3OY9A

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese at 2.55 resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retroviral intasome assembly and inhibition of DNA strand transfer.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oy9A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oy9A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oy9A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oy9A03
1OI1A 3KKRA 1WSIA 4FZYA 3IS9A 3SZ2A 2Z1JA 2EQMA 1W9HA 2IG0A 1S1WA 1LWCA 1IKWA 2X35A 2R7YA 3TWHA 3AV9A 3KLGA 2R58A 4BWJA 4B3OA 3ISNC 2F5KA 3A2FA 4LH5A 3SQ1A 3RWUA 1YTUA 3VQ8A 1NK6A 2P0KA 1U49A 3G10A 4FW2A 5K14A 4KAZA 3BDLA 4FJLA 4LSNA 4FJNA 1SV5A 4ZTFA 5CZ2A 5KE2A 4E7JA 1BL3A 3OYJA 4DS4A 1I39A 4DSLA 3QESA 3M8RA 2F96A 2XY8A 5KGXA 4DSJA 4FJIA 3OJSA 1RILA 3H8ZA 2ITGA 2A1RA 4DU1A 4FCYA 4DFPA 4C5EA 4EP5A 3PX0A 1RT3A 4KPYA 4CIGA 2RJDA 1BISA 1T05A 1KLMA 1RNHA 3E9FA 2PYJA 3KD5E 2OPPA 4ELUA 4OKKA 3LPTA 4JS4A 3NBPA 1TK8A 3NCIA 1DTQA 1GOAA 1KFDA 1VRTA 3MXIA 5EU7A 4CEEA 1ZYQA 1IG9A 2W42A 3OYKA 4OKJA 3CEYA 4CJWA 1J5OA 1J53A 2RF2A 5J39A 4CJQA 3MAQA 3DLKA 5E41A 4FJXA 3K2PA 3KK1A 2IGIA 2AJQA 1BGXT 3NTHA 3PUFA 4B9VA 3S3OA 3L42A 4C5HA 1WAFA 4O0IA 4HCCA 1RBTA 3LANA 4CK2A 4M3TA 2LSNA 3ZSXA 2OPRA 4CJUA 4F2RA 2GF7A 3K57A 1S5JA 3QEPA 2HHSA 2QXFA 1VSMA 1KVCA 1SKSA 1FKPA 1WJSA 3OYLA 2HQEA 1BIUA 2D0CA 3I0SA 4CHQA 3TANA 4K8ZA 3OQ5A 3LLRA 4AHCA 3CQ8A 4BACA 4AH9A 3WNGA 3B6PA 4CEAA 4Q5VA 4DTNA 1HYSA 1ZBFA 4AHVA 2Y1IA 3KKSA 2A1SA 4CHNA 1S6QA 4Z4EA 2MWPA 3L2UA 3OYEA 2YKNA 5CZ1A 1BI4A 4DQPA 2OZSA 4I7FA 3RRGA 2LVMA 3NGZA 1S9GA 2EQKA 1JXBA 1ZBUA 2IS3A 2ZD1A 1EX4A 3SUQA 4C8LA 3DOLA 4E7HA 4E3SA 4F2SA 4KHSA 4AILC 3HK2A 3QKJA 2YNIA 3OB9A 1B9DA 3MXMA 4G1QA 1RT6A 3PV8A 3PX6A 3MXJA 3DMJA 4IUTA 1RDDA 2R5MA 3JSMA 2RHUA 3MP8A 4A4HA 1RTIA 1X9SA 1RBSA 3UIQA 4E7LA 2O4XB 1QSYA 1TK5A 4Z0UA 3VQ5A 1K6YA 1U4BA 1LV5A 3LZJA 4OGEA 2XY6A 4CJLA 4CEBA 2WACA 2HHWA 4GW6A 2QKKA 3RR7A 3NTKA 4IURA 1DLOA 2G3RA 3HP9A 4Z4IA 3HL8A 4KTZA 4E7IA 3ZT3A 5J1EA 3M8SA 1WGSA 4KHQA 3FLGA 3DOKA 3OYFA 2RI2A 1C0TA 2D0BA 4Y1DA 3VQCA 2DIQA 2RHZA 1T7PA 4CCHA 4FJ9A 4O55A 4I9QA 2B4JA 4XIUA 3QNOA 3SJJA 1WLJA 2HNYA 3FEOA 4DTJA 4A4GA 3MEWA 1RT5A 4CF2A 4HUEA 1X9WA 2BDPA 4OVLA 2EQUA 3MEVA 4FM0A 2JZ2A 2X74A 4LSLA 4F3OA 3OYMA 1G15A 2XK0A 1IKYA 5C42A 1C0MA 3V9WA 1NKEA 4KHUA 3FFIA 4IFYA 1SKWA 4MQ3A 2O4GA 3HYFA 4Z4FA 5C24A 4CGFA 4FLZA 4AHRA 2I5JA 3RR8A 3SUPA 1LW0A 2G8KA 2IAJA 5SZTA 1BQNA 2OYQA 3CFPA 1XHZA 4DFKA 3DM2A 3OYIA 1JL2A 3OYDA 3VQ7A 3META 3NDKA 3VA3A 4FJJA 2VYTA 5HRPA 5HRSA 4Z4GA 1WN7A 4DTSA 4PQUA 4LH4A 3CFRA 5KTQA 4DSFA 1NKCA 1RI0A 4E1NA 5KI6A 4KB1A 1KHCA 3DLMA 1WSHA 3ZSWA 4AHUA 3P83D 1BIZA 1RTJA 3AVGA 4DMNA 2RJFA 3AVLA 2XDPA 3WNHA 4CK3A 5I42A 3LX7A 3ALYA 4B9MA 4FK2A 4CGHA 3IG1A 3LAMA 1KVAA 4CRIA 3HSTB 4DTPA 1W0HA 3OYHA 2X4XA 1IH7A 1SL2A 5J26A 1I3AA 4AHTA 3DRSA 3OVNA 4KFBA 3TAEA 4Y1CA 2FBXA 3SQ4A 3IRXA 3NAEA 3GOXA 1Z25A 1RBVA 4ID5A 3V81A 2G8HA 3RMDA 4N41A 4DF4A 2HVIA 4QQGA 1JLCA 3V1OA 3PX4A 2B8AA 3PMTA 4PUOA 2E6NA 1CXUA 3DYAA 3QIPA 3S3MA 3ZSQA 3NTIA 3K5NA 3ZSRA 4CFBA 4E19A 4FLYA 1NJZA 2GBZA 4CEZA 1A5XA 1RT7A 3DLHA 4K8XA 1VSJA 2F8SA 1LAVA 2D0AA 2GFAA 1IO2A 4IUQA 1NOZA 2YNFA 1A5VA 1TKDA 3F73A 4DTOA 2P5GA 2K3XA 1JLEA 3OYBA 3C6TA 4RW6A 3VQEA 3V9ZA 4C5IA 1JL1A 2Z1IA 4CGJA 4FK0A 1J9AA 2PZSA 3ZT1A 4DU3A 4B9XA 4IUPA 4IG3A 4CERA 4N56A 1LAWA 3VQ4A 4EDUA 4A4EA 3F9KA 4OPJA 2X4WA 1NK9A 2KZZA 1QHTA 2FBVA 3OS1A 1RCHA 3OYGA 3FC3A 1HYVA 2L89A 1WSGA 4LD0A 3VQQA 3P8DA 3ZT2A 4E7KA 4CF9A 3LWLA 1WSEA 1SKRA 1EP4A 1Q9XA 2MWOA 1TK0A 4J2AA 4Q0BA 4CJTA 3P8HA 4JLHA 1L3VA 1RT1A 5CIUA 4NCGA 4N4GA 3EAEA 2XY7A 5D3GA 1S1XA 3CM5A 5KH6A 2ETJA 4QAGA 1JLGA 3K58A 3RMAA 1QSLA 3HP6A 2G8UA 4N4IA 3M9QA 5HBMA 4H8KA 3CFOA 1TAQA 3NH0A 4FK4A 1WJRA 2YV0X 3QIOA 1ZBHA 2E6LA 1FKOA 3VQ6A 3C95A 1U47A 3EY1A 3LYIA 4HUFA 4DSEA 3TABA 3LAKA 3SYZA 4CGDA 2RI3A 1NK8A 4TSXA 1WJQA 2OA8A 3OS0A 3S6WA 1WAJA 3V1QA 4M45A 4KREA 4FLUA 3NHGA 5KRTA 2G8IA 4Z02A 3TARA 4B9SA 2IOCA 4L59A 2YKMA 3AVIA 4DFMA 2BUDA 2RJCA 3AVJA 3OYNA 3O4NA 3V4IA 4F4KA 3V1RA 4CHZA 4CEDA 5KRSA 3F70A 4NS5A 1L3SA 3L2WA 3AO4A 4C8NA 3O3FA 1R0AA 4L8RB 4A4FA 3AVNA 3SPZA 1QE1A 2HNZA 3ZT4A 4KKOA 1UAXA 4W5QA 3V6DA 3O3HA 2HW3A 3LH0A 4O5BA 3DRRA 3HVRA 3L2QA 1HQUA 3ASKA 3B6OA 2RI5A 3DLBA 3E01A 2KFZA 4BD3A 3QNNA 4QW2A 4F3TA 4CEOA 3NH2A 1BHLA 1HPZA 4DU4A 4FJGA 4CJVA 3KTQA 4EP4A 4FJKA 1NJYA 3VQAA 3PY8A 1OYXA 4C5GA 3SCXA 3DB3A 3L3VA 3AVBA 4CGIA 4OVAA 3AO5A 5M9OA 2JGUA 2IC3A 5DK5A 5IN1A 3O3GA 3SV3A 2G8WA 4PY5A 3L3UA 3U3GA 1L3TA 2EQJA 4RG8A 1SL0A 3PO4A 4DTXA 3HPHA 5FRMA 3LP0A 1GOCA 3TR8A 1OZ2A 3O8VA 3M8QA 3ZSZA 4CF8A 3QERA 4QCLA 2P5OA 1JLBA 1D9FA 2CKKA 4FLWA 4GMJB 1ASVA 2B5JA 3EYZA 1NK4A 2M1HA 1VSHA 4BE1A 3QLHA 3WNFA 1UOCA 2RHXA 3KLHA 1KCFA 1TL3A 4RW9A 5CY4A 5HRNA 4DS5A 4RW7A 1NKBA 4J2DA 4DTMA 3DLEA 3AVAA 1U04A 2E5QA 1REVA 3CYMA 3DLRA 4CGGA 5J2QA 2FHDA 4LD6A 1F21A 2RN2A 2VG6A 3NH1A 4C8MA 5SWMA 1TV6A 3QEWA 4WE1A 2ZE2A 3RMBA 2RHYA 4CJKA 1S1TA 4M3WA 3MEUA 4NYFA 3V9SA 2RKIA 4HCBA 3LP2A 