GA 4LITA 1WEIA 4LG0B 2DM1A 2KVQG 4FU6A 5CYQA 3LSRA 3HFNA 1JJ2P 2NVQJ 1B9NA 1WSIA 1TW3A 1WH7A 2DYIA 3S6IA 1NGEA 4C8QB 4DOVA 5EU7A 3BP8A 3CMEN 2JHJA 1RT5A 2QWNA 3O9RA 1BC8C 2DZCA 2RDPA 1K8KB 4CEZA 4CI6A 3DOLA 4A5AA 2JZ2A 1VQKN 4M75F 4XKBA 4N9IA 4XSZF 3PNTA 4DR1K 1MBJA 1REPC 4DTSA 2XSDC 1BBZA 3M07A 5IT3A 2CQNA 2KLAA 4N4HA 2X6WA 1YP5A 2GUPA 2DX1A 1R1TA 4JYKA 1D3BB 3K4CA 2QWRA 1K8KA 2EJRA 1IKVA 4J8FA 4KUDK 2LSNA 2F8TA 3HUGA 1FYKA 2D1XA 1EO1A 3RKWA 3H0HA 2PMZN 2EPDA 3T1AA 4QW2A 1SSHA 2KROA 5GIOA 4A0ZA 2ESWA 4BE1A 5GAMj 4LH4A 3U3YA 3CCSA 3EKSA 3ULQB 1PRMC 1RAHB 2VQEK 1FJGK 3DAWA 1IKXA 2K02A 3A5MC 1N32K 2LYCA 4YPHA 1TAUA 2NRAC 2EYXA 4ENNA 4JI3K 3WU2C 3U6FA 2O8EB 3RSEB 3LFKA 4KIFA 3HOXJ 4C8NA 2VJIA 2JPCA 2NOIA 1FOWA 2BDPA 1N77A 1SL0A 2K4BA 3V81A 1BBYA 4LFCK 1V76A 4NL2A 2YJFA 5GAN2 4ZTFA 2E5QA 1WZOA 3MEDA 4DSEA 4MTDA 3OW2S 4B09A 5CR2A 1ETOA 2SRCA 1RBRA 2LVSA 3EN9A 1IGUA 2YU9J 2R4GA 3IKTA 2M0YA 3JRFA 1UWBA 2RNGA 1JJ2M 1GUUA 2VGNA 4RGSA 1YITN 2W82A 1OOTA 4JI0K 3M55A 2JNGA 2LC4A 4BDZA 4RS8A 2W03A 5LJWA 1ZQ1A 4U67L 1S5JA 1UHFA 4IRIA 3IWZA 4B1ZA 5GADP 3NMZC 3LSMA 1RLPC 2EA2A 2MFZA 1CF7B 3J81O 1X9JA 1ETQA 5LGNA 3KKRA 4IBNA 2A6HF 5D5WB 3WQUA 1Q81U 4ZH4F 1YJNQ 1FC3A 2IS4A 3KCCA 4LD6A 1IRFA 2DYSH 5BRHA 1CKBA 1O57A 3QB0A 3SDBA 2X51A 2XUBA 4ZYAA 4EJOA 5IY5H 2R58A 4XU1A 4IHWA 2D2WA 1UFFA 4WF2A 2MC3A 3JV3A 1LOTB 3EQLF 4RAFA 4RAZA 2HBPA 5ICFA 2MK5A 1PCXA 3PLAA 2V1UA 2DA5A 1SV5A 1DLOA 3VYUB 4FL6A 2VOOA 4LUDA 3OYGA 1SAUA 2NS0A 2QQ9A 3K4LA 3L2CA 1RUOA 3A0IX 2IAIA 3QUIA 2NRRA 5AQPA 5AQJA 1YO5C 5D5XB 3JCUC 3TANA 4X9DA 4FJNA 4FT4A 4G6QA 4PKCC 2E6NA 3KWGA 1BR4A 2PEXA 2LH9A 5CQGA 1N75A 3NF8A 4H0VB 2STWA 1F43A 1ERDA 1O1WA 3F6OA 4J9IA 4MDXA 4Q5VA 4AM3A 2ELJA 4YDUA 3VA0A 1RZ4A 3V6DA 2KQRA 4QQGA 4E6KG 1KIKA 1OKJA 1XG1A 4CIEA 2ZJRL 3SUNA 1KXPA 3VF2A 4K0KK 2BZTA 3LYIA 3TPQA 1J0RA 2PMUA 3DI6A 1NU0A 1VQ4N 2L7FP 5J26A 4JI2K 5K5RA 2O5RA 2EWSA 3F6VA 3OH9A 5E84A 4RKUE 2GXBA 4B8XA 1WKMA 3GTPJ 1X4PA 1MH4A 2QQ8A 2OPRA 3S3OA 5D7UA 1ZGJA 3MWMA 4PIIA 1IREB 1FIPA 5AONA 3SV4A 3JAME 4BY1J 3VF4A 5CKFA 4JI7K 2KSSA 4IQJA 5LHHA 