4BDZA

Pfv intasome with inhibitor xz-90
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
total genus 104
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bdzA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bdzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bdzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdzA03
3L2WA 3ZT1A 1KVBA 3WNFA 1U49A 3EY1A 1JLBA 2D9TA 3CG7A 3LDSA 4DSLA 2E4LA 5HRRA 3ZSRA 3QERA 1Y97A 4CK1A 3VQCA 1HJRA 2EQUA 4JLHA 1ZBLA 3LP1A 4CEOA 1T03A 1QSYA 5K14A 2FHDA 3V6DA 4FJGA 4FLVA 2QKBA 1W9HA 4CEZA 3KD5E 5CIUA 1Q9XA 3FLGA 1NKEA 4ELVA 3IS9A 4LH4A 1BQMA 4FLZA 1R0AA 3OVNA 2QK9A 2X6NA 4N41A 4ZHRA 4KREA 2EQMA 4KTZA 2FC0A 4B9XA 3ZT3A 4NYNA 2IS3A 3ZSVA 2L8DA 3LWLA 3LP0A 3S3OA 4HCZA 3NDKA 3SUNA 3VQBA 1DLOA 4IUPA 4A4GA 3SV3A 1NK4A 4B9MA 1ZBIA 1TL1A 4IURA 3WNEA 4HHTA 5M9OA 3QEXA 1WJRA 3MXJA 4KV8A 1WSEA 2G8IA 3AVNA 4C8MA 1DTQA 3QESA 3MP1A 4A4EA 1QE1A 4AH9A 3SPZA 3F73A 1QTMA 4CGDA 4KHNA 3TAMA 2D0AA 1KHCA 3E9GA 3L3UA 4LH5A 1TK8A 4CJWA 3NHGA 3CQ8A 3MP8A 2JGUA 3AVKA 4NYFA 1GOAA 1EXQA 4JRPA 4FM1A 3PY8A 4EP4A 3NE6A 3QIPA 2VWJA 2O4GA 2A1RA 2HHQA 1J9AA 4IFYA 1D9DA 2QKKA 3L2VA 4XIUA 3SPYA 4PLLA 4FJIA 3QEPA 3ZT4A 4DQIA 1WAJA 4WE1A 1A5XA 3OYJA 3AO4A 3NTIA 2RPIA 2OPSA 4I2QA 4ID5A 3RWUA 3HPOA 3QINA 4BD3A 1C6VA 3OMCA 1JL1A 4J2EA 4OLBA 1KFSA 1L3UA 1LW2A 2IAJA 5EU7A 3SI6A 3LZIA 2Z1GA 3HSTB 3LAKA 3ZSOA 5HRPA 4DTJA 1NKBA 4C8LA 2YHAA 3RRGA 3EAEA 4AHCA 4DQQA 2XY5A 3DLBA 4ELTA 4CEDA 5CYMA 4HCCA 3AO3A 4FK0A 2HNYA 1VSMA 4KPYA 1JXEA 4GVMA 1Q9YA 2GFAA 2RN2A 3BDLA 3VQ4A 2G8FA 4IUQA 3MEDA 4CESA 3V9XA 4M3TA 3SJJA 1S9EA 3DLRA 3O3GA 1C1CA 5KRTA 1RTJA 4CGIA 3KLHA 3QNOA 5FROA 3H6ZA 1TGOA 1TK5A 3MO8A 1JLGA 3OS1A 4KRFA 2P5GA 4PWDA 1QSLA 2GV9A 3D45A 1X9WA 4F3TA 4OLAA 1ZBHA 1NOZA 4C8NA 4ELUA 1OZ3A 1EP4A 2G3RA 3SQ2A 3RR7A 3TAEA 1OZ2A 4AILC 4E7IA 3DB3A 4QVZA 4BWJA 3MEEA 2P0KA 4CJEA 3JYTA 3L8BA 4FLWA 4F3OA 5D6WA 1BIUA 3OYGA 1O1WA 2OPRA 3DI6A 1RTHA 3K57A 4Z4GA 2FBVA 4KAZA 2ITGA 4CHZA 1BHLA 3LPTA 3OYLA 4DTMA 3ISNC 1DTTA 4DSJA 1ASVA 3LP3A 1X9MA 2W42A 3QEVA 4FJXA 3HL8A 3K5MA 4HUEA 4FK4A 4W5NA 2P1JA 1WAFA 1UWBA 4CFAA 3SQ0A 3F9KA 4DLEA 3QKJA 2BGGA 3VQEA 2EFIA 4DFMA 5I3UA 3TWHA 3V9ZA 4FJKA 5J26A 2X35A 2ATQA 4DS5A 3OYEA 4M3ZA 2RJCA 1JLAA 1Z25A 1S1XA 4CJ4A 3RMAA 1L3VA 4N76A 3ZSXA 3VA0A 3NTKA 4FZYA 3OYIA 4Z4EA 1WNSA 2D0BA 3V9UA 4DFKA 4KB0A 3AVFA 2VG6A 1VSJA 4PLIA 3NGYA 1WSGA 4DTNA 3OYBA 2O4XB 3OYNA 3LLRA 2DFFA 2YV0X 2LDMA 1BCOA 2FBTA 3AVJA 3E01A 5CYQA 3ITHA 3ZSQA 1JLFA 1KVAA 4G1QA 4FJ5A 1VSIA 3VQ5A 5KRSA 2IDOA 2RO0A 1HRHA 5C25A 2HHVA 4CK2A 1L5UA 1H3ZA 4QCLA 3PMTA 2FBYA 3B6PA 3DLHA 1NJZA 3SYZA 3V81A 3CM6A 1L3TA 1HNVA 2XK0A 3FFIA 3O4NA 4DSEA 4O4GA 5FDLA 3TR8A 4UQGA 3ZT2A 4CHPA 4W5QA 1S1UA 3DLEA 4AHSA 1C0TA 1JLCA 1XHXA 4E1MA 4Z4IA 3M9QA 1HYVA 4CF0A 4CJ5A 2KFZA 4IDKA 4RW8A 2HVHA 3LAMA 1IKVA 3RMDA 4H4MA 4QQ6A 2WONA 3SCXA 1TKDA 4KHWA 2R58A 3ALYA 4A4HA 1UA0A 1VRUA 3PO5A 4CHNA 2KQ2A 3NAEA 3NTHA 4B9VA 1YTAA 3LALA 4OVLA 2VYTA 1RDAA 3QEIA 3BDPA 1RBUA 3T1AA 1XNIA 2O4XA 3M8SA 3RRHA 3TAFA 1QSSA 4DSKA 2HHXA 2EX3A 3EYZA 4C5GA 4FM2A 1EX4A 1T05A 3TAGA 1OI1A 3AVAA 1TKZA 1WSIA 1TAUA 2OA8A 4CGFA 4JRQA 2K3XA 1TKTA 1NOYA 1WGSA 1XI1A 3QETA 3NFAA 3SUOA 1SUQA 3C94A 4I7FA 2HHSA 5KE2A 4W5OA 1VSKA 1B92A 3HVTA 4FJ9A 3NCIA 3IRXA 2R5MA 5HRSA 4NZGA 4CJTA 1BGXT 5CY4A 3ZSWA 1A5WA 2HVIA 5D6XA 4IFVA 3MP6A 1T8EA 1W0HA 3AA4A 3VN5A 4AHRA 2Y1IA 1RBSA 1RILA 2RJFA 4QW2A 1HYSA 1C0UA 4Z4CA 3LZJA 1NJWA 1T7PA 3HK2A 4FW1A 4CF8A 5J39A 2HHWA 3MEWA 4MFBA 4FM0A 3META 4H8KA 2G8VA 2A1SA 2HQXA 4DLGA 2BE2A 2M0OA 3SUPA 4M3YA 4B3OA 4YNQA 1A5VA 4FJ7A 1QS4A 5D3GA 4CJLA 1VK0A 1U4BA 2XDPA 5KCHA 3G10A 1ZBFA 4CECA 3CFPA 1ZBUA 2RHZA 3FC3A 4NCAA 1L3SA 4Y1DA 4RG8A 3LPUA 1VSHA 1I39A 1UOCA 2KFNA 2CKKA 4Q5WA 3MAQA 1TAQA 4IUUA 1B9FA 3C6TA 4JS4A 5FRMA 5J2NA 1N27A 1RT2A 1TVRA 4B9LA 3K58A 2DY4A 3AA3A 4F2RA 1HPZA 2QQRA 1D8YA 3LGFA 1EKEA 2HNDA 2E6NA 3P8HA 5KGWA 3AVIA 4KI4A 3DOKA 1J54A 2HW3A 4DTSA 2M16A 4GMJB 2OPPA 3FEOA 1FKPA 3VQPA 4CJRA 3KLFA 1UAXA 3ULDA 4Q5VA 3V9SA 2BUDA 4OJRA 3VQ9A 4DS4A 5HP1A 3MXIA 2YHBA 3P5JA 4ID1A 1SKWA 2YKNA 4CEBA 4Z02A 4N5SA 3QEWA 3TAPA 2RHYA 3AVCA 1WJQA 5SWMA 2P5OA 4N4IA 1RT4A 2JZ2A 2B4JA 4E7JA 1LW0A 4CK3A 5J2PA 4F8RA 4FZXC 4J2DA 2F8SA 4BE1A 2XY6A 1RT5A 2Y1JA 3L42A 2JLEA 3PO4A 2OYQA 2E6MA 4UC4A 1KSPA 4FJJA 4I9QA 4DG1A 4C8KA 4M3UA 4Z0UA 3V9WA 2F96A 1CLQA 4CIGA 2M1HA 4FVMA 3EZ5A 3D0PA 2O4IA 1U48A 2XO7A 4GW6A 2BDPA 4DSFA 3K5LA 4CFBA 5C42A 4CHQA 1ASWA 3NF9A 3NF7A 4B9NA 3T19A 3FDRA 4OVAA 3QLHA 3TANA 1MHNA 2KTQA 1VSLA 4O0IA 3HP6A 3HXMA 1LV5A 4IUTA 4C8OA 1LWEA 5J1EA 4CJKA 5KTQA 1RT6A 3JSMA 4OPKA 2WOMA 3P8DA 4CIFA 1S5JA 3VQ7A 2GUIA 4QAGA 4RW6A 4DQRA 3THVA 2RHXA 4K8XA 3OYFA 4CJ3A 3QIOA 4M3XA 5C6SA 4CRIA 4CJVA 4DTPA 4KO0A 4FU6A 3M8QA 2YNHA 4B9SA 3UIQA 4JS5A 2RJDA 1LWFA 2JTFA 1JXBA 2RF2A 2YNFA 1VSFA 3SNNA 1BISA 1G15A 2DTUA 2MWOA 4E3SA 2KZMA 1S9GA 3AVBA 3LANA 4IBNA 4I9LA 4CE9A 4CGJA 4DTUA 2G8UA 3TABA 2DFEA 2PZSA 2XY7A 1SL0A 3HT3A 1XHZA 1NK6A 1HNIA 1OYXA 2EQJA 2YRVA 2HQEA 