4F8RA 3LGFA 1CXQA 1S9EA 2P51A 3QINA 4IBNA 3HO1A 1BI4B 3KUFA 4KTQA 4B9NA 2WONA 1JLFA 1TGOA 4KI6A 4FVMA 3VQPA 1ASWA 1VSFA 4FZXC 4NCAA 2RHIA 1GOBA 2X6NA 4CK1A 2YRVA 1CZBA 4CJPA 3HM9A 3AA2A 1U48A 4QQ6A 4DG1A 2LCCA 2IDOA 1IKXA 4BDZA 4FW1A 3TAMA 4J2BA 3JYTA 1RT4A 1VSIA 3ZSOA 2RPIA 2ATQA 1RDCA 4I2PA 5FROA 3OYCA 1XHXA 1ZBLA 4DWIA 3SD4A 1BCMA 1ITGA 2HHTA 3E9GA 3QEXA 2HHVA 5C6SA 3TAPA 2G8FA 3NF7A 1S1VA 5KGWA 4FJHA 3HJFA 3QEIA 2VG5A 1JXEA 4KRFA 4FJ8A 3AO1A 4KB0A 4QOZB 3AA3A 3Q1JA 3QJ6A 4ID1A 2HHXA 4OPKA 2B6AA 4PLLA 4B08A 3KLIA 3DB4A 1TKZA 4M3ZA 3BGRA 4QQDA 5KCHA 2P1JA 4W5OA 4DQQA 1KTQA 3U6FA 2XY5A 4II1A 4CF1A 2NLUA 3ASMA 4DSIA 3L2RA 3QBYA 3K5OA 4O44A 4M3RA 2M16A 1QS4A 2HNDA 1RTDA 2OZMA 4BE0A 3OMGA 1WSFA 3MEEA 3K59A 1FK9A 2R5AA 5D6WA 2DFEA 3VN5A 4CJSA 4CFCA 4E89A 1CLQA 1LW2A 4Q5WA 4OJRA 5IAYA 1X1PA 2FBTA 1C1CA 3KD1E 4CF0A 3SQ2A 1HMVA 3SV4A 1QQCA 1VSKA 1TL1A 2YHAA 3MEDA 4B8CA 4CJ3A 1KRPA 3AVMA 2KW4A 4BE2A 4H4MA 1TKXA 4GVMA 4BWMA 1HJRA 3KLEA 3KJVA 3SQ0A 1EKEA 1SL1A 2HMIA 2BGGA 1XI1A 3LGLA 4HHTA 3AVFA 2BANA 2JTFA 4FJMA 2XRIA 4B9LA 4KI4A 3I8DA 4FL6A 3ZSVA 2DAQA 4HVJA 1KLNA 2G8VA 3LWMA 2PYLA 2PY5A 1B92A 3CM6A 3NNQA 1TKTA 3H6ZA 3D45A 2ZQBA 3RRHA 4KV8A 4FYDA 3LP3A 1VSLA 3MP6A 4FJ5A 3LZIA 1N5YA 1NK0A 4O0JA 1QSSA 2HQXA 1TAUA 1L3UA 3KLFA 5D6XA 3K5MA 2EHGA 3NF6A 4CEFA 4M42A 4OKEA 1D5AA 1VK0A 4MFBA 1JKHA 2BIVA 4O4GA 2RO0A 1A5WA 4CIEA 5C25A 3NE6A 3L8BA 1EXQA 2F8TA 2HVHA 1DTTA 3OA6A 4JRQA 3SNNA 3DLGA 4CESA 5D6YA 4B9WA 4H4OA 4KHNA 2Y1JA 2FC0A 3U3YA 4J2EA 4E0DA 4M3XA 3V9UA 2VG7A 2X6SA 4HUGA 1UA0A 3ULDA 2HHQA 1RBUA 1NK5A 4DLGA 2EX3A 4M3YA 2E4LA 3AVHA 4RW4A 4YNQA 1U45A 3P5JA 1IKVA 1XC9A 4PWDA 4CJRA 4DTUA 3AA4A 3PMIA 4JRPA 1YVUA 4HTUA 1YT3A 3L2VA 4UC4A 3I0RA 4NYNA 4N47A 4YFUA 1UA1A 4C8KA 3OYAA 2DY4A 3H08A 4N5SA 3RMCA 4UQGA 4DSKA 1RT2A 5FRNA 2GV9A 2KZMA 2Z1GA 3NGIA 2LTOA 3ZSYA 3OY9A 1CZ9A 1HNIA 5J2MA 4CJ5A 1RTHA 4EZ6A 5DMRA 4PLIA 4ZHRA 4FZZA 4IKFA 2KTQA 3C6UA 4FM1A 1VSDA 4W5NA 3LPUA 3HVTA 3WNEA 4CJFA 5HRRA 3KK3A 3BDPA 4ELTA 3NF9A 4Z4HA 2O4IA 2QK9A 3EZ5A 2DFFA 5FDLA 4IDKA 1EETA 1ASUA 2BKDN 1S1UA 3OJUA 1NJXA 3NFAA 3ME9A 3T3FA 3QEVA 5I3UA 4JS5A 2E6MA 4B9TA 3MO8A 4KTWA 1C1BA 1N27A 1SUQA 2FBYA 4CEQA 1RDAA 4R5PA 3PO5A 3FDRA 1C0UA 3C94A 3PNWC 5CYMA 1T8EA 3S3NA 3OS2A 3TAFA 2DIGA 2KFNA 3DI6A 1Q9YA 2DTUA 4NZGA 3UT1A 2DFHA 1FXXA 4C8OA 4FU6A 4CIFA 2XO7A 1J54A 5HLFA 1KFSA 3S9HA 4FLXA 4DTRA 3D0PA 1Q8IA 1OZ3A 3HPGA 1MHNA 3ITHA 3VQ9A 4AHSA 1KVBA 4DQSA 4I9LA 4DQIA 2L3RA 4LY7A 4RW8A 1LWFA 2BE2A 3O4QA 5CYQA 4FLVA 3THVA 3C4SA 3P1GA 2VWJA 4W5RA 2YNGA 3HXMA 3AO2A 3SPYA 2YNHA 3TI0A 2X4YA 2YHBA 1N6QA 4EZ9A 2HB5A 5J2NA 1WSJA 2R57A 4CJEA 2D5RA 2Z1HA 4E1MA 4Z4CA 4DFJA 3QETA 2K3YA 2EKOA 1Z26A 4IUVA 3G0ZA 3LP1A 4IFVA 4KO0A 1RDBA 2O4XA 2OPSA 4IG0A 4ZTJA 1T03A 4OLBA 1ZBIA 1YTAA 4BDPA 4ELVA 1BQMA 2GFUA 2PQWA 1RBRA 3TAQA 3PFSA 4CE9A 2QKBA 2Q3SA 3VQBA 3HPOA 5T7BA 3LDSA 2QQRA 3V9XA 1JLQA 2NUBA 3OMCA 3KK2A 1L5UA 1KSPA 5KE3A 4N76A 4B8AB 1TVRA 4X34A 1S6PA 3LALA 4FJ7A 4IUUA 5J2PA 4PL6A 1H3ZA 4KHYA 4CJ4A 2LRQA 4M41A 5HP1A 2QQSA 1Y97A 1HRHA 4PA1A 3DRPA 4CECA 1O1WA 3AA5X 4CHOA 2XHBA 4NCBA 1B9FA 1XWLA 2X78A 4OLAA 4CHPA 5JS1A 3K5LA 5HROA 3HT3A 1WNSA 4I2QA 3TAGA 1LWEA 1JLAA 2RJEA 1VRUA 3QO9A 3AO3A 4KHWA 1C1AA 2EFIA 2LDMA 3ZT0A 1QTMA 4CFAA 4DF8A 3T1AA 3ZEHA 2KQ2A 3CG7A 1NK7A 4CHYA 2HHUA 1HNVA 2M0OA 4M3UA 4HCZA 3MEAA 3AVCA 3NGYA 4RG2A 1XNIA 3SUOA 4B9UA 1HQEA 3QIIA 3MP1A 5C0MA 3UWNA 4W5TA 4FLTA 1D9DA 2L8DA 3SUNA 3T19A 4CFDA 1X9MA 1NOYA 1VSEA 4ICLA 2D9TA 5JS2A 3M8PA 3RTVA 4GY5A 1NJWA 5KCOA 1MU2A 1SSFA 2GUIA 3KIOA 1UWBA 4FM2A 4N4HA 1HYZA 3MECA 3AVKA 1BCOA 3ZCMA 4DQRA 3NF8A 3VA0A 3SI6A 1D8YA 3IAYA 2WOMA 2VWKA 3VQDA 2OPQA 2JLEA 1C6VA 3MEGA 4DLEA 4OGCA 4FXDA 4BDYA 4QVZA 1G5VA
chains in the Genus database with same CATH superfamily
3CJAA 1BN5A 3ISNC 3A2FA 2FF4A 2P4RA 2QA4A 5FPMA 3J7ZO 3WUHA 3DXMA 3O8MA 4D7MA 5AQXA 2F96A 3REOA 3OJSA 1T05A 1T98A 2M8EA 2O61A 3A5ZB 3HSCA 2HBPA 1VF9A 1J5OA 1NBEB 1TYQB 3H35A 1FJGK 5FKNA 4D9JA 4IRGA 2FBHA 2GF7A 5IYDJ 2P9LB 1FBSA 2JPCA 1AHDP 3FB9A 1V4TA 4CEAA 2ZSIB 1V5FA 2FZGB 4CHNA 2DOFA 1K0SA 3SFIA 2LVMA 3LDOA 3QU3A 4HLYA 4S04A 2XF5A 1VQPQ 4HEA2 2DLLA 1VQ5N 3CJQB 1G2BA 2E5ZA 2ID6A 5AQOA 4NC8A 1K6YA 2L2OA 1GL5A 1NGCA 3JREA 2H1LA 2HHWA 2IA1A 2P9PA 2WBNA 4FWSA 1C0TA 2D0BA 2DL5A 4I9QA 3KLNA 4K41A 1GCQC 1VQ5Q 1IKYA 4FX4A 1E3HA 1FIAA 2CH4A 4KMUX 3HM8A 2ED1A 4DFKA 1Y0UA 3FZHA 3ABKH 1KEAA 4RTUA 2OA4A 2L0KA 4S0HB 3JRGA 1OR7C 2XDPA 2JRTA 3LX7A 1PKSA 2E2PA 3OVNA 1G8XA 3RMDA 4DF4A 2M02A 3CCVQ 4FYWB 4XH5A 1CXUA 3S3MA 1R77A 3Q5FA 4FL9A 3ZSRA 4FLYA 5DCMB 1OX8A 2DL7A 4I76A 2DYIA 1SQKA 2Y9ZA 3GUDA 4LUEA 1SRMA 2QA4N 1NG7A 2P7CB 2NUPA 2RA2A 3G1OA 4UV8A 2ZXHA 1AWXA 4YORA 3MX5A 3VKIA 4LD0A 3SBTA 3IAM2 4BRQA 3W3CA 3K6GA 2ECBA 1S1XA 4B23A 2FEIA 2XHCA 5DEQA 3K4LA 3HOTA 1VQ9I 3QIOA 5DD4A 3S32A 3GFIA 2DODA 4FSXA 1S3JA 4L9VA 5CVJA 5J8CA 1YWOA 2BZYA 4GLKA 3K9TA 1P90A 1KG6A 1FNNA 3HVRA 1C0WA 1N8RC 5BRHA 4IXAA 2KFZA 1YJ9T 3KTQA 4J9HA 1HSJA 2V1NA 1NJYA 1BYMA 4ZZDA 3KFWX 3SV3A 5M9OA 1KD1U 