4BDZA

Pfv intasome with inhibitor xz-90
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 104
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bdzA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bdzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bdzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdzA03
1J5OA 2DFFA 3PX4A 1SKWA 4AILC 4M3YA 3KLEA 4CHQA 4IUVA 4E0DA 3RWUA 4OJRA 4C8OA 2RJDA 4B9XA 3HSTB 3CG7A 3QEXA 3KK3A 3CFOA 1KLNA 4PLLA 5E41A 1ASVA 4UQGA 3H6ZA 1LV5A 4DTJA 4CJRA 3G10A 4BDPA 4OKJA 4OGEA 1NOYA 4QOZB 5KE2A 3SV3A 1UA0A 3H8ZA 3SV4A 4KB1A 4N41A 3L2RA 4CJ4A 3V1RA 1X9MA 1DLOA 4CHOA 3RR8A 2BGGA 2G8KA 4F2SA 4BWMA 3OYGA 1A5VA 5JS2A 2VWJA 1WSFA 1WSEA 3U3GA 3PNWC 1LAWA 2EFIA 3KD5E 3HVTA 4KTZA 3SQ0A 5D3GA 3LZIA 4J2BA 1RTHA 3TI0A 3E01A 1K6YA 3UT1A 4RW7A 1HYZA 3QEPA 3LPTA 1VSDA 3AVKA 1CZBA 3FLGA 3CM6A 4KREA 4I9LA 2KQ2A 3F9KA 1ASUA 3IG1A 3LPUA 4N4HA 2JGUA 4O0IA 4CF9A 4AH9A 1U4BA 3DRRA 4KHNA 3SD4A 4OVLA 3MAQA 4OLAA 4CEOA 3HPHA 1WLJA 3L8BA 1SSFA 2DFHA 1RBRA 4FJHA 5M9OA 1QS4A 3NF6A 4AHTA 3HPGA 1QTMA 1Z25A 1SKSA 2QK9A 3AO1A 3B6OA 3WNEA 3IS9A 3KLGA 1G15A 1RDDA 3QEWA 1XI1A 4JRPA 2IS3A 5T7BA 3SUQA 3OVNA 4FJJA 4W5OA 3ZT3A 5KTQA 1R0AA 4ELUA 2HHQA 3DLGA 3DYAA 3IRXA 4FCYA 5HBMA 4CEBA 3DI6A 1XC9A 4L59A 1TKXA 4CESA 1ZBIA 1J9AA 3MP6A 1JLAA 2BDPA 1RILA 5J2PA 1ITGA 4H8KA 1RCHA 1OI1A 1IH7A 1D8YA 4Z4HA 1WN7A 2IGIA 3LWMA 4GVMA 1LW0A 3K59A 3RMAA 2JTFA 2G8VA 1JKHA 1NKBA 4FJ5A 4LSNA 1B9FA 1T03A 2MWPA 4PA1A 4CF2A 3C4SA 4DSIA 1QQCA 3ZSZA 3AVLA 3OQ5A 4FJ9A 4EZ6A 3V4IA 4DU1A 4RG2A 3NF8A 3HPOA 1KCFA 4IUUA 4I9QA 5J2QA 4BE1A 3OB9A 1SL1A 4O4GA 4Z4CA 2M1HA 2QQRA 4CHNA 1OZ2A 3S3NA 1WAJA 1NKCA 4FK0A 2O4XB 4DSEA 2OPQA 4IURA 5IAYA 1ZYQA 2XDPA 3DLMA 2OA8A 4KFBA 3LGLA 3VQEA 3TAQA 3S3OA 4O0JA 4KO0A 3LZJA 5CYMA 3DLHA 4M3WA 3TAFA 3HO1A 2DIGA 4KRFA 4KHSA 1RT3A 4IUTA 3NF7A 1XHZA 4FL6A 3PO4A 4DFMA 4II1A 2BKDN 2A1SA 2HNDA 4CGDA 2I5JA 1NK6A 3AVCA 1VSJA 3OYBA 1KTQA 3AO2A 4IFVA 4F2RA 5C24A 1QSLA 1JLEA 3TABA 4Z0UA 4LD0A 4CIEA 4BACA 2FC0A 1OYXA 4QQGA 3DRPA 1YTUA 4FZXC 1NK4A 2BUDA 2BE2A 4M41A 4EDUA 3HT3A 1WSJA 4DG1A 4A4GA 3ZT0A 4QCLA 3P8HA 3OYJA 1RI0A 2G3RA 5HRNA 1Z26A 1SL2A 2LCCA 1DTTA 4BDYA 3CEYA 3HYFA 1WNSA 1TL3A 3SQ4A 2X35A 3MP1A 3NFAA 1WSIA 1EETA 3OJSA 1JXEA 3AVMA 3NH2A 4DU4A 3CYMA 4O44A 3HK2A 2E5QA 1G5VA 2YHAA 3ASMA 4J2DA 3H08A 4CJUA 4B08A 1TKTA 3KIOA 1C1AA 2Y1JA 3AVBA 1TK0A 2IDOA 2YNHA 2P0KA 4ID1A 1GOAA 3G0ZA 4FM1A 4A4EA 3UWNA 1UAXA 5HRPA 3K2PA 3DLRA 3KLHA 1UWBA 4N47A 2G8IA 3M8PA 4NS5A 3T3FA 1L3SA 4CJ3A 4CJTA 2Y1IA 3K5LA 3C6TA 2FBYA 3VQ5A 3LX7A 3K57A 1BIZA 3Q1JA 2GFAA 4QVZA 3AVJA 4E7LA 4CECA 2YRVA 4DF8A 1I3AA 4FLZA 2HHUA 1IKVA 2OPRA 2X78A 3DLEA 5KE3A 3HXMA 3RMCA 5JS1A 4DLGA 2RHUA 1SKRA 1IG9A 4DQQA 3QEIA 5C25A 4EP5A 1MHNA 3DB3A 3NHGA 4B9WA 2HMIA 2EQMA 4YNQA 4F8RA 4DTMA 4Z4EA 3U6FA 3LDSA 1KHCA 4BE0A 3OS0A 3AO5A 3AA3A 4FK4A 3ASKA 4DTSA 3TARA 4B3OA 1TAUA 3VQQA 4GW6A 4AHVA 4Z4IA 2OPPA 3PV8A 4E1NA 4CGFA 1NK9A 4NCAA 2KTQA 2X4WA 4DMNA 2EQJA 1TAQA 1TL1A 4A4FA 3PMIA 1A5XA 3L2VA 3SPZA 4N5SA 1X9WA 4AHSA 3AA4A 3ME9A 4BDZA 4KHYA 2QQSA 1RTIA 4E3SA 4C8NA 1C6VA 4CEZA 3THVA 3ZSOA 3RRGA 5KRSA 1S5JA 4C8LA 2FBXA 2XHBA 2HB5A 4FJLA 4KKOA 4FJNA 2ETJA 2B4JA 5HP1A 3NH0A 4JRQA 4B9VA 3T19A 3NTKA 3OMGA 2RF2A 5C0MA 3ZSRA 3ZEHA 4FW1A 3PUFA 3V9ZA 5KH6A 2IC3A 1U45A 1F21A 3M8RA 1T7PA 4DSJA 5CZ2A 1BQNA 4A4HA 1VK0A 1B9DA 3OMCA 4XIUA 2L8DA 3MEUA 3ZSVA 5I42A 1X1PA 2VWKA 3VQPA 3OY9A 3OYAA 2YNIA 2EQKA 4RW6A 2P51A 3V9WA 1J53A 1KVCA 3DOKA 2HHWA 1QSSA 3OYCA 3ZT1A 4CEQA 2XY5A 4FK2A 1S9GA 3VQDA 4E19A 2XY7A 3TWHA 3OS1A 3S3MA 3WNGA 4CIFA 4AHUA 1RDAA 2DY4A 1S1VA 1TKZA 3ZSWA 1HYVA 4RG8A 2ZD1A 2WOMA 4KI4A 2Z1GA 2Z1JA 3SQ2A 2RI5A 3EZ5A 2B5JA 2D9TA 2BIVA 4TSXA 1X9SA 4CHZA 1FKOA 5J1EA 5J2MA 2RHIA 1KFDA 3M9QA 4H4OA 4FZYA 4E7JA 4QAGA 3VQ4A 4DSLA 1JLBA 3ISNC 4B9NA 2LRQA 3V9SA 4EZ9A 3HP6A 4JLHA 4DTRA 4HUGA 3WNHA 4FLXA 2L3RA 2D0AA 3S6WA 3QINA 4CJKA 4C8KA 2FBVA 2YKNA 5I3UA 2XO7A 3MEWA 2LSNA 3SJJA 4OVAA 1RNHA 2RHXA 4NZGA 2HNYA 4W5QA 1Q9YA 2GFUA 3KTQA 3V81A 4RW9A 2M0OA 1LW2A 4CF1A 3BDPA 4FJIA 3L3UA 2CKKA 1NJWA 4DTPA 2P1JA 4OLBA 2GV9A 3LP3A 4FJ7A 4BE2A 1HNVA 4OGCA 3AVHA 4C5HA 3MEAA 3F70A 4N76A 4CFBA 2KZMA 2R7YA 4CERA 2RHZA 5EU7A 3PX6A 3O3GA 4ELTA 1HQUA 4RW8A 1ZBHA 1HYSA 3QERA 1VSEA 4CE9A 3DM2A 4C5IA 4J2AA 1YT3A 1JL2A 2HHVA 3NTHA 1YTAA 2YNFA 3TAMA 1WSGA 4HCZA 4CFCA 1QHTA 4HCCA 4DFKA 3CFPA 1N27A 1XNIA 3KJVA 2E6MA 2XY6A 2XRIA 2LTOA 5KRTA 1B92A 3ZT2A 4DTNA 4QQDA 3PMTA 3AO4A 1JL1A 2PY5A 3QIPA 1N5YA 1VSHA 3I8DA 4E1MA 4FM0A 3KLFA 2QKKA 1FK9A 3QNOA 2R5MA 4KAZA 1LWEA 1Q8IA 4FM2A 2Q3SA 2LVMA 3META 2RN2A 3RMBA 4PLIA 5CIUA 3RTVA 1BGXT 4ICLA 3SI6A 2PQWA 2FBTA 1U48A 2GUIA 4B8AB 3JSMA 3AVGA 1GOCA 3FFIA 1FKPA 2HQEA 4IBNA 2HVIA 2XY8A 3LYIA 3OJUA 3O4NA 1ZBUA 3SNNA 1LWFA 3NH1A 3SUOA 1RDCA 4CJPA 3ALYA 3AVFA 3O8VA 1RBUA 1NK8A 4B9MA 1NJYA 3V9UA 4DF4A 2OZMA 5KGXA 4IFYA 1TV6A 4E7HA 3SUNA 3OYFA 1WJQA 1XHXA 2HHXA 5FROA 2X6SA 2PZSA 4KV8A 4DS4A 4DQPA 1WAFA 1VRTA 1QSYA 1XWLA 1EX4A 4DSFA 5CY4A 4N4IA 4CGIA 