4BACA 4FK2A 2XRIA 4FW2A 4I2PA 4LSNA 3OYMA 3PX6A 4QQDA 4PA1A 3V1OA 2EKOA 4N47A 1J53A 4FLYA 1IKWA 4E7HA 1NJYA 3L2RA 3NH0A 1RT7A 3DRPA 3KLEA 1RDBA 1ITGA 3HPGA 2Z1HA 4CGHA 1UA1A 1XWLA 2R5AA 1LWCA 1RI0A 4E19A 1RBVA 1WSFA 3TARA 5J2MA 4FJMA 4CIEA 4NCBA 3V1QA 3VQ6A 4DU3A 4IUVA 2BIVA 2G8WA 4B8CA 1SKSA 5I42A 4KHUA 4B08A 4FCYA 3AO2A 3PV8A 4KI6A 4GY5A 3DM2A 3A2FA 5D6YA 3AO5A 4O5BA 4C5IA 1EETA 4CF9A 3SQ4A 4FJLA 1QHTA 1N5YA 4HVJA 4X34A 3KUFA 1J5OA 4CEQA 4O55A 4BWMA 3OS2A 4L8RB 3AVLA 1SV5A 3DB4A 3OYDA 4ZTJA 1B9DA 2EHGA 4ICLA 3OB9A 3QIIA 3DLKA 5CZ2A 4DTRA 2XY8A 4B9TA 2X74A 1RNHA 3MXMA 2RJEA 4PY5A 3KK2A 2RI5A 1LAWA 1WSHA 2X78A 3V1RA 3ZSYA 3TAQA 4OGCA 1HQEA 4LD0A 2NLUA 3I0RA 4KHYA 4OKJA 2K3YA 4W5RA 2HMIA 2Q3SA 3O3FA 3KK1A 1SSFA 2AJQA 2MWPA 4CF1A 3NGZA 4NS5A 3H08A 5IN1A 3RTVA 1U45A 2XHBA 3K5NA 2Z1JA 1VRTA 1CZBA 3PX4A 1G5VA 3VQAA 3OYAA 2WACA 1HQUA 3WNGA 4J2BA 1D9FA 4CJSA 4E89A 4LSLA 4KKOA 4QOZB 2DIQA 5CZ1A 4EZ9A 5KGXA 3VQQA 4PUOA 2LRQA 1TL3A 1SKRA 1HMVA 3HM9A 3OY9A 5JS1A 3K59A 2Z1IA 3NNQA 3DRRA 4E7LA 4B9UA 3KTQA 4M41A 2X4YA 3HPHA 4O44A 4IG0A 1SL1A 4K8ZA 4KHSA 2PYLA 4B9WA 4QQGA 2RI3A 2ZD1A 4H4OA 4CEFA 4E0DA 4CJPA 1U47A 4DTOA 4CJFA 2L3RA 2OPQA 2OZMA 4DSIA 4E1NA 4DF4A 3QO9A 3OJUA 3KLGA 3S3MA 4B8AB 3LH0A 2BKDN 2E5QA 3E9FA 1KCFA 1REVA 3AVMA 3C6UA 3KIOA 1JL2A 3L3VA 5FRNA 4OKEA 4AHTA 3PNWC 1ASUA 4BE2A 2G8HA 1Q8IA 1KLMA 4F2SA 1TK0A 4DFJA 4FJNA 4FYDA 5IAYA 1RDDA 1HYZA 4HCBA 1C0MA 2QQSA 4CF2A 4FLUA 4CFCA 4M3WA 3V4IA 2BANA 3K2PA 3T3FA 4BE0A 5HROA 1K6YA 3KLIA 4CEEA 3CM5A 3L2UA 1KVCA 4FLTA 4KTWA 2P51A 3M8PA 4OPJA 1NKCA 2F5KA 2VG5A 3K5OA 3AVGA 4FZZA 5C0MA 3LP2A 4NCGA 2B6AA 5DMRA 1Z26A 3PMIA 3QJ6A 4TSXA 1ZYQA 1IKYA 2IC3A 1C1BA 4M3RA 2YKMA 3KK3A 4FJHA 3SUQA 4CHOA 1S6QA 1NJXA 3NH2A 1BI4A 3AVHA 4FLXA 4J2AA 4FJ8A 3MEVA 5KCOA 2PYJA 2B8AA 1RDCA 4CJQA 4DFPA 5J2QA 3F70A 1GOBA 4CERA 5SZTA 3OQ5A 3Q1JA 1C1AA 3B6OA 3NH1A 3QNNA 3DYAA 3ZT0A 2PY5A 3O4QA 3DRSA 1YVUA 4CGGA 1FKOA 3CYMA 2R7YA 4Z4HA 3OS0A 4II1A 3MECA 3KJVA 1KTQA 2GF7A 4A4FA 4C5EA 1CXQA 3ZCMA 4Z4FA 3OMGA 3OYKA 2LVMA 2X4WA 3O8VA 4EDUA 1RBRA 3DLGA 2EQKA 2F8TA 4M45A 2R57A 1NK7A 4C5HA 1KFDA 5KH6A 1TKXA 2HNZA 4BDYA 3KKSA 5KI6A 4CEAA 3CFRA 1N6QA 1TV6A 4RW9A 4HUFA 3MEUA 4RG2A 2GFUA 4PL6A 1RT3A 2IOCA 2KW4A 5JS2A 3OYHA 3U3YA 1I3AA 4N56A 1IKXA 4BDZA 4LY7A 2OZSA 3DOLA 3IAYA 3S3NA 2RHUA 1JKHA 1IH7A 3AV9A 1D5AA 2G8KA 3RR8A 4AHUA 4M42A 4L59A 3HVRA 3VQ8A 1RTDA 1JLQA 2QXFA 3IG1A 3MEGA 2IG0A 4CHYA 3HJFA 2LCCA 5HRNA 4PQUA 1S1VA 4E7KA 2NUBA 3DLMA 3NF6A 3RMCA 4BDPA 1FXXA 4MQ3A 3I8DA 1KRPA 3BGRA 1JLEA 4F4KA 3OA6A 2X6SA 3NBPA 3NF8A 3KKRA 4ZTFA 1YTUA 5E41A 2LSNA 4CJUA 2GBZA 3WNHA 2DIGA 1X1PA 3MEAA 5T7BA 4DQPA 3CEYA 2D0CA 3ZSZA 1MU2A 3AO1A 3DMJA 3SD4A 2LTOA 2B5JA 2I5JA 3SZ2A 3U3GA 4AHVA 1KLNA 4EZ6A 1BIZA 4DU4A 4W5TA 2FBXA 3VQDA 3KD1E 2RHIA 4O0JA 4DMNA 1CZ9A 1IG9A 1WLJA 2VWKA 3C4SA 1NK5A 1NK8A 3LYIA 1S1TA 4KB1A 2E6LA 2L89A 3C95A 4OGEA 5C24A 4IG3A 3LWMA 4KTQA 2VG7A 3PUFA 4CFDA 4HUGA 5HLFA 2ZQBA 3H8ZA 1NK0A 3M8RA 3S6WA 1YT3A 1VSDA 2YNIA 3LGLA 4CCHA 2DFHA 3TI0A 1RCHA 3G0ZA 3HYFA 3U6FA 1X9SA 3AA5X 4RW4A 3NGIA 3OYCA 2D5RA 4N4GA 4DU1A 5HBMA 4HTUA 1NK9A 4DWIA 1WJSA 3CFOA 2ETJA 2HHUA 2PQWA 3I0SA 2KZZA 3LX7A 3HO1A 3ASMA 2HHTA 3VA3A 4KFBA 3SV4A 4FXDA 5KE3A 2HB5A 3SQ1A 1LAVA 1QQCA 2RKIA 3HP9A 1GOCA 4DQSA 4Q0BA 1BCMA 1RTIA 2X4XA 4LD6A 2IGIA 2YNGA 3UWNA 1BQNA 1VSEA 2ZE2A 5DK5A 3L2QA 1IO2A 1WSJA 4YFUA 1U04A 2DAQA 4DF8A 4N4HA 3UT1A 3RMBA 3O3HA 1CXUA 3S9HA 3ASKA 4IKFA 1FK9A 1RT1A 1SL2A 4KHQA 1WN7A 1XC9A 3P1GA 4RW7A 3PX0A 4DTXA 3PFSA 3ME9A 4Y1CA 4OKKA 1S1WA 1S6PA 3OJSA 1F21A 4FL6A 4R5PA 3QBYA 3ZEHA 3GOXA 1RBTA 3AA2A 3P83D 1BI4B 1BL3A 4EP5A 2RI2A
chains in the Genus database with same CATH superfamily
1I5OB 2JTVA 3CG7A 2BE7D 3P9IA 2FHDA 4FLZA 3EFRA 1VQ5I 4PJOG 3FR0A 3AGRA 4JRKA 1IBMK 2Q0OA 3CXCS 1YIJT 2PI0A 2PFBA 3NHGA 4IHYA 1VQON 1D3BB 1S72Q 4PUSA 1CF7B 3HKZA 3OH6A 3L2VA 1U8RA 3CQYA 3X25B 5GPAA 2OPSA 2L9NA 3HPOA 1ABOA 2IAJA 4F91B 2DOEA 3FHNA 1JQQA 5AQWA 2H8WA 5GAMh 2EA2A 2Y9ZA 3SJJA 3T7ZA 4C2MJ 3JCMQ 3H6ZA 3C2BA 1VQPN 4FVUA 3PIOL 2P5GA 4CA0A 3M7GA 1CF7A 1OCPA 5K1YA 4HQMA 2OPRA 2CDTA 3FFKB 3QQAA 5BMZA 2O8KA 3VS5A 5AQGA 3HZ6A 3MVPA 1X1CA 1W36D 4M77G 2WAEA 4B48A 3REAB 2DTZA 3CD6T 2HBMA 1JB0E 5J26A 2W41A 4AQYK 2W4SA 3OYIA 2D0BA 1IUYA 1VSJA 1U1TA 2FXAA 5AQSA 3AHUA 2A69F 1JLFA 2QYOA 3T5XA 2UUCK 2ZPFB 1LNXA 3EGXA 4A61A 2QM1A 3A5MC 3MKLA 3FFIA 3X28B 4HX8A 1M90O 1C0TA 3AFHA 1WH7A 2VBYA 4FPBA 4IDKA 3J7AY 1H8AC 5DCMA 3SCXA 1VQ6Q 1UA0A 3TMOA 3NTHA 3LALA 1BI3A 3TU5A 2AP1A 1TNTA 5FGMA 1A35A 3GFJA 4EMKC 1R58A 5KE2A 3CMEQ 1WWXA 2N8GA 1R5ID 4PSXA 4DYRA 1LCKA 1LVAA 3GF2A 5CJ9A 4EM0B 3QWXX 4NLCA 1N25A 3HK2A 3VSLA 4FM0A 3U9DA 4IEJA 4YNQA 1A5VA 1VK0A 2OTLA 4KH1B 4J19A 3O1BA 4NCAA 4MEXF 6PAXA 1QLYA 5E1ZB 4OMYA 1EKEA 3NRVA 5B5EC 1TWFJ 4M75C 1OCRH 2F5TX 4LLNA 3BG6A 1Q81O 1W6XA 2KIFA 4Z02A 4WQ5A 5LEJA 5BPNA 1YIJN 2JZ2A 1VQNN 2JLEA 3HSEA 2RK2A 3BCBA 1M3HA 4D8DA 5CKEA 4CFBA 1XOVA 4ASNA 2A40A 4Y13A 5FPMA 2P84A 1RT6A 2EBIA 2OBPA 1BB9A 2JT1A 1QW1A 