4BDZA

Pfv intasome with inhibitor xz-90
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
total genus 104
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bdzA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bdzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bdzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdzA03
4E7JA 4CJ4A 1UA1A 3O8VA 3QIIA 4DTOA 1EETA 2KFZA 3ZSRA 1UAXA 1B9FA 5IAYA 1F21A 4N4IA 4N76A 4HUEA 2YRVA 3G0ZA 5FDLA 3THVA 1SL0A 4C5IA 4BDZA 1EX4A 3VQQA 4KREA 2Y1IA 1ASWA 1ZBUA 4KHSA 1RT7A 3WNFA 2P5OA 4DU1A 3OYEA 1EXQA 2WONA 2PQWA 4NS5A 3F9KA 3VQ9A 1DTQA 4JS4A 1WLJA 1NK9A 4KHYA 3EZ5A 2HVHA 3ALYA 1BISA 2D9TA 4AHSA 2EQMA 1X1PA 4OGEA 4CRIA 3HJFA 4RW6A 1VSIA 4B9XA 3AO2A 2XY8A 4YNQA 1R0AA 4FJ8A 4CHYA 3QEXA 2LRQA 3LDSA 5HRSA 4KPYA 2HHQA 4IUQA 4CJFA 3HPHA 5C42A 4CF1A 2R5MA 1RT4A 5CY4A 4AHCA 5KRTA 3PX0A 2ZD1A 5T7BA 1NJZA 2BE2A 3OYBA 3NBPA 3DLGA 4CEQA 3PO5A 4DSJA 3ZT0A 3LWLA 2DIGA 5CZ2A 3LZIA 4FK4A 2QK9A 3LLRA 1TK8A 4N41A 2RF2A 3D0PA 4OKKA 1KVCA 4KTZA 2GBZA 2VG6A 3AVCA 4N56A 3S9HA 4BDPA 2X6NA 4Z4FA 2LSNA 4C8NA 4CF0A 3TAEA 3DLEA 1TKTA 3ISNC 4KO0A 1QTMA 3KIOA 4IURA 4NCBA 4MFBA 2LDMA 1JKHA 3HO1A 4CJKA 3V81A 2X4XA 4N4GA 4LH5A 2OPQA 3LAKA 4FJXA 4N47A 3PMIA 1JLGA 2HNDA 1RNHA 3PFSA 4CESA 5I42A 3ZT4A 1MU2A 3QNNA 2RPIA 3M9QA 1RBVA 2O4GA 4E1MA 4NZGA 5J39A 4JLHA 2JLEA 3LP1A 5FROA 5C0MA 1EP4A 2P51A 4C8MA 1S1WA 4CECA 3L2QA 3HPOA 3NAEA 1S6PA 4Z4GA 2O4XB 2LVMA 3E9GA 1LWFA 4CEOA 4ID1A 3OYNA 3IRXA 1VSMA 4I2PA 1C1BA 5JS2A 3L8BA 1FKPA 4BD3A 4ICLA 2CKKA 3RMAA 4GY5A 2RKIA 1OI1A 1C0MA 3TWHA 4HCCA 2KZMA 4FJGA 3L2WA 2NLUA 1NJYA 3LP2A 3MP1A 2G8HA 3AA5X 2OPSA 4B8AB 5HP1A 3SNNA 4PUOA 4DQQA 4CGGA 3OYHA 3OMGA 3ZT3A 1WGSA 2QXFA 1L3VA 3ZSOA 1FXXA 4O5BA 4LSNA 4FJMA 1ZBLA 3VA0A 1NKCA 3SYZA 3OYFA 4IUPA 2E6MA 3FFIA 3TAFA 1BQMA 3SUNA 3NNQA 1S5JA 4Z4CA 4DLGA 4ZTFA 2E4LA 4E89A 2X4WA 3K59A 1UWBA 1UA0A 1JL2A 3ZSWA 1QSYA 3OYDA 3T3FA 4OKEA 4DMNA 4DTJA 4B9MA 2FBYA 3AA4A 3LAMA 4CE9A 2KW4A 4A4FA 3NTHA 4PLIA 3AV9A 4BDYA 3MO8A 1VSJA 2NUBA 1WJQA 4FW1A 3HK2A 1KLMA 3ZSZA 3MEAA 1JLEA 1RTHA 1BCMA 4UC4A 1YT3A 3CEYA 3ME9A 2G3RA 1WNSA 1Z25A 4HCZA 3LX7A 4CFAA 3PNWC 4CIEA 4CF2A 3SV3A 3KJVA 1RILA 2HVIA 3B6PA 1WSIA 3AVHA 3TARA 3DB4A 3SD4A 3UWNA 5D6WA 1WAFA 3NFAA 2GF7A 4CIGA 1T8EA 4FJKA 2G8IA 3H08A 3V9XA 2ATQA 3VQDA 3S3NA 4A4HA 4OKJA 3QIOA 1WSEA 1A5WA 4CJUA 3MEVA 1VRTA 1D9DA 4N4HA 3RRGA 4FL6A 4IFYA 4ZTJA 3O3GA 4CK2A 3VQEA 1FKOA 4FLZA 4DFPA 1L5UA 1S1XA 4QQDA 2X35A 3DRSA 2HHSA 1T03A 3OYGA 4OVLA 4II1A 4AH9A 2PY5A 4HUFA 1RBRA 4KB0A 4M3XA 2RJCA 2RJEA 4Z4HA 4EP4A 3FC3A 3RRHA 4DQRA 3V4IA 4RW8A 5FRNA 2DAQA 1IO2A 2A1SA 2DFEA 3NGYA 4KFBA 4CJEA 2OA8A 4OVAA 2RHYA 3MEUA 1NOYA 3U3GA 3BDPA 3HL8A 4KV8A 2RJFA 3OMCA 1WJSA 3UT1A 5KE2A 4K8ZA 3MXJA 2IS3A 3P8HA 5J1EA 3KLFA 3QEVA 3PMTA 4JRPA 3MEEA 4I9LA 4PLLA 2R7YA 1XNIA 3OQ5A 4F4KA 3MP8A 2G8UA 2B4JA 4B08A 2G8KA 4F3TA 2IOCA 2YV0X 1YTAA 2L89A 2OPPA 2E6NA 3NF6A 4F2RA 4Z0UA 4B9UA 2X6SA 4O44A 4CHQA 3P83D 2A1RA 2WOMA 3M8PA 2YNIA 1HNIA 3AVAA 3RTVA 3PO4A 3PV8A 5D3GA 1SL2A 2VWKA 4E7KA 2YKNA 2K3YA 3LGFA 3RWUA 3P1GA 4N5SA 3L3VA 3V6DA 1JXBA 3NF9A 1SKSA 4PY5A 1O1WA 1J54A 1XHXA 4AHTA 1N5YA 1QS4A 4CEEA 3UIQA 3AVNA 1HNVA 1W9HA 4OLAA 4E0DA 3SPYA 3SUOA 1RDBA 2DFFA 5J2NA 3OY9A 3OS2A 4CJRA 3AO4A 5HBMA 1KTQA 4E7LA 4GVMA 4IUVA 2GFAA 1TL1A 2X78A 3L2UA 4FM1A 3DB3A 4B9LA 4J2BA 4L8RB 3FEOA 4DS5A 1BHLA 4KI6A 1LAWA 4FLVA 2AJQA 2QQRA 2D0CA 5J2MA 3SQ2A 2RHZA 3T19A 1TK5A 3DRPA 4H4OA 3SUQA 3S3OA 3AA2A 1N27A 4DQIA 2E6LA 1WSFA 5DK5A 2PZSA 1I3AA 1RBSA 3DMJA 2W42A 3CFPA 4M3WA 1ZBIA 4Q0BA 1CLQA 3GOXA 2EKOA 2OPRA 1BIZA 1U4BA 1HYZA 3OB9A 1IKYA 1JL1A 4DG1A 3O3FA 3NCIA 5KCHA 3DLHA 4FJ9A 3NGZA 4X34A 3SQ4A 4CJLA 3KD5E 3C4SA 4FJLA 1ZBFA 4DLEA 1RTJA 3JSMA 3QLHA 1IKXA 5HRNA 5SZTA 3I0SA 3B6OA 3KK2A 3U6FA 3SCXA 3V1OA 4C8OA 4FLXA 2WACA 4M45A 3AVKA 1NKEA 1JLCA 1LWCA 4IUUA 1BL3A 3C95A 4E19A 3OJSA 1QE1A 1WJRA 3SZ2A 3DOKA 4A4GA 4EP5A 3O4NA 3AVJA 4M3ZA 2VWJA 1IH7A 4IKFA 3KLGA 2RI2A 3ZEHA 4L59A 3TAGA 2M16A 2VG7A 3LH0A 3NTKA 3HYFA 3LP3A 4QQGA 1HQEA 4PA1A 1MHNA 3V9ZA 1IG9A 4BACA 1C0TA 3TAPA 4KTQA 4FK2A 3Q1JA 1TGOA 4CJSA 1U45A 2EQKA 3OYCA 3BDLA 1J53A 1RDDA 1Y97A 3HPGA 2Q3SA 2P0KA 3VQPA 3OYAA 2EHGA 5KH6A 2RHXA 4C5GA 4B9WA 3HT3A 5C24A 3K2PA 4O0IA 1NK7A 1X9MA 4CK3A 3AVLA 1X9SA 1B9DA 4ELVA 4PL6A 1CXQA 4YFUA 1QHTA 2F5KA 3V9WA 2DIQA 1D5AA 4I9QA 4NCAA 3HP9A 4CEAA 4FXDA 1TKXA 2XDPA 1NJWA 1RBUA 2O4XA 4DU3A 4K8XA 3AVFA 3VQCA 1Q9YA 1SKWA 4RG8A 5CYMA 2GFUA 1KCFA 2XHBA 1JLAA 5J2QA 3PUFA 4FJHA 2YNFA 3NGIA 3RMCA 3QINA 1C1AA 3KKRA 2PYLA 1SUQA 4TSXA 3DLBA 4CCHA 1RBTA 2FHDA 2MWOA 1TL3A 3MEGA 3NH2A 3MXMA 4Y1DA 4M41A 3AO5A 4C8LA 4M3RA 4OLBA 4F2SA 3RMBA 3QESA 4M3YA 3META 3F73A 3EAEA 5HRRA 5KRSA 4HCBA 1B92A 1HQUA 1TVRA 5M9OA 2Z1JA 1YVUA 4KKOA 2R57A 3ZCMA 1VSKA 1C0UA 3NH1A 2F8SA 5JS1A 1TKZA 5KGWA 5CZ1A 3LYIA 4B9SA 1T7PA 3PY8A 3IAYA 1S1VA 4H8KA 3TR8A 3DI6A 2JTFA 3FLGA 3A2FA 3DRRA 2B6AA 4CJ3A 4KHNA 1ZBHA 1NOZA 3HM9A 3OYLA 4Q5VA 3LPTA 2BGGA 3MEDA 5CIUA 4CF8A 1BQNA 4CHPA 3V9SA 3SV4A 