3OYFA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti l-870,810
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 109
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyfA03
2QXFA 1IKXA 4B9LA 1J54A 4C8NA 1J9AA 4BDZA 5KCOA 4B9VA 3O3GA 2KTQA 2HNDA 3HYFA 3RMCA 3S3NA 3TR8A 3AVFA 4KPYA 3NGIA 1NK9A 1JXEA 4KHNA 2ZE2A 2L3RA 4CJLA 1TAQA 1KFDA 5KGWA 4CHNA 3OB9A 3BGRA 4FLVA 3ZT2A 2K3XA 1I39A 2OZMA 5CY4A 4B9WA 4AHSA 1HPZA 4IKFA 2RJFA 1HQUA 3OYHA 3U3GA 1L3SA 4HTUA 5KH6A 4OKJA 2X78A 3CG7A 1RTJA 3SUPA 3HK2A 3AA2A 4CEDA 2O4XB 2AJQA 4Z4IA 2LRQA 1B9DA 4E7HA 3M8SA 1NKEA 3P5JA 3MEEA 2VWKA 1X9SA 2G8FA 4II1A 3B6PA 4EZ9A 2OPSA 4YFUA 4FLWA 3HT3A 1BISA 3NTIA 1TK5A 4WE1A 4DSEA 5J39A 4CGFA 4DF4A 2GBZA 2DAQA 2XK0A 1WN7A 3ZT1A 2WOMA 2P51A 4NS5A 3AA3A 3PFSA 1FKPA 3LP2A 4CGDA 2NLUA 1L3UA 3CEYA 3DRPA 3DLGA 2X6NA 3QESA 3O4QA 2GFAA 1HNVA 4FW2A 4DSIA 2YKMA 2ATQA 3QJ6A 4B9SA 3WNHA 3FLGA 3ISNC 1S9EA 1BQNA 1WGSA 4OLBA 2F5KA 3VQ9A 3PNWC 4JRQA 2KFNA 4XIUA 3B6OA 1D5AA 1C1AA 3MP1A 3ZT4A 3GOXA 5I3UA 2ITGA 4I9LA 1HYVA 2RI5A 4W5QA 1RILA 5C6SA 2MWPA 2DIQA 2B4JA 1U4BA 2RPIA 1TVRA 3NF9A 2D5RA 4DU4A 3OYJA 3V6DA 3S3OA 2A1SA 4CGGA 1TKZA 4DU1A 4FZYA 3TAGA 2RHUA 4MFBA 2D0CA 3MXJA 4AHCA 1N27A 4CFCA 3QBYA 1G5VA 5HRPA 3SQ0A 3ZCMA 3QNNA 4NCAA 1BIZA 3HM9A 2DFFA 2YRVA 3NFAA 1FXXA 4Q5WA 1JLCA 1UA0A 4CECA 3QKJA 4N41A 3LAMA 1KVAA 2F8SA 2EFIA 2GUIA 1S1XA 1RTDA 3AVNA 2FBTA 3HP9A 1RBTA 3LP1A 1HMVA 4OVAA 4CF1A 1WSGA 3OYCA 3QEWA 1G15A 4A4EA 1NK8A 4OKEA 2P5GA 2OZSA 3TAFA 1T05A 1LWCA 4DTPA 1JLAA 1TK8A 3H08A 3V9SA 2O4GA 4PL6A 1HQEA 1XNIA 3IG1A 5C0MA 3OYKA 5IN1A 1NK0A 4DQQA 1RBSA 1VRUA 3VQ5A 4ZTFA 1YT3A 4X34A 3OJUA 2QQRA 3CFOA 1LWFA 4TSXA 4AHRA 4KAZA 3K2PA 1NK6A 3ZSWA 3NF7A 3NBPA 4KFBA 1KCFA 5CZ2A 3KLGA 1EP4A 2JGUA 2D0AA 2YKNA 4PQUA 3ZSQA 3TAMA 4I2PA 4PA1A 1BGXT 1XWLA 1EKEA 3HPOA 3QEXA 1JLGA 4FLYA 3SCXA 4KTWA 3FEOA 1YTUA 2RF2A 4ELVA 3SUOA 4BDYA 3SNNA 4Z4GA 3LALA 3DB4A 1CLQA 4EZ6A 2LCCA 2B6AA 3AV9A 1NK4A 3TI0A 3C95A 1C6VA 5J26A 4ELTA 4CJKA 1BI4B 2D9TA 3HPHA 1ZBHA 4BE0A 1WSIA 2OPQA 4CEAA 3VQ6A 5J2NA 1UA1A 1TKXA 1OI1A 1BHLA 4OVLA 3F73A 1QE1A 4PLIA 3H6ZA 1NK7A 1WLJA 5EU7A 4FJMA 4J2DA 1TL3A 4LH4A 3JYTA 1RT4A 1BCMA 3H8ZA 4Z0UA 4FJXA 1CZ9A 3SPZA 4FU6A 2YHBA 2XO7A 3VA3A 3PX6A 3T19A 3AVJA 3AO2A 3SQ2A 3NAEA 1VSJA 3NCIA 3EY1A 2HHUA 4IDKA 4CF8A 3OVNA 2E6LA 1KTQA 3V1RA 1LAVA 4H4MA 2LDMA 2F96A 3AO3A 4CF2A 1DTQA 4J2AA 4FVMA 4E7IA 5HRRA 4M3YA 5DMRA 3AVLA 3DLBA 3DMJA 4DQPA 3VQEA 4DS5A 5HROA 4N56A 3LZIA 5CZ1A 3AVGA 3C94A 4FJNA 1TV6A 4UC4A 5FDLA 4E7KA 1KVCA 2I5JA 4CJFA 4FK0A 1JLQA 1T8EA 2E4LA 5KI6A 1JXBA 4E7JA 4PY5A 2ETJA 4DTRA 4E1NA 3EYZA 3I0RA 4O0IA 5CIUA 3O3HA 5J1EA 4Z02A 2RN2A 4DTOA 1QS4A 3L3UA 1U45A 3KD5E 3CFRA 4C5IA 4O44A 2RJDA 1QTMA 4AHTA 4GMJB 4QQDA 3NDKA 3SUNA 1ZBUA 2Y1IA 4B9TA 3SV3A 4N76A 2LSNA 4CHZA 1SUQA 4E1MA 3CFPA 2R58A 3ZSYA 3DYAA 1CZBA 4LD6A 4IUUA 3PX4A 4W5RA 4CHPA 2XHBA 1D9FA 3EAEA 2R5MA 4DTUA 1QQCA 4CEOA 5IAYA 3LP0A 2BANA 4KREA 4UQGA 3NTHA 1C1BA 2YNGA 1Z26A 3MP8A 4JS5A 2M0OA 2Z1JA 3M8RA 3MEWA 3MXIA 1UOCA 4IFVA 3SJJA 2XDPA 3MO8A 4C8MA 2QKBA 3MAQA 2JZ2A 4F3OA 4KRFA 3ME9A 3MEGA 1WSEA 4KTZA 3KJVA 3L2UA 4Y1CA 4HUGA 3RR7A 3K5MA 4I2QA 1W9HA 2DY4A 3HJFA 4B8AB 5J2QA 1REVA 4FJGA 4N5SA 3L2VA 2PYLA 1LW2A 2QQSA 5J2MA 2BIVA 5HP1A 2JLEA 4B9NA 3KIOA 4Z4CA 3THVA 4EDUA 3VN5A 1UAXA 2XY6A 3VQPA 1JLEA 4CJ5A 3ZSOA 1RDBA 1WSHA 1MHNA 1HRHA 4GW6A 4E3SA 4IFYA 4IG3A 3VQ4A 3ALYA 3HSTB 2F8TA 1W0HA 2E6NA 3LWMA 3QETA 3TAQA 4DQSA 3JSMA 3TAPA 3NH0A 3P1GA 4YNQA 2FBXA 1L3TA 4QQ6A 1CXQA 1HNIA 3SI6A 3DB3A 4F8RA 4E89A 1ZYQA 4CJEA 1HJRA 4DG1A 4IUPA 3ZEHA 4CE9A 3QEIA 1RNHA 2GV9A 1XC9A 3QIIA 2G8UA 4J2BA 4FLXA 2RHXA 2DTUA 3K5NA 1Y97A 1TGOA 4CJRA 3IAYA 3OYLA 4RW4A 1RDCA 4CK1A 4QOZB 2GF7A 4M3RA 3HO1A 3UIQA 4HVJA 4DFKA 3EZ5A 3KLIA 3OYMA 3NE6A 4CIEA 2FC0A 4B8CA 4F4KA 3RR8A 4OPKA 2D0BA 3HL8A 1KSPA 4CEBA 4CGIA 3K5LA 4DLGA 4H8KA 3KUFA 4F2SA 4KO0A 2HHTA 1NJWA 4CK2A 4HUFA 2P0KA 4FJJA 1SV5A 4J2EA 4AHVA 1GOAA 3ZSRA 4L8RB 4DFMA 3TAEA 4CGHA 2BE2A 3E01A 4A4GA 4M3WA 3NHGA 3OS2A 3NGYA 5D3GA 4Z4FA 1NOYA 3AVBA 2P5OA 1J53A 4KV8A 3V9WA 4CJ3A 4HCZA 3META 1X9WA 3K5OA 1B9FA 1S1TA 1S1VA 2XRIA 1YVUA 3DOKA 1WNSA 4CIGA 1S9GA 1UWBA 4B08A 3RWUA 2Q3SA 3SV4A 4DS4A 3LWLA 4O5BA 1ZBLA 1BQMA 2EQJA 2X4XA 4DTNA 1VRTA 1TK0A 1WSFA 3O8VA 3RRGA 4CCHA 4KB0A 4QW2A 4KB1A 3HXMA 2LTOA 2Y1JA 2BUDA 2PQWA 3ITHA 3IRXA 1LW0A 1U48A 4DU3A 4IUVA 3V4IA 1VSLA 1FKOA 4QQGA 4ICLA 3OMGA 2X35A 1ITGA 5M9OA 4NCBA 3AA4A 4KKOA 2L8DA 4A4HA 2X4WA 5FRMA 5DK5A 3RTVA 3L2QA 1JLBA 2E5QA 1KLNA 2IG0A 1RBVA 1DLOA 3NGZA 2JTFA 1ZBFA 1WJRA 1VSHA 1T03A 4L59A 1Z25A 3CM5A 4IG0A 1S6PA 1RDAA 3AA5X 1KHCA 3Q1JA 4QCLA 4W5NA 1SL1A 3MEUA 2M16A 5JS2A 4FJ9A 1WAJA 1KVBA 1RT6A 3D45A 3LP3A 4ID1A 4RW8A 1NKCA 4M3UA 4IBNA 3PO4A 4ZHRA 2Z1HA 2OA8A 4FJ7A 4HCCA 4DTSA 4I9QA 1X1PA 3SZ2A 1RT2A 1D8YA 1NKBA 1WJQA 3U6FA 2DFHA 3VQDA 1NJZA 3DLRA 4O55A 1IKVA 3QEVA 3F70A 4DSLA 3O3FA 4PLLA 3OA6A 2EQMA 1WAFA 4DSFA 1S6QA 3LANA 4OGEA 1C0MA 5KE3A 3MEAA 2XY8A 3K58A 3DLMA 1GOCA 2FHDA 