4BDZA

Pfv intasome with inhibitor xz-90
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 104
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bdzA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bdzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bdzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdzA03
4PLLA 4CK1A 4CJPA 2VG7A 1TKDA 1CXUA 4PQUA 4N76A 1HPZA 4DS5A 1DTQA 4DF4A 2R57A 3OJSA 1FK9A 4CERA 4E19A 4DTSA 4ICLA 1RBVA 2LRQA 4W5RA 4AHRA 4DTJA 4FJ7A 4CEOA 4ID5A 3B6PA 4PUOA 4FLXA 2CKKA 5C0MA 3MEWA 1IH7A 4F3TA 1I3AA 4F4KA 2HB5A 1IG9A 1HRHA 3DLKA 4N4GA 3EAEA 1NK5A 3OYGA 3OYHA 1EKEA 3ZT1A 4N4HA 4IFVA 2RJDA 3PX4A 2O4XA 4O55A 4FZYA 1W0HA 2EFIA 2ZE2A 5J1EA 4DF8A 2BUDA 4E1MA 4CFAA 3HSTB 1BCOA 5FDLA 3SPZA 4AHSA 3FLGA 1C1CA 4NYNA 5HBMA 3O8VA 4BWJA 3T1AA 5D6YA 4CEAA 1ZYQA 4FJJA 4M42A 1SL2A 4KPYA 3PV8A 3LWMA 3UWNA 2F5KA 1Z25A 3OYAA 2EQJA 3MP8A 1O1WA 4CIGA 3RWUA 2EHGA 1NK7A 2X4YA 3OJUA 2XDPA 3SUOA 4DSLA 4CJQA 3AVNA 2RHIA 2P0KA 1QHTA 4DLEA 3S3OA 3OS2A 4OKJA 3SUNA 1XHXA 2GUIA 3QKJA 4Y1DA 3FEOA 3S3NA 4FLYA 3DRRA 1WSIA 4BDYA 1VSKA 3F9KA 2YKNA 1CZ9A 4DTXA 4CJWA 1NK6A 1LAWA 2KZMA 4FJGA 1T03A 2JZ2A 3C6UA 2PZSA 4DG1A 1D9FA 4FLUA 4B9WA 1KTQA 1TV6A 3VQ8A 1BI4B 1BCMA 4CF0A 3TARA 3OY9A 3ZSVA 3SCXA 2KTQA 2ATQA 2ZQBA 4Z4HA 4EP5A 3C94A 3LPTA 2DFHA 3TANA 4HUGA 4B08A 2G3RA 3OB9A 5KE3A 3TR8A 1C1AA 3LH0A 1IKVA 4CK3A 4B9NA 3KLHA 5C6SA 3M8SA 3AO4A 1KFDA 4QCLA 3HM9A 4CF8A 3K2PA 1JLGA 3OMCA 4NS5A 5CYQA 3PFSA 3GOXA 4H8KA 3I0SA 1WLJA 4CJKA 2RJFA 3V81A 2WONA 4KHNA 4FJHA 4B8AB 3RMAA 3PMTA 1LWEA 4MQ3A 2RI3A 2F8SA 1WSGA 4NZGA 1FKOA 2A1SA 2YNIA 1ZBHA 3NTIA 4ID1A 3CM6A 3SZ2A 2WOMA 3NE6A 2XHBA 4FJNA 1GOAA 4A4HA 3KK3A 1U4BA 2G8HA 1SKWA 2HMIA 3OYBA 4C5EA 2OPRA 3AO5A 4Z0UA 4C5IA 1L5UA 4HUEA 1JLEA 3H6ZA 3LPUA 3NTKA 3QLHA 3TAGA 3ZEHA 4AH9A 4DQQA 1SUQA 3DI6A 4KTQA 4FM0A 4FU6A 3LZIA 5D6XA 3AVBA 4DSKA 1TL1A 1RT6A 4RW9A 1ASVA 1NKCA 2HHTA 1KRPA 4GMJB 3NCIA 4C8NA 4KTZA 1WJSA 3AO1A 4TSXA 1NOZA 1UA0A 4CEZA 3OS0A 1WAFA 4BDZA 4DWIA 1LW0A 4CJSA 5C24A 1TKXA 1QSYA 5IAYA 3L3UA 3DB4A 1T05A 5FROA 2IGIA 3VQEA 3TWHA 1SSFA 3MEDA 3CYMA 1BISA 4KI4A 1VRUA 3CG7A 3SQ2A 2XO7A 3QESA 3T19A 4KV8A 2DFEA 1RT5A 4KHQA 4AILC 3ZSXA 4YFUA 1KVCA 3WNGA 5HRSA 4DFMA 5M9OA 1BL3A 4W5TA 2YNGA 4II1A 3PO4A 1C6VA 1CXQA 3LAKA 1IO2A 2W42A 4DFKA 2D0BA 3V9WA 4OGEA 2X4XA 1TK5A 3QIIA 3MEEA 4E1NA 5HRNA 1EX4A 1HNVA 1RILA 4KHYA 3QEVA 3OYJA 3DMJA 2OZMA 1MU2A 2HQEA 3VQ9A 2DY4A 5KCOA 2XY7A 4IUVA 3KKRA 5T7BA 3QBYA 1J54A 3TAFA 1ASWA 4FLWA 4UC4A 4LH5A 4CGGA 3K57A 2ITGA 3F70A 3P1GA 2G8KA 2HHWA 1RDDA 1JKHA 3SUPA 1WAJA 3TAEA 3FC3A 2L89A 3V1RA 3OA6A 1JLFA 1S9EA 4EP4A 4A4GA 3ZT4A 1TVRA 4B9TA 2RKIA 4CJFA 1VSEA 3HPHA 4B9VA 1HYZA 2PYJA 3M8PA 4M3TA 4O5BA 3AVFA 2IS3A 3MXMA 4OPJA 1DLOA 2P51A 4FCYA 4CIEA 3HP9A 4H4OA 5HP1A 4EZ6A 5EU7A 1VSMA 3NGYA 4Z4GA 1RBSA 3AVGA 1D9DA 4FZZA 4Z02A 4O0JA 3LYIA 3MP6A 3ZSRA 2DTUA 1B9DA 2M1HA 1QSSA 2PYLA 1KVBA 3SQ1A 4EDUA 5HROA 1U48A 4FLTA 3ZCMA 3S9HA 1TAQA 2B5JA 5KGWA 1REVA 1BIUA 1KVAA 4W5OA 1J53A 2BDPA 3PY8A 2OPPA 5J2PA 1RT1A 3VQ5A 3NHGA 2G8WA 3JSMA 1RBTA 3H08A 4O44A 5FRNA 3QEWA 3HO1A 3DOKA 4QQDA 4DQIA 4C8LA 1NK9A 3PUFA 3KTQA 3AO2A 1YTAA 3OYLA 4QVZA 3NF8A 3U3GA 1HNIA 5DMRA 2KFNA 2HVHA 2JLEA 5J2NA 3LP0A 4IG3A 1W9HA 3KLEA 4KHWA 2RHUA 2BGGA 3AA2A 1NOYA 5KTQA 4M41A 3ZSWA 4JS5A 4E7JA 1RT2A 2Z1HA 3ZSZA 2L3RA 4FJMA 3L3VA 3BGRA 4DSFA 4CF2A 4HTUA 3NTHA 1EETA 2FBYA 5JS2A 1TK8A 4CHQA 2HQXA 3HVRA 1KFSA 3I0RA 1C0UA 1LW2A 4GVMA 4LH4A 1NJXA 5CY4A 3QETA 2IAJA 4J2DA 3NGIA 4BD3A 2Z1IA 4Z4FA 4AHUA 4B3OA 3AVMA 2NLUA 4FJXA 3HK2A 1Z26A 2YNFA 3SQ0A 3HPGA 4CHPA 4M3YA 1MHNA 3PMIA 4MFBA 2YKMA 4IURA 1JLCA 3D0PA 3QERA 1TKZA 4E7KA 4DU4A 2F96A 2MWOA 4F2RA 1XI1A 3V4IA 3VQ6A 3ISNC 2PQWA 4XIUA 2Y1JA 4B8CA 1JLBA 1GOCA 3AVJA 1EXQA 4CHOA 3P8DA 1S6QA 3MEVA 2EQMA 3HYFA 5DK5A 3LWLA 3DLGA 3AO3A 2GFUA 4AHVA 3TABA 3P5JA 3U3YA 3EY1A 4CFBA 1SV5A 1S1WA 3LP1A 1TK0A 1WJRA 1JXEA 3L2QA 2FHDA 1BQNA 3EYZA 4CEQA 3NF7A 3NBPA 4CK2A 4CF9A 1SKSA 2X4WA 5E41A 4CJ5A 4O0IA 1KHCA 1ZBFA 3G10A 3T3FA 3AA5X 3META 3HVTA 4I9QA 2E6MA 4IUTA 1VSHA 3WNFA 4FJ5A 4L8RB 1IKYA 5HLFA 3DRSA 4I7FA 5KGXA 1VSDA 2ETJA 5KH6A 3NH0A 3LDSA 5I3UA 2R58A 3LGLA 4DTNA 3B6OA 3LP2A 3V9ZA 1QTMA 4FYDA 1S1XA 1Y97A 1YT3A 3RR8A 3K5NA 4N47A 4BE0A 1TKTA 4KREA 4HVJA 1X1PA 1KSPA 1JLAA 3SV3A 3DLBA 1DTTA 2BE2A 4IBNA 3CEYA 2VWJA 2ZD1A 3L42A 3KJVA 3PX0A 3ASMA 2A1RA 4IUQA 3DOLA 2O4XB 3HXMA 4ELVA 3KLGA 4KHUA 3AV9A 1N6QA 1HQUA 3CFRA 4RW8A 4WE1A 4I9LA 3NAEA 4B9XA 4PA1A 4CECA 4J2BA 1EP4A 1NK4A 3FDRA 1Q9XA 3KD5E 2K3XA 4J2AA 3QEPA 5J39A 4HUFA 4F8RA 1XC9A 3BDLA 2BIVA 4K8ZA 1S1VA 3S3MA 2L8DA 1S6PA 3LP3A 5JS1A 4KB1A 4F3OA 1NKEA 3MAQA 4GW6A 1RT4A 3NF9A 2RPIA 3KK1A 4CEBA 1WN7A 1S9GA 3RMDA 3VQCA 1WSHA 3K59A 2FBTA 1VSLA 1FKPA 3L2RA 2QXFA 4BWMA 2D0CA 2RJEA 4OVLA 1YVUA 1R0AA 1U45A 4IG0A 3Q1JA 3L2VA 1C0MA 1U47A 1VSJA 1GOBA 1B9FA 2P1JA 2R7YA 2E6LA 4CJ3A 3EZ5A 1SKRA 3HL8A 3QO9A 1ITGA 1NJWA 2M16A 2LVMA 3VQDA 4DU1A 3SQ4A 1ZBIA 3OMGA 3QNOA 3AA3A 4UQGA 1WSFA 4CEDA 4B9SA 4LD6A 1TGOA 