3LSRA 1SAUA 1ZLKA 1ASVA 3CZ6A 1RADB 2UXBK 5CY4A 5GP9A 5J40A 1NGGA 2N8GA 2FHDA 4LD6A 2VG6A 2MG4A 1R0CB 3RJPA 2X6OA 1FTTA 3KFVA 2ZPEB 2NUTA 4KUMA 1BI4B 2WONA 4FVMA 4FZXC 2RHIA 4OWRB 1WPYA 1M3AA 2LBFA 1OVQA 3AA2A 1YBYA 2LCCA 3PIOF 1RDCA 3NRVA 3OBWA 2PVGB 3M5RA 1UG1A 1BK2A 2XDBA 3EHRA 5K7FA 2O8CB 5D8KB 3M6GA 2DQRA 1M1KU 2E12A 2RQRA 2F48A 4M7AD 1WCMJ 3EG2A 2P1JA 4II1A 2IVPA 2O03A 2NLUA 1VQ4I 4K43A 1KAYA 1FBUA 2JA2A 2CUDA 3F8NA 1J0RA 4CJSA 1CLQA 2L9NA 4PJMA 2ESHA 1VSKA 3GF2A 3MEDA 4MO7A 4C92A 3RVCA 1HJRA 1NLOC 3ZR8X 3VS2A 3VEWA 4KI4A 5GAMe 2DAQA 3H6ZA 3BR1A 1VSLA 3MP6A 1N5YA 3G71A 1IO6A 3R6NA 5D6XA 3BT9A 4I6MA 4IRIA 3GF5A 1U06A 2P4WA 4BGAA 3HGYA 2PG4A 2M7BA 3EG9B 4L5GA 2X6SA 3LA3A 5ERIA 5DCMA 1RAFB 1RBUA 4A3CJ 2ROTA 3ATUA 1LCUA 2OTJT 4HYEA 1XC9A 4HQMA 4JRPA 1R59O 2BW3B 4XR6A 1YT3A 1N5ZA 3QOEA 1UFMA 4PGGA 2ZSHB 1JGGA 1QPMA 3HVTA 2ZM6K 3RZOJ 4KH6A 4BEHB 4B9TA 1IZ1A 3MWPA 1YITT 1YHQN 4XNFA 4M7DA 3LA2A 3DI6A 4FWRA 1R00A 2FX0A 2H6BA 1L3LA 3Q7BA 4DQSA 3CCEN 2E7WA 4B3TK 1YXQA 1W5CC 5C0YA 3ID6A 2DF6A 1VQNI 5M1PA 4IFVA 1T03A 4LB5A 4J9EA 3BZKA 5F0CA 1W7PA 4DR1K 4X34A 3A1YA 3CMAI 1Q7YR 4AVPA 1M90R 3F6OA 1VQMA 2I10A 4KHWA 1LWVA 1Z67A 3SK3A 1NPPA 3ZQCA 4A12A 3MPUB 4HCZA 4KH1B 3OOUA 2PQ8A 1MU2A 4WYBA 1WXTA 4B3AA 2EK5A 3ZQIA 3H6EA 3WTTC 1QKWA 1ZBJA 1YQKA 2WOMA 3D1NI 2DI3A 2JZYA 1C6VA 3VETA 4CZIA 3DXJF 1S72A 3SWNA 4YIFA 4M7DB 3F72A 1HW2A 5JLXA 2W7NA 3SQ1A 1B07A 3VQ8A 3HM5A 4M9SA 4FJNA 3CD6T 1R1VA 3BEXA 2DYBA 1BL3A 2L54A 3INZA 4DS4A 1UHCA 4N0AC 4FJIA 2W82A 3R9PA 1ILYA 3MKWB 5LRRA 4EMKB 2OPPA 1B72B 3SEZA 3MZHA 1VQ7A 4M77D 2GBQA 1OFCX 1TUYA 3VEOA 1HDPA 4NQWA 3K2PA 1YG2A 1IGUA 1YIOA 3REBB 3FM3A 4HDVA 4C8QC 3G6EI 2CV2A 1HDDC 3I55Q 1P7JA 2M0MA 1UUEA 1IV0A 4BACA 3K1MA 2QCOA 5AQQA 2HKXA 1LE8B 2VE8A 5LJ3d 3CCVA 1J09A 5E3LA 5FO5A 2DBKA 4FTHA 3GZ6A 2FF6A 3VJPA 2O4XB 4LG3A 1SD6A 3LZJA 4OGEA 2XY6A 1EH7A 3VYSB 1FOYA 1PUFB 2E19A 3CXCP 2D2WA 1ATSA 1TC3C 4KHQA 4KT5C 3FLGA 5CHIA 3CCUI 2EH3A 1KU9A 1MBEA 4QS9A 4HNVA 4DV2K 5ICCA 2HBMA 4F7UA 4CF2A 3U4LA 3PIOL 1H0MA 1NKEA 1H8KA 5GAMg 4Y92A 3P4IA 4BG9A 2IAJA 4DQ2A 5SZTA 2UUBK 3DM2A 1SC7A 1KC8R 3CFRA 2W25A 2WSFE 1TWBA 5E3NA 1S7AA 3CJNA 3CCRA 4MDWA 3AVGA 1STZA 2HGCA 4FK2A 5HLIA 4U67L 1DPRA 3EGDB 7AT1B 3E97A 3AAFA 1P4WA 2OQRA 3THKA 2B8AA 3KCCA 3NTIA 1V5EA 1YTYA 5AQNA 3CWUA 1R1TA 5KVRA 4CZLA 3F0ZA 2P5GA 5ICFA 2Y4XA 2GTOA 1UE9A 4B9XA 3VENA 3QRFF 1QVGA 2X4WA 1SEMA 4U7DA 1WHUA 5GAMj 2ASMA 2CW7A 1DGRM 1ZR4A 2FXUA 2F7TA 3C2HA 1VQ6T 4DR3K 1Y8QB 2QA4T 3EY1A 4EIKA 2ID3A 3LWHA 5E17F 1WAJA 5KHDA 4DR2K 4Z02A 3CMEQ 1FYKA 3O4NA 2F4MB 3N4QA 4G12A 1XCVA 3LH0A 5FU6B 3UNGC 1V54H 2RI5A 4YOUA 2QQAA 1HPZA 2W6KA 4EP4A 4UB6C 1U84A 2H8WA 4EVVA 4NOYA 3PY8A 3VB2A 3AGKA 3FBNB 2YLBA 3UE5A 4JLGA 1IXSB 4MNUA 1WI7A 2E5NA 5DTDA 2QWNA 3CWSA 2CKKA 2ADUA 3M1EA 2CP6A 3AAQA 2WSEE 5J2QA 4EJUA 2FF3B 2KXDA 4FASD 4GY2B 4HVVA 3FK7A 4WE1A 1TNTA 2ZAEA 1DDNA 1S1TA 2QBYA 3SDGA 3IMXA 1V29B 1DT9A 1ASWA 1SZ2A 2EKHA 4IOAF 4CJPA 2DK8A 1ZQ1A 2R4GA 1AKHA 1YI2N 4F55A 3HOXJ 5LJ3e 2HHVA 3NF7A 2XRNA 1M1KR 3IQLA 1K8AU 3H3ZA 2O8CA 2G0EA 4B08A 3BGRA 2Q2RA 3L2RA 3T5XA 4M77B 4C30A 3K5OA 3G6EA 4HX8A 2CS7A 1UZCA 3JW4A 1LW2A 1YIJA 4BE2A 4BWMA 3KJVA 1JKPC 4Z88A 4B1ZA 3LAJA 4O5VA 3C2BA 1P6RA 2G8VA 1YJNQ 2XD0A 2YRCA 3CM6A 3HKZA 2ZB9A 2FOWA 1QSSA 2HQXA 2D1VA 3LSJA 2EHGA 4CEFA 3V7SA 5FKKA 3CCMQ 3B73A 1K8AO 2KEAA 3S2WA 3L8BA 3A8MB 1B1BA 3CCRI 4XKCA 4B44A 4E0DA 5AQVA 1Z6RA 4BQNA 4M77F 2LF8A 3A98A 4DV1K 4YNQA 1U45A 3LM2A 3P5JA 3FJ5A 3OIQA 4HTUA 4UC4A 4C8KA 2DJNA 3JB9G 3H08A 3U23A 3M0UA 2GV9A 3OY9A 3LL3A 3MKZA 4OMOA 2QGGA 4CC4B 1POGA 5LMNK 4A69C 2EZKA 4FOIA 1LFUP 3FXOA 4KTWA 4BJ5C 3LQRA 2MH2A 3RKWA 1T8EA 1I5ZA 2A07F 3Q0WA 5AONA 2JT4A 2RNGA 2A0FB 3CBPA 3MHXA 4LF4K 3KETA 1FP2A 2NUTB 3GWZA 2YX4A 3PL8A 3T0YA 5K7HA 2Q2EA 5GIOA 5CYQA 1S5LC 1RL2A 2COYA 2RQPA 4XTZA 4RWTA 1YHQA 2QAZA 2KRSA 3H9JA 2FO0A 4LLLA 2RGVA 4H0PA 4OLBA 1BQMA 2M0CA 2HVQA 3PFSA 2QKBA 2R7FA 3B6CA 4BBRJ 1RR7A 4G7OF 1RACB 4IUUA 3VDXA 3CW7A 1Z1DA 4D5CA 2WTEA 5JS1A 3VYGA 1J5EK 1MIJA 4M75G 4KIBA 1Y0NA 1Q7YC 1VQOA 3AO3A 2WFBA 4BJTA 2D0PA 3KYDB 1HNVA 2A3ZA 4M3UA 5LEKA 3LSTA 2M87A 2VPLA 3QIIA 4A0ZA 5IYBJ 5KPRA 3LSIA 3WGGA 3AVKA 3E5QA 1GRIA 1ORKA 5CCAA 4WQ5C 1YP5A 2RDPA 4G9ZA 2W57A 5LD2C 1WOQA 1S1WA 3TWHA 1IKWA 2GA1A 1SAZA 3RYPA 4KICA 1U49A 4K0KK 1OKRA 1U9OA 3HHGA 3BDLA 4LSNA 2V7FA 4JAXA 3OYJA 4DSLA 3EKSA 5CKEA 3QESA 3U21A 1G83A 3M58A 2RAEA 2OAUA 1YI2I 4DSJA 4DU1A 2Q97A 4DFPA 4EATA 4BR7A 1TK8A 1U3OA 3MXIA 3VFZA 4CZGA 4N4NB 1A0NB 3M0PA 1TLHB 3K2AA 1MBGA 1XC5A 5JFRA 3LDNA 2DA5A 1ZBXA 3LANA 4DBHA 2HYJA 4LDVA 1K73U 4KN4X 3MCZA 4HW0A 1KFZA 4CJUA 2A69F 2RKHA 1BIUA 2D0CA 2J4RA 3B6PA 5F0HA 3FISA 1UG0A 2KKOA 3CMAQ 4B3SK 2JMWA 2PTKA 1EX4A 3JRHA 1B9DA 2KIFA 3MXJA 2ZFWA 1X9SA 2FPFA 3SXYA 1RBSA 1Q86C 3TBIA 1T38A 2A7YA 3ZX3A 3PT9A 2YSRA 2X6YA 3JS6A 4Y1DA 4R56A 4CCHA 5FD6A 1KD1R 3WEEA 5CPRB 4RB1A 3I58A 4CA0A 1Z05A 3HPWA 4EJZA 5BR8K 2BOLA 3ZP5A 4F7UB 5J4VA 1I6HJ 4G7HF 1FW6A 1HF0A 3WTZA 1JL2A 3VQ7A 4LH4A 4OMNA 2JUGA 2DDAA 1RUOA 3CVSA 3CVTA 