4AHUA 3VQ7A 2BGGA 4OGCA 1RT7A 5D6XA 3SD4A 2YNFA 3LZJA 1YTAA 3QINA 4OKKA 1IH7A 3QERA 1X9MA 1A5XA 3HPGA 3TANA 1KRPA 1VSIA 2R57A 3AO5A 4FJKA 1NK5A 1WJSA 1TAUA 4HCBA 1VK0A 2IS3A 5KGXA 3KK1A 4CF9A 3E9GA 4CESA 2IDOA 2XY5A 4B3OA 5D6WA 3O4NA 1JL2A 4CJ4A 2O4XA 3PO5A 1Q9YA 4CJSA 5CYMA 2VG6A 3QO9A 2YNIA 4DQIA 4JRPA 3V81A 3D0PA 1SKSA 4FJ8A 3AVAA 3MEDA 4RG8A 1XI1A 3MXMA 4KTQA 3M8QA 4C5HA 2PZSA 4FJIA 4CJWA 4FK2A 4NZGA 3RRHA 1S1UA 4R5PA 3QIOA 2MWOA 3MECA 5K14A 1EXQA 3ULDA 4N4GA 5HLFA 3UWNA 4KHUA 2YNHA 1IG9A 4E0DA 1QSSA 3K57A 4FM1A 2ZD1A 1OZ3A 1U49A 4LH5A 2R7YA 1L5UA 1A5WA 4F3TA 3TABA 1JLFA 4B9UA 2KZMA 4BE2A 3OMCA 3AVCA 2RJCA 5E41A 1FK9A 5KTQA 2HVIA 4LY7A 3OYBA 4DTJA 4C5GA 4BD3A 3HVTA 1EETA 4CHQA 1KFSA 2HHVA 3MEVA 2HQXA 3K59A 2RKIA 2HHWA 3VQBA 3OYFA 2IC3A 3T3FA 4CHOA 3SQ1A 3V1OA 4K8ZA 4EP5A 4GY5A 4IURA 3NNQA 1O1WA 4A4FA 3KD1E 4CFBA 4CJVA 3P8DA 4CEEA 3PY8A 2RJEA 4BACA 1VSDA 4EP4A 1K6YA 4JLHA 1U04A 2IOCA 2CKKA 2G8VA 3CYMA 3LPTA 2DIGA 2PYJA 3VQCA 3QIPA 4DFJA 4AH9A 2DFEA 3PV8A 2OPRA 3L8BA 3ZSXA 1CXUA 3I0SA 3PUFA 3DLHA 5KE2A 5HBMA 2BDPA 3HP6A 1RDDA 1U47A 5SWMA 4C8KA 1DTTA 1IO2A 2RI3A 3S6WA 3KKSA 3RMAA 5FROA 1TKDA 2Z1GA 1RT5A 3U3YA 3SUQA 4DTXA 3DI6A 2KQ2A 3ASMA 2G8WA 4O4GA 3I8DA 3OYDA 1LWEA 1QHTA 4C5EA 3OYGA 4CJPA 4NCGA 3TWHA 2HMIA 4C8LA 1BCOA 4FZXC 4CFAA 3V1QA 4OJRA 4M3TA 2XY7A 3SYZA 3DLKA 4MQ3A 2G8HA 2P1JA 2L89A 3M9QA 4M45A 3A2FA 3KKRA 4M3XA 2HB5A 2FBYA 5KRSA 4DSJA 3OYIA 4BDPA 3LLRA 1H3ZA 3DOLA 4FLTA 5T7BA 4IUTA 4KI4A 3WNEA 3C6TA 2VWJA 1BIUA 3VA0A 5I42A 3LX7A 3OS1A 1RCHA 1MU2A 1I3AA 3LYIA 4FW1A 1NOZA 3S9HA 2EQKA 4AILC 2E6MA 4FM2A 1ASUA 4CFDA 3LGFA 4N47A 4DLEA 1N5YA 4FL6A 3NF8A 3F9KA 3E9FA 2IGIA 4E19A 3KK2A 2QK9A 3ZSZA 3PMTA 5KCHA 1BI4A 3IS9A 1J5OA 3ASKA 2KW4A 4FLZA 2RHYA 3RMBA 3V9UA 3DM2A 2HQEA 4M42A 3OQ5A 3PMIA 2RI2A 4FJHA 4ELUA 1IKYA 4IUQA 2O4IA 1HYSA 5KRTA 3ZT3A 1NJXA 4M41A 2K3YA 3WNFA 1OZ2A 1ASVA 4ID5A 3LGLA 4NYNA 4QAGA 1RBRA 1LV5A 4F2RA 4RW9A 4B9MA 3L42A 5J2PA 5C42A 3RMDA 3UT1A 3FDRA 4RW7A 4O0JA 4CF0A 1VSFA 3NH2A 3VQQA 1S5JA 3KLHA 2W42A 3NTKA 3M8PA 3AVHA 4CEQA 1ASWA 4CJTA 4ZTJA 1Q8IA 2BKDN 1TKTA 1JKHA 3BDLA 4CEFA 4CHYA 4FYDA 2HNZA 4PUOA 2KZZA 4RW6A 3TARA 4FM0A 1D9DA 1C0UA 3FFIA 3AO4A 4PWDA 4C8OA 4M3ZA 1L3VA 5HRSA 1SL0A 4FJLA 3WNGA 3L2WA 4DF8A 1JL1A 3OJSA 3PX0A 3LAKA 4OLAA 5SZTA 1QSLA 4QVZA 2HW3A 2LVMA 2OYQA 4N4IA 1QSYA 4FLUA 5CYQA 1C1CA 2VYTA 4H4OA 3AVIA 4Z4EA 3KLFA 4W5OA 4FK4A 2WACA 3DLEA 2B5JA 3SPYA 1BL3A 3DRSA 3S3MA 2X74A 4Q5VA 4CRIA 4FCYA 3OYEA 4DFPA 4DWIA 2RO0A 4DSKA 3QEPA 1R0AA 2EX3A 4E7LA 3CM6A 1HYZA 1WSJA 3L2RA 4KI6A 2HVHA 2EKOA 2RHIA 4Q0BA 4FZZA 4N4HA 1XHXA 3FC3A 2B8AA 2M1HA 3V9ZA 2GFUA 2HHXA 2KFZA 1SSFA 1RI0A 3AVKA 5HRNA 2G8KA 1LAWA 1Q9XA 4Y1DA 1SL2A 4KHYA 2Z1IA 4CJUA 1T7PA 1N6QA 2EQUA 2FBVA 4RG2A 4JS4A 4CIFA 4HHTA 2HHQA 1RT3A 5D6YA 1A5VA 1S1WA 3P8HA 4CGJA 3DRRA 3C4SA 4GVMA 4W5TA 5JS1A 2ZQBA 2PY5A 3LPUA 2YHAA 3VQ8A 2EHGA 1C0TA 1KLMA 2G8IA 4BWMA 4KHWA 4LD0A 2RHZA 3P83D 2OPPA 4Z4HA 3BDPA 3VQAA 1XHZA 2NUBA 4HUEA 2QKKA 1ZBIA 4KHSA 1SKRA 1RTHA 3KLEA 5FRNA 1GOBA 4DMNA 4FXDA 3QLHA 4LSLA 3CQ8A 3ZT0A 1OYXA 1VSEA 4FJ5A 1SKWA 2YV0X 3AO1A 4G1QA 4NYFA 2WONA 1RBUA 3OYAA 1NJYA 1F21A 4I7FA 3LDSA 1TL1A 3KK3A 3SQ4A 2IAJA 3NH1A 1B92A 2X6SA 3AVMA 4KHQA 2VG7A 1EX4A 3ZSVA 4BWJA 4CK3A 4CJQA 4DTMA 1IKWA 3OY9A 3NF6A 1VSMA 1VSKA 4LSNA 3QNOA 2R5AA 3V9XA 3OS0A 3KTQA 2X4YA 1RTIA 3HVRA 4CEZA 4OPJA 1RT1A 5C24A 3G10A 2G3RA 3L3VA 2HHSA 3G0ZA 3OYNA 4K8XA 3T1AA 2A1RA 2HNYA 3C6UA 4CERA 4DQRA 4BE1A 2VG5A 3MP6A 3LH0A 5C25A 4B9XA
chains in the Genus database with same CATH superfamily
4BRCA 1W36C 4I6ZA 2R5ZB 4D8KA 3ZXSA 4B9LA 3FZFA 1LDJA 1BN5A 1XNRK 2XIDA 3DXKB 4FT8A 1VQPT 3E6BA 1ENHA 2A28A 3HSCA 4K41A 1WBDA 4AFZC 2HNDA 3VB2A 4X6AJ 2YPRA 2HVQA 3CCRI 1K61A 3AVFA 3NGIA 5JLXA 2QA4T 4BRIA 4M7AD 1WEGA 3GZ6A 5KGWA 2KPMA 1EF4A 3OBWA 1AU7A 3BGRA 4E7ZA 1WXUA 4FLVA 1I39A 4GXOA 4BGBA 1VQKN 2ZJQF 1AVZC 4F92B 2WY8Q 2J6FA 2M4KA 4AHSA 4IKFA 3HRMA 3OYHA 1MSFC 1L3SA 2AKKA 1OH5A 4HTUA 2YU3A 5KH6A 2NUTA 2R7FA 2JMAA 5I22A 1B8IB 5FJ8J 5K1YA 2O8DB 3DP7A 4HLYA 2LC4A 3R6NA 2DNUA 3W6KB 3JSOA 1WNLA 3I56N 4HF2A 4J9GA 2O4XB 2MD0A 1VA7A 4C0DB 4XKCA 3N4MA 3FZMA 1M9SA 5BPIA 3EG1A 2OPTA 1YIJQ 3PFIA 4M74A 3R2XC 1NKEA 4X1VA 2R7XA 5BMZA 4LIVA 3CCSQ 1U2VA 2DA5A 4II1A 4YFUA 4FLWA 1A5JA 3C2HA 3EG9B 3CMAQ 3M0SA 4WE1A 3AGRA 4XR6A 4IOCF 4ENJA 2E5ZA 4DSEA 4J9HA 5J39A 3EUKL 2XF7A 4DF4A 4YY3K 4MDAA 2GBZA 2DAQA 2X3WD 2DA4A 2JN6A 4BR9A 3QP5A 5M3FJ 1WN7A 2MH9A 3MFKA 2C0IA 3ZT1A 2L9SA 1TUUA 4EA5A 1HQCA 2P5VA 4KH5A 3PFSA 4ZYEA 2NUZA 1NEGA 3CCMN 3PIPF 2DL3A 3BT9A 3VF2A 1ETOA 3CEYA 4MHGA 3O4QA 1RZ4A 2ROTA 2D1KA 4NQWA 1SFKA 3VWBA 2HQ5A 4C0ZA 3LMMA 1E6GA 3FLGA 1OR7A 4BEHA 1XGSA 3KP4A 1UG0A 1N3CA 1K83J 2CH5A 2JJ7A 1SD5A 5DUKA 3EPZA 4C92G 3FK7A 4LLNA 4BVOA 4OLBA 3MKWB 3PNWC 4D9JA 4AM6A 3H0HA 4L0YB 2KFNA 4XIUA 2FVUA 1C1AA 3ZT4A 3GOXA 1XC3A 3F5TA 1BU1A 2D45A 3W6JB 3V8KA 1SVLA 3JCMd 5DY9A 2P7VB 3A1YA 1YJWI 2XASA 1J9IA 3NF9A 2IVMA 4WFNL 1HF0A 2NVTJ 3CCLI 1W0TA 6AT1B 1O3QA 