4BDZA

Pfv intasome with inhibitor xz-90
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 104
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bdzA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bdzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bdzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdzA03
3WNEA 2X35A 3NH0A 3KK2A 2E5QA 1RDDA 4AHVA 1BGXT 2X6NA 3THVA 4B9WA 1D9FA 4OLBA 4BE1A 4DTOA 4F4KA 3FC3A 4CF0A 1IKVA 4OGCA 2VG5A 4FLXA 1NK4A 5D6YA 3DM2A 5C0MA 2YHAA 3MEVA 2D9TA 4EP5A 3PY8A 1NJWA 2G8WA 4FYDA 3NF6A 3KLIA 1HNVA 1XWLA 3VA3A 1SKWA 2RJFA 4KKOA 1FKPA 1WSGA 3MP6A 2A1SA 4IFVA 4HHTA 1A5WA 3QLHA 3OY9A 1NJZA 2EQJA 4DG1A 1QS4A 2XY6A 2IOCA 4LH4A 2YV0X 3QESA 4N5SA 5J2QA 1KFSA 3LP3A 3AVKA 4C8MA 1OI1A 4F3OA 3JSMA 3PUFA 1XNIA 3VQ9A 2HHQA 5FRMA 1UWBA 2OPQA 4CF8A 3KLGA 3OYIA 4N47A 3OYJA 4I9LA 1NJYA 3RR8A 3K59A 3HL8A 5KH6A 2YHBA 5KCOA 2BGGA 4MFBA 3L2VA 1SKRA 3MEUA 3ME9A 3IRXA 1BI4A 2RI3A 3NGYA 3QIOA 3OJUA 3AVMA 1DTTA 2X4YA 2IS3A 3LZJA 4PA1A 2RJDA 1GOBA 1IKYA 5IAYA 1RCHA 3ASKA 5J39A 4C5IA 1G5VA 1RTHA 3DLRA 4KHUA 3NNQA 4FJ5A 3AA3A 2RO0A 1F21A 4H4MA 4YFUA 1S1XA 4BE0A 3KIOA 3ZSRA 4PLLA 3S9HA 2Q3SA 5CYQA 3TABA 4AHCA 3V9UA 3L2QA 1HQUA 3NH1A 4ID1A 3ZSWA 1TKTA 4KTQA 3PMTA 3F9KA 3ZT0A 1BIZA 3VQQA 2GV9A 2QKKA 1HPZA 3LAMA 2IC3A 2G8FA 3AO1A 1TAUA 4QQ6A 4DQRA 3DI6A 3V4IA 1IH7A 1Q8IA 3LDSA 5JS1A 2EKOA 1HYVA 1HMVA 3PFSA 3AV9A 2YKNA 2O4GA 1VSEA 1BCMA 1J53A 3HM9A 4KHQA 4C8OA 1W0HA 4O55A 1YTAA 1SV5A 4O5BA 4PWDA 3MEGA 1T7PA 1QSYA 3BGRA 3P83D 4DF4A 4L8RB 2O4XB 4IFYA 5KE3A 4I9QA 3K2PA 2XK0A 1YVUA 5KI6A 3T19A 2HHWA 3LPUA 2Z1GA 1NKEA 2OZMA 4HCZA 1RI0A 3HT3A 4IG0A 2DIGA 3VQPA 3U3YA 2HHTA 4PL6A 1XHXA 3V81A 3M9QA 1YTUA 2G8IA 3ZSXA 3QINA 3HXMA 4M3UA 1TKDA 2BUDA 4DFPA 1EP4A 1NK6A 3NH2A 1C0MA 1U49A 4QQDA 3AO5A 3ZSYA 2Z1JA 4HTUA 3SUOA 5HRRA 1L3SA 3M8SA 3PX6A 2EQKA 4KTZA 4FJGA 3CEYA 4E1NA 4FJ9A 3ZEHA 3ISNC 4CGDA 4FJIA 2K3XA 1RT2A 3DB4A 1LWFA 2IAJA 5KTQA 3LAKA 1Z25A 3NTKA 3F73A 3QERA 3OVNA 2OPSA 2RHZA 1TVRA 4FL6A 4N41A 4DU1A 4N76A 4EDUA 2GFUA 3LGFA 2EQMA 4CJTA 4NS5A 3H8ZA 4F8RA 1VRUA 4I7FA 5J2MA 1QSSA 4C8KA 3HSTB 2CKKA 4AILC 4N56A 3O3FA 4OVLA 1RBRA 3L8BA 4QOZB 1TV6A 4BACA 3L3VA 3P1GA 2DFFA 4Z4HA 3ZSVA 4JRQA 1JKHA 4KREA 2ATQA 4LH5A 1FKOA 1ZYQA 4FW1A 1VSLA 4CHOA 3F70A 5J26A 3MXIA 4FJKA 4N4GA 1CXUA 3VQ7A 4FK4A 4EP4A 4LD6A 1RBSA 2JLEA 1T05A 3OQ5A 4CF2A 2OYQA 3MXMA 1JLBA 4OGEA 4FLVA 3PX4A 2VWKA 2G8KA 3P8HA 4FJHA 4CCHA 3TANA 4B08A 3SPYA 1GOAA 3ZSQA 3HVRA 4UQGA 1HYZA 4HUEA 2RI2A 3WNGA 4X34A 2X4WA 5E41A 2GFAA 4CGHA 3CM5A 4E3SA 1REVA 4DQQA 2XY5A 3V9ZA 1FXXA 2D5RA 2R57A 3MO8A 4E7IA 2GUIA 1HQEA 3SYZA 4CEEA 5M9OA 2NLUA 4PY5A 3O4QA 1ZBFA 3S6WA 1BCOA 4CEBA 4CGGA 1X9WA 3QEPA 4O0JA 1WSIA 4C5GA 2YNFA 2M1HA 3KJVA 2L89A 2PQWA 3EY1A 4FJ7A 1IG9A 1O1WA 4DTRA 2EFIA 3QIIA 2Y1JA 4ZHRA 3AVGA 1RTDA 3AO4A 1Y97A 4C5EA 4FLUA 4FZXC 4C8LA 3SV3A 1UA0A 4BDZA 1HYSA 3DRSA 3QO9A 3SUNA 4TSXA 1WJRA 4DWIA 4OJRA 2YNIA 1T03A 4DSJA 3EYZA 1KCFA 4IUQA 2K3YA 3LYIA 1K6YA 4FJLA 1S1UA 4CE9A 3HP6A 3TAFA 3U3GA 3DLGA 3Q1JA 1KHCA 1WSFA 4CGJA 1D5AA 4AHSA 3HP9A 1I3AA 4JRPA 4Y1CA 4DLGA 4M3WA 4KO0A 3C4SA 1RBTA 4J2BA 4OKKA 5KGWA 3VA0A 2PYLA 3K5MA 4IDKA 4CHYA 4ELTA 1Q9YA 4FJXA 4DSKA 1WJQA 2LSNA 2HQEA 4FJJA 1XC9A 2OZSA 2RF2A 2L8DA 4BWJA 4Z4EA 4KI4A 1OYXA 3ZT2A 4GW6A 3LWLA 1WSEA 3ASMA 2MWPA 1VSJA 3QEWA 3OYFA 5CYMA 1R0AA 3EAEA 3SUQA 5C42A 2KW4A 1CXQA 3MP1A 1NKCA 4NYFA 4Z02A 1B9FA 3KD1E 3D45A 2KTQA 1ASVA 2QKBA 3TR8A 1RBUA 2HHXA 3IG1A 1LV5A 1S9EA 4CEOA 4M42A 3MEEA 1SUQA 4KAZA 2XY7A 4J2EA 2BE2A 1HRHA 4FCYA 1JLCA 2KQ2A 3HVTA 2WACA 2KFZA 4AHRA 4E7JA 3NF8A 4Z4CA 4DQIA 5HRNA 3ZT3A 1B92A 3AVHA 2WOMA 4C8NA 4CHNA 1VRTA 2KFNA 2RJCA 4FM1A 2DY4A 3SD4A 1TK8A 2G3RA 4Q0BA 1XI1A 4B9TA 2M16A 3KLFA 2IG0A 5FROA 1LW2A 3AO3A 3DOKA 3TI0A 3OYHA 1LAVA 3HYFA 4UC4A 4FLYA 2NUBA 1S6PA 4IBNA 3OMCA 2HHSA 3H6ZA 3G0ZA 1CZ9A 4B9UA 1OZ2A 1L3UA 2ZE2A 3QEIA 1UOCA 3O3GA 3LWMA 4DU4A 2P51A 1C6VA 1JLGA 4PLIA 1KSPA 5CZ2A 4PQUA 3T1AA 3ZSOA 1X9SA 2R5AA 4CEDA 1B9DA 3TAGA 1CZBA 2FBYA 3AVLA 4CK2A 2LDMA 1D9DA 2F5KA 4CEQA 4Z4GA 3RR7A 1U4BA 2FHDA 4DMNA 1IKWA 3OYBA 3PO5A 4FU6A 2ITGA 1S1TA 1KVAA 4DTMA 1SKSA 4FJ8A 3P8DA 3SPZA 4KFBA 3LP2A 2R5MA 1KVBA 3CYMA 2JZ2A 3CFPA 1JXEA 3SJJA 1L3VA 3NDKA 1ZBIA 2B8AA 1MHNA 4R5PA 4B9LA 1N6QA 3IAYA 4QCLA 4FZYA 2Y1IA 3LX7A 4CESA 4CIEA 4BDYA 1D8YA 3V9WA 3I0RA 3VQ6A 4DFJA 3BDPA 2PZSA 1KLMA 4CHQA 5HRPA 4K8ZA 1ZBLA 3RWUA 3OYNA 1EX4A 4CK3A 3NF9A 3HJFA 2YNGA 4CJQA 1VSDA 3GOXA 3EZ5A 4DSFA 2RPIA 3KKSA 1J54A 2VG7A 4DTUA 2DTUA 3OYAA 1KLNA 3QNNA 4KHYA 4DU3A 2RKIA 3DLHA 1BHLA 1WAJA 2OPRA 3DRRA 4E7LA 4OKJA 1LWEA 3OB9A 2RI5A 2L3RA 4KRFA 4CRIA 3OYKA 4DF8A 4CJSA 4CECA 3L42A 4KB1A 5HP1A 3AA2A 4PUOA 2QQSA 4AH9A 3OYEA 3KKRA 4M3RA 1UAXA 4B8AB 1U48A 1QTMA 3HPHA 3K5OA 5KCHA 1WGSA 4N4IA 5DK5A 4FM2A 4F3TA 4AHUA 4E89A 1RNHA 4CIGA 3FEOA 4CJ5A 3HPGA 1JLEA 3VQEA 4OPJA 4CJ3A 1ITGA 3OMGA 3SQ4A 2FBVA 1RT6A 3VQ4A 3VQDA 1QSLA 2RHIA 2VG6A 4B9VA 3M8PA 2B6AA 1LWCA 4FJMA 5I3UA 4QAGA 4B9XA 3WNHA 2BANA 1S5JA 4RW7A 3ZT4A 2P1JA 