1LAVA 2W42A 4FLWA 3L2QA 1L3UA 3AVNA 3QIOA 5KI6A 5D6WA 3HL8A 4HVJA 3O3FA 2YNGA 1EKEA 2GBZA 3KKRA 4M3UA 3RMDA 3AVAA 3SYZA 1ASWA 1U49A 3DLKA 3OYNA 4EP4A 1C1BA 2PYLA 1JXBA 2RHYA 2RJFA 2YV0X 1TK8A 1S1XA 5HRSA 2E6LA 4CGGA 1D9DA 4DQIA 5CYQA 4CJWA 4IUPA 3V9XA 4YFUA 1RTDA 4IDKA 4FLYA 1C0TA 1GOBA 1UA1A 4IUQA 4JS5A 4FU6A 1T8EA 3TAPA 1W9HA 2RO0A 4LY7A 1BQMA 4HUEA 3LP1A 3NE6A 4CEFA 4Z02A 3DRSA 4FJGA 3QIIA 1H3ZA 3QEVA 3QO9A 4CJLA 4HCBA 4J2EA 3P5JA 3VQCA 4HUFA 3DOLA 2RPIA 3O3HA 3RRHA 1SUQA 1Q9XA 3SZ2A 4L8RB 3KK2A 2B6AA 5J26A 2Z1IA 3LANA 4C8MA 3FEOA 4CHYA 2NUBA 2R5AA 3LP2A 4FLTA 2BANA 4FJKA 4KHQA 3MEEA 3E9GA 3O4QA 2O4GA 4CIGA 3MECA 3ZCMA 1RT5A 4FYDA 3QKJA 2KZZA 4CCHA 1VSFA 1CXUA 3NGIA 2M16A 1RBVA 4KTWA 2RKIA 3DMJA 4B8CA 4HHTA 3LAKA 3P1GA 3SUPA 2F5KA 2E6NA 3P8DA 2JLEA 3IAYA 3UIQA 3DB4A 3PY8A 1O1WA 1L5UA 1RT4A 3RR7A 3FDRA 3KLIA 2F8SA 3L2UA 1RT6A 4FLUA 4DFJA 2ZQBA 3AA2A 4CEAA 4JS4A 1BI4A 2X74A 4M42A 3C95A 3NTIA 1VSKA 3AVIA 2X4YA 2IOCA 3VQ8A 3MEDA 3C6UA 2RI2A 1RT1A 1S1UA 2GF7A 1VSMA 3V6DA 3HJFA 2EHGA 3LAMA 1WJSA 3AA5X 5HRRA 2JZ2A 1U47A 1BIUA 1HJRA 4K8ZA 4W5RA 1TGOA 4ELVA 3M8QA 3ZSXA 3ITHA 5CZ1A 1VSIA 2EQUA 4PUOA 4BWJA 3JYTA 4LH4A 2HHSA 1HPZA 1KLMA 4PY5A 5J39A 3OYLA 2KFZA 4DSKA 4M45A 2G8WA 4DLEA 3A2FA 3P83D 3MXMA 1EP4A 2D0CA 4AHRA 4N4GA 4IG3A 4N56A 3LLRA 2Z1HA 2RJCA 2F8TA 4BD3A 3FC3A 5HLFA 3TAGA 2DIQA 2R58A 3KKSA 2YHBA 2KW4A 3ZSQA 3MO8A 3NBPA 3I0SA 5KCHA 3PO5A 2O4IA 4IKFA 1KVAA 1OZ3A 4NYFA 4CGJA 2ZE2A 4OPKA 2HQXA 1I39A 4PWDA 3OA6A 1NKEA 3QBYA 3I0RA 2IG0A 3LWLA 3MP8A 2P5GA 3EYZA 3VQ7A 2X4XA 4W5NA 4O5BA 4B9TA 3E9FA 1SL0A 1TK5A 3CQ8A 5IN1A 2VG7A 2K3XA 1HRHA 5DMRA 3ULDA 1S1WA 4NYNA 4CRIA 4M3TA 4Q0BA 4CFAA 3SCXA 4M3RA 5K14A 5FRMA 1TVRA 3NCIA 3AV9A 4CJEA 1REVA 1S6PA 1FXXA 3VQAA 3MXJA 4CHPA 1EXQA 1IKYA 2D5RA 2L89A 1BL3A 3OYIA 4CJQA 4I2QA 3V1OA 3OYKA 4C5EA 4QW2A 4DS5A 4CGHA 1S1TA 3TR8A 4AHCA 1CXQA 4FZZA 4DU3A 4E7KA 4NCBA 3PX0A 3K5OA 3L42A 4PL6A 4FJMA 1L3TA 1BCMA 1N6QA 1NK0A 3OYDA 3GOXA 2ITGA 1RBTA 3L3VA 4CJVA 3VA0A 4LD6A 4KHUA 4FJ8A 3L2WA 3D45A 4GY5A 1WSHA 4CEDA 4CK1A 1SV5A 2RI3A 4KPYA 1IO2A 1IKXA 3EAEA 3BGRA 4HTUA 4W5TA 1ZBLA 1S6QA 1Y97A 4NCGA 2HNZA 4DQRA 1NK7A 1WJRA 1HNIA 1BHLA 2IAJA 1RBSA 2DAQA 4DQSA 3NDKA 1C0MA 2QXFA 3LH0A 4ZHRA 5D6XA 3M8SA 2WACA 4F3TA 5DK5A 1HMVA 1RTJA 4IG0A 1RT7A 1D5AA 4OKEA 1KFSA 2G8HA 4Q5WA 2O4XA 2P5OA 1A5WA 4Q5VA 1VRUA 3MEVA 2OPSA 3PFSA 1JLQA 2A1RA 3VN5A 3OS2A 4ZTFA 4Y1DA 4ZTJA 4O55A 3QLHA 1JLGA 4I7FA 3MXIA 1T05A 4LSLA 4F3OA 3D0PA 3T1AA 4KI6A 3LP0A 4Z4FA 1LWCA 4OKKA 2KFNA 1L3VA 3S9HA 4PQUA 1CLQA 2G8FA 3LALA 4F4KA 2PYJA 1CZ9A 3NF9A 5C6SA 1BCOA 4WE1A 4DWIA 4I2PA 2HVHA 4K8XA 1VSLA 4KB0A 4R5PA 2WONA 4DTXA 3U3YA 1W0HA 4LH5A 1IKWA 2DFEA 4B9LA 4RW4A 4CJSA 1TKDA 4FJXA 1NJXA 4OPJA 3K58A 4QQ6A 4MQ3A 3HM9A 1S9EA 1JLFA 4Z4GA 4C5GA 2NLUA 2YKMA 1J54A 5D6YA 5J2NA 3NAEA 1HQEA 4DTOA 3VQBA 4KHWA 2MWOA 1BISA 3LGFA 5FDLA 3NGZA 1KVBA 1D9FA 4FW2A 4FLVA 3VQ6A 1C1CA 5C42A 4CJ5A 3K5MA 4E7IA 4CF8A 1U04A 1NOZA 3K5NA 4FXDA 1RT2A 3SPYA 3QETA 3HP9A 2VYTA 4DTUA 4M3ZA 2EKOA 2XK0A 2VG5A 3WNFA 2EX3A 3KUFA 2DTUA 1NJZA 4MFBA 2E4LA 4DFPA 1KSPA 2QKBA 3KK1A 2D0BA 3TAEA 2FHDA 1YVUA 1KRPA 3DLBA 2RJEA 4CFDA 3EY1A 2B8AA 4CK3A 3VQ9A 4X34A 4ID5A 1ZBFA 3OYHA 2HHTA 4M3XA 4CJFA 1MU2A 5KCOA 4B9UA 3F73A 4UC4A 4B9SA 2R57A 3B6PA 4H4MA 1QE1A 2G8UA 3ZSYA 3TANA 4CF0A 3CFRA 3ZT4A 1C0UA 1JLCA 5SWMA 1RDBA 3V1QA 2ATQA 3NGYA 4G1QA 2F96A 5SZTA 1UOCA 4CEEA 4E89A 3C94A 3NNQA 4Y1CA 3OYEA 4FVMA 5HROA 2K3YA 3BDLA 3QJ6A 3OYMA 1WGSA 3SQ1A 1DTQA 4GMJB 2HW3A 3MEGA 1NK5A 3HVRA 3VA3A 1BI4B 2OZSA 3AO3A 3QESA 2LDMA 2VG6A 3KD1E 3QNNA 5FRNA 3CM5A 2OYQA 4CK2A 5KGWA 2AJQA 4KTQA 2X6NA
chains in the Genus database with same CATH superfamily
5F0XA 2CFOA 1ZQ3P 1D1CA 2DFFA 4ZGDB 3BROA 5GTHC 3JCMe 3DXJF 5E79C 1TNTA 3RTRA 3KLEA 1NGFA 4OJRA 2V9PA 1OX8A 3CG7A 1KLNA 4PLLA 1KFZA 1MBGA 2CSQA 1R4NB 3K4CA 5CQGA 2E1YA 3PO2J 1LV5A 3G10A 1RAHB 1NOYA 5KE2A 2HDWA 4JV5K 3MN2A 3SWNC 3HFNA 2E5ZA 1VQ7A 1W1FA 4UY8I 5M1KA 2YRCA 2E2NA 4RKUE 3HDDA 2P0QA 3WQTA 4N41A 3L2RA 1LPLA 1D1BA 2MIOA 5E26A 2HAXA 1EQYA 1YW7A 2O9LA 2LJ3A 2G8KA 4ZC3A 3OYGA 5HDNA 1KQSS 2W85A 1WSEA 4PGHA 4CHUA 1SRLA 2P9SB 2DPDA 3QRFF 1TZLA 4FWSA 2L3PA 4BR7A 4N4OB 3K10A 2JXBA 4KTZA 1X6GA 1FOWA 3ZN1A 3LZIA 3GFMA 4J2BA 4PJ0C 2FSJA 1N34K 2UUAK 3I4PA 2QQAA 1K6YA 3UT1A 3JB9J 4BC5A 2CUEA 2EV0A 2DEUA 3S15J 3I35A 5EYRA 1HYZA 5CE3A 2UV1A 2ROTA 4B8XA 3AVKA 4M72A 2DLLA 3FLGA 3M1EA 2K6DA 4N4HA 3CCLQ 2VQFK 2ZB9A 1Y0MA 3EG9A 4XRSA 3R6MA 3WG7H 3GL1A 5AQPA 4F3QA 4AH9A 1ACIA 3WTWC 4FO0A 1WPYA 2CZ1B 5HLGA 4NL3A 4X65K 3H9JA 3R1XA 1Y96B 1WLJA 1SSFA 1J2XA 3BF3A 3CZ6A 3AG1H 1HCRA 3ZRGA 1CKAA 4XBFA 3FZMA 3Q3SA 1KD1C 1Q82O 4AFZC 1ZG1A 1IAWA 2V1UA 4HWIA 4M9XA 2VPLA 2QK9A 1M1KO 2HYGD 3B6OA 2E34A 3OA9A 1XDUA 4FT2A 2RM4A 2EAYA 3WNEA 2Y4YA 2NRVA 2K27A 1VQ8T 1G15A 4IZ9A 1VQOA 1Y96A 4OB1B 2CWEA 1ZLMA 2KROA 2IS3A 4YTLA 3KLOA 4ZZLA 1QPMA 4IOCF 2QYOA 1RR7A 4KT6A 4ELUA 3DLGA 2AO9A 1T6DA 4CEBA 1TL8A 3DI6A 1QVTA 4C2MJ 3C6HA 1J9AA 2CZ7B 1JKQC 2WBMA 4LIVA 3KEYA 1RILA 