3OYFA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti l-870,810
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 109
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyfA03
1K6YA 4M3TA 4E7LA 3KJVA 2XY5A 2BDPA 1C0TA 1C0MA 3ZSVA 3OS0A 1HNIA 2ZQBA 4PLLA 2HHWA 5J2NA 3QEIA 4BE0A 4FJMA 4FJKA 4W5NA 4IUTA 1A5VA 3OYDA 3DRSA 1TAUA 1U04A 1LW2A 3CG7A 3AVAA 1ITGA 3CM6A 4CF9A 2MWOA 4GVMA 1UWBA 1WGSA 4E7KA 3AVMA 3L3UA 4CK1A 3SI6A 4FXDA 3QNOA 1JXEA 4KHWA 3L42A 4EZ9A 3KLGA 4RG8A 2WONA 4N76A 1J54A 4DFPA 1SKWA 1ASUA 3C6UA 1IG9A 3NGYA 5C42A 2RI3A 4PQUA 3MEGA 4DMNA 1KVAA 4E89A 3V9UA 3QBYA 3SNNA 4DTSA 4FLUA 4CF8A 1BCMA 3ALYA 3LPTA 3DI6A 3P83D 1G15A 2FBXA 4B3OA 3LDSA 4PY5A 4CEDA 1S1UA 3I0RA 1BCOA 4AHCA 3BDLA 2Y1IA 2HNYA 1EKEA 4DSIA 2X4XA 1IKYA 1U4BA 4HHTA 4C8KA 1RBVA 1RT7A 3AVFA 4DTUA 4NS5A 4C8NA 2XK0A 2K3YA 1D9DA 4CJWA 4KAZA 1NK7A 3VA0A 1TGOA 2YV0X 1XI1A 3S6WA 3RMCA 2O4GA 3AVJA 4KV8A 3LP0A 3DLMA 3VQPA 3C95A 4QAGA 1NK5A 1REVA 4CFCA 4F3OA 4Q5VA 2BIVA 3VQ6A 1IKVA 3V6DA 3LANA 1MU2A 4BDPA 4TSXA 1BHLA 2G8KA 5JS2A 3AO5A 1ASVA 2HQEA 4DU1A 3PMTA 1B92A 3C4SA 1KFDA 2F8SA 4Z4HA 2B4JA 1B9DA 1NK6A 3RTVA 4C8OA 3HPOA 4QW2A 3TAQA 4A4FA 1WSFA 3AO1A 1T05A 5KE3A 3SYZA 2EQKA 4DQIA 3KIOA 1CZ9A 1R0AA 3P5JA 4ELVA 3DRRA 3TWHA 4PA1A 4CF2A 3KLHA 2RI5A 2RHZA 4FLZA 3O8VA 4ID5A 5EU7A 3ASKA 4FW1A 4DSEA 1RILA 1TKZA 3HP6A 2O4XA 1TL3A 3TANA 3OYGA 2RO0A 5FRMA 2FBYA 2OPRA 2RHIA 3SQ2A 4B9XA 4FZYA 3HO1A 4FCYA 1FXXA 1T03A 1NK8A 4AHRA 1GOCA 2RJEA 3ZSZA 2VG7A 3EZ5A 1WAJA 2B5JA 4RW7A 2BUDA 5C24A 4HUFA 2EQJA 4OPKA 4CECA 3DRPA 3OVNA 1A5XA 3L2VA 4OGCA 3QIIA 4A4EA 2HB5A 3OYFA 1GOAA 3PUFA 3FLGA 4WE1A 2F5KA 1SL1A 1NK9A 3HK2A 4FU6A 3NH0A 2HVHA 4CERA 4Z4CA 2OPPA 2XY6A 1VSDA 1FKOA 4I2PA 3K2PA 1RDBA 1KTQA 5KCHA 4F2RA 1RTDA 5HROA 2ZD1A 3EYZA 5D6XA 5HRSA 3SUNA 1NK0A 2R58A 1LV5A 4CFAA 3PO5A 1D8YA 1JL1A 4HCBA 3VQAA 3QINA 1S1XA 3TAMA 3TR8A 3IRXA 2XDPA 1UAXA 3HJFA 2HQXA 1IO2A 4CJQA 3MAQA 3DOLA 4AHVA 4CEQA 2DY4A 5JS1A 3NE6A 2F96A 3SJJA 1S1TA 1VSKA 5DK5A 3TAFA 3K59A 3WNEA 4M41A 3PX0A 4F2SA 1TV6A 3C6TA 5M9OA 3OY9A 4O0JA 4DFKA 3VQDA 1D5AA 3OJUA 4K8XA 4RW9A 1NJZA 4CRIA 3CFOA 2HNDA 4HTUA 3LLRA 4BE2A 3RMDA 3DLBA 1KRPA 3RMAA 2GF7A 1RNHA 4DSKA 3SUQA 3OYLA 2EQUA 4AILC 5D6YA 4OKJA 2ITGA 3SV4A 1ZBUA 1IKXA 4CEOA 4CJEA 4LSNA 4CGIA 1XHXA 2I5JA 3LX7A 1TK5A 4IFVA 4DTPA 2Z1GA 2L3RA 4KTQA 4N47A 3VA3A 3TARA 2D0AA 1NJWA 4E7HA 5KI6A 4Z02A 1Q9XA 2IOCA 1HYSA 1SKSA 5J26A 4B9WA 1RI0A 1UA0A 1TAQA 2OA8A 4QQDA 2HVIA 1KFSA 1WLJA 2KZMA 4I9QA 3AVHA 4L8RB 4KHQA 4FW2A 2GBZA 4FM2A 4HCCA 5HP1A 4M42A 4KB1A 4FK4A 4EDUA 1RBTA 1VSIA 3OYCA 1BIZA 4DTOA 3K5NA 3L2WA 2L89A 4QCLA 2Z1JA 1S1VA 4CJ4A 3V9WA 3H08A 2G8IA 4IUPA 1T7PA 4OVLA 1GOBA 1TVRA 3FC3A 2VG5A 2IC3A 3VQQA 2LRQA 3FDRA 4IG3A 1RTJA 3QNNA 1X9SA 4KRFA 4DSLA 4DF4A 2EKOA 3KK1A 4A4HA 3NHGA 2GFAA 1HPZA 4LH5A 1VSHA 1F21A 1WJSA 1N5YA 3SZ2A 3ASMA 5KRTA 4KHYA 4HUEA 1NK4A 4B9UA 3DLGA 4DQPA 3NGZA 3L3VA 3QETA 4IUUA 3NCIA 4CK2A 3MECA 3ZCMA 3V1QA 3TAGA 3OS1A 1FKPA 4CIFA 2DAQA 5SZTA 2G3RA 1HYVA 2GV9A 4DSJA 2RHYA 3CFPA 3NFAA 1QS4A 4B9SA 3CEYA 4NYFA 2K3XA 4CJTA 4OLBA 2IAJA 2RJDA 5KRSA 2G8UA 2YNIA 1RT2A 3DYAA 1YTUA 3S9HA 4CJ3A 1CZBA 1JLBA 3IAYA 1KVBA 1S6PA 4NCBA 3NF7A 3S3NA 3TAPA 2MWPA 3B6PA 4DQQA 1SL2A 3BDPA 4DWIA 3F70A 1L3SA 2BGGA 2YKNA 4NCAA 4ZTFA 2B6AA 4CE9A 1BQMA 1TK8A 1JLFA 2X35A 3Q1JA 2YHAA 4CGFA 4RW4A 4W5RA 3MEAA 1Q8IA 1VSLA 2F8TA 5E41A 3QEWA 4IBNA 1OZ3A 4J2BA 1DLOA 4IKFA 3OYKA 3LH0A 5D3GA 3JYTA 3U3GA 3ITHA 1H3ZA 1J53A 2LVMA 5HRPA 4DLGA 2PQWA 1RBUA 1YVUA 5HRNA 4E0DA 4FLXA 4CHQA 4DSFA 1JLAA 4FJHA 1ZYQA 5CZ2A 2R7YA 3L2QA 1QE1A 3PO4A 4C5EA 2BKDN 3SV3A 3VN5A 3HSTB 3DLKA 3M8PA 3FEOA 3AVCA 1Z26A 4CEFA 1U48A 2YKMA 1N27A 3LP2A 3I8DA 1VSMA 1QSSA 1S1WA 1JLCA 1XNIA 1VSFA 5C25A 4B08A 4GW6A 2E6MA 4CJVA 3H8ZA 2HHTA 3ULDA 4DU3A 4JS4A 1HNVA 3HPHA 4O4GA 3QEPA 3DOKA 2VG6A 3KLIA 4BDZA 3QIPA 1C1CA 3G0ZA 2QQRA 3U6FA 1SKRA 2LDMA 3V1RA 4KHSA 5FDLA 1J9AA 1JLQA 4B8CA 1SL0A 4NYNA 3DLHA 1I3AA 1J5OA 1X9WA 3VQ9A 4DTNA 5CYMA 2BE2A 3QLHA 4BACA 2G8FA 3AVIA 1EXQA 4CESA 2HHVA 4C8LA 2OPQA 4B9LA 4G1QA 4B9NA 4FJGA 1ZBLA 3LGLA 4Z4IA 3AO4A 4DTJA 2R5AA 3KK3A 4QQGA 3OYIA 5HBMA 4N4GA 3MXMA 3META 4CF1A 4RW6A 3LAMA 3LALA 4OKEA 3P1GA 4O44A 1EP4A 5T7BA 5I3UA 3I0SA 3VQEA 2HW3A 1LAWA 2RJCA 4X34A 4CJFA 3AO3A 4M45A 4DFJA 3VQBA 4CJPA 3LGFA 2RN2A 3DM2A 1ZBFA 4FK2A 3DMJA 2DFEA 3ZSOA 3MP6A 1RTHA 2HNZA 2XY8A 4QQ6A 1C0UA 1S5JA 4KKOA 1YT3A 4F3TA 2WACA 3V9ZA 3NTKA 3PNWC 3KKRA 1NKEA 4OKKA 3S3MA 3DB3A 3PMIA 2VWJA 4KFBA 3QERA 3U3YA 4M3YA 4PWDA 2RKIA 4DFMA 4UC4A 2A1RA 2YHBA 4W5TA 2X6NA 2EFIA 3K57A 4Q5WA 2RJFA 2OZMA 4BWJA 1DTQA 2OPSA 1LWFA 3ZSRA 4CGDA 1Y97A 2PYJA 2RF2A 2E5QA 4F4KA 4FJ7A 4NZGA 1I39A 2WOMA 1BI4B 1RBSA 5CZ1A 1WSJA 4PL6A 1KLNA 3NDKA 3CFRA 2OYQA 1HQEA 5HRRA 4LY7A 2XO7A 3QO9A 5IN1A 4BE1A 1CXQA 4CJUA 1WN7A 3OMGA 4DTMA 3NGIA 3F9KA 1T8EA 4CEZA 2PZSA 3RRGA 3HVRA 1RBRA 2IG0A 5FROA 1QTMA 2QQSA 1NJXA 3DLEA 3WNGA 4AHTA 4FJLA 3T1AA 3OYHA 4FJXA 3GOXA 4FVMA 3QIOA 4E7IA 1LWCA 1EX4A 3L2RA 4UQGA 