2ZGZA 5KYUB 2FLOA 1KQ2A 3QP6A 2L9SA 3K2ZA 1TQPA 3BY6A 2FBXA 1V5GA 2DT5A 3ULQB 1NGJA 4N41A 1DP7P 1EV7A 4PUOA 1QVFA 2GBZA 2Z5UA 4C92E 4M78A 3PNVA 1RDWX 1TT5B 3CC4Q 3OYBA 4PNOA 1AOYA 3KLOA 4PKGA 3DBLB 3HGGA 3VS7A 1D3YA 1RKTA 3FC3A 3CC2I 2L89A 1WSEA 3KEYA 1M1GA 2M30A 1HSTA 4L9TA 5EEHA 1E6GA 3CJBA 3J7YJ 3CF2A 4A5BA 1JKOC 1TXQA 1K9MC 3L9FA 3P39A 3VS4A 4A93J 3JRAA 4DFMA 1MBFA 2BUDA 4JKBA 1WBDA 2O8DB 3F70A 3HL2A 1UB4A 2XI9A 1NMNA 2Y48A 2VQEK 4A4KA 3HIFA 4CD1A 5D4SA 4C5GA 4BL0B 3AVBA 2VKVA 1T2KA 5DK5A 5IN1A 2KR3A 3T8RA 3FXQA 4O3MA 5LJ3h 3S2DJ 2DM1A 5GAN6 4GVEA 1HD3A 1DKGD 2K5LA 3AFHA 2ESWA 2JS0A 1F21A 3NWTA 2EJRA 3HOVJ 3ESWB 2HR3A 3M3YJ 1ETQA 2K02A 2EA2A 2HDCA 3L7WA 2WV0A 1JLFA 5HLHA 3TSQA 2K2MA 2DXBA 1N9RA 2IDOA 3F8FA 2P5VA 3JYTA 1VSIA 5HS8A 5FROA 4LDUA 1ITGA 3QUIA 1VQ8T 1X6BA 2OI3A 3QEXA 3G0QA 3I56I 1X9JA 4JD2B 3DV8A 5BNGA 2GX9A 3I59B 1Q7YO 4OPKA 2B6AA 3DB4A 3FKIJ 3CCJQ 3DJCA 2XY5A 4JKGA 4A61A 3NQOA 4XK8E 5LLQA 4A3MJ 3RDIA 4XSZF 3MEXA 1P4XA 5D6WA 3FX3A 2D8JA 3PFIA 4CFCA 3CF5L 5DUIA 1MNMC 2Y90A 3KLEA 3TQNA 1ZUUA 3ZMTA 2JTFA 4FJMA 2VBZA 1U8RA 2XGXA 3LWMA 3VOEA 1B92A 1RKWA 3LP3A 1RRQA 5LGNA 3H9NA 3ZQQA 3QBXA 3IRQA 5CVUA 1VQ7T 4OKEA 2HVHA 4AWXB 1YFHA 4JX5A 4J83A 1MD0A 5D5VB 3CUOA 1AWJA 3I56T 2CSIA 1ZBSA 5B8HA 2VUMJ 2RH2A 2CO5A 5GANh 4NC6A 3L2VA 1R71A 1YWPA 4AM3A 2Z1GA 3FXKA 3NGIA 4AI4A 2DXIA 1EETA 1S1UA 1BKBA 3QEVA 5CJ9A 1C1BA 3I54A 1OEBA 1ORNA 2FD5A 3PE0A 2R5ZB 4IHTA 5AZIB 3OS2A 1KU7A 2DPNA 2J5OA 5GAHJ 1Y6IA 1VQ7N 1IN7A 2R7TA 3LSGA 4NBQA 4RBOA 2BE2A 3PLAA 2J7IA 4B1RA 4XMYA 3THVA 3A01B 2P81A 3OH6A 3DQVC 3JCMb 3AG2H 2D5RA 2PUOB 4IG0A 1KIKA 4BR5A 1X1CA 2I5UA 3CCSA 2GOXB 2E4HA 3EG1A 3CXCA 2EAYA 3LDSA 5KE3A 1GLCG 3LALA 3FK6A 3ABUA 4J9DA 4M41A 5HP1A 3O8GA 2COWA 5IHKA 1B8IA 2QTVA 3BFMA 4OLAA 4UUSA 2L2PA 1UEBA 1YRNA 2F4IA 1LWEA 1M3HA 4KBMB 3BJ6A 3CCQT 2BZXA 4BRPA 2CGJA 1NK7A 4CHYA 1HYOA 5CQXA 4WCEL 2QWLA 3G25A 2E34A 1Q86R 2W10A 1WYXA 3FIWA 3I9QA 3L00A 3MJXA 2EW3A 2E1ZA 3OSSC 1Y8RB 3FMQA 1D3BA 4OGCA 2Y4YA 1QVFP 5M5XJ 2DK3A 3IS9A 3SZ2A 1GBQA 3FZFA 2EIMH 4F93B 3KLGA 2R5ZA 5AZIA 4UVCA 3R8EA 1EO1A 5IP7J 4YDUA 4ZTFA 1PRLC 1SSHA 3UDCA 3OHRA 3A01A 5CKFA 4WK8F 2O8BB 2A1RA 5B66C 4KPYA 3K70C 5KAIC 4F14A 3CCEA 4J6XA 4A5NA 1QO0D 2V6EA 5LY3A 3JAMO 2OD5A 4CJWA 1FMKA 1Z77A 3QWLA 2MSYA 4FJXA 4XEIA 1Y71A 5B1BH 4K42A 1O75A 2YR2A 1W36D 4H5WA 5GAMf 3OTOK 1WJSA 2K86A 3CJRB 1KA8A 5L3EA 3K4CA 1JCEA 2Y1IA 1GCPA 1S6QA 1BC7C 2QEXI 2DILA 5CZ1A 1OCZH 1Q81C 1Q1VA 3BZCA 1RI9A 2IS3A 1LNWA 4E7HA 4AILC 1UHFA 1VQKT 1NGAA 4JK8A 3KE2A 1T33A 1LQ1A 3CC2T 2E5LK 3T1BA 5HS9A 1TK5A 2KISA 2K5CA 4YFNF 3ZQ7A 1T0FC 2WACA 1YLFA 3HL8A 4JRKA 2VJ5A 1OH8A 3VQCA 2RHZA 3B02A 1W6XA 3VODA 2B4JA 3CQXA 5TGTA 2V1UA 1MZBA 2EQIA 3H5AA 4LSLA 2XAJA 1G15A 4BGBA 1M2OA 3VESA 3FFIA 3TO9A 1XG1A 2CWEA 4FLZA 3EUHA 4JBAA 1VQMI 4AHRA 3VU3C 3SUPA 1LW0A 5D6EA 1QVUA 2VQLA 3META 3QFPA 4KIGA 2L3DA 3OMYA 1WSHA 3P83D 2YJFA 4DR6K 3CPWA 1TYQA 5LJ5h 5GAN3 3SQ4A 2OF7A 3HOWJ 5BQTA 3LL7A 3ONQA 2LX7A 2JVGA 3NGPA 4CFBA 3I8BA 4Z8AA 4II2A 2D0QB 2Z99A 3V9ZA 3M53A 1KC8U 2Z1IA 1AZEA 2JJ7A 2EGEA 1ZXOA 3KTUA 1B59A 1NK9A 2V1QA 1R9TJ 2JWLA 5JLHA 3GG4A 1A04A 5HL7L 3K58A 1VQ9N 1YAGA 4N4IA 1TAQA 5DM6L 4EJVA 2P9PB 3VQ6A 1YITI 1YI2T 3OS0A 4A3KJ 1WGXA 4ILGB 5M1NA 4HT8A 3AVJA 4CEDA 5J4YA 3L2WA 1OKJA 2NOIA 2NOJB 4L6V5 3V6DA 5H1SQ 3TKYA 4Y33A 3M4YA 3RYRA 1NKUA 3DB3A 2JJ9A 2VQCA 1Y64A 2EQJA 4DTXA 3FGUA 2W48A 3MN2A 5LJ5j 4GMJB 4BEHA 2M1HA 1LB2A 1VSHA 4G6QA 2M34A 4HBLA 4DTMA 1U04A 1P2FA 1UGRB 2HBLA 3SFZA 5CE3A 5JLWA 3ERED 4CHUA 2RK2A 1K83J 4PIIA 4LUDA 3P8BB 3QINA 2P0WA 4MGRA 4K11A 4B48A 5A0LA 2H3GX 2ZGYA 1VSFA 3ZCOA 5FPNA 1WHKA 1U48A 2XUBA 4BDZA 3EUAA 4LE9A 3CCYA 4RMNA 1IRZA 4PHTX 3TAPA 3HJFA 3JXUA 1HQCA 3TTCA 4BNCA 3QO3A 1KTQA 3ISPA 5J6XA 5F1JA 3FZMA 3QYHB 3CXCS 2NVYJ 3GNGA 3OMGA 2R5AA 2DEQA 2DFEA 3EZWA 2AQFA 4A53A 1WXBA 3VEYA 2X6XA 4JI4K 5E8GA 2LMJA 1ZREA 1TUDA 2FQ3A 3CCVT 2K4BA 1ZG5A 5LHGA 4C3IJ 2PEXA 1W2BM 3ZSVA 3JSOA 5JVGL 1M30A 3OL3A 1MGQA 3THWB 3KP5A 2W41A 2I2LA 2XIDA 4DHYA 2NVUB 4MFBA 5C25A 2E41A 3SNNA 2Z16A 3CCLT 1NK5A 4IO9F 1NGDA 1WHLA 1Q81U 5ADXA 2IA2A 3ZQFA 2OZUA 4JJCA 3FSPA 4CXFA 3MZ8A 4MDXA 2HYGD 2HD0A 2NRWA 2KZMA 2EPFA 1Z9ZA 1T3SA 1PUFA 5DMRA 4L0YB 5HRRA 2DFFA 1JCFA 3T3FA 1YHQI 4M78G 2D1XA 4CEQA 4R5PA 3BCAA 3DKWA 4PJ0C 1E0EA 2HTSA 1GVDA 2KFNA 9ANTA 2DTOA 1S8NA 1BU1A 3D2EA 5HLFA 3EKUA 1G3YA 1HKQA 2DMNA 3G71Q 5F1RA 2L3RA 4M6VA 5KAFC 5GANd 3C4SA 1OV3A 3DPLC 2GIZA 1Q81O 5J1UA 3TEEA 2YHBA 3CCJI 1SFEA 1X6GA 4DFJA 4Z4CA 4J8OA 1RZ4A 3TTDA 3SZPA 3FIFA 2VKDA 5AQLA 1FEXA 2X85A 1D4XA 2DN0A 2RNJA 3GZ5A 1JLQA 3S41A 3R6OA 4CJ4A 3OSVA 1TW2A 2C6YA 5AZJB 3K5LA 3J80Z 3ZEUB 4A3LJ 1JLAA 3TO6A 3ZT0A 1VQLA 2NUPB 1XNIA 5EG0A 4BR2A 4KFCA 3F8MA 4UUTA 4E9HA 1E4GT 3RTVA 1YQRA 4FM2A 2EFNA 1UWBA 4N4HA 2MA3A 3ZCMA 1XQSC 4BRNA 2FRHA 1MV0B 4NC7A 2DPDA 1UAAA 4FXDA 3OGDA 3JB9I 1MBKA 2A6HF 4C0GA 4AIAA 1DJ7B 4CZCA 3D2EB 2H6CA 3KBGA 2Y0MA 4HX7A 4KAZA 1LPLA 4M77G 3H0GJ 2O9VA 2NRRA 2D8HA 3J81E 3VYTB 1RNHA 2LSOA 1R58A 2WUSA 3RKQA 1FMWA 4ZZLA 2R93J 