4OB0B 2LH9A 1LMZA 1RCHA 2BYVE 1QWEA 3G4ST 5KQDA 2H1LA 3VYUB 1GDTA 3INZA 2DXIA 1WN7A 3LWMA 3I71A 2XKOA 2G8VA 2VUBA 1B9FA 2ZPFB 5GAMj 3O80A 4PA1A 4CF2A 4CYDA 1TUYA 3KTUA 3IP4B 3VMFB 5LGTA 1K8AR 3SAFA 4JQFA 2GX9A 3GP8A 1K61A 1QQCA 1QPIA 3WXMB 3AVLA 5HODA 3JXUA 4EZ6A 3CC4A 4Z6YA 1KCFA 1ORPA 4I9QA 2HU9A 2A3ZA 5J2QA 3SHFA 3R6OA 4J9EA 4BE1A 4O4GA 2VXEA 2M1HA 1ZBSA 1ETQA 4LD5A 3KWGA 1APLC 4B1VA 1RZ4A 2X6WA 2O4XB 3O8GA 2OPQA 1GVJA 5FKLA 2ZGZA 5K5OA 3JB9F 2I5WA 4IURA 1I5ZA 1Q95G 3A5OC 1ZYQA 3DLMA 3RZDJ 4JZ3A 2FBKA 3WXIA 4L9TA 1OJLA 3LGLA 3VQEA 3F22A 4HV5A 1JEGA 2GEMA 3ZN0A 3S41A 4F17A 4M3WA 2H6CA 3TAFA 2GZWA 4XLPF 1ZC6A 1RT3A 2KI7A 3GWZA 4IUTA 5KPTA 2W24A 3CCSQ 5KHDA 1VQNA 1M5Q1 4FL6A 3EGDA 2BKDN 4CGDA 2FSKA 2I5JA 1NK6A 2MFZA 2Q0RA 3OBWA 2W00A 1YBYA 5FPNA 5GAEJ 2GBYA 4RGXA 2WAQA 1KTQA 2ECZA 1VQLT 1IUFA 3N4QA 2LT4A 1QCFA 1QHGA 3WTUC 2GLOA 2PVOB 1BG3A 1QSLA 2H09A 4XLHA 2WADA 5CPRB 1I81A 4WTOB 2GUPA 1HLUA 2FE3A 1VQOI 2HTSA 1OH6A 4U67L 5GAEP 3EFOB 2VJJA 4M7AF 3DRPA 1NK4A 2BUDA 4DHYA 4EDUA 1OULA 4DG1A 1K8AC 4A4GA 2QA4T 3ZT0A 3I4NJ 3N5NX 4LD9K 4BKXA 1IO6A 3SDZA 2LCCA 4AM3A 3JR9A 1WYXA 1WNSA 1C0GA 1VQMA 3DQVC 3SWNB 1KYWA 1FMWA 2QSFX 5ILVA 1UAAA 2D6FA 3OJSA 3EFOA 3SB2A 4M7AB 4JBAA 3NH2A 2AHQA 4PSWA 2DYIA 2LKXA 5DUKA 1ARKA 3FLCO 1WJDA 5H6QA 2AXTC 1G5VA 4J2DA 3TDUC 1FP1D 2DD5A 1TKTA 4OIRF 3BDUA 2BE7D 4FPBA 3CDIA 3IL2A 1TK0A 1MNDA 3SWNA 1UHCA 4EPCA 2LTPA 3CC4I 3I54A 2M0MA 2CUFA 1QVGP 4RS8A 1GOAA 1ZR4A 5KYUB 3G0ZA 4BREA 5E1XA 4M7AA 2COMA 4FM1A 2XPUA 2XV4S 4H0PA 2DL5A 4G9YA 4JKAA 1UAXA 3K2PA 4OB3B 2KY9A 4MDBA 3CC2A 1MBJA 5F1RA 1S7EA 5M3FJ 4XK8E 5GAN3 1WI9A 1UWBA 2EYZA 2DE0X 2HOEA 3LWHA 4JYAK 4HF2A 4IFEA 4JI0K 5K7HA 3HZ6A 2M7AA 4CJTA 3H1CA 2GXGA 2FBYA 3LX7A 1BIZA 1K73C 2XB5A 4M74A 2LT1A 2NVQJ 4N9HA 1W1WE 1P6RA 1NK3P 1U2VA 4FWRA 5GAMh 4JKEA 4FLZA 3FGUA 2HHUA 2VI6A 3NARA 1VQNI 2OPRA 5JVHL 1RIOH 5GAHJ 2KHMA 4OO1J 5KE3A 3HXMA 3RMCA 1JTXA 2KDZA 4FOIA 2Z5UA 2DX1A 1WEFA 4EHUA 5ICFA 1MHNA 5AFUH 1K4TA 3BT9A 1XN7A 5GAHP 4B9WA 3EH2A 2HMIA 3S1NJ 2QAZA 1AOJA 1GXPA 4YNQA 4DTMA 1QVUA 4Z4EA 2EK5A 1VQOQ 3LDSA 3LAPA 2VQLA 3AO5A 3AA3A 1FYLA 4F7UE 3KP7A 1OU8A 4MHGA 1FOXA 2HOAA 4DTSA 1WB9A 1TAUA 2KR3A 5L3CA 2DAOA 2HNIA 4BY6C 1KHIA 3E1SA 3PV8A 5IWAK 4CO8A 2PN6A 2D2WA 1G8XA 1E6GA 4CGFA 1NK9A 2M30A 1VQMI 4IHSA 1KG5A 2EQJA 2RQQA 2VWBA 2HEOA 3IH4A 2QWQA 5DEQA 1A5XA 1WEIA 4CA0A 4JHDB 1YHQA 3A0IX 4N5SA 4OMNA 2IVOA 2STTA 3AA4A 3ZBDA 2VOOA 1OKRA 4FWNA 3KZBA 2HBWA 3UF4A 2O8EB 1R36A 4E3SA 3GX4X 4KT5C 2VT2A 4NC7A 3H9NA 4ZYHA 2UYTA 1TBXA 1M90U 1IJWC 1ACMB 3I56N 2HWVA 3J80O 4WF9L 4M7DF 4C8LA 1WHMA 2V1RA 2AZVA 2DOAA 4HLXA 3V7SA 1O3SA 4JHDA 4J6YA 4FJLA 1VQPA 5F08A 4FJNA 2E12A 4IEJA 1Z21A 4PKCC 1VQ7T 2QLZA 4B9VA 4MZPA 3OMGA 1U8RA 3J80Z 2RF2A 1TU0B 3THXB 3KP3A 3AG3H 3V9ZA 1JKOC 3O9QA 2KK4A 1ZAOA 1U45A 3M8RA 2GIZA 4DSJA 2BE9B 2FSWA 1C0WA 4LUDA 1BQNA 4M7DB 2RAEA 4AG1C 2IJLA 4E2FB 1BN5A 4DV4K 4EM2A 3JS6A 1B9DA 3WHCA 2M7BA 2KKOA 2ZJRF 4KUIA 3ZSVA 2VWKA 3CC7A 4PJOE 3SBTA 2WB1N 3SDBA 3ID8A 3OYAA 3K1PA 4OMOA 5BNGA 1QVGA 5A0DA 2YPRA 1SMTA 3ABLH 3K2ZA 1YJ9A 4CEQA 1G4DA 2NOLA 2VCPA 3ID6A 2KHOA 3TWHA 2JTVA 3WNGA 3TKYA 4CXFA 4CIFA 2CO5A 2DL4A 4I09A 1HYVA 3CCQN 3G4SN 3ZMSA 2W57A 4EJVA 2Z0WA 3S1MJ 2RI5A 2HDDA 5C10A 2B5JA 2E3HA 3GF2A 1X9SA 4G7ZF 3EZWA 3ASOH 5KN9A 3VEZA 2WSFE 1N33K 1NWKA 5BPMA 1KFDA 1FBQA 3FWEA 1AHDP 4FZYA 4BBRJ 3ISNC 2CSOA 4B9NA 3J80K 3HP6A 1UELB 4JLHA 2FXAA 4JPBW 3MD2A 2BTTA 3R3LA 2XDBA 1YHQI 1ILYA 5AQOA 1TS9A 4DIQA 2MMPA 4JLIA 1KC8R 3ASNH 5BOXA 1ZRDA 3C0CA 3G71N 3LSRA 3R0JA 3MEWA 1MJ9A 1RNHA 2RHXA 4C0FA 1RAIB 2CH5A 1IDZA 4W5QA 1Q9YA 2EZIA 3CMAQ 5AZJB 1HUXA 4V2FA 3V81A 3FK6A 1LW2A 4CZFA 2XI9A 1OH7A 3BDPA 4FJIA 3L3UA 4A3JJ 3MPUB 5CJ9A 4KUDK 3Q0VA 1VQPI 3M1CA 5LJ3g 3J7YJ 4DTPA 2P1JA 3JAME 1GLCG 4OLBA 4BE2A 1HNVA 4OGCA 1FZPB 2JN6A 1HX1A 2NVYJ 4CFBA 4WYBA 1U0JA 3J7YP 2KZMA 1JJ8C 3EGUA 5AZJA 3BY5A 4CERA 2RHZA 3O3GA 4RW8A 4ILGB 1IBLK 3GO5A 3OGDA 3QERA 3PUBA 4C5IA 3CC7I 5GADJ 2ICWG 1WRJA 3VS3A 2YUNA 2QWNA 2X3WD 4WXDA 5KCMA 1O13A 3NTHA 4NNJA 2P9UB 1W2BP 2Y4XA 3VS5A 4FT8A 1QHTA 2QA4N 4JK8A 3LSTA 4C92E 2K9MA 3CFPA 1YJ9I 3KJVA 1ZARA 5GADP 3ONQA 2YJEA 1OMIA 5GIPA 3IAM2 4EM0B 3BZKA 5KRTA 2Y9YA 3RZOJ 3JSCA 1YUWA 4QQDA 4JAXA 1OVYA 4OPHA 2PY5A 4JKGA 2DRMA 1JU5C 1JTYA 3ZOBA 5GP9A 3TO6A 1JJ6C 1YRNA 4B4CA 4FM0A 2P9UA 2CQQA 1QW1A 1I8FA 2HYJA 2Y90A 2R5MA 4HX8A 1W6XA 1LWEA 1NGGA 4PKIA 4HA8A 1WX6A 1Y57A 2GTJA 3P39A 5E8GA 4FM2A 1TWHJ 1EFNA 2Q3SA 4B1UB 2RN2A 2UUZA 3RTVA 1H92A 4GKKK 2KDOA 2NOFA 2VE9A 1U48A 1IXRC 4XLNF 4B8AB 2IA2A 3AVGA 2A0FB 4BRAA 1U9NA 2CH6A 1FKPA 2HQEA 2HVIA 3Q7CA 2XY8A 1YI2A 3GLXA 2DODA 5LRRA 3J7ZO 3WU2C 3PO3J 5IHKA 5CQXA 1ZBUA 4JLGA 1GCQC 1ETVA 2V7YA 3NH1A 2CH0A 3SUOA 1JCGA 2VKDA 3F8NA 3RKWA 3CWTA 3EDPA 1RBUA 1D09B 3TL4X 2A40A 1YCSB 4M78F 1P9QC 1NK8A 4B9MA 1T38A 3IV5A 2DI3A 4FSXA 4WK8F 5KGXA 5GAMf 2BZTA 2NRZA 2X85A 3KVGA 4R55A 3CCRI 2PZSA 1KGSA 1XQPA 4DS4A 1WAFA 1HR0K 1VRTA 3O08A 4YOQA 4M6XA 4R8HA 3HGGA 1HPMA 5CY4A 4N4IA 1PRLC 1LAVA 1VZ0A 4FE7A 4LDVA 