5D6WA 4ELTA 5KCOA 2KFNA 4CEBA 2G8VA 4FL6A 1HRHA 4FLVA 2X78A 1Z25A 2YRVA 3SQ4A 1LWEA 4FLTA 3VQ7A 3NNQA 3MP1A 4F8RA 3EY1A 3AA2A 4N4HA 5KE2A 3V4IA 4O5BA 4CGHA 2B8AA 2HMIA 4H4MA 2YNGA 1D9FA 2E6LA 4AHSA 4CEEA 4EZ6A 4HVJA 1HQUA 4CJRA 3SPZA 3O3HA 2M1HA 1NOZA 1C1AA 4H8KA 1TKTA 1N6QA 1S9EA 2M16A 4II1A 4CHPA 2LTOA 3V9XA 1RT3A 3KUFA 4BD3A 3TAEA 4C8MA 3KK2A 1TL1A 4FYDA 4Z4GA 2X4WA 3HT3A 1NJYA 3NH1A 1JXBA 3AVKA 3AV9A 4CEAA 4KREA 1A5WA 2GUIA 3LP1A 3ZSWA 5J2MA 3LAKA 2YNHA 3NH2A 5I42A 2Z1HA 4B9VA 5CIUA 4M3ZA 2HHQA 2FC0A 4QOZB 3LWLA 5KTQA 4R5PA 3NF6A 4CHOA 2QK9A 2JLEA 1KVCA 4C5HA 1U47A 3NTHA 1SSFA 3MXJA 4BWMA 4EP4A 1BISA 1WJRA 4B8AB 3LZIA 4M3XA 1RDAA 3UWNA 1IKWA 1S6QA 1QSLA 4JLHA 3PFSA 3HYFA 4FJIA 2DIQA 5FRNA 3B6OA 4M3RA 4FJJA 1RT4A 3M9QA 1RTIA 4IFYA 4MFBA 4CFDA 2EQMA 4CIEA 3LP3A 1JL2A 1XHZA 4CHNA 3OYBA 3E9FA 3O4QA 2PYLA 1JLEA 1ZBIA 2L8DA 3KD5E 2EX3A 3MEDA 3QEXA 5DMRA 2QKBA 2G8HA 2P0KA 2A1SA 4DG1A 4FJ8A 1OI1A 4ZTJA 4KTWA 3PV8A 3AO2A 2RHUA 5CY4A 4B9MA 2KTQA 1FK9A 3ZEHA 4DQSA 5CYQA 1XC9A 4OVAA 1G5VA 3M8RA 3UT1A 1U49A 1TKXA 4Q0BA 3HM9A 1KHCA 2IGIA 4DTXA 4Z4FA 4LH4A 3BGRA 3A2FA 4IURA 4KHUA 3KLEA 4CFBA 2VYTA 1HMVA 4Z0UA 3VQCA 3OYNA 4FZXC 1UOCA 3RR7A 4KPYA 1KLMA 2D0CA 4J2AA 2KQ2A 2EHGA 2DFFA 2LCCA 3AVLA 5K14A 4KO0A 2M0OA 3OA6A 1BQNA 3SQ1A 4I7FA 1NKCA 4FM0A 4FJ5A 3SCXA 4CIGA 4KHNA 4LD0A 2BANA 1VSEA 3OYJA 3HXMA 3PY8A 2QXFA 3CM5A 3O3FA 4DU4A 4PLIA 4JRQA 2JZ2A 2HHSA 4CJKA 4LSLA 2DTUA 2G8WA 1RDCA 1JKHA 5HLFA 3ZT0A 4KI4A 2KFZA 3OB9A 4GMJB 3UIQA 2X74A 2D9TA 1BI4A 3ZT4A 3V81A 2LSNA 4FLYA 1WSIA 4N41A 2D0BA 2JTFA 1LAVA 4QVZA 1HJRA 4E19A 1RT1A 4M3UA 4PUOA 2XHBA 5IAYA 3QKJA 1X1PA 3K5MA 3ZSXA 3QESA 3NAEA 3K5LA 1ZBHA 4H4OA 2HHXA 3V9SA 1TKDA 4E3SA 3HL8A 4NCGA 1ASWA 2E4LA 3KKSA 4CHZA 2X4YA 4Y1DA 2CKKA 1CLQA 3K58A 2QKKA 3QJ6A 4Z4EA 3AVGA 1YTAA 4E7JA 1BGXT 3V1OA 3ISNC 1SUQA 4W5OA 2DIGA 4O0IA 4CJ5A 3WNFA 1CXUA 4DLEA 3VQ8A 3RRHA 2DFHA 3AVBA 1B9FA 4FJ9A 2R5MA 5C0MA 1C1BA 3OYEA 3LWMA 5J2QA 4N56A 3S3OA 4BDYA 2O4IA 1WAFA 2XY7A 2P5OA 2P51A 3OYAA 3LYIA 2X6SA 3PX6A 3TABA 3RWUA 3LPUA 4OPJA 4ID1A 2FHDA 4HCZA 3L2UA 5KH6A 3KLFA 1JLGA 3NBPA 4IUVA 4CJLA 3THVA 4CHYA 1RT5A 1O1WA 1QSYA 1OZ2A 3SQ0A 4JRPA 2IS3A 4IDKA 3NF9A 3P8HA 4DQRA 3P8DA 3WNHA 4OJRA 1C6VA 3JSMA 4YFUA 3QEVA 3FFIA 2ETJA 4DS4A 4JS5A 1RCHA 4AH9A 1MHNA 4N5SA 3MEEA 4KTZA 2XRIA 2R57A 1WNSA 3ZSYA 1TK0A 4L59A 3C94A 1WJQA 1L3TA 4J2DA 3LZJA 4I2QA 1QHTA 1IH7A 4IUQA 2RPIA 4OLAA 4J2EA 2KW4A 2P5GA 2ZE2A 5J1EA 3SPYA 4YNQA 3T3FA 1L3VA 2D5RA 3ZT3A 2FBVA 2ATQA 2KZZA 4KI6A 3ME9A 4OGEA 1W0HA 3HP9A 3SUPA 2VWKA 4MQ3A 1X9MA 1L3UA 1S9GA 2RI2A 4HUGA 3AVNA 3OS2A 5SWMA 1BIUA 3E01A 4Y1CA 3SUOA 3D45A 5J2PA 4CGGA 3DLRA 3HPGA 3CYMA 4EP5A 3AA5X 3DB4A 3VQ4A 1UA1A 4K8ZA 3IS9A 3NTIA 2JGUA 3TI0A 3ZT1A 3O3GA 1BL3A 1KSPA 4CF0A 3HVTA 4A4GA 3ZSQA 3PX4A 4C5GA 2RHXA 3NF8A 1QQCA 2Q3SA 3M8SA 2O4XB 1L5UA 3H6ZA 4DF8A 3K5OA 1VSJA 4GY5A 5KGXA 4B9TA 4FLWA 3M8QA 1RT6A 1VK0A 1EETA 4CJSA 2OZSA 1WSEA 4FJNA 4KB0A 1OYXA 3RMBA 2NLUA 3EAEA 4C5IA 3SD4A 4E1NA 4M3WA 4FM1A 4DS5A 1SV5A 4FK0A 3O4NA 2HHUA 1KCFA 2W42A 1Q9YA 4IG0A 3OYMA 2GFUA 5KGWA 5J39A 2YNFA 1NKBA 3MEUA 4LD6A 3MEVA 4DTRA 3CQ8A 1W9HA 4CGJA 4XIUA 4FZZA 3MXIA 4RG2A 4CK3A 1VRUA 2Z1IA 2Y1JA 1WSGA 3G10A 4E1MA 3OQ5A 4CCHA 2NUBA 3AA3A 3VQ5A 3KD1E 1LW0A 3RR8A 1WSHA 4N4IA 4ZHRA 4W5QA 3KTQA 3L8BA 3AA4A 3E9GA 2P1JA 3F73A 4ELUA 2E6NA 3MO8A 2AJQA 3ZT2A 2IDOA 4ICLA 5C6SA 1HYZA 4I9LA 4RW8A 2PY5A 2FBTA 3MEWA 3MP8A 1XWLA 1U45A 3IG1A 3D0PA 4O55A 3OMCA 1NOYA 3OJSA 1VRTA 3T19A 1RDDA 4AHUA 1DTTA
chains in the Genus database with same CATH superfamily
4M3TA 5IT9O 1C0TA 1K6OA 1YS7A 1NGIA 4KFCA 5EEHA 4G6TB 3E1YA 1HNIA 2DJQA 4PLLA 3NVMA 1RLQC 4WYBA 3QEIA 2DT7B 1J2XA 4IUTA 2Z5UA 5GAEJ 2NOEA 3HOSA 2HMAA 3UA6A 1QP3A 5BNGA 1VQMQ 4M7DC 1VQKQ 3DRSA 1TAUA 1WQ7A 1LW2A 3FZHA 2E2QA 4EQQA 4AYBA 2BZYA 5GAOp 1ITGA 2KXCA 1OU8A 3M5RA 1UWBA 4NXNK 4GLMA 2CYZB 2O88A 2HTJA 5AQMA 1T6SA 3L3UA 1QHAA 3GWZA 3DQVC 4HLXA 3BE3A 4XLHA 2JXBA 3F0ZA 2AKLA 1YJ9A 4JOMA 1HF0A 2J5OA 5F1XA 5IHNA 2Y0MA 2AXTC 5GAN2 3RNJA 1ASUA 3C6UA 3KFWX 2MC4A 3WVDB 2XDBA 4DMNA 3G4SI 2ESNA 3QBYA 4XEIA 1RRJA 4CF8A 2FF3B 4P9UA 4NNJA 3P83D 4AT1B 5DCFA 3C18A 3JRDA 4WF2A 2ESWA 2L7FP 3JRAA 4R1HA 3I0RA 4AHCA 3JB9D 1VA7A 2VE8A 2CUZA 1IKYA 3QP5A 4B22A 4HHTA 2YHYA 3FLCO 2DA1A 2BZ8A 3HI0A 1HPMA 3H3ZA 4M7AA 1GLJO 2Q0RA 4UUTA 1SFKA 3AVJA 2DBMA 3LM2A 1S3XA 5BS6A 3LP0A 3M1EA 3FMRA 4QAGA 1YITT 3CCJI 4Q5VA 5HDGA 2D1VA 1UELB 1YJWA 4H0TB 2UXDK 2DQLA 2DXBA 3CC4Q 1QVFM 1RL2A 2OTJT 2NWMA 4BDPA 2A6EF 1SS6A 1FT9A 5JS2A 3CBPA 1N8RR 3BW1A 1SG5A 1YHQN 2JS2A 3UDCA 4F9OA 3FWEA 4W97A 3I5UA 3JRZA 2XF5A 1KFDA 2LQWA 3J7ZO 4Z4HA 2R7UA 2E65A 3GX4X 5KYUB 1B9DA 3G25A 3HPOA 1PD1A 4HWIA 2HTSA 4BRQA 4B3AA 1WSFA 1NG2A 1T05A 3J80E 2VOPA 2YG9A 1QMCA 5GAOm 3ZN1A 3ID6A 4AU7A 2GUPA 3KIOA 1M3HA 3EGDA 4BY1J 1X9JA 4M72A 4Y33A 1ZBJA 4GV3A 1YJNI 2O8DA 4CF2A 1OJLA 1RESA 3KLHA 2RI5A 2RHZA 4FLZA 3VPRA 3NGPA 5AQRA 4FW1A 4DYRA 3NRVA 1RILA 3HP6A 2GELA 2O4XA 3X28B 3TANA 4ESFA 1QQOA 3D4VA 4W1UA 