4CESA 1Z7LA 1IN8A 3M1CA 2Y4YA 1TLHB 4XMYA 2YSQA 3O4WA 1NK6A 1K83J 4ZYEA 4WQ5A 4B9XA 1WCMJ 2Z0WA 5GIPA 2OTJT 2E1MC 4IO9L 2P9NA 2ZMEA 1OCOH 3J81E 3CEYA 4QVCA 1XGOA 3IH7A 3A1YA 2RAEA 1K8AC 4I9QA 2QA4T 1SUQA 1S9GA 4PKHA 4V19S 4OP0A 1QQNA 4ZDOA 2LP5A 3CPFA 5MLCQ 2GOXB 1JXBA 4CJKA 1EV7A 1QZZA 4GYIA 3BQZA 3HSEA 3KZIC 3CCMT 4BGDA 4FX0A 4KMFA 3VDXA 4FCYA 1HLVA 2HNYA 2KEAA 5EG2A 3SQ0A 1U04A 4RDUA 2JVHA 2FPEA 2QA4A 3GIBA 2FYKA 4U7BA 3QQAA 4M3ZA 4H0TB 4HYEA 2VC8A 1OZ3A 4NQWA 4CE9A 2Y48A 3I56N 1K6YA 3RJPA 3M3YJ 3CCRT 3TDUC 2OA4A 5LJ5h 3TAGA 5GMKl 1UGRB 4BC5A 1UELB 1U5TC 5D6YA 2W42A 3ROUA 1OVQA 2NAZA 2ZFUA 1Z3XA 5BN9A 2FB7A 2Z1DA 4NNJA 5A0LA 3PTAA 1KSPA 4F93B 1JCFA 4I98B 2KBTA 2EFWA 2ZJQL 2EKOA 1XDUA 2LP0A 3E1SA 4XL9A 4JD2B 2G7UA 1QQJA 4EJYA 4I6MA 2EINH 4JHDA 2TCTA 4JK1X 2LCCA 3NGZA 2OAUA 1XTDA 4CBXA 3LGLA 1UB4A 2FSWA 2D45A 4XH4A 2UU9K 2IIMA 1V4TA 2EAYA 3DXKA 2IJLA 4DFKA 3IS9A 4TSXA 2K6DA 2IGIA 1N8RU 4DHYA 3GL1A 2LKPA 4OVAA 2D0AA 2V1NA 2P7CB 4Z88A 3F23A 4O3MA 3CCJQ 1NKUA 3CUQA 5HROA 1MNEA 1JJ2S 3D7EO 1ZBFA 3COAC 3G73A 3V7SA 3V1QA 1J9AA 4OAYA 4YORA 4M41A 1N6AA 5J8CA 1CGPA 2NRXA 2M4KA 4H0EA 5FW9A 2K5CA 5M1KA 1ETYA 4M75C 3AA3A 1V5FA 2L54A 3OW2M 1ZGAA 5KN9A 4CFDA 2JUCA 2EPFA 2IVMA 4JKBA 2A5XA 2GXGA 3KTUA 5M1PA 4CJPA 4CVNE 2EGEA 1WJ5A 1J09A 2VN2A 1K0XA 3DTIA 1K1ZA 2L5QA 2DNUA 4FIBA 3DTEA 1KCFA 1VQON 4BRPA 2WY7Q 2PZSA 2PYLA 4JKHA 2X3XD 3A4CA 4XTWA 4U0VA 1B7TA 1U5TA 4A3EJ 1A5JA 1T39A 4C3HJ 1GLCG 2YT6A 3DXMA 3L2ZA 1RAEB 2GV9A 5CVUA 3PMIA 4ON0A 1VQOI 3CMEQ 3ERMA 1EWQA 2HMPA 3WXIA 4J9DA 4IOCL 4QOZB 2M3AA 4M78B 5FPMA 2HOAA 1NK9A 4MGRA 3FXRA 4FWPA 1Z26A 1OQYA 1ORPA 1VQOQ 3B6CA 2XROA 3QIOA 2V7FA 3ZT0A 4FLUA 3CPEA 1W5TA 5HCKA 1IN4A 1DT9A 1VQMT 3M0TA 4FK4A 2E6MA 3PIPF 4FW2A 5GJWB 3CJQB 1JLBA 1LNXA 2XAHA 3R4KA 2LTOA 3FJPA 4XIDA 2YKMA 4DCHA 4M3XA 3WQTA 3UR3C 1NGCA 4DLGA 2CUBA 4A4KA 1YITI 5EGOA 3OYYA 3HOZJ 1U1SA 2E1HA 3HPHA 3C6HA 4XTYA 5CVRA 2JUGA 1U8BA 1BR2A 1MUZA 1VQ7A 1W7PA 1R5GA 1GLLO 1H8KA 4XLAA 2OTJQ 4LMYA 3CCJN 4XLHA 2CUFA 3JRIA 1DTTA 2M0CA 2GTDA 2H1LA 2CDTA 4RGRA 1BHLA 4G94A 2QI2A 3NPFA 2X1EA 