5AQMA 4M78B 2E71A 3CWUA 2OTLT 1MSFC 1L3UA 2DOEA 2L9RA 5IP9J 5D6WA 3CC7Q 3MN7A 5D6EA 4QTRA 3O3FA 2ISYA 4IRIA 3KKRA 2E7WA 1VQ4I 2HL3A 2VC8A 5IT9O 1ZREA 3AVAA 3CC2T 1ZBJA 1M2VB 3VPZA 2E41A 4EMKB 4Q4ZF 1YJ9Q 3LQRA 4F52A 4EP4A 4WXCA 3K2AA 4MO7A 1C1BA 2PYLA 1E4FT 2XGDA 4HNTA 2RHYA 4WF2A 3N4PA 4AQYK 2V9KA 3M4GA 3TREA 4TVRA 5CYQA 1RNLA 4N0AC 1IG7A 4DJAA 4A53A 2DTZA 3V9XA 2DNUA 4YFUA 1RTDA 1HOMA 1M2VA 2VQEK 4EMKA 1RLQC 1IHWA 1JGGA 1C0TA 3QU6A 2EV6A 4B1XB 3PSIA 4K41A 4C1NI 2R93J 2OZUA 4LNPA 2EJ9A 5GAGP 3HXLA 1WXTA 3CMET 1IJJA 2QTXA 2D0OA 1W9HA 2RO0A 4M75F 1BQMA 1OH5A 2ZF5O 4IOAF 3SZPA 3MN5A 1RRJA 4DBFA 3KZYA 5JLFA 3DRSA 3QIIA 2DDBA 1GLAG 3QO9A 2WTUA 4CJLA 2ZJPF 4HCBA 1QQIA 4R56A 3I64A 3CCMA 1W2BA 2CP6A 2EILH 3NVKA 4FT4A 1NG6A 3DOLA 1Q86C 1X3NA 4B43A 3RRHA 1FY7A 1YI2I 3SZ2A 2D4WA 5IP6A 3LFKA 4M75B 1ZK8A 4LUEA 2IS2A 3EFRA 5AQNA 2O8BA 1U8BA 3D2FB 4QPQA 5CKHA 5M5YJ 2CV1A 3FHFA 4AC0A 4IJAA 3OIOA 2JMWA 3MECA 1Q81R 3KXTA 3CO6C 3IWZA 2JSCA 4BQOA 2C6YA 3E66A 1TNSA 3QKJA 3CCRQ 2KZZA 4CCHA 3A4CA 3F23A 5D5WB 3GW2A 2M16A 1XCVA 1YHQT 4XN0A 1RBVA 4Q47A 3N0UA 3I9QA 4KTWA 4OAYA 1H641 3S93A 2FOWA 4M75A 1TTYA 3J81E 1YF5L 1PUEE 4MO4A 5M1FA 3QICA 5J40A 1O57A 3UKRA 3GVAA 3V7CA 3GTLJ 4E6RA 3SAGA 3PY8A 4QVCA 3R61A 3RR7A 2E1OA 3FDRA 3KLIA 4W1UA 1RT6A 1FT9A 2EW3A 3DTKA 1VQ4Q 3AA2A 3AFHA 3TW6A 2E1MC 1YX5A 3S16J 4G12A 1VSKA 2NVXJ 3BPVA 4XMYA 4E70A 4CBUA 1QWFA 1UFFA 2ZPHB 3VQ8A 4ME7A 4JN4A 3V4GA 4RTFD 1KD1O 3C0BA 1S1UA 1VSMA 5L3BA 1EH6A 3CI5A 3U1KA 4E6KG 4XLAA 2ED0A 2DZ9A 2MA3A 4BQLA 1WJSA 2M34A 2HQNA 3AA5X 3CMYA 4K8ZA 1HW2A 4BR2A 1PP7U 2DPPB 4BRGA 3ITHA 3HSEA 2FB7A 4JD2B 3BC8A 4JRKA 4JJNK 1Y8RB 4A6EA 3QPTA 2EQUA 1TW3A 4RAGA 1YJWT 4PUOA 3JYTA 3OBYA 1DT9A 5BRHA 2EWSA 1HPZA 1J0RA 1KXPA 3BPXA 1T3SA 2WFBA 2BW3B 1RRQA 2K40A 4YFXF 4DSKA 2EFWA 1YS7A 3U23A 4FISA 3HYIA 2EWNA 4EJZA 4GNIA 2GWKA 1YG2A 4A5NA 4RCHA 4KN7X 2E5LK 1M30A 3LLRA 5IPAA 3FDYA 2F8TA 1XDSA 2BHZA 1D0YA 2H3JA 3WEEB 2VPRA 2DIQA 4DV5K 4PJNA 1UG1A 2WY7Q 1UHMA 2WV0A 2YHBA 2NOJB 4L18B 2MI6A 1KU2A 3KYCB 2IGOA 1Q7YU 2KMTA 3O1WA 3PO5A 4IKFA 2LK2A 1YCYA 2F4VK 4NBQA 5TGTA 3CP8A 4A3BJ 4RM3A 2MG4A 4NYFA 4CCJA 2JPCA 2HQ5A 1QBJA 2YRDA 4BNCA 1HSJA 1SVOA 4MLHA 2E7XA 2HQXA 2ME6A 3WEEA 2JTEA 4Y3OA 1GCQA 3R2XC 1Y0UA 1PP8F 3CERA 2IG0A 1GLFO 2YXYA 1A6IA 4RMNA 3DXKB 2NWMA 1CKBA 2I5UA 3SJMA 5KYWA 2PZ1A 4HT9A 4OPAA 4LDXA 5AFUA 1TK5A 4I01A 4O5FA 1H9TA 2Q2EB 3M7GA 1IN7A 2DA1A 2L5QA 1S1WA 1UGQB 4E47A 2WC9A 3H0FA 1HBXG 5LJ5d 1J3TA 2DJQA 4OAZA 4M3RA 3TU4K 2DF6A 5FRMA 3F6OA 3NCIA 3CCJA 3GTMJ 1RI9A 2PQ8A 4HOBA 1JO8A 3HOYJ 2V51B 3E1YA 3VQAA 3MXJA 2CGHA 2CYZB 3L1AA 2PEXA 3E3VA 2D5RA 2ZXJA 4P9FA 2Q2EA 5BPLA 2RDPA 3KP5A 2KKZA 1G2BA 1V5GA 3O9UA 4I2QA 4ISGA 5GAN4 1TH7A 4C5EA 3LMMA 1CXQA 3QPHA 4FZZA 3HOZJ 4BC3A 3N5BB 3LSGA 2PG4A 2JWTA 2UWMA 4E7KA 3UNGC 4NCBA 1B9MA 1K8AO 5DD4A 3VDXA 3MCPA 3NMUA 4XTUA 2K7AA 4A3IJ 1L3TA 1N6QA 1NK0A 5AQXA 1ZN2A 4LLLA 1UTIA 3VA0A 2ZMEC 2G7UA 4KHUA 4N0AA 4FJ8A 4LLGF 2ZXHA 3BQZA 2KNBB 1Q86U 4CZEA 1ZSZC 4S0HB 4CEDA 3IH3A 1S5LC 1SV5A 4C3IJ 1JJ2M 3FZKA 3AG2H 2PMZN 3FM5A 3ULQB 1XMQK 5FKMA 4KISA 2KMUA 1S6QA 1Y97A 4NCGA 2ESWA 2HNZA 1C0MA 3CD6I 1BR4A 2BY1A 2WACA 3ZMVA 5M5WJ 3LSKA 1JB0E 3HM8A 4Y91A 2QEXQ 3H3UA 2P5LC 3KEOA 4BUGA 2WAEA 4ESRA 2OTLN 2XSDC 3M6GA 2RREA 1RL2A 3GNGA 2HBPA 4IVNA 1XQHA 2YJFA 3QQAA 3I55N 1A5WA 1JJ2S 2XHIA 3AKZA 4BUPA 3O9RA 1NGNA 1VIEA 2OPSA 2L9VA 4ESBA 4ZTJA 2CP7A 4YOYA 1RDUA 1KZHA 3HTSB 2CH4A 4I7FA 4HVVA 3QOEA 2RGVA 1WEGA 1U78A 3LDQA 4A3KJ 4AIAA 1K73O 2YX4A 3K0LA 4FSSA 3RQIA 1L3VA 3CCVI 3TO9A 1V1CA 2KQWA 2E1MB 2OCEA 1RUOA 4JJDA 2BTFA 2XUBA 2NXNB 3AHUA 3CCJI 2ZJQF 1ETKA 4KB0A 4R5PA 1UJ0A 3ISPA 3CMEN 1KG6A 4DTXA 3MEXA 1KG2A 1STZA 4Z8AA 2JW4A 4LH5A 1FW6A 1WJCA 4RW4A 2PUKB 4FJXA 1XG7A 4BVOA 2DK3A 5GAN2 4DV1K 4OPJA 3HKZA 1DIZA 4A3MJ 3K58A 3FKIJ 1Y64A 1HNZK 1S9EA 2YUPA 3TCJA 2YHXA 1OCTC 2EV5A 2HSPA 4MTEA 1ZXOA 2Y0SA 1H3HA 4HQEA 2MWOA 2FRWA 2F9WA 1IN8A 5I2MA 5GANj 5E3OA 1XB4A 3F72A 4FW2A 1WUAA 4CZHA 2KRHA 1ZGJA 1QVFP 5ERIA 4PJOC 4L5EA 2NZTA 4LITA 4FXDA 1K8KB 4DTUA 5ADXA 5FLMJ 3ZQ7A 4XEIA 3JRAA 2P4TA 1ZKGA 1SSHA 1XC5A 3I53A 3KUFA 2DTUA 2E4LA 2OTJI 1KSPA 3CD6Q 2LFBA 2FPEA 2K9GA 1D4XA 3KK1A 2D0BA 3VUZA 3FJPA 3DBRB 1OR7C 5DYMA 2R7WA 4AMCA 1MWMA 2MLKA 1KRPA 2DM1A 1RABB 1V54H 4M77G 4MMLA 4H0OA 5GAOl 4ID5A 1S72Q 1HKCA 2IGKA 2H6BA 3WU0A 3OYHA 2ASPA 4XM3A 2HHTA 1EO1A 3CCMT 3CBMA 3QZ5B 2MW8A 2CV2A 2PJPA 4EFHA 4CI6A 2FRHA 4HSTA 3RNJA 3EPZA 4E9FA 2XHKA 2P9PB 4UC4A 4C1NK 4H4MA 2K2MA 1QE1A 4E9GA 3ZSYA 2G8UA 5LJ3e 3B6AA 4PDKA 2DD4A 5E18F 3OW2A 1RDBA 3CCVQ 2KRSA 3VTIA 3CCST 4G1QA 2F96A 3WQUA 5SZTA 2FOKA 2O2OA 5J1YA 3C94A 1AWOA 3CWAA 4A3DJ 5HROA 2K3YA 1GT0C 2P9PA 1WGSA 4DR1K 5CVUA 1NK5A 1PKTA 5GAOm 2SRCA 5JVGL 4QWQA 4ZN1A 1YJWN 1AWWA 1BI4B 2OZSA 2CT4A 3AO3A 4O8UA 2FF3B 2LDMA 3TQNA 4J6WA 1YVNA 3GPLA 1VQ5I 4J9GA 3QNNA 3BTLA 3JRIA 2A37A 4Y4RA 4ON0A 3DTIA 1XNRK 1J5OA 2I7NA 5GJWB 1B4AA 2JZYA 4UVAA 4M3BA 3T8TA 4AILC 1DKGD 4YOTA 2YDLA 3G6EI 2FG0A 3MMVA 3PL8A 4LG3A 1UHSA 4M77D 4IUVA 1VYVA 4E0DA 