4C5GA 3V1QA 3LAMA 1BHLA 2NUBA 1UOCA 1I39A 4ELUA 3O4QA 3LZJA 1JLQA 4KFBA 1IKWA 1LAVA 2EQKA 3NGZA 3OYIA 4QQGA 2VYTA 2RHXA 1RBUA 4QQ6A 4JRQA 2F8TA 4Z4CA 1Q8IA 4C8KA 4ZTJA 4RW6A 4E0DA 4DFPA 1NK0A 2B8AA 1WNSA 1N27A 3NH1A 5SZTA 1UWBA 3RR7A 2RI2A 4YNQA 2XY6A 4CGIA 5KCHA 3O3HA 2JGUA 1N5YA 2GBZA 2HNDA 1LWCA 2RF2A 1OI1A 4DSJA 2G8FA 1J5OA 4CHYA 3OYKA 3V9SA 2X35A 3NDKA 4EZ9A 5CIUA 2LTOA 4OGCA 3KLFA 3HPOA 3NF6A 2Q3SA 2X78A 4FJ9A 3OYDA 1WJQA 4RW4A 3E9FA 2Y1IA 1WGSA 3D45A 1X9MA 2VWKA 2Z1JA 3NFAA 1NJZA 3M8QA 3AVIA 5J2QA 4C8MA 1BGXT 5HRPA 1A5WA 2RO0A 3DLEA 4M45A 1HYVA 4BDPA 4CIFA 1T8EA 4FJ8A 3MEUA 4PL6A 3DYAA 1HJRA 1S1UA 1G5VA 3WNEA 3QJ6A 3SNNA 3VQ7A 2DIGA 1KLMA 2LDMA 4RG8A 4ZHRA 3E01A 5KRTA 2RI5A 4R5PA 2YV0X 5C25A 1ZBLA 3VQQA 3NH2A 3LALA 2IC3A 3NNQA 4Y1CA 3TAQA 2I5JA 3HJFA 3LGFA 2P5GA 1U04A 3FFIA 4DS4A 3C6TA 3RMCA 1RTDA 1KCFA 1T7PA 1BI4A 2OA8A 2LSNA 1OZ3A 1RTIA 4J2EA 3SYZA 4LSLA 3OYFA 4HCZA 4BE1A 3ULDA 4HHTA 2HHQA 4C8OA 4AHCA 3L2UA 3AVCA 4A4EA 4DTPA 4OKKA 3PO5A 1TL3A 4CGHA 2R5AA 2X6NA 2LCCA 1U49A 2X6SA 2HNZA 2DFFA 4CHNA 4RW7A 4FJKA 4M3XA 2G8UA 3MEAA 2BKDN 3AVKA 5KI6A 4I2QA 3SJJA 2QKBA 1HMVA 2E6NA 3SUQA 1FXXA 1LV5A 4ZTFA 4QAGA 1XNIA 5C42A 3CQ8A 3VA3A 1RI0A 5KRSA 3DM2A 4CJEA 1ASUA 4CEFA 2WACA 4KAZA 2HHVA 3O3GA 3U6FA 3V9UA 1SL1A 2KW4A 1S1TA 4FK2A 1B92A 3UIQA 1RTJA 3JYTA 1KLNA 1RT7A 1HYSA 4GY5A 2YRVA 3PNWC 3AA4A 3O3FA 2HNYA 3DLHA 3QNNA 4FW2A 4KTWA 1C1BA 4FLZA 3MO8A 4W5NA 2QQSA 4PLIA 1RNHA 4FM1A 1RDCA 4FK4A 4B9LA 4M3RA 3V6DA 4CGDA 2FC0A 2AJQA 2OYQA 3DRPA 4H4MA 3KLIA 4L59A 3QEXA 2P5OA 4BACA 3I8DA 1L3SA 2RHYA 4CHZA 4E7LA 3C4SA 5IN1A 1Q9YA 2IDOA 2M0OA 4BE2A 3IG1A 3ALYA 4X34A 5KE2A 3MXJA 5SWMA 1S5JA 3MXIA 4E3SA 1LWFA 2XY8A 3LX7A 1CZBA 2K3YA 2QK9A 5D6WA 1X9WA 2OZSA 2RN2A 4DTMA 4DU3A 3ZT0A 2E4LA 3ZT2A 4O4GA 4FL6A 1XHZA 2VG6A 4Z4EA 2PY5A 1RDBA 4K8XA 4Q5WA 4CJTA 4M3UA 3ZSYA 4I2PA 4FJIA 3IAYA 4IUPA 4HCBA 1QE1A 3M8RA 3MEGA 1UAXA 3C95A 3ME9A 2G8IA 3ASKA 4M3ZA 1OYXA 3VN5A 4OLAA 3H8ZA 4CCHA 1RBRA 4ELTA 4KI6A 3UT1A 2VG5A 2GFAA 3G0ZA 4KO0A 3SPYA 3RMBA 3K5OA 2FBXA 2BANA 4IDKA 1UA1A 4B9MA 4OKEA 2XRIA 3L2WA 4FM2A 2B4JA 4FXDA 1QS4A 3M9QA 3MP1A 4QW2A 1JXBA 1L3UA 5FRMA 4DLGA 4N56A 5J2MA 4DTUA 4DMNA 2OPQA 1J9AA 1D5AA 3CM5A 2YHBA 4DSIA 3THVA 3KD1E 4M3WA 4FW1A 1D8YA 4CF1A 3V9XA 4C5HA 1QSLA 1H3ZA 2RHZA 3OYMA 2YHAA 4CE9A 4CGJA 3KIOA 3RRGA 4E7IA 2HHUA 5I42A 3DLMA 4OLBA 3OQ5A 3CFOA 3KK2A 3HP6A 4IUUA 3VQ4A 3QIOA 4DQRA 3VQAA 1TAUA 3SI6A 3IRXA 3O4NA 3LLRA 2EX3A 3VQBA 1CLQA 4JS4A 1VSFA 1IKXA 2B6AA 4B9UA 1YTUA 3E9GA 4KHSA 3VQPA 4QOZB 2O4IA 4CFCA 2HVIA 2IOCA 1G15A 3WNHA 4NYFA 2KFZA 4CFDA 4DQPA 3F73A 1F21A 4IFYA 4CGFA 4A4FA 1BIZA 4AHTA 3AVLA 4KB0A 3TAMA 4LY7A 3PX6A 2R5MA 3OYEA 2D5RA 2X74A 4JRPA 4HCCA 4LD0A 3OVNA 3RRHA 4FZXC 1NJYA 3S6WA 3OS1A 4CESA 3TAPA 4E89A 3V1OA 1ZBUA 5CZ2A 1VRTA 4CJLA 3K58A 2E5QA 2Z1GA 3ZT3A 4IKFA 1QQCA 2HHSA 5J26A 3DLRA 3VA0A 1XWLA 3KKSA 2DIQA 4G1QA 3OYNA 1X9SA 4DTRA 5D3GA 1JL1A 3K5LA 1SL0A 4FLVA 3ZSOA 2QQRA 2KQ2A 4F2SA 1HQEA 4CJUA 2HHXA 2O4GA 4KRFA 1WSEA 1A5VA 1C0TA 5CZ1A 2D9TA 1NK8A 4FVMA 1K6YA 4RG2A 3HT3A 3DB3A 2FBVA 4N4IA 2IG0A 1L3TA 1VK0A 4CJ4A 1OZ2A 4CJRA 3QEIA 3QIPA 4OVAA 3ZSQA 1L3VA 3SD4A 2XK0A 5CYMA 4OPKA 3IS9A 2DAQA 2MWPA 4NCAA 1RCHA 5HRRA 3TI0A 4PY5A 4OJRA 1WSJA 4DQSA 2YNHA 3KUFA 4LSNA 4E7HA 3AVHA 4DTOA 3CFPA 3ITHA 3A2FA 1RDAA 2RJCA 3OYCA 4W5QA 4FJLA 4FK0A 1RT3A 3LANA 3RTVA 2D0AA 4JLHA 1NKBA 2G8VA 3P8HA 3AVAA 3SV4A 3K5MA 3P83D 4CJVA 4NCGA 2HW3A 1BQMA 4CRIA 2GF7A 4DFJA 1RTHA 2QKKA 5K14A 2OPSA 4DSEA 3L8BA 3QINA 4Q5VA 2EQUA 3MECA 1A5XA 4N5SA 4PWDA 4CEEA 1JL2A 2XY5A 4NCBA 2GV9A 2JTFA 4Q0BA 2EKOA 1VSIA 4N41A 3BDPA 2KZZA 4Z4IA 4KKOA
chains in the Genus database with same CATH superfamily
4PLLA 1H9TA 2LD5A 2VG7A 1HNZK 5CK9A 1TKDA 3M8FA 1ZQ3P 4PQUA 4DS5A 3HFNA 3I55Q 4ZYAA 4MO5A 2FF4A 2HDCA 3KWGA 1FK9A 4CERA 5HS9A 1I4K1 4ICLA 2RC4A 1RBVA 2LRQA 4W5RA 1SD4A 2EKHA 3UF4A 3CJCA 4FJ7A 4G8XA 3OMYA 2E8AA 1XMOK 4CEOA 4KA4A 2A6TA 2FX0A 4OU0A 4PUOA 4A5NA 1E4FT 1I3QJ 1O4XA 5C0MA 2GWJA 1WB9A 1M9SA 4F3TA 1RKTA 4F4KA 2HB5A 4DYCA 2KDSA 1IG9A 1GXIE 3LDLA 4J9FA 4U67L 2DD4A 2XG8D 3EAEA 1IDZA 3VF4A 3U1DA 3I64A 3OYHA 4B44A 2B86A 5J6XA 1X6OA 3S41A 1YE9A 4JI0K 3O1BA 2R7QA 3WTZA 2QTDA 1VQKI 1Z91A 2HWVA 3RERA 1BUPA 1YJNT 3SWNA 1K4TA 3F22A 3JS6A 2OTJA 4XKCA 4E1MA 2W7NA 5EG0B 5FDLA 4AHSA 3I53A 1C1CA 4J9CA 4M7YA 2WAFA 3E97A 1VNDA 2O9SA 3EGXA 4JOMA 5HKCA 2DDBA 3ULQB 4A57A 2A69F 2HOAA 3WEEB 2QTVA 3T1AA 5D6YA 4RS8A 4M78E 3ZMTA 1IGQA 3SFZA 2HBJA 1D5VA 4OB1B 3LWMA 4PJOB 4XLAA 1JT6A 3BJAA 4DV6K 3KYDB 1Z25A 3PIOF 2P5KA 1R77A 4RTXA 1P7JA 2QENA 2CUJA 3JRDA 4L5JA 3LAJA 3U23A 4ESRA 3SUOA 2J6OA 1NGGA 4LB6B 3CMEI 4NLBA 2ASPA 4KN4X 1RDWX 2X51A 4HVVA 3RPUA 3QKJA 2NS7A 3SZTA 1NK3P 2YLBA 4BDYA 5B5EC 4LDVA 4AU7A 3F9KA 5DM6F 3H46O 3QPTA 2A6AA 3VDXA 4CJWA 2KZMA 2CP3A 2QWPA 3CMAI 3HBTA 3VS7A 2EFPA 5GPCA 1E4GT 3UKRA 4B9WA 1KTQA 1K8AC 5EX5A 3TARA 2ZGYA 4OMFB 4PKCC 2JUFA 4J9BA 1KAZA 4XMYA 3QBXA 1KC8R 4HCKA 3DBHB 3SMPA 4AM7A 3CC2I 4EMKB 2QSFX 2IA1A 2CH4W 3CXCA 4PL8A 4Z4HA 