3OY9A

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese at 2.55 resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oy9A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oy9A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oy9A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oy9A03
3ZEHA 3E9FA 4IUTA 4Z0UA 4CHQA 2Z1JA 4DTNA 4EP4A 4FJJA 1XHZA 3K5LA 1FKOA 3PV8A 3M8RA 2XRIA 4IUUA 3WNHA 1IKYA 3QEWA 4QVZA 1Q9XA 5CYQA 4ELUA 2D0BA 5C42A 3OYDA 3DRPA 4KHQA 5KGXA 4FM2A 2RJDA 4KHNA 3RWUA 2BE2A 4QQDA 1VSLA 5C0MA 4M3UA 4BWMA 1TAUA 4YFUA 1U48A 5SWMA 4GVMA 3IS9A 3QNNA 2RF2A 4ID1A 2BGGA 4B9UA 1GOAA 2G8HA 1BQMA 1LWCA 3L42A 3HPOA 4CF8A 3PMIA 1G5VA 1UOCA 3DLGA 2R7YA 1KLMA 1N27A 2YV0X 5C25A 1TVRA 4KKOA 3V1OA 4HCBA 3RMAA 2QKBA 4O5BA 4I9QA 5J1EA 3AO2A 1VSMA 3VQAA 2I5JA 3SYZA 4CF2A 3PY8A 4FCYA 1J9AA 2KQ2A 4M42A 3L2WA 3K5MA 3S3MA 3OMCA 3MAQA 3G0ZA 1Q8IA 3B6OA 1W9HA 3JSMA 3ASMA 1XWLA 3AVIA 3VA3A 4L8RB 3ITHA 3KK1A 2HHXA 4ZTJA 4E1MA 1VSDA 3L3VA 3LZIA 3LP1A 1B9FA 4CJVA 3VQ4A 1JLEA 4OPJA 1WSHA 3NGYA 3KLGA 4KTWA 1WNSA 4DG1A 4FJKA 1CZ9A 1RT4A 4B8AB 5IN1A 2X35A 4FK4A 4JRQA 5KCHA 5KE2A 4KV8A 1JL2A 3CM5A 4CFAA 3RR7A 3M8QA 2LRQA 4DTPA 1VRUA 1ZYQA 3NE6A 1WSJA 1KFDA 4CJQA 1XHXA 4DU1A 4KTZA 4KTQA 4DTSA 3ASKA 3DLKA 2Y1JA 4DFPA 2NUBA 3AVKA 3SUQA 1BIUA 3SJJA 1L3TA 1NOYA 1NK0A 4CF1A 4IKFA 4FZYA 3OYFA 3HM9A 3VQ7A 4DWIA 3DMJA 3LYIA 4J2AA 3PFSA 3VA0A 1N5YA 1HYZA 2X6NA 2O4IA 2WOMA 4JS4A 2HVHA 4FLVA 3ZT2A 4JRPA 4ID5A 3L3UA 4CHOA 3CM6A 1C0UA 3MEVA 4CJLA 4B3OA 4FJ8A 3LWMA 3NCIA 3OYJA 4JLHA 4W5NA 1WAJA 4QOZB 4AHVA 2HB5A 4B9VA 3V81A 4GMJB 3HP6A 4RW4A 3SQ1A 5HBMA 3AVCA 3D45A 3LDSA 4MQ3A 3NTHA 3F73A 2BIVA 4CEAA 4W5TA 1N6QA 4CJRA 1JKHA 4DTXA 3ZSZA 4DSLA 3FDRA 3KK2A 4DTUA 1IO2A 4FJMA 2Y1IA 4AHRA 2X4YA 4E1NA 1C6VA 2P1JA 3P1GA 3SQ4A 3MEGA 1BCOA 3CG7A 4KREA 3PX0A 1DTQA 4MFBA 4FLWA 1J53A 3O4NA 4LH4A 3F9KA 4CJEA 4DS5A 2FC0A 2W42A 3BGRA 2PZSA 4KAZA 2IC3A 4RW6A 1QSYA 3SUPA 4J2BA 2RKIA 4A4EA 1VK0A 4CJ3A 2QKKA 3QO9A 2HHWA 3KLHA 3L2VA 2JGUA 4Z4CA 4CFBA 3EY1A 3QEPA 3ZSRA 2EQUA 2B4JA 3QJ6A 3HSTB 1QQCA 4QAGA 3QIOA 1VSHA 2XDPA 2RHYA 1VSEA 3DLBA 1MU2A 2HHUA 1ZBLA 1UWBA 1NJWA 1KSPA 4CEQA 3DI6A 4N4IA 3SD4A 2OPPA 3QBYA 1U45A 3V1RA 2FBXA 1KCFA 2MWPA 1IH7A 1RTJA 1HJRA 4E7HA 3LAKA 5J2QA 3HPHA 3I0RA 2GUIA 4LH5A 3T1AA 4N41A 4J2EA 1YT3A 1A5WA 3UIQA 4CHYA 3FLGA 1TK8A 1SUQA 4BDPA 1ITGA 4Q5WA 4CEFA 4M3XA 2QQRA 3QIIA 5I3UA 4C5EA 5FRMA 3ULDA 1RBUA 3MP1A 4CECA 4CE9A 1HMVA 2B8AA 1LW0A 2YKMA 4IUVA 3OYLA 3HYFA 4ICLA 3CFOA 5D6XA 3I8DA 3EYZA 1ZBHA 4C8LA 4E3SA 4CIEA 4CK2A 5E41A 2NLUA 1HNVA 4E7KA 1SL2A 3LH0A 3LGFA 3NF9A 4DTJA 2HW3A 3P5JA 3AVHA 3DOLA 3KLIA 3AA3A 3OYCA 2DAQA 1WN7A 2OZMA 2G8VA 1T03A 1RDCA 4ELVA 4CGHA 3V4IA 4FU6A 4IURA 1TKDA 4FZZA 1LAWA 4AHUA 2XY6A 3MEWA 4NYNA 4DFKA 3V6DA 3M8SA 2L3RA 3BDLA 1HPZA 3DM2A 2FBTA 5HRSA 3NFAA 4Z4IA 2Z1HA 4FVMA 2X4XA 3C6UA 4CIGA 2RI5A 3C95A 4FLXA 4PL6A 4F4KA 3OJSA 2Z1GA 3NH1A 3AVMA 1NJYA 5KGWA 2F96A 1EETA 1QSSA 3KD5E 1TK5A 3EZ5A 1G15A 3TAEA 1D5AA 2D0AA 2JTFA 4DMNA 3T19A 4M45A 5KI6A 3VQ5A 4KO0A 5KH6A 1BI4A 4FLUA 3SI6A 1U4BA 4IG0A 5HRPA 5I42A 4OLBA 1S1XA 4UQGA 2DTUA 4DSEA 3NHGA 3OS1A 3HVRA 1TL3A 1RBVA 2ZD1A 1S1TA 4DQIA 2P0KA 4R5PA 2R57A 3QNOA 1OI1A 1QTMA 4QQ6A 3ALYA 2YNGA 3MXIA 3VQEA 4KHYA 1LV5A 2E4LA 4XIUA 1TKXA 2BUDA 3AVAA 1EP4A 1A5VA 5HRRA 2EKOA 1CXUA 4GY5A 4BE2A 2P5GA 4ZTFA 3ZSYA 1BI4B 1SKSA 3ZT3A 1JXBA 1Z25A 1S9EA 4LSLA 2VG6A 3S9HA 2PY5A 4F2SA 3PX6A 2GFUA 1BISA 3TARA 4B9NA 3VQ9A 1EXQA 4ELTA 1GOBA 5J2PA 4DQSA 2P5OA 3AO3A 3MP8A 1T05A 3AA2A 4FJIA 4RW8A 4FM1A 2B5JA 4FZXC 1YVUA 2YNIA 2E6NA 3OYAA 1OZ3A 3WNGA 3CYMA 1B92A 2GFAA 3TR8A 3AA5X 4W5QA 3A2FA 2R5AA 3DLHA 3PUFA 3H08A 4O4GA 1TKZA 1VSFA 1ZBIA 2VYTA 4N5SA 3RMCA 4IUPA 3RR8A 4DLGA 1L3SA 1S1VA 2XHBA 4E7IA 2F8SA 2EX3A 3HO1A 5KRSA 1ASWA 1B9DA 1XC9A 1XI1A 3MEDA 1JLCA 4CJSA 4DTMA 5CZ2A 1VSIA 4AILC 3QEVA 3MXJA 3NAEA 3E01A 4A4HA 4NS5A 4M3RA 1WJSA 1DLOA 3V1QA 2HHSA 4Y1CA 4M3WA 4M3YA 1RT6A 1JLBA 3SPZA 2PYJA 2Z1IA 1Z26A 2IGIA 4B08A 4B9WA 2QXFA 1C1CA 1WAFA 2BDPA 3Q1JA 3KKSA 3LPUA 4FXDA 4FJHA 3WNEA 1KRPA 4CK3A 4QW2A 2XY7A 1S6QA 3DRRA 3IRXA 3QKJA 1NOZA 4CJPA 4AH9A 4J2DA 4KHSA 4CK1A 2JLEA 4CHZA 2DFFA 3FEOA 2G8WA 4KB1A 1KTQA 2HVIA 2EQKA 3META 4KI6A 5HROA 1EKEA 3DB4A 4O55A 4PA1A 1VSKA 4AHCA 2DFHA 1BGXT 1RI0A 1WLJA 1XNIA 2GV9A 4CJTA 1A5XA 4DQQA 3AVNA 4PLIA 3TAGA 3OVNA 4BD3A 1U04A 4B9SA 2HHTA 3MP6A 3KK3A 3AV9A 5KRTA 1S1UA 2XY8A 2IG0A 4DU3A 1RDDA 1BHLA 2PQWA 3TAQA 2F5KA 1REVA 2RHIA 4O0JA 3LLRA 1HQUA 4IG3A 2LTOA 3V9XA 1D8YA 1IKXA 5D3GA 3ZCMA 4DFJA 3NH0A 4E7JA 3LALA 5J39A 1RBSA 3QLHA 4Z4GA 4TSXA 4Y1DA 1SL0A 4KHUA 4DSJA 1S6PA 2O4GA 3SCXA 3ZT4A 4CRIA 3FC3A 2L8DA 1QE1A 3NF8A 4NZGA 4N4GA 4A4GA 4CHPA 5DMRA 3C94A 4OVAA 3AVGA 5JS2A 2EFIA 3RRHA 4FW1A 1D9DA 1WSFA 2X4WA 5J2NA 4QQGA 1IKWA 2RI2A 2IS3A 3RRGA 4FLYA 1VRTA 4HUFA 2XY5A 1HRHA 3AVBA 3DB3A 2DIQA 4C5GA 3MEEA 3U3GA 3LGLA 3ZSOA 5C24A 3CQ8A 2HMIA 3LP3A 5HRNA 4IBNA 2HHVA 1JLAA 3M9QA 4H4MA 3OMGA 2G8FA 1C0TA 2LVMA 5FRNA 3VQBA 4FJ5A 4DU4A 3VQCA 1HYSA 