3PNWC 3KUFA 3CFOA 3B6PA 1NKBA 3OYGA 4DSEA 2F8TA 4W5RA 3L3UA 4CJRA 2I5JA 4I2PA 3OJSA 1S9GA 2JGUA 4CFBA 4CEFA 1Q9XA 1RT4A 3META 4ID5A 4DFMA 2ZD1A 2KZMA 3V1RA 5HROA 4RG2A 1VSIA 3DB3A 3QJ6A 4KV8A 2AJQA 3DMJA 5CY4A 2LRQA 3SI6A 3I8DA 2GBZA 4J2DA 2M0OA 3CFRA 3E9GA 3B6OA 3SQ1A 3KD5E 2BKDN 3FDRA 1WSJA 4DQSA 2HNZA 3QBYA 4Q5VA 4IUPA 4LY7A 5DMRA 4W5TA 4NCGA 4LD0A 2DFHA 2DFEA 4FVMA 4OPKA 3QEXA 3MECA 2ETJA 1NK0A 5FRNA 1TK5A 5HBMA 3ZT1A 4DTPA 1HJRA 2P5OA 4CFCA 2XY8A 3S3NA 3BDLA 4W5QA 3TAMA 3TAQA 3AVNA 5D6WA 4G1QA 4CJLA 3DLMA 4E19A 1RT1A 2E4LA 2QXFA 4ELUA 3D0PA 1RT7A 4JS5A 1ASWA 1TK0A 1VSFA 4DSLA 3A2FA 1JL2A 4MQ3A 2G8HA 3K58A 2VWJA 1RT3A 1N5YA 1I39A 4W5NA 1C0UA 3LZIA 4CJWA 1L3TA 3VQCA 3PX0A 1RDCA 1KFDA 3LLRA 4CF9A 4GY5A 1NOZA 2EQUA 2RHUA 1A5XA 5JS2A 3KLHA 1HNIA 1QHTA 3NTIA 4W5OA 3ALYA 2IDOA 2G8VA 2W42A 1RTIA 1WNSA 1VSHA 1L5UA 1QE1A 3QNOA 1SL2A 4A4FA 4KB0A 3NTHA 4LSLA 4IUUA 4HCCA 1TKZA 4M3ZA 4OKEA 1WAFA 2WONA 4Z0UA 1JXBA 4HUGA 4NCAA 1TGOA 4Z4IA 2LCCA 3MEAA 3OS1A 3RMAA 3AVJA 4DQPA 3S3OA 1QQCA 3AA4A 1U47A 1C0TA 4EZ9A 2LVMA 3NHGA 3C6UA 2QK9A 3O4NA 4LSNA 1VSMA 1RTJA 3DRPA 3IS9A 1WLJA 2O4IA 4AHTA 2YRVA 2DIQA 3KLEA 1C1AA 4CERA 3O8VA 3K5LA 4DSIA 3UWNA 3V6DA 4B9SA 3OYDA 2HVHA 2OA8A 2BIVA 4CJPA 4CJKA 1X9MA 3LH0A 3AO2A 3T3FA 4RG8A 3VQ5A 2EX3A 2B4JA 5K14A 3SCXA 5SZTA 2QQRA 1T8EA 4CGFA 4E0DA 4CJEA 1W9HA 3NBPA 3PO4A 1X1PA 3TARA 2RHXA 4ZTFA 5D6XA 4DS5A 3OS2A 4CJVA 1C1CA 2RHYA 4FZZA 3VQ8A 3ULDA 1H3ZA 2G8UA 4EZ6A 3DLEA 4FW2A 3AVCA 5KRSA 5C6SA 2D0AA 2LTOA 4ELVA 4KI6A 4OVAA 3C95A 1Z26A 4CHPA 3OA6A 4CEAA 1NK5A 2X78A 1FK9A 4RW8A 3JYTA 4RW4A 1KTQA 1IKXA 1SL0A 3P5JA 3LALA 2F8SA 1BI4B 4E7KA 1DTQA 2X6SA 4DFKA 1SL1A 4K8XA 5C24A 4KPYA 2R7YA 4CJ4A 4GVMA 4CJFA 1BISA 4NYNA 4H8KA 4DS4A 3DYAA 1TAQA 3SZ2A 2HHVA 4BDPA 1EETA 2X4XA 3LP0A 2HMIA 1KRPA 1WJSA 1KVCA 5FDLA 3HO1A 2YKMA 2RN2A 4CIFA 2R58A 4HCBA 4CEZA 3V9XA 4DTXA 3MXJA 4FJNA 2HVIA 4OLAA 3S3MA 4M41A 3CG7A 3H08A 4O0IA 3OYMA 4BWMA 1NJXA 4KHNA 1DLOA 3LANA 4CHZA 2HNYA 2O4XA 3NFAA 1U04A 3NE6A 5I42A 5C25A 5KGXA 4DLEA 3L2WA 2HW3A 2E6LA 2BDPA 3MAQA 4II1A 3CM6A 2E6NA 1S1WA 2B5JA 2GF7A 4IURA 4FLWA 4IUVA 3RMBA 4J2AA 4JLHA 3AA5X 2FBXA 5J2NA 3PV8A 3MEDA 1XHZA 4KHSA 3E9FA 1BIUA 1RDBA 3M8RA 3I0SA 3RRHA 3HPOA 1JLAA 3C6TA 4QW2A 4F2SA 1SSFA 2YNHA 3FLGA 4DTSA 4WE1A 4O44A 4HVJA 3QIPA 3VN5A 3ZCMA 3TWHA 4M3YA 3DLBA 1BL3A 4M3XA 1J9AA 1G15A 3O3HA 2RJEA 2JTFA 3HK2A 2Z1HA 3KK3A 4M45A 3LP1A 1A5VA 2A1RA 3AVAA 3SNNA 1RBVA 4ZTJA 1RILA 3MEWA 4HUFA 2XHBA 2FC0A 1OZ3A 4N4HA 2HNDA 5CZ1A 5HLFA 3L2UA 3V1QA 5SWMA 3CQ8A 2PYJA 2X74A 3DLKA 4E1MA 4O4GA 4CJUA 2XDPA 4A4EA 2FBTA 1MU2A 3K5NA 2XRIA 4KHWA 3NGIA 3UT1A 1NK9A 4FLTA 4ICLA 1RDAA 1BQNA 2Z1IA 5HRSA 1VSKA 1ZBHA 3RRGA 2ZQBA 3C94A 3WNFA 1JLFA 3KK1A 4IUTA 4A4HA 3U6FA 4B8CA 4YNQA 3FFIA 1JLQA 2P0KA 2KZZA 1WSHA 4E7HA 3VQAA 3OS0A 4NCBA 4XIUA 1WN7A 4BD3A 4RW6A 2XO7A 3L2RA 5IN1A 4L59A 3OYCA 4KTWA 5KRTA 1NK7A 2P5GA 4CK1A 1UA1A 3AVFA 3QETA 3RMDA 2D0CA 4FM0A 4FXDA 1J5OA 4CGIA 4B9MA 4C5HA 4A4GA 4M3TA 3NCIA 1ZBUA 4FLZA 1LAWA 3NGZA 2IGIA 4JS4A 2VYTA 3ZSZA 4IKFA 4CFDA 4CFAA 5J2PA 1EKEA 3DOLA 1RT5A 4RW9A 3QEVA 3ITHA 4NZGA 1NK8A 3AVIA 2OPPA 2HHUA 1ASUA 1GOCA 3TAPA 1IO2A 5KE2A 2D0BA 3M8QA 2DAQA 1EXQA 3NAEA 5J1EA 2E6MA 3V9SA 3QKJA 1U45A 4FK2A 1NOYA 1VK0A 1CLQA 1BQMA 1S1VA 4I2QA 3V1OA 4QVZA 1TKXA 3NF7A 1C1BA 5T7BA 3RMCA 4H4OA 1TL1A 3SQ2A 1N27A 3VQBA 5CIUA 3TAEA 3SV4A 1S6QA 4IG3A 2EHGA 4Y1DA 5EU7A 1YT3A 4Z4FA 3UIQA 4B9NA 4FK0A 3LPTA 5D3GA 2HQXA 4BE2A 3MP8A 2F96A 1JL1A 4QQGA 1LW0A 3E01A 2HB5A 4GMJB 3SQ0A 1TL3A 3RTVA 2MWOA 3SUPA 3K57A 3PMIA 4Q5WA 4DTNA 3KTQA 3AVBA 4CF1A 2PY5A 3OYLA 3G10A 4F2RA 4B3OA 4DTJA 3LGLA
chains in the Genus database with same CATH superfamily
2BXYA 3GTLJ 2X35A 4ITVA 2Z1DA 1FMVA 2KAFA 3RTRA 3NH0A 4XORA 3K2ZA 3ZQGA 4DQ2A 1I50J 1B3QA 1RDDA 2A5XA 4AHVA 3TP3A 4OLBA 4ENMA 4DTOA 2LX9A 1YI2A 4LB6B 1D1AA 3GP8A 2GOMA 5J3LA 3LSIA 3W3CA 3HUGB 5EGOA 1FIPA 2VC8A 1BWFO 2AP1A 4KH4A 1V3FA 2QWQA 4OIOF 8AT1B 4DYRA 2MF2A 2CH4A 4EP5A 3PY8A 1NJWA 5ELZA 4P5OA 4AM3A 2EJFA 4FYXB 2XIGA 4D0PA 3VA3A 3QICA 1LEAA 4M78E 4B3AA 1T0JA 5I11A 4XH1A 5HDGA 1WSGA 2OI3A 3MP6A 3I8BA 3QPTA 1MMGA 3DKMA 1TUUA 1I1JA 1ORNA 1VQON 1A5WA 1VNDA 3QLHA 1SKUB 1TH7A 1FYMA 5H20A 3K4NA 4DG1A 3E1SA 1M1KU 5GANe 5AQVA 1FBUA 1KFSA 3LP3A 5L8RE 4BVOA 5M1FA 3FIFA 3HSRA 3JSMA 4F3OA 3EFRA 4M78B 2UXBK 2E2IJ 2OPQA 2X51A 4JI8K 2M0CA 4CF8A 1FBSA 1KA8A 4I9LA 3D2FA 3RR8A 1VRLA 1VQMA 3K59A 1Y0UA 2BGGA 4MFBA 3L2VA 4TV7A 1SKRA 3EH1A 2PN6A 3SZGA 3ME9A 3CCLI 2A6TA 1BM9A 3QIOA 3OJUA 3AVMA 3O6BB 3G1JA 2DOFA 1BR1A 4UVBA 1HYOA 2V1DA 4GV3A 2FEIA 5JLWA 1GOBA 4G6QA 5JHUA 3RPUD 3EQLF 1MBJA 2MW8A 4YFKF 2HF3A 1IV6A 5AFUH 4UNOA 3BCAA 2A5YB 1RTHA 1ZTRA 4HLXA 2YHWA 3VEOA 3ZR8X 5J8FA 3CCSN 5FLXK 4H4MA 2DTOA 3C2GA 3KIOA 5FFZA 5IOZA 3CP2A 2KY9A 4M7DD 4M77G 3R3LA 2MLKA 5CYQA 3TABA 3KZIC 3S14J 1T3LA 4PFZA 1LB2A 1VYTA 4XTVA 2YHTA 4XICA 3QUIA 2QKLB 4ID1A 3NH1A 2WB1N 3PMTA 3JCMX 2KHOA 4ABZA 4LDVA 1BI1A 1VQ7N 4F7ZA 3WXJA 5GINA 1TAUA 4DR5K 4DQRA 4JRIA 2R7OA 1YJWA 1Q8IA 