1EH6A 3ZXSA 1XN7A 4EFHA 2EGAA 5AIQA 3DLKA 3R60A 5AQPA 2I8DA 1M2VA 2PU9B 3PUFA 3WXLA 4B9VA 4O0IA 2NVXJ 1RBTA 2X0LA 5AQYA 5DV5A 1SKSA 2DXCA 3VGKA 2NNYA 1V4SA 2CV1A 2YHTA 2R7SA 2Q0UA 1BI4A 1T95A 2I7PA 1XPXA 2DW4A 4EM2A 3GYHX 1S9GA 3QBWA 4IXCA 4C8LA 1XCBA 2K9GA 2JT1A 4IUTA 3JSMA 4Q47A 2PZ1A 1YX5A 5D7UA 1LV5A 1Z21A 3N5BB 1W5SA 1XDUA 2GLOA 5IH2A 3CCUN 5FKOA 1DUXC 1OU9A 3KK7A 3M8SA 1D0YA 1A6QA 5EJCA 4FE7A 1B34A 3JCMW 2ME6A 4ZC3A 3TP0A 1KD1O 5GANe 4H4KC 4P55A 2JZ2A 2RK1A 1N34K 2HBJA 2O4GA 2MLGA 2EYZA 4DCHA 2G8KA 2BZTA 1ETXA 4J00A 4M9XA 1N39A 4LD5A 1RAHB 2E8AA 3E9LA 4BQZA 1NKCA 2ZJQL 4RAYA 3GCMA 1Q86U 1LMZA 3EG3A 4BI8B 2QTDA 2ZF5O 4DTPA 4CRIA 4HRIA 2W40A 4IQJA 2IP2A 3DRSA 2D5VA 4Y17A 1X3WB 4PFZA 4YTLA 3WXJA 2G8HA 3ZGKA 4NL3A 3V1OA 5JMVA 1AT1B 3MN6A 1FBQA 1MUNA 3C7JA 3VRZA 3G4ST 2ZNYA 1A5VA 3QG1A 1WUAA 3H46O 5F08A 1VQ6I 3GBTA 1VQ6N 4B1WB 2JM9A 4OPJA 2GIVA 1ZQ3P 4BQAA 2DTRA 3CCSI 3TPQA 1SKRA 4Q0BA 3G71N 2R7OA 4CJTA 1CGPA 4OMPA 3L2CA 4N4GA 4BC2A 1QHGA 3EAEA 1K61A 4B1XB 4OMYA 2DZCA 4H8KA 3RNJA 3VF4A 2YUSA 2I0NA 2ZJRF 3WGIA 1X1DA 2JPBA 3WTYC 3ER0A 1S22A 3CMYA 4FLUA 1GLEG 3VS3A 5KYXA 1HW5A 2CH6A 3A8YA 4UV9A 4I99C 2RJCA 2IS1A 5KRSA 1RLQC 3DLBA 2DPPB 4F3TA 3A2KA 4KIFA 4QPQA 2XAGA 2G8WA 2HSEB 2KDOA 3O3GA 1YE9A 5D8LB 1NLVA 3DWLE 3N97A 4IJNA 2DYSH 3QLHA 4KUIA 2RHXA 1KCFA 1WLPB 3O1WA 4R1HA 5HK3A 4LFBK 1WQ2A 1WHMA 4M3WA 2P5KA 3BY5A 3TREA 2HQHA 1S9EA 1ODDA 3KUFA 1J3TA 4KTQA 3BF1A 3ENBA 3SQNA 3CD6A 1SD4A 5FLMJ 2E60A 4N9HA 4J2BA 3JCMd 3G6EN 2ZJPL 2HHTA 2P9NA 1WBBA 1U1SA 2DZ9A 1JQQA 3CC7A 1EFNA 2NZTA 1LEAA 5EZGA 4G7ZF 3IH4A 4IHSA 5KCHA 2HQRA 1IXDA 4JUVA 2FSWA 3BOQA 3BW1A 5KPZA 2M16A 2RC4A 1UGVA 1FK9A 2YRDA 2CZ1B 4OIQF 1LDDA 4AG1C 4CZEA 1YITQ 4LJZF 2Q8KA 1SHGA 1MW7A 2KE9A 1IBLK 1KG5A 3CQZJ 1M8MA 3FDYA 4ZYAA 3THXB 3ZN1A 3EYYA 3K5MA 1MWKA 3NHNA 1MMSA 1FTZA 4IHWA 3Q9SA 4BR9A 3J81Z 1VNDA 4BKXA 4JRQA 1EBMA 3J7ZI 3DLGA 4NLCA 3GNFB 5KQ8A 3V9UA 1RIOH 3VUBA 1U6GA 3H1QA 1T6SA 3ULDA 4MLOA 3PSFA 1B6AA 4M6YA 4DTUA 3LFUA 5K1YA 4DV5K 2Q31A 3I53A 1IC8A 5C44J 4UQGA 4GV3A 3C0CA 4B3RK 1R5HA 2VJ4A 1VQ4N 5J2MA 2KIQA 3GFLA 3BDPA 3K1NA 3G1JA 2QK9A 1JUSA 5AQHA 3HXLA 1ASUA 1U5TB 1NJXA 4R79A 5I3UA 3KEOA 2HXIA 4KISA 1HOMA 2CJJA 3HTVA 2DIGA 3IC7A 3FHFA 1YJNT 3CCSN 2E1MC 4X1VA 2SEMA 2DTZA 4H0TB 1IHWA 3CCVN 1MHNA 4AHSA 2EQRA 1RUNA 4IVNA 2A68F 1H9TA 3P1GA 2VWJA 3AHUA 4KBOA 1X27A 3F0CA 3KEQA 2K3YA 3K4NA 4RMOA 2OPSA 5AQWA 4BDPA 2GFUA 3V7RA 2ELJA 1YIJI 1O4XA 4M63C 4I6MB 2NLXA 5IXBA 1Z7UA 1H3ZA 1O1WA 2UUZA 4DW6A 4QT7A 5LEJA 5HROA 1PD0A 2A36A 4RGUA 2ZJQF 2LDMA 5C15A 4KMFA 2VC8A 1AWWA 2VKEA 1UG2A 2V51B 3T19A 2F5FA 5JS2A 4GY5A 1IN6A 3CCEI 3IAYA 4M3FA 1IXCA 1S29A 3MEGA 3EE9A 4C2MJ 2E70A 2FU4A 1W9HA 3ENOA 3GZNB 2R58A 2VKHA 3RESA 4PFPA 1O9SA 5GADP 2A28A 3B8AX 2OPTA 4RTFD 4E7JA 4I09A 3BUZB 1W4MA 1I0CA 2CFOA 1FN7A 4CIGA 4NXMK 3EGUA 3NBPA 1V1CA 4LFUA 1ZYQA 3FMRA 4BY9C 1UHWA 1FMVA 5C3EJ 1QZ6A 4E4HA 3KVGA 2IGIA 2LF7A 1ENHA 1MJ9A 4ABZA 4BH9A 4FPAA 2WTUA 2LX9A 3A5NC 2OPRA 3I64A 2LP0A 3O6WA 1S5JA 1WJ5A 5HY6A 2HEQA 3M0SA 4AH9A 4Q5VA 1RI7A 1MKMA 3OYEA 3WXKA 3NEUA 2JTMA 2YNIA 1Q86O 1JHHA 3OW2M 4E7LA 4M7AG 4Z0UA 2UWMA 1N77A 1USTA 2DMOA 3HZ6A 1M90U 4O6JA 4CDGA 4BQOA 2G3RA 2JRMA 2DL4A 4FJ9A 3TU4K 2IVNA 2HNYA 5GJWB 3S8PA 1KQJA 4OVLA 4FSVA 5AZJA 4NXNK 1YJNI 2E2OA 4DUZK 4C8QE 2VGMA 1K0XA 2IIRA 2LT1A 4EJOA 1HXDA 2LD5A 4RKUE 1BQNA 4BBSJ 2O31A 4GV6A 4E7ZA 1PRMC 4RCCA 4UY8I 1ZLMA 1LVKA 1ZHIA 4Q5SF 5KI6A 5LJ5e 4PKHA 5F2RA 2JTEA 5ILUA 2L3QA 4DMNA 2RJFA 2JA8J 5E1WA 5FPDA 3VTHA 3DEWA 3TOAA 2WV1A 3OWTA 1I1SA 3IRXA 2AKLA 1Z25A 4ID5A 4J7IA 2J05A 3O08A 4QQGA 4JJBA 4M3XA 1LAVA 2ASOA 3QYEA 2Z9OA 4EIAA 4BVPA 3SJHA 4JI6K 3C6TA 4M3GA 2B63J 1J9AA 3FE1A 2LJ3A 4YRVA 1NM1A 2B9SA 5HOOA 2MAMA 2CP2A 1QP2A 3D2FA 3VQQA 1RGIA 4CYCA 1TK0A 2ENMA 1VQ7Q 4NCGA 2DKGA 1YS7A 3KP6A 2P6SA 3ZMZA 4F91B 3D7SB 3NH0A 3CFOA 5FPEA 1OU8A 3TL4X 3J7AO 2BVLA 4CGDA 1TWAJ 4QPOA 5KYYA 2WC2A 4C3HJ 5CYVA 2DOAA 3VWBA 4L8RB 3O3FA 1ZRDA 3CCQA 2XG8D 3E01A 4BREA 2W0ZA 3LOCA 4DUYK 1JJ6C 3VQAA 4A57A 2XF6A 5KYUA 1VQ5A 4PKIA 2W4SA 4CC7A 1SL0A 2VBWA 3GLXA 1WFXA 4FLWA 4OO1J 3RSEB 3WNFA 3S1RJ 3CLQA 1UOCA 4FT2A 3DLLL 1ATRA 3NWSA 3AG1H 2RKIA 4F8RA 4LDXA 4IBNA 5M5YJ 5GAOn 4KI6A 1TGOA 3CPWS 4JZ4A 1GOBA 1ACIA 1NMDA 1VQMT 4JX6A 5AQMA 2O5RA 4ELYC 3ZSOA 1RAGB 2AP1A 1D3BB 2CT4A 2YUPA 5ED4A 4FJ8A 3AA3A 2O8EB 2DAOA 4Y91A 3U6FA 3M3ZA 4CF1A 1JJ2A 1NE8A 4M3RA 2A41A 3I0XA 3VGLA 3S17J 3CETA 1OULA 4E89A 5IAYA 3HHHA 1FOXA 2R7UA 1UHSA 4L5IA 4CZZA 1CZAN 4B24A 1YJWT 3DTEA 3H3VK 1Q18A 2K9SA 3LGLA 4HHTA 2XRIA 5F64A 2PYLA 4HVJA 3OV8A 2F9WA 1I27A 3JCMc 4IZZA 5FLVA 2PUKB 5FLXK 1NJIC 4IWVA 4LC9B 4YG2F 1ZKGA 4D0PA 4NUBA 4GGGA 4XTWA 4CBUA 2UV1A 1P8ZA 2FC0A 4XLEA 1MA9B 2HNHA 4YOXA 1BI0A 2HOEA 2JM8A 4Q48A 3I3LA 4CGZA 1HKTA 2DE0X 3PMIA 4YFUA 2CFXA 2EWNA 4EPCA 4N5SA 2L9VA 5IT3A 4BRLA 2EWSA 4KNYA 2BXYA 3ZSYA 6AT1B 4MO5A 1PSEA 1HUXA 4CJ5A 4LK1F 1WZ2A 1DEJA 1VSDA 1PHTA 2QLZA 2ZXWH 4EW0A 3ZYYX 1K76A 4GKKK 2G7UA 3ML6A 3PO5A 5CYMA 4UB8C 3VS1A 5FKMA 3SMSA 2KJCA 3BJAA 2PVOB 3EEQA 1C0GA 