3QIPA 3K2PA 4OGCA 4OGEA 5T7BA 4B9TA 3D0PA 3SUOA 1JL1A 3SV3A 4FLTA 3L2UA 3OS0A 4KFBA 1X1PA 4Z4FA 3AO1A 1CXQA 3ZT1A 2G8KA 2FBVA 4Z4EA 2A1SA 1NKCA 3ZT0A 1RDAA 3VQDA 4CEDA 3P8DA 3QINA 4CJUA 1L3UA 3TAMA 3OYIA 1U47A 3HJFA 2LSNA 1L3VA 3IAYA 2E5QA 3AVLA 3MEAA 5CYMA 3S3OA 2JZ2A 4CF9A 1D9FA 2KFNA 1WSEA 2B6AA 3O8VA 3DLRA 4I9LA 3HPGA 3SZ2A 3ZSWA 3OYEA 3UWNA 2K3YA 3U6FA 1QHTA 2R58A 1OZ2A 2X6SA 4BWJA 4FJXA 3K5OA 3VQ8A 4QCLA 3O3GA 2DFEA 1WSGA 3KKRA 3H8ZA 3L8BA 3KLEA 1KVBA 2ATQA 4FJNA 1C1BA 1KLNA 2CKKA 1KFSA 4F3TA 3OB9A 3VN5A 1WJRA 5C6SA 4LY7A 3K58A 2XK0A 4B9XA 2HQXA 4BE1A 3AO4A 4CHNA 4KRFA 3TWHA 1RDBA 1Y97A 4O0IA 2RI3A 2YNHA 4I2PA 2QQSA 4LD6A 5M9OA 2YHAA 1L5UA 4Q0BA 4CGGA 4FM0A 2FHDA 3CFPA 3BDPA 3THVA 4O44A 4NCGA 4AHSA 4IFVA 1JLGA 3LZJA 3E9GA 4EZ6A 3RMDA 2RJFA 3VQPA 3PNWC 4CIFA 1TKTA 4OLAA 3ISNC 1LW2A 2YKNA 4FJ7A 1W0HA 2G3RA 4EDUA 3MO8A 1OYXA 1NK5A 3AO5A 5CZ1A 3HXMA 2D5RA 1RTHA 3TABA 3EAEA 4B8CA 1QSLA 2QK9A 2M0OA 3CFRA 2R5MA 3NDKA 3KJVA 3O3FA 1TV6A 3TAFA 3OYHA 3NGZA 3NTIA 4JS5A 3NNQA 4E89A 4BE0A 4CJWA 4PLLA 4RG2A 1MHNA 3MXMA 1ZBUA 4A4FA 4FYDA 4HCCA 1JLFA 4FL6A 4ZHRA 1C1AA 3KIOA 1CLQA 4HCZA 3HVTA 2AJQA 1S9GA 4E19A 3PO5A 4CESA 4CGIA 2RHZA 4OJRA 1RT3A 3L2QA 4LD0A 3LANA 4DFMA 1LWEA 2OPRA 2KZMA 4DTOA 1TAQA 1LAVA 1BL3A 2KZZA 1NK7A 3KLFA 2GBZA 5J26A 4I7FA 4HVJA 4II1A 3OJUA 3SNNA 4M3ZA 2HNYA 4FJGA 5FDLA 3MEUA 1J54A 3HT3A 4FK2A 1S1WA 1NJXA 3KTQA 4UC4A 4CEBA 1RT2A 3I0SA 3MECA 5HLFA 4OPKA 1RILA 2OZSA 1RT7A 1SL1A 2G8UA 5CIUA 4L59A 1LWFA 3OS2A 4DF8A 3QETA 2BANA 1SKRA 1UAXA 3O4QA 2O4XA 2KW4A 4FLZA 4WE1A 4IDKA 2M1HA 3ZSQA 1X9SA 3OQ5A 3DRSA 3KUFA 5K14A 2E6MA 4N76A 1U49A 3ZSXA 4K8ZA 4H8KA 4OVLA 4RG8A 4N47A 2X78A 4Z02A 4HTUA 2VG7A 1BQNA 3M8PA 4AHTA 4RW7A 3NGIA 4YNQA 5DK5A 5KE3A 3NH2A 1IKVA 1IG9A 1FXXA 3DLMA 3QESA 1WJQA 4PUOA 3OYBA 4DTRA 1SV5A 4HHTA 4EP5A 1HNIA 2KTQA 1YTUA 5IAYA 2O4XB 4DLEA 2RO0A 4LSNA 3NF6A 1F21A 5FROA 4CGFA 1RT5A 2VWKA 2D0CA 1NK4A 3CEYA 2LDMA 3FFIA 3V9UA 5KTQA 4OKJA 5CY4A 3C4SA 2HQEA 4HUEA 3OYKA 1KVCA 1NJZA 4PWDA 2M16A 4OKKA 4M41A 1NK8A 4FJLA 3SV4A 3PO4A 2K3XA 4CJ4A 2D9TA 1GOCA 3RTVA 3NF7A 1I3AA 2RJCA 4E7LA 4NCBA 1YTAA 4HUGA 3QEXA 4N4HA 1DTTA 1HQEA 2EQMA 4F2RA 4C8MA 2HNZA 2LCCA 3RMBA 2IOCA 3V9ZA 2ZE2A 4PQUA 1FK9A 3IG1A 3ME9A 3QERA 2OA8A 2FBYA 3O3HA 3LP2A 3TANA 3PMTA 2DY4A 2RJEA 3P8HA 1RNHA 4RW9A 3G10A 4KB0A 1TGOA 4F8RA 4Z4HA 3UT1A 3LAMA 4CJKA 3LPTA 1CZBA 4CEZA 3VQ6A 4CERA 4X34A 3U3YA 2Q3SA 4DSFA 3C6TA 1T8EA 3PX4A 5SZTA 4BDZA 2EQJA 5KCOA 2EHGA 1TL1A 4EZ9A 1ZBFA 3DYAA 3AVFA 4G1QA 1SKWA 3GOXA 5JS1A 3S3NA 4CF0A 3NBPA 1I39A 1RTDA 3LP0A 4BDYA 1KVAA 1TK0A 4GW6A 3DLEA 1R0AA 4DSKA 4C5IA 4CEEA 1RTIA 2WONA 3HP9A 3QEIA 3VQQA 3P83D 3SPYA 2IAJA 4CJ5A 1NK6A 4IFYA 4H4OA 1FKPA 5D6YA 4DSIA 4DQRA 3OA6A 2OYQA 1NKBA 4CCHA 4C8NA 1J5OA 3KD1E 4NCAA 4M3TA 1WGSA 4KPYA 2RHUA 3OYNA 1KHCA 1NKEA 3SUNA 2P51A 1WSIA 5EU7A 4E0DA 3OY9A 1VSJA 1HYVA 4FW2A 5D6WA 4BACA 3S6WA 2BKDN 3SQ0A 1BIZA 1EX4A 1ASVA 4CGJA 1T7PA 4I2QA 1JLQA 3SQ2A 2RHXA 2E6LA 2YNFA 1X9WA 1H3ZA 2VWJA 4C8OA 4IUQA 3DOKA 1C0MA 1S5JA 3K59A 4C5HA 2HHQA 1NK9A 4F3OA 4NYFA 2A1RA 4K8XA 3JYTA 2L89A 3AVJA 1RT1A 3LX7A 4OKEA 1JXEA 3WNFA 3T3FA 3V9WA 4CEOA 4Q5VA 4FK0A 1O1WA 1BCMA 4B9MA 4KHWA 2KFZA 2PYLA 2YRVA 2XO7A 2G8IA 4FJ9A 4CFDA 2OPSA 2ZQBA 3K5NA 4CFCA 2GF7A 3TAPA 2RPIA 4DQPA 1UA1A 4DS4A 2DIGA 2ITGA 2F8TA 4N56A 1UA0A 1X9MA 3AA4A 1QS4A 5J2MA 4C8KA 4DF4A 2WACA 2VG5A 3LWLA 4B9LA 3K57A 4W5RA 2MWOA 3TI0A 1SSFA 5HP1A 1ASUA 3HK2A 2OPQA 3OYMA 3V9SA 2HNDA 3HL8A 2RN2A 2X74A 4CGDA 2ETJA 2IDOA 3H6ZA 3L2RA 1Q9YA 3OYGA 1RCHA 3F70A 3ZSVA 1RBRA 4KI4A 1K6YA 2YHBA 3B6PA 3NTKA 4W5OA 4PY5A 1RBTA 4CJFA
chains in the Genus database with same CATH superfamily
5IP6A 4Z0UA 1KG5A 2QGFB 1ZGAA 1KC8R 2Z1JA 3LM2A 4FJJA 3TP3A 1X6OA 3SEQA 4D0PA 1WI9A 2DZCA 4F17A 1E6HA 2K4JA 1BU6O 1MJBA 3SZTA 1MD0A 3PV8A 2E5LK 2E3IA 2P9KA 4CI0C 4BR4A 2CH4A 2CT3A 1N33K 1YHQA 2XRIA 4W97A 2EINH 1BI2A 3CI5A 2WSEE 1Z91A 4DR1K 4QS9A 4ELUA 1HNWK 2EPFA 5FPDA 5C42A 3A2KA 1SZ2A 1O13A 4KHNA 3VEXA 3CCEQ 3JTHA 1X2QA 3UKUA 2UV1A 5C0MA 3FM5A 1AWJA 1WBDA 4M3UA 5D6FA 2VKNA 2FO0A 1GCPA 1MMSA 4ZDOA 5FLXO 3A5OC 1W2BA 4WQ5A 4BQZA 3H35A 1BW5A 4RTVA 2KT8A 4B8XA 4B9UA 1TWFJ 1GOAA 5BOXA 2G8HA 2IBDA 3L42A 3VUBA 4IFEA 4YELA 2K4YA 5DY9A 4KH6A 4B09A 2P9KB 2YX6A 1N27A 1FNNA 1JGSA 2DK8A 4M77C 4IF4A 2JG6A 3IC7A 3SZGA 3D2FA 4N0AC 2KDOA 1FPQA 2W4SA 3AO2A 3VQAA 4EJTA 4QLCU 3SYZA 3PY8A 9ATCB 3IDHA 3SFZA 4IDHA 3HG9A 4M42A 1WEGA 3UKUB 4CC3A 4U7DA 1VQ7Q 3TL4X 4UB6C 3V8JA 2YRDA 2VPRA 4YOYA 4DV1K 1MNMC 1Q8IA 1YW9A 3FXQA 5A0DA 1QZ5A 2A3ZA 3O8GA 4LFUA 3ASMA 3HTUA 3AVIA 3ASOH 2AZVA 1D1CA 2WUSA 2PMHA 4ZTJA 2DXBA 3GWZA 4E1MA 4HAMA 1M9SA 2ELJA 4OIPF 3N0UA 3P9CA 2B9SA 2W57A 3H0GJ 4KTWA 1WNSA 5H2FC 2ZXWH 1QKXA 2DA4A 1QGPA 2V1QA 4FJKA 3D2FB 1RT4A 3F8FA 1AU7A 1KQ1A 3F72A 1J9IA 3O8HA 4HDUA 4BY6B 3K4MA 3CVSA 2GCXA 3I3LA 1KU9A 3CM5A 1QVFA 2BOLA 3RR7A 3PIPA 4A3MJ 2CP6A 4DTPA 4MHGA 3X25B 1EV7A 3FXMA 5GAN6 5KYUA 1QO0D 5C4XJ 2Z2SB 3DLKA 5GINA 3NQOA 1NGHA 1JT6A 5DUIA 3AVKA 3SJJA 2OFKA 