3WT0A 1J9IA 3MCAB 3SQ2A 2YR2A 2IP2A 4M7AG 3FZLA 3MCPA 3O9RA 5A2QK 4RS8A 4R0KA 1ZUYA 1T95A 2LX9A 1Z9CA 1LNXA 1YW7A 4B1YB 5C24A 3H45C 2QG9B 1BW6A 4OPKA 4J9GA 1IXSB 2BOLA 2JVVA 4RLQA 3S2WA 3QYFA 2JW4A 3C12A 3G1OA 4G7ZF 2HDAA 1YRNA 2K6DA 2P7VB 3F72A 2CMPA 4B6MA 2COWA 1QA6A 2RV8A 4OGCA 2CUDA 3R6NA 2DYBA 1K8AC 3FLGA 2OUMA 4U87A 4ABZA 2DT6A 4M77D 1R36A 1NK9A 4FU6A 3D7SB 1T08B 2DN0A 4Z4CA 3BR6A 2GAUA 3RSEB 1FPQA 5LJ3e 1MV0B 3HG9A 4OMQA 1QCNA 2MABA 2CJJA 1J75A 5LJ3h 3A02A 2EIKH 3VOVA 2FF4A 1S1NA 3SDBA 3CZ6A 3CCMN 3SUNA 1LV5A 2OQRA 2I8DA 4S05A 4HCBA 5J3LA 4A6DA 3NMUA 3A1PA 2NOZA 3M5AA 2VQGA 4CCNA 2BY2A 1Q1VA 1HKSA 2XDPA 2OPTA 1K78A 3HJFA 4IHYA 2NUZA 1S7EA 4Y15A 1EQYA 3MAQA 3D2FA 5C2FA 2ZBKA 1UB9A 2DY4A 1X27A 3S17J 5FU6C 2F96A 1O3RA 4FYWB 1NGNA 3GNGA 4IHTA 1RETA 4GXOA 3B6CA 2RQTA 1WJCA 2COMA 3K59A 5ILSA 5GINA 1WFXA 2V1DA 3G4SA 4M41A 5DUKA 3PIPA 4RA2A 5M9OA 5BPNA 2VASA 3A0IX 1BWFO 2CGLA 4K8XA 1YOVB 2COBA 3WXJA 3VMFB 4CZGA 3D6RA 5LL6S 3LLRA 4BE2A 4K11A 2KKZA 3RMDA 3RMAA 2HF4A 1JJ2M 2ROTA 3OR1C 2ZZDA 1YAGA 4XLNF 3KFVA 1DP3A 1RNHA 3KPHA 2XIGA 4AILC 5D6YA 2X3WD 4OKJA 2ITGA 4C92F 5GJVB 1IKXA 1A04A 3TKYA 4LSNA 2IVMA 3OWTA 4D6WA 2R7VA 2I5JA 1QQIA 4DTPA 3OOUA 2Z1GA 2L3RA 3HZJA 5JLWA 4N47A 3VA3A 4E7HA 3M0SA 2V26A 4Z02A 4CCOA 4LIUA 3OGDA 3ZGKA 3VW4A 2KQWA 5J26A 2EJGA 3U8XA 4B3SK 1TAQA 3M9AA 4DKWA 1SSHA 2HVIA 1YITQ 1WLJA 2EIMH 2KZMA 2JTVA 2BYVE 2V1UA 3E6BA 3RTRA 3HC7A 4H4KC 4ZYEA 3FXLA 2MFZA 2GBZA 1I1SA 1J3TA 4M42A 2KMUA 2OTJQ 1WUAA 3ERMA 1GDTA 1U6ZA 3BUZB 1FX7A 1VSIA 3IUCA 2HYJA 2HYFA 5C12A 2DKGA 1KAYA 2W6KA 2W41A 2RGVA 1PDNC 2Q31A 4JYAK 4CBWA 3EHRA 2GA1A 1YJNA 5IYBJ 2GTOA 2HBWA 4C9YA 2XU8A 2G8IA 5AQSA 4RCCA 2HBPA 1HX1A 4RTFD 1QQMA 1TVRA 2LC2A 1ZGJA 1N9SA 2DK8A 4ILJA 1VQ6T 1Q81C 1MH3A 1WEFA 1UHWA 4IG3A 4P9FA 1N39A 2M34A 1RTJA 1W7PD 3HPWA 1DGWY 1X9SA 4KRFA 1Q82R 4DF4A 2EKOA 5GAMg 2V51B 2JTEA 3CO6C 2FRWA 1QZ5A 2F5EA 2O0YA 1F21A 2CP2A 4AD9A 2GIVA 3DTIA 2P9NB 5KYUA 1QZZA 1Q82O 2EWNA 3EQLF 2M0MA 4HOBA 4XOTA 1U9NA 4J7FA 2GWKA 4XTUA 1KQ0A 1S6LA 3MKWB 5HOOA 3PL8A 1VYVA 1VQLI 1C0WA 5E3MA 2RNJA 1LFBA 1SMYF 1OISA 2ZJPL 1W97L 2QWOA 2KRHA 2LOOA 1YI2N 1H641 2CT4A 3TSWA 4LG0B 1OV3A 2DAQA 2P0WA 1FW6A 3RYPA 4A3EJ 5J8CA 1G8XA 4C8QB 3S1QJ 1BBYA 1D0ZA 2HMPA 4I0BA 2QEXI 1TQPA 2K3XA 1NMNA 2IAJA 1KG4A 3TO6A 1T0FA 1TC3C 3MKDA 1LEAA 3BG3A 1XDSA 1LE8B 2P9UB 2A61A 1YTUA 4YRVA 1JUSA 5JICA 1CZBA 3CCUT 1S6PA 3F0CA 3IH4A 1DEJA 4FWPA 3T69A 3TO9A 2XKOA 1CKBA 4U67L 2MWPA 4GY2B 1ZSZA 1SL2A 2VV5A 3T5XA 1Y56A 4DWIA 1MNMC 4XLCA 1FYLA 2WB1A 4ZH4F 5CHZA 1L3SA 2BGGA 2WAQA 3VS3A 3Q5FA 3VEVA 4X62K 2A6HF 3ECHA 1XNQK 4CE9A 4HNVA 2VGMA 3CD6T 4EJVA 2EZHA 4M7AE 4F93B 1R77A 4RW4A 2LJ1A 3O4WA 1R6RA 2RNGA 2HZTA 2FOKA 1VSLA 1OR7C 4IJNA 3M1FA 5F0FA 5IHKA 3RSEA 2KVQG 2QBYB 1Y71A 5D5XB 4R55A 2RE2A 3O8GA 4DIQA 1S8NA 5D4RA 5HL7L 5K7FA 2WUSA 1VQ5T 5D3GA 3PSIA 2XB5A 5FPEA 3DKMA 3U3GA 2VPRA 3FRNA 3JS6A 1Z0XA 3ITHA 2UXNA 1J53A 2ECZA 1G3YA 4OX9K 2ZJPF 4A53A 4AIJA 2KIUA 3WU0A 2OCCH 3I4NJ 2P4RA 3BFMA 4FYXB 4FLXA 1FYKA 1LJOA 2E20A 1GLEG 5MLCQ 4M3BA 1ONVA 4KIBA 4L5IA 4C0FA 4HXJA 3SWNC 1HDPA 2ZWHA 4BQAA 2R7YA 2DXIA 5BRDA 4BGBA 2PZ1A 1B59A 2IIRA 1U1TA 2CGKA 2PQ8A 4MQVA 4M6XA 2HNHA 3DLKA 3M8PA 2L7KA 1VQMI 1VQKI 2DDAA 3K1NA 2DRKA 5CKTA 4M75C 4BRKA 1U48A 2PTKA 5HDNA 1VSMA 2EFPA 1X2KA 5BPDA 4FE7A 4B08A 2PG4A 1B4AA 4KA4A 3S2DJ 1YLFA 2DPDA 1GXQA 3BG5A 5EVZA 5HS7A 2C6YA 3H0GJ 1HKTA 3WHBA 3H8ZA 2GEMA 1W2BM 1RPWA 2G0EA 3G71A 3ULDA 4DU3A 4JI3K 1WHLA 3I3LA 2JTMA 4O4GA 4E9GA 3DOKA 2HOSA 4P5NA 2VG6A 3G3ZA 1ERDA 1F5TA 1KC8R 3KLIA 3QIPA 3G0ZA 5J4YA 2P9KA 3LFKA 3CCRT 2ED0A 4EA4A 1UUEA 1EH7A 4KHSA 3HZ6A 1JQQA 4XLEA 2QI2A 1M1KR 5IP6A 5GAHP 1SMTA 1KC8O 2X1CA 3Q3SA 2FNPA 5HLGA 1MWKA 4RB3C 3C6AA 1J5OA 1NYFA 5CYMA 2BE2A 3QLHA 1EA3A 1M1KO 2J4RA 3C0BA 3JSPA 3JCMg 4CESA 1FWZA 2HHVA 2BZTA 1FZPB 1AWWA 3VGMA 4B9LA 1J6ZA 4H5RA 3LGLA 2R5AA 2STWA 4PKHA 2G6FX 1IGUA 1MA9B 2CYYA 1QGPA 1XJWB 4FIBA 4BQLA 3GBGA 4WQ4A 1VQ6Q 3CETA 3ISPA 2YI1A 4WQ5A 1NYGA 2W48A 1SQKA 2D1HA 4CCLA 4JDSA 3MXMA 4MNUA 4J6YA 1QPIA 4CF1A 3THXB 2FBKA 4B43A 2CH6A 1LOJA 5KQ8A 4OMLA 2ID6A 3VUZA 4NB4A 3CC4I 1E3HA 4O44A 5T7BA 2OJED 5B66C 2V75A 2BH1A 2Q8KA 4HV6A 3VQEA 4XTWA 2HW3A 1JHHA 2HQRA 2RJCA 5IH2A 2HXOA 4ISEA 4XU0A 3DXJF 3VS6A 4DFJA 1UJYA 4UUSB 3VQBA 4CJPA 2RN2A 1JXOA 4HT8A 4FK2A 3U1KA 3DMJA 5KVRA 1FMKA 2BW3B 2QEXA 1WBDA 1KAXA 5DD8A 2XY8A 1WHMA 4C92B 1S5JA 1YT3A 3I56N 3EGXB 2HNIA 3W6KB 4DZPA 1JI8A 3OSSC 5A2QO 5F0HA 4OKKA 3S3MA 3GTPJ 2IVPA 3U3YA 3K4KA 4PWDA 4B47A 2BZXA 2B9SA 3CMAT 4MTDA 3HHGA 3TW7A 2A1RA 2DVJA 5AQVA 2YHBA 4W5TA 1OCPA 3KP3A 3E9OA 1P92A 2P9NA 1MPGA 1Q7YU 2JN6A 1H89C 3CCUQ 4OOIA 2RJFA 3TEDA 2ISZA 3OV8A 3VSKA 2XAJA 5ICFA 4BWJA 1DTQA 2NRVA 4CGDA 3LL7A 5B1AH 1SD6A 1ZHFA 3CQYA 4FJ7A 1I39A 3QB0A 2H1KA 5GAN5 2ZKZA 5CZ1A 4LG0A 4JK8A 2LX7A 1KLNA 1I27A 1W1FA 2MLGA 2NLXA 4ASNA 5JMVA 3CD6Q 4C8QA 2RB6A 3CCLT 5LEKA 3DPTA 5IOZA 4LDYA 4BE1A 2LMJA 4YIRX 2DW4A 2STTA 1R1VA 1PVSA 3CWAA 3OMGA 1LE8A 3EH2A 5LJ5e 2P9UA 3NGIA 1T3LA 