4K25A 1GFDA 3BG6A 4AHCA 3IRQA 3U23A 4CFCA 5HRPA 2PJRA 3TBIA 4NCAA 5DPKA 2ZBKA 4XLPF 4KN4X 2VXFA 2VIXA 2EGEA 1N8RC 1X6GA 2R7VA 5CVUA 1K8KA 4U67L 1JLCA 4EW0A 1Y64A 2NUTB 2JA6J 1KVAA 4ISFA 4P1WA 2EFIA 1PU7A 2GUIA 1N39A 3A8OB 4Y0WA 2HKNA 5KN8A 4BY9C 3G1LA 2VT3A 1RBTA 3LP1A 2K9LA 4OVAA 3CXCS 2ZNZA 3RESA 4C8QC 4DOVA 1V4TA 2A6AA 2L7ZA 1L0OC 2ZFWA 4BQQA 5DTDA 2H3EB 1U2VB 2P4RA 3Q3SA 2KROA 1D0YA 1WH5A 2DT5A 4HAMA 4DTPA 1X3UA 1TK8A 1JJ2M 3K4BA 1YIOA 1GXQA 3O5ZA 1HLVA 3VODA 4L5IA 3HTVA 5LL6Z 1JHHA 1HQEA 1H641 3EUHA 4FT4A 1SRLA 1K8AO 4E47A 3OYKA 2E1NA 3WTTC 1NBWA 1VRUA 1P4WA 1YT3A 1MGQA 2XG8D 1O3TA 1XN7A 4B8XA 3M0UA 1WA7A 3VS4A 3CFOA 3SDGA 4AHRA 2RF0A 4MLOA 3K2PA 3JCMc 3NBPA 2V9VA 4KFBA 2X85A 1S72A 4NQWB 5CZ2A 2DYRH 3ZETA 5ILVA 1RAEB 1K73O 4LUEA 4BRQA 2D0AA 3S1RJ 3TAMA 1NGGA 1K9MO 1S72Q 3BROA 3A98A 2VXDA 1ZRDA 4HVWA 3A1PA 1I27A 1Z67A 2EBPA 1OH7A 1YTUA 1ITYA 1T33A 1PM3A 3SUOA 4BDYA 2OTLT 4KUMA 3SNNA 2DBBA 4AIKA 2YUNA 3LALA 3RNJA 4I0BA 4A3JJ 2GWKA 4C2UA 5CYVA 2BYVE 1K78A 5C3EJ 1LWWA 5KPTA 4H5WA 2BE5F 1C6VA 4ELTA 1WEFA 3L6QA 3RKYA 2ECZA 4WF2A 2NZTA 2OA4A 4DK9A 4EHUA 3HPHA 1MBFA 3H0GJ 4IDHA 2JWTA 1ZA1B 2NVQJ 4BE0A 1ABQA 3KFVA 3V7RA 2E36A 3CDIA 1U8RA 1YXQA 3VQ6A 2LP0A 3FBNB 4B1RA 3OTOK 3DKMA 4PKHA 3ATUA 4OVLA 1PJRA 2P9PA 4GO1A 3F73A 2W7NA 1LPQA 3O1BA 3WGIA 1NK7A 1MNEA 1WLJA 1ORPA 3J7ZO 4FJMA 2I0NA 5GAEP 2QZ8A 3B6AA 1NJIU 3P4IA 4BYYA 3EHRA 4NL2A 2VLAA 4FU6A 3VA3A 3GEZA 3AVJA 1Y1WJ 4M9XA 1A35A 1HNXK 3A5LC 4YOXA 1JJ8C 4ZYAA 2MFZA 5LL6S 3EY1A 4BG8A 5IY5H 4IDKA 3GFMA 4GLKA 4FSSA 5GINA 5FKMA 4H4MA 1STZA 4YG2F 5BS6A 4KH0B 2R7OA 4GDFA 5ELZA 1AWXA 2IS1A 3U1DA 4J2AA 4GKJK 2NRWA 1DP3A 1K0SA 5CKHA 3QBWA 4RB0A 4K42A 3GWZA 5JFRA 3KZIC 2EK5A 3PNTA 4XRSG 3OL4A 4MLEA 1VQNI 2LFBA 1IF1A 2WADA 4KT0E 5HODA 2Y69H 4H5NA 5HROA 2ASMA 2QI2A 3FWEA 2MD5A 3LZIA 4IHXA 4J9EA 1O4XA 1KQSA 1X2KA 1KO9A 4G9YA 5FPMA 2NUPA 5M5XJ 2H1KA 1K8AR 3FMSA 2XIGA 2ME6A 3Q7CA 3PGGA 3WGHA 1P7JA 4CJFA 3SQNA 2GGRA 2K86A 3CD6I 1W4MA 5AR0A 2DPNA 3WE2A 3KETA 1LDDA 2ETJA 4DTRA 3I0RA 4GV3A 1KG4A 1K73R 4G94A 4BBRJ 3BG3A 2CZ6B 1YHQT 2YG8A 5AFUA 4HV5A 4C92E 2IS2A 1WFXA 2V9KA 5FPNA 2LK2A 3L3UA 3DBRB 3F6VA 3CFRA 2HDCA 5A2QE 2FBHA 1ZG3A 1QTMA 3MZHA 4AHTA 3RZOJ 4H0EA 1PP8F 2V75A 3Q9VA 2BZXA 3VEWA 3SV3A 4JI5K 4UVBA 3EDPA 2GWRA 4ILGB 3FJ5A 1TZLA 4LD6A 3PX4A 1RI9A 4W5RA 3VESA 3I55A 3ZMZA 1AKHA 1CF7B 1SFXA 2R5MA 1VQMI 2GQQA 3TDUC 1V54H 3PJRA 3FIFA 3I55Q 3LP0A 1FIPA 3EL2A 5LD2C 1VQ5N 5L3BA 4EAHD 1U06A 2M0OA 4XTXA 2Z1JA 4M63C 1PUEE 2KRCA 1KQ8A 1WSUA 4IFVA 2RN8A 1D3BA 3SJJA 4J9IA 5IPAA 4XLCA 1WCMJ 3VV0A 2DJNA 5IT9Z 3UA7A 4F16A 1WKMA 2NXNB 1GLFO 3ME9A 3ULEA 2M8GX 3GTKJ 1ZHIA 2EPDA 4HOBA 2K7AA 2XICA 3DXMB 3KJVA 2LC2A 4Y1CA 2JA7J 4KGXB 2HKOA 4YDUC 4J5YA 4HUGA 4C92C 2L7FP 5E3NA 4B47A 1Q86U 1Y1VJ 1VQ6I 3HJFA 3JB9G 2RC4A 2VQEK 2O6GE 2HKQB 2COWA 3FXJA 2PYLA 2WAQN 2IS6A 2QQSA 4JKCA 2D8HA 2F4OB 4DR6K 2DCEA 1NGIA 1I8FA 3LSRA 4CHUA 3SAGA 5IT9K 2R7ZJ 2IRFG 4IIMA 3HHTB 1EIFA 2YU9J 2NUPB 5EG0A 1JUSA 1FW6A 1MNDA 4M75A 3THVA 3VS7A 3DLAA 4B43A 2IAIA 4J6WA 2XROA 1PRMC 1UAXA 1JCFA 2ZGYA 3S15J 2HSTA 4XTUA 2DYBA 2GOMA 1XMXA 1YITT 3HSTB 3RMSA 4ZYGA 1C0WA 2K9GA 3QMLA 3I0XA 2CWEA 5E17F 3LAJA 1ETWA 2MC4A 3BR3A 1BIBA 2PVDB 1ATSA 3NH0A 4RBOA 1VAZA 3CC7I 2BXYA 5GAMe 1UHCA 3SI6A 5LRRA 4MDWA 3QYEA 3M1EA 2BY2A 1X6OA 4M7DD 4PJMA 4LB6B 3ZEUA 4XH5A 4BRHA 1KYZA 4BHPA 3GIBA 2FMLA 5D4RA 3AAFA 3ZEHA 4CE9A 4RDUA 3UDCA 4NUBA 2VOPA 3QIIA 1H89C 2G8UA 1H92A 3JRAA 1IXRC 1LCUA 1SS6A 3CC4T 1AKHB 1VQ9A 1Y97A 3OYLA 2VC1A 3E1SA 5M1QA 3TMOA 4RTYA 3HBLA 4IHTA 2ZGWA 1VQ9Q 3EZ5A 3NE6A 3RSEB 3CCRA 3RR8A 4OPKA 1OU8A 2DOAA 2O03A 2YXYA 1D3BB 4OINF 4JX6A 4CEBA 1GCQC 1LEBA 1SAXA 3CCRQ 1V76A 3VYHB 2F5TX 1J3TA 4KO0A 1Q82C 1NJWA 3ULEB 1WPYA 4HUFA 1BK2A 1KQSS 2P0KA 2KZGA 4FJJA 3CCVN 4ILJA 3NMUA 4BRDA 4AHVA 3DBLB 3HDDA 3TCJA 1GOAA 2CUFA 3A02A 5EDNA 2HEQA 1OLTA 2LCLA 2BE2A 2UXBK 2CO5A 3E01A 4A4GA 1D1CA 4M3WA 1WGXA 3LCNA 4QKUA 1A6IA 1LVAA 3G2BA 3I3LA 4RCHA 4RMNA 4AYBN 3C12A 3BTCA 3A2KA 1QVGP 2SRCA 1W5SA 1GBRA 4KV8A 4C0FA 2NOEA 4E70A 4DKWA 3DOKA 4C92B 2L0KA 3PM1A 2DRMA 2HYFA 3F8CA 4MTDA 2K9SA 2GTOA 2JA8J 4YOYA 1WBBA 1YRNB 4H5VA 2LBFA 2EKHA 3LDNA 3ZQCA 3J7AO 3MHXA 4J9DA 2Q3SA 4X0GA 1BOAA 4DS4A 3FISA 2WC9A 1TT0A 3M9AA 1ZBLA 1UB9A 2JS2A 1BQMA 5FU7C 5LBQA 3O8VA 3BPXA 1HW2A 9ATCB 1T39A 2BUDA 2UYTA 2PQWA 4DBHA 2FZKB 2I5UA 3IRXA 1LW0A 2DKGA 2V1XA 2GXGA 2W10A 3SZGA 3EGDA 4LK1F 2YLCA 4ICLA 1WI3A 2IGOA 4E9FA 3IKTA 5F27A 2YHYA 4KKOA 3NFCA 1TQMA 1GXIE 1V4RA 3FX3A 1QVFA 3P9IA 2WBNA 3RTVA 3L2QA 1Y7XA 4XH4A 3BR1A 3K4KA 2OF7A 3M8FA 1DLOA 4M7XA 2VQGA 4X65K 1ZBFA 3B6CA 5HL7L 3K2ZA 3N5NX 4HVVA 2XPWA 3VENA 4L59A 1Z25A 2DODA 1M1FA 2QA4N 4FVUA 2HMAA 1RKWA 3CCLA 1YJWQ 4PJLA 2K3PA 4YIRX 2D5VA 4XN0A 2ASOA 4W5NA 2QWOA 1YJ9T 1S3XA 1SL1A 2UXXA 3CCLQ 4FJ9A 4II3A 5GAHJ 5KHDA 1S9HA 1RT6A 4G7OF 5HS9A 1XMQK 1W7AA 3LP3A 4ID1A 3G4SQ 2PVGB 1PG5B 3TTDA 5KVRA 4OF1A 3WXIA 3QG1A 1R6RA 4BJ6C 3VF4A 4MLHA 4I9QA 1VHXA 2E71A 1X1PA 3SZ2A 3JSPA 1MIJA 4XQ3A 3U6FA 2DFHA 