3REOA 1KGSA 2X85A 1N33K 3GNFB 2EKOA 3MAJA 4JKDA 1QHGA 5GAMh 3AV9A 1QWEA 4B3XA 1VSEA 2P9LB 3CCMT 2WAQA 1BCMA 1QKXA 3CPWP 3ZCOA 3JR9A 1VQ4I 1G2HA 1ZR4A 4I98B 1EH7A 2XKPA 4C92C 4LGWA 4O55A 1YTAA 3EG0A 3O80A 4ZC3A 1BOTO 1IW7F 3DTKA 1KG5A 3RQIA 5A2QO 1QMCA 3BLYA 4WFAL 1C0FA 1JKPC 1T7PA 1ZBJA 5HKCA 2YX6A 2RN7A 1XDUA 1XC5A 4DF4A 4L8RB 3GEZA 3JB9J 5HS9A 4N9IA 1I5OB 4RGSA 1X3UA 3FZVA 5AQZA 3IH7A 3SZTA 2BXZA 1RAIB 2R7QA 1OISA 3BCBA 4FSSA 4I76A 2DL5A 1O7LA 1D3BA 2DIGA 1VHXA 2K2MA 1Y64A 2Z9OA 4N4NB 3BZCA 1TT5B 3CC2T 1YTUA 3KP2A 3ZSXA 2G8IA 4RUGA 4M3UA 4EJYA 1EP4A 4M71A 2R5ZB 1U49A 5LRSA 4QQDA 4FWQA 2Y0SN 2DOAA 5D6FA 1TWFJ 3FZKA 2CUFA 2VKVA 2IW5A 5HRRA 3PE0A 3M8SA 3H45C 2KBTA 2EQKA 2FRYA 4KTZA 4E1NA 4FJ9A 5AQMA 2CH0A 2PNIA 2TRTA 2IA1A 4CGDA 3E6DA 3NTKA 1WA7A 2KDOA 3CC4T 2R92J 2I7NA 3BTJA 3QERA 5ICCA 2E3HA 1P8ZA 5FD5A 2XHIA 2XKOC 3L4QA 5CHIA 2HR3A 1WFWA 1FEXA 2COZA 2QSGX 1IJWC 2GQQA 4TVRA 1IRGA 4JDSA 2P6TA 4M7AD 5GAMe 3R4KA 2GFUA 3VGLA 4L5IA 3EE8A 1CF7A 2GA2A 4BG8A 4NS5A 4A4KA 1FNNA 4BY9C 2JUCA 2QQ8A 4GXOA 1HLVA 2E36A 4AIKA 5J2MA 3SWNB 2C6YA 5FD6A 4NHJA 1ZSZC 3O3FA 4JX4A 1FIAA 1NJIC 3L8BA 4BACA 1OH6A 1ETVA 2QWOA 3P1GA 3M8JA 3IV5A 4PFPA 5HLGA 1MUYA 4JRQA 2PX9A 2ATQA 3G1OA 4AFSC 2R4GA 2K3BA 2L0KA 4FW1A 1VSLA 1MDMB 2A36A 3VSLA 3BJ6A 3F70A 5J26A 1BI3A 2O3FA 2HVRA 4NOYA 2NOFA 1BC7C 4EP4A 3U1KA 3DFGA 4LD6A 1HKBA 1Q82C 2JRMA 1RBSA 2JLEA 1QVPA 2F69A 1T0FC 4BHPA 2I0NA 3MXMA 2FZKB 3SMSA 3GX4X 1WBDA 1UHMA 3EZWA 4WQ5C 1DP3A 3PX4A 3P8HA 2KVQG 1VQ9T 2MFZA 1RETA 3A8HB 2KQRA 3V7CA 4B08A 5I9EB 1JXOA 2RN8A 2O8DA 3CPWM 3HVRA 4UQGA 1HYZA 4HUEA 4X9DA 2F2EA 1NHAA 2Y0MA 2E2NA 3UE5A 1FJGK 1Z6RA 4E3SA 3ZPLA 4CVNE 4ENKA 4XBFA 2EFPA 2D5RA 4ELZC 2ZMEB 4A6DA 2VN2A 1MJAA 2BE7D 4CEEA 2CDTA 1G99A 4A59A 2NLUA 4JI0K 2KJCA 2NYSA 1R77A 1YCYA 3AGRA 2I2LA 4MLHA 2VBXA 4FL9A 2EFQA 3GCMA 2FUG2 4JI2K 4GGGA 2Q97A 1FMWA 4CGGA 4F9OA 3GUDA 1R5HA 2ZGZA 2KRCA 1WSIA 4C5GA 2M1HA 3VB2A 4L0YB 1VQKT 2PQWA 1JTYA 2HNIA 5BOXA 4ISFA 2SEMA 2BE5F 3PQKA 3GLXA 4RMOA 4M6VA 1MBFA 4ZHRA 3TQNA 1E3MA 1X6OA 2F5FA 2GWJA 1Y97A 4C5EA 3CLOA 3CMAQ 2KPMA 3H41A 3JV3A 5ECAA 3DLLA 1UA0A 4BDZA 3SAGA 3CVTA 2DXBA 4AIAA 3A1PA 1BI0A 4ANJA 2K2VA 4TSXA 4M75C 2A37A 2Q8KA 1EV7A 2GAUA 3RYPA 3CCUI 4AC0A 2J5OA 4V2FA 2NOEA 4DSJA 4FWPA 2FA5A 3EYZA 4LF7K 2L01A 2W6KA 2XKOA 1LFBA 1S1UA 1QPMA 4ZDPA 4D7NA 3DLGA 2F5VA 3JXUA 2WAEA 4CUGA 3Q1JA 2F4MB 4M72A 1BA1A 4Y1CA 3CZ6A 3RZOJ 2Z5UA 4DLGA 4M3WA 1FOKA 5AQLA 3QU3A 2CW8A 5IT3A 2HKNA 4KO0A 3H0DA 1NJIR 4J2BA 3DTIA 3N5NX 3SBGA 2WSCE 1B9NA 2JK3A 2LMDA 1YITA 2M87A 4ELTA 4J6XA 2CSOA 2AS5F 2GQVA 3ZGKA 1TWAJ 1OPKA 2UXNA 3V7RA 1XC9A 2HU9A 3W3DA 3CWTA 2E71A 4KI4A 1A35A 3ID6A 2IS1A 1MBKA 3GBGA 3BR5A 1WSEA 1IN7A 2MWPA 1Q86O 1VSJA 3CCLN 1R0AA 3EAEA 2YI1A 1N5ZA 4DJAA 3QBWA 2KW4A 2LCSA 1MH3A 2PMUA 3HOYJ 2IAIA 1WI3A 2ZPFB 3KD1E 3W2VA 5KYYA 2ZPEB 1PD1A 2GWRA 1NGBA 1KG3A 2AO9A 2KTQA 4OIRF 3OA9A 3TR8A 4A3LJ 1S9EA 1YJ9I 1RRQA 2KK4A 4YHHK 2IVNA 3MEEA 4UV9A 4KAZA 3BQZA 2VKDA 3OH9A 1FTTA 4J2EA 5FKNA 4WQ5A 5ICGA 2ZGYA 4LXCA 1NGCA 3O2PE 2O9VA 3NF8A 2F4IA 1VQ8T 3ZT3A 1LPLA 4C8NA 3GXOA 2H1KA 4HSRA 5JHFA 1Q81C 2KFNA 2RJCA 4MMKA 3HOZJ 1BO5O 1YQKA 4KYWA 3FLCO 3VOEA 5JICA 5AZIB 3OW2P 3D2EB 5LJ5f 3LSJA 3CCVI 5GTHC 3RMQA 5FLXE 3DOKA 1XTAA 2O8CB 1S6PA 1K73U 4IBNA 2KRNA 1CZ9A 3F2KA 3IHUA 2ZE2A 3QEIA 1VQ4N 1UOCA 2XROA 2ESNA 3O3GA 1ABOA 1SFXA 2P9SB 2I5WA 1WJFA 4FWKA 2GX9A 1JLGA 1N6AA 3SFZA 2HVQA 4CZEA 3F0CA 4JK9A 4CEDA 3TPQA 1Q7YO 2CGPA 1CZBA 1MH4A 5LRRA 4LIUA 4CK2A 2LDMA 3HB9A 2O01E 2GXBA 2MABA 4HF2A 3T5XA 1S3XA 3PQJA 1N39A 1Y7XA 3V7SA 3CXCM 3CVSA 5CAIA 2FHDA 4M75A 3H9JA 4E70A 5BPNA 5AR0A 1CZAN 3FK6A 5HS7A 5DYMA 4C92F 1S1TA 2F1LA 4DTMA 2O5RA 3ABUA 4HRIA 1FSEA 5GAMj 2LRDA 4FJ8A 2NS0A 2VT2A 3HKZN 1R1TA 4XL9A 4DYQA 4KFBA 4CJ7A 4G6DA 2UXXA 1W6XA 4XSXF 2P81A 3NDKA 5CO7A 2Y9ZA 2RPNA 3SQNA 1OQYA 1ZA2B 1ZG5A 4FZYA 4HQMA 2IA0A 2ASMA 2NVQJ 3ZOBA 5IYBJ 5J6XA 1Y6IA 3GO5A 3PIPA 5CYVA 1W5SA 5BR8K 3N05A 4X66K 2ZAEA 4PL7A 4DFJA 2QCOA 4XTYA 2UUZA 2V7YA 4CZFA 2D1VA 2IVPA 4LD9K 5C10A 1K4US 1EX4A 4ZYAA 1VSDA 1B34A 2DMUA 3ER0A 1K8KB 3K4BA 1H89C 4BJTA 4RKUE 3AY9A 3AG2H 3KKSA 4IWVA 1J54A 2EQIA 2P9NA 4GVEA 3KP3A 2ETHA 2DTUA 2JVVA 4G7ZF 1S72T 3QNNA 1PSEA 3DLHA 1NGJA 2ZJQL 2QKMB 2OPRA 4CZJA 1OH7A 3DRRA 1LWEA 2EILH 4M3GA 2MK5A 4N0BA 4X9CA 3HTSB 3ZETA 4ZH4F 1Q81R 2WSEE 1RNLA 1WPYA 4CXFA 2KLAA 5M1QA 4FQGA 1QVGA 5GAOq 4CECA 5HP1A 2FD5A 4KB1A 4RLFA 3VS0A 2RREA 4B9QA 1M3AA 3E1YA 1VZ0A 1PUEE 2NRTA 1W97L 3KKRA 5HLHA 4M3RA 2MBFA 1AWXA 4I01A 3F23A 5KQ8A 1D8JA 5FFXA 4G6TB 1P59A 5KCHA 3BF1A 1WGSA 4N4IA 4ZDLA 3S1MJ 1E3HA 2DDAA 1WJCA 2K4YA 2M4KA 2VOOA 1X6GA 1RNHA 3CCMI 4CIGA 2Q2EB 1RRSA 3DKYA 2O8EA 4M7AE 6PAXA 2R7XA 1RT6A 3JCMb 4XLNF 2DL3A 2LNHB 1WHHA 1OCPA 3IKMA 1JI8A 1K7AA 4BHBA 4KN7X 2ZPHB 3CMAA 4ENJA 3WE2A 3CJRB 4J8OA 1KJWA 1S5JA 3H0IA 3JB9I 3M1EA 3PNWC 5TKYA 3EH2A 3LM9A 1UFMA 3CFOA 3HFNA 1NKBA 5GANd 4C2MJ 2F8TA 4P9UA 2VPLA 1Z91A 4JP0A 5BN8A 4M7AB 1U9OA 3L3UA 4CJRA 3FM3A 2HQRA 2JWTA 4UNFA 2QLZA 1X3ZB 4DGWB 2HXIA 2JGUA 