2DBKA 1NTCA 3N4MA 1U5TC 4HRIA 3HVRA 2AQEA 4FYYB 5FROA 1NJXA 3MX5A 4K41A 1S72N 1VQ5Q 3DLEA 3IDHA 1X3MA 2LSOA 1PUFA 3L1PA 3T1AA 2G7HA 3OYHA 1E4FT 3I71A 4V2GA 3MZ8A 4A3BJ 2KZVA 1HQCA 2Y2ZA 1EX4A 1LWCA 4UVCA 1VQKA 5D6WA 4ELTA 3FF5A 5KCOA 4L5GA 2HQNA 3J80Z 1HJOA 2CDTA 3SAGA 4CZHA 4M7AC 2KJCA 2YRVA 3SQ4A 2IIMA 3GCMA 4FLTA 3NNQA 3OW2S 5EXWA 2BUPA 3QFPA 3KP7A 2DXCA 3AA2A 2QBYA 4N4HA 3NVKA 5HODA 1NGDA 4Y28E 1EFNA 4S04A 4O5BA 1H1VA 4BRPA 2HMIA 3F8CA 4PKGA 3THWB 1K9MC 2M0CA 2CGJA 4EZ6A 4XH4A 2GX9A 3SPZA 2F2EA 2KGTA 5DUIA 1N8RC 3BP8A 1C1AA 3UPUA 1A0NB 1N34K 1D1CA 4C8QG 1M8MA 2NOJB 3A5LC 5F27A 2EB7A 4A3KJ 1R23A 2MK5A 2PUOB 2PAVA 1NBEB 3S6IA 2IXSA 2CW0F 2DL4A 1NJYA 3CCRQ 2EGAA 2EA4A 2QWLA 4YG2F 4BY9C 1Z91A 1X1DA 4FVUA 2F69A 4AVZA 4KREA 2AK5A 1A5WA 4AYBN 5LEJA 2L3DA 3FSPA 3LAKA 1Z05A 2YNHA 2D8JA 3WE3A 4FL9A 2Z1HA 4B9VA 4K25A 3LWLA 1W36C 4NXMK 1WI3A 3NF6A 2QK9A 4HLYA 1X58A 4JKFA 2CFOA 2JLEA 4NL2A 1KVCA 4C5HA 1YJ9N 2CZ1B 1WJRA 4BR0A 4B8AB 3LZIA 1S9HA 4M3XA 3CC4A 2HFHA 5IYDJ 1IKWA 2LFBA 1FC3A 1OVYA 4A3IJ 2E1MB 4B09A 2V8KA 1QSLA 3R61A 2WFBA 4DV4K 2EPFA 4L0YB 1TP4A 1TNSA 1T0HA 5LLQA 1K1ZA 5FRNA 2ECBA 2Q36A 5FWCA 2VUMJ 4M3RA 3CCEA 1RT4A 3GZNB 1RTIA 1SD4A 2OTJI 3EG2A 4EJZA 2EQMA 4B24A 1XHZA 4JNEA 1T3VA 5TKWA 3QEXA 4WF9L 2QKBA 3PVLA 3GLXA 3L1AA 3O8HA 1WHUA 2A1SA 4BRNA 4IEJA 3CDLA 2CGPA 2IGMA 4H5VA 3CJNA 2P8TA 2NNNA 2RHUA 2VIXA 2JHNA 3E97A 5CYQA 4LF7K 2X85A 2HDCA 1G5VA 2FPDA 3THXA 2BVLA 1WOQA 3W2AA 3M8FA 4ETSA 1WZ2A 3HM9A 1KHCA 2IGIA 3CMAQ 4IURA 1TS9A 3GTQJ 1BR2A 3W2WA 3WTXC 1HR0K 2HR3A 4UUSA 1DPUA 3OIOA 4XKCA 3J81Z 3RR7A 2F4MB 2L2OA 2D0CA 4PL7A 2BW3A 3CERA 2DFFA 4EJTA 5JVTA 3C0CA 4HNUA 2DMOA 5AQIA 4C92A 3JB9H 2M0OA 1BQNA 2D0NA 3EGXA 3IHOA 4ESRA 3ZMTA 4HEA2 2QDLA 4FM0A 2JVGA 1IXRC 3VEPA 1ZKGA 3CCQT 2LY1A 4CIGA 1P7JA 4LD0A 4ZGEB 3CCLQ 1E3PA 2DMTA 2ZAEA 5EGOB 1ATRA 4LDVA 2PJPA 4AF1A 2QXFA 4DU4A 2PJRB 3F8FA 1H92A 4D9JA 1ABQA 2ELHA 4IX7A 3I4PA 4JKAA 1EIFA 4XMYA 4J01A 4KMUX 2RD1A 2G8WA 1RDCA 1JKHA 1QLYA 4J8FA 3ZT0A 3RPQA 2EYQA 3GUDA 3QPHA 4CC2A 4C0ZA 3CPFA 4PHTX 2CP7A 2COZA 3KK7A 4FLYA 2XI9A 4FASD 5GAMf 4IFEA 2ZJQL 5IT9Z 2RA2A 2IGNA 4EA5A 2K79A 4E19A 3A5ZB 4M3UA 5IAYA 3MVPA 1Z6TA 4G8XA 2XRLA 5GTHC 3I55A 2IW5A 1K61A 3QESA 1VTNC 8AT1B 2AHQA 4O8KA 2HHXA 4CZMA 4OMMA 4E3SA 3H46O 2B63J 1ZLJA 1VQ7T 1ASWA 3KKSA 3K4CA 4OMYA 1OH8A 1AOJA 4C92G 3H1CA 4BHBA 1O3QA 4OINF 4R56A 4Y1DA 3BQYA 2IVOA 2QKKA 3D2EB 2OTLA 4HF2A 2KT8A 1DKGD 4PJMA 4B1RA 3UKRB 2B86A 4BJTA 1TWBA 3V1OA 2EH3A 2XDVA 3F10A 4B1UB 3BZKA 1NJIR 1NK2P 4KICA 3X25B 3VQ8A 3RRHA 2RK2A 2DFHA 4E70A 2R5YB 1K8KB 1NK3P 1D09B 3RKXA 3N5NX 2R5MA 3L9FA 5C0MA 1C1BA 1JE8A 3LWMA 5J2QA 1NJIO 2P51A 5I2MA 3VDXA 2QQ8A 1ETQA 4LXCA 3K70C 2H09A 5GAMd 3G4SN 1YITA 5CHIA 3TSZA 1V4SA 4C23A 1C0FA 3ID8A 4FYVB 1VQ9T 1IBLK 1VIFA 2Y48A 1NGBA 2P5VA 4HF0A 5JR3A 4IRIA 3MJXA 1XS9A 3BJAA 2NVQJ 2LQNA 2GWRA 4A0YA 2ZJQF 3GE1A 4M73A 4IUVA 3IRRA 2O8EB 3JRFA 4ITVA 4BRHA 3TOBA 2EW3A 4EGYA 1OZ2A 3O80A 2E2JJ 2K3PA 5FKOA 4IDKA 4XK4A 2LD5A 3AG2H 4AFQC 3E6DA 4MDAA 5EC7A 5LRSA 1KQ1A 4C8QE 2PNIA 3EG0A 4NL3A 5KYXB 3LDQA 3CCJN 2FF6A 2QUFA 2EPDA 4JS5A 2OA4A 3Q7CA 1JU5C 4N5SA 4BU2A 1YS6A 3KP4A 2QWQA 2W40A 2XAQA 2R57A 1WEIA 1WNSA 5IOYA 3ZSYA 4KGVB 1QVGM 2Z1DA 4L59A 2NRAC 1ETKA 4FM4B 3CJ7A 1WJQA 3K4MA 4J2DA 1VUBA 2XKOC 4I2QA 1QHTA 5TRDA 2BXYA 2LMDA 3GNFB 2RPIA 4OLAA 1J09A 4J2EA 1VQ6I 2P5GA 3LAJA 1G2BA 3O9QA 3SPYA 4YNQA 4ELZC 3FB9A 5I11A 2KNBB 1XTAA 2QQ9A 1W0HA 3TO7A 1S9GA 4CBXA 3AVNA 1ZELA 1SAUA 3BR2A 3ML6A 4L3QA 2MH2A 1MSFC 1BIUA 2D0OA 4Y1CA 5CR2A 1YJNN 1HW2A 3V7CA 2CREA 1NU0A 3KNTA 2X51A 3HSRA 2XG8D 3GEZA 2O6GE 2SEMA 3HYIA 1S72T 4EP5A 3FKIJ 1D0YA 5BQTA 3VQ4A 3ZQ7A 3P31A 4K8ZA 3IS9A 1X01A 3TI0A 1B34B 3CCQQ 5F0CA 3H0IA 1CGPA 3DF8A 3JB9F 4AM6A 2OQGA 2XD0A 1FNNA 1M2VB 4IHXA 1NE8A 4FO0A 4XRFA 4KH5A 4M75D 3JCMJ 3PX4A 3JCMf 3PSFA 4XKVA 2Q0UA 3TSPA 2VLAA 1MWMA 3QRFF 2CUJA 3AFHA 3REBB 4DR6K 3H6ZA 2YPRA 1VSJA 2CP0A 1ZRDA 3QOPA 4C0DC 5KGXA 4B9TA 2JWKA 4FLWA 3CCUI 4BUPA 1RT6A 1OYYA 1K73C 4CJSA 1VQ4T 1WSEA 4FJNA 2XB0X 2QTXA 3FIFA 3E5UA 5E1XA 4C5IA 1ETOA 5HLIA 3MQ0A 4GBQA 4HSRA 4E1NA 4I2OA 2EYWA 1ZYRF 4IOCL 2UZKA 3CMEA 5EGOA 1XGMA 4YY3K 4FM1A 5LGUA 4DS5A 3IWFA 3CD6I 2Q1ZB 1LWWA 5CQXA 2PJRA 1I1JA 2HHUA 2ZXIA 1KCFA 3W6JB 4IG0A 1MJAA 1ZX6A 3J7YP 1PP7U 2P0PA 2V6EA 1F1BB 2ZPGB 1U2VB 1VQ7Q 4KUDK 1NKBA 3MEUA 4LD6A 2VWBA 4JI4K 3MEVA 5L3EA 4DTRA 2E1HA 2DERA 4XIUA 1UGVA 3U9GA 3BF1A 3MXIA 1T8IA 4RG2A 1VQ5I 1ETWA 3I5RA 2Y1JA 1WSGA 4E1MA 1REPC 2NUBA 4A3JJ 4KH6A 1YX5A 2WAQN 3JCMd 2F5VA 3E7LA 1I1GA 2LDUA 1M3AA 3HFOA 1YVNA 5F1JA 3TCJA 4J9HA 1WSHA 3LWFA 3AY9A 3A8LB 1RNLA 4AIAA 3AA4A 1QQJA 5GAN3 2P1JA 1V55H 3QU3A 4H5NA 3K9TA 4ICLA 1XMOK 2LJ3A 2OF7A 4BROA 4I9LA 4WQ5C 2GIZA 1FJGK 4UVAA 2NRRA 3D7EO 2HF3A 4DCHA 4CDGA 3D2EA 3D0PA 4MDBA 4Y91A 3UKRA 4EMKB 1VQ9Q 9ATCB 2Z3YA 1PKSA 1MNEA 4CZFA 3MEXA 4MZTA 4M77F 2VKDA 1NOYA 1VRTA 4CZLA 1RDDA 4L5EA 5E20A 3KJVA 3LSRA 2QXLA 4LJZF 3ZSVA 1C6VX 1F36A 2HHWA 2R5YA 5IHIA 1K8KA 5J2NA 5DM7L 5AQHA 4CZEA 4C92E 3CCRI 