4FLXA 1ZELA 3CESA 3N4MA 1IV6A 5DPKA 4AIJA 2R7XA 2AXTC 2VOOA 2IGNA 2LZ6B 1RR8C 1IJWC 2EPDA 5GIPA 2FXAA 3CCRN 3QU6A 1OH7A 5EG0B 3LP1A 1VQMN 4ELVA 1RBRA 1ESVA 4EMKC 3WTVC 3BTIA 2LY1A 2QQRA 5C10A 1KQSM 4X64K 4ZDPA 2LQWA 3QZ5B 3DBRB 3DRPA 4L3QA 2X78A 3GFJA 1SFOJ 2RJEA 4QLCU 5EX5A 4A3JJ 1K78A 4DF8A 2P9UA 1NG6A 1JT6A 3SUOA 3HFOA 3MP1A 2F2VA 3UWNA 1D9DA 3HBLA 5C2FA 1Z3YA 4NNJA 2WWYA 3HYIA 1N36K 1OCOH 4OFEA 2LJ1A 2JLEA 4Y3OA 2H56A 1I5LA 5DM7F 1XNRK 4BY7J 2IBDA 2AT1B 1HNWK 1ETOA 1SV5A 3RPQA 1JE8A 3TMOA 2YU3A 3IUOA 5KCMA 3S93A 1HK9A 5KGXA 1W1WE 3P7NA 1AA7A 2MMPA 1RT3A 3ERMA 2M51A 3E9FA 1B7TA 1KFDA 3CC7N 1FSHA 3EHQA 2L7KA 5AQUA 4PJNA 2JHJA 4OMZA 2R7RA 3L0QA 4JKHA 3CMEN 2YLCA 2HVRA 4JDSA 2GTDA 2WAQA 4J6WA 4M78F 4C8QG 1RPWA 2C0TA 4CHQA 2HQEA 2QGFB 1ETYA 1HYSA 4AHVA 3T8TA 1QA6A 2A1SA 4JP0A 2DETA 2MWPA 3CC2N 3RRGA 1T0JA 3L2ZA 1UJ0A 3REAB 2QZ8A 2QQBA 3HK2A 4FYXB 1S6LA 2AHQA 4QTRA 2K3BA 4G1QA 3DMJA 1U3EM 2QYZA 2EYQA 5CR2A 4HTLA 1VYUA 2JUFA 4KRTA 1LCKA 1H88C 1FJLA 3HP9A 3VYRB 4KTZA 2A5XA 3F2KA 2LREA 2IVWA 2DIQA 1T7PA 3L4QA 3JAME 2CQQA 1WH7A 2HL5C 4XIUA 4A4GA 2KT8A 2BDPA 3ZBDA 5IYCJ 2EQUA 1B3QA 3MFKA 4MQ3A 4ZYHA 4J5YA 3X26B 3GLLA 1VOMA 3EGXA 3OYDA 5KTQA 3BG5A 3M0RA 4XU3A 4PJOB 4E1NA 2EA4A 3S14J 2QM3A 1RTJA 3LAMA 4OX9K 2DNUA 1SL2A 4X6AJ 3NAEA 1YNZA 3X25B 3C2GA 3QIPA 4PJOC 1N6AA 1VSJA 3CWTA 2QWPA 4N9IA 3D7EO 1IO2A 3O4WA 1HKSA 3GVAA 5BN9A 4RB3C 3FHNA 1Q7YU 2KDSA 1ZRFA 1TZLA 1WSGA 4JZ3A 2IIMA 1JJ2S 2XV4S 4I0AA 3KWIA 1M4ZA 1G3SA 5GAN4 4MEXF 4MZTA 5D3GA 3D5RC 3RMAA 5KH6A 2G8UA 4XL9A 3CUQA 3CCST 1EWQA 2CH0A 4A2BA 1SHFA 3WG9A 3LH5A 4IL6C 3SEMA 5DLOA 3AVIA 1WJEA 2R7ZJ 4Z89A 2GTJA 2ZMEC 2QQ9A 2E20A 4A4FA 4BRCA 3CCJT 2I7NA 3CMAA 3JCMh 1MMNA 1YO5C 4UNOA 2QM1A 5BMZA 2ABLA 2KK4A 1SRLA 1ZSZC 2KL4A 2V9VA 2R7VA 3J81K 1GOCA 3O8VA 4QCLA 3H5RA 2K3PA 3SEQA 1TL3A 3CP2A 4BXXJ 3AVAA 4M75C 1REVA 3VF2A 5AQKA 2E35A 4C8MA 2RHYA 2L02A 4ENMA 4HCBA 3Q9VA 2F4VK 2QWMA 1R8OB 1MJBA 4MMLA 4FIBA 4HSTA 1ZA1B 2HMPA 4H5VA 2DMPA 4JKDA 2ZKZA 4AD9A 4BS9A 1VTNC 2AS5F 5FD5A 1GHCA 5J1YA 4DBFA 2PBDA 1GXPA 1ZBLA 2CUJA 1SVMA 5IWAK 4ENJA 3E9GA 5C6SA 3I56A 1OMIA 2K4JA 4C92F 4PGHA 1JXEA 4KB0A 2HOSA 3THWA 4M7AA 4E6RA 1VQ7I 4GYGA 3VS5A 4B1YB 2O8DA 4CCOA 4HNTA 1BBZA 1OH5A 1WSFA 2FBIA 1IGNA 1J7KA 3CDIA 1X1PA 3K70D 2CUEA 5FGMA 4EM1A 4EHTA 1KRPA 3A8HB 2XHKA 5GANf 1OPCA 1YUWA 5M1FA 2CU7A 1TKXA 4B9LA 3F21A 3HSRA 1T0FA 1LFBA 3ELKA 3VTIA 2RO0A 3NE6A 1SVLA 4II3A 1DTTA 3NVMA 4H4OA 4BC3A 1GVJA 2E4LA 4RW4A 1YX3A 1M3CA 1KG7A 3H3NO 3IH7A 2BY2A 3K4JA 4EEFG 5F04A 1CZ9A 2WC9A 4QIWN 1MGTA 2O88A 1PWTA 4FM1A 5ECAA 2OV7A 2AXLA 2JMCA 4ELTA 2DA7A 1HKCA 5EZHA 5LJ5g 1XG7A 4V2SA 3FDRA 3V8LA 3KXTA 4PJOD 4FHTA 2EYYA 1IB8A 3UATA 2QEXQ 4I9LA 3E2UA 2DT7B 1XGSA 1WSJA 4CJEA 3H9GA 4AFSC 1RDBA 2WAQN 2XMFA 4BC4A 3EH1A 4YEJA 3X28B 4CE9A 2WADA 2KAFA 2LKSA 1L5UA 5JICA 2CZ0B 1B34B 1T56A 1RNLA 4D8DA 3ABTA 5GAN8 1HRHA 2GOMA 1ZRCA 2EVRA 4C0ZA 3AA5X 1TQIA 4C1NI 1VHXA 2FNPA 3JCMQ 4S05A 2KQ2A 2VXFA 2EIJH 4I6ZA 2M0OA 2K4YA 4B9UA 1YITA 1HBXG 4RTWA 1ITYA 3HSEA 2PBIA 1NWKA 2R7WA 1C0FA 2WB1N 1HYZA 2P8TA 2LQKA 3WHCA 1PSFA 1GLAG 4CD3A 3ID8A 3TSWA 1O7LA 2R7YA 3Q0VA 2P0KA 3UKRA 5K14A 1PP7U 3J81O 3PO2J 1FWZA 2OX7A 4JI3K 1R49A 3AG4H 1RILA 2RJDA 2BTFA 1BI1A 1KC8O 1B4AA 5EU7A 1IG7A 1YW7A 3OYKA 3ULEA 3MAQA 5J39A 4M7DF 2Y75A 2DJZA 4JV5K 2W00A 4NO7A 5L3GA 2Q0RA 1F36A 1AWOA 3I0SA 2V79A 4K8ZA 1X19A 2ABKA 1R1UA 3CQ8A 4RGSA 4CICA 3ENHA 4CW7B 4LF9K 1IJJA 2NRZA 1VIFA 3AKZA 2XKOC 1V3FA 3NGZA 5DDGA 2DFIA 2VQHA 2QK0A 3PX6A 4F7UE 3GIBA 4U87A 2E1NA 5BOXA 3BR2A 1YITN 3BQZA 3CC2A 3LCNA 5FW9A 1YYVA 2X1DA 2QEXA 3TU5A 3MEWA 2XDDA 4D8KA 3JCMX 3IUCA 1OYWA 2X74A 2XPVA 2XROA 2XAUA 5I22A 2NRXA 4G8XA 3MWTA 2KP6A 4P5NA 2AO9A 8ATCB 1VYVA 4LF8K 4U7BA 3JCMP 2NS7A 2OFIA 3VUZA 2KPMA 3TVTA 3G6EQ 3F9MA 1N75A 4FJJA 3UB5A 4RM2A 2BY3A 4C92B 4JN4A 4DOZA 2VI6A 2VT2A 3R2XC 4XIDA 4AHUA 3H1VX 3AVLA 2PJPA 1TUCA 1NG2A 4MTEA 5HDNA 4UUVA 2KRCA 1YS6A 4C3JJ 4AHTA 1KAXA 3V81A 3CPWP 1I8FA 1JLCA 1D0ZA 2AKKA 2E6NA 2BE9B 2P9LA 4GFBA 3QYFA 3VEZA 1IRXA 4MQVA 5J8FA 2YNFA 1D1CA 1JLEA 4CGJA 1FP1D 4N0AA 3ZT1A 3UA6A 4N56A 4X9DA 3F9KA 2PMZA 5IT9O 1A36A 1X58A 2JOYA 2AZSA 2F5EA 2LT4A 3ZQLA 2J5PA 5LBQA 1AVZC 1ETKA 2E6LA 4A3BJ 1MH3A 4HUFA 2D0NA 3TABA 3LAKA 5GMKe 5E1ZB 4CCLA 4IF4A 4LLGF 1ZSZA 3WXIA 2QGUA 3V4IA 1ETVA 2XHIA 1WJFA 3AO4A 1BA1A 1U0JA 3DEUA 1E4FT 1BOTO 4XKBA 3TSPA 4OF1A 3O3HA 3VEVA 1NEGA 3A03A 4ZGDB 2A6TA 1M90O 2MGQA 5CR4A 3E7LA 4PY5A 3J7YP 4RG8A 3GBGA 2KHMA 4Y13A 3HPHA 5FRMA 4M7AF 1M1KO 2O01E 3ZSZA 2P5OA 2AK5A 1U5TA 5E3MA 2VXZA 5FKLA 3DXKA 4DIQA 3DLRA 1TV6A 4KGXB 1JGSA 2EBIA 3MMVA 3LGFA 1VQ4T 2F6CA 1AHJB 3HFNA 2X6NA 3LDPA 3C7NA 3CBOA 3CMET 4ZGEB 1EWRA 1OPLA 1UFFA 3WU2C 1ORPA 2RPIA 3ROUA 2QF7A 4PJOA 4BI3A 1BCMA 1U6ZA 4IQ4A 4AQYK 2WSCE 1TH7A 4XQ3A 1KG2A 2V4JC 3THXA 1T08B 4O8KA 5HODA 3TDZC 4BRIA 3G73A 3VN5A 1QU3A 3VS6A 1C1CA 4KULA 3SQ2A 1LKXA 2KZVA 1QQCA 2YUNA 1M3BA 4ESFA 3LW5E 4FL6A 2PY5A 4H0YB 3E19A 3A8GB 4M3DA 1YJNA 1O57A 2ZQBA 3CMAN 4JI0K 3R3LA 5IHNA 3KLFA 1VQPI 4ZJZA 1A5WA 4KHPK 4V2FA 