1IGUA 2E71A 2GXGA 4FIBA 3M5AA 4N9IA 1R36A 1TWAJ 4S04A 4RGSA 1S22A 6AT1B 2K85A 3GP8A 3ZQCA 5GJVB 3GTJJ 1K1ZA 2P9NA 3L4QA 4KIFA 2F5VA 4MDXA 2QUFA 2FNPA 2HQEA 1X75C 1MBFA 4PA1A 3LQRA 2I7NA 4G9ZA 2AHJB 1RBVA 3SWNA 4NC8A 1ATSA 4EVIA 2CH0A 4LE9A 2F2WA 4AM6A 5D5XB 1N75A 3DLKA 3MXMA 2H6CA 4EHTA 1GHCA 1VQLT 3KCCA 1G3TA 2FPDA 4NS5A 4UUSB 5J4YA 2O3FA 1ON2A 3PSFA 2F5FA 3OYAA 1D3BA 2WACA 1HQUA 2E2OA 4E89A 4FT2A 5BRDA 2VKEA 5J4VA 1ETKA 1UJ0A 2VJIA 4A0YA 3DRRA 3WXKA 3O6WA 2LY9A 4DYQA 1KG2A 4E47A 3W3CA 3IQLA 1K9MO 2JUFA 4M7DE 2FEZA 1KCFA 4AHTA 3T1HK 4PJOF 5GAMf 1ZG5A 3HM8A 4HCKA 4HCBA 1HYZA 4JKDA 3CLOA 4M3WA 5HLIA 1X6GA 1ZARA 4F7UF 2DVEA 4HVWA 3K2PA 2ITMA 1D4XA 1BI1A 3CM5A 4QKUA 2XAUA 2P51A 4PJOD 2BY2A 2F5KA 1Z21A 1PM3A 4EV0A 4D1QA 2DBKA 3OYYA 1X9JA 4F9OA 1WJBA 4ZYEA 3AVHA 4OIRF 3CPWS 2PYJA 4M78B 3OQ5A 4CGGA 1NBEB 1JCFA 3MECA 2YRCA 4BBRJ 5HVQC 1N6AA 3LWFA 4P96A 3CO6C 3TEEA 4HUFA 4JX4A 3KX2A 1RT3A 3U3YA 4FYXB 2MLGA 3PGGA 1OX8A 3EHRA 3ZFJA 4M42A 4CCLA 1N9RA 3JCMd 4Z8AA 3MEGA 5HRNA 5KYUB 1XC3A 1OISA 1WSUA 1WHKA 2XICA 2CFXA 2IVOA 1K7AA 1ORKA 5H2FC 2NOBA 2LTOA 3Q9VA 4EZ6A 3S32A 4L5IA 4Q5SF 3C4SA 3I4PA 4F16A 2IBDA 1NMDA 3WEEA 1VQ8N 3U23A 4M78F 4M3BA 3KBGA 4RW4A 1M3CA 1VYUA 5FKLA 3DKMA 2NWMA 1NK9A 1KGSA 2ETJA 1WCMJ 4XLCA 3JCMP 3CWAA 1BUPA 4ZZLA 4NBQA 4BG8A 4YHHK 3UWNA 3GE1A 3RMBA 1KD1C 4IKFA 1GVDA 4LLLA 3ENOA 1G3SA 3J7AF 3CCVT 4M7DC 2F4VK 3R6MA 3OJSA 4JJBA 2LP0A 4MQ9F 3RESA 2LLKA 4IRGA 1U3OA 3K4KA 3A8HB 2CQNA 3OVNA 5GAMj 3B73A 4J9EA 3ONQA 3NDKA 3G4SN 4IURA 4A4EA 2D0AA 1KHCA 4LJZF 2VB6A 3BJAA 4CYCA 1R49A 1D9DA 4ABZA 4B1VA 1DDNA 2OCCH 1V5FA 4U88A 4PSWA 2JK3A 3FZLA 3SI6A 4MO7A 4L5JA 4DTJA 2O8BB 1V4RA 2HOSA 3BF1A 2LVSA 2O2OA 1VQKQ 3ASNH 1TUUA 1LFPA 3ZXSA 4B43A 2GV9A 4DBRA 1ZBHA 1QVFS 4E7IA 2VE8A 2IW5A 2P0KA 5D6WA 4KUDK 2WADA 3SLCA 4CHZA 1FIPA 2I5UA 3THWB 3BTLA 1HA8A 1YWPA 2DK8A 3QKJA 4WX9A 4GV9A 1VQ5N 4FTHA 3QICA 4FJKA 2EIKH 2JSPA 2O8EB 4AI5A 1MV3A 4OO1J 2BW3B 2HMAA 1GCPA 3ZMVA 4XLNF 3LOCA 4FYYB 3J81E 4FYWB 3LQQA 1BA1A 3WQTA 1UEBA 3V81A 5M1NA 1M27C 3S41A 2L54A 3J81O 3LAMA 2XC7A 5KK1A 1R23A 1LPQA 4QQ6A 2WONA 4KHWA 3ALYA 2KQ2A 1VQPI 3T1YK 4C3IJ 1X1AA 1T05A 1NPPA 5L3FA 4IIMA 2H56A 4MQVA 2DJNA 1I6HJ 2GELA 1B92A 3C65A 3SAFA 4U7BA 5J1YA 1AHJB 3GOIA 4AFUC 3PE0A 2NOZA 3VN5A 1B72A 1KD1O 3KYDB 2TCTA 2K79A 4E9GA 3HTRA 4RCBA 2FF4A 1HNWK 3WG9A 2DA1A 3EG9B 3GPLA 2ME6A 2A6HF 2DZ9A 3CESA 4W1UA 2FVUA 3E5XA 4G6QA 3K58A 2VC1A 2QQRA 3LGFA 3FZFA 3EUHA 2BV6A 1ON1A 3MWMA 1ZRFA 4N5SA 1WJQA 4V2GA 5F1RA 4A3CJ 3DKYA 2E6MA 3NWTA 5AZJA 4DG1A 4PKGA 1UGPB 2C06A 3K5LA 2NRAC 3CLQA 4EGZA 3QLHA 1MHNA 2VQCA 5FKKA 5LEKA 1K9MU 3ABLH 3JAME 4P55A 4HNUA 3UIQA 2IGMA 2JTFA 5HS7A 2YNFA 3VYHB 3WTYC 1XHZA 1OYXA 1YJNN 2QEXI 1VQ7N 4XN3A 2W85A 4JJCA 1YQKA 2R5AA 1HPMA 1E3MA 2EH3A 3D5LA 2RREA 4B8CA 1SKSA 3BR0A 4HX7A 3AAPA 3SQ4A 1SD4A 1WXTA 3KUFA 4JI5K 3OS2A 2CUBA 4D9JA 1I4K1 2HOEA 2CSIA 2YLCA 3R9PA 1OCOH 3GFIA 4XH1A 2KE9A 2K5LA 2X78A 3TAQA 1F36A 2DBBA 3I0RA 4RKUE 4O8KA 1HJOA 4CF1A 3GL1A 5IN1A 4GV3A 3ID6A 4BUPA 4ME7A 2E1OA 3PX4A 3WNGA 2I8DA 3L6QA 3ZX0A 1JHHA 4NO7A 4PUOA 5KGXA 3VQQA 2IS6A 2LRQA 5JS1A 1K73C 1D1BA 1VQ7I 2QEXN 2FO0A 3JCUC 1OKRA 2PYLA 5KNLA 3J80E 4X1VA 3FM3A 2Q1NA 4GDFA 3IH3A 2GBQA 1ASUA 3EHQA 3FXJA 3IKMA 4PHTX 1AVZC 4XICA 3CUQA 1OKJA 3J8AA 2DW4A 1HDPA 3CMAN 3KFVA 2BXYA 4Z88A 3MEVA 3PO4A 4KRTA 4DFPA 1BIBA 1W4MA 3GTLJ 1Z6TA 2IA0A 3WEEB 2ID3A 1XNRK 3HXLA 1B3QA 4BU2A 2GF7A 2AXTC 3E3VA 2Q2EB 3CFRA 4BDYA 1TV6A 4HLYA 1I3AA 4JI0K 5GAEJ 3S3NA 1WYXA 4JHDA 4BVOA 5IH2A 5AQJA 1Y8QB 2QXFA 3VODA 2IG0A 2F2EA 1SVMA 4J01A 2CZ0B 4F17A 4B21A 2E65A 4H4KC 2LF8A 3C12A 1KQ0A 3ID8A 4DQPA 2DT7B 2DA6A 2X1CA 3CCUI 4C0DB 1P2FA 2E1MC 5I11A 2WBNA 4AHVA 2JA2A 1VQ9Q 4KGXB 2DQLA 5D8LB 3C95A 4OGEA 4GKKK 4HUGA 1N3CA 3CWSA 3OWTA 2VXEA 1IV0A 2MAMA 4CJ7A 3JRGA 4LF4K 2B63J 2KRFA 3I0SA 3LX7A 4DOWA 1MPGA 1IN4A 5KE3A 4AF1A 4DV4K 5F6FA 2R5ZA 2K40A 1ACMB 1OPLA 4N4HA 3H9NA 3S9HA 1RKTA 2M7AA 5M3MJ 2M02A 2DYBA 1YI2Q 1X3WB 4C8QC 1OQYA 1RRJA 3FIFA 2ZJPL 1U49A 3M59A 4B4CA 2MGQA 2E1CA 3QERA 1LFUP 2W10A 3LP1A 4IVNA 2OC6A 3EG2A 1KEAA 5AIPA 4F3QA 1DP7P 2ROTA 3SUNA 4DW6A 3JCMJ 1ZG1A 5CKBA 1IRXA 3TPQA 3QESA 5KVRA 2E5LK 1A0NB 4KUIA 4B3SK 4G7OF 4A2UA 4U87A 2QEXT 1JKOC 4M77A 2Y0SN 4BD3A 5EDNA 1ZHIA 3VDXA 5DM6L 3EAEA 1IN5A 4XLHA 2HNYA 1Q9YA 1DGKN 4C1NI 4PJOC 4ISEA 4IHVA 1T6DA 1FYNA 1AHDP 1XCVA 2KY9A 4RB2C 2BW3A 1M3QA 3L8BA 1X01A 2E4HA 1BIUA 2ZO4A 1YFNA 3ZLJA 1WVRA 3K70D 1GLJO 3I0TA 4QPOA 1YJNA 4W5NA 1B8IA 1QVPA 1X6OA 3SQ0A 2BGGA 3VQEA 4YFNF 3G71A 2CFOA 2X9DA 4KMUX 3CF5L 5I3UA 3DWLE 1L3VA 1QZ6A 3I5SA 1L3LA 2HHHK 2ZJQL 2CV0A 1WHUA 3LDQA 1ZSZB 1TG0A 2HHVA 2H3GX 3OHRA 3SYZA 1Z9QA 5HKCA 3G6EI 2ZGZA 2X9HA 1JE8A 3FE1A 3EH1A 4LFUA 1WPKA 2ZNZA 5H1SQ 4C8QE 5JVTA 4B3XA 3HKZN 4JI4K 4I7HA 1VQOA 1YTAA 5HODA 4OVLA 2KROA 3CJCA 3QUIA 3RDVA 3N4PA 4RTWA 2EX3A 2DU9A 3QYHB 3FGUA 1J2XA 5AQNA 3KEOA 1NOYA 4JYKA 4JKHA 1VSKA 5GAN7 3TSZA 3ECHA 3QWLA 5HOOA 3D7EO 4OMLA 1PP7U 2XAHA 3BG7A 2EFPA 2A1SA 3EE9A 1IXCA 3KP7A 1YITA 3HDDA 3PNTA 1NG7A 3AAFA 