1D3YA 4C8OA 4B9XA 4C0GA 1ORKA 5FLXE 3EHQA 4F7UF 3F9MA 1ASVA 1A6QA 3CPWM 3OIQA 1CQTA 1Z05A 2QI2A 1OCCH 3CO7C 1OH8A 1KEAA 1IW7F 4OGEA 4QS7A 1OISA 3TSWA 5E1ZB 5HVQC 4C92C 3KZZA 4DR7K 2OTJQ 3SV4A 4KB1A 1KQ9A 5A2QE 2ZMEA 4DEXA 4CHOA 2CQXA 3M0UA 1KQSP 3RR8A 4F2SA 5LJ5g 4BWMA 4I0BA 1ZSZA 5HNHA 1PG5B 3G1MA 4L6V5 1GV2A 1YP5A 1BU1A 1MD0A 2MOXA 2VIXA 1BW5A 3MKZA 3U2RA 1ETXA 4BL0B 3KHYA 2P4WA 3BCAA 4WWCA 1DUXC 3SZTA 5D3GA 1RTHA 5GMKh 3NQOA 2QUFA 4GFBA 3E01A 2IVNA 3NGPA 4HF0A 1JUPA 4DV7K 1QVFA 3BG7A 4F7UA 3M0SA 4A0XA 2P5VA 3LPTA 2WY8Q 1ZR2A 4RAFA 1VRLA 1CZBA 1K9MC 3CCET 2UXNA 2EIMH 1ASUA 3IG1A 3LPUA 3E6MA 3OL3A 2F4OB 2M9UA 1N6AA 3GXOA 3FK7A 3RYPA 2CP0A 4CF9A 2DMTA 3DRRA 2X51A 3FIFA 4KHNA 3S1RJ 2EYQA 2EGCA 3VESA 1SVLA 2LJ1A 5FB2A 4BRLA 2MD0A 1O9SA 5D6FA 2KZVA 1JCEA 4ELYC 2E2IJ 2X1DA 1VQ5Q 3HPGA 1WJEA 4HSRA 1KG3A 1B8IB 4KIGA 1Z25A 1O4XA 5IOYA 1SKSA 2KZGA 2JNGA 1Q82R 2YU3A 2XICA 2D8JA 1W36C 2DK8A 1KJWA 3G6EQ 1FYMA 2Q36A 4JRPA 2EZLA 2JRMA 2FA5A 2F5DA 1NLOC 4FJJA 2CT3A 5AIPA 5KTQA 1NM1A 4WQ4C 2HHQA 1BR1A 1B8IA 3DYAA 3BZCA 3D0SA 4FVUA 4IHVA 4ANJA 4CZZA 1UGSB 4KMFA 5AQZA 3HOTA 4FWQA 1JLAA 2BDPA 1OI1A 3F8CA 2IGIA 2E64A 4GVMA 3HUGA 2JOYA 1LW0A 3U1DA 3RMAA 3W6KB 3CWSA 2F2WA 3CJ7A 4FJ5A 2ESHA 3E2UA 3TSPA 1X58A 3P4IA 1R23A 3KFVA 3GG4A 3OOUA 2HBMA 2QSGX 3PGGA 2ETHA 5CR2A 3CDLA 3O9SA 4A2AA 3V4IA 1N32K 1WVRA 4RG2A 2FNPA 1A04A 2K3BA 4ZGJB 3LDNA 3W6VA 3OB9A 2BZXA 1SL1A 2HD0A 4AYBN 2NLXA 3LDOA 4KMUX 4CHNA 1WHGA 1YJNT 3S3NA 4B44A 2VOPA 4DKWA 1TQIA 4UNOA 3LA3A 4QPOA 4DSEA 4M7AE 5AQFA 2NNWA 1JBMA 3SHWA 2OA8A 3CCUT 5TKYA 4B3SK 2FD5A 4BXXJ 5D8KB 3QAHA 4O0JA 1JRIA 2MYSA 3LZJA 4J8OA 5CYMA 3DLHA 1KQSA 5M5XJ 4MFDA 2KBTA 1UJ8A 3NF7A 1V5EA 1XHZA 1GXIE 1SHGA 3PO4A 1UUEA 1BA0A 2A1SA 4O8KA 1LE8B 1IGQA 1IV0A 3GEZA 5M1QA 2GXAA 4JKBA 3VEOA 3OTOK 2DTRA 5DM7L 3SK3A 2CS7A 3DKXA 3U4LA 3AO2A 2GNCA 5C24A 2BV6A 4C8QG 2KYMA 1Y8QB 1LEBA 1HNWK 3TABA 3AAQA 3MK6A 1H88C 2FC0A 2R7ZJ 4FYYB 4F91B 1P7IA 1WOQA 5IY5H 1XSXA 3OS5A 1TW2A 3HRMA 4M41A 3HT3A 3G7ZA 3X28B 4QCLA 1RI0A 3WTTC 2G3RA 1XOVA 2HR3A 1Z26A 2V7FA 2JM9A 1T8IA 4BDYA 3CEYA 2LP5A 1PU6A 2L7FP 5F1XA 1TL3A 3SQ4A 2EGAA 3BJ6A 4MNUA 4PFPA 2Z16A 4FOEA 2V7ZA 1FC3A 3AVMA 3CCMN 2K3FA 1N36K 2ZPGB 2CP5A 2E1ZA 4ZDOA 2E1NA 2OJED 3JCMh 2ZAEA 3HK2A 2HSTA 2Y2ZA 1IRZA 3CMAT 3HL2A 1SQKA 4WCEL 3D4VA 5L23A 5DS9A 4YPHA 3ABKH 1LEAA 2OQGA 3H08A 1E7OA 2M0YA 2K5IA 5KQ8A 1MMAA 4LXCA 3KIOA 1FYNA 3AVBA 4ZDPA 1XUPO 3THYA 5J6XA 4C92A 1I94K 3CCSN 2KL4A 1RADB 4A4EA 4G7OF 3BE3A 3UWNA 5HRPA 2XASA 4I0AA 2DL3A 3DLRA 1WSUA 3PFIA 2RHKA 2EKHA 2Q1NA 4C8QD 1WKMA 5CK9A 4M9ZA 1JI8A 2G8IA 2QSHX 4QS8A 4FWOA 5AQWA 4L5IA 4YFNF 1MUZA 1GXQA 3CJ1A 2Y1IA 3C6TA 3C3WA 4ZYDA 1AOYA 2GFAA 4KGZB 3I58A 4QVZA 2R92J 5L3GA 2PMUA 5AQQA 4E7LA 5F27A 3HSRA 1S6LA 4A4KA 4H03B 1QCOA 3M8EA 5GINA 1IKVA 4UNFA 4EMHA 4MLOA 2X78A 3JCMX 2F5VA 3O5BA 2YHTA 5FLVA 1SKRA 3QEIA 2CJJA 5C25A 4C3JJ 3F8FA 1D0XA 3DB3A 3GFLA 1W4SA 3JRCA 2KRFA 3ZETB 2ADUA 3BR1A 1MBHA 4DEYA 1R6RA 4CC2A 3OS0A 4YOWA 1EV7A 2CMPA 4FK4A 4WXHA 3ASKA 1BU6O 4RLFA 1DU0A 4M7DE 3I5UA 1ETWA 1DGKN 3TARA 3O5ZA 2BH1A 4C9YA 1WWXA 4AHVA 4EV0A 2ENMA 3RMQA 4Z4IA 3M0PA 4IQ4A 2WWYA 2PVGB 2RN8A 2GOMA 2QENA 5FFXA 2HBKA 4E1NA 4AUXA 2BVMA 1D5VA 1VIFA 1HNXK 1KQ2A 4YOVA 4YG2F 1GV5A 1W36D 3SLCA 2E5NA 1TL1A 1RAFB 3DPLC 3ZQIA 2JS0A 4ATOA 3DU5A 4P5NA 1BIBA 3RUXA 4A3FJ 4BQQA 5B66C 4AHSA 4WQ4A 4BYYA 2A6HF 4BDZA 4KHYA 1N8RC 1SFXA 4AFQC 1M3BA 1WQ7A 1RTIA 4C8NA 1C6VA 1QO0D 3D2EA 4FYWB 1UECA 4CEZA 4U0WA 3THVA 2AZSA 2WAFA 4HTLA 3R8EA 3CCEN 5KYYB 2UXBK 2P0WA 2FQ4A 4F55A 1Y1VJ 1S5JA 1HYOA 3BR3A 5CQEA 2FBXA 2DFUA 2HB5A 4A3EJ 1KC8U 1D1AA 3GMEA 4IX7A 2O31A 1W5TA 2B4JA 1OCOH 4LMYA 1NEGA 5HP1A 2Z99A 4JDSA 4LK0F 3JCMQ 3T19A 1TWBA 1V3FA 5GPAA 3M53A 1HXDA 1IXCA 1W0UA 3CTAA 4GV9A 2QZ8A 4A59A 5KYYA 4EVIA 2AKKA 5BRFA 3ULEB 1VYTA 2JUGA 1PD0A 2WTEA 3L2CA 2DTOA 2K9SA 1IN6A 2P9LB 2LQWA 5GAMe 1GLLO 1MIJA 3FHZA 1VQ9Q 3WUHA 5I42A 1DU6A 3OHRA 2OCCH 1MMDA 1IV6A 3VQPA 3F0CA 1S1NA 1X4PA 3OY9A 4KBOA 2YNIA 3MN6A 2EQKA 1OKJA 2HOSA 5HLHA 1BI3A 3CPWP 2X1EA 4EA5A 2HHWA 2E2HJ 4J19A 4CYCB 1QHAA 3FXJA 3ULEA 2LKSA 3ENOA 3VQDA 3S3MA 3HBLA 4BVPA 2P9LA 1RDAA 1MNMC 1S1VA 5B8HA 5E1WA 2VBXA 3AARA 5F0CA 2ZD1A 3JB9H 5LBQA 1W7PD 5C2FA 3SQ2A 2ZPEB 3EZ5A 2H94A 3MHXA 1U5SA 1J09A 4EEFG 1XQSC 4GXOA 5I22A 1RKWA 3I56A 4CYCA 1GLNA 2VKVA 3C2GA 2Y75A 3H36A 3TP3A 1T39A 4DQ8A 4H4OA 5E3LA 4TV7A 2D5VA 4E7JA 3VQ4A 5ICEA 3V9SA 1BO5O 1NGHA 3WXLA 1QZEA 4EQQA 3ATVA 2YG8A 2L3RA 1U6GA 4AM7A 4IHTA 1R8OB 1H9GA 2DJZA 3QINA 2P81A 5H2FC 1QMCA 3I8BA 1YJNN 4PFZA 5HNFA 3VEWA 5I3UA 1HKBA 2XO7A 3TSQA 1G2HA 1I1JA 2LSNA 1GBQA 4XKVA 1WHKA 4NC6A 1ON2A 2LCLA 2ECCA 1Q18A 3CCUN 3KTQA 3EUAA 4RW9A 1TWGJ 4CF1A 1J7KA 2YSRA 1YITT 2WB1A 2A08A 3BEXA 1YN8A 2DA5A 2KXCA 2M5WA 3ERMA 2QDYB 1NJWA 1U5TB 1R77A 2RB6A 4DV3K 1G99A 2GV9A 4AU7A 1R9TJ 1OU9A 3ZCOA 3EUHC 3AVHA 3T7ZA 2QWRA 3MEAA 3MJXA 2AIRB 2CUZA 1GCPA 5GAOn 1JKRC 1WPKA 2K9LA 1YXQA 1E3HA 3LSMA 2R7YA 2ZPBB 2YHYA 2PI0A 3EG0A 4ELTA 3CCQA 3G4SA 4R1HA 2K86A 5GPCA 4HBLA 2QASA 