1MJ9A 4LUEA 1T3SA 1NMDA 5AQNA 3GTKJ 3CC2I 1RT4A 4G7OF 1W70A 1XMOK 2V1XA 3RBBB 1XMXA 1D1BA 1IN4A 3MMYB 1M1KO 4YTLA 2EZLA 4M9SA 4EJWA 2P6SA 1LCUA 2ZJRL 2D6FA 4GFBA 4R8HA 1OULA 5CY4A 5F64A 2GBZA 2CSQA 3H1VX 3E9GA 2COMA 2E10A 3SQ1A 5H6QA 4J9IA 4DQSA 3AL0C 5IXFA 4Q5VA 5IP6A 2ZKZA 4IUPA 3MKLA 5DMRA 3N0UA 3D5SC 1ZG3A 4W5TA 1PRLC 2E5NA 3CC4I 3KWGA 3WU2C 3S1RJ 1BC8C 2LY1A 3CCUN 5GANg 3AFHA 3BWGA 3M3YJ 1D09B 4YOTA 3QEXA 1JXSA 2EZHA 2LH9A 3N97A 4BRGA 5FRNA 4OF1A 3VS5A 5M5XJ 4K2EA 3RMSA 2W25A 4XIDA 1X1BA 4H0OA 3WXKA 1ATSA 2CREA 2IXSA 4BROA 4FISA 4BRNA 4PGGA 2STTA 1RT1A 2FB7A 1B8IB 2DPDA 4E2FB 1RT7A 5GMKi 3W6VA 1AA7A 1TK0A 4DSLA 3A2FA 1JL2A 1SSHA 1ZRFA 2DU9A 4MO5A 2IS2A 2R7FA 1RT3A 1Z9ZA 4IF4A 2EPDA 3F0ZA 3BE3A 1V54H 3VQCA 1JKOC 3VYTB 2R3SA 1RDCA 1KFDA 2CH4W 3IWZA 4GY5A 3ML6A 4IOAF 4H5RA 2EQUA 1YBYA 3Q3SA 3RIRA 1V76A 2RQUA 2XHCA 1UHCA 1S6LA 2RQRA 3NTIA 2F2VA 3GL1A 4HXJA 2IDOA 1NYGA 1VSHA 2CUJA 4I0BA 1M2VB 3K1PA 1UECA 4NL2A 5LEKA 3NTHA 3PIPF 2CP0A 4M7DG 2VWFA 2HYJA 4IDHA 2VQFK 1VQ7Q 3RKXA 5BRDA 1NEBA 3JCMe 4F16A 1YJ9N 1VQ9I 1K78B 3E0JB 4NCAA 4Z4IA 1FP2A 3MEAA 3QZ9B 4AIHA 5KYUB 4DQPA 3S3OA 3C7NB 3OBYA 2XU8A 2X1EA 4Y13A 1C0TA 2HF4A 4JUVA 3O4NA 4OMMA 5IPAA 1NG9A 3VPRA 4HNUA 2DIQA 4GDFA 2K6DA 3KYDB 1M3BA 2HPMA 3O9TA 4JKBA 4FTHA 4CERA 3O8VA 4ISEA 2EJRA 2BZTA 2OA8A 4C0DB 3VEPA 3EHQA 2DDBA 3CCVN 2CSIA 1QRYA 1X2QA 4CJKA 5LGUA 3LH0A 3OIOA 3K10A 2M4GA 2XAGA 4XMYA 3VQ5A 2L9SA 4JI7K 3NHNA 1Z7LA 1VQKI 5EZHA 5KAFC 5K14A 1CGPA 2MA3A 1P9QC 1BU1A 4O6JA 2QQRA 2DA3A 1HDPA 1YIOA 4CJEA 3MMVA 2BBYA 3JB9H 3TARA 1Y96A 3H3ZA 4JKGB 3O9RA 1Q7YC 4ZTFA 2QEXQ 3HOWJ 4KA4A 4X6AJ 4KUIA 4DS5A 2RHYA 4U88A 3VGKA 1Z3XA 2Y31A 4WXCA 2MPXC 4EZ6A 1JGSA 4JK8A 1ZYRF 1IUYA 4FW2A 5C6SA 5KRSA 2L7MP 7AT1B 4ELVA 1AWCA 1HCRA 4O8UA 5AIPA 3FHZA 2ZZDA 3QHSA 4JEPA 4KIFA 3FSPA 1NK5A 5BS6A 3EGDA 3LWHA 3JCUC 3REBB 2VQCA 2AZSA 4RW8A 4BREA 3JYTA 4MNUA 3J81K 2Y2ZA 4RW4A 2VONA 3DWLE 4XTUA 2L7FP 2AXLA 1K0XA 5EOYA 1MNMC 3GTGJ 3L6QA 1E3PA 1DTQA 4DFKA 3KXTA 1H0MA 4KPYA 5IYCJ 1JO8A 2R7YA 4M75D 4NYNA 1F36A 1TWHJ 5DM7R 2VQLA 1EETA 1KQ1A 1X2NA 2E1MC 3QAHA 2EA2A 1M8MA 2DBMA 2MH2A 4M7AG 4XQ3A 2HWVA 3HHTB 2OF7A 5D7UA 1KVCA 2OFKA 5FDLA 3ONQA 4H0VB 1HA8A 2JM9A 3VS1A 2VYPA 5E1ZB 3ZMSA 2K3PA 3ZXSA 3V9XA 3X2QH 4FJNA 2HVIA 1U6GA 3VSKA 5CKEA 2Q36A 3HHHA 4P96A 2UU9K 3KLOA 1VQ6T 1DLOA 5FPNA 4A5MA 2K5IA 4IOCL 2JWKA 1P4XA 3FZHA 4KH5A 2IS4A 1BKBA 3I59A 4AG1C 3NFAA 3OBWA 1JEGA 5CCAA 3DBHB 3H46O 3VEVA 3NE6A 2K9NA 2K9GA 1PVSA 1V4SA 5KGXA 3L2WA 2NVYJ 1VAZA 4KGVB 1D3YA 1K0SA 3S16J 4HTLA 2WY7Q 1VQ8I 3MZYA 4ZYEA 2GF7A 1KC8U 4IURA 3GE1A 3HG9A 4DV0K 1XNRK 4JLHA 4ZYDA 4XTXA 3HJEA 5EDNA 2JTEA 1Q1VA 2FBXA 3DEEA 2K9MA 1QP3A 2EYXA 1BIUA 1OU8A 4DUZK 3L00A 1OVYA 3M8RA 2M51A 4HA8A 5HDNA 3FLGA 2X1DA 4DEXA 1R22A 4HVJA 5F0HA 3QIPA 1SC7A 3TWHA 3L2ZA 3CCMN 2L54A 5K7FA 5TKWA 2P84A 4ILHA 2Z1HA 3L7WA 1YI2T 3LDLA 1D3BB 3C1DA 3HSEA 1A5VA 5DDGA 3PNYA 2A5WA 2R7DA 1IGNA 1VQOA 4CCNA 4CYCA 1GXQA 5GPAA 1RBVA 1ZN2A 1RILA 3NVKA 3MEWA 2EFNA 4PJ0C 4HWIA 2GBYA 1QZEA 4QTRA 5IH2A 2FC0A 4N4HA 3WG9A 4LOCA 3LDNA 3KTUA 3I33A 2F2XA 3CQ8A 1H9GA 1IXCA 3TBIA 3VYGA 2D1KA 2O9SA 2BY1A 2QWPA 2E64A 5ERIA 5FPMA 3CC2N 1W1WE 3FXLA 1NBEB 3H92A 1MU2A 3MWTA 3K5NA 2XRIA 3J7AF 3IAM2 1M1KC 2O88A 2YG8A 2IVMA 3MN7A 4EMHA 1RR8C 2LC4A 2RM4A 4PJNA 1HSJA 1TUGB 4EHTA 2DILA 2DMNA 3C94A 5LJ3e 3WNFA 2HEOA 2DQRA 4M77A 4IUTA 2EGCA 4B8CA 4YNQA 1J9IA 1D0XA 3EL2A 3FFIA 1JLQA 2P0KA 1CF7B 2V7FA 1WSHA 3C12A 1NGDA 4ZN3A 1E7OA 3VENA 3CCSA 2EAYA 3CC4N 3GMEA 4JLIA 3BUZB 1R1UA 4V19S 3BJAA 4OMLA 4B1VA 4L59A 2V9VA 1LOJA 5KRTA 2XDVA 2V1RA 1XCBA 2ZSHB 3RMDA 1U5SA 2CGKA 2LLKA 2QQBA 2FO0A 1UEBA 2WB1A 5ILUA 2JT1A 1XUPO 3QPLA 4FXDA 5JI6A 3ZQHA 2R0QC 1SF9A 2CO5A 2K57A 3WGHA 4L0ZB 1J5OA 2DXTA 4DQ8A 4HVWA 3CCLQ 2X9HA 4OFEA 4A4GA 3RKWA 2W84A 1WZ2A 4QWQA 2HMAA 1AEYA 1ZBUA 3IC7A 5KPZA 4IRIA 3QYGB 3R60A 5DCMA 3CCQQ 3A4CA 2K5CA 1RKTA 5M3MJ 4IKFA 3M0UA 4GV9A 4BY6C 1X43A 5GMKl 3DOLA 2BW3A 1KEAA 1X69A 4ISGA 1NK8A 3AVIA 4DKWA 5ICFA 1YNZA 1WJAA 4HPQA 1GOCA 1R0BG 5GAN8 3DXMA 1STZA 4IHVA 4O8KA 5BR9A 2HYFA 4RTZA 2O8DB 2DAQA 5J1EA 2E6MA 3JRZA 5LBQA 1VK0A 2DXIA 2HSTA 4HX4A 1BQMA 4LG0A 2RA2A 4X1EA 1OR7C 2KQWA 3NF7A 1C1BA 1VQ9N 4IO9L 3RMCA 1N27A 2W03A 5DM7F 5HDKA 3VQBA 1SRMA 3TAEA 4IG3A 5AZJB 2E7XA 3RKQA 2EHGA 4AU7A 5L3EA 1VQLT 3K4JA 5E3OA 5EU7A 4BGDA 2P4WA 3SBTA 2X6OA 4A3GJ 3CJ1A 3O8MA 1TTYA 3GW2A 2Y0SA 1XSVA 3BROA 5D3GA 3HTRA 4BE2A 2GZWA 3FXKA 1QQIA 3OW2S 3U21A 2M9HA 1N36K 2YHYA 4Y3OA 1MDUB 2YRCA 2H27A 3L1AA 4PZJA 2HB5A 4GMJB 2ZPIB 3K57A 4J8FA 4BVPA 2PY5A 1VQKN 2JVHA 3LCNA 4BKXA 4F2RA 2CU7A 1LWVA 5EYRA 2KZGA 2CGJA 3S41A 2YUPA 4DTJA 4Q48A 2J05A 1UCRA 1VQ5T 1ZLKA 3PJRA 2Q0UA 3RQ4A 2NNYA 2AKKA 4CZKA 4FSVA 1UHSA 3THVA 2NUZA 4B9WA 3VTHA 5FLXZ 4BE1A 2KXDA 5TRDA 3CMEA 4F4KA 4JAXA 3QYBA 4XN3A 2LMJA 1R23A 3FC3A 5AFUA 5LJ5h 3J7AP 2VV5A 4OGCA 2Y4YA 2CP6A 5LHIA 3UKGA 4O3MA 5CQXA 2EWSA 5C0MA 5GANf 4S04A 3MEVA 5AQXA 1HDDC 5EJCA 2P4RA 2E1HA 1SD5A 4LJZF 1XWLA 1LDKB 1N9RA 4BQQA 2GGRA 1SKWA 2VKHA 3DEWA 2A1SA 