3L9FA 3BR5A 1B34A 3F9MA 1VQLQ 4Y1DA 4TV7A 2I0NA 4IUUA 4JLGA 4JS4A 5J2NA 5IWAK 1TVRA 4DR5K 4F2RA 4YIRX 3P8HA 4DK9A 3R6OA 3GBTA 3VQ9A 3IRRA 2KIMA 1PSEA 2M0CA 3NVKA 3FXUA 4H5TA 1TT0A 3H5AA 4X9DA 4PKCC 2RAEA 1WZ2A 1V4SA 2PBDA 3THXA 2QM3A 4PJOA 2WY7Q 2PG4A 1KD1R 4N4OB 3NF7A 1IREB 1SC7A 2VBWA 2XRLA 2OPTA 3E5UA 1JKQC 2NLXA 1AU7A 1Z05A 4ENKA 4IUTA 3CDHA 3ZMDA 5JLWA 1D3YA 2SEMA 3THVA 2GUIA 3NARA 4DBQA 2CP7A 2V7YA 1W70A 2RF2A 3CP2A 4OFAA 1VSFA 3IL2A 3AVBA 3GEZA 3TREA 4O5VA 4BC3A 1RETA 5HNFA 4V2FA 3GBGA 1PRLC 4R0KA 1X3NA 3OV8A 4YG2F 3L2RA 3BR3A 2STTA 1ORPA 3FK7A 4A12A 1WDXA 4OMOA 2HBJA 5DM7F 2G8WA 2HXIA 2RGVA 2WBMA 3SFIA 4EATA 4X34A 1QKXA 3OYDA 3T0YA 4DTRA 4OMMA 2Y9YA 5TISC 2H27A 1W5CC 1XMKA 1KQ8A 1YJ9I 1YG2A 4IRHA 2E20A 3HOYJ 1SHFA 4BY6B 1N77A 4WYBA 3BG3A 2V79A 3OBYA 3I33A 1ZYRF 3JB9J 2ESWA 4FYVB 3CCJT 4VUBA 5DLQE 2VXDA 3K1MA 3HPHA 1TNSA 4U7DA 1J5YA 1SRLA 2IGOA 4JHDB 3SDBA 2OPQA 3EUHC 1IHVA 2XD0A 2Z2SB 4MLHA 2XDVA 1WJCA 4HUEA 3SB2A 1RRSA 1RDDA 1FJGK 2LG4A 2XGXA 3S14J 2J7IA 4OIPF 2G6FX 1RLPC 3QJ6A 2M9UA 3SUQA 5HLTA 4OP0A 2J6FA 1BI4A 1BI0A 1N32K 4LDUA 4IPAA 3WE2A 4OFHA 1C1AA 3A03A 3ZT0A 4KICA 4A4KA 2CP0A 2QKMB 4QIWN 4PKHA 3I3LA 5L3EA 1YQRA 2DK3A 1PC0A 2HL5C 4UB6C 2Q97A 1V54H 4KH5A 3MKZA 5DTDA 3V7CA 4XSXF 4BNCA 3A5OC 3O9QA 1KQJA 2IOCA 2K2MA 4K25A 4AIDA 4BDZA 2IS1A 3AV9A 4FWPA 1WH5A 1UGVA 3IG1A 1LJOA 4C92G 2LKPA 2DOFA 3KKRA 1XQSC 1MH3A 1YWOA 2L3PA 4ITVA 3F5TA 3HIFA 4UNOA 2PBIA 3O6BB 4BAYA 3EPZA 4EEFG 2JJ9A 3X2QH 1YJWN 3PUFA 1LB2A 4XBFA 3EUAA 3S6WA 2RH2A 2QTVA 3D7SB 1BA0A 3G0ZA 1BDGA 4HF1A 5C3EJ 1NU0A 2KQRA 4E70A 5CCAA 1WJSA 3Q7BA 2DL8A 2LBFB 1J7KA 4A69C 4JN4A 4DA4A 2RK1A 3PIOA 4NL3A 1ZN2A 2IGIA 2ZE2A 3F8FA 3OW2M 5D4RA 3QPLA 3IC7A 2E7XA 2NUTB 3ME9A 3QBYA 1G2HA 4DSLA 1LDJA 2QA4T 2MLKA 4BXFA 1P7MA 4CEZA 4BR5A 4GLKA 1Q9XA 4M75A 1YI2N 4ILGB 4PCQA 3M4GA 4PFPA 4YORA 4LF8K 1FYLA 5M9OA 2ZJ2A 2G9WA 5F27A 3TAMA 1PD0A 4BRGA 3VTHA 4EP4A 3DKXA 2VWBA 4ORZA 3PQJA 2FMYA 3E6BA 2PJRA 5HRPA 4C8LA 3FRNA 3DLBA 3ZQLA 4ELTA 3CVTA 2HNIA 1I50J 2VODA 1MNEA 2L5QA 1IAWA 3FXLA 1Q7YR 3EO3A 4S05A 5IYCJ 1T3VA 4XU3A 2V75A 4KRFA 4OMPA 5CVRA 3S2WA 1QSLA 1X6BA 1Q7YO 4C8NA 3C7NA 1Y0MA 2G3RA 2L9SA 2W25A 1B7TA 3VGLA 2RQWA 4ESRA 3EG9A 1VQ9A 2LY1A 4JX5A 4DTMA 2O01E 1D0YA 5BPDA 5KYXB 3LP3A 2QSGX 3BZ6A 2E1HA 4DV3K 1LQ1A 2JXBA 4M75D 4DV7K 5EYRA 3JTGA 1M90C 3HKSA 4BGAA 2RJCA 4CJ4A 4ESJA 4BHCA 3V9UA 4DFKA 4X64K 2NS8A 1VSIA 5C25A 1AOJA 1L5UA 1DP3A 3ZX2A 4LDVA 1W5SA 4UQGA 1T39A 1BU6O 1S1UA 3M1CA 1UB9A 4LB5A 4HX4A 5AQTA 4DEYA 3NEUA 2QGGA 3JRDA 4I76A 4LN2A 2P9IA 1T33A 3BDPA 3PNYA 1NGAA 4BY7J 1R0BG 2VUBA 3HJEA 2K3XA 3A02A 3ZBDA 1SUQA 2PMUA 1YX5A 3G71I 1PKTA 1OU8A 1D8KA 2CGHA 1EH8A 4A3BJ 1YW9A 3NPFA 4BRFA 1Q86U 1N8RC 3ENHA 4NXMK 4BKXA 1NJWA 3DTKA 4FW1A 3KP3A 1Q95G 1H9TA 1IRGA 1V29B 3UKRA 3R6SA 1TWBA 4KNYA 3C7NB 4DIQA 2MIOA 3EG0A 1E4FT 4A0ZA 3VS0A 2KT8A 3FC3A 4J9BA 5GTIC 1UOCA 3I64A 5DV5A 1RT2A 1HPZA 1LDKB 2HNDA 3FEOA 1ZX6A 1Y0UA 3MXIA 4ANJA 5FLXO 2O8FA 1WJDA 2P5OA 1DPUA 4CK3A 4A3JJ 1BYMA 4M7AD 5B8HA 1CLQA 2XASA 1SG5A 1RGIA 4OINF 1RC9A 4FVMA 1MMAA 3EZ5A 5LJ3f 3C18A 2V8IA 4J9CA 2XO7A 5AQOA 3ZMTA 2E8AA 1T0HA 1Y96B 3OBWA 1J9IA 2HQRA 2YUSA 4LB6B 2LT4A 5J1EA 1VQOT 1MA9B 3P8DA 3VQ7A 3H35A 1XNQK 2BVMA 3D1NI 4ZZDA 1S72A 3M8QA 2KK4A 2CGPA 2R0QC 4A3FJ 3HTUA 2LD5A 3BPXA 4E3SA 2A7YA 1QRYA 2YX4A 1T98A 4IBNA 2LQWA 2CH4A 5I22A 2DLLA 1E4GT 1J0RA 4QQDA 1J53A 2HQHA 2XAJA 4L6V5 2GX9A 4ESBA 2HBLA 5J2MA 2GAUA 4J9IA 4X6AJ 1WJEA 3ZOBA 2M4KA 4GY5A 5GIPA 4YOWA 4OB2B 1QHTA 5BRFA 3J7ZO 1SPKA 4DV0K 4MFDA 1B9DA 1UE9A 3DQVC 4BHBA 3ZSYA 3CCQT 4AFSC 1RUNA 3M53A 1HQEA 4JI1K 2VV5A 1MH4A 2MF2A 3EG1A 3NGZA 1HNXK 1U45A 2VBZA 1NYFA 2JMCA 2EZKA 1FMVA 2VONA 2C0OA 2EB7A 5CZ1A 2O8DB 3HM9A 1GUUA 3CJ1A 2XAQA 2A6EF 4B9WA 1WZOA 2YT6A 4O8UA 2VKHA 1GV5A 1GLEG 2P7VB 3QU6A 2QDYB 3OJUA 3CC7I 1YI2I 2VVKA 4DS5A 1XDUA 2X6WA 4LMYA 4OKEA 2DLPA 1KLMA 2PMHA 5IAYA 2XF7A 4BG9A 3T3FA 1BW6A 2BZXA 3JRFA 2ZAEA 1KVCA 1V55H 3CCET 3E2UA 4FLTA 4OPJA 2EJ9A 1TQIA 2JZYA 5DMRA 3LP2A 2QQBA 2VN2A 2C0TA 4M3RA 1GFCA 3RUXA 4N0AA 3FBNB 2XI9A 2OV7A 1RDCA 2ZC2A 2V9KA 1S6LA 2ZSIB 1ZGJA 5AFUH 3O4QA 3ZPLA 5GANd 2YX6A 3GW2A 3VGKA 1MMNA 3ZCMA 3OMGA 4EMKA 3GFMA 3K0SA 1DEJA 2KW4A 5JS2A 1O3SA 2LH9A 4AWXB 2KVQG 4N56A 2RDPA 3DOLA 2M4GA 3CP8A 2UV1A 4C92B 1SMYF 2HI3A 5E79C 4CHYA 2CMPA 1RPWA 5FKNA 1W36C 2CJJA 1RIOH 4B1ZA 5GAN5 3NBPA 1LE8B 2XHCA 1FMKA 1OJLA 5LJ5d 3WGHA 4JX6A 1NKUA 1N3AA 2FSKA 2VWKA 4KTQA 3PFYA 2FLOA 3VENA 4HAMA 1VQ4N 5TRDA 5J3LA 3LGLA 2TDXA 2DXCA 3C6HA 4E6RA 4WF2A 3CFOA 3LWHA 3WUHA 3CF2A 5FO5A 1BW5A 4PK4A 3LSRA 4DQSA 4DV2K 5F2RA 4LD6A 2OD5A 4XU0A 3A01B 1X43A 2DAQA 3O3HA 2OTLN 1RT1A 1UDLA 1VIEA 5LJ5e 1K6OA 3EFSA 3L2ZA 3JREA 4DTXA 1FN7A 2BHYA 4Y1CA 1S1WA 1F21A 1ULYA 2E6ZA 1BL3A 2EFWA 2D9TA 3CCUA 4CK1A 1HJRA 1QSYA 4BBSJ 4J5YA 1IXDA 5CR4A 3O80A 2RPNA 3SEQA 1HSTA 4ELVA 1JUSA 2Z99A 2KLAA 3L09A 3KWIA 1YJWT 4BRHA 4ZHRA 5KN8A 1NNEA 2Y31A 2QCOA 4U0VA 3ZSVA 1P7IA 2QASA 2GNCA 4A4GA 1SRMA 1HDDC 4KV8A 3AVNA 4AH9A 5JHFA 4PJOB 2P9PA 4GLMA 3VF4A 