1RT1A 2XO7A 4DSEA 3DLRA 4DTSA 2XY7A 5HROA 4DSKA 2RJDA 1XWLA 3CM6A 5J26A 3LZJA 3MP6A 3IG1A 3LANA 5K14A 4BWMA 1D8YA 1NK0A 4QQ6A 4DFMA 4FJ5A 3M8RA 2IGIA 2X74A 4CEBA 4H4MA 4FLWA 4AILC 4KI4A 4CEZA 4FVMA 1NK5A 4FW2A 5DMRA 1DTTA 2XY5A 2EQJA 2K3XA 4HVJA 4G1QA 3NDKA 4CGHA 1U48A 1RDCA 1N6QA 5E41A 1G15A 2B8AA 4DTPA 4EZ6A 3MEWA 3SPZA 4OPKA 1LWEA 1LW2A 4RW4A 3H6ZA 1HYVA 3OVNA 2RHIA 4NYNA 4DTXA 3AO3A 2GUIA 1L3UA 3LP0A 2BUDA 5C6SA 3OS0A 3EY1A 1TAUA 5SWMA 4JRQA 1NJXA 3NTIA 1ITGA 1SL1A 1SV5A 4JS5A 4AHVA 1NK6A 2Z1GA 4LD0A 1T05A 1VK0A 5I3UA 3V1RA 2F96A 1YTUA 3E01A 3CQ8A 3ULDA 2HQXA 3TAQA 4QAGA 1KLNA 1C1CA 1VRUA 3L2RA 2IC3A 3CFOA 3WNHA 4CFCA 2ETJA 1S6QA 2FC0A 1C6VA 3EYZA 4M42A 2MWPA 1GOBA 3BGRA 3LWMA 2JGUA 3SQ0A 3QERA 4DFKA 3RMDA 3VQ8A 1BIUA 2YHAA 4GW6A 4ELTA 3SQ1A 2HHXA 3I8DA 3AVIA 3ZSQA 4EZ9A 4FU6A 1W0HA 5C25A 4BE2A 4F3OA 2G8FA 1KFDA 1VSDA 1NK4A 3U3YA 1S9GA 3WNEA 1K6YA 3I0RA 4KHWA 4FJNA 4CHZA 1I39A 2IDOA 2HHUA 1BI4A 4CJ5A 3K5MA 5HLFA 2DFHA 4KTWA 4FM0A 3LPUA 4CK1A 4AHUA 1ZYQA 3ZT1A 2HB5A 5D6XA 1RCHA 2PYJA 5J2PA 4DTRA 3QEIA 4FZXC 1S1TA 3NHGA 4KB1A 3K57A 3VA3A 4CJPA 4J2EA 4QCLA 2O4IA 4XIUA 1LAVA 3IS9A 3T1AA 1H3ZA 4IBNA 2IAJA 3P5JA 2G8WA 2E5QA 2HHVA 2GV9A 1KHCA 1CXUA 1TV6A 1L3SA 3JYTA 3C6TA 1GOAA 2KTQA 3NF7A 3MECA 2DY4A 2JZ2A 3CM5A 4RW7A 4CHOA 4KRFA 2ITGA 3VQAA 4DFJA 4HTUA 2RI5A 4DTMA 4O0JA 4KHQA 5D6YA 4Z02A 1JLBA 2RO0A 1RTIA 3MAQA 4NCGA 1TAQA 3QNOA 3PX6A 4B9VA 1HYSA 1JLFA 1RT5A 3OS1A 3O4QA 4HUGA 3OYJA 2Z1IA 2B5JA 3HVTA 3M8SA 4B9TA 4W5RA 3F70A 1HRHA 2KFNA 4DSFA 4CJTA 2P5GA 4FM2A 4B8CA 4DQSA 3DM2A 1J5OA 4LH4A 3TANA 4CFBA 4CGJA 3KKSA 1JXEA 3D45A 2FBXA 3KLIA 4CFDA 2M1HA 1RT6A 1VSLA 1A5VA 1BI4B 2YHBA 3DLMA 3AVMA 3VQ7A 4DF4A 1KFSA 2OZSA 1HPZA 3VQ6A 1KRPA 1XHZA 4B3OA 4C8KA 2RHUA 4RG2A 3AO1A 4CGIA 4FCYA 3OYKA 2DTUA 2X4YA 2BANA 3K58A 4QW2A 3ZSYA 3HP6A 3AA3A 1X9WA 3AVBA 3ZSXA 2QKBA 1U47A 1ASVA 2G8VA 1FK9A 4A4EA 3OYMA 4CIFA 1VSHA 3QO9A 3QBYA 3H8ZA 4LSLA 1ASUA 4OJRA 1Q8IA 4IG0A 4W5OA 3KLEA 4DF8A 4I2QA 1RTDA 1QQCA 4DSIA 4QVZA 3ZT2A 4LY7A 2D5RA 1L3TA 3VN5A 1GOCA 3KUFA 3HSTB 4AHRA 1JLQA 1U49A 1Z26A 1D9FA 3NE6A 4FK0A 4CGDA 3HVRA 3ASMA 4O55A 1DLOA 3VQ5A 3K5LA 1A5XA 2ZE2A 5HRPA 1G5VA 2D0AA 3OYIA 4LD6A 1REVA 3C94A 4CJVA 4UQGA 4J2DA 1Q9XA 2HW3A 3DLKA 5KTQA 2P1JA 3RR7A 5IN1A 3K5OA 3QJ6A 4C5HA 4C5EA 4E7IA 2RN2A 1WSJA 3ZSVA 2OYQA 2Z1HA 3TABA 3V9UA 4BE0A 1LW0A 4PQUA 1VSFA 3DYAA 4DTUA 1HJRA 2HHTA 1WN7A 4J2AA 2R5AA 3L42A 1NK8A 4W5QA 2Y1JA 2HHWA 4CHNA 3S6WA 4Z4EA 1J9AA 3P8DA 4FLUA 4BWJA 4M3TA 3SJJA 4FLTA 1OZ3A 1RI0A 2BKDN 1S1UA 3LGLA 5KE3A 2I5JA 5KGXA 4OGCA 3KK3A 1HMVA 3KK1A 3QEWA 1RDAA 3PX4A 4BE1A 4CF9A 4I7FA 3L2VA 1WAJA 3C6UA 2EFIA 2XY6A 2ZQBA 2LCCA 2BIVA 4CJWA 4Q5WA 4PWDA 3QIPA 1CZ9A 3KLHA 2HNYA 4IG3A 2YKMA 1LV5A 3ITHA 3M8QA 3QKJA 2FBVA 1QSLA 2OZMA 3KD1E 2YNHA 3WNGA 3MXIA 1KVBA 3ASKA 3AVGA 4NYFA 3OA6A 1RT3A 2HNZA 4DTNA 4WE1A 3QEPA 3TI0A 3FDRA 4DQPA 4F8RA 2QQSA 4FJ7A 2KZZA 2KQ2A 3OJUA 1SKRA 4QOZB 4KHUA 3VQBA 3DOLA 1TKDA 3TAMA 1CZBA 4IFVA 4FZZA 1SSFA 3E9FA 1S9EA 4DS4A 3SUPA 3O3HA 1RT2A 3LALA 1BGXT 4O4GA 4FJIA 4Z4IA 2HMIA 2HQEA 1TK0A 5EU7A 3G10A 4FYDA 2VG5A 1BCOA 1VSEA 4DU4A 4DSLA 4IUTA 2F8TA 5KCOA 4R5PA 4Y1CA 3QETA 4FJJA 1IKVA 1EKEA 2D0BA 3L3UA 4FLYA 2YNGA 2XRIA 4M3UA 4CGFA 1IKWA 4ID5A 4W5NA 2R58A 3CFRA 4CEFA 3HXMA 4B9NA 4E7HA 5CYQA 4ELUA 3S3MA 1U04A 1WSHA 2L8DA 4CERA 3NF8A 4OPJA 4DWIA 2FBTA 4E3SA 2VYTA 4ZHRA 2IG0A 2M0OA 4IDKA 4GMJB 3SI6A 4CJQA 4EDUA 4HHTA 4W5TA 2EQUA 1KSPA 1OZ2A 5KI6A 1KVAA 4E1NA 2RI3A 3CYMA 4RW9A 1OYXA 1XC9A 2QKKA 3V1QA 1WSGA 4FZYA 5FRMA 1UOCA 4KAZA 2BDPA 1QSSA 4MQ3A 4CEDA 3K5NA 2LTOA 1XI1A 3CG7A 3KTQA 3RR8A 2XK0A 3NH0A 3VQ4A 2L3RA 2EX3A 1NKBA
chains in the Genus database with same CATH superfamily
4OMYA 1JHFA 3KK7A 2CP0A 4CC7A 2DL7A 1F21A 4B1VA 1N3AA 4I98B 2DPUA 3LL7A 2NUTA 2DA4A 4AMCA 2D9TA 3WG9A 4DR5K 1VQ5T 5K7HA 2HHQA 3FXMA 1JT6A 5E20A 1UHFA 2HS5A 4HQEA 3TMOA 2F5CA 2AIRB 1UGQB 1QKWA 5BOXA 2QK9A 2FYKA 3NVMA 3S9HA 1UDLA 2XPVA 1IGUA 5DCMB 4CF0A 5GJWB 2QENA 4BHBA 2HAXA 2W04A 5IPAA 1EV7A 4JX5A 2W03A 1WQ7A 2JN6A 4CW7B 1FOWA 1QZZA 2DW4A 4LK1F 3SXYA 1JKRC 3CQZJ 3OW2A 2C06A 2Q2EA 5C0YA 4XKCA 1C1BA 1JKOC 5F0HA 3DXMA 1NBWA 5M1NA 1X1BA 3QRFF 4FJGA 2A28A 1YFNA 3OMYA 4JDSA 1FMVA 1TTHB 3T1HK 1X75C 3OYFA 3VERA 4NUBA 1YJNA 1BQMA 1Z7UA 2E4LA 1UWBA 1Z77A 3C7JA 4DTJA 3G0QA 1VQ7Q 3MO8A 1U5TA 3RKXA 5FLMJ 3CVTA 1BN5A 5HK0A 1KD1R 1R36A 2G3RA 3DPTA 3I64A 4BQNA 2G8IA 1G2HA 2ZFUA 2L01A 3TL4X 3QIOA 4LF4K 3QPLA 5F04A 4ZTJA 2HNHA 3OYGA 3LAJA 3TTCA 2L0KA 4HW0A 2YRCA 4IOCF 1MNEA 3QWYA 3JCMg 3OMCA 2F4IA 3KLFA 4J9HA 3DLAA 2KXCA 1P7MA 1IN8A 3NF6A 2Y9ZA 1XMQK 4CHQA 2O9VA 1FTZA 2RD1A 5DM6L 1Q7YC 4PY5A 1OR7C 5FKNA 3S1MJ 3LM9A 4IFEA 1W9HA 3BR1A 5AQPA 5EX5A 2O88A 5DV5A 2ZWHA 1K83J 2HSTA 5KK1A 3ZR8X 2E6LA 2PZSA 2BHZA 1KC8O 3FMRA 2EKOA 1VHXA 3G6ET 4F17A 1G3YA 4JRIA 5LJ5g 1U2VB 3O80A 2D4WA 5DUIA 3CC2Q 4DLEA 4EIAA 4E2FB 5EG0B 3B6OA 3U6FA 3AVJA 1P90A 2EIKH 1VQ6Q 3QP5A 2XKOC 1X9MA 4C5GA 3K2PA 1WKMA 3HEFA 3CWSA 1CF7B 3V9WA 4FSVA 3O8GA 4FXDA 1S3JA 2R5YB 2Z5UA 