3QB0A 3T0YA 1QQIA 1NJZA 2EAYA 4KIFA 2DL8A 4YOTA 3WHBA 3J81O 3MD2A 1IV0A 1XCVA 5GAOn 3IL2A 2KJBA 4NC8A 3I9V2 2BY1A 4M3DA 5HKCA 5CKFA 3CJNA 1WAFA 8AT1B 1UJ8A 4KA4A 2NRZA 3QFUA 3TSWA 1BKBA 3QZ9B 4WTOB 1VQ8T 4B1UB 2P0PA 4Y13A 2NOFA 1S7EA 3MPUB 2ZPBB 5GAN3 2LNHB 3QINA 4XICA 3RPQA 3JAMO 3MN5A 3QERA 1A5XA 3TANA 1KRPA 1VSIA 3ONQA 2LBFB 4J19A 1R59O 3I56I 4JK7A 3MN9A 2A5YB 3REOA 2IS3A 4CESA 2M30A 4CGZA 4M78E 5D6WA 1YG2A 2W40A 3WG7H 5JLHA 3TTCA 1JL2A 5HLIA 3H1QA 2F5FA 3TW7A 5J3BA 2VG6A 4DQIA 4JRPA 1NGBA 1Z7UA 1TUCA 3D0PA 3NARA 3KBGA 3AVAA 2ZGZA 1SKUB 5HLHA 4CZCA 1XI1A 2HKXA 5M1OA 3AT1B 2QSGX 2M0CA 5H2FC 2L9NA 2LJ3A 1D5VA 2PFUA 2TCTA 4NZGA 5FU7B 3RRHA 1JGGA 4FO0A 4ISEA 1J5EK 3M59A 2LSOA 4R5PA 3QIOA 3C6HA 1ZA2B 4QTRA 1RLPC 1EXQA 3ZMDA 3CCMI 3ULDA 3CCJT 2AZSA 1RAFB 2HCKA 2YNHA 3WVDB 4E0DA 5DM7L 1GFCA 1NGFA 3K57A 2GIVA 3R6OA 3VTIA 4OMNA 4LH5A 3CXCM 3MN6A 4IPAA 2R7QA 4OFEA 3PE0A 2B86A 1LB2A 5KQDA 3RVCA 1JLFA 2KZMA 3TL4X 2X9DA 3AVCA 2HSEB 1H0MA 4LY7A 1VQ7I 4IHSA 3K2AA 2ATCB 3FZLA 3HVTA 4CHQA 3QOEA 2K02A 5TJJA 2HHVA 3G1MA 3VGKA 2HQXA 1J5YA 2L01A 3PQKA 5J1YA 4TV7A 2LQNA 2IC3A 3VGLA 1VIFA 1ZKGA 3BZCA 4LFAK 4IURA 4BY6C 4LF8K 4RAZA 5C2DA 1NMDA 4LJZF 3U2RA 3KYDB 1T6CA 4FYXB 1YNZA 1VSDA 1I5ZA 1JB0E 5KYYA 4F7ZA 4CZIA 2IOCA 4BNCA 2CKKA 4I7HA 5KAIC 2A3SA 4ZYHA 1ZX6A 3D2EB 3TU4K 1D4XA 4M78A 1Y07A 5GIPA 1RGIA 4AH9A 1K9AA 2A40A 1JI8A 3ZSXA 1JKRC 1CXUA 1FJGK 3PUFA 1RUWA 5HBMA 2BDPA 3VYSB 2HBPA 1YF5L 1WI7A 1PUFA 4EMHA 3EKUA 5AQYA 2RM4A 3UNGC 3LM9A 3A01A 2ZNYA 1VQNQ 1QVFS 1PVSA 2RI3A 3CF2A 3S6WA 3CMET 3AHUA 4BB7A 1RT5A 1MBKA 3JW4A 3THKA 3SUQA 2EW3A 3DI6A 3BTJA 5JMVA 3QP6A 1G3WA 1P8ZA 4MTEA 4OO1J 3OYDA 1WQ2A 4EEFG 1LWEA 3CD6A 1QHTA 4BR5A 2X6WA 4HG2A 2HMIA 1B6AA 2KRMA 1X9JA 4CFAA 3CD6Q 4HZFA 2AQEA 2ZC2A 3WT0A 2NNNA 3FHNA 3P31A 4BUGA 2A6TA 1VOMA 5FLVA 5HOOA 4MQ3A 3KP6A 3H6EA 4KULA 5KNLA 2P9LA 3J80E 2QAZA 4M73A 1QMCA 5TRDA 2FBYA 1M3AA 2IP2A 4OB1B 3MN2A 2DL5A 2VWJA 2NRHA 3R60A 1REPC 2DPDA 1VQMA 5I42A 1B34A 5CJ9A 2IGNA 1YCYA 3ZQFA 3QU3A 1RCHA 2EFWA 3SHFA 1TW3A 1I3AA 1X75C 3LYIA 1TW2A 1VQMQ 1BU6O 3FB9A 4HX4A 2CFXA 1E3PA 3JREA 3K4CA 3GDQA 4WK8F 2ZAEA 3LGFA 4FL6A 4HF0A 3NF8A 2NRAC 4AFQC 2GZWA 5B66C 4LF7K 1X2NA 1I0CA 3HFNA 3D6RA 1FYLA 4W1UA 4E19A 1T08B 1QQNA 5F0FA 4X62K 3PMTA 2VYPA 3ER0A 3M6GA 1YFNA 3ASKA 5KYYB 3L2CA 2LH9A 3QXEB 1Z77A 1WJBA 3CJBA 1M2VB 2CW0F 4XIDA 1YP5A 4XL9A 2CGPA 2ID3A 3CLQA 4RAYA 4M78B 1TWAJ 4BY6B 2HQEA 3N0UA 2P6SA 1OH8A 3OQ5A 1IN7A 3PMIA 1VQ6A 2O2OA 3H5RA 4WF9L 4IUQA 1YJNT 5KRTA 1GL5A 2KIMA 1YW7A 3ZT3A 2Q0UA 3SMPA 4JAXA 1VQ6Q 3IC7A 1T44A 1C6VX 1HUXA 1PUFB 1OZ2A 1YW8A 4ID5A 2EJRA 2EINH 2CQKA 5HNFA 4ENNA 4Q48A 2D0NA 2CH4W 1ZREA 1HCRA 3L42A 1DU0A 3RMDA 2DX1A 3UT1A 2W82A 1UG2A 2F9TA 1YI2I 1QW1A 3EZWA 1OQYA 4O0JA 3I54A 4HVUA 4WYBA 1U8BA 1EJ9A 4CBWA 3GP8A 3KLHA 4KRTA 1YHQN 2F5EA 4FQGA 1KEAA 2X1DA 3O8GA 3M5AA 1SPKA 3UE5A 4OB2B 3BFMA 1KZHA 1FN7A 1C0GA 3U8XA 4WQ5A 4LLLA 4ZTJA 1TL8A 1Q8IA 2BKDN 4CEFA 2QG9B 2LJ0A 2P9LB 4PUOA 2QQ9A 2DETA 3CC7Q 2M0MA 1C0UA 2IXSA 2CW7A 1SG5A 4KHPK 3AO4A 4OPHA 3A5MC 3EGXB 3D0SA 3ZQQA 2VGMA 3O6WA 3F8NA 1XQHA 1KG5A 5CHIA 4FWRA 1KC8R 1QSLA 1FZPB 1SSHA 4JI7K 2XAHA 2GEMA 5F04A 4GYGA 2LVMA 3QBXA 3VETA 4N4IA 1USSA 5ICEA 1AWWA 1NG9A 1B7TA 2NYXA 4XSZF 2K2VA 3REBB 2PX9A 4EJOA 4A69C 4EV0A 3K9TA 1E3HA 5AQQA 4H4OA 2E1HA 5EX5A 1EA3A 2F5VA 4W5OA 1YQMA 5J40A 2KIFA 1R9TJ 2JWKA 5GMKl 2PUOB 4XORA 3DLEA 4LD5A 3WTXC 4S04A 2DZ9A 1XPXA 1BJAA 3E9LA 3OYEA 1FMVA 3VPRA 3CETA 1PD1A 2PQ8A 1VQ5I 2AP1A 4IJNA 2EX3A 4E7LA 3CM6A 1HYZA 2YG9A 4DR2K 4FZZA 1N8RU 4N4HA 2OTJN 2LG4A 4PSXA 3FC3A 2DL4A 2M1HA 2JA5J 3ABLH 3DFGA 1ZYRF 4D7NA 2DT7B 1VIEA 1XMAA 2FE3A 5HRNA 2G8KA 1Q86O 4EMSA 3GE1A 1W7PA 3RBBB 4GV9A 1LAWA 5FLMJ 4BGAA 4R8HA 2NOBA 2CZ1B 2Z1IA 1T7PA 4N0AA 2CJJA 4CCOA 4G6DA 1UHFA 4AIDA 2OAUA 2KI7A 1LJOA 4HHTA 5D6YA 4KBMB 1TNSA 1YITN 1UFFA 3DJCA 3P8HA 4BI4A 4CGJA 2MLGA 1WH7A 5JS1A 2Q1NA 3LPUA 1ZXOA 1BR4A 4BRLA 1XC5A 2X48A 2IGMA 2JPBA 4WXDA 3JCMV 1JJ6C 3QFPA 3GX4X 2V4JC 4KHWA 2DTIA 2RHZA 4X9DA 1M2OA 4CI6A 4J9FA 2FU4A 1UGSB 4Z4HA 3BDPA 5IYDJ 1S1NA 2IS4A 2QKKA 1APLC 1Z21A 2L02A 1ERDA 3IH3A 4KHSA 1QO0D 2CH0A 5AZIB 1QCFA 3KLEA 5FRNA 1GOBA 4A2BA 4E1JA 2VWFA 4LSLA 4R79A 3GTQJ 3ZT0A 4CDGA 1OYXA 4JK1X 5I2SA 1NMNA 2PMUA 3AO1A 4G1QA 2V8IA 3CC4N 2WONA 3S1QJ 4Q5SF 3NRVA 3X2QH 1SD4A 2LKXA 4O3MA 5FKKA 1IBLK 1AD5A 4FE4A 2E35A 3TKYA 4HV6A 1LDKB 4EVIA 3AVMA 1MMAA 5E1XA 1EX4A 2A69F 2VJ4A 3G0QA 3NF6A 1MMSA 4LSNA 3QNOA 2R5AA 3V9XA 1P9QC 3BOQA 4CZHA 3FZVA 1RTIA 2ZZDA 3I8BA 3EG3A 1RAGB 2A5XA 1JU5C 1QKXA 1OVYA 4CEZA 5C24A 2NOZA 2G3RA 2N8GA 4B1VA 2FXUA 2HSPA 3DPTA 1JXOA 2W00A 4DYQA 5FU6C 1QVGA 1UFMA 1MWKA 3C6UA 3GG4A 3V8LA 3V42A 1U6ZA 3HSEA 3NPFA 1S72T 2HOAA 5LMUK 4EMKC 4M71A 1MD0A 2ICWG 5FPEA 4IEJA 1TC3C 4FX0A 2LY1A 1I5OB 1Q81O 3M8JA 1J9AA 4BDZA 5KCOA 4OMPA 4YPRA 4IRGA 5FWBA 2AHQA 1UGQB 3OW2P 3I4PA 1NGJA 2MPXC 5AQTA 2YJFA 4Y33A 1JXEA 3DLLF 2ZE2A 1VQKQ 4CJLA 1KFDA 2QBYA 1P92A 2DF6A 2QYZA 2LQWA 2HMPA 4U88A 2P9SB 3E9PA 1Z05A 2KDOA 4OIQF 