5LHHA 3GFJA 1NPRA 4XRMA 4YORA 4OB2B 4CCLA 3VEYA 1RI7A 4CE9A 4NQWB 4J2AA 3GE1A 3TEEA 4LF5K 1YT3A 1F9NA 1JL2A 4ESJA 3RDVA 3QDRB 4UXNA 1LCUA 1Z3YA 1IGUA 1FYKA 1UB4A 4B3RK 1XNIA 1VA7A 1IG8A 2EZKA 2OD5A 4DBRA 3H6EA 4XLEA 3IDHA 4CC3A 2XY6A 3FB9A 4CZGA 2NYXA 2YU9J 3CETA 3T5XA 3NMZC 3G71A 4NQWA 4YOXA 4D9JA 3HKZN 1VQ6T 4M78E 1YOVB 4BGAA 2VKEA 2GGRA 3JCMf 2P9KA 2QKKA 1B7TA 1AEYA 3CMAN 1S9HA 3I56I 5CKDA 3DEUA 1UMQA 2QK0A 5IHIA 1M2OA 2LVMA 2M45A 5D5UB 2IGMA 3GZNB 3MKLA 2G6FX 1LOJA 2PQWA 4G6QA 4BJTA 1R5GA 1N9RA 2OJ2A 1GOCA 3T1YK 4OX9K 4JX6A 4HDUA 3LYIA 3O4NA 4M6YA 1KQ0A 1KK7A 4CW7B 1GUUA 5EG0A 3GBQA 1SD7A 1RDCA 1VQ8I 2FUG2 1QQMA 1LNXA 5EGOA 1ZELA 1O3QA 1RACB 5DY9A 2BOLA 2W6LA 4BRPA 3FZHA 2LRDA 4FASD 1QVGM 2X9DA 3ULRB 4UV9A 4IO9L 1XS9A 1V4RA 3MVPA 3DF8A 2OZMA 1T6SA 2QA4A 1TV6A 3OYFA 1WJQA 1NG9A 1XHXA 2HHXA 3ML6A 3QWYA 4Z88A 1FP2A 1ZSGA 2HQRA 3KEQA 5L8RE 4JZ4A 3CXCS 2TCTA 4I2OA 4A93J 4JKDA 2CP2A 4DSFA 2VBZA 1Q81U 4CGIA 3G4SI 2W42A 1XGOA 4RAZA 1AWJA 3K4NA 1HW5A 4M75E 2JA7J 1ATRA 3L2QA 3K4JA 2B63J 3GBGA 3BTIA 1UE9A 3HL8A 4HVJA 2V9VA 1SD4A 5JFRA 2M4KA 4OWRB 2DJIA 1T44A 1ODDA 3RMDA 2P4RA 3GUDA 3ZXSA 4BRKA 5JVTA 1JXBA 4YIFA 3OSGA 1LB2A 2RJFA 1WGXA 1ESVA 1H8AC 2PNIA 3JAMO 2HKOA 1BK2A 2R5YB 2E6LA 3VYTB 1MWKA 1D9DA 3IKMA 2CP3A 4KA4A 5D8LB 3G71I 4RBOA 1EH7A 1CF7B 2QCOA 2JN0A 1LJOA 5IOZA 3THKA 4IDKA 2H3EB 3JAMZ 4FLYA 1T3LA 2VBYA 1MW7A 2X9HA 1OQYA 1UA1A 3A2KA 4LB6B 3BQYA 2NOIA 4X9CA 4FU6A 4M77F 2O7OA 4LY7A 5AZIB 3K9TA 3HFOA 4EJWA 2XKPA 1D3BB 2R5YA 4CEFA 2F2VA 2AA4A 1ZBXA 1H3ZA 5J1UA 3HM5A 4QVDA 4EA4A 2A3SA 2M87A 1CF7A 1EIFA 3P5JA 4PFOA 4GLKA 2VQHA 3H5NA 4HSBA 1SUQA 1B72A 3A8GB 1OPCA 2COWA 2XGEA 3M8JA 3T8RA 1NGCA 1MUDA 3EE9A 2PMHA 3KK2A 2A69F 2P7VB 4UB8C 5AZIA 3F8MA 4M77B 5J26A 4RA2A 1S22A 1VQLI 1VQ8Q 3FEOA 1OYWA 3E97A 1FPQA 1D3BA 2NUBA 3LP2A 2UZKA 4B48A 4J5YA 4ZYAA 1NBWA 2K85A 1FN7A 2GOXB 1WXBA 5EDNA 5DDGA 2O4GA 1TQMA 1L0OC 2NRAC 1NM7A 5GANg 2P9NA 5AJ3K 2XRNA 3MZ8A 1DEJA 2A36A 2QA4I 1YQMA 4EVVA 1TP4A 4JX5A 1FX7A 3DU6A 4M77A 3DMJA 3KK7A 2O8DA 3RPUD 4HHTA 1EWQA 1J9IA 1K9MO 4EJOA 1BBYA 3FHGA 2F5KA 4U7DA 3B6CA 3P8DA 4H0XB 3UIQA 2O8XA 2VXFA 4YPRA 1ZGAA 1RT4A 3CIPA 1O3RA 4V19S 3RCOA 4FLUA 3JRFA 2JWLA 4DFJA 3CJTB 2ZQBA 3VS7A 2DT5A 3A1PA 3EUHA 1G3WA 5TISC 1UJYA 1M8MA 2FZKB 2FPFA 4KH4A 3PT9A 5KYXB 3A01B 4CZJA 4M42A 2MBFA 1V4TA 2H8WA 3C65A 2W1OA 1RDWX 5GJVB 3VGMA 2P8TA 4M7XA 1OX9A 4UB6C 4A69C 3L0QA 3R4KA 3T0YA 4CZMA 4XRSG 2XB0X 2D0NA 4G7HF 4B3XA 2KIMA 1FJLA 1W4MA 1XC3A 2CDTA 1KD1R 4U88A 3AAFA 1X4OA 1ABOA 5HS8A 3LAMA 1BA5A 3LL3A 3ENHA 2A07F 1EF4A 4J6XA 2XRLA 2A28A 3J7AO 5LEJA 1ZRFA 4C2UA 4MQVA 5KYXA 3WVEB 1P4WA 3B73A 1EWRA 4EW0A 4DGWB 4M7AC 3M8QA 3ZSXA 2CZ0B 4AWXB 2GWJA 2G7HA 2NVTJ 4MEXF 4EJUA 4LH4A 3IRRA 2FQ3A 4DOZA 3FXRA 3RJPA 3PJRA 4P5OA 3OYLA 3O8MA 2X6YA 3M55A 3IUCA 4RLQA 4NUBA 1KIKA 3JCMb 3QPSA 2SEMA 3RSNA 3CCRN 4ILHA 2G8WA 3S1QJ 2KLAA 1YITN 2F5CA 4OMYA 4AHRA 4GCVA 4A54A 4J9CA 4N56A 1P92A 1SD5A 3CBOA 3ZX2A 3PFYA 3FC3A 3DJCA 1OLTA 3BLYA 1VQLQ 5HLFA 3TAGA 2IVPA 2NOBA 4UUSB 3C18A 2P9SA 4U7BA 1S72T 2KW4A 3ZSQA 2CGJA 3I56T 3MO8A 2DLPA 2DZCA 3I0SA 1VQ4N 3DBHB 3VYRB 1HU0A 5EX5A 4B1ZA 2XIGA 4UUTA 2ZCWA 1KVAA 1PNJA 1UB9A 2QA4Q 2VJ4A 4PIIA 2W40A 4G8XA 3WTXC 3IRQA 1NJIU 3PQKA 1I39A 2RV8A 1NKEA 2MAMA 3K7AJ 2JJ9A 3FZFA 3QBYA 4C3HJ 3BG3A 2CZ6B 2EBPA 3RYRA 3MP8A 2P5GA 3EYZA 4UUSA 2IS4A 1XSVA 4FIBA 1BOTO 2ZZDA 2DMQA 1S7OA 4O5BA 4RB3C 1AKHB 4S04A 1B59A 3BR6A 2KIFA 2FEIA 2GCXA 1X6OA 3CQ8A 1R0BG 1QZZA 2K3XA 3H41A 1HRHA 1GBRA 2JT1A 4BR9A 2M3AA 4LG0B 4OIOF 4ZYGA 5IT9E 4BR0A 2ESNA 2DTHA 4LF6K 1NG7A 3ATUA 4YIRX 4M3TA 4Q0BA 4CFAA 5D4RA 2QKLB 3IHOA 1VQ6N 2TDXA 1BI1A 2BY0A 2IS6A 4BRFA 5KK1A 1O7FA 4FX4A 3AV9A 1OFCX 1W2BM 1T33A 1QGPA 1T0FC 3QPLA 3DLLF 1EXQA 2ZNYA 4MZMA 4HXJA 1LDDA 3DKWA 2V79A 1AWCA 3OYIA 2YR2A 4PJJA 2X6XA 2EJFA 4DR5K 3CCQT 2A05A 1VQ7I 1T3VA 3J81O 3TR8A 4HRIA 2XF5A 2C06A 2LZ6B 3OH6A 2YG9A 2UU9K 4GRIA 2L2OA 2QWMA 3QOPA 4RB0A 3P8BB 1UG0A 3RKQA 3L42A 2KRNA 2KISA 2DQLA 3J81Z 2K4JA 1RBTA 3RR6A 1C0FA 3L3VA 4LF4K 1UDLA 1I0CA 4LD6A 3WE2A 1SKUB 4PNOA 1W2BS 4ILJA 1M90C 3D45A 5IYDJ 4O3MA 2L0KA 2VKNA 4DA4A 1SEUA 1IKXA 3K70D 2Q8KA 3G71T 1D5YA 3F21A 3LM2A 4WX9A 5CAIA 4W5TA 4AIDA 1F4KA 1KONA 2RQRA 2IAJA 2DAQA 5DPKA 3E9LA 3CP2A 5GAN6 4BJ5C 2HKQB 1ITYA 3LH0A 5GAN7 2VXZA 5D6XA 1FOKA 2IEKA 3LM9A 5HDKA 4A0ZA 5DK5A 4LB5A 1RTJA 1Z67A 2K4YA 4M7DC 5AQSA 3WGGA 2XAFA 1D5AA 4Y15A 2HZYA 3HOXJ 5ICCA 4XU3A 2O4XA 2B0LA 1AWXA 1A5JA 1B34B 1M3HA 4Q5VA 3BZ6A 5AQIA 3V7RA 2ASOA 2IS1A 5LJWA 4ZTFA 5LJ3d 5JHUA 1ZUYA 2ATCB 1DPUA 1T05A 3BDDA 4BR4A 3J81K 2JQ7A 2VC1A 3H92A 4Z4FA 2ZXWH 3CUQB 4OKKA 1K73R 3CJCA 4PQUA 1CLQA 3U9DA 3LALA 5IXFA 3QB0A 4XH1A 1I27A 5FU7C 4XLFA 1QQJA 3R0AA 1B34A 4IHWA 2R7OA 4LF8K 4XU2A 3ENBA 4WE1A 4D5FA 2KPMA 2XPVA 1YW8A 4I2PA 4K8XA 1VSLA 5JVGF 3LWIA 4UVCA 1Z9CA 3LSJA 1K83J 3U3YA 4C8QB 2VQCA 1J59A 1W0HA 2DFEA 4AVPA 2PMZA 1MPGA 4A12A 1VQ7Q 4BROA 1J6ZA 2GAUA 3FZVA 1R5HA 2VQGA 2P5KA 4UV8A 1NU0A 3HSFA 4QQ6A 1RAEB 1XJWB 2KSSA 2RQTA 1SS6A 4MQ3A 1XMOK 5LFAA 