1AVZC 4OB0B 2EFNA 4FVUA 4FWSA 3QP6A 2YJEA 4M7AC 4FOIA 5KRSA 3FM5A 4A3JJ 2CP3A 1GBRA 2DI3A 3M0PA 3DWLE 1TKZA 1A04A 3FLGA 1VQ8Q 1UHMA 3RYPA 2M7AA 1KQ1A 2P7CB 4CHPA 5GAOq 3DLRA 1HKBA 3H46O 1QQMA 4V2FA 3S1NJ 4BWMA 4JI6K 4U88A 1B34A 1N3CA 2X74A 1NBEB 1OV3A 1NG9A 3CCYA 5DMRA 4EJWA 2KNBB 3LWHA 2EQJA 4G1QA 4BREA 4F9OA 4A0YA 3O3KA 4ZYAA 3I9QA 1VQON 2DPPB 6PAXA 5ED4A 1PUFA 4PKCC 5EXWA 3K7AJ 3GG4A 3THWA 4BL0B 2QYZA 5EJCA 4IHYA 2F96A 3ULDA 3SEQA 2LBFB 1FEXA 2HKQB 1TQPA 2MWPA 4GW6A 3FR0A 5LFAA 5IYCJ 2MC3A 5C2FA 4FYYB 3MN9A 3WNEA 1JKPC 4CJ5A 9ATCB 2QLZA 3LPUA 3M0QA 3BR3A 3OV8A 2XGDA 3PQJA 1YJ9T 4CJPA 4W1UA 2DL5A 4BGAA 1YVNA 2DL3A 3V7SA 4B23A 2P6SA 3N4MA 3I33A 4OMQA 2A69F 1K8AU 3IQLA 1JLBA 5TKYA 3FM3A 3BG7A 1NNEA 2LC2A 4LH4A 4JX6A 1DKGD 4IHTA 1MBFA 2LJ3A 1X2KA 3SQNA 4AC0A 2YHBA 1XHZA 4B3OA 5LHHA 3T7ZA 3AO1A 4YOXA 4BBRJ 3ZPLA 5D5XB 2VV5A 3K58A 5ICEA 1Q7YU 2LKSA 1H0MA 4EQQA 2COWA 4LSLA 4DF8A 2V1RA 4PJJA 3RVCA 1Y96A 4FWQA 3J8AA 3EGDA 1YE9A 2OYQA 3M07A 2MD5A 2Z1HA 4PQUA 1VSFA 3DPUA 2QTDA 3S2HJ 1H9GA 4O6JA 1WJCA 1J9AA 1VQ6A 4FLTA 4KH6A 2HVSA 5L3CA 2L7MP 2F4OB 4HG2A 4CF9A 2DXTA 2DKGA 2ZMEC 3WTZA 2MK5A 1P2FA 1QNTA 3ULRB 3ZQ7A 3CCQQ 1SVOA 2AA4A 4UNOA 3ASKA 1NYGA 2Y0SN 3OA6A 4DTNA 3TI0A 3M5AA 2QA4N 3KFVA 3CDLA 2HYJA 2HSEB 4A5NA 1Y0MA 3C65A 4G9ZA 3A02A 4ETSA 5DLOA 1M1KU 4YHHK 3QJYA 1W7AA 2L7ZA 4Y1CA 3M7GA 4WK8F 4C2UA 3VOVA 5GAHP 1QQOA 4B9NA 4JJCA 5ICFA 1BKBA 4FYVB 2P9UA 2XICA 4CJQA 3JCUC 5GAMg 2P9LA 5KHDA 1XI1A 3RR8A 3U2RA 3DAWA 1R1VA 4ESFA 2VQLA 2KFZA 4F52A 1HCRA 4IJNA 1E4FT 2E41A 2O8EA 2P5OA 1SSHA 4M78A 3GTPJ 4WQ5A 4EJOA 2EIJH 4EMKC 4ORZA 4I01A 4YNQA 2LRQA 4CF1A 1OULA 3I54A 3GFMA 1Z9CA 4OB3B 4BG9A 3LZIA 2RK1A 2HBKA 1D0XA 1GV5A 1VQ7A 4Z4FA 3I55N 4HVVA 1RLQC 1WJBA 1YJNQ 4FJXA 2EPFA 3LSJA 4IF4A 2O4GA 2ZJQL 2JLEA 3VB2A 3HPOA 1WI7A 4A57A 5DCFA 3GFJA 4NB5A 1WQ2A 1XTDA 3JCMJ 3TWHA 4HCCA 2CQ7A 2CFOA 5KYUA 1ZBLA 4IZZA 3SYZA 4WWCA 4FWRA 5I11A 2OTLQ 4PJOB 2NRHA 3KZIC 4C92G 4B9MA 2OI3A 5H2FC 1YJWI 3TEEA 1BCMA 3KJVA 1IHWA 3TARA 4PSXA 3H08A 3HZJA 1UECA 1J9IA 3OSSC 2COMA 1WSEA 2NVYJ 4IQ4A 1Z7LA 3VQEA 1L5UA 3EO3A 3CCUA 3ZFJA 3BZ6A 4HXJA 4H0TB 3M5RA 3C18A 4GKKK 3FBIB 4RW8A 2JN0A 2A1SA 3BDPA 3U9ZA 1XN7A 2R7UA 3SK3A 1YLFA 2E20A 1B8IA 1DJ7B 3JB9J 2AZSA 3MCAB 2IOCA 2EBIA 3M9AA 1BDGA 5HS7A 4ESRA 2EILH 3Q7BA 1ZG1A 1JXBA 3CWAA 2Y69H 2XVCA 3CCLQ 1I0CA 4J7FA 2AKLA 1KG4A 5C4XJ 3SUOA 2DFFA 3JR9A 5J2NA 3GNFB 5HY6A 4ZDOA 2X78A 5IT9O 2QK0A 4HF1A 1BU1A 3FEOA 4DS5A 3HBTA 4LNPA 2QQRA 1GXQA 2ZJRL 5GAOr 1B4AA 3G1LA 2I8DA 2CP6A 3TBIA 4B1YB 1R5GA 3NCIA 1SFUA 4FJ9A 3CIPA 5E1WA 4FJLA 4FL9A 4J6WA 1YNZA 4C8OA 4C3IJ 3H0GJ 4JKEA 4E19A 3GYHX 2HDDA 3G6EA 4JKBA 1LPQA 4QCLA 1IG9A 3L4QA 2PJRB 5F0FA 5AQFA 1B9DA 3H1VX 2B0LA 2KK4A 2FVUA 1UG0A 3AVFA 2COBA 2HXOA 1QVPA 4RG8A 1KU7A 1IUYA 2XHBA 5J2QA 4TSXA 2ICWG 3ZBDA 4EM1A 2NS0A 1B3QA 5AYFA 4B3TK 1JO8A 2BYVE 1ZUUA 2JMCA 4IOAF 5HRRA 4KKOA 1M3CA 2F8SA 1VQPT 3NWSA 4QWQA 2P81A 1LDKB 3FJ5A 3LYIA 3J7AP 3DRRA 1GUUA 1MWKA 1LQ1A 1P6RA 2ZNYA 3V9SA 2XO7A 4FQGA 1KYZA 1GCQA 2HNIA 3GTQJ 5GAOn 1K9MR 1IBLK 5J4VA 4FLWA 4GLMA 4AI4A 4CICA 3JCMP 5AR0A 1IREB 3UKRA 1IGQA 5E41A 3S15J 3K4KA 4J9EA 2CQQA 3THKA 1LWEA 2GXGA 3S17J 3OH6A 2OANA 1YITN 3LP0A 1D09B 4RTFD 3C2HA 1VQKT 3SAGA 4XTZA 1VK0A 1AU7A 2FU4A 3I3LA 5GPAA 4V2SA 5M5WJ 3F8CA 2FC0A 1XMOK 4AYBN 3BGRA 2JGUA 1M3AA 3QERA 3RPUA 3SQ1A 3VYHB 5KYWB 3TP3A 2V8JA 2VCPA 4A5BA 3G25A 2HHUA 1U1TA 1U9NA 2E36A 1UJYA 1EZZB 2HB5A 5D6XA 1TC3C 2PYJA 2FL7A 2X6XA 1S1TA 3O9SA 5E8GA 4JEPA 3G71Q 2HHVA 3I4NJ 1KHCA 3O4WA 3JYTA 2J6KA 5L3DA 4C92A 2YX6A 2BE5F 2E1MC 4DFJA 5J8CA 2O0YA 3LSTA 2PI0A 3CVSA 2RO0A 3QNOA 1TAQA 1GLFO 1HNWK 3BW1A 4B9TA 4W5RA 3F70A 4AYBA 3AARA 3KP5A 4JX4A 1WVRA 4CBWA 2EK5A 3EFOA 2IXSA 1RT6A 3D2FB 4HX7A 4OINF 2VWBA 2BANA 1K9MC 4QW2A 2EYXA 5GAHJ 1ZAOA 3QO9A 2XC7A 2QYOA 4MTDA 2EA4A 2I0NA 3RSEB 1VQOQ 2JK3A 1D0YA 3VEPA 2ZSIB 3ASMA 2QA4A 1H8KA 4FM4B 3SDZA 3H9QA 4J00A 3V8KA 3TABA 3HDDA 1LVAA 3HC7A 1HJRA 2X6WA 4W5QA 4JYKA 4MHGA 1JKQC 3AL0C 2L4AA 5KGXA 2QQ9A 4BRDA 3I56N 4EV0A 1P92A 3K4BA 3ABMH 4CJWA 2HYGD 3KLHA 1XG7A 4LGWA 2M51A 2XF6A 2E7XA 1KVBA 1YIJQ 5HVQC 1ZK8A 4M9XA 1SKRA 3VQBA 1G3TA 1GT0C 3OHRA 4FZZA 4DS4A 3ENBA 5I21A 5LGTA 1OH7A 3Q5FA 1YHQA 3O3HA 2IGOA 5EU7A 2VG5A 1D1AA 2V52B 3ZLJA 3CC7N 2R58A 3GIBA 1T56A 3O1BA 3HXMA 2LSOA 4XOPA 1L0OC 1ERDA 2QDLA 1YJ9A 3Q3SA 4D5FA 4GMJB 4WXCA 5GAGJ 2VYPA 3BTIA 4FHTA 2EQUA 2YUNA 1TWHJ 3UA7A 4XLNF 3BG9A 3A8YA 2CGHA 3CCSI 5J3BA 4CJ4A 2P9KB 3ZSRA 3THVA 2XU8A 4C5IA 4KHSA 2VOPA 3CCQI 2O7OA 3VQ9A 2COYA 2EWNA 3CTAA 1JJ2M 4RW6A 1SFOJ 2ZBKA 3HPHA 4EFHA 5C42A 4HZFA 1ITYA 3ZQIA 1RAAB 1VQNI 5AQTA 5GANf 4PJOE 2GBZA 1GL5A 1KD1O 2UUBK 4NCBA 4LH5A 3AAQA 4UHTA 1RBVA 3JAMO 4DLGA 4OP0A 1VQ6T 3DLLL 1TL8A 3L2QA 1WZ2A 1GCPA 1LWYA 3CUQC 4CEOA 4ID1A 2RPNA 3MX2A 1NJYA 3CF5F 2OPSA 2W25A 2J5PA 3ZT3A 2RQUA 3ZXSA 2EPDA 5LJ3e 1ZSGA 4C92D 5KN8A 4ZTFA 4XSXF 2X4WA 4PJ0C 3J80K 3OYDA 4O8KA 4OKEA 3AA4A 3W2AA 5GJVB 1VSJA 5H6QA 3IH4A 2DJNA 1SHFA 3WTWC 4UC4A 2ED1A 2M0CA 5FWBA 4AG2C 3LSHA 1WSIA 4AI5A 1T8EA 