2QGFB 2I5UA 5GMKj 3EG9B 3AVAA 1UG2A 3QBWA 3MKLA 4GVMA 4PJOD 2M02A 4BXUA 3HGGA 3CWUA 9ANTA 4E7KA 1G59A 1OVQA 1HYOA 2MLKA 2A5WA 3BY7A 2E8AA 3ZQIA 2HSEB 2V1QA 5AQQA 2PFBA 3CQZJ 3IKMA 3VSLA 4KHWA 4NO7A 1LPQA 4CZIA 3KLGA 3H1VX 3RKQA 4FT4A 2F4VK 1U8BA 2DBBA 2O8EA 1GBQA 3HL2A 5M5WJ 1MDMA 2E7WA 5C42A 2EA2A 2ZPFB 3CCST 1Z9QA 2GBQA 2DMUA 1FSHA 3A8OB 3PE0A 1ESVA 3RCOA 2P4TA 4DTSA 4YOTA 2QSFX 2WAFA 1BCMA 3ALYA 4M78D 3IUOA 4IJAA 1HW1A 1VAZA 1G15A 3EH1A 3LDSA 2EZIA 5KYXA 4C8QC 4DHYA 4J19A 1BCOA 3BDLA 2X6WA 1D8JA 1EKEA 2E36A 2J6FA 2X4XA 4A5AA 3C3WA 2KRSA 1U4BA 1OCTC 4Q47A 3WTSC 2L02A 4C8KA 2VQLA 2I7PA 2NS7A 1RT7A 3AVFA 4BRAA 1WJ5A 3S41A 2QENA 4DV5K 2VN2A 4NS5A 1Y39A 2XK0A 3EYYA 3LW5E 1K76A 3BZ6A 5ICCA 5BPIA 3VA0A 1NK7A 3S6WA 1CSKA 2FE3A 4KV8A 4F14A 3ENBA 1L0OC 1U8RA 3VQPA 4D1QA 2MW8A 5CK9A 4JI2K 5DM7F 1IBKK 4B3TK 1REVA 4KISA 2A28A 3MN7A 1ARKA 2QGGA 2M3AA 3WQUA 2CP3A 3CCUA 1XX5A 2OX7A 1Q82U 2VE9A 3BTCA 1K73O 2KDSA 3H36A 3O9UA 2M9HA 2GZWA 1G99A 3CMAI 4BHPA 2DAOA 1ASVA 2HXIA 2FYKA 2MGQA 3F9MA 4H0EA 1EH6A 3VYTB 3LSPA 3C4SA 2XAHA 1PRMC 5KQDA 1JGSA 2HQHA 3CD6A 1E3MA 1NK6A 4IOAL 2H6BA 5IXBA 3RTVA 2QEXN 3TAQA 1VQ4Q 4BHCA 3AO1A 1T38A 3JR9A 2EQKA 1PP8F 1CZ9A 1R0AA 1H9TA 4RGXA 2HDDA 1W2BA 3TWHA 1M2VA 2A36A 2RHKA 2KYMA 1ZUUA 4ID5A 4RAYA 4IHVA 3CCLI 2ID3A 1VQ5A 2V9KA 3ASKA 4DSEA 3RR6A 3JCMQ 4GV9A 2RO0A 5FRMA 3OHRA 2FBYA 4YTLA 4B9XA 5LHHA 1FXXA 1QHGA 4EW0A 1T03A 4EV0A 3JAMK 1GOCA 4EMHA 5LRRA 3GXOA 3R0JA 2L9SA 3HBTA 5H6RA 1KD1C 4DV1K 2O61A 1X75C 1NPPA 1P4WA 5AQWA 2EQJA 5HDKA 3TQ7P 2FLOA 1O3SA 4CECA 3ZQQA 4JRKA 1VF9A 1SRMA 3L2VA 3C65A 3QIIA 3PUFA 1GOAA 3GG4A 2YUOA 5IPAA 3KEOA 1HNWK 2F5KA 2W03A 4NB5A 1WJAA 1DIZA 1P9QC 2IAIA 1U2VA 3VENA 3SYTA 4CERA 2OPPA 3ABTA 1VSDA 5AQTA 5AQXA 4CC4B 1KTQA 1S3JA 2BHZA 1O4XA 1HDDC 2CWEA 3CCRA 3EYZA 5HRSA 1TWFJ 4D0PA 1VQMN 2N8GA 1VQKN 2K9GA 4GO1A 1TT0A 4M3GA 2NVXJ 4CFAA 4I99C 1JL1A 3VQAA 3QINA 3IH2A 2EFWA 4A62A 3TR8A 3M54A 5CVUA 3IRXA 1UAXA 2ZFUA 2HQXA 4LDXA 3FDYA 4JZ3A 2LBFA 4CEQA 2D1XA 3CC2T 3R9PA 2KISA 1ZAOA 4F3QA 2EQIA 4FSSA 4JK7A 4IZZA 2BTFA 4E9HA 2QTVA 2KDZA 1Y64A 2Y30A 4M3DA 1AZEA 3K0LA 2FJ1A 2VBZA 2E2IJ 4EMKA 3PX0A 4F2SA 2LT4A 3ZLJA 1HLVA 1YQKA 1QVUA 5D4SA 1KSWA 4DFKA 3SDGA 1G4DA 4ZGDB 3SHFA 2HPMA 4EMSA 2A07F 2W6LA 3EHQA 1KC8U 1KRPA 2ISYA 3CCSQ 4B1XB 1K0SA 1IF1A 4C92C 3WTYC 2CU7A 4DGWB 3EG9A 1M1KU 4O3MA 2EQUA 1YQAA 1Q86O 3BZCA 1KGSA 2YX6A 4CJEA 1FBQA 4PNOA 1XB4A 4LDUA 3PNYA 2DOFA 3LX7A 1TK5A 4IFVA 1GLNA 1WGXA 4EAHD 3A5MC 1Z77A 4JP0A 5DPKA 2KI7A 3FJ5A 3I9V2 1VQPT 1WCMJ 3TARA 3CCMA 1NJWA 3EYIA 1JTXA 2VBXA 1HNZK 1Q9XA 3ULEB 1KU2A 2I10A 2JMCA 3CC4N 1G83A 4B9WA 5GMKe 1RI0A 5HKCA 3F3XA 3CMAA 2OA8A 5GMKh 2LQKA 3G6ET 2EV6A 3S8PA 2GTJA 4XL9A 1KFSA 3R8EA 1MMNA 1IHVA 1ACIA 1Z67A 4OP0A 4BVOA 1N75A 1NLPC 4S0HB 5A2QZ 4FM2A 2H3GX 3TSQA 3X26B 2HD0A 1SF9A 5ILVA 3LDOA 4KB1A 2EIJH 4B3XA 4M77B 1RBTA 3FXKA 3G1MA 2ZXHA 2DRMA 5GAHJ 1PYVA 4B48A 4QCLA 4BRDA 2HWVA 2YU3A 4CJ4A 2JUFA 3V9WA 3ER0A 5L3BA 3ONQA 2V4JC 4KH4A 3CCLA 3Q9SA 4IUPA 3DP7A 4FWRA 1GOBA 2CW8A 3KEQA 4GYIA 2IC3A 2LNVA 1IHWA 2D45A 1X1BA 4LITA 2LRQA 2NOGA 2WA0A 2ZPHB 3CBMA 3FDRA 3JREA 3VEZA 4F55A 2VC8A 3CCQI 4BC5A 3MN2A 3W3CA 2FEZA 3QNNA 1Q18A 1ZGWA 4DSLA 2QW9A 1B6AA 2XROA 3RKYA 2GFAA 3O3KA 1VSHA 2GOMA 2C0OA 1M3QA 3ZP5A 2UUAK 2CV0A 1N5YA 4FSVA 5KRTA 1QHHD 2HCKA 2CO5A 2XGCA 1NK4A 3DLGA 1W5TA 4Y92A 3IH3A 4XM3A 2NRTA 2XV4S 1BM9A 5KYNA 3H0HA 3QETA 2ETHA 1GCPA 3NCIA 2ENMA 1U2WA 1SHFA 4CK2A 3MECA 1I6HJ 3ZCMA 1EJ9A 1YIJT 2HBMA 3LM9A 5E26A 3TAGA 3OS1A 5FPMA 4JYKA 4L9VA 5AIPA 2GXBA 1HYVA 3IH7A 2GV9A 1X6BA 3CFPA 4WFAL 4B9SA 3CEYA 1R59O 4CJTA 1R9TJ 4MMKA 2IVWA 3PFIA 1RT2A 2ZPBB 1ODDA 5ADXA 2VKHA 4A93J 1KZHA 1VQ7I 1TUCA 1W70A 2KSSA 3PIOL 4NCBA 4M7DF 3S3NA 4XQFA 2P9PB 3TAPA 2FD5A 3BDPA 4PCQA 3F70A 2WC2A 1FOKA 2GOXB 2YDLA 3BG9A 4GCVA 4IEEA 1BQMA 1QVPA 3Q1JA 2UUZA 1XSXA 1OQKA 2A3SA 4L9JA 4XLFA 4CGFA 4I6ZA 5LMNK 3BF3A 4UVBA 1Q8IA 2Q1NA 1R4NB 3CC2Q 4B4CA 2LP0A 4YOUA 1V5EA 3QEWA 5BPLA 1VZ0A 1PG5B 2XGXA 3HEFA 5ICEA 4J2BA 3A8MB 2DILA 3MX2A 4IXCA 4IKFA 4RM2A 3HRGA 4K43A 3QUIA 4DK9A 2NOLA 1IRGA 3EETA 3TU4K 3LH0A 3H6EA 4NUBA 3JYTA 5LD2C 4IOXA 4DLGA 2PQWA 1YI2A 2YUQA 1VQ9I 3VU3C 1GLFO 4OIRF 1YVUA 2BY1A 1BB9A 3AAQA 1OYIA 4A63B 3R6MA 1IAWA 2A0FB 1WPKA 3M0RA 1X3ZB 3QHSA 1ZYQA 2WV1A 2JS0A 3FHNA 5L3CA 4CUGA 3M0QA 3L2QA 1U84A 3ERED 2Z33A 2E3HA 1XCBA 2DLPA 4C5EA 2BKDN 1FBUA 2V8JA 3HSTB 1W7PB 1NGHA 2M4GA 2ITMA 2NOBA 3FEOA 3WXMB 4QVCA 1AKHB 4CI0C 3MMYB 5FU7B 4CEFA 3QO3A 5F0XA 3I8DA 1VQLT 3PIOF 4MQ9F 2ABKA 2YRCA 1YITN 1S1WA 3PQJA 1ACMB 1VQPQ 1HKGA 1VSFA 3Q0VA 1ZQ1A 4RTXA 3RKWA 1JO8A 2KRFA 4CJVA 3BTLA 3QZ5B 1BR1A 2OTJN 3C2GA 3URGA 2YX4A 1STZA 4CVNE 3AARA 3G6EQ 3QEPA 1TWHJ 1TWCJ 1LEBA 2FZCB 3TW6A 1C1CA 2QQRA 2VKVA 4XTXA 2LKPA 4X65K 5L23A 4DBFA 1SKRA 4DBQA 2LDMA 2MD5A 1JKOC 3KYLA 1HNXK 2O8FB 1J9AA 5EY4A 1AWCA 2VGNA 3JB9G 4B8CA 3BWGA 1WH7A 1SL0A 3DLHA 5FFZA 3KEYA 3RESA 2X1EA 1X9WA 3VQ9A 4DTNA 2BBYA 1QPMA 1JCFA 3CCQA 2OPQA 3QDKA 2F2VA 4OIPF 2L01A 5FWBA 4G1QA 4B9NA 