4C3HJ 1TK8A 1HKTA 2LZ6B 2M9HA 2FBKA 4XIUA 4FJIA 4DQIA 1Q81U 2RPIA 4ID5A 4BYYA 1RESA 2FG0A 1MUZA 2DODA 2XY5A 2PTKA 5CYMA 2J6KA 1Y6IA 4GVMA 2RN2A 3BUZB 2EQRA 2Y69H 3H0HA 3HRGA 2EJFA 2YUOA 1YOVB 2COWA 2Y4YA 3VS3A 1ZUYA 3RR7A 3TW7A 2Z9OA 3DB3A 4BWJA 1UG2A 1T2KA 4FT4A 4QSHA 2E60A 2ZFUA 4F92B 1SZ2A 5BN9A 2W42A 1RR8C 4EAHD 3F9KA 4OAZA 3D2FA 1Q1HA 1SQKA 2ZMEC 2E1YA 5JVHL 1YAGA 4PWDA 1JLAA 4K42A 4RTXA 2V9PA 4FT8A 4I02A 3S17J 3VYUB 1D1AA 1MMDA 3SXYA 4HTLA 3PMTA 4QCLA 3DLHA 2K9LA 3G73A 2IVWA 4CHPA 4AHSA 1JLCA 4E1MA 4WFBL 1YRNB 2OTJN 3HEFA 2QWLA 4NHJA 2MW8A 3QP5A 3QEIA 3CCRI 1RDAA 3L1AA 3CD6Q 3CJ9A 4WQ4C 4EIKA 2MC3A 1OVQA 3EYZA 3G71T 1UFMA 4MTDA 2QSFX 1X69A 2LRDA 2QENA 1SANA 4CDGA 2GUPA 4WCIA 4G7HF 4M6VA 4QVDA 4IFVA 4HDUA 4XQFA 4FL9A 3CPWM 2CW7A 1PDNC 3HOWJ 2RNAA 3DV8A 2HQXA 3SJHA 4JPBW 4M4ZA 4BJTA 3OR1C 1G3YA 4CBXA 3B6CA 4C0DC 2XRNA 2X6OA 4BY6C 2MC4A 1TAQA 3COAC 2D1HA 2LX9A 3SFMA 3HSRA 2E6NA 1J54A 4DTSA 4KIGA 1XSXA 3EKUA 4MZMA 2KL4A 3G4SQ 4Q5VA 2DTRA 1ZRCA 2ZGYA 1SKWA 2Q31A 4B8XA 1ZSZA 2QLZA 1WRJA 2OYQA 2NOJB 1QNTA 3BLYA 3D0PA 4XTWA 2IA2A 2HXOA 1QWEA 5E18F 1MNMC 3A5LC 1YX3A 2P81A 1LWEA 4J9DA 5FKOA 1MKMA 1KK7A 5CVVA 1DGWY 1ZGWA 3CDLA 2YNHA 2EIMH 4JS5A 5KN9A 3TKYA 5LHHA 3GYHX 3CMEA 1B07A 3O9SA 1R8OB 2MWOA 4DTUA 4CE9A 2DFEA 3IDHA 4Q48A 4X66K 3HFOA 5CHIA 3K70C 4I2PA 2VJJA 4JKGA 1XMOK 1M2VA 3CMET 3HPGA 4B22A 2YU9J 2JMWA 3JAMK 2LNHB 4FJMA 2NOIA 1VQKI 4AVPA 1YJ9T 1VQLA 1HCRA 1M1KR 3CCQA 5AN4A 1KONA 5LL6S 5BR8K 4C0GA 1XJWB 2M5WA 3FMSA 3LMMA 2JM9A 1U1SA 2L0KA 3O9TA 4RTZA 2WV0A 2JA5J 2RHKA 2DA9A 3O2PE 3AGKA 5ICGA 2DA4A 4HSRA 1IXSB 1K76A 3RTVA 1ETOA 1OCTC 2VPRA 1DU0A 3QAHA 1QP3A 1VRTA 2IP2A 3FBIB 2NOFA 1PYVA 2HYFA 1WJ5A 4YOQA 2FOKA 3O8HA 1NTCA 2EQIA 4Y4RA 3CETA 1RDUA 4HF0A 3GZNB 3KZYA 1SL1A 4EJTA 1KQSS 1Y64A 4B3MK 2RI3A 4E0DA 3KLOA 1U47A 1XMXA 2L9VA 5AQUA 2ZJPF 1L0OC 3HSCA 4M78A 3PIPL 5FLMJ 1IBKK 2K9NA 2M0YA 2Y4XA 1Q8IA 2XSDC 2JRTA 3VOEA 5JVGF 4LD5A 1NJIC 2L4MA 1CSKA 5GAOr 2JVHA 4IOAF 4XRFA 1QVTA 1SD7A 5BOXA 1B6AA 1SAXA 3F70A 2PY5A 2K4JA 1MBGA 2FBIA 4B3AA 2LVMA 3X26B 1WB9A 2WTUA 1JUPA 1BOAA 1NK7A 4BEHA 5AR0A 2HNZA 1SSHA 3MEUA 3C1DA 4MDBA 3E5QA 1Q81C 1ZSZC 4YTLA 4L59A 2JMAA 4LDYA 4HA8A 4LD9K 2F9WA 3CJTB 4RCHA 3PLAA 2E2JJ 3CC4N 1JLEA 1MMGA 2GIZA 2KT0A 2B0LA 4ZTFA 1TWCJ 1A6QA 1X1DA 1X1PA 2JUGA 2HQNA 1AOYA 2PU9B 2O0YA 1YQLA 2DTOA 1TH7A 4W5TA 3M55A 3HPWA 3A0IX 4IG3A 4KBMB 5HLFA 1NK0A 5IXFA 1YT3A 4M3DA 3HYFA 4D8KA 3BT9A 4FWKA 4IWVA 3H3OB 4DWIA 1U5TA 1FW6A 2P9UB 1Q86C 1N8RU 1NGCA 4G7ZF 3I5RA 2KRCA 5ICEA 4XTVA 5GINA 4X62K 1QQCA 1FOWA 5KQ8A 4GVEA 1YJ9N 5BQTA 2KISA 3BTIA 3FF5A 1YJNT 3HHTB 4M7AB 4UY8O 4UY8I 1HKSA 3EEQA 1EJ9A 4M3TA 2YR2A 2K5FA 2X6YA 3ZSRA 2OU2A 4ELZC 4IEEA 4CEOA 3CJQB 1MDMB 1EH6A 3IWFA 2XHKA 2CO5A 4KH0B 2X6NA 2CZ6B 1U6GA 1PU8A 2E2PA 1LUJB 5L23A 3A1YA 4LF7K 3W2AA 3LCNA 1WIEA 3F72A 1VQ7A 1KU3A 3L3UA 2XPWA 4N0AC 3NVMA 4HWIA 1UMQA 2X4JA 1J9AA 3OGDA 3H3UA 4PLLA 2LJ1A 2BYVE 3OYJA 3NTIA 2FPEA 3HG9A 4Y15A 3ZETB 4OLBA 2AXLA 3PL8A 3GVAA 2NUPB 5M1KA 5ILUA 2QGUA 4DQQA 2XHIA 4CEDA 2D5VA 1W5TA 1O3TA 4Z4FA 4CGIA 5E1XA 3QNOA 3FKJA 2K9MA 3UNGC 2HQ5A 1IV6A 5A0LA 2RQRA 3M0SA 4CJEA 4KN7X 5L8RE 4PJ0C 3W2WA 3FK6A 1YITT 2MYSA 1BHLA 4E9FA 4DSJA 1ASVA 4MZPA 1F1BB 1UWBA 4M7AG 2UUZA 4A62A 2JWTA 1X3MA 3KETA 3QZ5B 4ISGA 2PLYA 3CBOA 4BJ6C 1VQ4I 3RR6A 4FZYA 2XGDA 3OA9A 4KMFA 3G2BA 2JPSA 2CT4A 3OYBA 3OYNA 2VC8A 3DJCA 3M3ZA 3N5BB 2O8BA 3UA7A 2ISYA 4J6XA 4UUVA 2DO7A 2JVVA 1JI8A 2QTXA 1NGGA 3LM2A 4O4GA 2F4IA 1KJWA 5L3CA 4D7MA 1HYOA 1HSQA 1OV3A 4OB3B 4B1RA 1QVGA 4MMLA 2K27A 4PFZA 3LL3A 3M54A 2PUKB 1TKZA 2CUZA 4C8QD 2DAOA 1FSHA 1Q86O 2AIRB 4I7FA 3KHYA 1SVOA 4H0VB 2QWNA 5J6XA 3H0DA 1OFCX 1RBSA 3ERED 2DI3A 2P9SB 2O61A 5E84A 2FUG2 5L3GA 4DLGA 2BE2A 1LOJA 1A04A 5E3LA 4S0HB 3TP3A 4CECA 2R7RA 1GLDG 4M77B 3T1BA 4M9SA 1R9TJ 1MUDA 1I94K 2ZB9A 5A2QO 1HK9A 1X4OA 4OB0B 4J2AA 1YIOA 3A5NC 1LVKA 5F1XA 3GX4X 4J9GA 3EH2A 2CS7A 1ZG3A 2EYYA 5AIQA 5SWMA 2B4JA 2ECBA 1XN7A 2F8SA 2XY6A 3TGNA 1YITI 4FJJA 4M3UA 4Z0UA 2F96A 2XUBA 4QS9A 4X9CA 2OTJA 3K4BA 3S93A 4HG2A 4B9NA 3CCJA 3TEDA 4JNEA 4GV6A 4RTUA 4MDWA 3HP6A 5GAOp 1AWCA 2WOMA 4DQRA 1LJ9A 2A3ZA 2GEMA 3RPQA 1S9GA 1O13A 4XTZA 2H8HA 1NK6A 2YRVA 2KLOA 3Q9SA 3PX6A 2F4MB 4YIFA 2CUJA 1M30A 2WAQN 1HNZK 5FU6B 2H8RA 2Z1HA 5ILSA 4E19A 1MDUB 4YOYA 2DDAA 4A3DJ 2M51A 2BIVA 2LCLA 1H8KA 3PSIA 3A2FA 5D6YA 3FWEA 3MFKA 4F7UA 4DUZK 4A5NA 2R7FA 4C1NK 4RM2A 4O55A 2D0PA 4HOBA 5KCMA 4U67L 2MI6A 3O3FA 2AJQA 3KYCB 2MWPA 2HAXA 3MZYA 2GCXA 1K73R 5AQYA 4GBQA 1N9SA 2B9SA 2JA7J 1H641 4QOZB 5AQFA 2MBFA 3L00A 4RMNA 2G0EA 2P9UA 3K59A 2VE9A 3H92A 2O8FB 3J7AP 2X4YA 5CKFA 1RR7A 4H4OA 4RAFA 1KU7A 1HUXA 2NRXA 3S2HJ 3KK3A 2FNAA 4JK7A 3PNWC 3OOUA 4RB0A 3HRSA 3OH9A 2BANA 1OQKA 4C92D 1K6YA 4L9VA 5JLXA 4KTWA 3CJBA 3VYGA 1NKCA 3VS6A 3CC2N 1Z9CA 2YKMA 1PU6A 3E9LA 3DBHB 1XGNA 4YDUC 4KH4A 4WXCA 2AKKA 1GT0C 1RLQC 3V7RA 2E2NA 2WFBA 2EYWA 1RBRA 1FZPB 3DLGA 2CGLA 1MJAA 2VC0A 4PL6A 1Q82R 1WEFA 1JO8A 1RAHB 1GV2A 1FTZA 1XQHA 5LHGA 2OAWA 4JAXA 1S1VA 1KRPA 5C4XJ 3J7YJ 