4RGUA 3EDPA 3CERA 5A2QE 3VQDA 2LR8A 2IS2A 1WH7A 4FL6A 1X01A 4CK2A 4FLZA 4RGXA 4AH9A 2JS2A 3FZFA 2CSIA 1AWXA 2QSHX 3NEUA 2DMTA 3DBHB 4DKWA 2DQRA 3DCFA 2DFUA 1Q1VA 3QXEB 2QGUA 4I9LA 3EN9A 4RUGA 2G8UA 2NLXA 4YORA 4CH7A 3AVAA 5L8RE 2KZGA 5GAN6 5AQVA 4MO4A 3SJMA 1SKSA 1HLVA 5HLTA 3D0SA 1ZN2A 4WFBL 3ERMA 2LNBA 4E7LA 2Q97A 3TOBA 3AG1H 4ESBA 5J2MA 2AQFA 5B8HA 2X1CA 5CYVA 2KRSA 2CZ6B 3KYDB 2NWMA 3HIFA 3O9UA 1R4NB 2BHYA 4TVRA 4IHSA 3I0SA 3BCAA 3A8HB 3GPLA 4FWOA 3E6DA 1WJRA 2M4GA 3BZCA 4EP5A 4LF7K 1FSHA 4XRSA 3V9ZA 2QAZA 4O3MA 4L9TA 3GTJJ 2EQKA 1RDDA 3OYAA 3VKIA 2IJLA 5LJ3d 4A3IJ 3WTUC 4TV7A 1M1KO 4PL6A 4LD5A 3SEMA 2O01E 2DIQA 1UMQA 3IFRA 4CEAA 1TKXA 1KA8A 3BTCA 2O9LA 1M3QA 1Q9YA 1RDWX 3H3VK 3VEYA 3NGIA 1RAGB 2G9WA 2NRTA 3M0UA 4Y33A 3AO5A 2NRRA 3TW6A 2HSPA 3EAEA 1ZLKA 5IOYA 1XNRK 2O9SA 2HTSA 1KAYA 3OW2S 2NUPA 3MEDA 4HPQA 4DSEA 3EG9B 4MZPA 2M0MA 2GCXA 3GNGA 1NK5A 1S6LA 2IAIA 4BC4A 1VQ9Q 1AZGB 3VS3A 3K9TA 1X69A 4XH5A 3S93A 4CVNE 5CVIA 1LFUP 4BXUA 3EY1A 1M2OA 1W7PA 4CYDA 5DD8A 2HZDA 4OMZA 3WEEB 1FW6A 1BM9A 4BY1J 2CZ0B 3DEEA 3RZDJ 1VQKA 4FU6A 1MDUB 1O9SA 1S9GA 2P0WA 4KHWA 3PNYA 1NGEA 3GW2A 1Z91A 3DBRB 2GIVA 5FPEA 2V1DA 4DTRA 3S6IA 2XV4S 1O3SA 3IS9A 4IBNA 3JRDA 4UVAA 2GV9A 1GOAA 4A12A 3UB5A 1MSEC 1HJDA 5LEJA 4XTYA 3ZQLA 2CMPA 4LLLA 1V5EA 4JKCA 1KFZA 1J5OA 4DQSA 2OA4A 3Q0VA 2Y30A 4LXCA 4I0AA 2DT7B 1H9TA 1A35A 1QQIA 2DJZA 1VSLA 5BRFA 1KFSA 1HKSA 4XRSG 2XHKA 2DTUA 3IDHA 2RQQA 3CWTA 4A4EA 4OJRA 3L2ZA 3W0LA 4OIRF 1AEYA 3QOEA 5J47A 3FE1A 3VN5A 3KUFA 4HDUA 4B3AA 2DA6A 1ZRDA 1NGBA 1BA0A 1EIFA 4YDUC 2AK5A 2IPOB 3UKUB 3GBTA 3GTLJ 3GL1A 3B6CA 1HMVA 1Q1HA 3MAJA 3C6UA 1BWFO 2CW8A 5GP9A 1RL2A 3LDLA 1OR7A 2FBVA 1QSLA 3V7RA 3AVGA 1YCSB 3MZ8A 2IIMA 2I2LA 2Q31A 1KG5A 3KEYA 1NM7A 2P9NA 4XRFA 1UAAA 2ZJ2A 2HPIA 2P9UB 2KGTA 4IUTA 3C12A 5GAMh 3CCJN 2ROLA 3I56T 1BBZA 3F3XA 4ELUA 3OIPA 4B3XA 2L8DA 3WTVC 5F0CA 2V1UA 4ZHRA 3RMSA 3H3ZA 4HHTA 4MLEA 2UUCK 3E97A 1JRIA 1LFBA 4B3MK 5T7BA 2IGKA 3F2KA 3HI0A 1NKBA 5KVRA 4C92B 4BHPA 3IRQA 5AT1B 3B6AA 3MN7A 1YBYA 1D3BA 2NUZA 2VGMA 2ZXHA 1B1BA 2YRDA 2R7RA 5DPKA 4NS5A 4H5WA 5EY4A 1FN7A 1N77A 1WLJA 4AHSA 4K2EA 2XAHA 3AO2A 2JVVA 1G59A 1NG6A 2R93J 3FRNA 1YJ9N 4QS8A 3VS2A 5FD5A 4XKVA 4M6XA 1M2VB 4JUVA 3EKSA 3K2AA 5GAOp 2F5EA 3NBPA 3B73A 3TKYA 3K1NA 2RF2A 3HTSB 3JSPA 5BMZA 1QVFS 1JQQA 1Y0NA 2LSNA 2E1CA 3DLEA 1TKTA 3ISNC 3ZMTA 1JKHA 3KWIA 1N8RO 1NJIO 3H5NA 3TW7A 3LW5E 1H3HA 5EDNA 4DR6K 1W4SA 3JRAA 2QWOA 4M3FA 1VQ8I 4Z4GA 2GBQA 1IXSB 1WLPB 2LVMA 3E9GA 1LWFA 4I2PA 5JS2A 1RIOH 3CCRN 3BEXA 5EEGA 3EGXA 2HCKA 1MBGA 3ZX3A 4B8AB 3SNNA 3OMGA 1TWGJ 1N6AA 4H0EA 1MV0B 1APLC 4IUPA 4FASD 1Q82U 1R9TJ 3QYHB 2KW4A 3AV9A 1R5ID 5J6XA 3ABKH 1UFFA 4PFPA 1YITT 1GBQA 2K7AA 4E70A 4LITA 4N9IA 2NUTB 3W2VA 4PJLA 3Q9SA 5D6WA 2XAFA 2ATQA 2KDOA 3HFNA 4CJUA 3O6WA 1IDZA 1FKOA 2X35A 4A61A 2JSCA 1KAXA 1ZQ3P 3V4IA 2E2HJ 1IO2A 3VEVA 4I99C 4A3BJ 3H1QA 3P8HA 4XIDA 3JCMe 1XNIA 4FOEA 4WQ5C 2B4JA 3LH5A 3CCQN 4F3TA 1GLNA 2HU9A 1FOKA 1K73C 4L0YB 5AQJA 4N5SA 2QEXT 2QWMA 2R4GA 1QS4A 3AVNA 2IIRA 1VQNQ 4JYAK 3ER0A 2J06A 2WSFE 1TL1A 1DT9A 1ZRCA 3MN2A 1BHLA 1ACMB 4NC6A 5GTHC 2XRLA 2LQWA 4EM2A 4DQIA 5DK5A 3S8PA 4M3WA 5IHNA 3S2DJ 1JL1A 4DG1A 1JTYA 3CCJA 1LNWA 3IC7A 3QUIA 4RTWA 1BG3A 2BW3B 2FZKB 2KHMA 1ZKGA 1I07A 3C95A 2WAQA 4M3ZA 3M53A 4E7ZA 4FX4A 2P0KA 2DL4A 1KQSM 4Y3OA 3GFIA 4G8XA 1WB9A 1D3YA 2IVMA 1Y56A 2F5KA 2JPBA 4AM3A 3HP9A 2FQ3A 2EQRA 2HMPA 1UG1A 2CZ7B 4K8XA 2TDXA 2DL8A 2V79A 2GFUA 4KT5C 4MQVA 2RQWA 1OEBA 5B1AH 1IXCA 2DO7A 2CGKA 4HNVA 2NRAC 3NH2A 2A05A 3EFRA 3BCBA 2J05A 2R57A 1KC8C 2B86A 3TR8A 2NRXA 3FHNA 2JHJA 2Q1ZB 4KH4A 3CD6Q 3E19A 4NDLA 3WU0A 1Z9QA 4H4MA 3FXLA 3W3DA 4I09A 4HVJA 5BPIA 1Z0XA 2CJJA 2QF7A 2Q2EB 4DEYA 5FB2A 4NYNA 3AO3A 1FIPA 2DERA 4BR4A 1XMXA 3PO2J 1QPIA 3P4IA 2FRWA 4J19A 2A07F 4EIKA 5BPDA 3RYRA 1XGOA 2B9SA 2CUBA 3WNHA 4BC3A 2W85A 3MPUB 2YJFA 2MI6A 3MEXA 4JZ3A 2YHAA 2HHXA 2WAEA 4GBQA 4OU0A 2F2VA 2HOEA 5HLGA 4JI5K 4M78C 4OMLA 2X1EA 4J2EA 2GXAA 1M90U 3FFKB 3L7WA 3R3LA 2KTQA 1FY7A 2CW0F 2GA2A 3A5LC 1UTIA 3EG9A 1VQPA 1K9MU 3OS1A 2FUG2 2KFNA 2ITMA 1OCZH 3HBLA 1MV3A 2JM8A 1JXEA 3JS6A 1B72A 4NLCA 1QBJA 3VQ7A 1JCEA 3E9PA 4CGIA 4XU1A 1TT0A 2LK2A 2VXFA 3QU6A 3LDQA 1KU3A 1QQCA 1U3EM 1TWCJ 3EYYA 1T98A 2L7FP 2VJIA 4I7HA 1RR7A 4CC3A 4C5EA 1WSJA 4Q4ZF 4MEYF 1VQLT 1W7PD 2Y1JA 3CC7Q 2DXIA 5B66C 2TCTA 2LDUA 2OTJI 1RLPC 4BE1A 2CGLA 2ZJPL 2RN7A 1UCRA 4CZLA 2ZQBA 3DU5A 3DXJF 2WSCE 4JI3K 4JHDA 3WNGA 3FBNB 2OTLN 2VXDA 3GTGJ 2FJ1A 1FMWA 1I50J 4A3KJ 1T44A 2LF7A 3G1OA 2GQVA 4FJIA 3LQQA 2HMIA 4Y92A 4M7AD 4ISGA 2QG9B 4CD1A 4W5NA 4ID5A 1MMNA 3JRZA 3DU6A 2LNHB 3E1YA 5AQSA 4CERA 4M72A 2DD4A 4E3SA 1BOAA 4CBXA 3CCSA 5I9EB 4CCJA 4KREA 4RW9A 3N5BB 1QSSA 2XDVA 3NH0A 4F7UG 3VQ4A 4PKHA 4BI4A 2QA4T 3CJRB 5LRRA 1N39A 2V9PA 1UA1A 5GADP 2ZPBB 2E1MB 2PBIA 1Q81R 2WONA 1VQMN 2BY0A 3CHWA 4BU2A 1ETOA 1K4US 3F8MA 4CHYA 1FP1D 4GDFA 2FZGB 1A36A 3M0RA 5LJ3g 1TT5B 3PX0A 2PLYA 3CCJI 4NO7A 3OYBA 5CZ2A 4F91B 2OTJN 4DBRA 4OKKA 5FKLA 1Z3XA 3CC2N 4E9GA 3CCLT 3D5SC 3KIOA 4MFBA 4BJ6C 