1STZA 3LPTA 1ZRCA 3I9V2 3E6MA 4HUGA 2KEAA 3I55I 3F8NA 1YIOA 3CD6A 3HSEA 2KL4A 1EH8A 3DXJF 1LWWA 2DF6A 3ZQLA 1IKVA 1UEBA 2KLOA 2XSDC 2CH0A 3KLHA 2VOPA 1N75A 5AZJB 3AO4A 4HNTA 4CF8A 1N33K 2BHZA 3OMCA 4NS5A 2P7CB 1TL8A 2IGMA 3QSUA 3V42A 4ZYEA 4M77C 3GOXA 1JTXA 4ESFA 3HHTB 5F0HA 3I0SA 1SANA 4CCMA 2OCCH 2BE7D 2RJFA 2WBMA 2CP0A 1J6ZA 4FJHA 4B8AB 1U5TC 4GFBA 3V4GA 2L3PA 2RI3A 4NZGA 4M7AC 1T6CA 1VQ4T 4LFBK 1UECA 3KP4A 2HPMA 2JHNA 3ZQCA 4YIRX 4AUXA 1Q81U 1Q7YU 3MN9A 2EYWA 3W2AA 4PJ0C 1AWOA 2X6WA 3CM6A 5IP6A 3P9CA 3E6DA 1MUYA 3NE6A 2EZIA 5FD6A 3EGXB 5IT9O 2ENMA 4CJ7A 2KP6A 2OPRA 2DXCA 3P9IA 3FSPA 3AO5A 4Z0UA 1KC8O 1W7PD 2M34A 1HBXG 3L2CA 4FPAA 4I98B 5GADP 4JP0A 3RQIA 4A0YA 4NC7A 4RM3A 5CO7A 2A68F 4AH9A 3NPFA 3DI6A 2XDVA 4ENNA 1OQKA 5DDGA 2JW4A 3N4QA 3F8CA 1VQMN 5E20A 2WV1A 5D6XA 2COYA 1TL1A 3E0JB 1T44A 2NRWA 5HLGA 4AIJA 1Z7LA 1GV5A 1NKCA 2HHTA 2MABA 4CUGA 3D1NI 5DYMA 2L5QA 5L3EA 5D6FA 4C8NA 4MZPA 4ENJA 2QYZA 4Z2YA 4B22A 3EG3A 1MZBA 3H9QA 5JVGL 3D5SC 3HRSA 4ZN1A 1X2MA 3NARA 2D0NA 2JWKA 3OS0A 3EQLF 2JQ7A 1T8IA 5FJ8J 2DTZA 1DGWY 4DV4K 3QWLA 4UB8C 2W6LA 5M1PA 1M8VA 3CJQB 5ICGA 2DXTA 5C24A 1FYKA 1T05A 3J7AO 1UJ0A 3VQEA 1AWWA 2IVPA 3CCUN 1VRUA 4RAYA 1R4MB 2DM1A 1XQSC 4B09A 1RT5A 4EFHA 3SLCA 5LHGA 5LJ5e 1Y96A 1SQKA 4C0GA 1KVCA 4ETSA 1T56A 3W3CA 4CC3A 1VYTA 1JJ2S 1VQMQ 1EV7A 1BL3A 1QZEA 2QUFA 4W5TA 1VI0A 1D3BA 1NHAA 3PO4A 1C6VA 4KH4A 1KQSA 4ESBA 4KIBA 2DXIA 2D0BA 5K5QA 2X4XA 3HTVA 2P6SA 3MEEA 1YI2T 2F2WA 2IVOA 3QHSA 3B6AA 3QEVA 3LSRA 3C2BA 3IWFA 3VV0A 2H8WA 3CCLT 3VQ9A 4C92F 4BG9A 2DY4A 5TKWA 3FDYA 2XY7A 4IUVA 2CV0A 2QBYA 2P9IB 3TAFA 1O3QA 1ASWA 1WZ2A 4FLWA 4U88A 4LH5A 4II3A 2Q8KA 2V1UA 5EDNA 3O1WA 1PVSA 2CDTA 2ITGA 3TO9A 2O0YA 2IA0A 3ZMSA 2R5ZA 5A2QE 3FC3A 4GDFA 4WXHA 3CCUQ 1QVFM 1GDTA 2EIFA 2L89A 2HOTA 1W2BA 3IAM2 2Y9ZA 1WLPB 3OA6A 4EP4A 4KNYA 1ZHFA 1HX1A 2BBYA 3UNGC 1GFCA 1TVRA 4BQZA 1H3HA 5EZGA 4X64K 4FE4A 1VSEA 3F21A 5AQLA 3AVFA 5F08A 1X2KA 2MPXC 3MXMA 4OPJA 3K4NA 2W40A 4LDWA 4IO9F 2K9LA 2LX7A 3N4MA 4CIEA 3HP9A 1VQ8N 5AZIA 3N4PA 4LIUA 5HP1A 2RQPA 1WJBA 1RESA 1VSMA 5C4JJ 3P8BB 2BZTA 1IRGA 3NGYA 4Z4GA 1U6ZA 3M1CA 3VUZA 5JHFA 4FZZA 1UG0A 4Z02A 5C15A 2VE8A 3FXUA 2CW0F 4O0JA 2X6XA 3IHUA 1KQJA 3FXRA 3ZQFA 3IDHA 1A36A 2OJED 2QK0A 2EA2A 4C8QA 5DM7F 1FTZA 2K5FA 4O8UA 5HROA 5LJ3e 4FLTA 3ZCMA 1TAQA 4FX4A 1BIUA 1KVAA 1J53A 2RM4A 2DQLA 4KH1B 3PY8A 5LMNK 5J2PA 1GUUA 1UHCA 3D4VA 3ZETA 4G9ZA 1B9MA 2KNBB 4ON0A 1WX6A 2KKOA 1BKBA 2VC8A 2QGGA 3DWLA 3UA6A 1RBTA 5FRNA 3EHRA 1SRMA 3CPEA 4XL9A 3B02A 4PJOD 3NVKA 4DQIA 2AK5A 4C8LA 1NK9A 4AIKA 3PUFA 2CREA 2L3SA 4HNUA 3CO6C 4O8KA 2XC7A 2DX1A 1ABQA 3FKJA 3OYLA 4QVZA 1IBMK 4BR9A 2E1YA 3U3GA 4AIHA 2HVHA 4P9UA 3SDZA 2ED1A 3LP0A 1VQ8Q 4FSVA 5J2NA 1K6OA 4IG3A 1U5SA 1XDSA 2KT1A 3KP2A 2BGGA 2P9PB 5M3MJ 2EFOA 5KTQA 4PSXA 3ZSWA 1XD7A 2HR3A 4JI4K 3FXLA 1M90O 1RT2A 2Z1HA 1T3VA 3ZSZA 3BGRA 4JRKA 1FYNA 4CF2A 3SAFA 2KXCA 3NTHA 1EETA 1PU8A 2FBYA 1GLCG 1VQMI 4L9VA 4HF2A 4ISEA 3JRBA 5EY4A 3I0RA 3CUOA 1C0UA 4GVMA 3I5UA 5D4SA 3CMEA 4OPHA 3RSEA 3AG1H 3GE1A 3CCYA 2Z1IA 5GAN5 2E7WA 5EC7A 4AHUA 2VJ5A 2NRHA 3AVMA 4NC6A 1ON2A 1I6HJ 5E84A 2QEXN 2Z0WA 2XDBA 4PKHA 3AG4H 2UUZA 3CMAA 4HV6A 4F2RA 2VPRA 4DNCA 3VQ6A 5I2MA 1HD3A 3ISNC 1J0RA 4UOBA 2A42A 4WFAL 2Y1JA 3G1JA 4EMSA 2CG4A 2J5OA 1EXQA 2RV8A 4KUMA 3A2KA 3WG9A 3HI0A 1TYQA 2EV6A 4A2AA 1DQUA 4HEA2 5ICCA 1ZSGA 2AZSA 2JSPA 3CC2A 5B8HA 3RSNA 5AZIB 3DLGA 1IB8A 3TP3A 4DOZA 3TEEA 3X26B 4CFBA 3N05A 3I55A 3CF5L 1HKSA 1OCCH 1S1WA 1ZH5A 3CDIA 4M78F 5BRFA 5ERIA 3L2QA 3RKWA 2GEMA 1Z9CA 4RB3C 3NFCA 1WSUA 1IW7F 3CC7A 4GO1A 3NF7A 1K78B 1RAGB 3WQTA 2ID6A 3BJOA 5KPRA 2XRLA 1SKSA 1TNSA 1W36D 2QEXQ 1EZZB 3BC8A 4HKEA 5BRHA 2L7FP 2FXUA 4GYGA 1WUAA 1KD1C 4CI6A 4BRCA 2L01A 2JHJA 3T3FA 2RGVA 3NWSA 5IOYA 4HWIA 3THKA 2E6MA 3O9RA 4YIFA 3RNJA 4R79A 1IKYA 3CDLA 3FJPA 2CUZA 1ZRFA 5HLFA 3DRSA 1Z7UA 4ZC3A 4ILGB 3T1YK 4JI7K 4I7FA 3MMVA 2LDUA 5KGXA 5J8CA 5KH6A 1G4DA 5I9EB 1FYMA 1REPC 2OTLI 1Z05A 2UYTA 2HGCA 4M75A 1E3OC 2DZ9A 3LP2A 1XQOA 1G3WA 1Y97A 1BYMA 3RPUD 3JRCA 1P6RA 2QYOA 2FZKB 2XHCA 3RR8A 4N47A 3J80Z 3ABMH 1QZYA 4PFZA 1VQ8I 3SV3A 4FE7A 2M3AA 2CZ0B 4F16A 3WHBA 5FKNA 3VMFB 3A0BC 5FU7B 3RSEB 2HEQA 5KQDA 3CEYA 3L42A 3CVSA 3DV8A 2A1RA 1N34K 1XS9A 4IUQA 3NHNA 2LY9A 1S5LC 4DV5K 2O8FB 4LNPA 2O4XB 4D5FA 5TISC 3TTCA 1Y0NA 3AV9A 1B8IB 3KEYA 1PWTA 1R23A 4IOAL 2NOGA 3R6NA 3DKXA 2QA4I 3CFRA 4WE1A 3FK6A 4B9XA 4BL0B 1OLTA 2EYZA 4PFPA 4GV3A 5HLTA 1BW5A 5GMKl 5CYVA 4JK1X 4X62K 2Q2EB 2BHYA 5CQEA 1YWPA 1TYQB 1QNTA 4KJZA 4NBQA 3GPLA 2E5ZA 5TJJA 2DFIA 2K3XA 5HCKA 1R59O 4BU2A 2VBYA 3TDUC 3QEPA 5J39A 4HUFA 1X3NA 1XC9A 1K8AR 3LDOA 1PD0A 5JS1A 1VOMA 4B48A 5AQQA 2HBMA 1RT4A 2DL3A 2RPIA 2ASMA 2WAQN 2NOEA 5BMZA 2J06A 1VQPT 2P9LA 3JCMe 3DLAA 4YDUC 2MH9A 2RK2A 3P39A 3BPXA 3MKDA 3K4LA 5FLXZ 4AVPA 1S3JA 1KC8U 2FQ3A 1YVUA 2LC2A 1R0AA 4E1JA 4XTWA 4A3KJ 1GLFO 4IG0A 3KETA 4F14A 3EUAA 1M3CA 1KG5A 1VSJA 2IVNA 1AKHB 3SXYA 5GJWB 1H88C 3EZ5A 1YJ9N 5E8IA 1K9MU 3JAMK 4EHTA 2PMUA 3JSCA 1N3AA 3VQDA 1D1BA 2CW8A 2DPNA 1ZBIA 1Q95G 