5CQXA 2K3PA 1K7AA 4IKFA 2CGHA 4M3GA 4FZYA 3OYFA 3SDZA 4HWIA 5EG2A 1ZA2B 1Z0XA 3DLLL 2F69A 3M58A 3JS6A 1FX7A 3PFSA 1Y7XA 1MUDA 1OH8A 1DGKN 4KULA 2O4IA 1Q81U 3I56Q 5D8LB 3ZT2A 1Y6IA 4B3OA 1XTAA 2HHHK 2QEXN 5KYUB 4UV8A 2R7ZJ 2DODA 2DI3A 2OAWA 5B66C 5B3SH 5KHDA 4AHVA 3SAGA 1FC3A 4JJBA 2QTDA 1F4KA 4Q47A 1JUPA 5DYMA 1BN5A 5HBMA 3LDSA 3SDGA 5GMKm 3NTHA 5C10A 3IUOA 2NOEA 2ABLA 3FXJA 2KMUA 4PUSA 2BIVA 2E19A 1XG7A 1N6QA 2O6GE 2KIQA 1M1KC 4KMUX 4DSLA 3ZSZA 4DTUA 4PFPA 2CGJA 3TOAA 3BY6A 4CYDA 2DL8A 3DEEA 3SQ4A 1IUFA 4HSBA 1DTQA 4HG2A 4A5BA 5JVGL 3DBHB 4BKXA 2DBKA 3G71A 2P7CB 4YFNF 2W42A 3EG0A 2V1NA 2IC3A 1X3MA 4A2BA 3CMEQ 4IEIA 4HKEA 2RKIA 1KG1A 3CCQT 1VK0A 2IS1A 4CJ3A 5J47A 3QICA 3L2VA 2JGUA 4BBSJ 4G7ZF 4LG3A 4P5OA 3EQLF 2AO9A 3R6OA 1K1ZA 1J75A 2LNVA 3HRSA 2F2WA 2EQUA 3HSTB 1QQCA 1QMCA 2MOXA 2JVHA 4ATOA 1DIZA 2RHYA 4PHTX 3OW2P 3I59A 1K8KA 3EUAA 5FB2A 3T9NA 3CCLT 3CCQA 5HS8A 4JKAA 4LIVA 1KSPA 3LDPA 2A36A 4JP0A 9ANTA 1GLAG 4UVBA 4N4NB 2YJEA 3GDQA 1LB2A 3J80E 3FMSA 5ILVA 4TVRA 1RTJA 1TP4A 5DPKA 5J2QA 1U5TA 1ORKA 1AWCA 3JRAA 1IHVA 5FLXZ 2E36A 3CCLA 4PCQA 2A6HF 1YT3A 1A5WA 4XMYA 4QVCA 2F5CA 2PMUA 4Q5WA 4C92F 3GE1A 2YX7A 3I59B 3CPWP 4CECA 4PJOF 5DLQE 2Y69H 4CE9A 3TTDA 1W7PD 2B8AA 3G3ZA 2YKMA 1BA0A 3HYFA 2QQAA 5C44J 4ESJA 4HNTA 4IRGA 4C23A 4E3SA 4CIEA 5EZGA 4CK2A 4JN4A 4RGXA 2DA7A 2X0LA 3FFKB 1USSA 1LWYA 4J01A 2ZPHB 3ZQHA 4BRHA 4A3LJ 3CC4Q 3ZCOA 2B63J 1H92A 4EGYA 4WXHA 1K8AC 2GM4A 1WIEA 1Z3YA 2W1OA 1RDCA 3ZMUA 4JKBA 3I53A 4L5JA 2JA7J 2KRMA 2D2WA 4IURA 4FZZA 4AHUA 3HXLA 1RFQA 3V6DA 3BTJA 2EWSA 3E6CC 3MHXA 3CJBA 4G6TB 4YIIA 2GIZA 1LPLA 2FBTA 1OCCH 2KZVA 4LLGF 4E9HA 4CIGA 4F3QA 4E4HA 2AHJB 2X51A 1T0FC 1S72Q 3KZIC 3ZP5A 4JI1K 3WODF 2B0LA 5IT9E 5GIOA 2K3FA 4M78A 4WF9L 1M1KO 3CCSI 2HS5A 1UGQB 4KBMB 4X0GA 3EZ5A 1G15A 1MDUB 1WDXA 3HKZN 3MPUB 3MX2A 3LW5E 3TAEA 1XQSC 1KYZA 4MQ9F 5EYRA 4BRDA 1FOYA 3HHGA 3T19A 4M45A 4J9EA 4AI5A 1V76A 1NGCA 3H5NA 5I2MA 3E5XA 3PFIA 3PTAA 1I5OB 1BI4A 4FASD 4FLUA 1U4BA 4IG0A 5E26A 1JCEA 4XEIA 2VVKA 4IQ4A 3L09A 4UUSA 3WXJA 2DTUA 4DSEA 3HVRA 3SK3A 3GBTA 2KR3A 3ISPA 2K7LA 4Y13A 1G8XA 1FTZA 1SHFA 1YG2A 3VYUB 4M78B 1UHMA 1P2FA 2XB5A 2ZJRF 3SMPA 4DCHA 2V1RA 2O8CA 1LJ9A 3BQZA 3MXIA 2Q31A 3EKSA 2XSDC 2OANA 3FX3A 1MBEA 3SAHA 4XIUA 3BF1A 2BUDA 3QWXX 3HB9A 1K9AA 1GFCA 2VJIA 4EHUA 3I71A 1MMDA 2EKOA 1OMIA 2WY8Q 1HYOA 5L3FA 5M5XJ 1BI4B 3ER0A 2VT3A 2PLYA 4UUSB 4JYAK 5C2DA 2KIMA 1S9EA 4B3MK 4LSLA 4YPHA 5IP7J 3WTYC 1Q82C 2HPIA 4KIFA 1V3FA 1UELB 3JB9H 1TWGJ 2DMOA 2UXBK 4B9NA 3VQ9A 2PBIA 1X1DA 2KYBA 1GOBA 5J2PA 3RERA 1JU5C 4DQSA 2P5OA 4JYKA 2NRHA 5CHZA 4C92C 1SD4A 3ECHA 2Y30A 3HTSB 1Y57A 4M74A 2V6CA 1GHCA 4XU0A 3EE9A 3QO3A 1YVUA 4JPBW 4PJOC 3HOTA 4EM0B 4KN7X 4W1UA 1V1CA 4IEEA 1B92A 2GFAA 3TR8A 2FF3B 4A3KJ 2E65A 1VQ5T 2NRTA 2YPRA 3ZMSA 3OL3A 3VW4A 3OA9A 4OU0A 4O4GA 1PD1A 4K42A 3I4MJ 1K8AO 3RR8A 5HNFA 4F14A 1S1VA 4EJUA 3ATUA 1YUWA 3QDKA 4L3QA 3BR3A 2FRWA 4Y17A 2QWPA 3DKYA 3E5QA 1VQ5A 3HO1A 5J1YA 4M75D 2LKSA 1XI1A 2D0NA 1HUXA 4AILC 1R1TA 5KAFC 3E01A 4BJ5C 2HDCA 3F8CA 4PFOA 1XUPO 2GA2A 4BVPA 3V1QA 4FHTA 2DA2A 1RT6A 2DQLA 2NOHA 4K25A 5AZIA 2Z1IA 2K79A 5HS9A 3GZNB 4DIQA 4B08A 2QXFA 2BDPA 3KKSA 4XAXB 4BG8A 3BOQA 3M1EA 3TO9A 5GMKe 1SFKA 3HKSA 4PJOG 1OJLA 2EIMH 3W2WA 2QEXI 1HSJA 3HHTB 1QBJA 2XY7A 2PAVA 3DRRA 3IRXA 3QKJA 3RI4A 1RADB 4D8KA 2HOTA 1JHFA 5F1JA 4XL9A 2JLEA 3CBMA 1ONVA 1Y39A 2VBXA 1KTQA 1S3XA 2E70A 2ID3A 3ZMDA 2ZWHA 2HVIA 2F4VK 3DB4A 3ULEA 1XJWB 3WT0A 4O55A 4CO8A 3JV3A 5AZIB 5F0HA 1ZH5A 2DFHA 3F8BA 1U8BA 1M3CA 3NGPA 1X9JA 2VWBA 2GZWA 1WLJA 3CC2N 5E1XA 1M1KU 3DKXA 1SAXA 1XNIA 1X3NA 1M90C 3KE2A 3V7RA 1D1AA 3FZLA 2GV9A 2OI3A 1SMTA 4CJTA 2W03A 3C18A 4OMMA 5K5OA 3TAGA 4M7DA 3TSQA 2LFBA 2C0TA 5FKNA 3AG1H 4EMSA 4J9BA 5E8IA 4BEHB 5AQMA 3AV9A 2UUAK 2GIVA 2DYIA 2P0PA 3RYRA 1D3BA 5CKEA 2RHKA 1RDDA 1BHLA 2PQWA 3TAQA 1QCOA 1TU0B 2F5KA 3ULEB 3LLRA 4U88A 2LTPA 2NUTA 1BJZA 1YQMA 1D8YA 1B34A 1IKXA 1ZTRA 3L0QA 3NH0A 3LALA 2RVCA 1VQ6N 3BJ6A 5FFZA 5CO7A 1I27A 3OH6A 1X3UA 5AQUA 4KHUA 2Q1NA 2M87A 3VS0A 2PVDB 1TC3C 4M7DB 3R6NA 3SCXA 3JB9J 4NOYA 4CRIA 5GANg 1S7EA 3ABLH 1R9TJ 4N4GA 3G71Q 4XH4A 4A4GA 1AT1B 4OVAA 2YU9J 3AVGA 5BQTA 1KC8C 5JS2A 1T2KA 2EFIA 3RRHA 2IW5A 1D3BB 1D9DA 2MABA 1VQMT 3K70C 4QQGA 2P5LC 2RI2A 3I4NJ 5AQIA 3RRGA 2NUTB 1CF7A 1VQNN 2FF4A 4GBQA 3SZPA 1HRHA 3OHRA 1B34B 3BP8A 1OYIA 1WJ5A 1X2NA 2ISZA 4LITA 3LGLA 4YOTA 2HFHA 3CLOA 1RABB 2DK3A 2LYCA 2EVRA 4JNEA 1VQMA 2HMIA 3M7GA 4KIBA 1WKMA 4OPHA 1WCMJ 3CCQQ 2HHVA 4IHVA 5FPNA 5FWBA 3VKIA 4M9SA 1U3EM 1SSHA 3DLLF 3RZDJ 4DV6K 2V9PA 3VQCA 1HYSA 3FJPA 2MD0A 1ON1A 5CLSA 3QIPA 4B9TA 5D5VB 1JL1A 1KXPA 2UUCK 5ED4A 1CF7B 2XF7A 3DTIA 2WY7Q 4YFKF 4Z4FA 2G9WA 1MWKA 4XLAA 5CAIA 4BXXJ 2FBVA 3CO7C 1UB4A 4MZTA 2XIGA 2A1SA 3VYGA 2E2JJ 4LUDA 1RDAA 3CVTA 3VQDA 1WJEA 1UEBA 3C0BA 3O9RA 1WHJA 1R6RA 3FXLA 1P7IA 4FWPA 3TAMA 5GAN7 2AXLA 2KAFA 1QQMA 4RB3C 2ZB9A 1ZUYA 2FU4A 4HX8A 1WQ2A 1YIJN 3ZN1A 3BEXA 2FRHA 1C0FA 4BYYA 5IOYA 2HYGD 2STWA 3O08A 1PU8A 1M90O 4Y3OA 2NXNB 4CF9A 3BJAA 1D9FA 2KFNA 1WSEA 