3CCEI 5T7BA 2VXFA 4JI2K 1R00A 3GDQA 3U3GA 1KLNA 2NS7A 2P9KA 4DU4A 1F4KA 4E6KG 3RSNA 1HBXG 2RHIA 2ZKZA 3LWMA 4EJVA 2ZF5O 3W6JB 2KFDA 2M8EA 2YSRA 3SEMA 1X9SA 1HR0K 2LMDA 3F23A 3SMSA 4OAYA 5GAHJ 5LBQA 2AS5F 2BH1A 5AQZA 5F0XA 2NAZA 3ASMA 1Z77A 1BCMA 4C92C 1U04A 4BC2A 3FJPA 1SHGA 1CXUA 4M78G 1K4US 2CQQA 5JHUA 1BG3A 1M90R 2PMZN 2FX0A 3NGPA 1BQMA 4B9XA 2IS3A 3WTUC 5A2QK 2VQGA 3RBBB 1TL1A 2D1XA 1K8AR 3QMLA 4CJWA 5F0FA 1UGSB 1UG0A 3NE6A 1Q7YC 4U0YA 3BEXA 1V4TA 5IHNA 4JK9A 1K9MC 1S72N 3NFCA 1WJFA 1OH5A 3ZSOA 4RTFD 4HXJA 2CUDA 4HCCA 5FU7C 1D8JA 3AO3A 5I21A 2JW4A 3ZR8X 5IT3A 4IUQA 1S9EA 3PJRA 2RVCA 1BIAA 3MO8A 3AG1H 3ZN0A 2A41A 4ZGDB 2DMTA 5GAMe 2FRYA 3H6EA 3E66A 3MEEA 5EGOA 1U5TB 1RTHA 1YIJA 3OYLA 3BJOA 5E20A 3RI4A 3H1QA 4FK4A 3KVGA 1WAFA 4IOAL 3MKWB 4JV5K 3ZQHA 1TXQA 2DXIA 2KEAA 1JXSA 4PNOA 4CZCA 4OWRB 3U1DA 3LLRA 3CBPA 2Q1ZB 1T38A 3VQ5A 1FP2A 5FD6A 3Q0WA 2XAFA 3F6VA 3ZMZA 2HKXA 3ZT2A 1E3PA 1PP8F 2KFZA 5JLHA 3MEXA 1P4WA 4OMQA 1FYKA 3GLXA 3NAEA 3U1KA 1LKXA 4BL0B 4LK0F 4FM2A 3TAGA 4BB7A 2DMPA 2HKOA 4JJNK 2EJGA 1WBBA 2X51A 3NCIA 1XGMA 5CY4A 4BRIA 1VQPQ 4BUGA 3CCSQ 1W0HA 1OR7C 2KXDA 4I0AA 2VQHA 2HHWA 1K9MR 1U9OA 2XDBA 3SJMA 4CI0C 5HDKA 3K0LA 3KP5A 4FPAA 5D3GA 4CJLA 4FASD 1L3SA 3HGYA 3LPUA 4B1UB 2X1EA 1OCCH 1OCZH 4Y7NJ 4XNFA 3DOKA 2QA4A 1P4XA 3VQPA 4CJRA 1FKPA 3JCMh 4DS4A 3V9SA 4X1EA 3WTWC 3P5JA 4PJMA 1ETYA 2RNJA 3WTVC 4WCGA 3TAPA 2A0FB 2R7ZJ 1BC8C 3GTKJ 4BE1A 3OR2C 2DNUA 3TO6A 1U48A 3I59B 2E88A 5TKWA 2NNWA 3J80O 2P4TA 4OPKA 1JKRC 1VQOQ 1G6NA 4K8XA 2D2WA 3OYFA 1QQJA 2FE3A 4F52A 4X65K 2DQRA 5ECAA 1IC8A 4C23A 1WFWA 4W97A 2IXSA 2EV0A 3I4NJ 3QFUA 3PM1A 1Q82C 1T08B 4FK2A 3P7NA 3QPSA 3HRTA 2BZ8A 1VFCA 1I1GA 2FU4A 1T0JA 2GWJA 1YI2A 1NH3A 1GFDA 4DU3A 2KHOA 4FM4B 2DJZA 2OTLQ 4B08A 3AO2A 2PMZA 1XTAA 1JKPC 1VQPA 5GIOA 3BWGA 2GA2A 1K79A 1YCSB 4XRSG 2XY8A 3UKUB 2RI5A 1R59O 3IKTA 2WTEA 2WV1A 3F8CA 2H1KA 2QYZA 3ER0A 2K3YA 2DKGA 1EWRA 2L7KA 1UHSA 2TRTA 1IGQA 4BEHB 2Y0SA 3DEUA 3JCMb 4CBUA 1USSA 1X2QA 2COMA 1CZBA 3W0LA 2XF6A 1G59A 1D9FA 4LSLA 3MZ8A 2ZCWA 3MQ0A 1KG4A 3NNQA 5AZIA 3QDKA 4B9UA 4OX9K 1K4SA 2Q36A 2R3SA 4FQGA 5M1PA 3JCMe 1NJIO 3BY5A 2L3RA 3BOQA 3ZGKA 3INZA 1WQ2A 3LH0A 5C0YA 1UJ8A 2E1ZA 4BE2A 4CW7B 1VQ8T 3JRZA 4GFBA 5ELZA 1JT0A 1UUEA 4CF2A 3EUKL 3CC4A 5GTHC 1U5TC 2ED1A 3JW4A 2XSJC 5HLHA 4LF9K 1ZYQA 1IKYA 4BHPA 5DDGA 5D5VB 1KIKA 3WXIA 5M5YJ 4CERA 1U2VB 2DMOA 3CC4T 2QWWA 2MOXA 4LF6K 3I56Q 2FSNA 1ODDA 4RLFA 3I0WA 4M45A 4A6DA 1QVFP 4RG2A 4NC6A 2EINH 3SBGA 2DA3A 4CCJA 1IKXA 2XIGA 3I54A 5BRHA 1VA7A 5GAN4 4K41A 1RTDA 1P92A 3CXCP 2HEQA 4MGRA 1RABB 4DV1K 1S8NA 5CHZA 2K86A 4F4KA 4E1JA 5DYMA 5E41A 2DIGA 1UCRA 4AG1C 2KQWA 2NRHA 5GANe 4L0YB 2VIXA 2L3SA 2FBXA 1RACB 4MO4A 3EYYA 2IVNA 2LNVA 1NK8A 3RQ4A 3HYIA 2ZQBA 2OI3A 1VSDA 3SK3A 1RCHA 3U6FA 3THYA 4L18B 4MMKA 4B3TK 3KZBA 3BJ6A 2BE5F 3CXCM 2UZKA 4HTUA 3G4SA 3CWTA 1APLC 3RMSA 5CVIA 3PUBA 3VA3A 3CPWA 3M58A 2HB5A 5LD2C 4IOXA 3J7YP 2IPQX 3L2QA 3CCRQ 1WSJA 3DBRB 4DF8A 3UT1A 3MCPA 3M8FA 2DRKA 3S1MJ 4M6YA 1ZA1B 4DHYA 2A5WA 1Z7LA 3JTHA 3E1YA 3VEWA 5IHIA 5E26A 2KIUA 4B6MA 4JLHA 3EFOA 2KI7A 4FJGA 1W9HA 1VQLN 4LH4A 3UPUA 4L0ZB 1GVJA 2ZXWH 3R3LA 3ZT3A 3LWLA 4HV5A 2L8DA 2H94A 5EF6A 2L7MP 2E70A 2J6OA 3SV3A 4A63B 3H0IA 3QEXA 2WAQA 4K43A 3CC2I 2MFZA 1VQ9I 1NBWA 2WSFE 4YY3K 3E9GA 1VQ4A 3AVKA 1TQPA 2HBPA 2KPMA 2COZA 4IFYA 2F5CA 3QEPA 3ZT4A 3CUQC 1WAJA 5BPMA 2JN0A 5KAIC 1C6VA 3QINA 4J2EA 3AG4H 3EYIA 5EU7A 3PIPA 2BTFA 2M45A 3CJAA 2ETHA 1OLTA 5AYFA 3G1MA 4DR1K 3KP6A 2LQ8A 1TTYA 1UECA 4ZYDA 2GFAA 4I6ZA 4XR6A 4AUXA 5EG0B 1W2BS 1TOVA 3M4OJ 4IHSA 3QBXA 4J7FA 4A6EA 2HS5A 2MA3A 3ERMA 4M3GA 1Y1WJ 3JYTA 4H5RA 2QWRA 5B1AH 3K57A 2BOLA 1FY7A 4HYEA 2NUPA 5LFAA 3CCEN 2X6XA 1R77A 1Z6RA 3JAMO 3EKSA 4LUDA 4I09A 1OPKA 4C8QB 2XGCA 2X35A 3VEXA 4IHTA 3ZSXA 1FC3A 4Z4EA 2K7AA 4KB0A 2EGCA 2K3BA 4R79A 3IKVA 1BCOA 1P8ZA 4JKAA 3ZSQA 1ERDA 3N5NX 1HRHA 1W2BM 1NJZA 3QZ9B 3RKWA 3QOPA 2FRWA 1HNVA 1VQMA 3ASOH 2W48A 1ZUKA 3CCJI 1SD6A 4RW8A 2D1KA 2ZJRF 5M1QA 1USTA 4P5NA 3D0SA 1D0ZA 2Q0RA 4Y17A 4CZMA 3T1AA 5LJ3j 2WB1N 1O75A 1VZ0A 1VQMT 2FD5A 1OI1A 2LY2A 3PNVA 4M74A 2B7EA 4HT8A 2HZTA 2A07F 1KG7A 3QETA 4W5OA 3CJ7A 2O03A 2CUFA 5D6EA 2JOYA 1XG7A 5FU6C 2RJFA 5AFUA 5J39A 4MFBA 3LDPA 5GP9A 3ZP5A 2Y90A 3G6ET 2JS0A 1Z3XA 4KT5C 4GO1A 2ASMA 3G10A 2XAGA 3J80K 4JI7K 2A3LA 4XRMA 2CSOA 1R1TA 3D4VA 2CKKA 3OW2S 3ATVA 3C6TA 2RMOA 1XPXA 4BRKA 3T69A 4D0PA 2BUDA 5DD8A 3CCRN 3CPFA 1YP5A 2X3WD 2FZGB 2ASOA 3ULEB 1E3OC 4WFAL 1YJWA 1LW0A 5J2PA 3HOTA 3UB5A 1UG1A 1SFEA 1HLUA 1V1CA 1X2KA 4H5NA 1E3HA 2V52B 4DSFA 5C42A 3SWNC 1ASWA 4L3QA 2NZTA 2CH4W 4EVVA 1U9NA 1JTXA 1S29A 1PUFB 2H3EB 3JSMA 3K4JA 5EZHA 3R6NA 3B8AX 3Q5FA 5EG2A 1JXBA 2LTPA 5IPAA 3SNNA 4M77E 4XKBA 2WWYA 1AA7A 4M71A 1HNIA 2E19A 3CC7Q 1W97L 4PJJA 4BACA 2P7CB 4BROA 3HM5A 2O8XA 1Y7XA 1DT9A 1QVGS 2AZVA 1F5TA 1WSFA 2VJ5A 1NGBA 4CIEA 3TARA 4RLQA 3P9KA 1POGA 2IVPA 1VRLA 5CVUA 5D8KB 5GANj 1C0WA 1ZQ3P 5JI6A 3AO5A 3DFGA 4FJLA 4BR4A 2W1OA 1TQMA 4BWMA 3I9V2 1SV5A 3VV0A 2OAZA 3OB9A 1RRQA 3UKRB 2YS9A 3ZCOA 2W6KA 4PJLA 