1HNWK 5AQOA 4E9GA 4CW7B 3I56A 2KR3A 1TLHB 5GIOA 1IRFA 5EZGA 4GNIA 1R5HA 4C92D 4HSTA 1RETA 1RNLA 4IWVA 2UUBK 2EZLA 3I56Q 4M7AA 2DEQA 3ELKA 1Y56A 5K7ZA 3HK2A 3AA2A 2EFQA 1UMQA 3I0TA 5GTIC 4RM2A 3G71A 5K5QA 2WV1A 1OMIA 4CD3A 4E7HA 4RWTA 3P5JA 2L9RA 3DEUA 4WCIA 2E3HA 3T7ZA 3MEEA 1X9SA 2G8FA 4IZZA 3H3ZA 2V26A 3B6PA 4EZ9A 3J81Z 2Y75A 2OPSA 3HT3A 1D3YA 1S29A 3BR6A 4A3KJ 2OTLA 3CCMA 4MFDA 2EWNA 1MMGA 4CGFA 1BBZA 1FYKA 2EWSA 1O13A 3MQ0A 3CCMQ 3DWLE 4XOTA 3F72A 4BUPA 2P7CB 4PHTX 4CGDA 3DRPA 2AXLA 3QESA 1YJ9N 1HNVA 3MWPA 5GAGJ 2MC3A 4CCMA 1JXMA 4PJOF 2XKOC 2YKMA 3QJ6A 3CPFA 3QDKA 2WY7Q 1VQ7A 1SEMA 3ISNC 3THWB 1IG8A 1EO1A 2OV7A 4GY2B 5GAHP 2NRVA 1KAYA 3J81K 3CBMA 1VQ7Q 4A0XA 4DNCA 5DCMA 1GVDA 2QENA 4D0PA 3LOCA 2UWMA 3I5SA 1YBYA 5I3UA 4A3CJ 2ITGA 2ITMA 3HOWJ 2YX6A 3CJCA 2L3DA 2L4AA 4W5QA 1T3SA 5GMKj 1U9OA 3CC2A 3D2FA 1U4BA 2F2EA 3OA9A 2MK5A 1QPIA 1JKPC 4K11A 4KUDK 2L5QA 1Q81R 3HTRA 3OYJA 3VSLA 1E2XA 5LMNK 5FU6B 2L0AA 4FSXA 2RHUA 2E6ZA 1IBKK 3E19A 1FBQA 3MXJA 2I2LA 4JJBA 3CCQA 3SQ0A 4RAGA 2UZKA 1RKTA 4EMKB 2R92J 4B3AA 4B1ZA 4RTVA 3HM9A 2K79A 1A0NB 1WYXA 2RQWA 1A36A 3IKVA 3I55T 4MQ9F 3HHGA 4Q5WA 1TSFA 3CMMA 3SAFA 4U0VA 2NRTA 2DMPA 3LAMA 4N41A 4EW4A 1BR2A 3VS5A 5EGOA 3HKZN 2MBFA 3RZDJ 3K1NA 2LVSA 3HP9A 2TRTA 3PTAA 1PSFA 5LJ3h 4LF9K 3ZMVA 2XI9A 1DIZA 4BRKA 3HSFA 1G15A 1NK8A 3GTOJ 1F43A 2M9UA 1HJDA 2O31A 3MCAB 2GTDA 1LWCA 3BZ6A 3VEPA 3V9SA 1R7JA 4X9CA 3CCJN 5LJWA 2M02A 3IUCA 3VEYA 3VS6A 1PC0A 3EH2A 3WEEB 3JRCA 1MBJA 1YQAA 1QVGS 2V8JA 1E3OC 4N4NB 3MZYA 2QQRA 1ODDA 2VKVA 5GJVB 4PJOG 1U78A 1SZ2A 1IZ1A 3TSQA 3ZSWA 3M1CA 2LX9A 2YWWA 4GKKK 4EA4A 4L9TA 1GXPA 1KCFA 2Z5UA 4B21A 1M5Q1 2O9SA 4ZGEB 2JGUA 3UR3C 1NWKA 3ZSQA 2D6FA 4PA1A 5AQJA 1XWLA 2QCOA 3THXB 4PFOA 5KYXB 2HR3A 4L6V5 5IHNA 4BC3A 4B1XB 1RIOH 4AIAA 1NLPC 1QVFM 2QKMB 1GRIA 1MDMA 3DB4A 3A5OC 4EZ6A 4ZZLA 2RHKA 2RB6A 2CP2A 4X64K 2DK8A 4IX7A 3C95A 4KT5C 5CQXA 4IJAA 1BI4B 2ESHA 2E7XA 1ZBHA 1K1ZA 3QYFA 2DTHA 2DDAA 1X3WB 4PCQA 3NAUA 2HI3A 1YLFA 3M0PA 3GZ5A 3CCEI 2LDUA 1UA1A 3ENBA 1UELB 4B3RK 1TWCJ 4IOAF 1WHMA 3BR5A 1QE1A 5D7UA 3H6ZA 3OOPA 4XRFA 5HS7A 5EU7A 2EZKA 4J2DA 1TL3A 4UUTA 5KYUA 3PSFA 3R0JA 3EHQA 4I99C 3H8ZA 1W1WE 2AK5A 4FJXA 1BI1A 4JEPA 1VQ9T 2STWA 3CMEN 3WE3A 2ACJA 3AO2A 3SQ2A 3NCIA 2BHYA 3PIOA 5GAMg 3LWFA 2ZKZA 4AM3A 2QWRA 5IOYA 4AI4A 2E6LA 2ZCFB 1YI2A 2Y48A 3FK6A 3QWXX 3CCRT 3SFZA 1SMTA 5IWAK 1SEUA 3VGMA 4EPCA 5AIPA 1BL0A 1YI2Q 4FVMA 2Y0MA 1CGPA 3M4OJ 2YRDA 5DMRA 1T0FC 1IGQA 2KDZA 4M4ZA 5C10A 3AVLA 3DLBA 4DQPA 2J5OA 2JHNA 2JS0A 5K7HA 1XSDA 1H8KA 4F7UF 3W3DA 2ZXIA 4DS5A 3A03A 3HUGA 4DR4K 2QWQA 2O7OA 3K6GA 3RCOA 1OX9A 4ZJZA 4YOUA 3EFOA 3FXLA 4EIAA 2YDLA 1FWZA 2JQ7A 2M2EA 1PP7U 4UC4A 4RTWA 4KMUX 3TVTA 2B0LA 2XPVA 2I5JA 1N36K 2YRCA 3FXMA 4IEIA 3KCCA 3NMZC 5GMKi 1KK7A 1QQMA 1ZLKA 4UY8I 4G9ZA 1FTZA 3EYZA 1MJAA 3CQYA 3GVAA 5CIUA 2VGNA 1GLBG 2XSDC 3O3HA 2G7UA 2EIKH 3D5SC 2RN2A 5F2RA 1GCPA 2D4WA 1HK9A 5FFZA 2YSQA 4C5IA 2EPFA 4BC5A 1KHIA 4NOYA 4MO5A 3CUQC 3LQRA 2A37A 3ZLJA 3NDKA 3GZNB 3SUNA 3WXKA 2Y1IA 3ABMH 3CFPA 1SUQA 4BHBA 2R58A 4YFNF 1XOVA 1MH3A 4PDKA 1CZBA 2DQRA 1V4SA 5J4VA 5GAN4 4JI2K 4JBAA 1G2HA 1ON2A 4M9ZA 4OMFB 3O3KA 3GOIA 4JYKA 2BV6A 4AU7A 3E1YA 5CKBA 3AKZA 2EA4A 2G9WA 4XMYA 3OS5A 4M3FA 1QQCA 3LWIA 1VQ5Q 5IAYA 2GELA 2V1QA 4UQGA 4MFEA 3NTHA 2PFBA 1M90R 1KQJA 2DA7A 2EH3A 3MP8A 2F4MB 1ZH5A 2KBTA 2VI6A 3MEWA 1QBJA 3S1NJ 1UOCA 4DEYA 5AFUH 1RLQC 2DAOA 3IAM2 4M78D 1DKGD 1XQSC 3MO8A 1UGVA 1LE8A 2WTEA 1HW1A 2A41A 4A3EJ 3UKRA 4KRFA 2FOKA 1U5TA 2ZM6K 5IP7J 4RGRA 3RI4A 2DXUA 3CCLT 2Q31A 4U0YA 2P9UA 4JKEA 1JUPA 5L3GA 3L2UA 5BN8A 3V7SA 2WAQA 2GOXB 3K5MA 2IA0A 1CKAA 3T69A 3FXRA 1IAWA 2DY4A 1KFZA 4F7UG 4FL9A 1B59A 3GLLA 3HIFA 3ISPA 1EWQA 1X1BA 1I5LA 2DPPB 3QDFA 2K5CA 5J2MA 4RKUE 3IHUA 2GWJA 1SANA 4M6VA 2AT1B 1R22A 2M4GA 2JLEA 5HP1A 2NS8A 3U9GA 1D5YA 3EKSA 4I6MA 2GNCA 3KIOA 4Z4CA 4EDUA 1M3HA 1YHQI 3JR9A 1PYVA 5GANh 3ID8A 3VQPA 4M72A 1R4NB 3ZSOA 3I5UA 2V7FA 3N05A 1HRHA 2QSFX 1AT1B 1F1BB 2X4JA 3OYYA 2Z2SB 5H6QA 4AVPA 5ADXA 2F8TA 2E6NA 1MJ9A 3V7CA 4BY1J 3NQOA 2JWLA 3QETA 2O8BA 1ZUUA 1PU6A 1O7FA 1I6HJ 2K3FA 3GCMA 5AQXA 3LSMA 3X24B 4E6KG 2FBXA 1CXQA 3TP0A 3K0SA 3FRNA 3DB3A 2KT8A 3JV3A 3JCMW 4CD1A 3F2KA 4HKEA 4A5NA 1XGMA 2EGAA 1R0CB 3SHWA 5AQPA 5DM6L 4RTTA 1ZBSA 3SWNC 2J6KA 1XMKA 3LDPA 4OIPF 1RNHA 4C3HJ 2QGGA 3T8TA 2L9VA 2HNIA 4R56A 3HRGA 3VTHA 2CGKA 2ENMA 2DTUA 2E10A 4IO9F 1SVMA 3CVSA 3ULRB 2RQVA 5AQMA 4F52A 1BOTO 4QOZB 2YUSA 2V7YA 4FX4A 3D7SB 5C0YA 3HO1A 3CUQB 3UIQA 1ETKA 4DR1K 3SFMA 1XCBA 3I59A 3OYMA 2MOXA 2DD5A 1X1DA 5F1JA 4CIEA 5CVRA 3BE3A 5DD8A 4A3MJ 2FLOA 2MAMA 1XTAA 2HS5A 5GADJ 4Q47A 2P0WA 3C0BA 3MZ8A 2X3XD 2ABLA 2RPNA 1LE8B 3FZKA 3M1FA 4H8KA 3QICA 4IOXA 4QVDA 4J7IA 1WHUA 4CZEA 3N4QA 3WTSC 4FWQA 1U5TB 2HHTA 3E5UA 2GXAA 2OTJI 1NLOC 4FOIA 4CK2A 3HGYA 3G7ZA 3C65A 4DV0K 3G6EI 1I81A 4JHDB 2CQNA 4Y7NJ 1SV5A 1C0FA 3QPHA 4DEXA 5L3FA 3LSKA 2YI1A 3ZSRA 4AYBA 4L8RB 1ORKA 2H56A 2HPIA 2KZVA 1UZCA 1U1SA 3LFKA 2DERA 1V55H 2EFNA 2K9NA 2NLXA 2E2IJ 2PU9B 4XH1A 2E2PA 5H6RA 