3ULEA 3KZBA 2DL5A 4BRFA 1JCGA 3H3NO 3T8RA 2E34A 2B7EA 3KLOA 2L4AA 3WG7H 3ZQCA 1WWXA 1QZEA 1M1FA 2J6OA 3R4KA 3M3YJ 4FWSA 5K7HA 5CKHA 5IP7J 1PSEA 4LUEA 4N4GA 4X9CA 3DXMB 2EFNA 1LKXA 4M77A 2RQWA 3M4YA 4BGAA 4OKEA 2FBHA 4OMFB 3EUHC 4V19S 1GT0C 1EP4A 1E6GA 5I3UA 1RR8C 1GV5A 4LDWA 4MLOA 1V3FA 3TP0A 4X34A 4CJFA 1R71A 3FJPA 1KYWA 4A57A 3QDRB 2DX1A 3DM2A 1ZBFA 4YDUC 1RABB 2DFEA 2RC4A 2K3FA 2DDBA 2DJIA 1SVOA 1HC8A 1YXQA 3MCZA 2HNZA 1C0UA 1VQ4I 4F3TA 3X20B 2RPNA 2ADUA 4A3LJ 1YIJQ 2JM9A 5CQEA 2KY9A 2FZKB 1VQ7A 2E71A 3JSOA 1WHHA 2JA6J 5GAEP 1LQ1A 1M1EB 2F2XA 4DFMA 4C1NK 2HHHK 2GQQA 2X48A 2E2NA 2HL5C 2Q2EB 4MGRA 3F8BA 1GCQA 1WNLA 4A5MA 4M6YA 5E8IA 4Q5WA 4JN4A 1E3OC 4JJDA 5AQGA 3GZ5A 2OZMA 2NVYJ 4KBMB 1LWFA 4GKKK 2X0LA 1V54H 1Y97A 2AP1A 2JT1A 5AJ3K 2WOMA 1BI4B 1I4K1 4M6VA 1R0CB 1W5CC 3CHWA 4EM2A 4M77G 1E17A 3FE1A 3CF5L 1HQEA 3VOEA 1QVGA 5DY9A 3P9CA 2JK3A 2Z2SB 4A2AA 2DETA 3EFSA 3EFRA 3R3LA 3GF5A 4AIHA 4XH5A 2HOAA 3MN9A 2Q0OA 3RZOJ 1CXQA 1IN8A 1WN7A 1VQ8T 5IWAK 4A2BA 1XC5A 2E88A 1PC0A 1GL5A 3OBWA 2K9NA 2RMOA 2X9DA 3RRGA 1RBRA 2IG0A 4CW7B 1FP1D 2P9PA 1W6XA 5GTIC 4AHTA 4LF4K 4FJLA 3BR5A 2RREA 3O1WA 3S16J 2ICWG 1U6GA 4AIKA 4FJXA 1ZHIA 3CJAA 5E1ZB 2XSDC 5JI6A 1T98A 3HJEA 4FVMA 2JUGA 4D8KA 1MUZA 4BR4A 4E7IA 3L2RA 4OB0B 2P0QA 4U0WA 2YSQA 2DF6A 2G8VA 4UY8I 2C0IA 1NJIU 2K5LA 1RAFB 1M8VA 2W24A 2D5VA 2DMNA 4YFNF 1J5YA 4IHSA 2X6OA 3I9QA 2M9UA 1LWEA 2VQCA 4F8RA 4CBUA 2W84A 1WHGA 3GYHX 2W0ZA 1SAXA 1AT1B 2IJLA 3DV8A 1PSFA 5KE2A 3V8LA 4FETA 3BR1A 2VONA 2B8AA 2H8WA 2E6LA 1VQLQ 2VBYA 1MKMA 3VGKA 4HVJA 1X1CA 5J40A 4CJRA 2VOOA 4HX7A 4H8KA 4DV7K 1TKTA 1N6QA 4EVIA 4HVVA 5I9EB 4II1A 1HSTA 4QWQA 2LTOA 2QA4T 1RAEB 5LFAA 3KHYA 1RT3A 3KUFA 1O3TA 4BD3A 1M90R 5LHGA 2BTTA 3TAEA 3CF5F 4A3FJ 5CKFA 4JKGB 4C8MA 4VUBA 2QCOA 4KDPA 3L00A 3MZHA 1TL1A 3KK2A 4FYDA 5ILUA 2JWLA 3QP6A 3CCSI 3NH1A 3HTVA 1HXDA 2EK5A 3HB9A 1JXBA 3AVKA 4OFHA 2FPEA 1M90O 5GIOA 4CEAA 3CW7A 3VF2A 2HQAA 3RI4A 3SEQA 2DFUA 1UFFA 3LP1A 1ZG3A 1VQNT 1S72A 1ZR4A 5CIUA 4K0KK 3M53A 3LWHA 4QOZB 4BI8B 5KTQA 4R5PA 1OU9A 2PEXA 1VQ6N 5HNFA 4LLNA 5C3EJ 3P9IA 4C0GA 3LSKA 5LHIA 1Y1VJ 3NTHA 1WFWA 3MXJA 4BWMA 1OLTA 1Y57A 3K1MA 1NGAA 5HK3A 3D5SC 2NUTB 1RDAA 1B9NA 3UWNA 1S6QA 1OX9A 1Z3XA 2XPWA 3VPZA 2YWWA 2FZGB 5D8KB 3FXUA 4JLHA 3WXLA 3D2FB 4DR3K 1GHCA 3HYFA 2BXZA 3M6GA 3RIRA 3B6OA 4KH0B 4FJJA 2XKPA 4WCEL 3W2VA 3ABLH 1RRQA 2A37A 3M9QA 3WQTA 4IFYA 3SZTA 2QLZA 4CFDA 4CIEA 3VTHA 1VQ4A 2A6TA 4EVVA 4CHNA 5C4JJ 3E9FA 4WCIA 3O4QA 2PYLA 1JLEA 1J59A 3S15J 2I7NA 3GFLA 2EX3A 1ZGAA 3VRZA 2P5KA 3CLOA 3DTKA 4FJ8A 1YJWT 1H9GA 2DE0X 4ZTJA 2PMZA 2KIMA 5GPCA 4IVNA 2W00A 1WXUA 1ZG1A 3BCBA 3ZEHA 2IGOA 1SVLA 4N9IA 5H6QA 3SAHA 4JEPA 2HVQA 3A2KA 1ORKA 3DXMA 2DU9A 3CCUN 3ABUA 1DU6A 1I5OB 1TKXA 2NOIA 4Z4FA 4LH4A 3VJPA 1NPRA 4Y3OA 2DMQA 4NLBA 3KLEA 4ILHA 2DA4A 4ZYGA 4CFBA 2XSJC 2VYTA 3OYNA 4HX4A 1U5SA 3BDUA 2MOXA 4KPYA 1KLMA 2VQFK 3CD6N 4J2AA 2RVCA 2D6FA 2LCCA 3AGRA 2YRDA 3RZDJ 2NNWA 4C1NI 5HLHA 3OA6A 3MMVA 3BPVA 3M4OJ 4I7FA 5GAOr 5KAIC 1OCOH 4A61A 4FJ5A 4BRMA 4JJNK 1IDZA 4RGUA 1MBEA 3GTJJ 1M9SA 4KHNA 3M0UA 2BANA 4WXHA 3ABKH 1VQ5N 3PY8A 2V8IA 4QS7A 3CM5A 1S7OA 5KCMA 1VQ8Q 4WWCA 4F16A 4JRQA 2Q2EA 2JZ2A 3THYA 2BE7D 2M5WA 4LSLA 2DTUA 1DP7P 4CZKA 3EG1A 6PAXA 1X2QA 3MK6A 2EAYA 3GVAA 2A3LA 3LQRA 3ZMVA 3CIPA 5HLFA 3PNTA 1A5JA 1MV3A 4KI4A 1AEYA 3FKJA 4C3JJ 3OB9A 4GMJB 4LLGF 1SEUA 3ZQGA 1G2HA 3C1DA 1XQOA 4M75F 3PTAA 1BI4A 2F6CA 2FL7A 1DDNA 1IJJA 4DR1K 3A98A 5ECAA 4UY8O 2VC1A 3G2BA 5JVHL 1R5GA 3ZFJA 1E2XA 1JUPA 2EJ9A 4C3HJ 2P81A 2OFKA 3OOPA 4EEFG 4PUOA 4XSXF 1L3LA 3JCMW 1H8KA 3ZSXA 4RTUA 1QKWA 2OZ6A 3CC2I 4H4OA 1D3YA 3E5XA 4HDUA 4TVRA 1T33A 3VB2A 3ZEUA 2V7ZA 3J7YJ 3KP2A 4NCGA 2KEAA 2E4LA 1YN8A 3KWIA 3U9ZA 1F9NA 2DNUA 2OJ2A 1ZARA 3DLLL 4M77E 1TU0B 1USTA 4DBHA 3J80K 4XN0A 2CKKA 2KBTA 1C0GA 3CCRN 1CLQA 3K58A 3QJ6A 4Z4EA 5D6FA 1BW5A 1YTAA 2QA4Q 1BGXT 2NS8A 2EZLA 1FIAA 1VHXA 2Y75A 1SUQA 2DIGA 4O0IA 4MLHA 4CJ5A 4YPHA 3EG3A 2QWWA 1CXUA 3E0JB 5AR0A 4M7YA 3GTGJ 4JX5A 4RCHA 5E84A 3MFKA 5M1KA 1B9FA 4XRSA 4PGGA 2L3SA 2JNGA 2EILH 3OYEA 3AG3H 1XMQK 1OKRA 2PBDA 1XMKA 3S3OA 1VQNQ 2O4IA 4P5OA 2HKXA 2ZGWA 3HOVJ 3WU1B 1W2BS 2ZJRF 2KRMA 3RDVA 2X6SA 3U1DA 3M0TA 1WKMA 1MIJA 1Y0UA 1ZSZB 5AYFA 1R00A 3EFOA 1VQPI 3AG4H 4F92B 5B3SH 1H8AC 1RAGB 1EO1A 1PD0A 4Z88A 1BOBA 2FNAA 2ABLA 4JKGA 3CO7C 1HSQA 5KH6A 1SKUB 3KLFA 1R22A 5AQFA 2KKOA 3HXLA 3S32A 3VODA 3NBPA 4CJLA 3E9LA 2DM1A 3G6EI 4CHYA 1B7TA 1HKQA 2QSGX 3UE5A 4V2FA 4JJCA 2VB6A 4J9IA 4QPOA 1IGQA 2DPUA 1QSYA 1CZAN 3JCUC 2A3ZA 2W4SA 4BUGA 4OO1J 4HAMA 1W2BP 4BB7A 1LWYA 4XU1A 1N32K 4KNYA 2V1NA 3WNHA 1NBWA 1MUDA 2JQ7A 3L4QA 3DLLF 4F7UB 4EATA 2WV0A 4DBRA 2ETJA 4DS4A 1H3HA 8ATCB 5H20A 1ILYA 1MHNA 1IJWC 4KT6A 4Y4RA 1YJWQ 2NUTA 4E9EA 5M3MJ 2XRIA 5BRHA 1FBSA 4FWQA 2AKKA 3CMAN 2DQRA 5KNLA 2P4WA 1TXQA 3C94A 4ZGJB 3WU2C 2LREA 2XDDA 3LZJA 1NH3A 1ZC6A 5FD5A 3CC7T 4PJOF 2DK3A 4IUQA 4GNIA 2KW4A 1KEAA 2ZE2A 1B1BA 5J1EA 2DJNA 3Q9VA 4ZNXA 5C10A 4ILGB 3T3FA 1F43A 1WH5A 3VS2A 3ASOH 4HYEA 2FBVA 4KI6A 3CJCA 