2QWMA 2CW7A 4LFUA 4HHTA 1IRZA 1R0CB 1KG1A 1YVNA 4C3HJ 3PT9A 3FR0A 3K70C 3QESA 4XM3A 3A5NC 2HKXA 4KH0B 1QNTA 3BDUA 3K1MA 4C8MA 1OI1A 3BG5A 3VQ9A 3GFMA 4B23A 1O9SA 3KLGA 1LWWA 1OEBA 4G8XA 3OYIA 4N47A 3J81E 1F43A 4FOIA 1VUBA 1B1BA 3K6GA 1DPUA 5KCOA 2V52B 3EFSA 2NRAC 1HW5A 5AQPA 3CCJT 3IRXA 3UPUA 2EGEA 4BGBA 2LQNA 4EMKB 2X4YA 2H3GX 4J19A 2IS3A 1QKWA 2HTJA 4UY8I 5IAYA 2W04A 2HL5C 2DYIA 5E8GA 2QQAA 2LP5A 3MJXA 5FKMA 2DLLA 2L3DA 4FE7A 3ULQB 1YIJT 2KRFA 1OR7A 1MBHA 4J7IA 2EV5A 2QWRA 4FJ5A 1USSA 1VQ8N 1ZK8A 2QTVA 3W0LA 4AHCA 5LJ5e 4JKFA 3V9UA 2F2WA 3ZQCA 4IPAA 3E5UA 1UHFA 2C0TA 4A2BA 2RKHA 2HZYA 4CCOA 3F9MA 4FWLA 1IGQA 3ZLJA 3JS6A 2YLCA 3Q7CA 3E2UA 2DERA 2FEZA 3EGXA 4XK4A 3IRRA 3W2WA 4E6RA 3A5ZB 1M9SA 5HK0A 5CVJA 4J9GA 4QQ6A 4CD1A 3E6BA 1J09A 1IH7A 3ZMDA 3LDSA 5JS1A 3M0TA 2H3EB 3IKVA 3WT0A 4M7XA 3PGGA 4NB4A 2YKNA 3CC7Q 3S93A 2DL8A 4LFAK 2O4GA 2RVCA 1K8AO 1RADB 3VUZA 2QTXA 2Q0OA 1HSQA 3K4MA 2KHMA 4FWMA 4U87A 4C8OA 2K79A 3M55A 2RB6A 2QEXT 2F6CA 1HC8A 2E3IA 4XU3A 3GZNB 2RQTA 3MEGA 2QSFX 3BTCA 1HNXK 3P83D 3QPSA 1FYKA 1U8BA 3MKWB 4C8QC 2O4XB 4IFYA 4U0WA 4I9QA 1OH5A 1HXDA 4F3QA 4LDWA 2XK0A 4IHTA 1WQWA 1YVUA 2F5CA 1BR2A 2WA0A 4EIAA 2TCTA 2HHWA 2Z1GA 1S5LC 1O7FA 1NKEA 4HCZA 1IV0A 1RI0A 2DPUA 3HEFA 1M90R 4QPOA 4BRIA 1YO5C 1U84A 1YXQA 5GTIC 2Q1NA 3M9QA 1G4DA 3QINA 3CCLA 1T33A 5DUIA 1YAGA 2M9UA 2NOIA 3IH3A 4DFPA 1NK6A 3NH2A 1KAYA 1C0MA 5JVTA 2DTZA 1WJBA 1B34B 2OAWA 3ZSYA 4HTUA 1NWKA 3DV8A 3HOUJ 1ZGAA 3HOTA 5D6EA 2XGEA 1P90A 1K1ZA 2P9NB 1KQSS 3HC7A 1TC3C 1AWOA 2CFXA 4KGXB 3JCMd 5FJ8J 5JVGL 1D1CA 4AI4A 4BI8B 4DOZA 4IXAA 2K3XA 3DLAA 1OV3A 1Z25A 4JD2A 4IQ4A 4IHSA 3OVNA 2ZJPL 1W5TA 1VQ6I 2RHZA 1TVRA 4CI0C 4H03B 2ENMA 2JA6J 1AKHB 4M77D 4DR6K 4N41A 4A53A 1S72N 4N76A 4EDUA 3RVCA 1WB9A 2E19A 1JUSA 1TYQB 1QQNA 2ADUA 4UHTA 4Y7NJ 1SQKA 3QJYA 4GKKK 3DP7A 1PSFA 1V5EA 1WKMA 4EGYA 5BPDA 3PIOA 4M3EA 2YU3A 1QSSA 3HSTB 1LNWA 1YJNT 1FYNA 5HNHA 2CUDA 1VQ4A 1TXQA 4RWTA 3S15J 1UGVA 5AQJA 3ZSVA 1EZZB 2ZJ2A 4KREA 2A3ZA 3BPXA 4FPAA 5EVZA 3E7LA 3OIQA 1GLCG 1K73C 1JKRC 1X1DA 5HCKA 3P7NA 3WHBA 4F92B 1CXUA 1REPC 2AHJB 2FVUA 1YHQQ 1T05A 4CA0A 2V7ZA 1MUZA 1NGIA 1JT6A 4CF2A 1OYYA 1U6ZA 1ZUKA 4OGEA 4FLVA 3CCVQ 3GOIA 2VWKA 2HVSA 3WU1B 3ZN1A 3HKZA 2FBKA 3CBPA 4JKHA 5M1OA 2Z0WA 5L3BA 1EBMA 4HNTA 5FU6B 1NZ9A 2NLXA 3VS3A 2XPVA 3QYFA 2RI2A 5DLOA 2FX0A 1QZ5A 5GMKe 4DEYA 4X34A 1X3NA 1YUWA 3GWZA 3CM5A 1REVA 3G71T 2W6LA 3V9ZA 2QBYA 2LQ8A 2FJ1A 5GP9A 3I56T 2DPPB 1EQYA 4K43A 2R57A 1FYLA 1W2BS 3MO8A 4AFQC 2GUIA 2CG4A 2EQRA 1AWJA 2X6YA 1J7KA 2DA9A 2XF7A 2A68F 3CJAA 3HRTA 4CH7A 3S6WA 3KZYA 2VIXA 1BCOA 3P9IA 2CT4A 2YRDA 1EIFA 4CEBA 2NRZA 1ZAOA 1UHWA 3QEPA 1IBKK 1R58A 1XGMA 3FXRA 2YNFA 3LWIA 2P9IA 3VJPA 1BUPA 1IG9A 1O1WA 2Z16A 1EWQA 3CUQC 3FKIJ 2JA5J 2E2OA 3KP7A 2R7VA 2A28A 3TEEA 4I09A 1IBLK 3AO4A 1UJ0A 3O8HA 1SVLA 2HBKA 3ERED 4BJ6C 3SV3A 3JTGA 1NM7A 5GAN3 3A0IX 4QVCA 4HF1A 5DD4A 1KD1R 3H36A 1WJRA 4DWIA 2FOWA 4OJRA 2RD1A 4H5NA 3JREA 4A3JJ 2NUTA 2E5ZA 3A1YA 1ILYA 2HTSA 1KCFA 4IUQA 2K3YA 4B8XA 3LYIA 1XQPA 3P8BB 4L5JA 4M75G 3NEUA 4FJLA 4J9FA 1IDZA 3U3GA 1ZA1B 2HDCA 4A0YA 1YYVA 1KHCA 1ZELA 1WSFA 4AHSA 3HP9A 1HW1A 1USTA 1SAUA 1RBTA 3CCQT 4B1WB 4CZHA 4OKKA 1M1EB 3FBNB 4XEIA 5KGWA 2PJPA 1GLFO 1GRIA 2QVOA 2A41A 3VA0A 3W6JB 3AT1B 5LJ5j 5D5XB 1QVFP 3U9GA 3E19A 5FWBA 2OZ6A 2LSNA 1K73R 1MSFC 4MDWA 4RB2C 2ICWG 1U1TA 2X3WD 1VA7A 1JTXA 2OTLT 2DD4A 2L8DA 2DK3A 3BG9A 1DEJA 1WBBA 1E4FT 5C12A 3KX2A 4QS9A 1PU7A 2OU2A 1FX7A 3EGUA 5AQWA 4EW0A 2ESHA 4XNFA 1S7AA 4F93B 3LSTA 1APLC 2VC0A 2HBMA 1M30A 1NKCA 4NYFA 2EK5A 4Z02A 1HLUA 4XU0A 1KU9A 2FBIA 2NYXA 3D45A 2H6CA 4XLCA 2JT4A 3VRZA 2HQNA 3L4IA 1BK2A 2M7AA 2HHXA 1KONA 4IIMA 2CS3A 3GF5A 1SUQA 4RDUA 1VQLI 2X6WA 2FXUA 4FCYA 1MUNA 3L9FA 4AT1B 1R49A 1JLCA 4ORZA 3FWEA 4N9HA 2P9PA 3CCMQ 2O8BA 2QAZA 3ZMTA 2WACA 1JCFA 2KFZA 4AHRA 4E7JA 1FPQA 1T44A 1Y0NA 3Q9VA 4Z4CA 4I99C 5HRNA 2VJ5A 3DXJF 2WOMA 2VXDA 2C06A 3IMXA 3BG3A 1MPGA 1YWPA 1NKUA 2XVCA 1RGIA 3F22A 3S1NJ 5BREA 3WEEA 2ZPBB 2FF4A 3S17J 2DYBA 4BQZA 2UUBK 2VXZA 2KDZA 2M8GX 3V8JA 3I53A 2IG0A 4A5BA 2V9KA 1PCXA 4BBRJ 1WUAA 4RTFD 1LW2A 1MNDA 1M8VA 3OYHA 3HYFA 3P38A 3CCUA 4FLYA 3BP8A 2FSNA 2NUBA 2W10A 1K8AC 2HHSA 5LMUK 2VJIA 5ILVA 1VQ5I 4B9UA 5FU7B 3GVAA 4UUTA 1OZ2A 2QF7A 1ACMB 1NG6A 4F52A 2AA4A 3CC2Q 3C7JA 3EGDB 3E5XA 1LEBA 4DU4A 4NXMK 4UUSB 2P51A 4Y33A 4KDPA 1C6VA 2DOEA 1KSPA 3H1QA 5CZ2A 3CUQA 1QCNA 4PQUA 2A07F 3UKUA 3ZSOA 2JHJA 1KQ9A 4ZZLA 3H0HA 3R6NA 1J0RA 1B9DA 3JRDA 2J6KA 2VGMA 2ECZA 2DMPA 2IA2A 5F1RA 3MPUB 1PM3A 3NAUA 1ZH5A 1D9DA 3MK6A 3TVTA 1U4BA 2Y30A 1K9MU 1IKWA 3OYBA 3QFUA 2YDLA 1S29A 1Y56A 4M7DA 2HZDA 2DT7B 1V5GA 1JCGA 2A0FB 3QBXA 1TT0A 3TCJA 2JA8J 2VUBA 5AN4A 2R5MA 3CYMA 2JZ2A 1LFUP 4C8QF 2IT0A 1VYUA 2EYYA 2D1HA 1GBRA 2LOOA 1L3VA 1PC0A 1RIOH 2JPCA 3ZYYX 2YPRA 4R5PA 4L18B 5ILSA 3V42A 4B9LA 3DLLL 2NRRA 3BT9A 1M1GA 4I6ZA 2ID3A 3LX7A 3I59B 3R1XA 1YJ9A 4BDYA 5KYWA 3MWPA 1D8YA 2L4AA 4C2UA 3V9WA 5HNFA 3VQ6A 5I22A 1WDXA 1YX5A 5L3FA 1ZLJA 3CCJI 2DQLA 1RC9A 3R6OA 4CHQA 2VJJA 1J5YA 2QDYB 1QVFM 