4XR6A 1YI2Q 4RKUE 2VC8A 4N47A 1JEGA 2NNYA 5I42A 1GLBG 1MWMA 2P51A 2H6CA 5DEQA 2KIQA 5DTDA 3COAC 1VSMA 1PD1A 1SQKA 4BD3A 2V7FA 1X19A 4PJOG 1HBXG 3I0TA 3WXIA 2O8FB 3SWNC 4KBOA 3I8BA 3SFMA 1KK7A 4ELZC 5D5WB 3G3ZA 3P31A 3NNQA 2L2OA 1KIKA 4U87A 1SAXA 3Q9VA 1MGQA 2JS0A 3WGIA 2QCOA 4EAHD 3GO5A 4FW1A 2UUZA 2PU9B 4UVCA 2QGGA 1DDNA 3U9GA 4B8XA 4FETA 2ASOA 3ZQHA 2FF4A 4DA4A 3M1EA 5IY5H 3CJCA 3D1NI 3CQYA 1CSKA 2MFZA 4GV3A 1TG0A 5B1BH 1G99A 3O3GA 4X66K 4QQDA 2X4JA 2HZTA 2QEXQ 3ZGKA 1YX3A 4HUFA 3HOSA 1QPMA 4DQRA 2DFEA 4RBOA 2DQLA 1NLOC 4IEIA 3HL8A 2EV6A 4ZN1A 3OTOK 2AHJB 1OLTA 3PMTA 3CPWP 3HTUA 2ZPHB 4PLLA 3B8AX 5E1ZB 4B9UA 3GLLA 5D5UB 1QZEA 4XLFA 5AQRA 2V6EA 2JMAA 4R55A 3GXOA 1IC8A 4FIBA 1NZ9A 3F9MA 3SPYA 1YI2T 2KSSA 3JCMb 2VKVA 4GVMA 2ZGWA 5BR8K 3DB3A 3CI5A 3QFUA 5GAN4 2AJQA 5KPRA 3HGGA 4KGVB 1IRGA 3LNQA 2YT6A 2ZM6K 3ISPA 4A3LJ 1UGSB 3M54A 5LL6S 3RDVA 4RMNA 1UJ0A 2IW5A 3V1OA 5LEKA 1M2VA 2CDTA 2WACA 2O2OA 2WAQN 2PJRA 1IH7A 4LLNA 4JPBW 4C1NK 3QMLA 2VL8A 1WPYA 5A0DA 1DGKN 3TSWA 5CKDA 2F2XA 2Y4YA 2LKXA 4A62A 1NE8A 1J75A 3OL4A 3MWMA 2E1YA 4GVEA 2Z9OA 2CRGA 1V54H 3DJCA 1S72A 2IVPA 1SKWA 3RKQA 2QA4I 1TUCA 1ZYRF 1V29B 4YPRA 3R0AA 2W10A 3MEGA 1O3TA 4WQ4C 3AGKA 4M41A 4C8LA 4XQ3A 4Z88A 4M3RA 2FB7A 3R61A 1FWZA 2HZYA 4IIMA 3QO3A 5KGWA 2DE0X 3V8JA 1N9SA 1WJ5A 1X6OA 2M0YA 1JU5C 3M6GA 2GWJA 3WHCA 1XWLA 1WBBA 2JPCA 1CKBA 1K9MO 4AILC 3IHOA 2EFQA 1T3LA 4FWLA 2XY5A 3I5RA 4BVPA 4L9VA 4EZ6A 1SKUB 3KNTA 3MEWA 3ZEUA 5C12A 2GUIA 1MW7A 3MKLA 4C92C 1JJ2A 2OU2A 4DYRA 4JRQA 1T0JA 4AHVA 3HHTB 5ADXH 2WB1A 2DODA 4C30A 1T6DA 4QAGA 3GZNB 2DO3A 4CFCA 1GOBA 1VQ6I 2VE9A 3T5XA 4BR9A 2GQIA 1W2BA 3FXJA 1FBSA 4BE2A 1NK4A 2VE8A 5LJ5h 4CHZA 3ZEUB 1BI4A 3BROA 1UGRB 3PNTA 4P1WA 1Q86U 2XSJC 5AQLA 3G4SA 3H5AA 2DPDA 5D4SA 5H1SQ 1B07A 1LAVA 4XIUA 5AONA 3CCRA 2E5QA 2BZ8A 2V9VA 3UATA 2DT6A 4KRFA 4JQFA 3H6EA 1E4GT 4DTMA 3EQLF 4BNCA 4KHQA 2DEUA 3WEEA 1HYSA 1QHAA 2NVUB 4B9VA 1SFXA 5C15A 1JLFA 1YQMA 4D7MA 2YUPA 1S3XA 1AOYA 1QVFP 2NRZA 2OQGA 4UUSA 3WXMB 2JPSA 3VYSB 4BR2A 1VQ5N 5D4RA 2VIXA 4HLXA 2X4YA 3L6QA 2WV0A 3F6OA 2DFIA 5FFXA 1FK9A 1JUPA 4DQ2A 4CIFA 4EA5A 4CYCA 5AQQA 4V19K 1KZHA 4CXFA 3HRUA 3J80O 1FP2A 1JLQA 2DN0A 5BS6A 2PMZA 2P5VA 3QOPA 5KTQA 2I10A 3JCMW 3SFIA 3F72A 2IEKA 2V7ZA 4WTOB 3IL2A 4MFEA 9ANTA 4YIIA 4MLHA 2IS6A 2CV1A 4IG3A 2E3HA 3QKJA 3QG1A 4FWPA 4NXMK 3LSGA 3KLNA 5F1JA 4QT7A 4Y0WA 1CZBA 1NGJA 5L23A 3SUPA 4DQ8A 3QYEA 4DZJA 2Z2SB 3HSBA 1YIOA 1BCOA 1SRLA 5GMKi 2D0BA 4M7DC 4FLYA 2KMTA 1W36C 1V5FA 3F6VA 2AXLA 3VOEA 4C8QB 4C3JJ 2HF3A 3QODA 1U6GA 3SI6A 3R1XA 2QASA 1YRNA 3RMQA 1QCNA 5KI6A 5LRSA 2LP0A 3HTRA 1GLDG 1T6SA 2HR3A 3OBYA 4CEDA 1OCRH 3SAHA 3IWZA 3DPLC 2LT1A 1N34K 2Q36A 2EIMH 3CCQA 2PN6A 1QVTA 3A8OB 3S14J 3G0ZA 1EF4A 1ZBUA 3OR2C 1LUJB 1EXQA 2NVQJ 3L1PA 1VSIA 2XY8A 3IHUA 1M1GA 4DEXA 2CH6A 5GAEP 2VQGA 2DA9A 3CO6C 2MH2A 1LOJA 4CEQA 3EZWA 2X4HA 2M45A 1DU0A 2MW8A 3AVCA 3JRBA 2JT4A 1FJGK 2QWLA 5C44J 5EGOB 2X4XA 3PMIA 1IW7F 2DK5A 1RNHA 1H8AC 1OCOH 3E9LA 3VEOA 3CCQT 1EO1A 1KONA 2L9NA 1HYOA 4HA8A 1RKTA 1C0MA 1OI1A 1PYVA 2RKIA 4ZC3A 4MLOA 3J7YJ 2M9UA 4DV6K 4CGGA 4FJMA 2BZTA 2KQRA 3AAFA 4Z4CA 1HUXA 3T3FA 2VKDA 2K27A 2V9KA 4A4FA 1YP5A 4LIVA 1WNSA 3FXKA 2KZVA 4PL8A 4UB6C 3H36A 5DM7L 4GKJK 2A0FB 5EC7A 4A4HA 1JJ2P 1ATRA 3RRGA 1MD0A 5JFRA 1VRTA 3LFUA 4BBSJ 2RVCA 3WGHA 1IDYA 2G0EA 3EUAA 3W2WA 2MG4A 2XROA 3FC3A 3RRHA 1RACB 1VQOI 1PVEA 4HWIA 1EH6A 3MEUA 4HAMA 3DEUA 3ZMUA 3V4GA 2WFBA 3MXJA 1G3WA 5J1EA 1ZBJA 1UB9A 4Y4RA 2QTVA 2YHWA 3VUZA 2DTOA 5GANj 1SL2A 4CZEA 3D7EO 2YKNA 1U0JA 4HV5A 4BROA 4YPHA 3KP2A 1SD4A 4CJRA 5E18F 1KTQA 4GY2B 1O75A 3PVQA 4ITVA 3IKTA 3GUDA 3BPXA 4L18B 1I3AA 4AVPA 5HDNA 3CFPA 4M78F 1NHAA 3IH7A 1HYZA 3G71N 1I1JA 3HOYJ 1Y39A 1HNZK 1YITA 5AQYA 3RI4A 3CJ9A 1JLCA 4IUUA 1BL3A 3HG9A 4BG8A 3MX5A 2O3FA 2VUMJ 4A54A 1QCFA 3K1MA 2XKOA 1FYKA 1XQHA 1SVMA 4KTQA 4S04A 1U45A 2Y0SA 2QWWA 5M3FJ 2WY8Q 1X9SA 2ZJQF 4YFUA 2ID6A 1XX5A 2FQ4A 5FPMA 4J9DA 1RBUA 2NYSA 3VRZA 3O9TA 2EZHA 3AAPA 1S72N 3QINA 1DGRM 4RB1A 2E65A 4E6KG 4OMMA 3QFPA 2DTZA 1EFNA 3G4SI 1YYVA 2NOJB 1S72T 4FSSA 5LY3A 5JS1A 3HUGA 1WX6A 4DCHA 1E0EA 4KISA 3OSFA 3MCZA 1TQIA 1K61A 2WTUA 2KDSA 3I58A 4ZYDA 4DTSA 4B6MA 3F10A 3MJXA 4DFMA 3OH9A 4CEZA 4FVMA 4B4CA 4KA4A 5LJWA 1YO5C 2D5VA 3CCJT 1MIJA 2VLAA 2JVHA 4ELYC 3CCMQ 4R79A 1BIBA 3WVDB 5AQKA 1LW2A 3MKZA 4B1RA 1TBXA 1NJXA 3DTKA 3O8HA 1NK6A 1KLNA 2DA1A 1VRUA 3L2RA 2X9HA 1I81A 1GFCA 3VQ8A 2Q8KA 4MQ9F 3M3ZA 4JI2K 1JXOA 5ILUA 1NKUA 2OFIA 4B48A 1AHDP 2FNPA 5GPCA 1NYFA 1SD6A 3CUQA 1XPXA 4BEHB 4FZXC 3NHGA 4B09A 1ZSZC 1MUNA 1CXUA 2FOWA 3EGUA 2A6TA 1WRJA 1EA3A 4XICA 2W41A 1VTNC 4RS8A 5TRDA 1L3LA 4DGWB 1RT5A 3HVTA 2JOYA 1QRYA 4IX7A 4U0WA 4DR3K 4YY3K 2K2MA 4CZGA 4NC8A 3FDYA 4IOXA 2CQNA 2PUKB 3R6MA 2ISYA 4ENJA 1WFWA 4BI8B 2L3DA 2L3SA 2LT4A 2DYSH 4Z6YA 2V4JC 2UYTA 8AT1B 5B5EC 3FXRA 1Y7XA 3H8ZA 4NQWB 4I2QA 1RTDA 1OJLA 2K4YA 1IN4A 5KYXA 4KITB 2O8BA 4BRIA 1D9FA 1ON1A 1ZUKA 3SZPA 5F1XA 3R8EA 3VQ5A 3GZ6A 4DF4A 5HRPA 1G5VA 2D0AA 4G6QA 4CJVA 3R4KA 4JBAA 2FBIA 3KWGA 2CS3A 3GP8A 