3AVBA 2P5OA 1J53A 2VBXA 1DGRM 4HCZA 4EJYA 3META 1X9WA 3GXOA 4JI4K 3DCFA 3SZTA 3UKUB 4CZKA 2XHIA 2Q1ZB 1UGRB 2DU9A 4UUVA 2CV2A 3GNFB 2EYZA 1UWBA 5GMKe 4B08A 1VNDA 1IB8A 4HWIA 1RC9A 2O8EA 1K79A 2L3SA 3LL3A 4AIHA 4B9QA 5ICGA 1TK0A 3SZPA 3RRGA 4CC7A 5GAMd 4QW2A 4KB1A 2VXZA 1ZLMA 2LTOA 5AQVA 3L1PA 1P6RA 1HX1A 3ITHA 4FIBA 4BR4A 2E34A 2F2XA 4DU3A 3M07A 1GLJO 3C7JA 4XTZA 3V4IA 2EILH 3CC4I 1VSLA 3L2ZA 3OMGA 2EZIA 2ZPHB 5E20A 1IXDA 1WPKA 5I21A 4OWRB 3BW1A 2PBDA 4OB0B 4BG9A 4HCKA 1DEJA 1PRLC 2L8DA 2BW3B 1HKBA 4MEXF 2X4WA 3CZ6A 1WIEA 1HR0K 2QQBA 4ZH4F 5DK5A 4V2SA 5CLSA 1JLBA 1S72N 1KLNA 4QPOA 1PKSA 2D1HA 3CD6T 3INZA 2LRDA 5LJ3f 2UV1A 2LQ8A 4RGSA 1VSHA 2P9NA 1QHHD 4D8DA 1OV3A 1Z9QA 5A0GA 1RDAA 4JKAA 1U6GA 1I6XA 2F6CA 3SWNB 4EJWA 3DKYA 3KHYA 4KBOA 1GLAG 2E1OA 3PFYA 2FZCB 1M3CA 1UUEA 1WAJA 1W5CC 2CT4A 4P9UA 3D45A 1XB4A 1R5ID 4RW8A 3HB9A 3M3ZA 1X01A 4IBNA 2GCXA 4ZHRA 1W7PD 1M30A 2JVHA 2B7EA 2OA8A 4FJ7A 2WAEA 4JKGA 2JRTA 3AAQA 2DOEA 4H4KC 5EG2A 5LRSA 1NKBA 1VQMT 2R5ZA 1VQ4A 5DYMA 4GV6A 4O55A 1IKVA 4GLMA 4OMMA 2H8RA 3F70A 2JW4A 4DSLA 3FM5A 1IUYA 4PLLA 4F7UE 3OA6A 2EQMA 3VS0A 3OR1C 3CJ9A 2CUJA 2ABKA 1JCEA 3LANA 1R77A 1C0MA 5KE3A 1E17A 3MEAA 2XY8A 1MV0B 1W1FA 3NEUA 3K58A 2FHDA 1TWBA 5LJVA 1MBEA 1RUNA 4NB4A 2CRGA 3HRUA 2PVOB 3FXOA 1ZBJA 4OKKA 2RGVA 4M77F 1BYMA 2W1OA 3UPUA 2JM8A 4C23A 1T3VA 3K4NA 1TTHB 1WJSA 1NK5A 1TAUA 1VK0A 1B8IA 5KGXA 3E9GA 1WJDA 1Z9ZA 2FEZA 3CERA 2XY5A 5EXWA 4CZGA 4HT8A 5GP9A 3W3CA 1O3SA 1VQ6T 4CJ4A 2O4XA 2OZ6A 3L4QA 3PO5A 1Q9YA 1SD7A 4U0WA 1Y96B 5ICFA 1ZGJA 1PVEA 2HBKA 2JOYA 4DBFA 3VPZA 3D5LA 1SKSA 5CCAA 3CUOA 4OP0A 4PGHA 2XB0X 1NKUA 1IW7F 4KTQA 3EG2A 3M8QA 4C5HA 4FJIA 4FK2A 1KD1U 3K70C 3ZL7C 3EG9A 3BF3A 3D1NI 3R6SA 2DM1A 4JK8A 1BW6A 4OIRF 2MWOA 4ENMA 2AA4A 1I50J 2EA2A 3BC8A 3I4NJ 5HLFA 5HVQC 3WXMB 1GHCA 3DKWA 5CE3A 4KISA 5KN9A 4M3GA 1M8VA 2QWLA 4ETSA 4RB1A 2IVWA 3GFLA 4J01A 2ZD1A 4FM1A 1YS7A 5HLTA 1YWPA 1NG2A 3OHRA 4BJTA 2WSCE 2YHTA 2ED1A 4Y4RA 3OMCA 5AIQA 2RQTA 1ZAOA 3CCEA 1FK9A 4XNFA 4WX9A 5KTQA 2HVIA 3OYBA 4C5GA 3HL2A 2RNGA 1EETA 1KFSA 3MEVA 3CCEQ 3FR0A 3HBTA 1OPKA 3PIOL 3I55N 2DA1A 5MLCQ 5AN4A 2M3AA 5BNGA 2HVRA 4K8ZA 4OMLA 1O1WA 3NNQA 3OMYA 2OX7A 1S7OA 4A4FA 3IUOA 2QWPA 1QVGM 4I02A 1ZR2A 2HL5C 3P8DA 4XQFA 4FPAA 2STTA 3PY8A 1NTCA 2RJEA 1OFCX 4DZJA 4EP4A 2XDDA 1M1KR 4KIBA 2E1YA 5A2QO 1NM1A 9ANTA 4JLHA 1I1JA 1RPWA 5GAMj 3OWTA 4DFJA 4M77G 1VQOI 4Z6YA 5E8GA 4ASNA 1DT9A 3H1CA 3M7GA 5JVGF 4X1EA 4XKWA 5HY6A 4M3EA 3H9QA 3DLHA 4M9SA 5KE2A 5IT3A 1MGTA 4M7DF 5EYRA 1U47A 1BUPA 4C8KA 4BI3A 3CQXA 4DR3K 1DTTA 1O57A 2ZJPL 1IO2A 1RDUA 2VUMJ 3RMAA 2K85A 4PJJA 1TKDA 1YIJA 4LDUA 3DEEA 3U3YA 5GAN2 3ENHA 4OFHA 3ASMA 2G8WA 2A68F 4O4GA 3CCSA 3I8DA 2P6TA 1R0BG 2FPFA 2KL4A 4C5EA 3OYGA 1EZZB 4NCGA 2A3ZA 1BCOA 4ISGA 1NEBA 4QT7A 3CMAA 2F5CA 2FA5A 3WXJA 1TXQA 3V1QA 4A63B 3C1DA 5JICA 5GAOr 2XY7A 2QSHX 1UJYA 1KU2A 4A3DJ 2QW9A 4DUZK 4B3TK 4Y3OA 3KNTA 4PFZA 2HGCA 4BC4A 2A36A 2HTJA 2L89A 3RJPA 3MK6A 3G3ZA 3BQZA 3U9DA 2L3QA 3A2FA 3DTIA 2HVSA 2K4BA 4R0KA 1HKCA 4DSJA 1V29B 1DGKN 3H46O 2JRMA 4FLTA 2CZ0B 2AHJB 4IUTA 3DPUA 2Y4XA 5FKOA 1U5SA 3JRHA 2E5KA 2XGCA 4XTVA 1EH8A 4C8QE 3TO9A 1UTIA 1XJWB 1WHHA 4F7UB 1KC8C 4IVNA 1YYVA 1Q82O 2UU9K 3KVGA 3J8AA 1VQ9N 5GANf 2GQIA 2E6MA 2MW8A 2EIJH 4WFAL 3E6MA 1ASUA 4FM2A 4CFDA 1NNEA 4IXCA 2EFOA 1N5YA 2H3GX 3BQYA 2UXNA 2BY0A 1LKXA 1RAAB 3K4MA 5KPRA 3O8HA 3E9FA 3M4YA 1Q7YC 2A5WA 2MLKA 3KK2A 2A42A 2QK9A 3ZSZA 1ULYA 5A0DA 2J5PA 3CCRN 5KCHA 1J5OA 5ERIA 2KW4A 4FT2A 2OD5A 3G4SI 2RHYA 2XB5A 1P7IA 3V9UA 3VRZA 5LJ5h 2Z33A 1U0JA 1RADB 3MJXA 1BI2A 3ZCOA 4CCKA 1LJ9A 3CMEI 2ESWA 1ZRFA 1L3LA 4FJHA 3VS1A 4M7DG 2IPOB 4ELUA 1IKYA 2YT6A 1NJXA 2MIOA 2M9HA 2K3YA 2BTFA 3WVEB 1S8NA 5LFAA 1F4KA 4A4KA 3LGLA 4QAGA 3EH1A 3HOXJ 1LV5A 4F2RA 1P4XA 4A62A 4IHVA 3FDRA 2R7WA 2R3SA 2DK3A 2EVRA 3V8JA 3MKDA 2QGFB 3SLCA 2Y2ZA 2CUEA 4FE7A 1YHQQ 2P9IB 4CF0A 1D0ZA 1S5JA 1FLIA 5AQUA 3NTKA 2QYOA 2VV5A 4GVEA 2JSPA 2MI6A 1IG7A 2JTVA 3BJ6A 3EUAA 3VSKA 1ASWA 2FG0A 2H6BA 4CUGA 3GUDA 2E60A 1BWFO 2VJ5A 2DK5A 1TKTA 4JI8K 2O8CB 1QZEA 3DU6A 3I56T 2OFIA 3DAWA 4FYDA 2HNZA 4E6RA 2HDAA 4RW6A 5C15A 5JVGL 4C8QA 2CH4A 1D9DA 2W0ZA 4HSBA 1LOJA 3FFIA 1POGA 3THYB 1HLUA 1SL0A 2XMFA 4FJLA 2Q2RA 4A3BJ 2FPEA 1BI3A 2KYMA 1JL1A 2VVKA 4DGWB 1VQLN 4C0GA 5SZTA 2ECCA 2V8KA 2CQ7A 4QVZA 2MF2A 4QS8A 1FMWA 3G71T 2KE9A 4RCCA 3ZMSA 4D5FA 2JN0A 2L2OA 3WTVC 1C1CA 3E5QA 4AF1A 1WZ2A 2HBMA 3VUBA 2VYTA 3AVIA 1Q82R 2C0OA 3KLFA 1FOYA 3CCMT 3BF1A 3H41A 1J2XA 3SPYA 4G8XA 2G7HA 2ECBA 1RDWX 2YUQA 2E41A 1TH7A 3HOSA 2JHJA 3CCLN 2OTJA 4BJ5C 4DWIA 4E7SA 5AJ3K 4O6JA 2LZ6B 3G6EA 1CF7A 3QEPA 5A0LA 2OTJQ 3T1YK 4JZ4A 2RV8A 2RHIA 4Q0BA 4LLGF 3G6EQ 3U9ZA 1VQ7T 2XRLA 2B8AA 3KP2A 2GFUA 1AWJA 3JB9I 3JCUC 2KFZA 2VL8A 1R23A 1V5FA 4M77E 2YCHA 3OV8A 5KPZA 2IPQX 3BCAA 5HDNA 4A0ZA 4EIKA 3P38A 2X6YA 3Q9SA 2COYA 1G3YA 3TOBA 5FGMA 1Q9XA 2UXCK 2HF3A 4KHYA 4DV6K 3ERED 3ECOA 3CC2T 1OYYA 4QPQA 4RTXA 1RFQA 1JHFA 1LCKA 4I0AA 1A5VA 1I4K1 2NNWA 1J6ZA 5GAN5 1TYQA 1S1WA 3DXMA 1JBMA 1V3FA 4M6XA 