1VQ6N 2IPOB 4HYEA 4A93J 3K70D 3GTJJ 4JQFA 2QI2A 4UOBA 1MW7A 3F10A 4E6KG 4EW4A 1XQOA 1YIJI 2E1OA 1XOVA 3MD2A 4EA5A 1Z77A 5E3NA 1WXBA 3CCVA 1KLNA 2F5EA 4PJOC 1XGNA 2DBBA 4KHYA 1H9TA 4DU3A 1BHLA 4ZN1A 1TTHB 5F0CA 3ULEA 3OB9A 3QWYA 4G9YA 1QVGP 3AGKA 2VKEA 1B7TA 4DF8A 2P0WA 2E2QA 5DPKA 1QW1A 4PUOA 2P9KA 3BTIA 5GAGJ 1N9SA 3ATUA 3BZ6A 4AH9A 1LFPA 3M53A 4CYCB 1UAXA 1WEFA 2W48A 3M1CA 4B8AB 4XRSA 3CF5F 4H0PA 2AXTC 1LDDA 2E2HJ 4IXCA 2V75A 2ASPA 2M30A 4OAZA 2O6GE 3CC7T 4E89A 2LSOA 5FLMJ 1R00A 1YI2N 3FEOA 1Z7UA 3CI5A 3CCET 3HPGA 3F3XA 3CQYA 3H9GA 3OMGA 1ITGA 2KZVA 1YE9A 2E60A 3F5TA 4M77E 2M8EA 2QEXI 1IN5A 3E5QA 4M3FA 3RYRA 1HX1A 4QT7A 1VQNT 3P39A 2E1NA 5BN9A 1KQ8A 4BB7A 2B6AA 3M8PA 1LWCA 2LF8A 2YU9J 2ATCB 4FJMA 4QAGA 3WODF 2ECCA 1PWTA 1D0YA 4MMLA 2BANA 4RW7A 2J4RA 3ECOA 2ZCWA 3FKJA 3KUFA 2D1XA 5E3MA 3INZA 2EH3A 3OYGA 3AARA 4KISA 2JMAA 2PBDA 4W5RA 4M77B 3E3VA 4OMYA 4FX4A 1U2VA 4PFOA 3M9AA 2CH5A 3FE1A 1R4MB 2GWKA 1E2XA 1G3SA 3DKWA 4HV5A 4M78C 1TW3A 2LQKA 4CD3A 3Q0WA 1VI0A 3META 4DFMA 2ZD1A 3HKSA 2V1NA 3V1RA 4JJDA 5F2RA 2FMYA 4A61A 1X9JA 3QJ6A 4RCCA 1DQUA 3SI6A 2KL4A 3I8DA 3TU4K 1UUEA 1WJEA 1V29B 2QA4T 1XGSA 5F04A 3B6OA 1I3QJ 4B47A 3VERA 3QBYA 4FYWB 2EFOA 1NGNA 1NBWA 2PFBA 2QWLA 2KP6A 3NRVA 4LD0A 3B6CA 2VE8A 2KISA 3LSGA 1QZYA 5JLXA 3UA7A 1NJIO 2ZBKA 3PNTA 3TDUC 1P6RA 3M54A 2ETJA 5HBMA 4DTPA 1HJRA 3UNGC 3HM5A 1NG7A 4CFCA 2BW3B 2XY8A 4BRHA 3NFCA 3KPHA 3N5BB 1YS6A 4G1QA 4NC8A 3DLMA 4J6YA 1JT0A 2W57A 4YEJA 5A0DA 2VVKA 4D6WA 4ELUA 4ZYHA 4HVVA 1DU6A 2HKQB 4JS5A 1WXUA 2HBLA 1KC8C 3JSPA 1V5FA 4MQ3A 1YJNI 3PIPL 3K58A 5KPTA 1I39A 3CCMA 4W5NA 2PBIA 4JLGA 2MC4A 2DO7A 5K5OA 4MDBA 3CWUA 5GANh 1L3TA 3EG2A 2EZIA 1B4AA 4DR3K 3PX0A 2ROLA 4CF9A 3LAPA 1SD6A 1XPXA 3JCMf 3FMSA 2ZCFB 1R71A 5KNLA 1OX8A 3ZX0A 2OD5A 3KLHA 3MZ8A 2L0AA 4MLEA 1VQ8Q 1HNIA 3MWMA 3SDGA 3ALYA 1QVGM 4L3QA 4JN4A 5LFAA 5BPIA 2X1CA 3TSWA 1O3RA 1X6BA 5FLXO 1SL2A 1OVQA 1YHQT 3O4WA 4KB0A 1P92A 4HSTA 3M8EA 2XICA 4PKHA 5L3DA 1TKZA 4M3ZA 3HUGA 4HCKA 1WAFA 1JJ6C 1RAAB 2VUMJ 3HBLA 4U67L 1JXBA 3CC2A 3RCOA 2DZCA 5GAOm 1M3HA 1RUWA 5KPRA 2B7EA 1VQLN 5KK1A 4F7UF 3DKXA 3AVJA 2V8KA 3AA4A 3A01B 4BRLA 2CJJA 2LVMA 3NHGA 3JRIA 2KRMA 3WTSC 2LF7A 1RTJA 2IVWA 2RNGA 3KCCA 2F5TX 2LREA 1WLJA 2LC2A 4YORA 3G71I 5FB2A 4AHTA 1UELB 1WHUA 3KLEA 3I56I 3EETA 2CT3A 4YOXA 2LT1A 4DSIA 3UWNA 4BRDA 2V4JC 3M59A 1HJDA 3CC4A 2OJED 2MLGA 2A08A 5GAGP 1T08B 4BR4A 3WTXC 2O8KA 2VJ4A 3VS6A 3T3FA 3CERA 4RG8A 4M78A 4F14A 2XUBA 1R5GA 4C3IJ 2EV0A 1YRNA 1RR7A 2PUKB 2EYZA 3SCXA 1VQ5N 5SZTA 4DR2K 1T8EA 3C3WA 4E0DA 1AU7A 4A0XA 4A6EA 3HXLA 3HRSA 4BHCA 4RTWA 3WTUC 2RHXA 3A8YA 2HDAA 2Y4XA 1RZ4A 1Z21A 3SJHA 2COYA 3B8AX 2EIMH 1IGUA 5GAOr 2EIKH 4CJVA 1XMQK 2PFUA 1U1SA 1UB4A 4B22A 3ULDA 3HIFA 2YXYA 2V26A 4BRFA 3ECHA 3VF4A 2EGAA 3AVCA 2F4OB 2D0AA 5D4SA 5E20A 2MCNA 4NQWB 3HHGA 3EUHC 3SWNC 1ARKA 4CHPA 3OW2A 1IN8A 4HX8A 3OA6A 2X78A 1AHDP 2O2OA 1KC8R 3MKDA 1QWFA 3KBGA 1WFXA 3P5JA 2F8SA 2VC1A 4DV6K 3CCQI 2KKOA 4JX5A 1EWRA 2DXUA 1Q82U 1OCOH 4DV4K 2GEMA 4PL8A 4UY8O 3LSPA 2PZ1A 1A36A 4CJ4A 4CHUA 1BISA 1S72Q 1KQJA 1D0ZA 2L3PA 4A3KJ 3SZ2A 2HHVA 3I4PA 1VQ9A 2X4XA 2Q2RA 2OTLI 2H09A 4MEXF 4N0AC 4I6MB 2HMIA 5I2SA 1KRPA 3S2DJ 1WJSA 3HO1A 1LPQA 4XLAA 4MDAA 3AG3H 3CCJN 5GAN7 4CEZA 2P9LA 4LC9B 3TSQA 4MZPA 1F4KA 4HKEA 4OLAA 1WIEA 4M41A 1Q81O 4AQYK 2E20A 3CG7A 3OYMA 4B44A 2DTIA 2M3AA 4QIWN 3NARA 1QHAA 2L9NA 5J4VA 2QW9A 4KHNA 2XPUA 2RNJA 2VKNA 3T69A 4CHZA 2HNYA 1YIJN 2V6CA 2KRSA 3EGXB 3LL7A 4A57A 1Z9CA 3J80Z 1MD0A 1AZGB 2ZMEC 1NG2A 4KT5C 5C25A 1ZHIA 2KMTA 2BDPA 1VQKA 4II1A 4AMCA 3K7AJ 2CQQA 4EQQA 2JM8A 4OMFB 3CM6A 1M4ZA 5GAN2 2E6NA 4X1VA 2B5JA 3A0HC 5TGTA 3RDVA 4FLWA 3TW7A 1G59A 4LB5A 1MA9B 1V4TA 1KYZA 3R2XC 3EN9A 1U3EM 3OV8A 5J2NA 3PV8A 1XHZA 2R5ZA 3CD6T 1NPRA 4PJOF 3E9FA 1OOTA 1X3MA 2JXBA 1S7EA 2LKXA 2DRKA 3F6VA 3DXKB 4DIQA 3I0SA 1HBXG 2QGFB 1XC3A 5EY4A 2YCHA 4QW2A 4F2SA 2WADA 2KMUA 2W7NA 3COAC 2DT5A 3T1BA 4O44A 1XNQK 2DJNA 1H92A 1J6ZA 4J9CA 4PGHA 1BL3A 1VTNC 1WLPB 1I0CA 2QEXN 1B6AA 3KK3A 2PJRB 3JB9F 2DCEA 3LP1A 4BQOA 1GCQC 3H0FA 3V8KA 3EKSA 5CLSA 1AZEA 4XN0A 3RZDJ 4GRIA 2ISZA 2M0YA 3D6RA 2PVGB 3H5AA 1NEGA 3KEOA 2ZWHA 3FHGA 4BRAA 3G0QA 1TW2A 2DO3A 4PKGA 1U5TB 1I81A 1H1VA 2HNDA 3F8BA 3C0CA 5LJ3f 5EEHA 5EF6A 2R7WA 2HFHA 4HSBA 2ZJQF 4O4GA 4E7SA 4YFNF 1J3TA 3T1YK 3EUHA 3CWSA 3SWNA 4B1UB 3GDQA 3RNJA 1UTIA 1MMNA 4YDUC 3NGIA 3UT1A 1X75C 2LFBA 3TOAA 4FLTA 4ICLA 1TP4A 4JD2B 2CH6A 1HNWK 2ACJA 5HRSA 2Z1IA 1BI2A 4GNIA 1W7AA 4W1UA 3M4YA 3FM5A 1JE8A 2ZQBA 4J9BA 3I55Q 2DM1A 2R5YB 2PMHA 4A4HA 1PP7U 4M9ZA 2JTVA 1MDMA 3A03A 4J83A 1RAHB 1RDWX 4M78F 1M90U 2EZKA 2B0LA 3T8RA 5GPCA 4IEJA 3TTFA 4BD3A 1DU0A 5KHDA 5HOOA 4N0AA 4X65K 4WF9L 3BG6A 2ZGWA 4S0HB 4CK1A 3AVFA 3QETA 3G4ST 3U23A 2D0CA 2W4SA 4DOWA 4FM0A 1WNLA 3MN6A 4C0FA 1TU0B 1R7JA 2C0OA 1JCEA 4C5HA 4II2A 1N77A 3NCIA 2K27A 4PIIA 2A7YA 4BEHB 4G94A 1HKCA 1YJNN 5I21A 3G6EQ 1YWOA 2ZMEA 1VIEA 1QVFS 1RUOA 4BS9A 2ABLA 3QOPA 1W7PD 1MV0B 3ZSZA 3PUBA 2E34A 2WFBA 3EG3A 4C92A 3J7AO 2HQHA 1ZX6A 1ZGWA 3HSBA 3QDFA 3QEVA 