3AG3H 4XLAA 3A1PA 2IP2A 1E3HA 4FLUA 3LSMA 2E70A 3H5RA 4HKEA 3QEWA 1M4ZA 3I5UA 5L3BA 3H45C 5KQ8A 4OFEA 2X6YA 3NQOA 2EFIA 3QPSA 4RCHA 1RNLA 3H3UA 1I5OB 2AHQA 2HNYA 2PNIA 3CMEQ 1VI0A 2G7HA 4X9CA 1FSEA 1JJ8C 4M71A 1GRIA 4OMPA 5A0LA 1RUOA 5GANe 4M7AF 2Y2ZA 3TAMA 2WBNA 3FB9A 4LG0B 3E9FA 1YIJI 4EMGA 2CT4A 4CYCB 3GCMA 3IWFA 2EFPA 4U0VA 4Y15A 3NF8A 1UZCA 4M78D 1FOXA 2X48A 5AIPA 1QQJA 1JT0A 1W0TA 1OZ2A 2OTLI 4E1NA 2RI3A 1TQMA 1WSGA 2LQKA 4RTYA 2BXYA 4CZIA 3KTQA 1PM3A 2F4MB 3PVLA 2CV2A 4NOYA 4DTOA 2WB1N 4WYBA 5GMKe 2O61A 3WUHA 1EX4A 2PQWA 1PRMC 4KHYA 3NFCA 4ILGB 1RRSA 2GELA 3UR3C 2O8EB 1XJWB 4CJFA 5ILSA 5CY4A 1QZYA 2KEAA 4AHCA 6AT1B 4LFUA 2ZD1A 2M8EA 3PGGA 5BQTA 5HDGA 4DSJA 3M8JA 1SRMA 4N56A 2FSNA 1RESA 4O8UA 3H9NA 2A5XA 1D5VA 4C8NA 3REOA 1T3SA 2LDMA 4CJKA 5FW9A 3ZX0A 3OSGA 3A0BC 3SMPA 2E1OA 4FK0A 5EVZA 3NE6A 1EP4A 3M4GA 3OYNA 3JCMX 5CAIA 2IVNA 2RQRA 3A98A 1RUWA 3EYIA 2F2EA 3GZ5A 3CMEA 3ZSOA 4WXHA 1SS6A 4O5BA 4L9JA 1M1EB 1U06A 1WSUA 1OPCA 2DYRH 4S0HB 1NJIU 3LQRA 5GAN5 2FNAA 4CE9A 4QS9A 4IO9F 4A2UA 2JA2A 3K2ZA 2ATCB 2HVIA 2ME0A 1YJWQ 5HNHA 1SF9A 3NHNA 4CIGA 1WAFA 3C6HA 1R1TA 4JI7K 4BVOA 2GBYA 2X1DA 4OMNA 3DXMB 4NBQA 3CJAA 2H8HA 1T03A 4JKGA 3O9QA 4PFZA 1Y64A 2RJEA 3C2BA 3VETA 3O5ZA 3I55T 2G7UA 4BY7J 3N5NX 1D0ZA 3R60A 1I4K1 4WF9L 1ZR2A 2R7YA 5BPNA 4KT6A 2HL3A 1K4TA 1RFQA 3HOVJ 2LP5A 5D3GA 2YNIA 1HNIA 2K3YA 3VU3C 1K8KA 1N5YA 1MJBA 4CEEA 1HNVA 3CCJQ 2GGRA 4J8OA 3AO4A 3H35A 4IUVA 1X58A 4J9GA 1OCTC 2DZ9A 4BEHA 2ID3A 2FOKA 3I55I 1XC5A 3URGA 5CVRA 4PSWA 2OPRA 3EETA 4Y52J 5IT9Z 4ZNXA 3R0JA 1VQOA 3KK2A 4FLXA 3OOUA 1OH8A 2PVDB 1LWCA 1OQYA 3OJSA 4ANJA 2GWKA 1N36K 2QXLA 2VODA 1ORPA 4XQFA 1Y97A 3CMAQ 4L3QA 2EJGA 1ZHFA 5AIQA 3ZCOA 2YI1A 1QHTA 3M8EA 2EJFA 3JB9I 4NQWA 1BW5A 4XLPF 1BL0A 1WHMA 2ZPGB 3CD6A 4BI3A 2M4KA 2HDAA 2DMQA 1JLAA 5MLCQ 1KJWA 3RERA 1RBTA 2A3ZA 3M58A 1TL3A 5B3SH 3X24B 1K8AR 2M5WA 3CCMN 3ABTA 1B34B 5M9OA 3IAM2 1X3UA 2GA1A 1C0UA 1HR0K 1W97L 4YFKF 4C0DB 1S1VA 5AJ3K 3CUOA 4KICA 2OTJA 2ZXJA 4RAYA 3SB2A 3OYLA 1XG1A 4KDPA 5HROA 1FZPB 1JTXA 2TRTA 1T8IA 4XMYA 4XLCA 2FSWA 2HDWA 1BC7C 3RR6A 4FW2A 1W2BP 1UFMA 4WFAL 2KRFA 3LWIA 3U4LA 2H3GX 3K9KA 4J5YA 4OX9K 4O5FA 4OPKA 3H6ZA 3CQTA 3T9NA 4NC7A 1L3UA 3EL2A 2KIUA 4B22A 5AQXA 1VQLA 3CZ6A 2OAZA 5I3UA 2P4WA 1U2VA 4AU7A 3VYGA 2IA1A 2MLKA 3M4YA 4DBQA 1QCOA 2ETJA 3ZN0A 3P9IA 3JSCA 4ZDPA 1BIUA 2FO0A 1MBKA 1AKHB 4PCQA 2W7NA 5CK9A 4KH5A 1M90R 4EEFG 3THXA 1RADB 3I0RA 2W1OA 2VC0A 3HOZJ 2QI2A 4BQOA 1TNSA 2R7XA 1QVUA 4CK1A 3PM1A 2DXBA 4LF6K 4BR5A 3K57A 1YW9A 3KYLA 1KXPA 2ME6A 2YG8A 1M9SA 4NHJA 3EFSA 2DTRA 1FX7A 3OW2P 4F7UE 2RI5A 2MCNA 4P9UA 1SAZA 1ZTRA 3CCMI 2O5RA 3DM2A 4CFBA 3RIRA 4CGJA 3HOXJ 4OOIA 2OZUA 3ABUA 2M1HA 1A5VA 1BI4B 3AVMA 2JRTA 3G71T 1HK9A 1HKQA 4C8KA 1QKXA 3HM5A 3PIPA 3ZSXA 1YCYA 5A0GA 3OYMA 2OD5A 4J6YA 2PFUA 3VFZA 1TS9A 5EZGA 3J81Z 2GTDA 4AHRA 1YWPA 5CPRB 4N4NB 3M57A 2YS9A 3KXTA 3EPZA 3Q0WA 1E7OA 2ETHA 3DLKA 2VQHA 3QJ6A 4C5HA 4U7DA 5DM7R 2W40A 2DD5A 2K4BA 2D6FA 2D1XA 1LW0A 3V9UA 2ZKZA 2B63J 4A0ZA 3L42A 4RGRA 4M77A 1N75A 1MJ9A 4CHNA 4ZN3A 4M7DG 1S7EA 2PZ1A 4F92B 1RI0A 2RAEA 1XCVA 1WBDA 3KK1A 2FMYA 5D5VB 3CPWM 4BC5A 4I7FA 4DBFA 3CCLA 4ZGDB 4MDXA 1YRNB 4M73A 5TISC 1MKMA 4HQMA 3ONQA 3CCLN 4QOZB 4M74A 1TKDA 3X28B 1VQPN 4Z2YA 4B1WB 1RT2A 1FLIA 2JUFA 3VEWA 4K11A 5J40A 1PJRA 2A68F 1VQLI 2CUFA 1Y8RB 4IIOA 1N8RU 2UXCK 4XH4A 4PJOD 4RAGA 4EDUA 1O7FA 1WWXA 1NGFA 1KSPA 3WXLA 1OVYA 2M30A 4JI8K 1SFEA 4DV5K 5LJ3f 2R5YA 3DBLB 4E7JA 3J7AF 1AOJA 2P9SB 4AG1C 3PSFA 4J6XA 4HUEA 1ESVA 3EUHC 2YRVA 4A3MJ 3CJBA 4LFAK 3JCMf 1ASWA 1K0XA 1EBMA 3EH1A 4II2A 1DTQA 1Z1DA 5GAMd 1S7OA 3BZKA 2EQMA 1T38A 3M55A 4B9XA 3SHFA 2DTIA 2NOFA 2BV6A 4IUQA 2H3EB 4A3DJ 3G1JA 4MTEA 3LDPA 1G6NA 3ZT0A 4FK4A 1TK8A 4IRIA 3D0PA 3H3NO 3TSZA 4Y7NJ 3SZTA 3BUZB 2D1HA 4IURA 3RJPA 5IYBJ 3HO1A 1I5ZA 2YX7A 5FWCA 3TP0A 3PV8A 1W70A 1EJ9A 5M1KA 4DR7K 2MOXA 3ID6A 4HEA2 4GY5A 3ASNH 2HI3A 1VQLN 2YHXA 2GLOA 1K76A 1X1AA 3VA0A 4U0YA 3FFIA 3S2WA 3QBXA 2KPMA 3PNVA 4N0BA 2FEIA 2EB7A 3BQYA 1KD1C 3HKSA 4CZJA 1WJQA 2M2EA 3CMAT 4BRAA 1OYWA 3F0CA 1YT3A 2PFBA 3QYFA 4HCZA 4CIEA 3LFKA 2DMOA 3B6PA 2KXDA 2EFWA 2W84A 3SZGA 4OKJA 3WU1B 2PVGB 5M3MJ 3U8XA 4II1A 1RBRA 2W6LA 4EP4A 1M5Q1 4OWRB 4AFUC 5TGTA 4H5VA 3LA7A 4K8ZA 1X27A 4FWMA 4F4KA 3AG4H 2RM4A 2E6NA 4F2RA 5CQYA 5E3OA 2FSKA 1T0HA 2LREA 2DA7A 1G2BA 5CO7A 3RWUA 1MDMB 4BJTA 1XHXA 2W6KA 1RI7A 5EGOA 1T39A 5TKWA 3JTHA 2HEOA 4D1QA 1N5ZA 1SAUA 4J2BA 4M7DD 1DUXC 2X6OA 3NGPA 1J0RA 3GOXA 3MMVA 1HOMA 1K4SA 2RKHA 4RWTA 1ZBFA 4RM3A 1W1WE 4N4OB 5JVTA 1ORNA 4CCNA 3EE9A 3QQAA 3KLGA 1YJWN 4L59A 4AQYK 4BY6B 2NYXA 3Q1JA 1J53A 2HGCA 2Z1DA 4NL2A 1FBUA 4ZDLA 1LMZA 2ZSHB 2YHTA 5M1OA 2JJ9A 1VQ6N 1WHGA 2A5WA 3DXKA 2E5NA 2AQEA 2R7TA 3RMCA 2NOZA 3KKRA 2LKPA 1SUQA 3WU2C 1O3QA 2YPRA 4CCLA 4LUEA 1YW7A 2XAGA 5JR3A 2ROTA 4M3YA 2LYCA 3UDCA 3SDBA 4V19S 2HWVA 1NGHA 3MN6A 3ZCMA 4KJZA 3A01A 5M5XJ 4D7NA 3I0XA 4QTRA 2XPWA 4BRLA 2JTFA 4AFZC 3A2FA 2CFXA 3CCVA 2GM4A 2RQPA 4KYWA 3S16J 2I5WA 4LC9B 3I55A 3MKDA 1TTYA 1U1SA 2NS7A 4JD2A 2QTXA 1MSFC 