2W04A 2QDLA 2ZQBA 3VOVA 4H5RA 1IV6A 3JCMP 1C0TA 3CCQT 4LDWA 1KXPA 2G8IA 1X2QA 4QLCU 2M7BA 3RPUA 4BWMA 5IP6A 3FLCO 4G12A 1GLDG 3V4GA 3H35A 4KGZB 3OIOA 3JB9F 1XHZA 4HUEA 4ZDOA 1ZBIA 1ZELA 1SKRA 1G4DA 4LF5K 3CPWA 3RR6A 5E1WA 4C8QB 4DMNA 4FXDA 3NVKA 3CQ8A 3CC4Q 1OCOH 2ELHA 1SKWA 2COMA 2RNAA 4NYFA 3TQ7P 2DLLA 3VDXA 1NJYA 5F0CA 4I7FA 1I07A 2HZTA 5F08A 4CC4B 4M77C 2E4HA 3CQTA 3SQ4A 1N77A 2ZSIB 2IAJA 1B92A 4KN7X 2QGUA 5HCKA 1WHKA 3C0CA 2P0QA 3JXUA 4DTMA 1K9MR 2CZ7B 3CWSA 3QZ5B 3X28B 2MGQA 1NU0A 4P55A 5CPRB 2EV6A 3DF8A 2E3IA 1K73U 2X4YA 3A8LB 4QS7A 1RRSA 1X58A 3R8EA 3HVRA 4WXCA 4GYIA 1VUBA 1TNTA 5AONA 2KNBB 4Y17A 4A2UA 2JUCA 3L3VA 3G0ZA 4Q4ZF 2LY2A 4XSXF 3O2PE 4ZDPA 4ZGJB 3T1AA 5IYCJ 3MVPA 1N9RA 3MP6A 3LH0A 2NRXA 4AWXB 4B9XA 4PL7A 3TO7A 4A93J 2QXFA 1IKXA 4BH9A 4FTHA 2COBA 4ELYC 3SEQA 1J54A 3JTHA 2XF5A 1ZGWA 4C8NA 3OIPA 3Q0VA 4BY7J 4B9VA 5LJ3e 4FWLA 3O3GA 2KFDA 4AD9A 3RSEA 5E3OA 2NS0A 2EYQA 3I0WA 2KTQA 5J8CA 3HYFA 3RMCA 3TR8A 2ISZA 3PQJA 2RREA 4KPYA 2KJCA 2LT1A 3CO7C 3H9GA 4LB5A 5K5OA 2L3RA 1J59A 2Q36A 4PK4A 4CHNA 3VU3C 1YN8A 2LLKA 2OZMA 4IIOA 5CY4A 1ZBXA 4ABZA 4WXHA 4K0KK 2O61A 1HPZA 2WTUA 1HQUA 1AA7A 1TYQB 3U3GA 4LMYA 1WZOA 1TP4A 3PO3J 2XVCA 1TBXA 2IGKA 4OKJA 2X78A 3CG7A 1RTJA 1E6HA 3SMSA 3W2AA 3SUPA 4CEDA 2AJQA 2MYSA 1MUNA 2K5IA 3ZX2A 2VN2A 3S2HJ 4Z4IA 2OI3A 4RTZA 1Y57A 1W2BA 1UHSA 3H5NA 2DDBA 2I10A 2LQKA 2KHOA 4YDUA 1KG2A 4C92A 2LP5A 2VWKA 5EEHA 4BBSJ 5GAOm 3QHSA 1YRNA 3CWTA 2ZMEC 2UXDK 1BISA 3CD6N 4RCBA 2K4JA 4Z94A 3NTIA 1YI2T 4JZ3A 3QQAA 3CPEA 4BC2A 3N5BB 2BXZA 1T98A 3ZQIA 4U7DA 3H0FA 4M7DC 3P9KA 2HDWA 3UATA 2EJFA 5FB2A 2WOMA 4NS5A 4Y52J 3AA3A 1FKPA 2GIZA 3SK3A 2NLUA 3BG7A 3DLGA 3A0IX 5KCMA 4EJVA 4FW2A 3QOPA 1FPQA 4DSIA 1WHGA 2ATQA 1K76A 2FL7A 2EBIA 1IO6A 4M77B 1LFBA 3W2VA 2DZCA 4ON0A 2F5KA 3VQ9A 4B6MA 1KQSP 4JRQA 2AS5F 1D5AA 4PJ0C 3KE2A 5IHKA 1WUAA 4I9LA 3HSBA 4NHJA 2ZPGB 1HYVA 2R4GA 2RI5A 4RTUA 1RILA 1UAAA 5C6SA 2IBDA 2MWPA 3AG3H 3BWGA 3OH9A 1R5GA 4PSWA 2RPIA 1SRMA 1MW7A 1Z6TA 2BH1A 3N97A 2D5RA 1Z7LA 4Z88A 4DU4A 1T6DA 3V6DA 3QPSA 1RRJA 3J80O 1DDNA 3S3OA 5LEJA 1N9SA 4CGGA 4DU1A 4FZYA 5BPDA 3CCUI 3TAGA 3PLAA 4MFBA 1N27A 3MX5A 3QBYA 1VQOA 1BIZA 2KYBA 2DFFA 1LPLA 3CPWS 1VQOQ 4KITB 2YRVA 3NFAA 1HKSA 4A3FJ 4JD2A 3DBHB 1UA0A 1M3BA 4CECA 4C9YA 5AYFA 4UNFA 3PIPA 1G83A 3KP7A 1GCQA 3HI0A 4NL3A 2F8SA 1HSQA 4LDXA 3HOTA 2NAZA 1PDNC 1S1XA 1HPMA 1RTDA 1GUUA 3BDDA 3LM2A 2FRYA 3OSSC 1OPCA 4O8UA 4OPAA 4RMOA 1P90A 2Y31A 2VT2A 3CWUA 2CP3A 3IH2A 2B9SA 3OYCA 2Q0OA 1IDYA 3TP3A 4XBFA 2ZCWA 2IT0A 3ATVA 1E4FT 3JCMh 2QEXI 4OKEA 1XDUA 2P5GA 2OZSA 2NOLA 1MH4A 2K9QA 3TAFA 2VC0A 5B5EC 1GLLO 3I64A 5DM7F 4XOPA 1JLAA 4JI6K 2QLZA 3H08A 2F48A 1WVRA 5A2QZ 2O4GA 4MQVA 4PL6A 1NHAA 3KP5A 4LG3A 3IG1A 5LJ5f 1IDZA 2AZVA 1NK0A 4YHHK 1RBSA 3SYTA 1R58A 4ZTFA 3ESWB 4X34A 1LQ1A 2FRHA 2E88A 3OJUA 2UUZA 3EO3A 2HZYA 3H92A 4B48A 2JTEA 1U84A 2D1VA 4C30A 3NF7A 5BPNA 4LFCK 1X69A 3KLGA 1EP4A 3C3WA 1YQKA 2YKNA 3TREA 3WTWC 3LDQA 5GAN8 3GLXA 2Q2EA 3BTIA 4NLCA 2XV4S 4M7DB 5K5RA 4FWKA 3SCXA 5A2QK 3FEOA 2E2NA 4HXJA 4IL6C 1IV8A 2IA2A 5D5VB 1MMDA 3ENOA 1UECA 4E2FB 2EIMH 1JKQC 2VODA 1VQPN 1CLQA 2DXTA 3FXQA 1GV2A 1ATNA 3VMFB 2B6AA 1BIAA 2QUFA 4AG1C 5GMKm 1YJWA 3Q0WA 4H0PA 4LIUA 4DZPA 1XNQK 3PVLA 2GXBA 2D9TA 2BOLA 1LWYA 3MN7A 3HM8A 2C06A 2HNHA 3G4SA 1WQ7A 1ETVA 4CEAA 4LITA 4LFBK 3ZBDA 2RK1A 1TKXA 1F9NA 2OUMA 3FBIB 1OI1A 1BHLA 1OYIA 5ED4A 1BB9A 4WQ4C 2M34A 5CVVA 4PLIA 1YX3A 4XRSA 1W2BS 1QA6A 2GA1A 1RT4A 3CMEQ 1KONA 2BGCA 5EZHA 4JD2B 2PI0A 2XO7A 1HJOA 3T19A 2XF6A 4Z8AA 1OQKA 1M90C 1BA1A 2P84A 5TKYA 3NAEA 1VSJA 2OQGA 2HHUA 3CF5L 1VQKI 2OCEA 3E7LA 4EATA 3OVNA 1RACB 3N4PA 3V1RA 5ECAA 1QNTA 1HD3A 2LDMA 1XSVA 4D1QA 1KU9A 3SJMA 1WXTA 3D2EA 3LSHA 4CF2A 4LK0F 4A57A 4E7IA 1N75A 1HKTA 4A5BA 4M3YA 4BHCA 1KQ9A 3FIWA 4PL8A 2OQRA 1U9NA 1DP7P 4H03B 1XS9A 3VQEA 1B3QA 3OSFA 3RIRA 1PHTA 3LFUA 1WEIA 1BA0A 4LF4K 5CZ1A 2VQCA 1BG3A 2FBKA 2LY9A 3FMQA 3C94A 4FJNA 1TV6A 3WU0A 4CSWA 4E7KA 2VBWA 1KVCA 4L9JA 1F5TA 1ABOA 2PG4A 3CHWA 2KISA 4FK0A 1JLQA 1T8EA 2E4LA 2GX9A 3B73A 4YOVA 3JRIA 4HT9A 3HZ6A 4E7JA 4J83A 3H0DA 2Y4YA 4XU0A 3EN9A 2MABA 3MWTA 2Q2EB 2NOGA 3K70D 1GBQA 3VKIA 4DTOA 1QS4A 5DLQE 4UVAA 4O44A 2RJDA 4A6EA 1R1VA 3F22A 1RR7A 2KKOA 1WB9A 1ZBUA 2DTZA 4KGVB 4B9TA 3RKQA 1WXBA 1D8KA 1BJZA 4N76A 2LSNA 4CHZA 4A0YA 2H27A 3RMQA 3NHNA 1UEBA 1AHJB 3ZSYA 4MMLA 2I5WA 3O9RA 3BPVA 2XRNA 4IUUA 5I11A 1ZUYA 4M75F 2XHBA 1WHLA 3EAEA 4DTUA 3FXUA 4B24A 2OAWA 4YELA 1ZQ1A 5D4SA 4KREA 4K2EA 1C1BA 4DV1K 1LUJB 4V2FA 1GLEG 2JVVA 5JLWA 3FHGA 4OX9K 3M8RA 1U2WA 3SDZA 2R7TA 1U1TA 1QVFP 1S6LA 4F55A 4B09A 1W36D 1G2BA 1FC3A 2QKBA 2JZ2A 4F3OA 3B02A 2DMQA 2V6CA 3WXLA 4UB6C 3H3OB 1A6QA 2HQAA 3HC7A 3JRDA 3PO2J 5C4XJ 2K57A 4JJNK 4IQJA 1M2VA 3IQLA 1IRXA 1WSEA 4GCVA 3O6BB 5J6XA 4KTZA 4N9IA 2ZPEB 3RR7A 4I2QA 3LW5E 4EM1A 2FEIA 3VYRB 4OIOF 1R71A 1OYWA 5GAOp 2AO9A 4JQFA 4FETA 1VQNA 5HK3A 1KSWA 4GRIA 4B1YB 1SQKA 3U4LA 1XUPO 2BIVA 3HOUJ 2WB1A 3A8YA 3WTUC 1VQ4T 1NGEA 2VQLA 3A0HC 2DL7A 4GFBA 2XY6A 4K43A 3CP8A 