2H1KA 2EYWA 5D6YA 2IS6A 4B9WA 1F1BB 1Y96A 4JHDA 5GAHP 3J80E 2RE2A 5I9EB 4M3YA 3HKSA 2FL7A 1OOTA 1NYFA 2VIXA 1YVUA 1OH6A 3M1CA 3RMCA 4WXCA 2V9KA 4Z94A 4BHBA 1SD5A 2P9NB 1GLNA 4W5NA 3K4MA 5GAEP 2LC2A 5CVIA 3I4NJ 2J6OA 1R5ID 2LTPA 4BUGA 3NFAA 3MO8A 4XKVA 1N27A 1OCRH 1RDAA 3JRBA 2M5WA 2VE9A 3CLOA 3S3NA 3UT1A 4CIFA 1Q8IA 2FEZA 1XX5A 1HLVA 4U0YA 4MIMA 3G2BA 3QB0A 3GTGJ 3AO2A 3DWLA 3GE1A 5EDNA 4WCGA 3QDFA 3QETA 3OW2P 4IUVA 4JRIA 3VGMA 3C1DA 2KRNA 2HBKA 1W2BP 1IAWA 1NGFA 3VQBA 3HPOA 3GO5A 2NUBA 4NHJA 2P0QA 2X51A 1TVRA 4XICA 1XMQK 4FJ7A 4A54A 3WU0A 2KDZA 2OCCH 1W97L 4PA1A 3EFRA 3CCLI 2OTJN 1Y7XA 4KDPA 1PYVA 3DXMB 1P9QC 1ATNA 1ACMB 4Y4RA 3T1AA 3AVCA 3SUNA 4DR7K 5M1QA 1PUEE 1QZEA 4YOTA 5KCOA 2UU9K 3CCUA 2PJRB 4D6WA 4LITA 4NQWB 3C6AA 2ASPA 3VQDA 1KQ9A 4M75A 2IPOB 4BDYA 1IW7F 3KKRA 4FZYA 2H27A 5KYYB 4FWKA 1W2BS 5TKWA 3RI4A 2VB6A 4CBWA 1NK6A 5KQDA 2KQRA 4PDKA 1W7PD 2H3JA 4H0VB 2CGHA 2PYJA 1KLMA 2A08A 4M7DD 1P92A 4CZHA 1QKXA 2MD5A 3VERA 4M78D 4IIOA 4CEEA 4M71A 3U1KA 1MMGA 2COMA 5HLGA 4M3TA 2LSNA 5GTHC 3WVDB 2QSGX 3CCUT 1CKBA 3UKRB 2D4WA 2OBPA 4B6MA 3KKSA 1G3WA 5GAOl 2R7QA 2YS9A 2OZSA 2DVEA 1JRIA 1BDGA 3SUQA 2K9NA 2Y69H 3MXMA 5F6FA 4C2TA 4FVUA 2KHOA 2DEUA 1NYGA 1QCFA 2HZDA 4ZN3A 3S1MJ 1S72I 3UIQA 1WPKA 2BTTA 4B9QA 2GM4A 1A35A 3E5UA 4CJLA 4CEBA 3RR7A 1C6VX 4H0OA 1WVRA 1ON1A 3DOKA 3GTMJ 1X4OA 4HLXA 2XPUA 3FKJA 3D5LA 1MSFC 4X65K 2QENA 4GDFA 4RAGA 2J6KA 2E1YA 3PNYA 4JPBW 2ZNZA 3LSKA 4OMQA 4UHTA 2HXOA 5JVHL 2Z33A 1KZHA 3BWGA 3K0SA 2FMLA 2OYQA 3WTWC 4DOWA 3DLAA 4HVUA 3P38A 1RC9A 3DLMA 1NH3A 4HDUA 3A0HC 2QWRA 1Z6TA 3W3DA 1QVGM 1KQSP 2FUG2 4F3QA 4C8QB 2DVJA 2JS2A 1RBVA 3HC7A 4A6DA 1VI0A 3T69A 2HVIA 5E20A 5M3FJ 2F8SA 2XB5A 5CKDA 2KKZA 1NOZA 4RW6A 4KREA 4EVIA 4J9CA 3P31A 4CF9A 2M45A 4EMHA 4XN3A 2AIRB 4CI0C 1I6XA 2O3FA 4RS8A 4N0BA 5AYFA 3IFRA 2DT6A 3BTJA 1X43A 2EV5A 4U88A 1TQMA 2PJRA 1USSA 3OSGA 3C95A 3E0JB 1KHIA 1QZ5A 3ZMSA 4B22A 1IHVA 1XTDA 2DL8A 1CQTA 4Y15A 2DDBA 3AVNA 1YIJQ 4W5QA 1SFXA 3DRRA 2Q2EB 2E10A 2YUOA 1BHLA 4FJGA 4CCJA 3RMSA 4HQEA 4FJKA 1YQMA 2SRCA 2DOEA 2K5IA 2ROLA 4XRSG 3U3GA 4F9OA 4EJYA 1GBRA 3VYUB 1SMTA 1N3AA 3WE2A 4XAXB 4CCMA 4B1VA 4B3MK 4Y7NJ 4J2DA 3EN9A 4XLPF 4A5MA 3JAMZ 4JKCA 4MTDA 5SWMA 1FIPA 4OPAA 4LFAK 4BUPA 3L4IA 2DPUA 3DKMA 1X3ZB 3IP4B 2STTA 1VQ4A 1KC8C 1CZBA 1K4TA 4LIUA 5CVVA 4CYCB 1WEGA 4QQ6A 3BC8A 4DG1A 4BJ6C 2YJEA 1S3XA 1XHXA 3SD4A 4MZMA 5H20A 1M2VB 1XQOA 1V55H 1QZYA 1S1VA 3V42A 1YJ9I 4KRFA 5E18F 3CCQQ 4IEIA 1U2VA 3SYTA 2QQ8A 2IAIA 4PCQA 3NMZC 3EO3A 3QBYA 2CS3A 2YWWA 1N8RU 5CO7A 3CCRT 4BE0A 4LIVA 3K59A 1H641 5TKYA 2RQQA 2AZVA 4C1NK 1JI8A 3GTKJ 1S1NA 4CF0A 3IKMA 2LY9A 4H4MA 3BE3A 4PJOG 8AT1B 2PI0A 2YI1A 4XKWA 3RRHA 1TKTA 3S6IA 4WQ4A 4O0JA 3RMQA 3CWAA 1SG5A 5H6QA 4I02A 3JRIA 3RTRA 2XDVA 4DZJA 3DU6A 4CIEA 3DCFA 3PTAA 3CQYA 4HVWA 3OA6A 1Q82C 4KHNA 4LNPA 3KP7A 3M56A 1NEBA 2KVQG 4WF9L 2P9KA 1BI2A 1IKVA 2JPSA 1R6RA 1JUPA 1NJIU 5GADJ 4CI6A 5AQRA 1FOWA 2KLOA 4XLHA 2D1HA 4QKUA 2KT0A 1VQ9A 3NF9A 5AIPA 2OTLI 2QKLB 3K9JA 4HA8A 3ME9A 1YW9A 3LWFA 1SUQA 4QVDA 1BOBA 3C94A 3BG7A 1O3QA 4CCNA 4NZGA 5CHZA 2XO7A 1WFWA 1BG3A 4OMFB 1PP8F 2A40A 5D5XB 2E1OA 4RW8A 4BI4A 3VSKA 2DBBA 5FFZA 5ADXH 1W1FA 2YNGA 3HXMA 1E3OC 4E1MA 1Q82R 3MQ0A 3K0LA 1KK7A 1GLLO 4BRAA 4KO0A 2CRGA 1I4K1 1EIFA 2VPRA 1E3PA 2NXNB 4PFOA 4ESBA 4DKWA 2X9DA 4EMGA 3JB9H 4B8AB 2ZFUA 4C92G 1WH5A 4KHYA 2LRQA 2QQSA 1KSWA 3H3OB 1A31A 3F23A 1JEGA 1WNSA 3NPFA 2M2EA 3QO9A 3ZEHA 1LPQA 2TCTA 2RF0A 3QPSA 1PDNC 4HG2A 1CSKA 2ESNA 4Z2YA 4V19K 5DM6F 3Q3SA 2JA7J 1YQLA 3LM9A 1RESA 2OC6A 5LL6Z 4IZ9A 2IW5A 1I1GA 2IT0A 3VA0A 1PD1A 4LN2A 4LB6B 5IT9E 2E3HA 1W7PB 4EJTA 4JYAK 1HJDA 3KZYA 4LOCA 4A3GJ 3MCAB 2CUBA 4LH5A 4RB2C 3RR6A 3TW6A 4FYYB 1AOJA 2D6FA 3TGNA 1I39A 2M7AA 1KJWA 3PX0A 5EY4A 1VIEA 3BG3A 1BISA 2HQAA 1ULYA 4FO0A 3NCIA 4HF2A 3WG7H 3FXMA 2MF2A 2W42A 1IG9A 2KMUA 4OKJA 1O13A 1T3VA 2O8EA 1TWHJ 3L42A 2NRAC 5J3LA 2V7ZA 3KWGA 2QXFA 3DTKA 1FKPA 1R23A 3TANA 2JWKA 4F7UF 1HLUA 2HHHK 1K78B 1QQJA 4DEYA 4JI1K 4AYBN 3CQTA 2OUMA 1SEUA 1AEYA 3LDLA 4F2SA 1WHHA 4FPBA 4LF5K 4L18B 1WEFA 1OCPA 4OIPF 1K4US 5DYMA 2E64A 1YJWA 2RHUA 3JRDA 4G6TB 4HV6A 1KAZA 4WXDA 2LKPA 1LWYA 2X9HA 1QPIA 4GW6A 5LJ5f 4AVZA 4E9EA 3I4PA 1G3TA 4PJJA 5J1EA 2PMUA 5FU7B 3I55A 2LYCA 2EYXA 2O0YA 4MMKA 3RBBB 4LK0F 4AIDA 3NARA 5C42A 4FWLA 5AQFA 4ATOA 3CCMA 4OAZA 4WFBL 3U1DA 3HYFA 4CGFA 3N5NX 3D6RA 1Z9QA 1MMAA 3OYIA 3VA3A 3NDKA 2XU8A 4DTSA 4PQUA 4E6KG 1VAZA 4KB1A 4WXHA 2RQVA 1M27C 3ZSWA 1APLC 1KVAA 1HKBA 2X4XA 3KHYA 4Y1CA 4EJWA 3OW2S 1ABOA 2K2VA 4JNEA 4Y52J 4J9GA 2FNAA 4LMYA 5AQSA 3DYAA 3CMAT 2JHNA 5A0DA 3F73A 4DTOA 1MDMA 2K3XA 1LJ9A 1VQ5T 3RIRA 4KUDK 1RCHA 3R6SA 3FXJA 4EA4A 1MBHA 3O3KA 2MWOA 1X3NA 2MPXC 1S72Q 4CJ7A 1Z91A 2CP7A 2RPNA 5HBMA 2ELKA 1WJRA 1VQMQ 3FMSA 5CQEA 4M7DG 4NDLA 1GLJO 2MK5A 4TSXA 1JTXA 2ZZDA 4M45A 5FB2A 4HF0A 4ETSA 4L0ZB 1L3SA 1BA5A 2V52B 4J8FA 2K6DA 2XC7A 2C06A 1VQ8A 1H1VA 2HDDA 2KRHA 3FXLA 1FLIA 3VEXA 3L3UA 2XF7A 1G6NA 3CC4A 4UVAA 2K85A 2V8KA 1BIBA 4BE1A 1IN5A 1TT0A 4RW9A 3CPWM 1U5TC 3SBGA 4BHPA 1HR0K 1I50J 