5JVHL 3CBPA 3A03A 4J01A 1I8FA 4Z94A 4IWVA 2R3SA 4YRVA 4X65K 3G4SN 3SPZA 1XCBA 4GO1A 2D8HA 3U23A 3OS0A 5FKOA 4OB1B 1SL1A 3E5QA 3C3WA 4ENNA 3S1RJ 2R92J 3D2EA 4XN3A 3SBTA 1TWFJ 1Q86R 2FLOA 2CP7A 3JCMQ 1HC8A 2YWWA 4JKFA 1W0HA 4DUYK 2UU9K 4M77D 5LD2C 4XNFA 4C92F 1J59A 5HLFA 2QEXN 1ZBXA 1VYTA 3OS5A 2CUJA 1V3FA 3O6BB 4B47A 1WXUA 1UEBA 4UY8O 2EZIA 2A6AA 1KG7A 4LF5K 4FYXB 2ZCFB 2XMFA 2C6YA 4RW7A 1E2XA 3JRGA 1HA8A 3TTDA 4C1NI 4DZPA 2SEMA 2KT0A 4GRIA 3M8SA 3TOAA 2QSFX 3FWEA 2IA0A 3KLIA 2O8FA 4FCYA 5FPDA 5IXBA 1HDDC 5JICA 5HP1A 3KLEA 1IRXA 1BYMA 4LF8K 3ECHA 3MKWB 5EOYA 4XL9A 1REVA 3HL2A 2YUQA 5KYUB 4EVVA 2JNGA 4E7IA 4DTUA 2L0AA 2LC4A 2R5AA 4AIJA 1VQ8T 1ZREA 2VC1A 2C0TA 7AT1B 3WQUA 2EGAA 3SJJA 3KK3A 4JLGA 4HLYA 3L2VA 4RCCA 1X3ZB 4PNOA 4M77F 3J7AY 2K5CA 1RT3A 1S72Q 2KZZA 1VUBA 3CJ1A 3G73A 4BC2A 4JV5K 4Z4IA 1WHLA 4FYDA 5FPNA 2K5LA 2QA4Q 1TH7A 1EKEA 1X3WB 5DY9A 4IHVA 2DOAA 1EWRA 1B8IB 3OR1C 4DWIA 3LSRA 4KHPK 3RESA 1LWVA 2K9GA 2ASMA 3I59A 1I6XA 2RB6A 5LLQA 5GMKl 4XK4A 2YG9A 4MQ3A 4BKXA 2XK0A 3DP7A 5J8FA 2EX3A 2LMJA 2L9SA 2ECBA 5FO5A 5AQOA 1DPRA 1W2BS 2BTFA 4BDZA 1C0GA 3VQQA 1H1VA 1XS9A 4MDWA 2RMOA 2L9RA 3F9KA 1I27A 4Y17A 2KR3A 3P8BB 1LE8B 4JRKA 1R8OB 1OH5A 5D8LB 1KSWA 1DGWY 2XGEA 2X0LA 5LMUK 2X85A 3I0WA 3GBQA 1VQLQ 3PO5A 2K6DA 2CUDA 3LWLA 4DV0K 2Q0UA 3BOQA 3K6GA 2MF2A 1W7PB 3PFIA 4LDXA 1LFPA 1HF0A 1Q81O 1BJAA 3C1DA 4B9QA 3CJTB 2K40A 1LKXA 2BEOA 3PFSA 2E2JJ 2MSYA 1QVGM 5BN9A 4X6AJ 2YDLA 5J4YA 1J09A 3NAEA 3P39A 4A6DA 1X4PA 3RMAA 3ULEA 2OTJQ 3L2WA 1R00A 4E9FA 3ZMSA 2WC9A 2QXFA 2AT1B 4JZ4A 1WXTA 1TSFA 5FLVA 2E6MA 1HNXK 2J5OA 2ZB9A 2P4TA 4DNCA 1I3QJ 4O5VA 3F22A 3GTOJ 2VB6A 4XU0A 3A5MC 1USTA 3NTHA 3CC7A 4YELA 2NUBA 3MEAA 3ME9A 2LX7A 2IGMA 4CF2A 1FNNA 4C0FA 1HSQA 2GF7A 4R0KA 4PDKA 1E6HA 1ZELA 5FLXE 3CMAA 2FEZA 1D9DA 3MEVA 3VUBA 4Q48A 2KP6A 5L3FA 2V8IA 3CCEI 2VOOA 2DMNA 1K8AC 4ZGJB 1ULYA 3NGYA 1QP3A 3R6NA 1W5SA 3U3GA 1HSTA 4KV8A 4X1VA 1TYQB 4XSZF 2BE9B 3G6EI 3TSUA 4BRFA 4AIDA 1ZG5A 1BR4A 1YN8A 1JHHA 2JTVA 4I6ZA 4YOUA 2X6SA 1XMAA 1QWEA 2A1RA 3NARA 4ASNA 3PO4A 2GQQA 1R6RA 2VWKA 3LGFA 3V6DA 2CP5A 4KN7X 4OLAA 1JCFA 3TSQA 3OS2A 5AQGA 2IVWA 4L5JA 1PNJA 5KYWA 4V2GA 3VMFB 3IAS2 3SYTA 1XUPO 4M75C 2FBKA 3D7SB 4LK0F 1ZBIA 1WDXA 2EKHA 3ZQCA 2YU9J 2ECZA 1RTJA 4HV6A 5AQWA 3C7NA 5F0XA 3DOKA 3QDRB 5IYDJ 3T8RA 4PA1A 4BACA 3TAPA 3NVKA 1TGOA 2R0QC 3M8FA 3AVLA 3KYCB 3HHHA 4AFQC 2W57A 1VZ0A 2B7EA 3ATUA 1CGPA 3EHQA 2XDPA 2EV0A 5D7UA 1I5LA 4E7SA 1BUPA 4CZFA 3LA3A 2FD5A 5LBQA 3LA2A 1IO6A 3X26B 2OAUA 4AWXB 4XOTA 4Y1DA 2Y9YA 4BRNA 3AY9A 4A59A 4HCBA 3WTSC 4EMHA 2M87A 3P9CA 1FOYA 3TEDA 2K7LA 4G7HF 4H8KA 3N0UA 4FTHA 2K9MA 2GNCA 4Q5VA 3LPTA 2BGGA 3I71A 2VBXA 4JP0A 4D8KA 2XY7A 2HVQA 2E2PA 5GIOA 1HXDA 4C8QF 1Q82O 4PJOF 3BTLA 1DTTA 2DX1A 3NDKA 3T8TA 3JW4A 3J7AO 1E6GA 5JVGF 1RPWA 3ASOH 1K78A 2BUDA 2Y90A 4Q47A 2DXUA 2F69A 2LD5A 3E01A 2HQXA 1ENHA 1USSA 3SQ0A 4DFKA 3E3VA 1Q82R 3AVIA 5C25A 3E1SA 5KYYB 2DDAA 4CDGA 2Q1NA 1JB0E 3L2CA 3CCEQ 3JCMd 5HS8A 3K5MA 1O57A 3TPQA 2DFHA 2KMUA 1W5CC 3X2QH 4YIFA 1ZG3A 2O8KA 3AHUA 2QVOA 2PMUA 4BRKA 4CGZA 2OPTA 2KJBA 3NMUA 3BJ6A 1W0UA 3CMAI 1VQ7I 4QVCA 4LFCK 2HF4A 4EJZA 4B8CA 4P96A 1FJLA 1WJDA 2E64A 5AQZA 4OPHA 2OZSA 3VQ6A 4WQ4A 2CUZA 3VF2A 2RHUA 1R1UA 5GAN2 3OBWA 4D6WA 1U47A 3CDIA 4JKGB 3WG7H 4FSXA 3FHGA 3HSTB 4HOBA 2JRMA 4CO8A 3CCVT 2O03A 3C94A 2CO5A 2HW3A 5GMKj 2WV1A 1YIJT 2CQKA 5JLXA 4M3GA 1R0CB 4ENMA 2E4HA 3BDUA 2HQHA 1WIEA 4K42A 2DK8A 3WHBA 4YEJA 5FGMA 5D6FA 1Y0UA 4D8DA 1W4MA 2I7NA 3QIPA 2MGQA 3U9DA 1LV5A 2ZMEA 3CCUN 1R0BG 2IA2A 4MZMA 1TXQA 4DQPA 1ACIA 4IOCL 1AD5A 2QQSA 1N8RC 3FZLA 2KQ2A 1ABOA 4A3GJ 2RNGA 2A41A 3ZX2A 3FF5A 2W24A 5GTIC 1TK0A 2DBBA 1IB8A 4IQJA 4FJJA 4X9DA 2YNGA 5FLXO 4M3UA 2J4RA 2FX0A 1JBMA 2NOGA 4M7AA 4E7HA 2KHOA 4IXAA 4F7UB 1XGSA 5IHIA 1V5GA 3E6MA 3CC4T 1WJAA 3DKYA 1OYXA 3JRCA 4KAZA 3GE1A 1WXBA 2KI7A 4AFSC 1U9OA 2P9NB 2V75A 3CXCP 1VQ5A 5IAYA 1H92A 4N76A 1PCXA 3TO6A 2RQTA 2J6FA 2FMLA 2Y1IA 3CW7A 1RT7A 3CESA 4RTVA 2A7YA 2XGCA 1BISA 2K85A 1X1PA 2VXZA 4OGEA 3WGGA 1QGPA 1A6IA 4MMKA 2E2OA 1XSXA 3CCMA 4B3RK 4BRHA 3EG1A 4G94A 2WBMA 2FBHA 3A1YA 2LJ1A 2KDZA 3CD6N 2I5UA 2EH3A 3CPWS 5IOZA 2QZ8A 2N8GA 3TAEA 3D2EB 4N4GA 1KQ8A 1YITI 2Y48A 1SFKA 1MU2A 4IVNA 5J39A 5C0MA 4ESJA 4WCIA 3UF4A 4AT1B 1AHJB 4ICLA 4ZGEB 1D1CA 4HNTA 1VA7A 2NLUA 4BRMA 3MP1A 2HBJA 3OYHA 4XEIA 1YWOA 1X2MA 2DA5A 4JJNK 2ELKA 1Z05A 3I56Q 4DIQA 3H9JA 1YQLA 3PQKA 4UOBA 3CXCM 1JCGA 3LOCA 5HOOA 3JRIA 2O8XA 3K10A 4CFAA 1ZSZA 1TZLA 3I9V2 2VJ4A 3BFMA 3L9FA 2VBYA 3CD6T 5FLXK 1S1XA 2BY3A 4F7ZA 3FMQA 1GVDA 2RJCA 2E7WA 3MQ0A 1SD5A 3PL8A 5M1QA 4RLFA 3FJPA 5DS9A 4A3FJ 2X51A 3WT0A 4OB2B 3QEVA 1QVGP 1XQOA 4B08A 5BPLA 3GDQA 1QVFM 3MHXA 5AFUH 4E7KA 2QKLB 2D8JA 2E6ZA 5BPMA 3LSIA 1LEAA 4E0DA 1VQ9T 3CC2A 2LG4A 2ZCWA 4F14A 3A0IX 2GFAA 4B9LA 1MUZA 4KI6A 3JRHA 1K73U 5JLHA 4LF9K 2RHZA 3T19A 3TQNA 3AA2A 4HNUA 2C0IA 5EEAA 1RBSA 4IRGA 5KAIC 2EYQA 2XDBA 3C4SA 1POGA 1DU6A 3QLHA 5SZTA 2P9PA 5CVJA 4RDUA 4A4GA 3QAHA 2VG7A 3HYFA 4QQGA 3K70C 1YAGA 2DA3A 2KJCA 1YHQI 3HPGA 2STWA 