2VBWA 3IKVA 4OGEA 4LG3A 1D3BB 2VWKA 4ENNA 4E1JA 2MCNA 1H88C 4RTYA 5SWMA 3E01A 5KYYB 3TPQA 2O8CB 3ZMZA 5CKDA 5HVQC 2DO7A 2KZGA 3CCLN 2LZ6B 2IRFG 2CUFA 4M78F 3WTVC 4EMGA 4N0AC 2P9KB 3DU5A 4GGGA 5CLSA 3FBNB 3PIOA 2KRCA 2QSHX 3ZT1A 2GBYA 1YIJI 1PUEE 4JAXA 2VJJA 1BL3A 4CYCB 1YUWA 1KSPA 3ZMUA 1ZH5A 3J81E 2FRYA 3ZSQA 4B9QA 1XSDA 2A5YB 2ZMEB 5IXFA 3CCJA 5F04A 4B21A 4ENJA 3HKZN 1L5UA 4XR6A 3CXCM 2KL4A 2HAXA 4YOQA 2VODA 1YNZA 4GY5A 1Q7YC 3T7ZA 1KFZA 2QYOA 4GKJK 4MFEA 2JA8J 1X4OA 2ZPEB 3VESA 4RTTA 3F8NA 4CCJA 2O31A 4AM7A 3QBXA 1Y8QB 1QKXA 3QG1A 4KB0A 1OYXA 3LDNA 5GAN8 4BG9A 3CPWA 3CC2A 3RMBA 1V1CA 2NLUA 3EAEA 4AFZC 3L6QA 1RGIA 1D4XA 5J8FA 3FIWA 1ZN2A 1QBJA 2HEQA 3PT9A 1SV5A 4A54A 5AQZA 3O4NA 4MDWA 2W42A 1Q9YA 3UKGA 1M2OA 3JCMb 1TW2A 4L18B 5KGWA 1YYVA 2EJRA 3U23A 2YT6A 2ECCA 5KHDA 1FP2A 2HQ5A 4BH9A 1W9HA 3TGNA 2R0QC 1AOYA 4CGJA 2IS4A 2A6AA 4FZZA 1QWEA 5IT9E 3R1XA 2LCLA 3CMYA 2DA3A 3CUQB 1M4ZA 4CCHA 2OU2A 3QYEA 2NNYA 2DJZA 2FUG2 4U88A 3VQ5A 3ZMSA 3RR8A 3AT1B 3ZX2A 4A5BA 2NRXA 2FQ4A 2KIFA 3N0UA 1K8AR 5FLXO 4ZHRA 3L8BA 4B8XA 2O2OA 3MO8A 1JHFA 2AJQA 1VQPA 5AQJA 1S7AA 4G94A 5JVGF 3OIQA 4L5JA 1PHTA 2AO9A 1K8AO 3QSUA 1IUFA 1HYZA 1Y0NA 1ORPA 4XU3A 2FBTA 3BROA 3MEWA 1NM1A 5D5UB 1XWLA 1Q1HA 2MYSA 1FTZA 1O9SA 4Y7NJ 1AHDP 4J9DA 5K7ZA 5JLFA 1ZUKA 3PO2J 5CJ9A 1XN7A 3FHFA 4BG8A 4LFUA 1K6YA 2XY5A 2H27A 4FT2A 1Q86U 4OWRB 3BDDA 5FO5A 7AT1B 2EFQA 1UGRB 2ZQBA 3W6VA 3MWMA 2E1NA 3CDHA 2CP5A 4PZJA 4BE0A 3EUAA 4HSTA 3O8MA 4W5NA 1RAHB 1U0JA 2Y4YA 3OYDA 1OCZH 3CG7A 3U2RA 2FOWA 2NRWA 4BQQA 4M75B 2G7UA 3SXYA 4IWVA 3I5SA 3FMQA 2YHWA 3LFUA 1WX6A 2RN7A 4OIOF 2GA2A 4YIIA 2HVRA 1PUFB 2QWRA 1WGSA 1KU9A 5L3GA 3AVMA 2FSWA 2A08A 3TVTA 1AWOA 3SAFA 2H3EB 2DPPB 3DJCA 3SI6A 2P9SB 2A05A 4FXDA 5BMZA 1BN5A 1ON2A 4BYYA 3L42A 4EZ9A 4RG8A 2WONA 1JBMA 4LE9A 4N76A 3BQZA 5HNHA 4EJWA 2J6KA 1EH8A 4HA8A 1IG9A 3CC7Q 3NGYA 2RI3A 4PQUA 5FLMJ 1OH7A 3FZKA 2DOEA 1KVAA 4E89A 3V9UA 1JUMA 2PLYA 4IRGA 3SFZA 4EIKA 4FLUA 4ISFA 3LPTA 3OSFA 3RBBB 5GAMj 3K4BA 1IXDA 2RAEA 4ENKA 3H35A 4FISA 2DTZA 4B3OA 1TZLA 4PY5A 1NLOC 4CEDA 3PIPF 4F7UA 4IIMA 3V7SA 1RI9A 4DQ2A 4KBOA 1H0MA 1OYWA 2Y1IA 5FGMA 3JRBA 2HNYA 4DSIA 1YIJA 2WY8Q 3CCQN 3I56I 1GLDG 2KDOA 1LVKA 3CP2A 2EYYA 1RBVA 1ZBXA 4BRIA 5KYWB 2YUNA 4C8NA 4QPQA 2K3YA 1D9DA 3ZMDA 4CJWA 2L54A 3CBOA 4KAZA 2D2WA 1TGOA 1B72B 5KPZA 2JMAA 1XI1A 1V4TA 5DCMB 1FOYA 2FMLA 4XTZA 2K7LA 3C95A 1NK5A 4OIQF 1UMQA 1IN6A 4EFHA 1NGGA 5ICGA 3MN5A 3CTAA 4G9YA 3WTUC 1K4TA 3VQ6A 2W85A 3KWGA 1SC7A 3V6DA 1MU2A 1RLPC 4TSXA 2HU9A 2E2HJ 1BHLA 1D3BA 2G8KA 3RERA 3EUKL 3AO5A 2J05A 1ZXOA 4YELA 4EHTA 5KYYA 4DU1A 4HSBA 2O8CA 3PMTA 1MUNA 2E70A 4FWKA 4BEHB 3LSJA 3OYYA 1OH6A 3FK6A 1KONA 2F8SA 1UHFA 3LL3A 1IRFA 2D0PA 3ELKA 1NGCA 5IP9J 4OFAA 2UWMA 4C8OA 4QW2A 4E7SA 5E3LA 4ZYDA 4A4FA 4DR4K 2AT1B 3L0QA 5KE3A 1U3EM 3SYZA 2JM8A 4DQIA 1Q81R 3VKIA 1GFDA 2O9VA 4CYCA 3JTHA 2ED1A 4ELVA 3DRRA 3A1YA 4B1VA 3VUBA 1VQ7N 4PA1A 2MH9A 5GJWB 5EU7A 2ZMEA 3M0PA 2L0KA 3JTGA 4F7UG 3ZBDA 4FOEA 1Q81O 3IFRA 1TKZA 2VL8A 4LFCK 1VFCA 1TL3A 2KK4A 2XHKA 1VQ8I 2OPRA 2RHIA 4YIFA 3HO1A 5GAN6 5M5XJ 1YTYA 4PJOB 2K5CA 2QQBA 2L0AA 2VG7A 3EZ5A 4X9DA 2HSPA 2B5JA 1SFOJ 2BUDA 1XQPA 2EBIA 4HUFA 2DA9A 2LF7A 1BIBA 4MEYF 4JD2B 1IG8A 4QIWN 2FSJA 2OV7A 2L3PA 1X4PA 1A5XA 4M3FA 2HB5A 3OYFA 2FEIA 3IAS2 4WE1A 2MF2A 1VQLA 3BG6A 3ZQHA 1SL1A 1VQ9N 3ZN0A 1SFUA 1U5TB 2K2VA 4M78B 2E1YA 2YHXA 3Q0WA 3ROUA 3K2PA 1RDBA 3HDDA 3K7AJ 4XTYA 2RN8A 5KCHA 2FX0A 3CUQA 1IN7A 5AZJB 4F2RA 2CG4A 5HROA 2ZD1A 1MBGA 4M7DD 1NK0A 2R58A 3VS0A 2QA4I 4C2MJ 4M3EA 2DTIA 5H2FC 4MHGA 5LJ3g 2KPMA 3H9NA 3TAMA 2DK5A 3M4GA 3FMSA 1S22A 1OR7A 3O9SA 4PJ0C 2XC7A 1IO2A 5B5EC 5GAOl 4Y13A 3DOLA 3WGHA 4E4HA 4AHVA 1VQOT 3RVCA 3NE6A 2HZDA 3FBIB 1SAZA 1X43A 1MJ9A 4J6WA 1VSKA 3G71Q 1VQNI 3S14J 2GGRA 2VJ5A 3A5OC 5DK5A 3H1QA 2AA4A 3P38A 4BR7A 2NVTJ 4NHJA 1TV6A 1QNTA 3C6TA 3WVEB 3E6CC 4O0JA 1P4AA 3P4IA 3VQDA 2Z16A 1D5AA 2KQRA 3RMQA 3QJYA 2HNDA 2YS9A 3OSVA 1GXIE 1GBRA 1T39A 5C15A 2BV6A 2GF7A 2TRTA 1E7OA 5GADJ 4JKHA 2ZXWH 2DEUA 4DR2K 2MSYA 3OYLA 4M75A 4LUDA 2A40A 2BEOA 4CEOA 3BTIA 3MKZA 4CGIA 3U4LA 3CQTA 4YFXF 5FJ8J 1XHXA 1JT6A 3H5RA 1QVGS 2IBDA 5EOYA 4KTQA 1UGSB 2P9SA 3IHUA 2D0AA 3EDPA 3LH5A 1VQMA 1XNRK 3D5LA 3FZFA 1B07A 1BDGA 1GLAG 2IOCA 3PM1A 1YJWI 3RUXA 1SKSA 5M5YJ 3CCET 1W4SA 2HSTA 4QQDA 2TCTA 5AZIB 1BUPA 3AVHA 3K4JA 2IS1A 1HD3A 3QYBA 4L8RB 4KHQA 4FW2A 2HYGD 4BQZA 3G7ZA 5HP1A 3HHTB 4NOYA 4FK4A 3UNGC 1SHGA 3BT9A 2CUEA 3IL2A 1M27C 1WIEA 3OYCA 1VQ4N 1J7KA 1QVGP 1YW9A 1BIZA 4K2EA 1X19A 3ENHA 3L2WA 2CT3A 2KAFA 1UEBA 4E6RA 2Z1JA 1S1VA 3S1MJ 1EV7A 5KYWA 2ZCWA 2CSOA 5EF6A 2HKOA 1B72A 2DXUA 4PFPA 4CCKA 2PMZN 5DCMA 2QVOA 3PJRA 2EZKA 4A4KA 5DV5A 5GAMe 4ZC3A 1K9AA 1VQ8A 2FPFA 2VG5A 4BY6B 5GAMh 4MO5A 1MD0A 4M75G 3TTDA 2UUCK 2E5NA 3HTUA 4EHUA 2CW7A 1ZRFA 2PUKB 2Y90A 2E60A 4RTWA 4FPAA 5FW9A 3VWBA 3RJPA 3NHGA 4BEHA 4LH5A 2WTEA 4RBOA 2XPVA 1I5LA 3AAFA 3T8TA 3SZ2A 1M3BA 2VJ4A 4HUEA 4B9UA 1ZTRA 3CVSA 1JT0A 3NGZA 3FXOA 3L3VA 1ZREA 2JPBA 3B02A 3VYSB 5GANg 2MBFA 2C06A 4RDUA 