3OMGA 2RQQA 3KYLA 3VODA 1OR7A 1WSFA 3M0UA 1RC9A 4KT0E 1RADB 5HNFA 1I07A 1UOCA 3RBBB 3FMQA 1Q82O 1JLQA 3RMQA 2P7VB 2VWFA 1XQHA 1LUJB 3K4BA 3A01B 5C2FA 2WY7Q 4J19A 3OYIA 3SEZA 5CE3A 4I7HA 3RYPA 5CVRA 1WNSA 1BIAA 3NH1A 5AQSA 3MCPA 5JVGF 1Z6RA 4YNQA 1QVFS 1KO9A 2ZXHA 5KCHA 1W2BP 3O3HA 1QLYA 1IXSB 2SRCA 2P0WA 2ESWA 1D09B 1YJ9Q 3HXLA 4PFOA 4EJZA 1MBFA 4C0FA 2HYFA 4IVNA 3FXOA 2A37A 4BY1J 4ZYGA 1J5OA 2FBIA 2A0FB 2EJRA 2YUPA 4L9JA 3PO3J 4JZ3A 3LSMA 3T8RA 2LG4A 4XU2A 1YCYA 4A3LJ 4OGCA 5K7ZA 3KLFA 1GV2A 3HPOA 1OH8A 3NF6A 3F8MA 2FUG2 2K02A 2E2QA 2Q3SA 3ZXSA 1WJQA 3E9FA 1KHIA 3C7JA 2MAMA 3NFAA 1PP8F 1T6DA 3B6CA 4M6XA 3H5RA 5DV5A 1BU1A 1WWXA 1A5WA 2RO0A 3WT0A 2IA2A 2MD0A 2PU9B 4BDPA 2CV1A 4BRKA 3OBWA 3SQNA 2DL5A 4PL6A 1O7FA 1HJRA 2OZUA 4WX9A 3L00A 1VQMA 3M4GA 2MD5A 3SNNA 1WVRA 3NVMA 5FLVA 1T33A 1U6GA 3E01A 5B3SH 3AY9A 4M7DG 2C0IA 2UWMA 2C0TA 1VQ9T 3QMLA 4JKHA 1Y39A 8AT1B 2E71A 2HXOA 4IJAA 4M9ZA 1K61A 1SFKA 3VQQA 1USTA 1ATSA 3NNQA 3VS4A 3TAQA 4EM0B 1WQ2A 5LHHA 1DU6A 4LK1F 1TUCA 2Q2RA 4A12A 3SB2A 2P5GA 1U04A 3FFIA 4GCVA 4PGGA 3CCMT 3RMCA 5LD2C 4AFZC 3I0WA 2V8IA 2Z99A 1T7PA 4DBHA 4DEYA 1LOTB 1IN4A 5CHIA 1EFNA 2ZSIB 1VAZA 3Q7CA 2Y0MA 2E1MC 1WEIA 2ME0A 3SYZA 3MD2A 4P5OA 3OYFA 1POGA 3IUOA 2VQFK 2K5IA 3BDDA 1AT1B 3CCUA 1Y8RB 2CV2A 3ULDA 3MX5A 4CZIA 4FWKA 2EPDA 3BT9A 1TXQA 4C9YA 3OHRA 1T95A 1OCOH 4JDSA 2WSFE 2M8GX 3QICA 4CHNA 3HC7A 4FJKA 5A0LA 2LVSA 4A3FJ 3MEAA 3GTKJ 4IWVA 3AVKA 4M71A 4Y3OA 4FYVB 3ISPA 1SAXA 2NRAC 2IVWA 2MIOA 3SUQA 1MWMA 3SAHA 3U9ZA 4OIRF 4QAGA 4NQWA 3IWZA 5GAN2 3H1QA 3KBGA 5LJ5j 4B1VA 1MNMC 2WACA 3LWIA 2GXGA 2P9KA 2M9HA 1SL1A 4L5EA 4FK2A 1DP7P 4BC3A 3JYTA 4ELZC 4EIAA 3HKZN 1MV0B 3ERED 3H5NA 4PJOE 4GY5A 1LFBA 2OTJT 2FF3B 2EV5A 2HMPA 3SK3A 1QWFA 1X2QA 2Q1ZB 3MO8A 1OH6A 4MDBA 1AOYA 4B9LA 4M3RA 3AAFA 1NBWA 2BY3A 3V6DA 3DPUA 3TEDA 1SPKA 2ZJQL 3SBTA 3DRPA 3KLIA 3W0LA 4ZZDA 3I0XA 2ATCB 2RHYA 3CJBA 2IPOB 3C4SA 5IN1A 5L8RE 1Q9YA 2IDOA 3GO5A 3FMRA 3BFMA 2L9VA 4BE2A 4DUYK 5ILVA 3DXMB 1KA8A 4X34A 1E3HA 1Q86C 3EE8A 3PVQA 5SWMA 2R7XA 2DMTA 2EH3A 4E3SA 2YWWA 2MF2A 3QPLA 4ILJA 1LWFA 2F6CA 2VCPA 4IEIA 3PO2J 4DTMA 3H3OB 4DU3A 3ZT2A 2KRHA 5LRSA 3FZHA 1XHZA 1PD1A 4Z4EA 5HNHA 4K8XA 4W97A 2DODA 1M30A 4Q5WA 1NWKA 4CJTA 4M3UA 1XTAA 3VTHA 3ZSYA 2JA6J 4JN4A 2JOYA 4HNVA 3OTOK 1V55H 3FHNA 1QE1A 4BRNA 1ZG3A 3ME9A 4BEHA 4BBSJ 1M3HA 3VN5A 1RFQA 4OLAA 2IGNA 1X3MA 4ELTA 1R5ID 4ZYDA 3GIBA 2K27A 5LJ3j 3D6RA 4KO0A 2O8BA 3CF5F 1KU9A 1YTYA 4IDKA 2PBIA 1WBBA 1LDJA 4B6MA 3OH6A 4F7UB 2GIVA 2XRIA 4YFKF 1HDPA 4FM2A 2KK4A 4FXDA 2V7FA 3BUZB 4TVRA 3M0RA 3VYTB 2L4MA 5F1JA 5DCMB 3M9QA 1ZYRF 3MP1A 1MDMA 4QW2A 4RCHA 5FRMA 3CD6T 2NOZA 1GXPA 4C3HJ 3VRZA 4JKAA 2DKGA 4ESJA 1B34B 3BTJA 3F72A 3KLNA 1TS9A 3OIOA 4FYYB 1UB9A 2ZZDA 5F0FA 1H3ZA 3OYMA 2C6YA 4M75D 3K9TA 3KIOA 1YITN 1P8ZA 2QEXA 1FT9A 1Z77A 3GDQA 5EGOB 1G3TA 5I42A 2E65A 4JI5K 4OLBA 1KD1R 3HIFA 2A3LA 2XIDA 2D2WA 1NJIO 2Y9YA 2ABLA 3M58A 3M8JA 4IUUA 1M1EB 3UDCA 4DQRA 3N5BB 3VQAA 3LSGA 2F48A 1Y56A 3SI6A 3O4NA 3LLRA 3CQTA 5KHDA 4MTDA 3H3VK 2VUMJ 3A98A 3PJRA 1NG2A 3R6OA 4JS4A 4EMKC 3A0IX 1IKXA 2B6AA 1UFFA 2ITMA 2RAEA 5GAN4 1OV3A 3VQPA 4LLGF 3SAGA 1RIOH 4B23A 4YFXF 4JI6K 1PSEA 4X6AJ 3IL2A 3G71T 4NYFA 2E36A 1P59A 1RACB 1IHWA 5M1KA 1ETVA 2HVRA 1F21A 4P96A 3GFJA 3PNYA 4A59A 2QGFB 4KB0A 3IAS2 4JKGA 2X3XD 3LWHA 3BTIA 5EJCA 2R5YA 3BG6A 2BE9B 2KZVA 1N9RA 1VTNC 3RRHA 4FZXC 3GBGA 1LNWA 1NJYA 1XSDA 4CESA 1YITQ 5KYXA 1OKJA 3MKZA 4E89A 4JD2A 1JJ8C 5LJ5h 3K10A 5ILSA 1X27A 2Z9OA 3PQKA 6AT1B 5I11A 1N77A 2PVGB 5A2QZ 2FPDA 4KHPK 2BW3B 4IKFA 1KD1O 2HHSA 1NNEA 3DLRA 1W36C 1D1CA 4BEHB 4E9HA 2ELHA 2E5KA 3GFLA 3KKSA 4G1QA 2YLCA 1XGOA 4X9DA 3WVEB 3K5LA 2DJQA 2DRMA 1C6VX 1F4KA 3CXCM 2QQRA 2BVLA 1AVZC 1S9HA 1JXOA 4EATA 4F93B 1NBEB 3I5RA 3FBNB 1RI9A 1HQEA 1UJ8A 4CJUA 2OBPA 2FMYA 3J7AP 2GCXA 1WSEA 3IFRA 2KMTA 1KQ9A 1XGNA 1R6RA 5CZ1A 2HMAA 1SAZA 5JMVA 1VQOT 2FBVA 4BRGA 1RUNA 4RB2C 4N4IA 3J81K 2IG0A 1L3TA 1VK0A 1K8AU 4CJ4A 3X20B 3QEIA 4OVAA 2DL4A 3ZSQA 1NG7A 2XK0A 1WPKA 1KK7A 2PAVA 2DYRH 2KE9A 4CZKA 1HJOA 1EF4A 1M3QA 1RCHA 3R3LA 4MZMA 1H89C 5AFUA 4DQSA 2YNHA 4IHXA 3F5TA 2UZKA 2YHWA 4PZJA 2E34A 2OU2A 4LF9K 1VQ7N 3CBPA 2JM8A 1JKPC 1Y6IA 4FJLA 1O3RA 2VXEA 4JQFA 4A3EJ 1OYWA 2ECZA 1E7OA 1IZ1A 1RABB 4JLHA 3L1AA 1P90A 5GJVB 3VSKA 1U84A 3AVAA 4H0YB 3SV4A 2WB1N 2JVHA 5GANe 5GIPA 1RR8C 5LJ3h 5F27A 1FP2A 2F5VA 1HSQA 4QKUA 3Q9VA 4M74A 4CRIA 2AO9A 5BOXA 2D1VA 3F23A 5K14A 3F6VA 2J6FA 2WAQA 3GTQJ 2GZWA 2YI1A 3QINA 4M77A 3IHOA 3VEOA 5KYUB 1HA8A 3R6SA 1A5XA 2JMWA 1U5TA 4F91B 4IIOA 5BPLA 3I8BA 4N5SA 4M7AA 3EFOA 1YUWA 2LMJA 1H641 4Q0BA 3KYCB 3E2UA 5LJ5f 2JSCA 1S72N 4BR5A 4Z4IA 4KKOA 4DBRA 1GLLO 1VQ7Q 1OEBA 3GFMA 4ZN3A 1HPZA 5ED4A 2ZM6K 1YJ9A 2A5YB 2FBKA 3BR5A 3U1KA 1YITI 4DF4A 4BRHA 1M5Q1 3CUQB 1VF9A 3OBYA 1TUYA 3VF6A 4XTUA 3SMSA 1VQKT 1CF7A 5FPNA 1FOYA 2ZJ2A 4B3MK 2XGDA 1LQ1A 3QYBA 2CGHA 4CZJA 2E5LK 3CI5A 2NVQJ 2O8CA 3J81Z 2CKKA 3QDRB 4J00A 1KQSM 4HQEA 1IH7A 2L2OA 1I3AA 1U8BA 4LN2A 4XSZF 3DLKA 3J80O 3LFKA 3I4NJ 4AMCA 1J09A 1IXRC 3I59B 2XGCA 