3X26B 3HYIA 5M1NA 3O8VA 4YIRX 4I9LA 2VN2A 4O3MA 3MKDA 2QKMB 4BL0B 4BRPA 1E3OC 3CCJI 3VYHB 1FOWA 1G3WA 4NUBA 3AGKA 1XCBA 4ZGEB 1UG2A 1OZ2A 2R4GA 4WCGA 2KISA 4FJXA 4A6EA 3A8OB 3H5AA 2QASA 3BR6A 2EIFA 3VQ8A 2DFEA 2JHNA 4WCEL 5GAMh 1IRGA 2A68F 5AQQA 2ATQA 4FJNA 3HOYJ 5F6FA 1JXMA 5H6QA 1KLNA 2M8EA 3AKZA 5FD6A 4JQFA 3QXEB 3FWEA 1KO9A 4IZ9A 4GGGA 2X6WA 3K58A 2BZ8A 1WHKA 3I0TA 1VQPT 3PM1A 4BE1A 3AO4A 2HSTA 4RTYA 4KRFA 3R0AA 1H9TA 3TWHA 5LGNA 1H3HA 4IJNA 1P9QC 3DXJF 1MGTA 2COBA 2X6OA 4AIJA 4JI0K 3QB0A 4HEA2 2L9SA 2YHAA 3HTRA 4IOCF 2DJZA 1ZAOA 2X4JA 1ON2A 3M4YA 4FM0A 1KC8O 5KPRA 3THVA 3JCMV 5CVUA 2PNIA 1D1BA 3CERA 4MMLA 3ERMA 3PNWC 1Q82U 2E1MC 1TKTA 2JZYA 4OLAA 2M7AA 2HDWA 1MMAA 3GTGJ 2GOMA 3VERA 4I98B 2KL4A 4B3RK 4JI7K 3JTGA 3P9KA 2KXDA 1TUYA 2BZYA 5BS6A 1RAEB 5CZ1A 4IWVA 3HXMA 1TUCA 4XH1A 2EGCA 4RS8A 3QYGB 4B9QA 1SANA 2M0OA 4J9CA 2R5MA 1RNLA 1HXDA 3NDKA 5GPAA 3VENA 1YFHA 3TAFA 4ANJA 3NGZA 1BOTO 5GANe 1FZPB 4FOEA 3OYYA 3WGIA 5ECAA 5GJVB 2L3QA 2CH0A 3OW2M 1Z3XA 4M78D 4HCCA 3TGNA 1AHDP 3SBTA 3WUHA 1FT9A 1A6IA 2JWTA 2DOAA 3RKQA 2DDAA 1KG3A 3J81K 4O6JA 2L7KA 4F16A 2Y2ZA 2K85A 3SWNC 3CDIA 1VQOI 2D1XA 2NYSA 4CESA 2D0OA 4H5RA 4CGIA 2O9SA 1RAIB 1RT3A 2DAOA 2YS9A 3L2QA 1UHSA 1REPC 1LEBA 2DFIA 4DR5K 3C12A 2LJ3A 2HEQA 3RR6A 1W2BP 3TTFA 2I8DA 3RKXA 3OSSC 1BL3A 2KZZA 3DTEA 4MEYF 5CVJA 1POGA 5KK1A 1UJYA 2PMZA 2QWNA 2ZM6K 4I7FA 1ZQ1A 4HVJA 4II1A 3SNNA 3NWTA 4FJGA 2E64A 1J54A 2YG9A 1M4ZA 2IVNA 3G25A 5KN9A 3CPWM 2CUBA 2OJ2A 2H3JA 3NFCA 3GXOA 1V5FA 4CEBA 1UHCA 4C2MJ 2KPMA 1WHHA 5IY5H 2WAEA 1RILA 3FK6A 3G1OA 2BTTA 4M78E 1F9NA 2VKEA 2BHYA 3FXUA 3QETA 2L7FP 5LMUK 2W6LA 3AARA 1EQYA 5EVZA 3NVKA 2O4XA 4AVPA 1ZSGA 5JLXA 4M4ZA 2J05A 2M1HA 2LC4A 3OQ5A 3TEEA 2EGEA 4DEXA 2XAFA 2UZKA 2QA4Q 3VYRB 1YJ9T 4A3CJ 4OVLA 1KQ9A 4IIOA 4N47A 4QKUA 2NS0A 3WE2A 2VG7A 2K5LA 1U9OA 3CD6T 3TW7A 2AQEA 2VT2A 5DK5A 2JM8A 4J8OA 3H9QA 4B1UB 5LJWA 5TJJA 1RLQC 2FZKB 1TT5B 1YITN 3CESA 3MAJA 3DLMA 1KQSS 1QVFP 2ESNA 4PUOA 2L3PA 1YJ9A 4BREA 4OIOF 3CMAA 4PKGA 4EP5A 2V1UA 3CUQC 2O4XB 2IGOA 3CCVN 2JNGA 2M45A 3M54A 3CD6A 4H0OA 3C3WA 2KLOA 1VF9A 2RDPA 3HOVJ 1RESA 1NK4A 2VBYA 5D5WB 5AQRA 1ZLMA 3FFIA 4RGRA 4U67L 1GBQA 3GLXA 3V9UA 4O8UA 4OKJA 4HBLA 3FDYA 5CY4A 3J7ZO 3CCMN 3C4SA 2WWYA 2HQEA 3J7AP 3CTAA 2M3AA 4C0FA 1WJCA 2ZC2A 2CZ6B 4M41A 2EA4A 4ABZA 3S2WA 4EV0A 3K4LA 3PO4A 2ETHA 4DGWB 2VCPA 4C2UA 2NUPA 3J7ZI 2OBPA 4OMOA 4FTHA 4HUGA 3UKRA 3ML6A 1I6XA 1HQEA 4JKGA 4FWNA 2Y0SA 4C8MA 3JAMK 4MEXF 1EH6A 2HNZA 3RMBA 3RBBB 3H3VK 1G3YA 1VQKQ 2YUNA 2ZE2A 4PQUA 4M3FA 4NDLA 4G7HF 4C8QF 2FBYA 3J8AA 3TANA 4BRIA 3H0IA 3TPQA 1VYVA 4D7NA 2NOGA 3HDDA 3G10A 1YAGA 1GLCG 3WVEB 2E2OA 1TGOA 4F8RA 3GNFB 2RV8A 2D0PA 3UT1A 3LAMA 1R77A 3AFHA 4PNOA 2OAZA 4F7UG 3C7NA 5ICCA 4KICA 3ABUA 2VOOA 4IXCA 3PSIA 1NZ9A 4EEFG 3UKRB 2C06A 3ESWB 4JKGB 2LC2A 5HK0A 3TQNA 3F22A 4UNOA 3BFMA 3C6TA 4G94A 3KP3A 5AYFA 4BDZA 3QP6A 3WHBA 3QJYA 4EZ9A 2HQHA 2OTJT 2H56A 1NBEB 2K9LA 2CJJA 4RB0A 3RCOA 4QPQA 1QPIA 3S3NA 1AA7A 1MIJA 1I39A 2Y31A 5M1FA 1RTDA 2DE0X 4PFZA 1KG2A 2HZTA 4WQ4A 2PJPA 1VQMQ 5LJ3f 4M7DD 1UB9A 3QEIA 1YIJI 3V7CA 3VQQA 3G2BA 3T0YA 3X28B 4CJ5A 4ZN3A 2OTJA 3C7NB 4CZEA 4IFYA 4CZZA 1FKPA 1OQYA 3A5NC 1BBZA 1QZYA 4DQRA 3GFJA 3OA6A 2DOEA 4E9GA 4FOIA 2K4BA 3WTWC 1FEXA 3PIPL 1J5OA 4M3TA 3CCEN 1ZRCA 3FE1A 1LDKB 2X9HA 3A4CA 1NKEA 2QWOA 3WQUA 4JKCA 1O57A 1XN7A 1VQ9N 1SD5A 3CJCA 1ZELA 1IG8A 3IKMA 3CCRT 2EIJH 5FPEA 3JRBA 2MK5A 5BRFA 2EYWA 5JICA 3EGXA 3OR1C 4BACA 3DXKA 3VUZA 4JV5K 1IUYA 3CMMA 4JK9A 4ON0A 3KP5A 2DA3A 4CGJA 2V1DA 5JVHL 1G6NA 2J7IA 1LEAA 3SQ2A 3TO7A 2E6LA 2YUOA 2MFZA 4A3JJ 1WBBA 1X9WA 4M7DE 3ZEUA 5LL6Z 1W97L 5LJ5h 2RN8A 1XCVA 4DR4K 4C8OA 4FM4B 4C30A 3CCRA 3S41A 3ZXSA 4NHJA 4B1XB 2DA1A 1X3WB 4BG9A 2QKLB 2A61A 3HPWA 2VXFA 1VQ7N 1HKBA 2A1RA 1NJIO 4HPQA 1QVPA 4RUGA 3JYTA 3LX7A 4WFAL 3KLOA 1MZBA 2K27A 1W5CC 3WNFA 3G6EQ 1K61A 1D5YA 3V9WA 3EGXB 3HGYA 3DXKB 5E3NA 2KFZA 3K1NA 3A02A 2KIFA 2P9SA 4IQJA 2YRVA 2G8IA 4FJ9A 1ABOA 2E3HA 1PCXA 4DK9A 1VQLT 4CFCA 3T1BA 3TAPA 3KWIA 2RPIA 3ZEUB 1UA1A 3JCUC 2DIGA 1KQ2A 2F8TA 4OB2B 2VC0A 1OX9A 4FWMA 2DX1A 4BR0A 2IGMA 3TBIA 1YWOA 4BJ6C 3WXMB 5BPIA 4ENNA 2PBDA 3AA4A 2DMPA 5J2MA 2WACA 2WAQA 4A54A 3IH4A 2JM9A 3MZYA 1Y1VJ 1MBHA 4FQGA 4B9LA 1ETWA 3HM8A 3K57A 1VQLA 3A8LB 5AIQA 3H1VX 1SSFA 2KBTA 3CJ7A 4ISGA 3T1YK 2FL7A 2OPQA 3HL8A 2HNDA 3VRYA 1Q81R 1TQIA 4AG2C 2P9SB 1Q9YA 1UFMA 4L5EA 1WJBA 4DHYA 3GL1A 1N77A 4CBXA 1FW6A 2VQEK 3LH5A 2QBYA 1RBTA 4XNFA 2VKDA 5GAN8 3VPRA 3E9FA 2A41A 5I22A 2I10A 4IOAF 3ZETA 1O4XA 3DBLB 5ADXA 2OTLN 2UUBK 3TCJA 4CHQA 3F21A 3M1CA 4XH5A 2NOBA 1X69A 2L02A 4Y7NJ 1XGNA 2NRVA 3CCYA 3SDBA 2DTZA 4UVCA 2DF6A 3K5LA 3KLNA 1ZG1A 4J83A 4CC4B 1TWHJ 5GAN2 4MFEA 3M8RA 1WI3A 4LDYA 2HYFA 1E7OA 2V6EA 5AN4A 2F6CA 5GAN3 3DRPA 4KHQA 4EMKA 1KAXA 1Q18A 4RAZA 1K0XA 4C8QG 2O8XA 2HU9A 1OX8A 2E88A 2LZ6B 2CMPA 2F48A 2KJBA 2E6ZA 3CCUI 4YFUA 1U48A 2KZGA 2ME6A 1FYKA 2W10A 3ZETB 3SLCA 2RF2A 4ID1A 2MG4A 3VEYA 5GJWB 1TWCJ 3VEOA 4B1VA 2DM1A 3HPOA 2KQRA 4CF8A 1WJAA 2HWVA 4BR5A 2GEMA 4YORA 1KLMA 