2KRNA 3UA7A 2XGDA 3ZCOA 3TTCA 4H0YB 4CD3A 3DLLA 1LB2A 2DD4A 3V1QA 2KE9A 1FKPA 4CIFA 2L9VA 5SZTA 2G3RA 2XMFA 4DSJA 2K5IA 2RHYA 3W0LA 2SRCA 4AG2C 4QT7A 4NYFA 2UU9K 2DA5A 3UB5A 3V8JA 4JRIA 5CVVA 3FM5A 2ASPA 2BVMA 5KRSA 3E66A 2DXTA 1XGOA 2QA4A 3DYAA 3S9HA 3F5TA 5ADXH 2K3BA 4CJ3A 4PJOA 3ENOA 2ASOA 3QFUA 1EBMA 1K4US 2OCEA 4H0PA 4JD2A 4LFAK 1OMIA 5BN9A 5ERIA 2VPLA 4F7UE 1TUUA 3VYHB 4IO9L 4NCAA 3I55T 4ZTFA 1QCOA 1WJEA 1MUYA 3VEOA 2NUPA 1ZLKA 2D4WA 1TW3A 4XK8E 1VQNA 3OR2C 1EWQA 1TK8A 1JLFA 2X35A 4JI5K 3LDPA 1FSEA 4RTVA 2YHAA 4Z6YA 3TMOA 2CUBA 3VEXA 4EJOA 4PJLA 2E5ZA 4LF9K 1U5TA 1VQOQ 1IV6A 4M78A 4BRLA 2F8TA 1XGSA 2OTLT 4AUXA 4IBNA 3HUGB 4ISGA 4NBQA 1EF4A 1T6DA 3HOXJ 1DLOA 1WI7A 4IZ9A 3N05A 2WSCE 2P5LC 4KGZB 2L7MP 3KXTA 1GLBG 3TBIA 4MMLA 3OYKA 1KQSM 3CCSN 4AMCA 3MN6A 5AZJA 1BBZA 1H3ZA 1IRZA 2LVMA 5HRPA 2V1RA 1NNEA 3AL0C 4C8QF 3F2KA 1Y1WJ 1M90U 1KQJA 4QVDA 4B44A 4BL0B 2IA1A 4DSFA 5GANj 5M1PA 1JLAA 3VETA 5GAN7 1JXMA 5CZ2A 4PIIA 1A35A 2P9LB 1IRXA 1TTHB 3PO4A 5IYCJ 4L6V5 3VN5A 2L3QA 3JCMP 2ZFWA 2H8HA 4PJOG 2LRDA 4FHTA 2XHIA 3AVCA 1NG9A 3K2ZA 1Z26A 4PKCC 3GL1A 3ZL7C 2E7XA 1NM7A 2VXEA 1K9MR 2K9LA 4ANJA 1UFMA 1QSSA 1FOWA 2IS6A 2DPNA 1USSA 2PMHA 1JLCA 2ASMA 4EW4A 5C25A 5HLTA 2A69F 2QTDA 5EZHA 3A8HB 1N3AA 4ATOA 2E6MA 3VS1A 1K9MO 4IO9F 4A59A 4E7ZA 5EG0A 2R5ZB 2HHTA 3CCEQ 1IDYA 3GF2A 4WTOB 4JS4A 2WC9A 1HNVA 4OAYA 1N8RO 3HPHA 1OFCX 1DUXC 2ZSIB 3F8MA 5D7UA 1X1AA 4M78G 2LC4A 2FQ3A 3CC7I 3JCMe 3EGUA 3VYRB 3ZOBA 3V1RA 2NOHA 5FDLA 1HSJA 3JCMh 4FX4A 2OC6A 4M74A 1PNJA 4M9XA 5KAFC 4BS9A 5E3OA 1BIAA 1NGJA 4JI6K 3LWIA 1WQWA 4HW0A 4BACA 2G8FA 3AVIA 5H1SQ 1EXQA 4C8LA 1MGTA 1ZBLA 3G73A 4Z4IA 3AO4A 5A2QE 3X2QH 4ZN1A 4Q48A 3KK3A 5AZIA 4FSXA 3C6HA 2PFUA 3ZRGA 2MMPA 2O01E 1DT9A 2E2OA 2W10A 4QKUA 3CI5A 5HBMA 2LKXA 3EZWA 3META 4HT9A 3LALA 2OFIA 2QM3A 2A5XA 1Q82C 3M8EA 3PFYA 1AD5A 2P6TA 2AHJB 1LAWA 3AO3A 4M45A 3JCMV 3NQOA 1KQ8A 5D6EA 2OTJA 1QCFA 1W0TA 2JA5J 3SB2A 1A31A 3OH9A 2RM4A 1RTHA 4QQ6A 2KLAA 1MDMB 2DTOA 2QF7A 2DA6A 4LGWA 2YJEA 4F17A 5LY3A 5D5VB 4YOWA 2P7CB 2LH9A 3SEZA 3J7AY 3KKRA 1O7FA 1NKEA 3WTWC 3DB3A 3S93A 2VVKA 3V8KA 3AHUA 4KFBA 3QERA 4CJ7A 3BCAA 4HZFA 4X1EA 4M3YA 2RKIA 1UG1A 3HSEA 5DLOA 4XRMA 2RF0A 2UV1A 4UC4A 1KJWA 4LN2A 1O57A 1HU0A 5D5WB 3KZZA 2M8EA 2JJ7A 4FX0A 4C0DB 2X6NA 2LY2A 1Y6IA 1ON1A 3OL3A 1T0FC 2H1LA 2CQ7A 3CMET 4M75E 3JRCA 2OPSA 2FU4A 3ZSRA 3RMSA 1ENHA 3EKSA 2PYJA 4KUIA 1QP2A 2E5QA 4F4KA 3QU6A 4NZGA 1VRLA 3I55Q 3CC2N 1IUYA 1ZSZC 3ZYYX 4WFBL 4AVPA 4PL6A 3VTIA 1XPXA 3CFRA 4H03B 5FLVA 5HRRA 1F1ZA 4BI4A 2XICA 4UB6C 1HA8A 1KU7A 2EV5A 2V79A 3IC7A 5DS9A 3DKWA 5AQKA 3J7AF 1PM3A 4R8HA 2OTLQ 3DPUA 5CAIA 3F9KA 4R79A 1P8ZA 1T8EA 1YE9A 5TGTA 1QWFA 4CEZA 1RKTA 2PZSA 1UHCA 1QTMA 5C4XJ 4KYWA 1IW7F 4XIDA 5AQLA 3DWLA 3FR0A 2L9RA 1AU7A 5LJ5g 3H0FA 4PKIA 4MFDA 2CH4A 1OPCA 4AIDA 4CEBA 2ZC2A 1Y7XA 1HRHA 2X78A 2ZF5O 3QPLA 4HX8A 3C7JA 1VQPN 3VQ7A 4JZ4A 2KHMA 1W4MA 3HUGA 3EY1A 4CYDA 2OAZA 5DYMA 1DPRA 2E4HA 2NZTA 4G7HF 4H4MA 4AHSA 4CEEA 3G6EN 3G71I 3LDLA 2PX9A 1HQUA 3CC7A 1WI9A 3CXCA 2M1HA 1R7JA 1NOZA 3LAPA 1S9EA 3A01B 2M16A 4CHPA 1VNDA 4OPAA 2Z99A 3V9XA 2O3FA 3SDZA 2GXAA 4EM1A 3W3DA 1W7AA 1TTYA 3EE8A 1YWOA 2R7SA 2GLOA 2CZ7B 1P7MA 2X4WA 1KC8C 3HT3A 2YCHA 2P9LA 4MLEA 3CCVT 2H3JA 1APLC 3LMMA 4XKBA 1U06A 5LL6Z 3OS5A 4G6QA 4XAXB 1M1KC 1ETYA 4JK9A 2DT5A 3CPWS 3O5ZA 2DZ9A 2L9NA 5J2MA 3H41A 5I42A 2O8KA 4I6MB 2HHQA 2FC0A 2OBPA 1WXBA 1JGGA 2I0NA 2ZMEC 5GANe 2KXDA 5LJ3f 4MO7A 3BPXA 5GANh 2R5ZA 2PMUA 5F08A 4DNCA 4EP4A 1BISA 3R6SA 1KG5A 2V52B 4DV2K 1N78A 3WHCA 1P7IA 1YQMA 4DR7K 1LVAA 4PJOE 1D1BA 4KN4X 1JRIA 5LJ5j 1R8OB 3HM5A 3JXUA 1ZBSA 3VF6A 2Y0SA 2LBFB 5A0GA 2R7TA 3PFSA 3B8AX 4FWNA 4FJIA 4WQ4C 1D8KA 1U78A 5KN9A 1LUJB 2FB7A 2EJFA 1HW5A 2CH4W 3CPWP 1CQTA 1D5VA 4KRTA 5FD6A 2Z0WA 4MFBA 2LLKA 2K9SA 1T6CA 3H3UA 5EDNA 5J1YA 4V2SA 2H94A 3CJBA 1ZBIA 2L8DA 4G12A 3HRSA 1T44A 1YIJN 3MEDA 3L2ZA 1PVEA 3E2UA 1T3SA 4M78E 1R5ID 4RM3A 1KHIA 1PJRA 2W25A 2W82A 4ZJZA 1HCRA 3KZIC 3H3VK 1K0XA 4DG1A 2MAMA 1OI1A 4E2FB 3V4GA 4B9MA 2F48A 4DQSA 1XC9A 4A3DJ 1OULA 3GFIA 4DOVA 4OVAA 2CQXA 2ZNYA 2EGEA 4LLLA 3CUQC 1ZLMA 3CQXA 1KA8A 3M8RA 4XONA 4LFBK 1BO5O 3UT1A 1IREB 4JK1X 1ULYA 4BAYA 1Z3YA 5LJ3d 4FT8A 3BGRA 3AKZA 3A2FA 3SBGA 1VI0A 2GM4A 1VQ6A 3CWSA 4FZXC 3O6WA 1PU6A 1XG1A 3CMEQ 2KIQA 2KQ2A 2MG4A 2EHGA 1I6XA 2EBPA 1RC9A 3AVLA 5FPDA 1ABOA 2J7IA 2M7BA 4KO0A 1IV0A 4DA4A 3SQ1A 4QS8A 1AHJB 4A3GJ 3P9KA 1D1AA 2VQHA 1NKCA 2LJ0A 2JWTA 3KYCB 2XAFA 2E41A 3B73A 3A4CA 3DEUA 2K9MA 5JFRA 3SMPA 2E64A 5FLXZ 3HXMA 1WXTA 4XLPF 1TWGJ 4JI8K 4CICA 1E4GT 1YQLA 3A0HC 4PLIA 2IS2A 4BXXJ 4KIGA 2HHSA 4KN7X 2RQUA 2R3SA 1T56A 1WJBA 3SQNA 5J47A 3GTLJ 5FKMA 2XF7A 4H5TA 4M7AD 2KFZA 3UIQA 4LF8K 5F6FA 1K73R 4X0GA 5M1NA 4RGSA 3VS5A 3ZT4A 4Z94A 3CPEA 4PSXA 1YHQT 2DCEA 2LSNA 3KVGA 4PDKA 4JX4A 2D0BA 2X1DA 2JTFA 4XSZF 1K8AU 2ZGZA 4V19K 1VQLN 1RT1A 1XUPO 2DOAA 2O9LA 3E9PA 1BA5A 2CGHA 4FWOA 4KGXB 3K5MA 1K4SA 5C0YA 3QAHA 3NAEA 1VQOI 1ZBHA 4DW6A 3V9SA 2HEOA 1TKDA 4C2UA 3HL8A 1ATSA 5GANf 5AQOA 3HRMA