3GCMA 4NB4A 1YJNA 4ITVA 3T9NA 4RTFD 4C2UA 2DOFA 2PUOB 1BO5O 2XF7A 4B9QA 1RAIB 3S16J 3PFYA 4LC9B 1S72Q 2YS9A 4IDHA 1G3SA 4XLCA 2YHTA 1FYLA 3CMET 2W85A 3CLOA 5J1EA 3CCSN 4DF8A 2R7OA 2I7PA 4NLCA 3HSTB 1T3LA 1BCOA 4A53A 3WG7H 1UGQB 3TREA 1MWKA 2COZA 3P31A 2M9UA 1SMYF 1WEFA 2D1KA 1W2BM 3LWFA 4JNEA 2M45A 1BR2A 1IUYA 4E9GA 3O8VA 3MWPA 4BWJA 1ZBJA 2AS5F 4YOWA 4BRIA 4JV5K 4CEAA 1ZYQA 3CMAT 4FJJA 5FKOA 2COMA 1I8FA 3S14J 2LQ8A 1X3WB 5K7HA 1OPLA 2JA8J 4KPYA 4C92G 3PSIA 1PKTA 2QWRA 2IGOA 2QQBA 4BJ6C 2TDXA 2HQNA 4KBMB 4WFNL 2EQJA 3MK6A 3BR0A 4CIGA 3RWUA 1NK7A 1NZ9A 2GA1A 3OJUA 2HU9A 2E3IA 4EAHD 4C2MJ 3WTYC 4C8QE 2RMOA 2L9RA 2FRHA 1Z1DA 5EYRA 3CC2T 5M1QA 3QB0A 2VQEK 1ARKA 4M77B 4CJQA 2L9SA 2O03A 3QZ9B 3F2KA 4DLEA 1TT5B 4B1XB 3N0UA 3CCJI 3I55T 4CO8A 1AWXA 5KYWA 1FIPA 3FEOA 1W5SA 3M0PA 3S3NA 3VFZA 5ADXA 4FLYA 3WXKA 2ZGWA 2J6KA 3EFOB 3DRRA 3ABLH 3M07A 2DILA 2J05A 2YKNA 2F1LA 3DWLE 4K11A 1NK6A 2DA3A 3CCQN 4OMZA 5M5WJ 2D6FA 5FLXO 1T03A 3CCSQ 2JZ2A 4KMUX 1ZK8A 4Y92A 4FLUA 2FA5A 2K9GA 1M3BA 3JR9A 3TSZA 1BI4B 4A2UA 2W4SA 1ACMB 3ZSVA 3SCXA 2DMNA 1EQYA 1WH5A 2ZPFB 3BY5A 1U1TA 1WRJA 4JJBA 3BE3A 2GTJA 4BH9A 4X9CA 2CT4A 1ACIA 3THXB 4S0HB 3FGUA 2ZQBA 5F2RA 4EP5A 2EILH 3C94A 1VQ7I 3K69A 2DFHA 2ZB9A 2P0QA 5DEQA 1ZREA 2M02A 3T1BA 3O9QA 4LFAK 5KE3A 1IRFA 2CW7A 1C1AA 4JX5A 3JW4A 3OL4A 2HQAA 3R0JA 2ZJQF 5C6SA 3HSCA 3G4SI 3M8SA 4LF4K 3FHFA 5IHIA 5IPAA 5AQOA 3GTGJ 2MMPA 3CPFA 1VQ4A 2HSEB 3PFSA 2MC3A 3KX2A 4DCHA 2L2PA 5D7UA 1O9SA 2HOSA 1DPRA 4CJKA 4I09A 1VQNN 4M7DB 1CQTA 3C7NA 1W7AA 1YHQI 3CCQQ 2IGKA 3RMAA 4FHTA 3S2HJ 3TMOA 4X1VA 1WSGA 3ML6A 5CKFA 2A1SA 3OW2A 4HTLA 1O7LA 3CCEI 1DUXC 2CP6A 2MCNA 4ID1A 3SZ2A 5AQMA 4JRIA 2WOMA 4PL7A 1M8MA 3RZOJ 4FJNA 1Q86R 1EIFA 3KFVA 1SKWA 7AT1B 3E3VA 4C5EA 5HLHA 1S72I 1ZRDA 1WGXA 1Z6TA 2GIZA 3JRHA 2A6EF 3VERA 4D6WA 3HG9A 3PT9A 4GGGA 1YO5C 3JCMh 1JQQA 1R0BG 3THYA 3VOEA 3TAGA 2Z2SB 1ULYA 2OX7A 4KN7X 3EYYA 3HKZA 4KTQA 2KHMA 1HJDA 2XICA 4UY8O 5M5YJ 2UXDK 3AVBA 2JPBA 1RT6A 4XKWA 1LPQA 1WHMA 3NCIA 2FG0A 1VQ6N 3UE5A 2R3SA 5CLSA 3BF3A 4QSHA 4MO7A 3VYGA 5KYWB 2OV7A 3NEUA 1VQNQ 3CQZJ 3ZMDA 1M1KC 4GKJK 3ID8A 5HY6A 1YQAA 3DTKA 4BJTA 1UA0A 2YU3A 4OMNA 5D6EA 4RTWA 1KG2A 3MVPA 4N4NB 5CPRB 4LFCK 4DOWA 1DKGD 4FYXB 4DBQA 1JE8A 2LBFA 1LW0A 2MOXA 3O8MA 3GZ5A 2HVQA 1SVMA 1B59A 3EEQA 3L3UA 3DB4A 1MJBA 3CXCS 4YELA 5FKLA 2KPMA 2K4YA 1K73R 4DR3K 1Q86O 1SZ2A 2HPIA 3JB9G 3CYMA 4KI4A 2HKNA 3CCSI 2ID3A 4M75E 3CG7A 4TV7A 2XO7A 3TW6A 2UXXA 1W0TA 1EWQA 5HOOA 3ZSXA 2HKXA 4Y91A 4YFUA 2HSTA 3GX4X 4DFMA 3SJHA 5M9OA 3HSFA 4M3FA 1V5FA 3EGUA 1V1CA 2F7TA 4J9GA 3LAKA 1JUMA 2W24A 1IO2A 3IRQA 2VKDA 1OPKA 4DFKA 3CJNA 1VQ6Q 2JVGA 2F5EA 1FMWA 4OFEA 1SVLA 1EX4A 1HNVA 4KHYA 4CH7A 5K5RA 2JTVA 1KD1U 5KCOA 3C7NB 2EFNA 3RKYA 4XOPA 3KKRA 5KAIC 5T7BA 2OI3A 5IH2A 2GELA 3QPSA 3QYEA 5L3BA 2EZLA 1V54H 2OJ2A 2B63J 2SEMA 1O57A 3DCFA 3L1PA 2HQRA 4HSTA 3NAUA 1RDDA 2NLXA 5GAGJ 4ENMA 1RZ4A 3TAEA 3CCQI 2HAXA 2X1DA 3SFMA 4MEYF 4CBWA 1YOVB 3ESWB 2UXNA 4H0XB 2R7TA 4EVIA 4IFEA 1NG6A 1TTYA 2CP5A 1S9EA 5E26A 4A4GA 4LG0A 1ZQ1A 2JS2A 2BTFA 3H9JA 4F04B 3X2QH 4FOIA 2IBDA 1P4AA 3SYTA 4B9VA 2PYJA 3JCMf 4M3EA 3G0QA 2P9NB 2IS3A 2OFIA 1DLOA 3HRTA 1LDDA 3MJXA 4X66K 1BB9A 1OOTA 2VJ4A 4KUDK 4EZ6A 1J7KA 1E17A 2Q36A 2F4MB 2ELJA 3WE3A 5BPMA 1RAAB 2AZVA 5A0DA 2GQQA 3CWTA 1T39A 1IDYA 4BRDA 1GT0C 2DTUA 4XU0A 5IT9E 1JTYA 2M5WA 2D5VA 1QWEA 2M1HA 3NGPA 1KVBA 4EDUA 4HYEA 1A35A 3QJYA 2B5JA 2YUSA 1REVA 2P0PA 2BZ8A 2VKEA 5BRDA 3HOUJ 2OPPA 1MMSA 5AYFA 2KIMA 1KG6A 1HW1A 2JT4A 1VQNI 2LJ3A 3NHGA 1MMAA 2BGCA 4M63C 1VQMT 2NUTB 3AGRA 3K1NA 3DQVC 4WCIA 4O44A 2JPCA 3HO1A 4BBRJ 2IS6A 1XPXA 1UELB 3DOKA 5L23A 3QBWA 4UNOA 2EA4A 2DN0A 1SFXA 1E2XA 5JFRA 3O80A 1ATNA 4JEPA 2O88A 1HNIA 1KQSS 1BU6O 3GTPJ 3THWA 2JLEA 1QBJA 3VEYA 5K7FA 2HDAA 4NHJA 4M77D 4FWNA 4KHWA 4XU1A 2RHUA 5LJWA 1NOYA 3HM5A 4IQ4A 4M41A 2HBWA 3SFIA 3A03A 4E7JA 1Y0MA 1XSXA 2L3RA 3D5LA 3PLAA 2GXAA 1E0EA 2WA0A 1NK2P 4M7AD 2RD1A 4IZZA 1YIJN 1QCOA 2EGAA 2WWYA 2DLPA 1H1VA 5E3OA 3O5BA 4YDUA 2AQEA 4PIIA 3CCUT 2MLGA 3ZL7C 1NM7A 2HQXA 1A6IA 1V3FA 4AVZA 1LW2A 1T08B 4IRHA 3NGIA 2GM4A 1XB4A 1VQ6I 2OD5A 4KICA 1FX7A 4H5NA 4B3OA 2DD5A 3H0FA 1ORNA 4NL2A 1W2BS 1NLOC 2LKPA 2Z1DA 3SQ0A 4M3YA 4CYCA 3PMIA 3JCMJ 4KUIA 1P7IA 1TKZA 2COBA 4DU4A 2F96A 1X1BA 3DTIA 1XI1A 3V4IA 4BQAA 3ZEUB 1T38A 3BQZA 5GMKm 2AHQA 3AVJA 4BY6B 1T0JA 2M7BA 1F43A 2EIMH 2V26A 2VBWA 5IP9J 1LJ9A 4AYBN 3AL0B 4WTOB 3AO3A 5E3LA 1VQ7A 3U3YA 4BVPA 5ELZA 2P8TA 2KT8A 1YIJQ 3BZCA 3LP1A 5GAN3 3IH7A 5GAN8 4Y13A 4XH5A 1NGFA 2DRKA 1N39A 1FBSA 2AP1A 2WB1A 4BRMA 4GYIA 5BPIA 4HRIA 4ILHA 5FPEA 3SZGA 4XRFA 4LF8K 1YJWN 1U2VA 4NB5A 3ZQHA 1N5ZA 4CK2A 3EL2A 4CJ5A 2HTJA 1WH7A 3CP2A 2IRFG 1VQ8T 4C8QF 1KHCA 1ZBFA 3G10A 4DR1K 2W1OA 1K4US 2DK5A 2FJ1A 2Y4XA 2ZAEA 1YS7A 3A5NC 3HVTA 3E66A 5AQHA 2J4RA 1VSHA 3W2VA 5L3DA 1BN5A 3WNFA 3PE0A 4FJ5A 2G6FX 1P2FA 4L8RB 4F3QA 4LB5A 5GANj 2CS3A 1OCRH 1K8KA 2DLLA 2XKPA 1FMKA 3M5AA 1S72A 3TBIA 1VSDA 1BI2A 4UUSB 2EIJH 4JKFA 4LG3A 1UMQA 3LDSA 3S93A 5EEAA 5A2QO 1KEAA 4FTHA 4J9DA 1S1XA 