2HQ5A 3RSNA 1OCZH 2RQWA 1R4NB 4EJYA 2KT0A 3L4IA 5GAN5 5HDNA 4HCBA 1TQPA 1Z7UA 2JMCA 2RF0A 5AQKA 4NC6A 1AEYA 2H3EB 4BI3A 4N9HA 4EMKB 3BY5A 3CMEN 2EZIA 2E2HJ 1J9AA 5LEKA 4F93B 5CKTA 3K5MA 4H0XB 1FYNA 1HQCA 4YOQA 1XX5A 2ZXHA 3TKYA 3G0ZA 1YITI 2NNYA 1IJWC 4X9CA 3B6OA 3FZMA 3SB2A 1W9HA 4XTXA 4F92B 1OU9A 2XD0A 3VA3A 1T08B 1Y8QB 3PIOA 3KK1A 2K2MA 3FHFA 1I8FA 4CICA 3LZIA 3LP1A 4BI8B 3VQ4A 2A3LA 5AQTA 4OPJA 1VZ0A 3S32A 2A6TA 1IV0A 1R0CB 3KLGA 1NG2A 4QWQA 2EFQA 4HX7A 1CZ9A 4DV0K 4BGAA 3GTMJ 4GRIA 3CCMI 1WFWA 1PUEE 1JKPC 3CCST 1QVGA 2IVMA 5IN1A 1NLVA 3LOCA 1ETOA 2FBHA 3N4QA 1DUXC 1FLIA 3M8QA 3MKLA 2DEUA 3TMOA 3NE6A 3CQYA 2V8JA 1BUPA 4CJQA 1XHXA 2HF4A 1FY7A 4HA8A 4XLNF 3OWTA 3JRCA 5KPZA 4DBRA 2COMA 3SUQA 1NOYA 4BR7A 4CF1A 1YJ9Q 5GMKh 5ILUA 2G7UA 3CMAQ 4LFCK 3L1PA 2IIRA 3HM9A 3JCMJ 2E5NA 4RB1A 3VQ7A 2DO7A 1VQ4Q 2HGCA 1T98A 1U8RA 3UATA 3VS6A 3DMJA 3TQ7P 3H0FA 3CD6Q 2DXTA 2JN0A 3LYIA 2LCLA 2DK5A 3ZMVA 2LY1A 4C0DB 3U21A 3GMEA 1YQLA 3K69A 2WOMA 1R1UA 2HZYA 4X9DA 2BXZA 2OCCH 4FSXA 1C0UA 4CJLA 1NYFA 3QBWA 4FJ8A 3I0XA 1I1SA 2BTFA 3LWMA 2YT6A 3NCIA 2LK2A 1WPKA 4CZKA 4W5NA 1WVRA 3CC7N 4EVIA 2XU8A 3R60A 4RW4A 1RAGB 1BR4A 1QWEA 2MH9A 3EYYA 3SQ1A 2P9IA 2OZUA 4A3GJ 4D9JA 4CSWA 5ICGA 4LDUA 4OMZA 2YSRA 4XN0A 4JRKA 2A07F 1KD1R 3RVCA 1S72N 1JKHA 3VDXA 4RMOA 4FJMA 1IO2A 5FLXK 1SF9A 3L9FA 3FXRA 4AHRA 2O3FA 2PX9A 1Y96A 1OISA 2CH5A 1BCOA 2W6KA 4NXMK 4MFBA 2FNAA 2YLCA 5CYVA 3L4QA 2KE9A 2B7EA 5TGTA 1Q1HA 3G1LA 4DS5A 1LUJB 1TS9A 1QZZA 1VQ8I 3FB9A 3BGRA 2PZSA 2EH3A 5L3DA 3S6IA 1IXSB 4CYCA 4C1NI 2KXCA 3SUPA 3M57A 2L4AA 3KX2A 1ZSZC 2M5WA 2P9IB 4NL2A 2BY1A 3JCMW 1RACB 2QKKA 3LSHA 3QO9A 5GAOr 3TSUA 4B1RA 3VU3C 3BZ6A 3RDVA 3CCEI 3N4MA 4LUEA 2GXAA 3QIOA 4RLQA 1Y96B 2XDPA 2A5XA 2X3XD 1YWPA 3IP4B 4RCCA 1VSEA 1W2BM 3DLBA 3OTOK 4AT1B 2HHUA 1VQPN 4LD5A 1NJWA 4MTDA 1N3CA 1JGGA 2R7XA 3S93A 1OH5A 1YJNQ 4N4IA 1NMNA 4CYCB 2FBXA 1KCFA 2MWPA 1IH7A 3V8LA 1HU0A 3R8EA 3HOZJ 4XM3A 4E7HA 4NB4A 5D5XB 1JO8A 2CUDA 1QQIA 6PAXA 3T1AA 3JCMd 1M3AA 2OTJQ 3E19A 4AM7A 3UIQA 2M9HA 1L0OC 4CHYA 1MNDA 3EGUA 2E5ZA 2A6AA 4ZNXA 3F5TA 2E8AA 1SUQA 2D4WA 2VUBA 3KETA 1QVGS 3M07A 1VQ7I 4M3XA 2QEXT 1YJWI 1UECA 2IVOA 2QQRA 3QIIA 2BY3A 2HNIA 4ZJZA 1ZUKA 5FRMA 4A53A 3U9GA 4WXCA 3ULDA 1RBUA 4GV6A 1HMVA 3N4PA 1LW0A 2HMAA 4PKHA 3OYLA 1U6ZA 1AHJB 3CFOA 4ZH4F 5D6XA 2OX7A 3EYZA 1ZBHA 4CH7A 1ZA1B 1SMYF 4LLNA 4X65K 5E41A 2JWKA 1HW1A 5HODA 4L18B 1HNVA 1T0FA 4B43A 4FIBA 4EIKA 1SL2A 1ZK8A 2ED0A 2LY2A 2P4RA 1D0XA 3MJXA 1G3TA 2QEXA 5FKOA 2MMPA 2HW3A 1FWZA 3K4NA 1VFCA 2IA0A 1OR7C 3IAM2 3AA3A 3OYCA 2DAQA 2NRWA 3J80O 3M9AA 3O9TA 2LX7A 4JJNK 5F0FA 3I5RA 1T03A 5HLHA 3REBB 1HX1A 4ELVA 1QVFM 3JRHA 3GTLJ 3V4IA 4ZN1A 4OB1B 1TKDA 1K9MR 2R7RA 2XY6A 2HOAA 3MEWA 3CLQA 4NYNA 4DFKA 1BB9A 3M8SA 1HPZA 2DMUA 5F2RA 4MLHA 1V29B 4Z4IA 2IGKA 2HQRA 2X4XA 1X4PA 1KSWA 3QG1A 1UHWA 3S1NJ 1MUZA 5FU6C 4PL6A 2AKLA 2M4KA 3BR0A 1FIAA 3OJSA 1IN6A 2Z1GA 3AVMA 4JD2A 5C2FA 3FXKA 2X3WD 2JTVA 4YRVA 2HBWA 4NC7A 5LHGA 1O3TA 4CVNE 3KD5E 1TK5A 2PG4A 4A3BJ 4G8XA 3BJOA 2FUG2 3W6KB 4DQ2A 2CUEA 2R7UA 1D5AA 3IAS2 1XD7A 4ESBA 3R61A 4DMNA 3I56I 1XG1A 5KI6A 5KN8A 5D4SA 1FJLA 3KK7A 1K73R 1R36A 5IYBJ 4MNUA 1QCNA 2FNPA 1H641 2PTKA 1UJ8A 1UFFA 5I42A 4K43A 1Q7YR 1S1XA 1BR2A 3OS1A 4M7YA 1HLUA 1TL3A 2ZD1A 3K1MA 2RMOA 1YNZA 2FSNA 4JD2B 2P0KA 3GTPJ 4R5PA 2R57A 4DZJA 1R58A 1SD7A 3W6JB 1QTMA 3PIPF 3ALYA 2YNGA 2CV2A 4DUYK 4KYWA 1NLPC 5EJCA 3V42A 5IT9O 3QBXA 2YHXA 2PFUA 4KHYA 1KFZA 3QU6A 1PYVA 4LB6B 3RJPA 3L6QA 1QWFA 1A5VA 2K5FA 3FZFA 4GY5A 2P5GA 1R22A 4ZTFA 2VIXA 1G99A 2NS8A 1W1WE 3PLAA 2W40A 4AIHA 1Z25A 3S8PA 2GNCA 1N78A 2XC7A 3KYDB 4PJLA 2DLPA 3J7AF 4IHWA 5BREA 1X43A 3CMEI 3S9HA 4HRIA 2PY5A 2FE3A 3AGRA 2KFDA 1JKOC 4F2SA 3P7NA 2EW3A 3TARA 2IVWA 4N9IA 2YUQA 2GTJA 3M8JA 1HD3A 1E3HA 1QA6A 1EXQA 1PC0A 4CD1A 1QNTA 2CSOA 3VSKA 2F5FA 2MSYA 3AA2A 4RTXA 2RNGA 4RW8A 4OMPA 2R7OA 3GBQA 2E6NA 2LKPA 2NWMA 3OYAA 2XKPA 3E3VA 3LWFA 3KEOA 1RI9A 1BA1A 2FZCB 4B3SK 1HR0K 1NGIA 1N75A 2R5AA 3QDRB 1MMGA 1FOKA 2HVRA 1TKZA 1ZBIA 4N5SA 1HW5A 4LN2A 1L3SA 2NRZA 2XHBA 2LOOA 4MFDA 1TNTA 5DCMA 4E7IA 2F8SA 1M2OA 2EX3A 2F9WA 4JKEA 2LQWA 1JJ2P 5KYNA 2Z5UA 4CCOA 3RKYA 4DTMA 5CZ2A 1RAFB 1VSIA 5J8FA 3QEVA 3MXJA 2W41A 3NAEA 1VAZA 5JI6A 2QXLA 4FL9A 1R23A 4M3RA 3H1CA 1WJSA 4C9YA 5BPNA 4HTLA 5F04A 1DLOA 4Y1CA 1EIFA 1NEGA 3WVDB 4M3WA 4M3YA 1QP2A 2ZPIB 4CZJA 1I4K1 1JLBA 3HFNA 2YR2A 4MDAA 2PYJA 3IKVA 4M77D 4BY6C 1U84A 1Z26A 4JEPA 3HEFA 1NPRA 2CWEA 2IGIA 3BG6A 3CC4I 4LC9B 1CKBA 1V5EA 1DGWY 4ISFA 1Z9ZA 1ZC6A 5DCMB 4QW2A 4CUGA 1PNJA 3K9TA 2O9LA 5H20A 3I64A 1LFUP 1IN8A 3BTCA 3PVQA 3SHWA 3QYBA 4DKWA 2KLAA 2XV4S 3CHWA 1LMZA 4OFEA 2W48A 1EBMA 2DFFA 1JUSA 1PM3A 2KVQG 1U3OA 3QP5A 3DU6A 3NHNA 2DL4A 1PG5B 1S72I 5EF6A 4UHTA 4YG2F 7AT1B 4E6KG 4AHCA 5LJ3g 3D6RA 2Z3YA 3U23A 4I0AA 1RI0A 2FSWA 2KP6A 2QQ9A 5AQVA 2CDTA 1VUBA 1U5SA 1E0EA 2CU7A 4DBFA 4HV6A 2X4HA 2F1LA 1A5XA 4QPOA 3AVNA 1U04A 4A0XA 3H3OB 1SKUB 2K9NA 2VWFA 3MP6A 3ENHA 3O9QA 3JCMQ 4DYQA 1O3SA 1S1UA 1MUNA 1K4US 3U4LA 1WHUA 2DMTA 4DU3A 4HVVA 3KYCB 