1HA8A 3IH7A 3JCMW 1JLFA 4JK1X 2JHJA 5D6YA 4LN2A 4D1QA 1LWYA 1MSEC 1GVDA 4OFAA 2LQ8A 4BY9C 3NAEA 2QEXN 1HQEA 4DTOA 2XVCA 3VQBA 2NRRA 2VB6A 2CV0A 2OTLA 5F64A 5AQYA 2HS5A 5FDLA 4OFEA 4FLVA 5BN9A 1SHFA 3EG1A 4CJ5A 4E7IA 4CF8A 3I55A 1NOZA 1YIJT 3O4WA 1Y0NA 5J4VA 3ZLJA 3NVMA 1N3AA 1K0XA 2VYTA 3UKUB 2EKOA 2XK0A 2FX0A 4M7AD 2WUSA 4LFBK 2HTJA 2E65A 3GBTA 1N8RO 5C15A 4DFPA 2QKBA 5GIOA 1OQKA 2ACJA 1ERDA 2LD5A 1YVUA 5KYUA 1WJFA 2RJEA 2NNYA 3EY1A 4EATA 1RESA 2YHWA 3VF2A 5CKEA 4YELA 4BHPA 4CK3A 3VQ9A 2O8CB 1E3OC 3UKUA 2E3IA 3HHGA 4XTYA 3M5RA 4M3XA 1P59A 4CJFA 5JLWA 1MU2A 4KN4X 5F0HA 4KYWA 3CMEA 3H3ZA 3FBIB 3GOIA 3CF2A 3F73A 2OC6A 5I11A 1R4MB 1U2WA 3W2VA 4BS9A 2KDSA 2FMYA 2HZTA 3TANA 2P6TA 4GYGA 1C0UA 3BTCA 4IWVA 3OV8A 1JLCA 1XMXA 2EQRA 3V1QA 5HY6A 1R71A 2X4JA 3WTZA 3AT1B 3NFCA 3E5XA 4FM4B 4E9HA 2M4GA 2F4MB 3ZMTA 4J9IA 4E89A 3NNQA 4Y1CA 4AIKA 5C4JJ 1PDNC 3VGKA 4UY8O 3JB9I 3QJ6A 4GMJB 2HW3A 2O0YA 3W2AA 4X1VA 4H0VB 5GMKi 2XPWA 1ONVA 3KETA 3FMSA 5AN4A 4B3AA 4M9SA 2LY9A 3LDPA 2KGTA 3KLNA 3KD1E 3WTYC 3VRYA 2HI3A 3CM5A 3EE8A 4QSHA 3OIPA 1K6OA 2OYQA 4CK2A 3WU1B 3P31A 4KTQA 1J5EK 4PUSA 1Z6TA 3CD6N 2M8EA 3PX4A 2PLYA 4M3YA 3FXLA 1G3SA 1UEBA 4I76A 1T0FA 2D8HA 4CHQA 1FTZA 3X20B 2Z9OA 3RWUA 1SFKA 2CG4A 1WFXA 3QFPA 1WIEA 2LY1A 4DOWA 3CC4Q 2OTLI 3TOBA 1Q82U 3EUKL 5LGUA 1SAXA 3CFOA 1S72N 5E41A 1M1KU 2A5YB 4UQGA 1EH8A 2E2PA 4HKEA 3H6ZA 3LQQA 4DTJA 2W48A 4BDPA 4OKJA 2FO0A 1KO9A 3VW4A 4J9DA 3CC2I 4QOZB 3VENA 4OIQF 2CGLA 1KYZA 2V1DA 5FD6A 1U6ZA 1TXQA 1LCKA 2O8EA 3H0HA 3Q9VA 1LFPA 4CJ4A 3M4YA 2O9SA 1DLOA 1QZYA 1V5FA 2DQRA 1WHHA 3O9TA 4D8KA 3CCVN 2BGGA 1S7AA 1XGMA 2DYBA 3JCUC 2YI1A 3RI4A 5JS2A 2VWJA 1WSFA 3U3GA 3GTQJ 1T08B 1LAWA 3KD5E 4M78C 2XAUA 2H27A 4D0PA 1VQNQ 3VGLA 3D1NI 4II3A 4BRQA 2BZYA 5KNLA 4D7NA 3CMEI 1YJWA 3THXA 4A6DA 3THWB 3EH1A 2JRTA 4E4HA 4EJTA 4EMKC 5EOYA 2EFPA 1YTYA 3P38A 4RW7A 2NUPB 4V2SA 3DXMB 4CSWA 1VSDA 4M7DA 3QUIA 3CM6A 4KREA 3FSPA 1MV3A 4HNVA 4B09A 2HPIA 5FWCA 4XRFA 3ZYYX 5FU7B 1U4BA 4RCBA 1W97L 4LDUA 1HW1A 5F6FA 3THWA 3SD4A 4OLAA 2EA4A 2V8JA 3REBB 1HKQA 2GXBA 2EJRA 2FJ1A 4CGZA 2B9SA 1RBRA 4LGWA 3IUOA 4FJHA 2MH9A 1QS4A 1VQMQ 3AAPA 3NF6A 4GGGA 3X24B 1YWOA 5I9EB 5DM7F 2H8RA 1OPKA 3H5AA 4FYVB 2CFXA 1KG4A 1V76A 2OTJN 1MH4A 3IS9A 3KLGA 2LMDA 4M71A 3EQLF 3GZ5A 3QEWA 3E6CC 1XI1A 4A57A 4I98B 1ON1A 5TRDA 2LNVA 2K79A 2VJIA 2OTLQ 1NGJA 1HJOA 3ZT3A 4M75C 4NHJA 3IRXA 4FCYA 5EEGA 4BXFA 1AHJB 4NC8A 1YQAA 1XC9A 4L59A 3CC2Q 4LFUA 4UHTA 5ADXH 1SMYF 1BJZA 5J2PA 1ITGA 1E4GT 4H8KA 5EJCA 4ISEA 4NXNK 1YX3A 3JRZA 1IH7A 3S32A 4BH9A 4W97A 2OX7A 3RIRA 3WT0A 4L9JA 1SEMA 3OW2M 3UA6A 1JKHA 1NKBA 4L0ZB 3HRGA 4LSNA 2DMUA 1Y71A 1T03A 1MJAA 2MWPA 3I5RA 2DETA 3H5RA 4BY7J 4XTVA 4DSIA 1WCMJ 1F1BB 2ZSHB 1RAGB 3T9NA 3OQ5A 4FJ9A 4KNYA 3MWMA 1RGIA 4DU1A 2PAVA 3CMEQ 4IUUA 4FX0A 4FWPA 3OR2C 3URGA 1YJWI 1Q7YR 4DV6K 2K9NA 1VFCA 4H5TA 5GANe 2UUCK 3FXUA 4B23A 1WAJA 4ITVA 4CZKA 4V2GA 2VKHA 1GLBG 4L9VA 2Y30A 3K1MA 1BJAA 5FLXZ 2XDPA 4GV6A 2EIJH 3G6EN 2UXCK 2JS2A 4JKHA 3PM1A 1VQ9T 1B3QA 1M9SA 2KT0A 4JOMA 3DP7A 5KAFC 3QBWA 5CVJA 1DP3A 5LL6S 2M8GX 2DIGA 3EFSA 3JRDA 3WVDB 4X1EA 2DMOA 5AQVA 3VETA 5A2QZ 4AI5A 1M3AA 3IFRA 4DFMA 3DKYA 2HNDA 2PTKA 1SFOJ 2R7XA 1VSJA 5LJ3h 2RK2A 3CVTA 3LAJA 3PIOL 3I0WA 1YHQQ 4HYEA 1WI7A 1UZCA 5A0LA 3ZQHA 1YIJN 2QWOA 4IXAA 2GTOA 3EHRA 4LD0A 4CIEA 4BACA 3D6RA 3QYEA 2KIQA 2A68F 3H0GJ 1YTUA 4FZXC 2DU9A 5H6RA 5FU6C 3PIPL 2BE2A 1K9AA 1B07A 1XX5A 3P8HA 3TW7A 3OYJA 1JXMA 5DCFA 3ZPLA 2Q97A 4LDYA 3ABUA 4K25A 4BJ6C 5D4SA 5A0GA 1O7LA 4FSVA 4ZJZA 4YRVA 3HYFA 3TSZA 4OMPA 4JI7K 2XG8D 1VQPQ 3N97A 4AYBA 1RPWA 2F9TA 2EVRA 2X35A 4G94A 1Q7YC 3MP1A 3NFAA 1QVFM 1WSIA 3VSLA 2LOOA 3CCYA 4U0YA 1EETA 5FLXK 2CUDA 1JXEA 1FEXA 1Q86R 2J6KA 5DCMB 3ERED 3CYMA 5M1NA 2YHAA 3ASMA 3A1YA 3M4OJ 4B08A 2W0ZA 3IMXA 4R79A 3MAJA 2E6ZA 2IDOA 5A2QK 2R0QC 2P0KA 3GDQA 5C12A 2FU4A 1IN5A 8ATCB 3LA2A 1YJWQ 2EIKH 4EMGA 4OFHA 3I55T 3HOWJ 3KE2A 1QVFS 4N47A 4ENKA 1YFHA 3W3DA 2JHNA 1K78B 3NRVA 4BI4A 3M8PA 2M1BA 2EPFA 4M78A 4NS5A 3DCFA 4D7MA 2QW9A 1L3SA 1N9SA 1VYUA 1YO5C 2DILA 4CJ3A 3TP0A 1BB9A 1L3LA 3L9FA 3CQTA 3K57A 3Q1JA 1FIPA 2K4BA 2Q1ZB 2W10A 4WCIA 2TRTA 4CECA 3MWPA 5GAMd 2YRVA 4DF8A 1I1SA 4PJMA 2E60A 2DA9A 4CJ7A 4QS9A 1TOVA 2ASMA 3DLEA 1K78A 4XQ3A 1XMKA 5K1YA 1MGQA 1IG9A 1XTAA 4EP5A 1M1GA 3WE3A 1F36A 5HLTA 4HCKA 3M58A 4CICA 2KVQG 4KITB 2EQMA 4F8RA 3EGXB 2D1XA 3ECHA 3Q7BA 1KHCA 1BBZA 5E20A 1WQ2A 2IAIA 4OMFB 2AQFA 1K4SA 1BR2A 3EEQA 2NRWA 2Q2RA 2O8KA 3FMQA 2QVOA 4B3OA 2OF7A 3PNTA 1NYGA 3VQQA 2GTDA 4GW6A 4ETSA 4L3QA 2CQ7A 1MBEA 1SRMA 3GYHX 1IZ6A 2C0TA 3CCSA 4X0GA 2FZCB 5KN8A 3HG9A 2F48A 3QO3A 3BF1A 3EGXA 1IXDA 2KTQA 2X4WA 2R4GA 2M51A 4KHPK 2JJ7A 2FVUA 2O8FB 1TAQA 2DL7A 2FL7A 3M0TA 4A4FA 1I3QJ 1QHHD 3PMIA 2IIRA 1D8KA 1VQKT 2GBQA 4E7SA 1WBDA 1Y39A 4HW0A 2F6CA 3HIFA 2JG6A 3G1LA 4XAXB 3ME9A 3D2FA 2QQSA 4M75D 3HSBA 3E5UA 2VGMA 5AQUA 2DL8A 1KQSM 2F5FA 3ZSOA 2BXZA 4Y17A 4ZNXA 5EXWA 2J5PA 2RNAA 3NEUA 2O8FA 5B1BH 3TQ7P 4I6ZA 1PJRA 3SMPA 1WJBA 2XHBA 2CU7A 3QWLA 4KKOA 2YUOA 2ETJA 2KT8A 2PFBA 3M56A 