2KZVA 5LLQA 4W5RA 1YJNI 2XGEA 3ULEA 2DA5A 4AIKA 3CMYA 2DX1A 3T8TA 2QWQA 4IFEA 4CC4B 3S1NJ 4WF9L 2DIQA 1UHCA 1QHAA 5GMKi 2DYSH 3THXB 4DV5K 3BDDA 1PRMC 3A4CA 1DJ7B 3CCQI 4IEIA 3CCSA 4CJFA 2OZMA 4XU2A 2ELKA 3JSCA 2VLAA 3S3MA 1S7EA 1REVA 2YLBA 2Z0WA 3E9FA 2BE9B 3L3VA 2ZPBB 2P9PB 1LFBA 3SHWA 2D0OA 4M78C 3LDOA 3K9TA 2XG8D 2DILA 4PIIA 2F1LA 4ZYHA 5DUIA 3NH2A 1Y07A 2ATCB 2DF6A 3L0QA 4FJ8A 1KQ9A 1K78A 1HSJA 3I59A 4BGBA 2AZSA 5KYUA 3DRSA 4LF5K 1O4XA 3OS0A 4II1A 3KJVA 4A4FA 2ZPGB 3CCMA 1LWYA 3TO7A 2W6LA 4A0XA 2RN8A 1YNZA 5EVZA 2PQ8A 3U8XA 3RJPA 2G8KA 1D5AA 4LITA 5M1FA 2L3DA 4AHUA 5HL7L 4K11A 1JLQA 3HJFA 2P8TA 1BOBA 3NF6A 3R0AA 1ARKA 2A42A 3E1SA 3BGRA 3WXLA 4CJUA 2D6FA 4LG0A 2HVRA 2O9VA 4P9FA 4IZ9A 2IA1A 3MKDA 1XB4A 3KNTA 2NRWA 2EWSA 2HF3A 1FLIA 2L89A 4RS8A 2CW8A 1S5LC 5AQIA 4RGUA 3VYSB 1EFNA 2LJ3A 2RQUA 2EWNA 1ZXOA 1S72I 1KC8C 2JVGA 4YOXA 2COBA 1M1KC 2M87A 1EF4A 3SV4A 1LAVA 2RKIA 1G4DA 4FX4A 2GQQA 1LOTB 2YNGA 2NNNA 1VSEA 1IO2A 2JNGA 1SL2A 3PX0A 4YELA 3CCJQ 5J8CA 4RTVA 2DOAA 5GAOl 3WNFA 2HTSA 3CC7N 1IF1A 5KYNA 2EQUA 1VQ7Q 3HB9A 2QKBA 1ETWA 3RQIA 4BVPA 3TCJA 2FPFA 2A37A 2O88A 4NYNA 2DETA 1BBYA 4AYBN 1DLOA 3R0JA 1W0TA 2W84A 1DTQA 4KHNA 1QTMA 3T8RA 2WY8Q 1ZTRA 4KA4A 4M7DB 5JVGL 3QIPA 4PDKA 3J81K 2QKKA 4ZC3A 4CZEA 1IG8A 1G8XA 5F08A 3L7WA 2LQNA 3LAKA 1NKBA 2KHMA 1AEYA 4RWTA 1BOTO 4K2EA 2V6CA 5DY9A 1SEUA 1TK5A 1IDZA 1E6GA 3R8EA 5GMKm 4F3TA 5GAOm 4QVZA 3OYGA 2HNHA 4KYWA 4P5OA 4MFEA 2E5NA 1KG5A 1HU0A 1X3UA 2CGJA 3JXUA 4FOEA 1MIJA 2P1JA 4YFXF 5E8GA 3EDPA 1VIFA 1GCQC 3QYFA 1R1VA 3QWYA 4GXOA 2QQ8A 3QHSA 1SAZA 1R1UA 2A61A 4M63C 3WVDB 2VG6A 3S15J 1IO6A 2DFFA 2YV0X 5CYQA 1AKHA 4FJ5A 2UXDK 4DGWB 2R7XA 4CK2A 3IUCA 1XCBA 1KU2A 4A5BA 3CM6A 5M3FJ 3EL2A 2LYCA 4W5QA 3U4LA 1XQOA 1GCQA 1ILYA 2X85A 1IKVA 1TKDA 1Y8RB 2BVLA 4DOVA 4Y0WA 2FQ4A 1M1KU 1NM7A 3HOUJ 2O4XA 2P5KA 1ACIA 4N4NB 1QCNA 4I6MA 3VETA 1S1NA 4GKJK 3NFAA 4D5CA 2HHSA 4O6JA 1IN6A 1I1SA 4NZGA 2WA0A 4U0WA 2CP5A 3VS2A 3ZETA 5GJWB 2FA5A 1HYSA 2XDDA 1HKQA 4XK4A 1C0GA 3RSEA 3VS1A 4BRDA 3BTCA 3WGGA 2P4WA 3LWIA 1R5GA 2RHZA 3O9RA 2KFNA 1PVSA 1T44A 5FRMA 2W40A 2JM8A 1TBXA 5E3NA 5CKHA 1BN5A 4YOTA 5KGWA 3VMFB 4KI4A 2ZPIB 1YYVA 3TTFA 1M8MA 3AG3H 4OJRA 4Z94A 4ILJA 3QSUA 1QCOA 5JMVA 2GQVA 4EJYA 2QWMA 1RT4A 3WXJA 1H92A 4FE7A 4BH9A 5J40A 1RAAB 3I55N 2NOLA 1RADB 3KWGA 3V9WA 1GLLO 2Q0UA 5IT9K 1V3FA 3E6DA 3T19A 4CZIA 3JAMZ 3QDFA 1RI9A 1Q82O 4GNIA 2QWPA 4CJVA 2SRCA 3CJNA 4IJAA 1NGHA 2E2QA 3JSOA 1RAFB 4XSZF 2KZMA 1YLFA 1FIAA 4XH5A 3CC4Q 4JBAA 1Z67A 1RAEB 4FW2A 3OYMA 2I5WA 2A6TA 5J47A 4N47A 2G7UA 1NJYA 1REPC 1FOYA 5C2FA 3OW2A 2FQ3A 4OOIA 1WA7A 1I27A 1U2WA 2CW0F 3IRQA 4CF9A 1N5YA 3HGGA 3GNGA 3VYRB 3TOAA 4EM1A 4HQEA 2HBWA 3R1XA 3HSFA 3E9PA 2NLUA 1YQAA 1OH8A 1J6ZA 4EM2A 4YPRA 2LC4A 3MWPA 5M5WJ 2XHBA 4EFHA 4A2AA 4HF2A 2ICWG 3CD6I 5KPRA 1AWWA 4CJSA 1K73O 3CMAI 1B9NA 1STZA 3FDYA 4RAGA 1TL3A 4ZGEB 3RZDJ 3B02A 4WQ5C 2IIRA 3H36A 3K2AA 3R61A 1JTYA 4E7LA 3BQYA 3KTQA 5LJWA 2FF6A 4ATOA 1FBQA 4B1WB 1AWXA 5FWBA 4R55A 2D4WA 3GMEA 4PGGA 3A98A 3J81Z 3CUOA 1I5ZA 2EGEA 1T6CA 2BKDN 3UKGA 4BC4A 2W7NA 1JL2A 4KGVB 3H3VK 2MD5A 3OIQA 1PKSA 1YIJQ 2QQSA 2EFNA 4RAYA 4B24A 4MNUA 3M8PA 3JCMW 4UOBA 1N8RO 3RDIA 5HDNA 4M75E 1WKMA 5A0DA 1C1BA 4M75B 5IP7J 4FLXA 1OYIA 1FX7A 5KCOA 1NK3P 3X24B 4EDUA 3O8VA 3EGDA 2R57A 4C5HA 2RV8A 1FTTA 5CR2A 3BR6A 4DR4K 2RNGA 4IQJA 4LY7A 2RHUA 2ABKA 4LOCA 1W2BA 2YHWA 4B3RK 2E2IJ 3OL4A 3DAWA 1M1EB 2LCCA 1YHQI 1BBZA 4L9TA 1Z3YA 1KFZA 4II3A 5HCKA 4UVCA 4B47A 1VQ4Q 2X6SA 3CCVN 2IEKA 1F1ZA 4DR3K 1MU2A 2V4JC 2R7SA 3LFUA 2DYIA 2VKNA 2ZNYA 2Q2RA 4O0JA 3G3ZA 1KU9A 3G0QA 4CFDA 3H8ZA 3CCMN 2QQAA 4UV8A 1K0XA 2A36A 4NB5A 1GXQA 4OU0A 3UATA 4DU1A 1VQKA 4DR6K 4QS7A 2PQWA 3TP0A 2DA2A 4WQ4A 1B9MA 4A2BA 4XK8E 2FSJA 2YX7A 2Y2ZA 3CCUT 1MBKA 1SMTA 3CI5A 4A93J 3F2KA 4OKKA 3QOEA 1TTHB 2STWA 1I07A 1UFFA 1Q86R 1ETVA 2HVHA 2IGNA 1W7PD 1M4ZA 2ABLA 2E4LA 4UVBA 1ZBLA 1AD5A 3M0PA 3DXMA 3ZQFA 3V6DA 4IDHA 3KD5E 4ZYGA 3JB9I 3UR3C 1P6RA 5EY4A 3K1NA 1QQNA 5KYYB 3WNEA 3KLNA 4CZJA 1XUPO 2R7OA 2CG4A 3H41A 3LDLA 1XGSA 4LXCA 4C92E 2XB0X 3LSKA 3CQZJ 2VT3A 2Z1GA 1SVLA 4A3MJ 3THWA 1QU3A 3ECOA 4CC7A 3I56N 3SAGA 1DGRM 5FROA 2YRDA 2V7ZA 4ELUA 4F3OA 4P9UA 3CC4I 1J3TA 1YS7A 2RQPA 3I35A 2PJRB 3LPTA 1ZHFA 5A2QZ 4B1YB 1MJBA 2NVXJ 5FFXA 4A57A 3FLCO 1Z25A 4HPQA 3REOA 3SDZA 1T3SA 4BR2A 1TT5B 4YOVA 1T3LA 2AHQA 3PIPF 2CT3A 3QO3A 2NOGA 2CQ7A 2ZSHB 1OMIA 3GWZA 1NG2A 3WTXC 3RYRA 2X1DA 1Y57A 3ELKA 5IP9J 4UVAA 3RMDA 4DKWA 2CYYA 4BR7A 2BY3A 2M30A 4WXHA 1VRUA 2VYTA 3VEPA 7AT1B 2JSCA 1T0FC 3MMVA 4LFCK 4C5GA 1P9QC 1VQ5T 3QP6A 3AVAA 1TAUA 3CCMT 1XMAA 2QTDA 2OAUA 2KRSA 4M7DA 3K4LA 2CV2A 4CH7A 5AQRA 3CC2Q 3DXMB 1D5YA 1V76A 3N4QA 2HVIA 3MP6A 3QODA 3CCUN 4AHRA 3CWUA 1VTNC 3GZ5A 1C0UA 3LZJA 3M57A 2KBTA 4BQOA 3VW4A 3CCUQ 2UXXA 4B3OA 3G1JA 1YHQT 3U21A 1AZEA 4HV6A 3CZ6A 3EETA 4RG8A 3V42A 5AJ3K 4M3FA 3MAQA 5JFRA 2XU8A 1VQ8Q 1N27A 4DNCA 3CCLA 1WHHA 3F10A 5KAFC 1KO9A 2M16A 1UAXA 4JD2B 5LJ3e 3V7SA 3THKA 4O5FA 3UE5A 4CVNE 5LJ5g 1U0JA 3C0CA 1IN7A 2ZZDA 2EV5A 4JI3K 4CD1A 