2LT4A 1WQWA 2ECZA 2RNAA 1RC9A 3CF5L 3VS5A 1W4MA 3FK7A 1U2WA 1OOTA 4EM1A 3A8HB 3KXTA 4HQMA 1N6AA 1SVLA 2C0OA 1Q81C 1C0GA 5J39A 1IN4A 3FM3A 4Z4GA 3ZQ7A 1P4XA 1XQHA 2L0KA 4JKHA 5GAMf 1ETQA 2Q36A 4ME7A 5CKHA 4LFBK 4ENKA 2XASA 1R00A 3D1NI 3FC3A 1S9HA 2FMYA 4PSWA 2L8DA 1EO1A 1QE1A 3NF8A 2DO3A 4A3FJ 2XB0X 5BPMA 4CHPA 2CUFA 1I6HJ 3C94A 1XMQK 5IT9Z 2XHKA 4ZYEA 4FW1A 2WV0A 1ACIA 4BR9A 2J6FA 3JCMX 3MKYB 2FBIA 2X4WA 5LRRA 2ZJ2A 2CP3A 4FLYA 3RPUA 3EGDA 2XY5A 3H3NO 1IXRC 3AVBA 2QCOA 3CCUQ 3IMXA 2ZJQL 1IW7F 4C5GA 5D8KB 3MEEA 3EDPA 4MGRA 3GIBA 3OIQA 2DPDA 3JSOA 1T33A 1W7PB 4AMCA 1BL0A 2QZ8A 2AT1B 3M9QA 2PUOB 4C3IJ 2KYMA 2BZXA 3A98A 4KGXB 3ZGKA 1XGMA 2G8FA 3A5LC 4I02A 2D5VA 2JXBA 3VEPA 1I50J 5HDKA 4EJZA 3IUCA 2O0YA 3IQLA 3VQBA 2FZGB 4E9EA 4J9DA 4DU4A 3VS2A 2QQ8A 2V75A 2J6KA 2ESWA 1O7FA 2EIKH 3SUOA 1QHGA 4I7HA 4XRMA 3EGDB 4FLTA 2EBPA 4XQFA 1TTHB 2VJJA 3SFMA 4KFBA 2DXIA 3BR5A 2EV5A 1CXQA 3ZT1A 2RK1A 4Z4EA 2GQIA 4E7ZA 2Q2EA 4II2A 5IHIA 1KONA 3LQQA 4CEDA 2D1HA 3QINA 3S1RJ 5J6XA 4EJWA 2L9RA 4XK8E 4CJUA 4YPRA 5GAEJ 4XLCA 4NXNK 2H3GX 1U1SA 3CC2A 1ATRA 3EHRA 1PDNC 3QUIA 4ZDPA 1ORNA 2HNHA 2QLZA 5AQHA 3LFUA 2E5QA 3AVLA 1FSHA 4J7IA 1KA8A 4BHBA 2ROTA 2W00A 3N5NX 3E6BA 3EFOA 1QRYA 1EFNA 3QYEA 2V7ZA 1BOAA 1VQ6T 1WGXA 3I55Q 3DLRA 1G3SA 3G4SQ 2VL8A 4K0KK 4CZGA 4JZ4A 4FPBA 3T69A 3M1FA 3H36A 3CQTA 3SZ2A 1FN7A 3FSPA 1KU2A 2Q2EB 3G73A 3TW6A 2MYSA 2LP0A 4S04A 3U8XA 3T5XA 3QRFF 2CP2A 2X6SA 4E7SA 4BWJA 5LHIA 1SFOJ 1F36A 1SAZA 3DU5A 1VQ6A 3J7AO 2MPXC 3O3GA 5F1XA 3WXKA 5IWAK 1KVBA 3DPUA 2NNNA 5LHHA 3CPFA 1VQNT 1KG7A 3QPHA 1TBXA 1Z9CA 3EFOB 1Q81O 3I54A 3P9IA 4MDBA 2H27A 3H0DA 3ZX0A 1HF0A 5LJ3e 2QA4N 3H9JA 4E47A 1Y97A 4O0IA 1BR1A 1WJDA 2HTJA 4DOZA 2QQSA 2D0QB 1HOMA 3CO6C 2BW3A 1VQNA 4PJNA 5LD2C 4FYYB 4CGGA 3ULQB 3BF3A 3CFPA 3P4IA 3GW2A 3BDPA 3GVAA 4LFAK 4O44A 4NCGA 1AOJA 5A2QE 3LZJA 2SRCA 3RMDA 2I5UA 2COYA 1FTTA 1UGSB 2A40A 1CGPA 1YCYA 4YFXF 1LW2A 2M0MA 2XDDA 1YIOA 2E1YA 2OU2A 1W0HA 2G3RA 1OYXA 4AM3A 4M75A 4CZHA 3CCSN 3SWNA 1RI7A 2TDXA 2H6CA 1KD1C 2D5RA 1T0JA 2BUPA 2ZXIA 3TABA 1J5YA 4B8CA 2K9MA 2QK9A 1W5TA 1R49A 2RC4A 1JKRC 3VFZA 2PUKB 3CFRA 4DV5K 1VQ8Q 2BW3B 4YOVA 2HF3A 1KU3A 1NE8A 3G71I 1Z67A 1YIJT 4A5NA 4BC5A 2HBPA 3MWTA 3PFYA 4PLLA 2OD5A 4KNYA 1YX3A 2EQIA 2HYJA 5AQOA 5H1SQ 2NAZA 2KY9A 2SEMA 4FYDA 4L0YB 4HSRA 1JLFA 1TWBA 4ZYAA 2DT6A 3ENOA 1K6OA 4HCZA 3HVTA 4E19A 4RTUA 4M7DF 4M75B 1VQKN 3PO5A 3SWNB 2DTIA 1TUUA 2GTDA 2EWNA 4C3HJ 5B8HA 1LJOA 4DFMA 2CS7A 1LWEA 2CQQA 1N39A 2YG8A 4WXDA 5CKBA 3CCQI 2KIUA 2OPRA 1AKHA 4Y52J 3B8AX 2K02A 1TAQA 1RRQA 1T8IA 1LAVA 2EFPA 5KYYA 2DDBA 3LAPA 2DW4A 2GBZA 4OO1J 4DEYA 1E2XA 3O9UA 3ONQA 1M3BA 3TSPA 5LGTA 2ESHA 2HNYA 5LJ5d 5FDLA 4KH4A 1G2BA 2QTVA 1GCQA 2QYZA 2NVXJ 4MO4A 2HSEB 4FK2A 1S1WA 4BHCA 1YI2Q 1PVSA 4QS8A 1LE8A 2FLOA 2HQNA 4H0PA 2CH4W 3CCLI 3C65A 1JRIA 2HBKA 1TL8A 2O8DA 2RNJA 1YJWQ 2KKZA 2MF2A 1VYTA 1NGFA 5CIUA 3JRGA 5GAMj 4L59A 2E10A 4V2FA 4BRMA 4ZYGA 5B1AH 4C92D 4DF8A 1E4GT 4PJOD 3VOEA 1IGQA 2P81A 1E6GA 4Y0WA 1AKHB 4DR2K 4FLZA 4WE1A 5KYYB 1X9SA 3MCAB 1XSDA 1FMWA 2EYQA 5HNHA 3KUFA 4N76A 3OIPA 3L1AA 1M1GA 1T38A 3JB9F 5DM7L 2LLKA 4F7UA 4K8ZA 4H8KA 3AL0B 4H03B 3GPLA 4NO7A 1D3YA 4J5YA 3JRIA 2FPFA 1YE9A 1WXUA 1S22A 3NGIA 5J8CA 1WA7A 2O8DB 2CT4A 3NH2A 2LDUA 3FXOA 3M0QA 3K9KA 2LH9A 1FXXA 3VB2A 2VKHA 2XROA 1WJQA 4FT8A 1WX6A 1HSQA 4M77G 1K9MC 3ZQGA 2KTQA 1XDUA 1Z21A 5IAYA 4KUIA 1YTYA 3SQNA 3GYHX 4LD9K 4DLEA 2RO0A 3EUHA 3NF6A 3ZX2A 5FROA 6AT1B 4BRCA 3GTJJ 2D0CA 3AY9A 4UVAA 1DP7P 1ULYA 2GWKA 3FHGA 3MKWB 4F7UB 5KTQA 2VONA 2R92J 3IWFA 3ZQFA 4ESFA 3OYKA 1NJZA 1KD1O 1Z1DA 4AVZA 4PWDA 2NVTJ 2O2OA 4FJLA 2ZGWA 3SV4A 2MLKA 3KWGA 1KYWA 2HOSA 3PO3J 5DM7R 3W0LA 3NF7A 3L2CA 5LJ5f 2RJCA 2VQLA 4FWLA 5M1PA 1V4SA 3PE0A 1YTAA 3M0RA 5BN9A 4Y15A 1AOYA 1D5VA 1Z6RA 2K2VA 3JCMP 4FYXB 1K73C 3QEXA 4ITVA 1DTTA 3HUGA 1LDDA 4F2RA 3G6EN 3BCBA 1S3JA 3DAWA 2LCCA 4XONA 2IOCA 3V9ZA 3THYA 1Y0MA 1Q7YC 3CWUA 3O2PE 3R6SA 4ILGB 1G4DA 1R5GA 2P4WA 4LF4K 1MJAA 3SMSA 1YQKA 3ME9A 3IG1A 3P31A 4O8KA 2JPCA 3D2EA 2OA8A 1BK2A 1M27C 1P8ZA 1P6RA 1I3QJ 3O3HA 2L9VA 3PVLA 3LP2A 1I5LA 2QYOA 5GANj 3PMTA 2RJEA 4M7DC 4IHSA 3DV8A 4RW9A 3O4WA 4KB0A 4L9NA 1N3AA 2STTA 2HD0A 1FMVA 3LPTA 5KQDA 1SC7A 3RNJA 2HDAA 4YOXA 3HUGB 3ELKA 4FWRA 3HSFA 3C6HA 4A3EJ 2NRXA 1VIFA 5AT1B 3ZL7C 5SZTA 2EQJA 1OULA 5KCOA 3OBWA 3MWMA 2VE8A 5AQPA 3FJ5A 3D2EB 4BBRJ 1YITT 2IPOB 1Y56A 3GUDA 4E9FA 3MCZA 3NBPA 3MQ0A 4MZPA 3PIOL 4KGVB 2V1XA 2XPWA 2XPVA 4KITB 1FOXA 3DLEA 1R0AA 4C5IA 1RTIA 3CCVT 3COAC 4U0YA 4B23A 3BQYA 2LJ0A 2H8WA 2IAJA 2YCHA 1NK6A 1DQUA 3HJEA 2LBFA 4J9GA 1YITA 1XSVA 4H4OA 2JPSA 3CPWA 4Y91A 4DSIA 1JJ2M 1J3TA 1X1CA 4HV5A 2DNUA 2OYQA 3CCMT 4CCHA 5I21A 4IO9F 1JUMA 1RPWA 3KP6A 5FLMJ 2JA5J 4D7MA 4ILJA 1S7OA 3KD1E 3CCVA 5F1RA 3THXA 4CCMA 4DV2K 2RHUA 4JI3K 4EGZA 3GFMA 4WK8F 4CBUA 2HVSA 2W85A 1MNEA 4ZC3A 1K8KB 1K9MO 3OY9A 3FISA 2X1CA 4JOMA 4PGHA 4FW2A 5M1OA 3CCMA 5AONA 3KEQA 4I0BA 2YWWA 1ORPA 2BKDN 3CC2Q 1LQ1A 1BIZA 3RQ4A 3EHQA 3CF5F 1BKBA 1WI7A 1T7PA 4I2QA 3HTVA 2LBFB 1YVNA 2HR3A 