3ABTA 3TL4X 2K4YA 2PG4A 2L3SA 2RREA 1YFNA 1AHDP 1GCQC 1R77A 5L3BA 1KJWA 2QBYB 1ZLMA 1JXEA 2F7TA 1HYSA 1LW2A 1JT0A 4LFUA 5KE3A 4F92B 3CCEQ 2WAQN 3TAPA 4O5VA 3GOIA 2YRCA 3CO6C 1S72I 1GDTA 3NFAA 3ZQHA 2FD5A 3EG1A 3L9FA 1R58A 3CC4N 5FLXO 3KD5E 4E7HA 4AHCA 2UV1A 2P8TA 4MIMA 3G4ST 4AYBN 4CGZA 1JKPC 4K8ZA 3EEQA 4GYGA 5K7HA 4AU7A 5CZ1A 4CZIA 1U8RA 1VQPI 3CJNA 1YIJA 3ZLJA 4Y33A 4LF5K 4C8QE 3MXIA 4M7AG 3QFUA 2AA4A 1JEGA 1U78A 2M1BA 2K27A 5FU6C 1WRJA 3QPSA 3AO5A 3OYFA 3CC7N 4DQSA 3GVAA 2ISZA 4AHRA 4B9WA 3AFHA 3K4KA 1HSTA 3OYAA 1XMAA 2NNNA 4BR9A 2E3HA 1G6NA 2D8JA 2LJ3A 1F5TA 2OPTA 1D5AA 1X58A 4MEYF 4QPOA 5I2SA 2ZPIB 2RC4A 2JJ9A 4RM3A 3TP3A 3BLYA 1NJWA 3GP8A 1RTJA 2JG6A 4A62A 3OMYA 3I55A 4DNCA 4B3AA 3ZRGA 3HSTB 4M9ZA 4JJBA 2XF7A 1PHTA 4LLGF 1MBKA 3BG9A 4BGBA 5AZIA 3JRDA 5EEGA 3ZPLA 1KD1O 4Z94A 1LPQA 1F1BB 2MF2A 3BPXA 1SFUA 2KGTA 5KYXB 2HU9A 4MFBA 1R5ID 3O3GA 4CBWA 2YI1A 3F8BA 3VPRA 3MZ8A 1P90A 4WYBA 1U9NA 1KLNA 2HPIA 5GAMg 2ZC2A 2JA8J 1TL1A 1X3ZB 2R7YA 1UHMA 1BI2A 2RO0A 4G6TB 4RTZA 2EZLA 4F9OA 5EZHA 1ACIA 2J4RA 1TYQB 4C92B 1WNLA 3OYBA 3PIPL 1EH8A 4EM0B 4AIDA 1BJZA 3VGKA 4UNOA 4IWVA 1VQ4Q 2M7AA 4C5IA 1VIFA 2NUZA 1ZXOA 3ISPA 4BQLA 2FLOA 3HOWJ 5TKYA 2KT8A 4L0ZB 3HRUA 2DLLA 2D0OA 1YCSB 4FWSA 3DBLB 3M0QA 3R8EA 1R0AA 4QCLA 4CO8A 1X1AA 2OD5A 1NGAA 1B9FA 4RW4A 5BPDA 2O4XB 1KQ0A 4JRIA 1IUYA 4DR3K 3CFPA 1NYFA 4KYWA 3ELKA 3TU4K 5FDLA 1IRGA 1LKXA 2VVKA 3HGGA 1ZUUA 3ERED 2KIMA 4L9JA 4F3QA 1QCOA 2WSCE 2ED1A 1HKBA 1Y97A 2W85A 1LUJB 1M1EB 4YIRX 2KZVA 3O5BA 2VXZA 4BQZA 5IYDJ 1PWTA 4KKOA 5C4XJ 3A2KA 3THXA 4GY5A 5AQKA 2VT3A 3P9CA 3DB3A 4XIUA 4A3BJ 4B8AB 1PJRA 3KFVA 1FW6A 3NDKA 3RRHA 2OZSA 1WSEA 4PJOE 4ZDPA 2E2JJ 2XY6A 3QZ9B 4ZYGA 1C0MA 5FGMA 1R0BG 4L3QA 3LDSA 3L42A 3THXB 3KLFA 1RGIA 4XSXF 2X74A 4BE2A 1N8RO 4EMSA 2LCSA 2YHAA 2L4AA 4FJ7A 1SF9A 3ZQFA 1V29B 1RKTA 4AT1B 4P9FA 3N05A 1LJ9A 2OCCH 4OMLA 2DA4A 4LLLA 1MIJA 3ALYA 2CWEA 1BOTO 3AL0B 2QGUA 5E3MA 1NG9A 5CLSA 1ZBXA 5EEAA 2SEMA 1ATRA 2XY7A 1K4SA 1X6BA 4O8KA 3T3FA 3H92A 3PIOL 2P9IA 1IBLK 2O4XA 2RHIA 3CCMN 2YKNA 3RDIA 3CCEN 1BIZA 2PFUA 1JQQA 4DV7K 1D9DA