4NZGA 1KQSA 4C1NI 5F1XA 5FPDA 2ZJRF 5K1YA 5IT9K 1NK3P 2K3FA 2E41A 4L9NA 3VPZA 1IO2A 4FWNA 1LQ1A 4XQFA 3GYHX 1YG2A 3CC7I 2D0BA 2O7OA 2DFUA 3M8QA 4JHDA 4PJOD 2DMTA 3QRFF 1NPPA 1RRJA 1U45A 3CCEI 4FK2A 1NOYA 1T0HA 2VXFA 2LKPA 1YQLA 1S1VA 3JW4A 5B66C 2QBYB 4YOVA 3HSFA 1NMNA 1OCZH 1VQNI 4MIMA 4BJ5C 3CJQB 1TL1A 3SQ2A 1XS9A 2DEUA 4J00A 3VFZA 3UDCA 1UMQA 1XTDA 1JJ2P 3JB9D 5GANj 3CLQA 1Q18A 1ETWA 4YOUA 2H8HA 3H1CA 2BTFA 1UJ8A 3Q9SA 3CXCP 4B9NA 4FK0A 3LPTA 3QYEA 3D7EO 2P9IB 3G71N 1K9MO 1Y07A 2HQXA 3I56N 4EVIA 2LJ0A 4BI4A 1GXPA 1G83A 1GLDG 5E1XA 2GTOA 2RQQA 5DS9A 4GY2B 3E01A 1DPRA 1J75A 3JRHA 4O5VA 1PUFB 3O9UA 2MWOA 2RHKA 3LDPA 4DTNA 4CZIA 1MBEA 2GTDA 3AVBA 4CF1A 1BU6O 1KU3A 2FRWA 4V19K 1ABQA 5E1WA 3JRFA 4JI1K 4NUBA 2QA4I 2YUOA 4YG2F 1G3YA 2DLPA 2WC2A 3QFPA 1LNXA 5M5YJ 4Z94A 1KFZA 3KK2A 2CRGA 2FMLA 4D5CA 1K6OA 1DIZA 3PLAA 4NBQA 1S8NA 1H3HA 1BGXT 2X6NA 1K79A 4CO8A 4UUVA 4A3IJ 4A5AA 4M6XA 4B3RK 4AFUC 1CQTA 1WCMJ 4CF0A 1K76A 2K9SA 2VG5A 4M78D 4CW7B 4BQLA 2VL8A 4K0KK 2FPDA 3PO2J 5D6YA 3OOUA 1ZSZA 2A05A 2X9DA 3DM2A 2V51B 3JCMV 4ESRA 2CP3A 1N32K 3N4PA 1Y57A 4AIDA 3HSCA 4FYDA 2JHNA 3NF6A 3SHWA 1DGWY 5AQIA 2IGKA 1QCFA 1QGPA 4X64K 4KKOA 2LX7A 1FKPA 1W2BA 4IFVA 3A98A 2IS6A 3GTPJ 3CCQN 3OY9A 1IV8A 1VQ6Q 1NJZA 2EQJA 2J6OA 2XY6A 2DL7A 2IOCA 1KD1U 4M3DA 5K7HA 3VYRB 2ISYA 1T0FA 2L5QA 2P9UB 1OYIA 3TEDA 3BY7A 3PUFA 4GBQA 5FRMA 2V9PA 2OTLN 3CETA 1X4PA 1O13A 2O8CA 4I7HA 4IHYA 1ON1A 1GBQA 1NJYA 4Z88A 3CUOA 4HLYA 3F72A 5KYXB 5KH6A 2YHBA 2A3SA 2P9PB 2O8BB 3MEUA 2HSEB 1YHQI 1BI4A 2P9SA 1A5JA 2RI3A 3H3UA 3AKZA 3D5RC 3LFKA 1O3QA 4PA1A 3LZJA 3OMYA 2VLAA 2Q1ZB 1IKYA 2B86A 3WEEB 3ASKA 5J39A 3CQZJ 2LNVA 4C5IA 1G5VA 2IGMA 2YLBA 4MEYF 4M9XA 1QVUA 2UYTA 3OTOK 4EIKA 2DA4A 4CBUA 4KHUA 2BV6A 3TGNA 3NNQA 3CQTA 1F21A 4KNYA 4YFUA 3QO3A 5AQQA 2PQ8A 4JKEA 1TUDA 4E9FA 3ZSRA 4PLLA 3S9HA 2Q3SA 2B63J 1T6SA 3KETA 2CQNA 1YI2Q 4D5FA 3L2QA 4IHWA 1IREB 1HQUA 1OFCX 4M3BA 3DTEA 4YFXF 1TKTA 3VEXA 4KTQA 1JJ2M 3W2AA 4MDXA 2XSJC 3F9KA 3WG7H 3VQQA 2BVLA 3UKUB 1HPZA 1GV5A 4M7DE 1JQQA 1QU3A 4A2UA 3CO7C 3BY5A 2G8FA 2Q31A 5JR3A 2DL4A 2LY2A 1TQMA 1NK2P 4LUDA 3PFSA 4KN4X 5C15A 2QGGA 1ACIA 2IIRA 2WV0A 1TUYA 3SJMA 1ORPA 2L9RA 5E8IA 2W82A 2BHZA 1UG1A 3HM9A 4KHQA 5KQDA 4M7DB 1WI7A 1W0HA 2OAZA 1SV5A 1QQOA 1M3QA 2YUSA 1AT1B 5J3BA 3MQ0A 4M6YA 3R8EA 5KN8A 3THWA 4KH6A 2XDBA 4LDXA 2P0QA 3A8GB 3EFOB 5DEQA 1VQMQ 4IOCF 3W6KB 2WY8Q 2JSCA 4OB2B 1SEMA 5KI6A 4AWXB 2OZMA 3AAPA 3HT3A 4C8QG 1Q86U 3CPFA 1T2KA 1WQ2A 2GIVA 3GFLA 3U3YA 3SFIA 2HHTA 3C6HA 2QSHX 2LD5A 1XHXA 3V81A 2VBWA 1KIKA 4FM4B 1S3JA 1M5Q1 2DX1A 4KIGA 1LCKA 4RAYA 2P7CB 3HXMA 3WVEB 1TKDA 5BRHA 1MNEA 4DZPA 3RKYA 4H5VA 1YF5L 3SLCA 3AO5A 2OQRA 3MZHA 2NOGA 3SUOA 2Q0RA 1RFQA 3RSEA 3PX6A 1EO1A 2MI6A 4R56A 3HBTA 4KUMA 3FZMA 2OJ2A 4KT0E 1BG3A 1NYFA 4FJGA 2L7ZA 5B8HA 1KG7A 4QLCU 3KP6A 3ZEHA 1PNJA 2LCLA 2FSWA 1O4XA 1Z05A 3WGGA 4CCMA 1RT2A 3DB4A 3ULEB 1LWFA 3ZMVA 2IAJA 5KTQA 3LAKA 3F73A 2L7KA 5AQKA 1OCTC 4JKCA 3ZQ7A 2G6FX 2D0PA 2OPSA 2CZ7B 1WHLA 4RM3A 2IGNA 3U4LA 2KKZA 3SK3A 1XMKA 2DXCA 1B59A 1I8FA 4DU1A 2NVUB 4B1ZA 4XR6A 4E1JA 1ETQA 4CJTA 5CVIA 4JJCA 3H8ZA 4C0DC 2I8DA 3KFWX 2WTUA 1VRUA 4I7FA 1PYVA 1I6HJ 4C8KA 2CKKA 2YJFA 4N56A 2NRWA 4FWSA 2CUEA 3ZP5A 5GAN6 1G8XA 1NNEA 4AF1A 4ZGJB 3G7ZA 1Q7YU 1D4XA 2DFFA 1VQLQ 3CD6I 4BC2A 3EG9A 1JKHA 3JRBA 1FY7A 2IP2A 3KZZA 1ZYQA 3JCMW 3CC7N 4YY3K 4CGZA 5J8CA 2KLOA 4ZJZA 4JK7A 3CCEN 3Q5FA 3H35A 2XGCA 1N8RR 3VQ7A 4FK4A 3AAFA 3JAMK 1YW9A 3GPLA 2XMFA 4C92D 4M74A 2GXAA 2OYQA 1VQNN 4KULA 1NE8A 2E7WA 2W40A 4GCVA 5L23A 3VYUB 1XMAA 2OFIA 1OCCH 2FNAA 1RUNA 3JCMh 5IT9E 3I4NJ 4FJHA 1WHGA 5BPLA 5C0YA 4CCHA 1ZR2A 1IAWA 3TANA 4CZGA 4XKVA 3SPYA 3DBLB 1VQ5Q 4YPRA 1K9MC 3HZJA 3LW5E 1GOAA 2NUPB 2QYOA 1E0EA 1Z1DA 2CZ1B 3VTIA 1JJ8C 1B8IA 3TO7A 2XY5A 1BA0A 4F04B 1ZXOA 2DE0X 4E7IA 1NTCA 1HQEA 2DN0A 4H5WA 2QUFA 5M9OA 3ZEUB 3K2AA 5LGNA 1A6QA 1XG1A 3O4QA 4PY5A 4HNVA 5JMVA 3ASNH 4M73A 1ZBFA 4FOEA 3QPHA 4ME7A 2DAOA 3VETA 5TJJA 3L1PA 3J7YJ 1Z67A 4MZMA 1VQ6A 1X9WA 2QA4N 3CO6C 4EM1A 1FTZA 4O0JA 3CIPA 3I55T 3KJVA 1P7IA 2W41A 4FJ7A 1TBXA 3PNVA 5C44J 4DTRA 3CCRT 2Y1JA 2QM1A 2LBFB 3BOQA 2DK5A 1QQJA 1ZUUA 3AVGA 1M2VA 3SDBA 4QSHA 5AQTA 2WC9A 4FZXC 2VPRA 1P7MA 3DRSA 3QO9A 2KR3A 5GAOl 1V4RA 2A40A 1TL8A 4A3BJ 1T03A 3G4SI 2G7HA 4HVUA 2FOKA 1K78A 3ABMH 1TLHB 4IO9F 1AD5A 5CKTA 5KYUA 1U9NA 4RTXA 1F1BB 3C7NA 3ZFJA 2LG4A 4BL0B 4A3CJ 4F91B 1K6YA 4RTUA 4CE9A 3HP6A 3SYTA 3CCJQ 1FMKA 4CGJA 2EYWA 3HOVJ 1O3SA 1D5AA 3NGPA 3IUOA 1I3AA 5E18F 1O3TA 1MMSA 3G6ET 2FLOA 4ZGEB 3C4SA 1WQ7A 4QPQA 1H88C 1KO9A 4LF6K 4PSWA 2PYLA 1IRFA 1PRMC 1YIJQ 6AT1B 4IX7A 4IDKA 3BPVA 4CHYA 1PU6A 1Q95G 1Q9YA 3FHNA 3LSMA 1OH8A 2F5DA 1WJQA 4D8DA 2RDPA 2DZ9A 2HQEA 4FJJA 2KE9A 2P8TA 2DA5A 2OZSA 4J9DA 4BWJA 4Z4EA 1UDLA 3ZT2A 1PG5B 2DI3A 3LWLA 4RB3C 4BY1J 3ASMA 2COWA 5BNGA 3QEWA 1YHQN 2QYZA 1ZSGA 5C42A 4KRTA 5IHIA 4DZJA 3R9PA 4F7UG 3MP1A 4X0GA 4JKGA 1GLAG 1ZUYA 1I27A 5EGOB 3GFIA 4KIBA 1T38A 5K5RA 2M5WA 1OKRA 3FXMA 3PIOL 1XCVA 2QKBA 2EPFA 3CPWS 3IG1A 4CEOA 2O31A 1KU2A 1F1ZA 2L3SA 3FZFA 