5AQXA 2QWQA 2WSCE 3SJHA 1U5TB 2QA4I 3DOKA 1DEJA 2CSIA 2P6TA 4YDUA 3RPUD 2WTEA 2WAFA 3IV5A 3VWBA 4M7AF 4C5HA 2V4JC 4EPCA 2HHQA 1HBXG 3N5BB 4C8QA 3D5LA 3Q0VA 4OWRB 4P5NA 3TSZA 1ZHIA 4DYCA 3R1XA 4PL7A 2LMDA 4K8XA 4A57A 4DUZK 4A93J 1NGJA 2AS5F 4GLMA 3ID6A 1R0BG 1JXEA 4BQAA 3E6MA 2HBJA 4Q5VA 4FK0A 2TRTA 1K73O 2F5EA 3JB9G 2M7BA 3K2ZA 1HKSA 5C4JJ 1ZR4A 3NMZC 1X01A 1VQ6Q 1JE8A 1Q7YO 3BG5A 2KK4A 3K5NA 4HOBA 3LNQA 2XGDA 1XDSA 3LSIA 1TYQA 1UA0A 1B8IA 1HDPA 5DUKA 1SAUA 2FEZA 3CF2A 4C8KA 3CUOA 1CSKA 4C8QB 4JI2K 1LFPA 2HL3A 4K11A 3EO3A 2DERA 1KD1U 3VODA 4W5RA 3J7YJ 5M3FJ 4L5GA 3LDNA 3CCJN 1VQNQ 4FWSA 3OYMA 2WC9A 2H94A 3MMVA 5BR8K 1UG0A 3MEXA 5M1QA 1T3LA 3H6ZA 2VBZA 4S0HB 2K5IA 1NGAA 1RCHA 2RKHA 5EEHA 4OPAA 3CMAN 3OW2S 2YHBA 3M5AA 3NTKA 3CCET 4W5OA 1VQKI 4J9FA 4PY5A 1VQ4N 5AQJA 2JN6A 4CJFA 1TYQB 4IUTA 4JLGA 3EYIA 1B8IB 4Q48A 5FKLA 1VQ9T 3GZ6A 4DTNA 4M7XA 1T6DA 3QZ9B 4RB2C 3K4KA 2Q0UA 4F52A 4EJVA 4JX5A 4MDWA 3CCEA 1OPCA 2V7FA 1IKYA 1JEGA 2OFIA 3QEWA 2UXCK 1Q9XA 5CYQA 2D0BA 3RUXA 2MD5A 3KEYA 4RTWA 3OYDA 1YCSB 1VQ9A 2K9QA 5KGXA 4FM2A 1DGRM 2MBFA 2RJDA 2KI7A 2GWJA 2K57A 1YHQQ 3C2BA 4QQDA 1RZ4A 1VSLA 2D1VA 5HDGA 3CPWS 1Y0NA 2RQTA 4Y92A 4BWMA 4RLFA 2O8CB 2M34A 4GVMA 3ATVA 3IS9A 1VQ7T 3CDLA 5D6EA 3QNNA 1TSFA 3R0JA 3R3LA 4XRSG 2ZFUA 3JB9I 3GBGA 1JQQA 4MO5A 3FKIJ 2BZTA 1LWCA 3DBRB 3DLGA 1LNWA 2R7YA 3MK6A 1VQMI 3KP7A 1MDMA 3HSRA 2YV0X 3UE5A 1BO5O 4QIWN 1JXOA 2BE5F 1TVRA 4KKOA 3LL7A 3RMAA 1Q86R 1VQ7A 4I9QA 5J1EA 1VSMA 2I5JA 4CF2A 4FCYA 1ZLKA 2GGRA 1BJAA 4MQVA 1IBKK 3L2WA 3HZJA 1FMKA 2XKOA 4KUMA 4NBQA 2UXDK 4M7AC 1IREB 2DYRH 3CJTB 1XWLA 3ITHA 3BG9A 1NG7A 4OB0B 1IRZA 4CA0A 1VSDA 3L3VA 2GXGA 3DPTA 1B9FA 1R5ID 1VQON 2E1OA 1JLEA 4LF7K 2M8GX 2V9VA 2EYXA 3M55A 4KT0E 1WSHA 4AFSC 3CJAA 3OR2C 1MDMB 1K9MU 3IHUA 5GAMg 1YJNN 2DU9A 1B72A 4ELYC 3M0SA 3LSMA 1N32K 2DRMA 3BC8A 4H4KC 2KSSA 3TVTA 2JA8J 2X35A 4C92G 2M9UA 4FSSA 4JRQA 2RB6A 3JCMh 4KV8A 2DBBA 1JL2A 4CFAA 2OTLT 2E7WA 1YS6A 1NLOC 1VRUA 4IHTA 1ZYQA 2KMTA 2R5ZA 1XSXA 2QK0A 1WSJA 1UGPB 3I56T 4DU1A 4A0ZA 3HOWJ 4FO0A 3ASKA 3JRDA 4JAXA 2CS3A 3TEDA 3FIFA 1BIUA 1ZXOA 4C2TA 3G6EI 3IRQA 4M75E 3W3DA 2OTLA 2OPTA 2LVSA 3F9MA 4QSHA 3CW7A 5EOYA 1MBKA 4MZMA 2C6YA 1X3ZB 4EW4A 5CKFA 1K73U 2FQ4A 4M7AG 4R79A 4OAZA 2YHYA 5B5EC 4AFUC 5JHUA 1AWXA 1HYZA 2JJ7A 5HS7A 2E1HA 1Q7YU 2ME0A 2OF7A 3OSGA 1YO5C 4JRPA 4ID5A 4YOWA 3MEVA 5IXFA 2R5ZB 2EV6A 3U2RA 3ROUA 3RKWA 4DYRA 2QSHX 4JLHA 1LFBA 4IHYA 2KDSA 1BWFO 1WAJA 5IHKA 3NVMA 4QOZB 2WV1A 5A0LA 3L7WA 2WADA 4GMJB 1GLNA 3HP6A 1OVQA 3X24B 2ELKA 3PT9A 1BU1A 3AVCA 2NNWA 1Q82O 1I5ZA 3S14J 4MQ3A 3CMET 3CXCA 3HM5A 3F73A 1ZR2A 4I6MA 4CEAA 4CJRA 4I01A 1J0RA 2XDVA 4M9XA 3FDRA 3KK2A 3ZPLA 2Y1IA 2NOZA 1QU3A 3I5SA 2DA5A 2L0AA 2ENMA 3P39A 4E1NA 2ZSHB 2P1JA 3OBYA 1UUEA 5DDGA 1HDDC 1KZHA 2XGXA 5CQGA 4KREA 3TSWA 3K6GA 3R4KA 4FLWA 5D4RA 1J53A 4CJEA 4XLEA 3CMEA 2F4IA 1O9SA 2FBKA 1VA7A 5GAGJ 2FC0A 2VC8A 4NLCA 2J5OA 3CP2A 1YW7A 1N9RA 2X1DA 1J6ZA 4KT5C 4RW6A 1QSYA 2FX0A 4J2BA 3DF8A 4J9HA 2E7XA 4JRIA 4JZ3A 5DM7F 4RTFD 3IHOA 5E8GA 3ZN0A 3GF5A 3LDOA 3O9SA 1UGRB 2HHWA 3KLHA 4M3DA 4CFBA 4I6MB 4L0ZB 1AWOA 2F4MB 3D4VA 5GAOn 3ZSRA 3BY7A 5ICFA 1FYLA 4RGSA 1OH7A 4QAGA 1VSHA 3VYSB 3FMRA 4UUVA 2O88A 1MU2A 3ULRB 4Y28E 1T95A 1R71A 2W04A 4CEQA 3DI6A 3K4CA 4DA4A 4F7UE 5EG0A 1WHLA 3V8KA 3SD4A 2OC6A 2OPPA 3QBYA 4YY3K 1U45A 2OJED 3VOVA 2LRDA 4BNCA 1HJRA 2XGCA 3HHHA 4ZGJB 4LH5A 4BU2A 1OR7A 4RKUE 1CQTA 4N41A 4J2EA 1OYWA 3TO6A 4B21A 1BI1A 1IO6A 5B1BH 1V5GA 2OCEA 1TK8A 4BDPA 3RYPA 2ZNYA 1MGQA 1HCRA 3CCLQ 4CEFA 1DP3A 5AJ3K 1X6BA 1XTDA 2P6SA 4KGZB 5I3UA 3TREA 4C5EA 1KQ0A 3CCVQ 3BCAA 2MCNA 3CC7T 4WQ4C 4BXFA 3EFRA 3ENBA 1SVOA 3I8DA 5EG0B 5DM6L 2LQ8A 1RIOH 4XKBA 3BTIA 3VETA 2O03A 3LA3A 4ISEA 2EJRA 4E7KA 3LH0A 1Z7LA 5KYWA 1XC5A 4GCVA 1U78A 3LGFA 2ZF5O 1NPPA 1S72T 4HZFA 3P5JA 1BA5A 2OAUA 3A0HC 5H6RA 4CHUA 3AVHA 3ZQLA 2W7NA 3DPLC 4XTVA 3CC7A 5GAMe 3PO2J 2G8VA 4BQNA 4RAGA 1PRMC 2EV0A 4FU6A 5KNLA 4CC2A 1LAWA 1O75A 3AG2H 4XKVA 2EZLA 3KP4A 2F9TA 2LCSA 3BDLA 2L54A 1IN7A 5JVGF 2ASPA 3DM2A 1EA3A 1S72A 5GAEP 1TLHB 1FJGK 2Y4XA 3ABMH 2CW8A 3C95A 4FLXA 2F5VA 1PU6A 4OAYA 1YJ9I 3FR0A 2N8GA 5KYWB 3CMAI 5KGWA 2F96A 4C1NK 3BDDA 1QSSA 1HLVA 1VQ4I 4EA4A 2VYPA 2HXOA 3CD6I 3CXCS 3VYTB 3CWTA 3GG4A 4DV3K 1RUWA 2D0AA 2JTFA 5DS9A 3DWLA 4DOWA 1KEAA 2L5QA 2ZO4A 3LSGA 2Y90A 1KQSA 1T39A 3WTZA 3WU1B 1QP3A 5GTHC 1MSEC 3I4PA 3PNVA 4UQGA 3S2DJ 2X48A 5EX5A 4ENJA 3DQVC 1CZAN 1LNXA 3GNGA 2KRSA 3SJMA 3P8BB 1RBVA 4IPAA 2E2PA 1VQPA 1S1TA 4KMFA 1MH4A 2E2NA 4X62K 1ZREA 4QS7A 3URGA 3OOPA 3QNOA 2DBMA 1A04A 3JXUA 1OI1A 2GXBA 5GMKi 2IJLA 4B3XA 3H45C 4H5TA 1NM7A 1JB0E 1SS6A 1X4OA 1XMOK 5ILSA 2JSPA 4CZCA 3ASNH 3E2UA 1XS9A 2VASA 2E4LA 1BIBA 5L3BA 1TKXA 2E35A 3AVAA 1ZYRF 3ZQIA 2IAIA 2A3SA 3CP8A 4C8QD 4FX4A 4OMNA 5KAIC 1NK3P 3ZSYA 1YS7A 4AG1C 3ZT3A 3ZOBA 2P4TA 3SBGA 2FVUA 1IC8A 1EH8A 3FMQA 4AD9A 4YTLA 2NOLA 1D4XA 2VG6A 3QYFA 3BWGA 2GWRA 4ZZLA 2AKKA 2DVEA 4PIIA 2AHQA 3MZ8A 1G83A 1WEIA 1BISA 2DMNA 2FF6A 2IS4A 4BROA 1VQ9Q 1ACMB 1OVYA 4J7FA 1EJ9A 4GXOA 4WCIA 