1YT3A 1WZOA 2X1EA 4N0AC 1MV3A 3CMMA 1XOVA 3K5NA 2Z33A 1TKTA 3QU3A 1X1PA 3RDVA 3S1NJ 1KSPA 5GAGP 1KU3A 1JHFA 4GKKK 3TCJA 1W7PA 1YJWQ 2BE2A 2CH5A 1YW9A 1LB2A 2K5LA 4RGSA 3OW2P 2FSKA 2ZMEB 3R0AA 3FWEA 4ZZLA 2HZDA 4I6MA 4P9FA 1OQYA 2DMOA 1QHGA 4C30A 3DOLA 4IJNA 4MO4A 4ELVA 3CP8A 2ZJRL 5DY9A 4B3XA 4CYCB 1WQWA 2HD0A 1IJJA 4KHUA 1RLQC 1JUSA 1W1WE 3CIPA 4V19K 4UNFA 2PNIA 5GAMe 1MA9B 2FF6A 3VOVA 1HQUA 3H3ZA 4ZJZA 1X2NA 2CGLA 2R92J 4BUPA 1BI3A 4J2BA 3EFRA 5EVZA 2Q0UA 1T0FC 3CJ7A 3DPLC 3KWIA 4DKWA 4M7DF 3V8KA 1SEUA 1U1SA 4RTUA 2CYZB 4F8RA 2H27A 1MBEA 1BG3A 3DF8A 5GPAA 1MBGA 2HYJA 2ZF5O 2L8DA 2QEXT 4KB1A 4BAYA 2V8KA 1QGPA 3IH2A 3QP5A 3MAQA 3A8HB 2XRNA 3NF9A 5KYYA 3OIQA 3VEXA 3EFSA 2BZXA 2DA6A 1Z3YA 3HGGA 4RTTA 2PTKA 3HUGA 3K59A 1VSLA 3I3LA 4KYWA 5LL6S 3WGGA 4B21A 2QAZA 5EG2A 2HKOA 2D0CA 1UFMA 4QVCA 1YIJI 3LAPA 4BI3A 2XROA 2JMAA 2JMCA 1HYOA 1C0MA 5GAMg 5BNGA 3EG0A 1VQ5N 2E2NA 1GOBA 2P1JA 1K4SA 1HNWK 2E6LA 3CERA 4CJ3A 1D0ZA 3HHGA 3F6OA 2K4BA 3QO9A 2GTOA 2NOHA 1NJWA 4EJUA 2LVMA 2RQVA 5KN8A 4DV3K 2V9PA 3QNOA 4ZGJB 1JO8A 2HOEA 2L3DA 3H0GJ 3M8EA 4CEDA 3B8AX 2K86A 4ORZA 2AXLA 3GXOA 1F5TA 1TGOA 3TQNA 3J7YJ 1X1AA 2GWKA 4RA2A 3LAMA 2IT0A 1WBDA 2NVUB 5DUIA 1I39A 4AIDA 4C92B 2P4RA 3O4QA 1R1UA 1YLFA 5CKHA 5EEGA 4PJNA 2O8EB 2R7DA 2HQHA 1IKWA 5MLCQ 3NGZA 1AZGB 4LDYA 1MNEA 2DO3A 4AG2C 3JRAA 4M3DA 1RBUA 1AWCA 4JRQA 2EPFA 5CJ9A 4ZTJA 4I76A 4RW6A 3VYRB 2B8AA 3J81O 1G2HA 2YCHA 3HDDA 3L09A 1KQ1A 5SZTA 4OWRB 3PTAA 2EJFA 1UWBA 3RR7A 2FYKA 3GEZA 2XY6A 4CGIA 1VQ5Q 1Q18A 2CS7A 2LJ1A 1B6AA 2XF5A 2W00A 1SS6A 1LEAA 1YJWI 1V4TA 2LREA 2GBZA 1BA1A 4JK7A 1OX9A 1AEYA 1VQNA 1OI1A 1M1KR 2VN2A 5FFXA 4FM4B 3MQ0A 4I6ZA 4MMLA 4XICA 3T8TA 4CHYA 3L0QA 3H92A 2YDLA 4I01A 3HRGA 3QFUA 2PN6A 1PYVA 3JCMV 3V9SA 2DA7A 2NRXA 3NDKA 4IPAA 4FVUA 3FXKA 5GANh 2DA9A 2JZYA 5EOYA 5EG0A 6PAXA 4FJ9A 1QHAA 5LJ3d 3J7ZO 3T69A 3E1SA 2Y1IA 1WGSA 3RKXA 1X9MA 5H20A 2E2OA 3WEEA 1MIJA 3M8QA 3AVIA 1S3XA 1MKMA 2I5UA 3DLEA 4XN3A 1HYVA 1KAYA 3AG3H 3MEUA 4IOCF 3DYAA 1X1DA 2E1CA 4GY2B 1K73U 1NPPA 1NEBA 1S1UA 2EYXA 3QJ6A 2OQGA 1G59A 2DIGA 4FWLA 3WHCA 2EBIA 3VB2A 4HSRA 4D9JA 3EHQA 1H8KA 4FQGA 4J5YA 5GP9A 2YX4A 2PJPA 1YFHA 3M3ZA 2DK3A 3TU4K 2PJRB 4FWQA 1M1KO 4V2SA 1PRLC 5D8KB 2FSNA 2V6EA 2JNGA 1Q81C 3H0IA 1Q7YC 3M4OJ 2WBNA 3JSOA 1UHFA 4PKIA 1RTDA 2W0ZA 4DB3A 2DI3A 1QVTA 2KRNA 2OA8A 1WHGA 4KDPA 3I5SA 5KYNA 5KAFC 1RTIA 4QVDA 3ZMVA 2YU9J 2PFUA 3LA7A 4DR2K 1ETKA 2WAEA 4BE1A 3GYHX 3H36A 3CWSA 4EMKA 2DU9A 3VEZA 5JLFA 3L2UA 2W82A 2DQRA 2VQGA 1YJ9T 1QO0D 3AVCA 2GQVA 1HLUA 3VU3C 4ZGDB 2X6NA 1P92A 3EDPA 5HLIA 1B4AA 4CCJA 2K5CA 5ILUA 4UVCA 2HNZA 2DFFA 2X1CA 4EM2A 3DP7A 4PGHA 1K76A 4DYRA 2BZYA 3I58A 3T7ZA 1TUUA 2K79A 1GFDA 4M72A 2V7YA 4J7IA 1M1GA 5AZJA 3CC4N 2BKDN 1BIBA 5KI6A 4CZGA 3IKTA 4GRIA 3TTDA 3LSIA 4IZ9A 2EAYA 1FXXA 1X75C 4ZTFA 4FIBA 3KP6A 5C42A 1P4WA 4XKBA 2CQKA 1OVYA 3J7ZI 2NUPB 4GVEA 2CGPA 1UGRB 3VA3A 1RI0A 5KRSA 1VQ5I 4JAXA 1ASUA 3CJRB 2P4WA 2BY1A 1EJ9A 2I10A 1I27A 2HHVA 4PJMA 3O3GA 5H2FC 1YRNB 3U6FA 3V9UA 5FKMA 3VYHB 4CSWA 5GANf 2KW4A 3QO3A 4OIPF 4OINF 2GOXB 3LOCA 2W25A 1RT7A 3SDGA 2ZPBB 1ON1A 4M78B 3EGDB 5LLQA 1TWBA 2QW9A 1BJZA 3PNWC 3O3FA 4OX9K 2VOOA 2O8DB 9ANTA 3M0QA 3CUQC 1ZHIA 2VJJA 2QQSA 3BZKA 4L0YB 4RTZA 3Q7BA 5LGUA 1N9SA 4CGDA 4V2FA 4YRVA 2FC0A 2AJQA 4M77E 3FZMA 2VKNA 1MBHA 1HXDA 4L59A 4IIMA 4BACA 3HSBA 3I8DA 3CC4Q 4E7LA 2X4JA 1OH7A 1KU2A 4XNFA 2H94A 1KSWA 4M7AE 1FIAA 1WJCA 5AQXA 3ALYA 3HOTA 2LYCA 3WGHA 4CZEA 5F1XA 4XRSA 4YOUA 5AR0A 3MXIA 3CJ1A 1ZGAA 3X24B 2IVMA 3FFKB 5D6WA 1RNLA 1GBQA 2OAUA 3FXJA 2UXCK 3EE9A 2EJ9A 3M55A 3KNTA 1RDBA 2QWQA 2WSEE 2K9MA 4FJIA 4HCBA 4RKUE 1JJ2P 1FJGK 1Q82C 1DT9A 3MEGA 3ASKA 2H6BA 2M0CA 4RAGA 1AU7A 2NOIA 1OYXA 1VIEA 4M3ZA 1R49A 1Y07A 2DA5A 3C6HA 4CCHA 3CHWA 4KI6A 1GCQC 3V8JA 2L0KA 1U9NA 2XAUA 2VXZA 2Y90A 4DOVA 2Q97A 1OMIA 2EZHA 3RMBA 3WXMB 2FBXA 1E3PA 2QZ8A 2VONA 2QG9B 4B9MA 1OX8A 3L2WA 4K2EA 2G9WA 1QVUA 1Y8QB 3E19A 2KRSA 1FBUA 4LITA 4KGZB 3SDBA 1JXBA 2QI2A 4N56A 1LWVA 3G1OA 2HL3A 5KCMA 4QWQA 1QQOA 4DTUA 2OPQA 1UGSB 1D5AA 4C2TA 2YHBA 5LL6Z 4DSIA 2NVYJ 5J4YA 2JA5J 3BOQA 1S1NA 1YYVA 4FW1A 2CJJA 2P9IA 3V9XA 3BTCA 4KBOA 2OFKA 4Z88A 1QSLA 1QCFA 1QVFA 1N6AA 2YHAA 3BR3A 1A0NB 4CE9A 3EZWA 3RRGA 1QHHD 1R1VA 4E7IA 3PIPA 4XH1A 3JCMd 2I7NA 3T5XA 4OMYA 4UB6C 3CFOA 3QIOA 4OMQA 1IC8A 5J4VA 3IRXA 5E1ZB 4LLNA 2UUBK 2QDLA 4YHHK 3G71A 1LCUA 1SRLA 3E9GA 2Y0SA 1R0CB 4AYBA 2NYXA 4KHSA 4ANJA 1XJWB 2Q0OA 3ZQQA 1GVJA 2FD5A 4II2A 2DXBA 4FWMA 1G15A 3HTSB 3GZ6A 2O8XA 3KEOA 3WNHA 2DL7A 4DUZK 4CFDA 4DQPA 2KFZA 1QVGM 4LOCA 3P9KA 1X4PA 1X19A 2ISZA 1ZA1B 5IT3A 1X3ZB 2ZJPL 5KNLA 4WK8F 1FTTA 4AHTA 5DS9A 1QQJA 2A3SA 1ZUKA 3PX6A 2ZJRF 1G3YA 3K9KA 3TKYA 2O01E 3CC4I 1X4OA 3ZQGA 1YJWA 2A07F 2GNCA 4LD0A 4M7DC 3KP3A 4DV7K 2V6CA 2CZ1B 3ZBDA 2L7KA 1KGSA 5H6RA 1ZBUA 3QDFA 1T98A 1V5EA 3K58A 4BRLA 1YXQA 1SD7A 4O5VA 3MEXA 1WNLA 2TCTA 2H3EB 3ID6A 1D3YA 3VA0A 3ZP5A 2DCEA 1YVNA 4PJOG 4G6QA 1OCPA 4MZTA 4WF2A 1JL1A 4D7NA 1KJWA 1OISA 4FYWB 2KQ2A 4F2SA 4JI8K 3REAB 3FB9A 4YG2F 3ZYYX 3E6CC 1VQOA 