2P6TA 1SVLA 5BRHA 3J7YP 2I7PA 3IKMA 1P59A 3SJHA 4B1XB 1NGAA 3CCSN 1VQ9A 3CC2T 2VKHA 1K7AA 1X43A 4PUSA 4PJOC 2GXBA 2WAFA 1OYYA 2WY7Q 3VQCA 4WCEL 5CYMA 1BR2A 4HF2A 4FJKA 3I4MJ 1NPRA 3A5OC 2XD0A 4CCHA 2DRKA 1WPKA 2LOOA 3META 1VQKI 4J9FA 2CZ1B 1K1ZA 5CZ1A 2JTMA 4HRIA 2B6AA 3HM9A 5CVUA 1BW6A 1WI3A 2K9SA 3L4IA 1RT1A 4DSKA 4FO0A 4E6RA 4DOVA 4BUPA 1G83A 5K14A 2OUMA 1ILYA 2E3IA 3AL0B 3C2GA 3H0FA 1N6QA 4EGZA 2YUSA 3OGDA 1BR1A 2QSGX 1S22A 2JWLA 4ILJA 4GGGA 1H89C 4F04B 1XC3A 1A31A 3V1RA 2KT8A 2R7DA 2EYWA 2L3QA 3CFOA 1S6QA 2COZA 3X20B 1NGDA 1D1BA 4EZ9A 2DEQA 4FJNA 1I39A 3M1CA 1ZHIA 3OYYA 3BT9A 2VT2A 1RCHA 3FKJA 3GTMJ 3QEIA 4KB1A 3QPHA 2E34A 2O8DA 3RSNA 1RAHB 3T1AA 2G8WA 4XM3A 1TV6A 3J7ZI 3GLXA 3MECA 2JZ2A 4X62K 4ATOA 3P9KA 1ZA1B 1AWCA 4HT9A 1A0NB 4HTUA 2NUPB 2P7VB 4Z02A 2A08A 1BC8C 2Z1IA 1M30A 3FHFA 3C0CA 3TANA 3KKSA 3CCVQ 1BA5A 4PKGA 2E71A 4DR1K 3AG2H 2R5ZB 3ZSYA 2XAJA 3AVBA 3RKYA 2FRYA 1VSHA 5IT9K 3D5RC 2WSEE 5GMKm 1YJNN 3VS7A 4JD2B 2D5RA 4MNUA 5IT3A 1Z26A 2XASA 1KGSA 3HVRA 5BR9A 3DEWA 3K5LA 2E1NA 3GVAA 1A5XA 4Q0BA 3OYIA 3O08A 4J2DA 1QQNA 3H41A 3KBGA 4CCMA 5HNFA 2HMAA 3CWUA 1M1FA 3P38A 1NK8A 1OISA 1WI9A 4HVUA 5CQXA 4UY8I 1FIAA 4ZJZA 1XB4A 2UUAK 3J7ZO 2ZF5O 3KP6A 3CP8A 2FPEA 3REBB 4NLBA 2KISA 4FPAA 4GXOA 3BC8A 1PUEE 3MXIA 4KT0E 1XSDA 1KQJA 2HNZA 3F23A 4F8RA 2YXYA 2GOXB 1V4TA 1U5TC 2CS7A 4BJ5C 1KO9A 4PJOA 2EVRA 2J7IA 3LALA 5KAFC 4DSLA 2K9NA 3FX3A 4MEXF 2XKPA 4AD9A 2W0ZA 4B44A 3UPUA 4IHWA 1GV2A 3CCRQ 1R49A 1T3VA 2PAVA 1CZAN 3L00A 2JZYA 1T08B 4BAYA 3R2XC 1MBEA 2H09A 3RQ4A 4FZYA 2D0OA 1NK2P 1UOCA 5E1XA 3EG0A 3K5NA 5DYMA 2LTOA 2L3RA 4BS9A 3CC4A 5GAN7 4BYYA 2LRDA 1EETA 4PZJA 1R23A 3EG3A 2CWEA 2LFBA 1SL0A 3LWFA 2NNNA 1TWAJ 3K1PA 1AWWA 3J81K 2KYMA 4KNYA 4M75F 4E47A 4DR2K 2JWTA 2RDPA 3CJNA 5GAOm 1NJZA 4KGZB 1PU7A 3DLGA 3VWBA 4C8QC 4JK1X 3RCOA 2DIGA 4XONA 1LDDA 1KVCA 2VASA 3H92A 4JAXA 3JCMc 4I02A 3W3CA 5K5RA 3Q7CA 1YXQA 3TAGA 1JE8A 3I5SA 4CECA 4MFDA 2CYYA 2JQ7A 3VEZA 3KETA 4RCBA 5CKEA 1P4AA 2G8HA 2KLAA 2L4MA 3UKUA 3K4MA 2QWQA 4G6TB 3SUNA 1FYMA 1MMGA 2XUBA 2ZMEB 1HSJA 3GMEA 3KHYA 3BY5A 3KCCA 4M78B 4I76A 3I59B 1KLMA 4K41A 1RTHA 2QQ8A 1KEAA 1Z25A 4C0GA 2M7BA 4DYCA 1VQMI 3AVHA 3NFAA 3SD4A 4C0DC 3S3NA 1T33A 3HYIA 2JA8J 2HKXA 4KIFA 4DFPA 4M75D 4HX8A 1RAEB 1IV0A 4F93B 1STZA 1Q81C 4IHXA 2KIMA 2DT5A 3U1KA 2R7WA 1G8XA 4FWNA 3LM2A 2OA8A 3DTIA 4A5AA 1NOYA 1KHIA 2P9SA 3CCST 3JREA 5KE2A 2K9LA 2ZFWA 1VQ5Q 5IHKA 3L09A 4BGDA 1WNLA 2RHKA 4DK9A 3MP8A 1A5JA 1WHKA 3FSPA 3HOWJ 4M3BA 1RAIB 1YF5L 3P83D 1K6OA 3M8PA 1QHGA 2DVEA 2HFHA 3CCVI 3P1GA 3L3VA 3IUOA 1O1WA 1U3OA 2O31A 4XH1A 2MLGA 1O4XA 5KYXB 2L7KA 4X0GA 2DLPA 2DYBA 2QWPA 3L2UA 2DXCA 2F6CA 2BVLA 1OCCH 2HTJA 1M8VA 1HLUA 2WUSA 2H8WA 1HW2A 1N27A 5ICCA 3LSKA 1YJ9Q 2K86A 1U4BA 3DLHA 4OMFB 3H0DA 4X34A 1AZEA 3KD5E 1VRLA 2K9QA 3BR5A 3SCXA 3I56A 5HLIA 4G7OF 5GANh 2GEMA 1QE1A 1OU8A 1J3TA 4IO8A 1MHNA 2EZLA 1VQ7T 4FK2A 3BF3A 4CJSA 5CKFA 4YOWA 4HVWA 2V7YA 1YIJA 5GAN8 3HT3A 5GAGP 4CK3A 1DEJA 2LNVA 4J9CA 1UHCA 2PQ8A 4RTTA 4M7DF 4FJHA 4LDVA 3DLBA 1DQUA 2QW9A 1GLEG 5D8KB 4J83A 2A37A 4PK4A 4OLBA 4H5NA 3F73A 2LY1A 2VBWA 3MK6A 1B92A 1TVRA 1YVUA 1C0WA 2JA7J 4RTZA 2VT3A 4GCVA 4LD9K 2K3FA 1REPC 1T7PA 2D0PA 4GV9A 2VJJA 4BQLA 4DV1K 2OTJT 1MZBA 3M4OJ 2JUCA 2M1BA 1BQNA 2H56A 1BI2A 3MP6A 1E17A 4LDUA 2OF7A 2MPXC 2AKKA 2OX7A 3VS1A 3QSUA 2QBYB 3VGLA 3VSLA 2OCCH 2XB5A 4CGHA 2C0OA 3TCJA 2R5ZA 1W36D 4DTXA 2RHIA 4F55A 1ZH5A 5KYYA 1BO5O 1JUMA 1TAUA 3EGXB 4JS5A 1XGMA 1S72I 4D5CA 4LDYA 4QVDA 2KRMA 3KP3A 2M3AA 3HGYA 3G6EQ 5M1PA 2IC3A 3K4NA 4FX0A 3SHWA 2V1QA 3F5TA 1C6VA 1WEFA 2E1ZA 2G6FX 3K0SA 1CQTA 4ELTA 3RBBB 5GANd 4F3OA 1VSDA 5LJ5e 1ZSZB 2IDOA 1BBYA 1HX1A 3CCSQ 5F2RA 1Q86O 3ZT1A 4JJDA 2F5TX 2JSPA 5J2PA 2LMDA 2CH5A 1H3ZA 3P5JA 1HW5A 4FISA 4OPAA 1L3SA 2HEQA 1DP3A 5GADJ 1K8AO 2UXBK 2ZGYA 2MC4A 2HDCA 4NCGA 3E6BA 2E2QA 1B72B 4HUGA 4RM2A 4OAYA 2X3WD 1HRHA 2ESHA 4DSFA 3TU5A 4GYIA 1ARKA 3WVEB 4PFOA 1KRPA 1S1NA 1FYLA 4PGGA 3PUBA 3X25B 4DR4K 1E3OC 2G8VA 1YS7A 2V26A 1ASUA 4IG0A 2CT3A 1R22A 1SC7A 1YJ9I 2JVGA 4B1UB 1S8NA 3FZMA 2PBDA 1U49A 4H5RA 3BP8A 3N97A 3M56A 4I6MA 2DM1A 3RSEA 3SBGA 4A93J 3JTGA 1Q9XA 4LE9A 5IN1A 1WEGA 1SPKA 2XHIA 2PMHA 3FISA 1R71A 2HHWA 3S6WA 4QSHA 2P0QA 3RPUD 1HJOA 3M59A 1IBMK 1KYWA 5I2SA 3DV8A 1CKAA 4FWKA 2XHCA 1LB2A 3H9GA 3WTXC 4Q5WA 1KQSP 3BR2A 2YKMA 3M8QA 4DYQA 1B9MA 4E4HA 2HL5C 1YJWT 3JAMK 1F9NA 2E12A 3G10A 2F8TA 5JHUA 1IKVA 2P9LB 3VENA 3BPVA 4L5IA 5EZHA 2KLOA 3JV3A 2DBMA 2VYTA 4EJVA 2NVXJ 1T6CA 4P55A 4BR7A 2KT1A 5M5YJ 1KVAA 1X1DA 1KQ9A 4M75E 2LTPA 3FIFA 2YSQA 5EF6A 1I6HJ 3QDFA 4U67L 4JKAA 4GYGA 2VPRA 1BA1A 4KBMB 3OYEA 3EZ5A 2HVHA 1P4WA 5GINA 4FJ8A 2DETA 4KPYA 4XAXB 1YI2I 4R56A 5IXFA 1OCPA 1RT4A 4H0XB 4OAZA 2P9IB 1KC8U 3TGNA 3CCEN 2ESNA 3LLRA 4N41A 5GAMe 5FJ8J 2VG6A 4GLKA 1NGNA 1NEGA 1ZBSA 3A01B 2HD0A 2HNDA 2YHYA 1W1FA 3QNNA 3CCUI 5FROA 2LCLA 4C8MA 1IRFA 3EH2A 4M7DA 2DU9A 3JB9F 3ZMVA 2VVKA 1WZOA 4DHYA 2GIZA 5F64A 4LUDA 2KZMA 3E9OA 2VN2A 1V76A 3DKWA 1NGCA 3K70D 2P5KA 5HS9A 1WGSA 3ID8A 1NKCA 4RB2C 5CCAA 1U84A