3G71N 2NNYA 2VXEA 1WSHA 3C2BA 1FX7A 2HPMA 1G99A 4A5MA 2KIQA 4JLIA 4GW6A 4E3SA 4IFYA 5KYNA 4XLNF 4IG3A 1OR7C 4FISA 3ALYA 4RUGA 4HX7A 1X2MA 4KMFA 1B07A 4PIIA 3LWMA 1WJFA 4LXCA 2CMPA 4DQSA 2DBKA 4NBQA 1OCRH 2G6FX 3TAPA 1JTXA 3HPWA 3P1GA 4ESFA 3JRBA 2E64A 2OTLN 2ZO4A 4YNQA 2NWMA 2E2HJ 3RQ4A 2PTKA 4QQ6A 4ATOA 3D4VA 1VQLI 1PNJA 3L7WA 2FSKA 3EGXA 5AQKA 4BXXJ 1ZYQA 4CJEA 1DGWY 3C7NB 2PEXA 1X1CA 4DG1A 4IUPA 2FQ4A 1MKMA 4M75G 4OMYA 3QEIA 3TEDA 2Z99A 2K6DA 2GV9A 2E5LK 3GMEA 1W6XA 3GTLJ 1XC9A 4J2BA 4FWMA 2RHXA 1R36A 3I71A 4CZJA 1VQ7N 4CJRA 1TGOA 1S22A 1Z91A 3JRGA 4RW4A 1RDCA 4IRHA 4CK1A 2WC2A 2P9KB 2CFOA 2GF7A 1IN6A 3HJEA 1IJJA 3TU5A 3T5XA 4FPBA 4M3RA 1X19A 5ADXH 3IWZA 1UJ0A 3KLIA 5HDKA 2FC0A 2H09A 1OCCH 4CZZA 2EYYA 2CP6A 4F4KA 2NOHA 1X4PA 3HL8A 2D0BA 1KSPA 4BRMA 3CC2N 4CGIA 3K5LA 4DLGA 1NJIO 3KUFA 5M1FA 3F0CA 3JCMQ 2R7SA 1FSHA 4F2SA 2KSSA 3NWTA 2DA2A 4HRIA 4XONA 3QAHA 1YQLA 1JQQA 1HC8A 2DTRA 3GTJJ 2KHMA 2EGCA 1WI9A 4JK9A 2LKSA 4JOMA 3BR0A 3O9UA 3CCQN 4XM3A 4J2EA 3CCET 3LA3A 2VKEA 4DFMA 2GA2A 4XK4A 4A54A 4CGHA 3KZYA 3P7NA 2DXCA 1LNWA 3BZKA 3HXLA 3WU2C 2CYYA 3HTUA 4MZPA 4MDBA 3NGYA 3A8MB 3EUHC 2NYSA 4YEJA 4FWPA 3I58A 3S8PA 4CC3A 3TW6A 1NOYA 5F0XA 2RQQA 3V9WA 4CJ3A 4DBRA 2O8FA 3K5OA 3AG2H 1B9FA 1S1TA 4AUXA 5IT9E 2HZDA 2XRIA 1YVUA 4BRNA 1OVQA 1DJ7B 5LHGA 2ZSHB 2R7DA 1ZK8A 1JKOC 4CIGA 2DFUA 4AC0A 2V52B 1X27A 4C8QD 5F64A 1Q1VA 3MCPA 3RWUA 2E2QA 2JPSA 3ID6A 1WHJA 3SV4A 2PN6A 2ZJQL 1KGSA 4HF1A 2E8AA 4KUIA 1VRTA 2QWNA 2OBPA 4KH4A 1KU3A 1KQ1A 3CC7A 2CUZA 3LDOA 2B63J 2QASA 1U48A 5H20A 4ZDLA 1FOKA 1GLNA 3J7ZI 1H9GA 4C1NI 4QQGA 2FF4A 5AZIA 2X35A 1E0EA 2CSOA 2OANA 4NCBA 2AQFA 4BEHB 2VQFK 2V1DA 4HW0A 1YIJT 3DEWA 3G1OA 4JI1K 5AQFA 2PAVA 1D8JA 4H0TB 3CCST 3LSGA 2E5QA 1KD1C 2JXBA 4R55A 3FSPA 1RBVA 3H0IA 1QQOA 2JG6A 3NWSA 2YLBA 1KC8U 4RA2A 1XTDA 3JCMf 2KT1A 3CMAT 1WJRA 1N32K 2O0YA 5HNHA 1IXCA 4RGXA 2W48A 5AQGA 4IOCL 2LTPA 1S6PA 3SEMA 2DT6A 1KHCA 2L54A 2K5FA 3CLOA 1Q7YU 4PKIA 1UE9A 1PWTA 2FPDA 4FWOA 3CCUA 3L4IA 2BHZA 2LNVA 7AT1B 4O5FA 3Q7BA 3PIPL 1T38A 2LMDA 1UCRA 1NJIR 1MPGA 2PJRB 3CCUQ 1NKCA 3ZRGA 3PO4A 5HS8A 1SD6A 3DQVC 2Z1HA 2C0TA 4DV3K 3KX2A 4RM3A 1TG0A 3VF6A 3HOVJ 1MUYA 4DTSA 4IHWA 1GT0C 4YORA 1D8YA 2YUPA 1K8KB 2O9VA 1UGPB 5IOZA 2KRSA 4AM7A 4N9HA 3VQDA 3QDRB 2X6OA 2CS7A 5HLGA 1R8OB 3PNVA 4KT6A 4E9HA 4DSFA 3M55A 1NGDA 1S6QA 2DILA 4OGEA 2PJPA 3HG9A 3S14J 3W6VA 2A08A 3QO3A 3TPQA 4BR2A 4AHUA 3RPUD 3VQ7A 2CDTA 4B3XA 2HBJA 2BGGA 3G25A 2QEXA 2O8FB 1M1KC 2CUBA 5D6XA 3SD4A 2FBIA 2P9SA 2YNFA 3LZJA 1HW5A 1YI2N 5EEAA 3GTMJ 2QEXQ 1IH7A 4I98B 3HPGA 2UUAK 1MUDA 3J80Z 3PSIA 1ZTRA 3IAS2 4CF9A 4CCNA 1KA8A 2Y0SA 3MAJA 2WSFE 2IDOA 5L3EA 4Y91A 1QZ5A 3O4NA 3CTAA 1OOTA 2BE7D 4CJSA 5CYMA 1ZLJA 1V5GA 2EIFA 3V81A 4EQQA 4DV5K 4LDYA 1NGNA 3MEDA 4RG8A 2EYXA 3ZFJA 5D8LB 1ZUKA 3ZETB 3F6OA 5FD5A 3CPWM 2KQRA 4JV5K 4CJWA 3JSCA 4UV8A 1S1UA 4M75E 4M78F 4XTWA 4JI3K 1QVTA 2AKLA 1UHWA 3J80K 1RL2A 5K14A 3URGA 3IH4A 2PLYA 4M77D 3F23A 2JT1A 1MJBA 3IH7A 1IJWC 1NK2P 2F7TA 2D0OA 3UWNA 1IG9A 4UXNA 1KYWA 1QSSA 2UUCK 1SAZA 3REAB 1OZ3A 3L9FA 1K78B 5I9EB 2R7YA 5LJ5e 2VJJA 1X3NA 5BREA 1KAXA 1L5UA 4F3TA 5E1ZB 2Y30A 1HXDA 5IXBA 2KAFA 5H1SQ 2GLOA 4JKBA 3GBQA 1PCXA 3WODF 4PZJA 1HNZK 2V6EA 5E41A 4DTJA 3THWA 1M27C 5JVTA 1QLYA 3K59A 2HHWA 2P9PB 1Z3XA 1EBMA 3VQBA 5B8HA 3OYFA 2JK3A 3UF4A 3GO5A 5B1BH 4CHOA 2R7RA 3CI5A 3KEQA 3UA6A 2EJ9A 1NG6A 4O8KA 4GY5A 3I35A 4YOQA 1JO8A 1OKJA 4MZTA 5GJWB 3KD1E 4F04B 2O88A 4A61A 5JLFA 2CREA 4IEEA 3A8GB 3ZYYX 1SFOJ 4BACA 4KFCA 5ILSA 4F91B 1K6YA 1DU6A 1VQKA 2CS3A 3K9JA 1CQTA 4KH1B 1V5EA 4D6WA 1Q86R 2XHKA 4XU3A 3HOYJ 1JT6A 3CYMA 3WQUA 3FDYA 3CCVI 4M75C 2KMUA 4JNEA 4EMKA 3AG1H 4A2AA 4KICA 2PUKB 3J7AP 1SVOA 1S7AA 3EGUA 5KYWA 2DFEA 2OPRA 3O4WA 2OTJT 5D6FA 3I0SA 4CZFA 5F6FA 5KQ8A 3GPLA 2QKLB 3G6ET 3HP6A 4EJTA 2NVYJ 1RDDA 2DJZA 4QWQA 3CP2A 5JVHL 3HHHA 3ZQGA 4L5GA 3KKSA 2ZJRF 5FROA 2K40A 1GDTA 2Z1GA 3FXKA 4DTXA 2KQ2A 3IDHA 5GTHC 2HWVA 4ZYDA 3CBOA 3QRFF 2KQWA 5AZJA 1FSEA 3ZQ7A 3TWHA 2X6XA 2LJ1A 1WJEA 4A12A 4C8LA 3VEXA 3ABUA 2DJQA 4L9NA 3EEQA 1W2BM 4M78G 2HQHA 4OJRA 2QTVA 1ZQ3P 3CIPA 4FYVB 3HEFA 2QDYB 3UKGA 2IVOA 3DLKA 1YQRA 3CWAA 1RR8C 2G8HA 4C3JJ 5J1UA 3GTGJ 3WEEA 3VUZA 1ONVA 4KNYA 3QPTA 4NC6A 4JUVA 3DV8A 2XGXA 4M45A 3Q0UA 4M3XA 1Y39A 3MKLA 2DVEA 2YUOA 3OYIA 2OCCH 3C6TA 1BIUA 3KZBA 3K1MA 3VA0A 2KEAA 2LF7A 2EV5A 1VRLA 3BY5A 1G59A 4LNPA 1WJ5A 2VKHA 1X4OA 2DXIA 2BZTA 1VQPI 3THXA 4DBQA 5EOYA 5KYXA 4EMGA 3IMXA 4AT1B 2CQXA 4JDSA 3E6CC 2KXCA 1ILYA 1T56A 1VFCA 2Q0RA 4N47A 4DLEA 4HPQA 2QA4I 2BVMA 2OC6A 3K4JA 2XKOA 3HZJA 5D8KB 1GLCG 1BI4A 4ME7A 1VQ8N 2WUSA 4A3GJ 2GBQA 4YIFA 1OH6A 3E2UA 4CA0A 4M7YA 2IEKA 1B72A 3PT9A 3RMBA 1Q81U 3TOAA 3HRSA 5E3LA 1NYGA 5LY3A 4D7MA 1LMZA 4IO8A 3DM2A 3ECHA 2CP5A 2W6KA 4BGDA 4M42A 2RI2A 3ZQLA 2V9PA 5KYWB 4HQEA 2JM9A 5FW9A 4HQMA 2O4IA 4BS9A 2Q8KA 4H0OA 3IV5A 3WNFA 1ASVA 4LG0A 3JRFA 2L7MP 1O3RA 4YFKF 1XGOA 1K0XA 2VE9A 2FZGB 4RW9A 2XAJA 3J7AF 2I7NA 2RMOA 5EG0B 5C42A 2X4HA 4NO7A 2QWWA 4M75B 3DU5A 4RW7A 3HGGA 5AZJB 3NH2