3C2HA 2P9PA 1Y1VJ 4C0DB 4NXMK 3IKMA 4B3RK 2E12A 2ECCA 5GAEJ 1HKQA 1C0TA 2FL7A 3LQQA 1DP3A 3O8GA 4RG2A 4LF6K 4BI8B 4EW0A 3R8EA 4A3MJ 3DB3A 1TWAJ 2EINH 1AZEA 5AJ3K 1TU0B 3QG1A 3WTUC 4K25A 1OZ2A 4XLNF 1XC3A 4ISFA 2L7ZA 3QIPA 3RQ4A 1KIKA 5HK3A 1L3VA 3PM1A 4RB1A 4E7ZA 2PG4A 1RAEB 5CYMA 2H3JA 4OPKA 5C3EJ 4A69C 3OW2M 4BC4A 1IV0A 4O3MA 1ZA2B 4H0OA 1I5OB 3TI0A 2NYSA 1L3LA 4LSNA 4DTOA 2P9SB 3JXUA 3A2FA 3QP6A 1XTDA 2OTLN 1RDAA 4EJWA 3ELKA 3OYCA 4W5QA 5D5UB 2CSQA 4U7BA 4FK0A 4LUDA 3F8FA 3LANA 1Y71A 3RTVA 1ITYA 4EPCA 2KI7A 2PVDB 3VPZA 4FASD 3R4KA 3QUIA 3I0TA 2G8VA 2JK3A 4D0PA 1VZ0A 3P83D 3HHHA 4Y15A 4AT1B 4CJVA 3A0HC 1YITT 1S7EA 1M90R 5GAMj 4L5GA 2OPSA 4KRTA 1OU8A 5ICFA 2V7ZA 2FEZA 3G73A 4DIQA 1NLVA 2OC6A 4M4ZA 1RAHB 1QQNA 4A3GJ 4G9YA 1Y64A 2WTEA 4OIQF 4G7OF 3A1YA 3CPWM 4FETA 2FE3A 2A41A 1K78A 4J9EA 4PWDA 2QA4N 2XY5A 2GBQA 3I9QA 1I6XA 2JTFA 2BOLA 1VSIA 2ZBKA 2CP7A 5DTDA 2DYSH 4UXNA 3BDPA 3QAHA 4M78D 3L9FA 5FD5A 4FISA 4YFNF 1VQKA 3I54A 4UV9A 5E79C 2YUOA 2ADUA 4KGVB 1VQ5A 4CJPA 4RLQA 5FPMA 2OTLQ 1B9NA 2UU9K 1R36A 4E6KG 1DTQA 1IN5A 2CFOA 1SAUA 3KXTA 5LFAA 1WOQA 4E19A 4RGRA 4BHBA 1N25A 3MKLA 4A6EA 2KAFA 1WXUA 3VYSB 2QGUA 1VQ9I 2DT7B 2PMHA 4B4CA 3TOBA 1J5EK 1TWHJ 1J9IA 2RQUA 1O13A 2DOEA 2M51A 2HKQB 2Y31A 2M8EA 3MEWA 3S15J 1W4SA 4HBLA 4AM3A 1JJ6C 2HI3A 4Y4RA 1FBQA 3A02A 1B72B 1IRZA 1XMQK 2PLYA 3ZX0A 1NK5A 1EKEA 3OGDA 3RTRA 4CBXA 2QA4Q 4IHWA 3ZT1A 3J80K 2X6OA 3H5AA 2FZGB 3OSFA 2V52B 2RJDA 1HUXA 2O8FA 1H0MA 2O4XA 4FZYA 2Z3YA 4PNOA 1W0HA 4RLFA 2ZE2A 4BQNA 1XC5A 3QODA 4OMMA 4OOIA 1B8IA 1NJIC 4BNCA 4BC5A 4CFAA 4AFSC 3Q9SA 3SPZA 1FNNA 1F1ZA 4NYNA 5HBMA 1K9MC 3VRYA 2X9DA 3UKUB 2Q2EA 1HF0A 2WY8Q 3TVTA 3MX2A 1SL2A 4N0BA 1NGNA 1Q7YR 1Q81R 4B1ZA 3TO7A 5FKKA 1FWZA 3OYAA 1AWJA 4KULA 1I1JA 2VWBA 5AQYA 2EHGA 1SFEA 1JHHA 3JB9F 2LNHB 1GLDG 3C1DA 1OYYA 3D5RC 4DSLA 2V8JA 2V1RA 4BHCA 2PEXA 2LLKA 4MLOA 3AVNA 1LKXA 3QWXX 2KIUA 5E18F 1QHTA 3OWTA 3LA2A 1VQ7T 4OKJA 3KEQA 2FMLA 4AI5A 2NUZA 1XHXA 3M5RA 2I0NA 2GUIA 3M0SA 4Y1DA 2FU4A 1U78A 3GBQA 1BM9A 5AQFA 1QA6A 3S32A 2KRCA 2A05A 3GG4A 1CZ9A 4DTXA 4H5TA 1LAWA 2X48A 4A6DA 2E2PA 1C0WA 1UB4A 3C6UA 2PZSA 1D9FA 2LH9A 3VEPA 4PKGA 3R9PA 1U3OA 2JN6A 1TV6A 1AKHA 3HZ6A 5FLXK 5L3GA 3C6AA 5CQYA 3VTIA 1RGIA 2JA7J 2KTQA 5GAEP 4G94A 1XG1A 1PVEA 4EJVA 4IF4A 2VQCA 3DAWA 2M87A 1R1TA 3ZFJA 4BY6C 3OL3A 4FWRA 3LDPA 2VJIA 1Q81O 1Q7YO 1IBLK 1HCRA 4Y52J 4B08A 2G3RA 3E5QA 3OB9A 3TR8A 2R7WA 2LF7A 2B9SA 3LH0A 3AL0C 3GTLJ 1S72T 4MQVA 4M3BA 3ZN1A 3WTSC 4CK3A 3GLXA 4B9NA 2K7AA 3VS6A 4EQQA 3K0SA 3FLCO 4H5VA 4QCLA 1LE8B 3HM9A 4A61A 3A01A 4CXFA 2VXFA 1JLGA 5GAMh 1QW1A 1QVFP 5GMKi 5CYQA 2P9UA 2P84A 2XHKA 4H8KA 4K0KK 4A63B 1IRXA 2A5XA 1F9NA 3V81A 2HBPA 4EJOA 2W84A 3PMTA 1HKGA 2V51B 1LWEA 2VPLA 2EV0A 1LFPA 2Q0RA 2XD0A 1FKOA 2OANA 1T3SA 4AWXB 3ZQ7A 1ZBHA 4FL9A 1JU5C 1O3TA 2XKOC 2IPQX 3OV8A 5BREA 2NRRA 1GOAA 2JWLA 1U4BA 2RE2A 3OYBA 3CCRN 3QWYA 1HKTA 1YQLA 1S6LA 2XASA 4HZFA 1YS6A 3CJ9A 2JTEA 1ZSZB 1JLEA 3H6ZA 3CD6I 4BR7A 3LPUA 3BWGA 1KG3A 5L3FA 1ATRA 3R61A 3TQ7P 2BH1A 1B3QA 1HPMA 3QLHA 1QVGS 1NYGA 4OFAA 3ZEHA 1SG5A 2I2LA 4DQQA 1KZHA 4XOTA 4L9NA 1K9AA 4IOXA 3LZIA 4MQ9F 2R0QC 5AQGA 2DAOA 1CKAA 3T0YA 3CCST 1Q82R 4DSKA 3L6QA 1BOBA 4RW9A 2R7VA 2R7RA 3MN6A 1KRPA 5D4RA 1YP5A 3WODF 1E6GA 2E1OA 2YX6A 3K1PA 4KTZA 4C3JJ 5IYBJ 4ZH4F 1AOJA 4AFUC 1GVDA 1L0OC 2ZMEC 2KY9A 4XLPF 3TOAA 4OMLA 1SD5A 2ZNZA 2E2JJ 1A5JA 2EZKA 3KCCA 2DPUA 1Y57A 1TKXA 1QSYA 1Z21A 5FROA 3CCRQ 4CZCA 2IGIA 1MSFC 2ZGZA 2JS0A 3TWHA 2WV0A 2A28A 1BISA 2CYYA 3SQ2A 2VGNA 1NH3A 1F1BB 3QESA 3R1XA 2H1LA 4IO9L 1IG7A 1QZ5A 3DXKB 4KHQA 4AILC 2LY1A 4PJLA 3PSFA 4J01A 4ELYC 3WNGA 2KJBA 5HRSA 1V5GA 3PQJA 4XONA 1MH3A 4OFHA 4DR4K 5JICA 1CXQA 1I94K 1D0XA 1RUOA 5BN9A 4C8QG 1NMDA 4OGEA 1TK5A 2FSWA 4E1NA 1KONA 3F10A 2AA4A 4JI1K 5HRNA 2P9UB 1E3MA 1RILA 3A8OB 4FT8A 1PHTA 1ODDA 2E10A 2RQRA 2CT3A 3DMJA 2OZMA 1MU2A 1M2VB 2HQEA 2E88A 3OW2S 2ZJPF 1UE9A 2CZ7B 2R7SA 1VHXA 5HDNA 3BR2A 5JI6A 3UATA 4JUVA 5JLWA 5KN9A 4CGGA 4MFEA 4E6RA 3K57A 1XSVA 1JGSA 1D8JA 2X0LA 4IO8A 3P1GA 5GANd 1R9TJ 1JKHA 1MJ9A 3SUPA 1JB0E 5A0GA 4GNIA 4B1RA 4NC8A 2RVCA 3W6VA 1MUDA 4D1QA 3QYGB 4XLEA 4DQ2A 2G0EA 3PVLA 3V1RA 1JLFA 2VT3A 3MCAB 1NG9A 3W3DA 2KIFA 5E17F 1S7OA 1U0JA 2BY0A 2LQWA 4MGRA 2RKIA 1HC8A 2OQRA 1HNXK 3H0DA 1ZR2A 3WQUA 2Z16A 3HPHA 3D2EA 3SZPA 1VQNT 1HYZA 4M3TA 4O5BA 4XTVA 3GLLA 3IC7A 3E5XA 2LNVA 5E1WA 2E20A 4FCYA 4KT6A 3MKYB 2PQ8A 4H4OA 4GLKA 4N0AA 2IP2A 3CC7N 2Z5UA 3OR1C 4RCBA 2CWEA 2LT4A 1YAGA 2EFWA 2P5LC 1FSHA 2W04A 3S8PA 1WYXA 2DTOA 3CPWS 4EMHA 1BBYA 1QP3A 4OIOF 2M7AA 4C92C 3DEEA 2FPEA 2E1ZA 2VBZA 4NNJA 3JRGA 2MYSA 4I99C 3EG9A 4EJYA 3ZSRA 1WEGA 1MDUB 2WADA 4BR0A 1QSSA 3SQ1A 2DDAA 1U48A 4U0VA 5KGWA 2XSJC 5JR3A 3JCUC 2RNAA 2KDZA 5CCAA 2VQLA 3IQLA 2H8RA 1UHSA 2W10A 3ZX2A 3DXMA 3JSMA 4RTVA 1KYWA 3H08A 2LT1A 3UR3C 1YQKA 2A5WA 4CA0A 1VQ6T 1T0FA 2M1BA 1ZGJA 4AD9A 4VUBA 3AO2A 2QKMB 1YTAA 4DEXA 4KH6A 3S2WA 1ZUUA 5DMRA 4KMFA 3KE2A 2KFNA 1EWRA 3CCRI 2F4IA 4ZGEB 1YNZA 4MHGA 3CC7Q 4DZJA 3AA2A 3KTUA 3C0BA 4IHYA 5LY3A 4XK4A 2XUBA 