2UXXA 3NH1A 3RPUA 2K7AA 2NS0A 3LP2A 2DA6A 1PU6A 4XONA 3R1XA 3LQQA 4AUXA 4ZN1A 3H3UA 3CI5A 3IH3A 3JSPA 1ZLJA 4XU1A 1YJWI 2M8GX 3JSCA 3WHBA 2ATQA 3V8JA 2HF4A 4GBQA 4HAMA 3RKXA 2HS5A 4KH0B 1VA7A 2A3LA 4BGDA 3O9QA 2OTJA 2NNNA 1Y1VJ 3IH2A 4WCIA 4M9ZA 1IZ6A 3J80K 2YT6A 1VFCA 2K79A 1U2VB 2HF3A 3WTUC 3T9NA 5DM7R 2HDWA 2FZCB 2LY2A 1D8KA 3JAMK 1NJIO 4FOEA 3U8XA 1VQKA 3SV4A 1TL1A 2YHAA 5D6FA 2BHYA 4A0XA 1H3HA 3SQ0A 1EKEA 2DU9A 3AVFA 1R36A 5LJ3j 1LVAA 2BXZA 5GANg 1NK0A 4RCBA 2DA3A 3S1NJ 2O8FB 3O9RA 2F5VA 2NOHA 2DO7A 1VQKI 4O4GA 2F8TA 1M5Q1 2F2XA 4FWQA 3RQ4A 1CF7A 4D5FA 3FM5A 5AQZA 4HUGA 4A3EJ 3EFOA 2EX3A 3FJPA 3AVHA 2VC0A 4HCKA 4NL2A 3EUHC 1RT2A 3SLCA 4PLIA 4H03B 2KTQA 2GQQA 3SDZA 2VBYA 2O4IA 5J3BA 3A5MC 3LNQA 4BR0A 2LK2A 1LOJA 4FWNA 2FG0A 3TSZA 4FX0A 4YPHA 5GMKh 4FQGA 4XOPA 5GANj 1O3SA 9ATCB 4P9UA 1KFSA 2LFBA 1BA0A 1YJNN 2R0QC 4DQIA 3CCQI 1WRJA 3O8HA 4PUSA 3IWZA 2F4OB 2YNHA 2X4YA 2HB5A 2F69A 1UGSB 5HK0A 4JX4A 2IGMA 4UNFA 1MPGA 3CMEI 3JV3A 1W0UA 4MEYF 2DXUA 3KK2A 2KMTA 2P9IB 2FYKA 5EGOA 3CTAA 2ZMEA 3LSHA 4F04B 2XICA 4U0WA 1SAXA 4CHOA 1XWLA 2QBYB 2X1CA 1PG5B 2DRMA 1LNXA 2HCKA 1YQAA 4XSXF 3WGHA 3CCJA 2AHJB 3IRRA 5EEGA 4CZKA 4BR4A 2OTLA 2HHUA 3GW2A 2FB7A 3A5OC 2PMHA 1YHQQ 5C0MA 4W5TA 2CP5A 4X0GA 3QHSA 3F6VA 4HKEA 4DJAA 4CFDA 2OFKA 2VV5A 4KYWA 2LP5A 4A3FJ 3MECA 1BCOA 3PQKA 3G71I 1R4NB 1G2HA 3IKTA 1S7OA 5CQYA 1K8AR 4R8HA 1LWCA 4IHVA 3ZLJA 2VXEA 4BRFA 4CO8A 3PUBA 1NM7A 4HX4A 2GGRA 1HCRA 4FJLA 2GXGA 2A61A 1ZYRF 5CZ2A 2OTLQ 2R7DA 4EGZA 2JVVA 1YCSB 4DR5K 2F1LA 4JS4A 2VJIA 2FRYA 2FSKA 5EG2A 2HBWA 4JD2A 2DTIA 4PKCC 3O5ZA 3EGDA 3KK1A 3C0BA 3PVLA 4CK2A 2A05A 1HA8A 2VJJA 3ZSXA 3G4SN 5HVQC 3A8LB 3A02A 1BIAA 4IOAL 2MI6A 4UUSB 3M0TA 4I2OA 4AIHA 1SKUB 2ZBKA 1HNZK 5EC7A 3BG6A 1W4SA 2EQKA 4RCHA 1ZBUA 3GP8A 1BB9A 5HKCA 4E3SA 2NRTA 2EB7A 2DMUA 3GTOJ 2DTHA 1P7IA 1D1BA 2I5WA 1FPQA 2VXDA 1ZG1A 2HZYA 4BRHA 1WJBA 1UHMA 4F16A 2W1OA 2WBMA 1WGSA 2RI2A 4XBFA 5KYWA 1TWCJ 3I55T 5L23A 1TOVA 5LHHA 3M07A 1BW5A 2YHWA 3RKYA 1VQPA 2ME0A 2E2JJ 1KQSS 1SKWA 3IHUA 5C24A 1QBJA 1VQON 3ZRGA 1W36C 3CFPA 1VQOI 2BV6A 1BR4A 5L3FA 2CV0A 4DNCA 1N3CA 2LNHB 3CDHA 4W1UA 4OIOF 1M1FA 5I42A 2UXNA 3ALYA 5ICEA 1WHGA 1ZK8A 3G7ZA 3TAEA 2CH4W 4F7ZA 5M5WJ 3JTHA 3DLLA 2XAQA 4E19A 1K1ZA 4CEZA 3CD6N 1XSXA 2D0AA 1X01A 2CMPA 2V1DA 2HL3A 5I11A 3TW7A 5GAGP 3VQEA 2VYPA 5C4XJ 3DU5A 2ITMA 3CMMA 1J2XA 3DFGA 3D4VA 3QXEB 4FT4A 4M7AC 2O8XA 4IUPA 5DCFA 3U9GA 2RN8A 2K57A 1NBWA 3CO7C 3WTSC 2W24A 2BEOA 4HPQA 2KI7A 2XY7A 1QSLA 2V1RA 1JLGA 2VQGA 1JXOA 4JKAA 1ZBHA 5EGOB 1HW1A 4FK4A 2COBA 2LQ8A 5AJ3K 2J6FA 5FU6C 1NK8A 2P9SA 2FQ4A 2RV8A 4UXNA 3GTPJ 4B9SA 2NOEA 2OTLT 2E71A 2E2HJ 1D5YA 2BY0A 1K8AC 2QWOA 3BDUA 3B6OA 5AQIA 4FE4A 5BRDA 5AR0A 3WU1B 4EMKA 1B72A 2NVTJ 1FYNA 1JJ8C 3L3VA 1LWWA 3BTLA 5GAOq 4YOQA 3FR0A 1TS9A 3TR8A 3M8QA 4RTXA 1TNSA 3LFKA 1Y56A 5L3BA 4KT0E 1XC3A 1NK4A 5A0GA 3CCSQ 2E5QA 1EF4A 4H0XB 2DA4A 1A6IA 5TISC 1MUZA 2RN2A 1YIJN 4MDAA 3BR3A 2ZE2A 2C0IA 1HJOA 4U0VA 1U5SA 3HO1A 3DKXA 4RB0A 5A2QE 1KU2A 3H0FA 5E79C 2A37A 1V76A 5GAOm 2KT1A 4P9FA 1UJ8A 2CDTA 1IKXA 2LVSA 3IDHA 4YIIA 4B47A 1RAEB 3OYCA 4RAFA 1GXIE 3HUGB 1FOKA 1E7OA 2KYMA 2VKNA 2G8FA 3OBYA 5KGWA 4FJHA 3QEIA 1MMDA 4QOZB 5DY9A 4M3BA 3SDBA 3I5SA 3CERA 4MDBA 4QQDA 1QHHD 5LJ3g 4BVOA 1G99A 4C9YA 1K6OA 5GAGJ 3ASMA 2MCNA 4M74A 2HNDA 1KG3A 1HKGA 1VUBA 1I94K 1HNXK 4GLMA 1IG8A 3P9CA 4XORA 3R61A 4CJ3A 2P7VB 2XVCA 4OINF 4MFDA 3IKVA 1IDZA 2B7EA 5B5EC 4A62A 1NGHA 2R3SA 3DXKB 2KNBB 1D5AA 1VK0A 1JKHA 1K8KB 2HEOA 5BRFA 3FHZA 2O9SA 2YG9A 4J2EA 1UA0A 3ZETA 2NUZA 1XS9A 2ZGWA 4DLGA 2BHZA 3QPLA 1AU7A 4L9JA 4N4OB 4PWDA 3CCLA 1X4PA 1PU8A 3ULRB 4IOCL 2EJFA 3VPZA 3EUKL 1PNJA 3A8OB 3O1BA 4BROA 5I2MA 2ZCWA 4WQ4C 1NHAA 2HOAA 3WVEB 3R6MA 4X9CA 2XSJC 3JR9A 4A5AA 1O7FA 1PVEA 2RQUA 2C0OA 4TVRA 3SZGA 4IDKA 1VQKQ 1OVYA 2GA2A 1BJAA 4JYKA 1C0UA 1UJYA 5F1XA 3CC2Q 4DBRA 4HOBA 3OA9A 3ZEUA 4C8OA 1WQ7A 1J54A 4FWMA 3D0PA 1OZ3A 2K27A 1IF1A 1JBMA 1KVBA 1MH4A 3O4QA 2XRLA 4BXFA 2PNIA 3QSUA 3GDQA 2HQNA 1R22A 2D0OA 1PU7A 4HNUA 2YHXA 4WFNL 3G0ZA 3PFYA 5ILVA 5BS6A 5BN8A 5JR3A 2LMDA 5BR9A 1ABQA 3BTCA 3WXMB 4OB2B 2Q3SA 2DCEA 1PCXA 3U2RA 1SF9A 5J2PA 3EH2A 2VWBA 1Y97A 5AT1B 2DD5A 1UMQA 1M90C 4CHPA 2XASA 4I2QA 3JRZA 1QTMA 2P6TA 2YX7A 1QWEA 4C0DB 4UY8O 4YELA 4E70A 3EG0A 4RG2A 5KNLA 3M8JA 1EZZB 3O6BB 5IPAA 1OX9A 3M8PA 1I07A 2GUIA 2F5CA 2DFUA 1FYMA 4M75B 1D8YA 4OPHA 3CCEQ 4AFQC 3CXCM 1MNEA 1Q81R 1YVNA 2O8FA 3ITHA 4FK0A 4I01A 4RAZA 2EQMA 4M75F 1IREB 3PIPA 2ZO4A 3EDPA 3Q7CA 5TJJA 1WNLA 1MJAA 4FW2A 3H0IA 4B1UB 4F17A 5KE2A 1YFNA 4I7HA 2XY8A 5KK1A 2JSPA 3H8ZA 2NYSA 2HSTA 3MZYA 1QVFS 5KN9A 3E6BA 3F8BA 3LPTA 4OKKA 2CUFA 1QLYA 1VQOT 1VRTA 4A59A 5KYNA 3BY7A 2RN7A 2QKMB 3NTHA 3UR3C 3FZKA 4C23A 3IL2A 1VQNN 4F2RA 2M4KA 1K9MR 3OYLA 5GAN2 3OQ5A 4CZJA 2MD0A 1BO5O 3HTUA 2VT3A 1ZHFA 1WX6A 2EFPA 2NAZA 1NLPC 4DV0K 2MYSA 5EEAA 4DZPA 1OQYA 4OU0A 1BJZA 3OIPA 1YN8A 2HZTA 2MABA 1MUYA 4DV7K 1VQPN 2E5KA 1M9SA 2CP0A 5E3OA 2VASA 3KZIC 5B1AH 1LFPA 1AWCA 1K8KA 2IS4A 4E47A 4O55A 3SJJA 1GV2A 4M73A 4O8UA 4HUEA 1X9WA 4EGYA <