3DPLC 1J09A 4IZZA 5I2MA 2BDPA 1HKGA 3TTCA 1QMCA 4OVAA 1VYVA 2HDAA 3KE2A 1VSLA 2F48A 4O0IA 1QPIA 3E97A 5IYBJ 2UUAK 4JUVA 2IS4A 2JQ7A 3BR2A 1IXRC 4PJNA 4CRIA 5C15A 4BR0A 3DLAA 4XOTA 1M8VA 4B1XB 2DTUA 1QP2A 3HZJA 3LANA 2PZSA 1VQMQ 2R5YB 2XY7A 1UAAA 2P0PA 4AIHA 2E1MB 3DEEA 4FWSA 4Q4ZF 2NOEA 2DPNA 1LWVA 3V1OA 5AQKA 2DMNA 3NH0A 1RT7A 2Z16A 1RDBA 1ENHA 2YSQA 1XTDA 3CHWA 1IZ1A 1LWCA 4DCHA 1IRFA 3PTAA 2DFUA 4OMZA 1ZR2A 3DWLA 2YI1A 4KI6A 4L5EA 1H0MA 2VOPA 2L01A 4RCCA 3UKUA 4L9NA 2HDDA 5J1UA 3JSPA 4B9TA 1RNHA 4PY5A 2PAVA 3KK2A 4BY9C 1LAWA 4I98B 4UNFA 4OFEA 2V26A 4V19S 1AKHB 4OIQF 4HBLA 5E1WA 2Q2EA 3G4SI 1N34K 2YHTA 2HWVA 3RKYA 1TZLA 3VPRA 5GANf 1VQ5Q 2HFHA 5F0HA 3REBB 4EGYA 1TYQA 2QG9B 3JRHA 3DP7A 2ZWHA 2VUMJ 2DVJA 2CWEA 4M41A 5KPTA 4DSIA 3QO9A 1CGPA 3O4WA 1VQ6A 4HEA2 3TTDA 2RQQA 4BQLA 9ATCB 3CJRB 3G4ST 1GLNA 2PEXA 2XKPA 1Y56A 1JUMA 1M9SA 1GLFO 2VG5A 3G6EQ 5FPDA 3WHBA 4DV6K 1FOKA 4WCEL 1S6QA 1WNLA 2E3HA 5HK0A 4CJQA 3SAHA 1SFKA 3LA7A 1R5HA 1GOBA 5JLFA 3GIBA 3DYAA 3HI0A 1Y1VJ 4XQ3A 2P6TA 1K8AU 2RN7A 2F8TA 3I8BA 4I2OA 1U5SA 2YHXA 1FJLA 1XS9A 3K69A 3DU6A 4M7AC 5GAN6 2OZSA 1IH7A 2LDUA 2V6EA 3VQ8A 1H9GA 3AARA 3IMXA 2QA4Q 1P4AA 2BBYA 4PQUA 2DERA 2NVTJ 4M7DF 4N0BA 3WTTC 4ZGJB 1JJ8C 2LSNA 3QYEA 4DZPA 3ZL7C 4F7UE 2O8EA 5BR9A 1BIZA 1IW7F 4FJ9A 1CZ9A 1JJ2M 4AM7A 5CYVA 1ONVA 3ULRB 1KA8A 2E12A 2W57A 3AA5X 5BNGA 4HSBA 2V1RA 4QT7A 5HBMA 2YXYA 2JWLA 2LP5A 4XL9A 2KIQA 5IYDJ 2DO3A 1GOCA 4BQZA 1LEAA 2JHJA 3ATUA 1UJYA 2UXCK 2OFKA 1RUWA 2OX7A 4C8QG 4RW7A 4I0BA 1GXPA 3CCVQ 4YEJA 3ZEHA 1SD5A 3CCQQ 1W0UA 3L2WA 1Y71A 4NDLA 4BGDA 3ABMH 4UHTA 3VOVA 3CCQN 1NKEA 3IS9A 1R0AA 2GTOA 4BJ5C 5GAN8 4JI6K 1ZBIA 2QK9A 4GGGA 3V4GA 1RFQA 1WSEA 2K4BA 1VQNT 3BR1A 3DPUA 2JN6A 3KEYA 1VOMA 2HSEB 3DXKB 5E3OA 2HMPA 3LAJA 2HHQA 1K0SA 4A3LJ 3CCMI 4HZFA 3PT9A 4NL2A 3LZIA 2IGKA 3KPHA 1YTYA 1VSMA 1NE8A 4Y91A 3E9OA 4XM3A 1RTJA 4DQ2A 2KKOA 3FSPA 2FB7A 1OZ3A 5FLXK 3H9JA 1O1WA 3DI6A 4E4HA 3QJYA 3ISNC 1UTIA 1DTTA 4ZN3A 1ETXA 2MG4A 3FZMA 1HW5A 1YITQ 1VQ9N 2BY0A 3F3XA 2CV1A 3BE3A 3V9ZA 2NRZA 4V2SA 2ATQA 4M3ZA 3O9UA 4BI8B 3TL4X 3NMUA 3AVJA 5HNHA 2VGMA 3I58A 2RO0A 2V9VA 5LRSA 1JGSA 5GAOq 4M7AF 3TR8A 2ACJA 3GTGJ 2LQKA 2P9LA 2NYSA 2Y48A 4H4MA 4OPAA 3HHHA 3JS6A 3BPVA 1C6VX 1O3QA 3DU5A 4YDUA 1JT6A 4A53A 2P9IB 1QBJA 4CGFA 3SYTA 4CZFA 2QA4N 1WGSA 4LDWA 1XI1A 3ZX3A 5GAGP 4Z6YA 4ZJZA 3TBIA 1KQ2A 3IRXA 3QFPA 3QU3A 2D0NA 4LFBK 4CJTA 2VI6A 3M56A 5EC7A 1Z7UA 1F43A 3S1QJ 3E19A 1BM9A 4H0XB 4Z4CA 3JCMX 4P1WA 3HOXJ 3S6IA 3MEWA 1RI7A 4H8KA 1KQSP 2AQFA 2E64A 2M0OA 4M77F 4IQ4A 3MHXA 3AKZA 2XDPA 2F7TA 1XQPA 4E2FB 1B9FA 4B9LA 1QZ5A 2ASPA 2V1DA 1O57A 4J9FA 1VQNQ 3KLFA 2P9LB 3S1RJ 3QEWA 3AVCA 4N4IA 4E7JA 1M90U 1ZLKA 2ZJRL 2EZLA 3VYTB 3KTUA 1VQOI 4RUGA 4OPHA 1FP1D 3JCMc 3VUZA 2QXLA 3SZTA 3VEOA 3AY9A 8AT1B 4OMNA 2BUPA 3FDRA 5GADP 1G2BA 4ZDOA 3FXRA 2MMPA 2Q8KA 4TVRA 3SZPA 2IS2A 4FU6A 3SMPA 1QPMA 2K5CA 4FWQA 4BQNA 5CQEA 3L4IA 3ZN1A 1KQSA 3HT3A 2PNIA 3M07A 4KJZA 2JA6J 5AQQA 4H5WA 1W2BP 3I5UA 4FLYA 4IHXA 4M77D 3TOBA 3O1WA 2RQTA 4A3GJ 1VQ9T 4NC7A 2CYZB 2HU9A 1W7PB 1YHQA 4IUVA 1TSFA 3HFNA 4NB4A 2W0ZA 4FCYA 3PV8A 1GLAG 3CPWP 5TKYA 4L8RB 3QPHA 1DPRA 1KZHA 4DUYK 2RC4A 1PNJA 1SSFA 2GTJA 2YWWA 5LL6Z 1O7FA 1GL5A 1TW3A 2F5EA 2F5DA 2O8CB 2QEXA 1VQKN 2P5LC 4C8QF 1ATRA 4KKOA 1MSEC 3HRUA 2KAFA 1IBLK 4F55A 4M9ZA 4XKWA 1B59A 3M0UA 3M0QA 4C2TA 4QQGA 4D5FA 4EJZA 1XC5A 4HVUA 4ENJA 1TLHB 4YIIA 4DTOA 4JI8K 1K8AO 4WWCA 3VGMA 2XV4S 4JDSA 4JKFA 1S3JA 1QVFA 5MLCQ 4IOCL 2VCPA 3M6GA 3E7LA 3VESA 4FYDA 3FKIJ 3ROUA 1K61A 4QPQA 5HROA 1T95A 5DLOA 3RKXA 3OSSC 2DXTA 4F7ZA 3BZKA 3TSPA 1RUOA 4A54A 2HDWA 4NCGA 2GGRA 2L02A 4TSXA 2JJ7A 4HT9A 4MTEA 2YUQA 2VQLA 3TSUA 1XMQK 3RERA 1YVUA 4Z4HA 3G6EN 5HY6A 4AIJA 2EILH 1G83A 2X4WA 1QCFA 2K02A 3LSIA 1KFDA 2KDZA 4JQFA 2HSPA 2AKLA 4DZJA 5IHKA 2ME0A 3LNQA 2V51B 1QKWA 3SZGA 3M0TA 5AQMA 2LT1A 5GAMd 5AZIB 2F6CA 1QZZA 4E7KA 3F8MA 3ZQGA 5K5RA 4HSTA 1VNDA 2YDLA 2C6YA 2DN0A 2CRGA 3VQDA 3KD1E 1IG9A 3H3NO 2XROA 1ZELA 2C0IA 3VTIA 1WFXA 5FB2A 1T56A 1NZ9A 1VUBA 2KMUA 4EMSA 5E17F 1QHGA 2OUMA 1Z1DA 1JEGA 2HHUA 3CTAA 4IIOA 3HP9A 2GLOA 2A5XA 3QB0A 4RA2A 3VSKA 2ZBKA 3JCMf 4M75G 2Z33A 2PVDB 1X1BA 5D7UA 5FFZA 3WU1B 2FF3B 3AA2A 2UYTA 1BI4B 4EP5A 3WE3A 3HC7A 3LDSA 4BRCA 5HRRA 3VQCA 3SDGA 3VF6A 5EOYA 2CP2A 3VS4A 5I9EB 4BRPA 5FJ8J 2X48A 1EIFA 3G1LA 1KYWA 1SL0A 4IUPA 4ENNA 2DXUA 3DLLF 4HHTA 1LMZA 4EJWA 1VQKT 2GBYA 5H6RA 2WB1A 3C6AA 4FO0A 1EXQA 4DOZA 4FM1A 3TVTA 3VWBA 5B66C 2CH6A 2KNBB 3RKQA 3K4MA 2W04A 2HKQB 5LMUK 3FX3A 3RRGA 4ESFA 2XPUA 1CQTA 1ORNA 3VQ4A 2GWRA 2DMUA 4BR9A 1DIZA 1BJZA 1YI2T 4FWNA 2VGNA 2PVGB 2H1LA 2VXZA 3VEZA 1I1JA 4O3MA 5EEHA 4FLWA 1K4TA 1VQ7T 2FZKB 5C2DA 5K5QA 4FJXA 4CFAA 2B86A 3CCEA 3BF3A 3GTMJ 2E10A 3LH5A 1O3RA 3CCYA 5ICCA 2JPCA 1YS6A 3VA0A 1WNSA 2CU7A 3JRAA 4EHUA 1OU9A 3CC2A 3NGYA 4EPCA 3HXMA 2LDMA 3BDUA 5KRSA 3S8PA 4AM3A 2O31A 2RM4A 2HYJA 2CUEA 3CCMQ 3D5RC 2R4GA 3O4NA 4DSEA 5CVJA 4KISA 2RD1A 1UGQB 4MLOA 1NGEA 5LHIA 1HYVA 4CJ5A 5BN8A 2BXZA 2EK5A 2ESHA 3LSGA 2ELHA 3F21A 3CCSN 1KAYA 1AWJA 5DD4A