2XY7A 1K9MR 1JHHA 2BE2A 3PVLA 3H9NA 2DNUA 4AD9A 4AYBN 1A0NB 2XF5A 1YRNB 4A3EJ 2KQ2A 3HVTA 4XK8E 3IAS2 3WQUA 4HQEA 2Y90A 3WTZA 2ME0A 3R0AA 2N8GA 3L09A 2EWNA 2W85A 2K40A 5CKBA 1R8OB 4CHNA 1U2WA 3G25A 4LFCK 3F8CA 3EPZA 4K11A 4FM1A 4XSZF 2DY4A 1RPWA 3RR6A 3SD4A 1TK8A 1XB4A 3J7ZI 4RAZA 2G3RA 4Q0BA 1XI1A 1QP2A 4M7AF 1ETYA 3ZMZA 4M4ZA 1QA6A 2M16A 4ILJA 1GV2A 4YOQA 3KLFA 3FJ5A 5FROA 4YPHA 2QWWA 3EDPA 3QP6A 3ZRGA 3TI0A 4KITB 3TSPA 5LY3A 1X1AA 1HKQA 4XRSG 2RH2A 4BI3A 4NDLA 3OMCA 3D2FB 4XONA 1QBJA 3DWLA 3DPLC 1IUFA 1T56A 3TDZC 5EZGA 4H0EA 3C65A 1L3UA 2RNAA 1V55H 1M90O 4M7YA 4MO7A 5HVQC 2OAUA 4PLIA 1I1GA 2O0YA 1YITQ 3VKIA 1X9SA 1T39A 3VRYA 3N4QA 2R5AA 2JMCA 3ZMUA 5AQYA 3NPFA 2FBYA 3X25B 1LMZA 2MIOA 2P5KA 4EJUA 1SAXA 1VQPT 2W1OA 3MVPA 1UGPB 3J80O 2WUSA 4C2TA 3JCMJ 1KHIA 2J5PA 4Z4GA 4WFNL 3RR7A 4BXXJ 4B48A 5HK3A 4DMNA 1SPKA 2PEXA 4PUSA 2WBNA 2K9QA 1WSUA 2ITGA 4DBQA 4B43A 5BRFA 2AK5A 1IN6A 3QQAA 3S32A 2IBDA 3A0BC 3SPZA 1M1FA 3THYA 4V2SA 2AIRB 4I02A 2PI0A 2ZO4A 1RLPC 3J7YP 2PVOB 2B8AA 2ZSIB 1MHNA 3CCYA 4CZLA 2ZNYA 1A04A 2OTJT 3WGIA 2Y1IA 1X2KA 2NNNA 3ESWB 4CIEA 5LJ3h 5CVRA 3VU3C 3CPEA 2GOXB 3LA2A 5KN9A 1VQLA 3I0RA 4PK4A 5GADJ 1YJNQ 3I54A 2FRHA 3I0WA 1JXMA 2UUCK 2ITMA 3BR2A 2PZSA 5CVUA 4PNOA 1ZBLA 2EIJH 3RWUA 2DT6A 4BXUA 1I5ZA 4CK3A 2BY3A 2OQGA 3NF9A 3HJFA 2YNGA 4HZFA 3EZ5A 3GIBA 2DEQA 2RPIA 4DTUA 4ESJA 3PSIA 3CF5L 2L9VA 4ASNA 3BW1A 1GLLO 4RTYA 4H5TA 5AONA 4E7LA 4OKJA 3QOEA 2CUBA 3DQVC 3ZX3A 4OFHA 4A69C 1VQ5A 1J5EK 5ADXA 3SZPA 4PJOG 2CGHA 4CRIA 3EHRA 4E7ZA 1LVKA 3VW4A 2AQFA 4B4CA 3TW6A 5E84A 4CJSA 4OIPF 2D8HA 4JI5K 1I6XA 1R4NB 2GM4A 3CD6N 3L42A 2FZGB 3AA2A 4I2OA 3I5UA 4Y0WA 2QQSA 4XH4A 3OYEA 4FX0A 2VGNA 3WE3A 3M58A 2DF6A 3UA6A 1QTMA 4FIBA 2A42A 1HU0A 1NLOC 3G71Q 3JB9G 4AHUA 4LF5K 2VBYA 4DV3K 3I56Q 4XOTA 2HMPA 2X3XD 3CMEN 4MO4A 1WWXA 1JLEA 2UUAK 5JVGF 4YOWA 3VQEA 4OPJA 3QXEB 3M56A 3D5LA 1JJ2S 5C2FA 3DEUA 3DBRB 8ATCB 3OGDA 2FBVA 1PP8F 2G7UA 3VQ4A 2XIDA 3VQDA 2XASA 2XV4S 2RHIA 2VG6A 4G12A 3CXCS 4B9VA 3O08A 2ZJPF 2P5VA 1K4SA 5I3UA 1VFCA 2JA2A 1XSXA 1LWYA 2VQHA 5IYDJ 4OB1B 2A69F 1VQMT 5DM6L 1EFNA 5FKOA 2LDUA 3B6PA 4E47A 2DYSH 4YELA 4FHTA 3JAME 4DSEA 4EA4A 2WSFE 3SFMA 1HF0A 4EATA 2K4BA 4XLEA 1IG7A 4J6WA 2I7PA 4I2PA 3OJSA 5IXBA 4XOPA 5CQEA 5A2QK 1GXIE 1NM1A 4CEFA 1KG6A 3I9V2 2Z2SB 4JV5K 3QP5A 5DLQE 3KFVA 4ID5A 1S9HA 3CCJA 3MCAB 3A5LC 1KD1O 3IDHA 1XDSA 4Z6YA 2HEQA 3KVGA 5HODA 1TWCJ 5B3SH 4RG2A 1OX9A 1S72I 3DB3A 2HPIA 3I35A 4M78G 1VQ7A 1VSIA 1G3TA 2AJQA 4DK9A 5D5VB 3GZ5A 4DHYA 2M0OA 3L2CA 2EIFA 4EMKC 4C92E 1YIJA 2A6HF 2BKDN 4JYKA 2OCCH 3FDRA 2HNZA 4LY7A 2AT1B 2DFEA 4FVMA 2LNBA 4MQ9F 1T98A 4OFAA 2RC4A 5C4XJ 4OX9K 4GLKA 1MUDA 3G4SN 4LLNA 1OJLA 1YJWT 1NK0A 3HRMA 1S7OA 2KEAA 1R6RA 3JCMP 2OTLQ 5GIOA 4C92B 2P5OA 2NOZA 1XJWB 3HTVA 3IQLA 2ESWA 5AZJA 3HFOA 3S3NA 1K73O 3M0QA 4E9EA 2D0OA 3TAMA 3TAQA 5GMKm 4RB1A 4AM7A 4DV1K 1HR0K 4E19A 4WCIA 4FSXA 1RAEB 3ULRB 3D0PA 4JHDB 3SMPA 2A3LA 2VWJA 1N5YA 4RMNA 3BEXA 5BMZA 3LZIA 2Y48A 1MSEC 5FKLA 2DVEA 4YRVA 1IC8A 2VASA 4WTOB 5L3CA 2KIFA 2QEXA 2PG4A 4OB0B 4DBHA 1OKJA 3A5OC 5EEAA 4HF0A 1NOZA 2RHUA 1B72A 1YOVB 2JNGA 5JS2A 1QHTA 3VUBA 3EYYA 3QG1A 2G8VA 5GADP 4RAFA 2XF6A 1WNSA 1W4SA 4WCGA 4BR5A 1GHCA 4RA2A 1W0TA 1EJ9A 1E17A 4JI3K 4H0XB 3ZQFA 4B1YB 3ZL7C 5HS8A 4PHTX 3M5AA 4HBLA 3CMMA 1MGQA 4C0ZA 5TISC 4Z0UA 3MCZA 4HUGA 5GAN5 2ZF5O 3ENOA 1E3OC 5EG0A 3OS1A 3RMAA 1QQCA 1N78A 1BJAA 2QK9A 1PKTA 3DRPA 2ELKA 3OR2C 1QVFA 3BY6A 2VXEA 3IFRA 3JRCA 2F48A 1FSHA 1SVMA 2O4IA 3O8GA 3TU5A 2YRVA 4ZDOA 3QODA 2CUZA 1OCRH 1Q82R 2DRMA 4OIQF 4LK0F 2P7VB 3V6DA 2O03A 2PMZN 4PJJA 2HVHA 2DW4A 1UAAA 3EEQA 2OPTA 4R79A 3K9TA 3FISA 9ANTA 3AO2A 4D8KA 2GNCA 4FYYB 3GBQA 2QZ8A 3AG4H 2FPFA 1ZKGA 1ZSZB 3B02A 2B4JA 3OHRA 1VIFA 3I55I 2L4MA 4BY7J 3K4CA 1FJLA 4WYBA 5M1NA 1HNZK 2HI3A 1NGFA 4LG3A 2SRCA 1MWMA 2NRXA 2Y75A 3CCRI 5FGMA 4BRKA 1ZRDA 1M90C 5H6RA 4J5YA 3M5RA 5CK9A 3PO4A 4OAYA 1IDYA 1X1PA 2K7LA 1MV3A 1VF9A 3FRNA 4XLFA 1TG0A 5D6XA 4EMKA 5KYYB 4LDYA 4FZZA 1TQIA 1YJNA 5AJ3K 3ELKA 2G8UA 1NH3A 1T6DA 3DLEA 5AQSA 4GYIA 2LTOA 2HOEA 4OWRB 2IEKA 5BPMA 4KI6A 1Z26A 3ISPA 3VDXA 1BIBA 4CEAA 4B09A 1FK9A 5C3EJ 3CJNA 2LZ6B 2HHHK 1H8AC 1ETKA 3FF5A 2AKLA 1QHHD 3G6EI 1SL0A 4ESBA 3LALA 3ERMA 4B1RA 3RERA 4EGZA 1BI4B 4E7KA 5AT1B 1CKAA 1SL1A 2NZTA 5C24A 3I64A 2QK0A 2M45A 3CJCA 2K86A 4GVMA 2E2PA 3HRUA 2CQKA 2NRHA 4K42A 1WEGA 1HOMA 1ON2A 4FYVB 2O8XA 4LK1F 4P55A 2CZ6B 3CTAA 2RN2A 4HCBA 1QPIA 4AI5A 4M75E 4RGXA 4DTXA 3MXJA 4YIFA 3A8MB 3LSHA 4M63C 3UATA 1W36C 3H08A 4O0IA 1D5VA 5LMNK 3G71A 4A0ZA 2KRHA 1G3WA 4FT4A 3DU5A 5FU6C 3I56A 1IRXA 3LANA 3BJOA 2YT6A 2K85A 1I07A 2O4XA 3TO9A 1TOVA 2DBKA 1SMYF 5GAHJ 1U04A 4BH9A 3U9ZA 4M75B 3FHFA 1HUXA 4XTWA 4DLEA 3LWFA 2R7TA 1DP7P 3CCEQ 1ULYA 2E6LA 3CJTB 5LJ3j 4HDUA 1ONVA 4KJZA 2P0PA 3VEZA 3FXQA 1S1WA 1RABB 3I3LA 2FBHA 5LLQA 1I94K 1VQNQ 4EPCA 4Z2YA 3RMBA 2D5VA 1WX6A 1GLJO 3AA5X 1ZBSA 5J1UA 3HGYA 3VOVA 1BW6A 4C92G 5AQHA 3KZBA 1BBYA 1BA5A 3MEDA 2DA2A 4KHSA 3HL2A 1CSKA 5J1YA 1T8IA 1RDBA 3THWB 1E6HA 2MC3A 2NRVA 2HXOA 3PTAA