2CFOA 3I9V2 4N4OB 2DILA 1T05A 3B02A 3E7LA 3EH1A 1V4TA 2B5JA 5E84A 4B1YB 4FZXC 2YNIA 5FW9A 3M6GA 3WNGA 3CYMA 4JHDA 2CZ7B 5KYXA 1ESVA 1YJNI 1I1JA 3AA5X 1YRNA 3Q9SA 4OMQA 3J80K 4W5QA 4EMKC 4C8QE 3A2FA 1WLPB 3A5ZB 3H08A 2HZDA 4GVEA 2H09A 1A31A 1VSFA 5LJ5g 2VYTA 3X2QH 3RMCA 4IUPA 2OTJI 3CDHA 5HCKA 2TCTA 3M53A 1QVTA 3A8YA 4HLYA 2CRGA 3M8FA 3EZWA 1B9DA 2CZ1B 3MEDA 4JBAA 4BXUA 1GLJO 2FRYA 2O8EA 3CCUN 1ZKGA 2H1LA 4JI5K 1VQ5Q 4DOVA 4A4HA 4EFHA 4NS5A 1E4FT 3MN6A 1MH3A 1JCFA 4JHDB 2HHSA 5KYXB 2Z33A 5LEJA 3GTQJ 1YRNB 1J59A 2IGNA 3SPZA 3MDQA 5K5RA 4LDXA 3D7EO 4XR6A 4B9WA 3OSVA 4E70A 1WAFA 3Q1JA 4TV7A 1YN8A 2ICWG 2KNBB 4FJHA 1KRPA 2EPDA 4A63B 2EGAA 3WU2C 2HKXA 3I58A 1S6QA 2BY2A 2BBYA 3CCRI 1ZG5A 1RETA 2BY0A 1TZLA 5FU7B 4CJPA 4J2DA 2O8EB 4R1HA 4RAFA 2JHJA 2LY9A 1T6CA 2WB1N 2ASMA 4CK1A 4KHSA 3WQTA 1GLFO 1X27A 2ADUA 1WH5A 3FEOA 1JTXA 3ZQCA 2G8WA 4KB1A 4RM3A 2ZCWA 2O8BA 3GZ5A 3KZZA 5IT9K 2CV0A 4PA1A 4G9YA 4Z2YA 2OTLQ 4JKDA 4C0DC 1PP8F 4GV9A 3V4GA 1M3HA 1BGXT 2ID6A 2XAGA 2Q8KA 1ZUUA 3KBGA 3EG1A 5M5WJ 4EAHD 2RGVA 3ZX3A 3Q0UA 4XKCA 2R7WA 1TW3A 3OGDA 5HY6A 4LK0F 4PLIA 2UYTA 3I55N 3A03A 1UZCA 4OFAA 3G4SN 3OVNA 4DV7K 3JRZA 4XTZA 2BGCA 4P9UA 1XPXA 5CQEA 4CDGA 5E3MA 5L8RE 5KRTA 3FLCO 2F2EA 4BC2A 4RMNA 1VQLI 3CWAA 3G71T 2O8BB 5J3LA 3VGKA 4NNJA 1REVA 2DD4A 2RHIA 1TOVA 3VS3A 2IIMA 1HKGA 4XOTA 5FJ8J 1KHIA 3NAUA 3EETA 5ADXH 3AAFA 3ZMTA 3JCMc 3ZCMA 2ZAEA 3HFOA 4E7JA 2NOFA 1M2VA 5BPLA 2VQGA 3QLHA 3PQJA 2Y4YA 5CKDA 2GQQA 1I1GA 2ZMEA 4Y1DA 1W2BS 5AZJA 4J00A 1S6PA 2R7DA 1IRFA 4DR7K 2O4GA 1C0WA 3WTVC 4NZGA 3WG7H 3WGGA 2Y0MA 5DCFA 4UY8O 2NUPB 2FEIA 4M6VA 5E3OA 1WSFA 4OX9K 1IKWA 3KFWX 3BROA 2IS3A 1NEBA 4PDKA 3MKZA 1NHAA 4HUFA 3ERED 3J81E 3E6DA 4UY8I 3DB3A 1M2VB 2JSCA 2DIQA 3U3GA 3ZSOA 2YU3A 2ZMEB 2DPNA 1TUDA 1MMNA 5AZJB 2BVLA 4IOCL 2DL3A 5HRNA 4IBNA 4RM2A 5E3LA 2HXIA 3OMGA 2GX9A 1OEBA 1TH7A 1M8MA 2LVMA 4Z94A 1K76A 2CSQA 5K1YA 2BHZA 3Q0WA 1VQ8N 3QOEA 2ZKZA 3K2PA 4OGEA 1V4RA 5T7BA 3D0PA 4AFQC 4XRFA 2AIRB 1ILYA 3C1DA 1ODDA 1OKRA 3L2UA 2Q1ZB 3D7SB 2ZXJA 1X1AA 1X1PA 3OS0A 4LXCA 5LJ5e 2W84A 1U2VA 1QVFS 3AO1A 1Q86C 1YF5L 1QZEA 3ECOA 3QFUA 1OCOH 2A7YA 1IXCA 1NKCA 2EILH 3E9PA 3P8DA 5GTIC 2QDYB 5CVRA 2QSGX 3O3KA 1ZN2A 4FSVA 1L3UA 5LGUA 2X6YA 4ILHA 4I6ZA 3MN9A 3FIWA 3G1MA 3GTOJ 2E34A 5J3BA 3FF5A 2LSNA 3IAYA 1MPGA 2XRLA 5CYMA 1NGGA 4XN3A 4EW0A 4U7BA 5BNGA 1XMXA 3S3OA 1MBFA 3QODA 3CETA 2JTEA 2QVOA 2B6AA 3CC7Q 1SG5A 2QF7A 1QW1A 1GV2A 1K79A 3G0QA 2MAMA 1D0YA 1U2VB 2KJCA 2KDZA 1YI2N 4UV9A 1DPRA 3I0WA 4HCKA 1A0NB 3OYEA 2K3YA 4J8FA 4YHHK 3JSCA 1QHTA 2BXYA 4AYBN 2R58A 2HTSA 1YJWN 2VBWA 4JKFA 3K5OA 5C15A 1NWKA 1HW2A 3ZR8X 5IHNA 3KKRA 1RKTA 3H8ZA 3L8BA 3TP0A 4Z6YA 2HAXA 3F8NA 2RN7A 1QQJA 2IP2A 1NJIR 3OB9A 2KHOA 3VN5A 1SPKA 3VGLA 5C6SA 1U1TA 2KHMA 1GLLO 2XK0A 3GX4X 2EBIA 2E12A 4B9XA 3VMFB 3A1PA 1PKSA 2WBNA 1MWMA 3G1JA 3MN2A 2RI3A 2JPBA 2YNHA 4I2PA 4LD6A 3CJ9A 5M9OA 3CJRB 1FYMA 4Q0BA 3SEZA 4A4KA 4GKJK 3RPQA 4AHSA 2DXCA 2QQBA 1S8NA 2D1KA 2RQUA 4EZ6A 3Q7CA 3TTCA 2VGNA 1H8AC 3JAME 4XTYA 2GA1A 2YLBA 4ASNA 4AU7A 3BG7A 2DTRA 1VQPQ 1PWTA 1WNLA 1XQOA 2YKNA 1FP1D 4FJ7A 3W2VA 2DTHA 2AQFA 5TKYA 2CYYA 2Q2RA 4EDUA 1X19A 1NK5A 5J4VA 2QWRA 1F5TA 2XAJA 1JBMA 5AQYA 4AIAA 4HF2A 1TQMA 3GOIA 2O9VA 4PSXA 1RTHA 4UNFA 3EAEA 5DM6F 4CGZA 3J7YP 1XMKA 4LIUA 2CQNA 4XICA 3NRVA 2AXTC 2COZA 3VRZA 3I56N 1I07A 3M5RA 1TV6A 4GY2B 3OYHA 5BRDA 1GLDG 5FO5A 4CJWA 2DMQA 4JI8K 4RG2A 1MHNA 4M77A 4HSTA 2CREA 3MXMA 2PN6A 2JUFA 1P7JA 1WQ7A 2P9UA 3HOSA 1RL2A 1ZBUA 4N0AA 4O5VA 4DR3K 5A2QO 5L3GA 4FL6A 2P9NA 4ZHRA 1PSEA 1XOVA 1Q86O 3B6AA 3C7JA 2EYZA 1C1AA 2VB6A 3KIOA 1CLQA 1KGSA 5CHIA 2AJQA 2MGQA 1S9GA 1LCKA 2QBYB 2EAYA 2NUZA 1IZ1A 4OJRA 3BT9A 3M59A 2ZPBB 3LL3A 3LANA 4HT8A 3S17J 3JR9A 4EVVA 3RMQA 3EG3A 4DJAA 1ETXA 3OJUA 4KN4X 3REOA 1RKWA 1UG1A 4M77B 3FGUA 3I5UA 2LG4A 2P9UB 1NJXA 2CG4A 4DZPA 2JRTA 1AZGB 4UC4A 2QA4T 2CYZB 2P9NB 1GXQA 4ELZC 1RT2A 3I0SA 3MECA 1BI3A 5GAOq 2OZSA 2ITMA 2KRFA 1SL1A 3FKJA 1IHWA 4C0ZA 2G8UA 1LWFA 4XU2A 3ZQQA 3OS2A 5F64A 5DD4A 4HDVA 3WEEA 2NOJB 5KQ8A 4A0YA 1UHFA 1SKRA 1IRXA 2CW0F 5CR4A 5CVVA 2KW4A 2QA4A 4I76A 3DWLE 1TG0A 3ZSQA 4BUGA 4HLXA 1S5LC 2F2XA 3O5ZA 3DRSA 3ABTA 5CK9A 4RDUA 2IVPA 1JJ8C 3KZYA 4QVDA 4RG8A 2JOYA 2X78A 1VOMA 4LOCA 1W4SA 4YNQA 1STZA 3I55I 3G4SI 4BGDA 5KE3A 5AQGA 4M71A 4HNUA 4RA2A 2JTMA 1IG9A 4BEHA 5I2SA 3UKGA 1IJJA 3QESA 3OYBA 1D09B 1SV5A 3HOXJ 3WEEB 3CCSA 5LJ3j 5JFRA 3HC7A 4B4CA 5GAHP 4GO1A 3QQAA 4LSNA 1IGNA 3H0HA 2FXUA 1F21A 4CGFA 1RT5A 2NVUB 4N0BA 2JA2A 5JHFA 1DKGD 3O5BA 1B3QA 1ZX6A 2LDMA 2W24A 1FBSA 1BIAA 3EG2A 4BS9A 3IRRA 1DDNA 3C0CA 4HUEA 5FKKA 1VQKT 2R7FA 1KVCA 4M73A 3CC4N 2JA6J 2DEQA 2JT1A 2W0ZA 3BPVA 1LWVA 1LVAA 3DP7A 1DU0A 4CJ4A 3RTVA 4ZYHA 3RMSA 2O5RA 5L3EA 2JUGA 5E1WA 4E7LA 3EE8A 3GO5A 3HZ6A 2DN0A 3B6CA 1VQKA 2NS7A 5FFXA 1M5Q1 4N4HA 5GAOp 2EQMA 2R3SA 3INZA 1E3PA 2HQAA 3JREA 3A0IX 1XGSA 1Y07A 1W36D 1LWWA 1W0UA 3DLAA 4HF1A 5LJVA 1FK9A 2CUJA 2PVGB 3KZBA 3CXCP 3QERA 3FRNA 4A5MA 5M5YJ 4GFBA 4B1WB 3UB5A 5KPTA 4C3JJ 3THWA 2R0QC 2EFOA 3HGGA 2IT0A 4QTRA