4UV8A 2E41A 4FJMA 1OCZH 1WHKA 2LCSA 3JAME 4DSFA 3VS1A 3G6EN 1LOJA 3BLYA 1KFSA 3JCMc 4LH4A 4F7UA 4LIVA 5CY4A 3QETA 3S1QJ 1MD0A 4DV1K 4ZDPA 4YOXA 2XAHA 4Z4FA 5DCMA 2IS1A 4DK9A 2NLUA 4BQLA 4FJXA 1BWFO 3AFHA 2YNFA 3HPGA 4UUVA 4MFBA 1JLCA 3D0PA 5J47A 1B34A 2ZFWA 4E7KA 3WUHA 2RN7A 5LJVA 1NKUA 2D0OA 3I4MJ 2PQWA 1M90U 4XIUA 2KJCA 5JLHA 4M75G 4B8CA 2JUGA 3DKYA 3WU2C 2DYBA 1F36A 2AHJB 4KIGA 3D2EB 4CHOA 5K5OA 3PFIA 5M1FA 1S6QA 2MC4A 4WQ5C 3HB9A 3MEVA 2EQMA 3HYFA 5EGOA 4LMYA 3LWLA 4WWCA 2V75A 4LDUA 2GFUA 4AHVA 3TABA 5GAOl 4IHVA 2OTLA 3EY1A 5BN8A 4IXAA 3FHGA 1TW2A 1YBYA 1J3TA 1SV5A 1MUZA 3G6EQ 2V9VA 2KSSA 5IOZA 4BI4A 3EG9B 2XMFA 3RESA 1JXEA 2CUDA 4RGUA 3TDZC 1I81A 3ZMUA 1JI8A 2FHDA 1VQ8A 4HPQA 1WA7A 1BQNA 4EIKA 4CEQA 2CP2A 4MLEA 4OPAA 2E64A 3CW7A 3GTJJ 4BVOA 4JHDB 3R60A 5J40A 2YXYA 2JRTA 3NBPA 2IS4A 2X4WA 2E4HA 2H09A 4CGZA 1IV8A 1SHGA 4HW0A 2FPFA 2ISYA 4A54A 2IAIA 4BY7J 4K41A 4QTRA 2HZTA 3Q3SA 3AAPA 4HX7A 3CJAA 5GAOr 1DGKN 3K6GA 2DK8A 1FP1D 2QA4A 2A6HF 5KPZA 5FFZA 1B1BA 1QVPA 4D7MA 1GBRA 3VENA 3KZZA 2W03A 1SMTA 1NJIR 1WHUA 2BW3A 2CH6A 5CKTA 3JREA 3PNTA 2R58A 3LGLA 4DTNA 3B6OA 3V9ZA 4FYDA 4RMNA 5F04A 1K9MR 5AIQA 4M78C 1VUBA 2STTA 1X3UA 4R1HA 3U4LA 5A2QK 3MPUB 2M4GA 4HVJA 2HF4A 3CC7I 4EM1A 3L7WA 3K70D 2K2VA 3ECHA 2ZD1A 3PX0A 2W57A 1V4SA 2E1HA 3FRNA 1W4MA 1RRJA 4FOEA 4UUTA 5AFUH 1ENHA 3HRUA 1WPYA 3CESA 3ZGKA 4IL6C 2O2OA 1N8RC 3ZR8X 4FPBA 3SWNB 3KLGA 4EW4A 5B1BH 1HKBA 3WTXC 2XGXA 2DA1A 4L18B 1JKRC 4I9LA 5AQJA 3NAEA 3RKQA 4CCKA 2XB0X 1YIJT 3OOUA 3JB9H 4GV6A 2ME6A 4AFQC 1OKRA 3BTLA 2V1NA 5FO5A 3LSKA 3BQYA 1NK4A 1K1ZA 5C4XJ 4L5IA 4CI0C 4JX6A 1OH5A 3HEFA 3KD5E 2QDYB 4WCEL 3OIPA 1PCXA 3BDLA 3G1MA 2KGTA 4XEIA 1W97L 4K8ZA 3S3MA 3I33A 2FNAA 1K9MO 4F3OA 1BC8C 2LCLA 4C0ZA 4CEBA 1PUFA 3DLLA 1IBKK 2ZSHB 4C3IJ 2DXUA 1Q1HA 1WJDA 3JCMQ 3EG2A 2FBTA 3O08A 5FB2A 4LFUA 4MDXA 1OJLA 2XI9A 2QXFA 4BWMA 2KRMA 2NNNA 2RJEA 1R7JA 5IY5H 3MKWB 3TSUA 3RYRA 3G6EI 2I5WA 3PUBA 2PFBA 3L2VA 3VYUB 3HGYA 5AQIA 3LM2A 2OPTA 2CU7A 2NOLA 1RAFB 3UKRB 5KYUA 3Q0WA 1HQCA 3DTEA 3FR0A 2LP0A 2YRDA 4IOAF 1SKRA 3HL8A 2XAJA 2O61A 2F5DA 2HF3A 1ITGA 3M57A 2GAUA 4XU3A 2M16A 4DU1A 3QQAA 3DPTA 3M56A 4AI4A 2F4OB 2EB7A 5D5VB 1YJWT 4UQGA 3ABUA 2A36A 3PIPL 2QLZA 4LD6A 2BY2A 2MA3A 2VLAA 4R0KA 1OVQA 4G12A 3CUQA 2NUBA 4BRPA 1CKBA 4A2BA 3LZJA 2HQ5A 3EETA 4WFBL 4KFBA 3FZFA 1LAVA 2EQKA 1MW7A 4FSSA 1WDXA 4QQGA 4KFCA 3FISA 4BKXA 4RDUA 4QQ6A 2DBMA 2F8TA 4Z4CA 1DDNA 4C8KA 3I56N 5KVRA 4Q4ZF 3CCJN 1NK0A 5DD8A 1EA3A 1N27A 4A62A 4B3TK 5IYCJ 3JTGA 3H1VX 2JGUA 4A3IJ 1V4RA 1FOKA 3I59A 5DLOA 2HNDA 3P4IA 1IN8A 1JKQC 3CLQA 5AQZA 5KQ8A 2CUEA 2FNPA 1JCGA 2RF2A 1BOTO 1Q82U 5ECAA 3Q5FA 4BB7A 2BV6A 3U2RA 2BEOA 3OYKA 4RCCA 1ABOA 3JV3A 5LJ5g 4EZ9A 4E7SA 2LTOA 1FZPB 1ZAOA 1XMKA 1ETXA 2X78A 1WXTA 3M7GA 1WKMA 4HQMA 1V29B 3ENOA 3CCRA 2Z1JA 3MZHA 1GCQA 5J2QA 2P4TA 1PUFB 1BGXT 3MFKA 2Y4YA 4EEFG 4F7UG 5ADXH 4CIFA 4WF9L 3G4SN 4J9IA 2L9NA 4MIMA 3GF2A 5HL7L 3W6JB 3I56Q 3CCJQ 1R4NB 2XHIA 1TQIA 4XM3A 1HSJA 4XTYA 1OFCX 5AQTA 1ZG1A 1G5VA 4JKDA 3WNEA 2O3FA 2VI6A 4C0DC 3VQ7A 1KLMA 2MW8A 4ZHRA 1YHQN 5KRTA 3L2ZA 2GLOA 2D8HA 4O5FA 4R5PA 1J5YA 5J3LA 2YV0X 5C25A 3CCEN 1ZBLA 1Y0UA 3NH2A 2IC3A 3QU6A 4CC4B 1PM3A 4WXDA 2QQ9A 2I5JA 1EO1A 1D8KA 3GF5A 1MH4A 2AKLA 3LGFA 4DJAA 3C6TA 4UVBA 3CWAA 5L3CA 1HW5A 2L54A 1H8AC 1Y96B 2X85A 1WCMJ 3KP5A 4N9IA 1NGHA 1BI4A 3BF1A 4IEJA 2RQTA 2BXZA 1XX5A 1OZ3A 2E5NA 5CR4A 1D3BB 3K2AA 1QQMA 2QXLA 4F7ZA 2VYPA 2JT1A 1U8RA 1VQ5T 3THXA 3K4JA 2HHQA 4XKVA 1XUPO 2WTUA 3FKIJ 3G4SQ 1PKSA 3FMSA 4A4EA 2K85A 4BXFA 4XIDA 2R5AA 3TGNA 3G3ZA 2LCCA 4CICA 2KLAA 4QS8A 1XQPA 5LJ3g 4KGXB 2QBYB 4F55A 4RW7A 3O9SA 3ZPLA 1X69A 3GNGA 3HOXJ 1YHQQ 4M3XA 1AHJB 2X6YA 3MDQA 4MNUA 1R71A 1KAXA 2YJEA 4CCLA 2P5VA 2E6NA 3CCEQ 3DU5A 4JJCA 2UXBK 2R5ZB 4GV9A 1M27C 5CKBA 1LV5A 2CZ6B 2VE9A 1XNIA 3AARA 4M7DA 1VQLN 2K3FA 4WQ4C 4S05A 1XN7A 1IXCA 5F64A 1B7TA 1GLAG 1GLNA 3HYIA 2M0MA 4CJEA 4JLIA 3HOSA 4NUBA 2PZ1A 1VIFA 5GMKe 2BXYA 4KAZA 3EO3A 4OAYA 2HBLA 4YIIA 4A3JJ 2NRTA 3NMZC 2FRYA 1DGRM 2FZCB 3UIQA 1YF5L 1RTJA 4RMOA 3CCUI 3S2DJ 4AIAA 1KLNA 1HYSA 2BTTA 3T1HK 3J81E 1BC7C 2YRVA 2HNYA 3DLHA 3ATVA 4AF1A 2RB6A 3LSJA 1C1BA 4FLZA 2PVOB 4XR6A 1RNHA 2K7LA 2ROTA 4FK4A 4E47A 1UJYA 2D1HA 3H0HA 2NRVA 5LJ3f 5CKEA 5CR2A 3K1MA 4C8QB 2UUCK 3QEXA 2P5OA 1QCNA 4J6WA 5ICEA 1L3SA 1Z9QA 4PJOF 4CHZA 5BPNA 1SC7A 2HNHA 3ULRB 3E5UA 3IG1A 2ELKA 3I56I 3ZETB 3M1FA 3OOPA 3ZX3A 5DM7R 4H0PA 3QOEA 3M4YA 1VQLQ 3DJCA 5KE2A 3MXJA 3CCVN 2LFBA 2XIGA 3CXCP 1LVAA 3TP0A 2XY8A 3LX7A 4IXCA 1APLC 1X9WA 4OB0B 2OZSA 3A5OC 3M3YJ 2RN2A 3DBRB 3H41A 2E4LA 4O4GA 1UTIA 4B1UB 4K43A 4DR6K 4LDXA 3E1YA 3WGIA 2RREA 4I2PA 1PRMC 2E35A 4BYYA 2H1KA 3C95A 2ZKZA 1UGPB 4IHSA 3WU1B 4E2FB 2DZCA 3M59A 2Y69H 3MN7A 5GAMd 3E6BA 3VS3A 1TZLA 2EBPA 2FXAA 4HXJA 1HLVA 2BANA 4IHTA 1MSEC 2XPVA 2XV4S 2KDOA 3UA7A 2WC2A 4HX8A 5D5XB 1LMZA 2VB6A 1QZ6A 1EH7A 4A4KA 4J6XA 2B7EA 2HFHA 3G6EA 1J9AA 4D5CA 3CCVQ 3CM5A 1MMNA 3THVA 5E3NA 3FK7A 3KD1E 1ILYA 3IMXA 4M3WA 4KISA 1A6QA 4A0XA 4CBUA 4CHUA 1D8YA 4CF1A 4ABZA 3GW2A