4A3GJ 3NH0A 4JRQA 1GRIA 3RPQA 4GV3A 5C0MA 3BTJA 3QMLA 2VBWA 1GLDG 4FW1A 3MCAB 2IC3A 1VHXA 2CSIA 4H4KC 4RTVA 1F21A 1T7PA 2JA8J 4PHTX 2H1KA 1VNDA 1TUGB 3QDKA 1XSDA 5HL7L 3BR5A 2GQIA 1KQJA 2R7QA 3OMCA 3EG9B 2LSOA 2HQAA 4C0DB 3MEUA 3SMSA 2FRYA 4ELZC 2QBYB 2ZO4A 3X26B 4ZDLA 1MZBA 2R5ZB 3ZT1A 3H3VK 2HSEB 4FK2A 1S9GA 2D45A 3R6SA 3CCMI 1OCPA 3PE0A 4EHTA 1UCRA 2DA7A 3G3ZA 2XY7A 4LFAK 5MLCQ 2A41A 4JD2A 1YI2Q 3HEFA 1N39A 4RUGA 2DY4A 3C6AA 3TTCA 5HLIA 3ZSWA 3FF5A 3H3NO 5FU6B 2WOMA 4KI4A 3TU5A 2GA1A 2W03A 2Z1JA 2QBYA 2V6CA 2Y48A 3FR0A 1PD1A 2BW3A 3EYIA 2BIVA 3CCEA 5E3NA 2R5ZA 4CHZA 4OOIA 1FKOA 3CCSI 5J1EA 5J2MA 2RHIA 1PSEA 4DSLA 1M90O 3DFGA 2LRQA 4H5WA 2DO3A 4EZ9A 2HXIA 4DTRA 4II2A 2ZFWA 3CPFA 3WNHA 2KT1A 4RGSA 1QZ6A 3ZMUA 1WHJA 2D0AA 3NPFA 2LMJA 1RETA 3S6WA 3H45C 4RTZA 1UFMA 3CQXA 4RCCA 2FBVA 4C8KA 4I02A 3VERA 5BR9A 3BY7A 4C0ZA 3AL0B 4OVAA 3CBPA 2NAZA 4L5JA 2HNYA 4KFCA 2R7SA 1RC9A 4NL2A 1VQ9N 1G6NA 4P55A 3HZJA 4HVWA 5J3BA 2MLGA 1X9JA 4IO9F 3R60A 3DXKA 2XDVA 3LP3A 1BC8C 4KIBA 4RM2A 4IHXA 1OV3A 3FXQA 1XG1A 2LR8A 3DAWA 2K5LA 3MZHA 3F70A 3DLAA 2VL8A 4BAYA 4N76A 3S2DJ 3W0LA 4H5RA 3KWIA 2FBIA 3M54A 2DXCA 5LJ3f 4NB5A 2LCSA 4EIAA 1HQUA 1ZBHA 4A61A 2VYPA 1HYSA 2COZA 4HEA2 2ZJ2A 5CVRA 4RWTA 3VS0A 2OANA 1YYVA 1VSEA 5JI6A 5BREA 4KH0B 5DM6L 4LF7K 3CF5L 2HHVA 2Y31A 4GO1A 1VUBA 3JRHA 3QU3A 3TTFA 4DFKA 5C4XJ 2EINH 2PU9B 2J05A 3V8JA 3CCMQ 3L2ZA 2E6MA 3EGDB 3SJHA 1TLHB 4F92B 2XRIA 4BC2A 3WXKA 3SZGA 5HK0A 2ID6A 2LTOA 2JWKA 3ZT2A 1YJNA 1ZQ1A 3PMTA 3AO4A 4IQJA 1JL1A 3OW2P 1T98A 2L9SA 3F10A 1N5YA 1M1EB 4AI4A 1QKXA 1FJGK 1VSHA 1IB8A 3I8DA 1U06A 4E1MA 2MC4A 4MIMA 3KLFA 4EW4A 4NOYA 5BPDA 1J75A 3CCEI 1FK9A 3CCUA 2RH2A 2WSCE 5EVZA 3VV0A 4Y52J 4X64K 4OIPF 2XD0A 2KQRA 3MKYB 4PLIA 3KYLA 2AKLA 1BGXT 2PFUA 1KU3A 4ICLA 3SI6A 3DPUA 2DXBA 4BXUA 3HHTB 2HBJA 3VOEA 2GUIA 1FBSA 2QQ8A 3U9ZA 3VODA 3FFIA 3QHSA 3CCLT 3LCNA 2L4AA 3OJUA 4FWLA 1IGNA 3V8LA 2JA6J 3F6VA 5GAMg 3MX5A 1KAZA 4X9DA 3ALYA 3AVFA 3KP6A 3FM3A 4NDLA 4OMZA 5LJVA 2NOZA 1E0EA 3AGRA 1NJYA 2BZ8A 3RQ4A 1CSKA 3K0SA 3V9UA 4XKWA 1Z1DA 3SUNA 2JM8A 3QBXA 2X6SA 3KNTA 2XGXA 3DLLL 3CXCP 3VS6A 2VXDA 2F5TX 4DQPA 1QSYA 1XWLA 3T1BA 1EX4A 4A2BA 3E19A 5D5VB 2GWRA 2LX9A 2WC2A 4M77E 3ZR8X 1PSFA 2DEQA 4P1WA 4CCNA 2IVMA 4YIIA 2J4RA 3M0RA 4XN3A 3QIOA 5KI6A 5HK3A 3CMAA 2WV1A 2YNGA 5IP7J 2V8IA 2NYSA 2P7CB 3OSSC 2DYRH 4NXMK 3J7ZI 2NS0A 2XC7A 1U2VB 2NOEA 5GMKj 3DLKA 5DTDA 3W2WA 3OYNA 4H0YB 3TMOA 3G1JA 3JRGA 4MEYF 1WZ2A 3SEZA 1MMSA 2O01E 3Q5FA 3J8AA 4KH5A 5CVVA 4E7ZA 2DMPA 2O61A 3GF5A 1TK8A 5HRSA 1R00A 3I4MJ 1FNNA 2QGGA 1YJNI 4AT1B 1R22A 3SBGA 4CJWA 4DR3K 2P84A 1LJ9A 4B21A 4PKHA 1VQKN 3CCEQ 2VC0A 3X25B 1GOBA 4JS5A 3CCUI 2OV7A 3HRTA 1T8EA 3MX2A 1KD1U 5B5EC 2EA2A 3LDLA 3LP1A 1OCRH 1F5TA 1K8KA 4DR2K 3QWXX 2I10A 2P9IB 2KIUA 4J2EA 1RAAB 3VB2A 1YS6A 3PNVA 1DP7P 2BEOA 4AIJA 4HUFA 3F5TA 4KUMA 1JE8A 4ZYEA 5AR0A 2DW4A 5C3EJ 4GLMA 3O3HA 1WLPB 2LNBA 5GAOq 2DA6A 2ZBKA 1Q9XA 4JI4K 3OSVA 4RGRA 4L8RB 1IC8A 2Z1IA 1NHAA 5LJ5j 1VF9A 3LANA 4C8MA 2XAQA 1ZUKA 5GAOp 3D7SB 2R5AA 4L5GA 4FLTA 2YS9A 5AQLA 3MEEA 2WBNA 2QG9B 3E9GA 4J9BA 2P9IA 3O4QA 4I6MB 3TOAA 2VODA 3TO7A 1QRYA 4B1RA 2MPXC 2K3PA 5K7FA 4CIGA 4O6JA 1EA3A 1IBKK 3VUBA 3CCJQ 1RT5A 1Y07A 4D5CA 3QODA 1VSFA 4DR4K 3P9CA 2HPMA 4IXCA 5LEKA 5LY3A 2Z2SB 4B8CA 4BRHA 1HSQA 2V8KA 4KRTA 4CD3A 4DBQA 3LAKA 2RQPA 1H8KA 1YW9A 3SUPA 1FMVA 2E4HA 2E6NA 4I6MA 2MC3A 1K9MR 2OAZA 2HNHA 4CZLA 1MV0B 2BE5F 5IT3A 1O1WA 3GIBA 4MGRA 3TBIA 3I9V2 2OAUA 1NK2P 2XAJA 3CMAI 4F7UG 2B86A 4JS4A 2KP6A 1BI4A 2X74A 2WA0A 3C95A 3NTIA 4B1YB 4BQZA 3AVIA 1FSHA 2X4YA 1K0SA 1W70A 3MEDA 3J7AY 2H3GX 3C6UA 2A6EF 1RT1A 3FMRA 2QWPA 1WFWA 3V6DA 1XTDA 2EHGA 1R59O 4B3TK 1YJNQ 4PL8A 2XAGA 4A3CJ 2KRMA 4KGVB 2JZ2A 4XK4A 1U1TA 1BIUA 3CXCA 3FHNA 5FFZA 2LF7A 5AYFA 4ELVA 1WA7A 3HKSA 1G3TA 1CGPA 1W5SA 3CCUQ 3P9KA 1VQ8N 4YHHK 1LPQA 4BHCA 1R5ID 3A8HB 2X6OA 4JI6K 4PY5A 5J39A 2KFZA 1X3ZB 4D8DA 2XU8A 2DN0A 1WH7A 3CPWS 1I50J 2OFKA 5CKTA 1X6BA 2LY2A 4JI8K 2RQWA 1ZLKA 4N4GA 2EH3A 3HOSA 1R1UA 1K8AU 4C23A 1T56A 4EGYA 3SYTA 1TWAJ 2JA2A 2C0OA 4D6WA 1TTHB 3VS4A 3KKSA 5H20A 3IWFA 4CCOA 2F69A 1OEBA 2DXUA 3NBPA 1BIAA 1IDYA 5KCHA 2O4IA 4A5MA 2BHYA 4CCMA 2LKPA 4XNFA 3V42A 2E2QA 2XDDA 4BQAA 4CGJA 5GTIC 2ELJA 4M63C 4PWDA 3OA6A 4PJOG 1K4US 2FSNA 3OMYA 2LC4A 2NVUB 2AXLA 5J1RA 1PCXA 1VQOT 3EKUA 4QKUA 2NS8A 3VQ7A 2CREA 2X4XA 3EYYA 2V75A 3EG2A 4W5NA 4B9TA 3OWTA 1SL0A 3EO3A 2MSYA 3WODF 2VLAA 4ENJA 4BRDA 4A5BA 2RKHA 2C0IA 5DMRA 1E2XA 1DGWY 3DTEA 2E8AA 3QDFA 1SVMA 4CRIA 4GY2B 1XNQK 1KU7A 3PNYA 2BY2A 5LJ5h 3AG4H 5CKBA 2NUZA 3ABMH 5K14A 8AT1B 3ABTA 1SF9A 1SPKA 2HVQA 1ZHFA 4E1JA 4OU0A 5HS7A 2IPQX 1S6PA 3GTOJ 3CCRA 1RKTA 4CHPA 1POGA 5K7ZA 1YITA 2K2VA 2HL5C 3DEEA 3L7WA 4Q48A 4IEIA 2IW5A 1K73U 4YY3K 1QA6A 3OR1C 3OYKA 1T2KA 2HQHA 4QW2A 4DS5A 1BOBA 4CGHA 1S1TA 4AHCA 2QM1A 4L0YB 4HV6A 1VQLN 2L7KA 2DKGA 1BI2A 3CC4T 3CUOA 3M0QA 1CZAN 3PX0A 2L3QA 2R3SA 3LFUA 3CCLN 2EPDA 3K5OA 4GVEA 1Z77A 4MFEA 4PL6A 1VQ4A 4JKGB 4J00A 4AM6A 3ZFJA 1N75A 3GOXA 2ITGA 4GYIA 1YRNB 2A42A 4PJOD