3OY9A

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese at 2.55 resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oy9A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oy9A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oy9A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oy9A03
4ID5A 3C94A 4CJRA 2ZE2A 1UOCA 4O0JA 4LSNA 3CFRA 4QQ6A 2VYTA 4RW4A 3O3HA 3QNOA 1RILA 4B9LA 4O44A 1WSHA 1BI4A 1TGOA 2XY6A 1X9WA 1T03A 4Z02A 5FRNA 2ATQA 1L3VA 2DIGA 3WNEA 5KE3A 3OS1A 3DLBA 4FLWA 2RHYA 4DQIA 4KI4A 4DQSA 4CGGA 5CIUA 3WNFA 5D6YA 3DLKA 4B9NA 3QIIA 3V9XA 3RMDA 4I7FA 3RTVA 1A5WA 4WE1A 1TKTA 3QKJA 1J5OA 4CIFA 4NYFA 1WSEA 3QEIA 4H8KA 4Z4FA 1QHTA 4LD6A 4I2PA 1D9DA 3V9SA 1ZBUA 3BDPA 3LX7A 5C6SA 2DAQA 3CEYA 1H3ZA 1BHLA 3S3OA 5HRPA 3KTQA 3NTIA 3AO1A 3FFIA 4Z0UA 4FM2A 1YTAA 2KZZA 4DSFA 2RF2A 4DFPA 4PWDA 4CIEA 4KB0A 4NCAA 1WSGA 4OKJA 3QINA 2BE2A 4FLYA 1DTQA 1ZBIA 3AVNA 4NS5A 4M45A 2LCCA 4YNQA 4CF8A 4CHYA 4NYNA 3MO8A 2B4JA 3OYDA 3DI6A 4M42A 1S1UA 4CEBA 5CZ2A 1WNSA 3OQ5A 2B5JA 3NH2A 4OPJA 3TAQA 1RTDA 1VSDA 3ULDA 1U04A 4FJJA 2EQMA 3S3MA 1JL2A 3U3GA 3KKRA 1FK9A 4CF9A 4FJIA 4CJSA 4Y1DA 3OA6A 3A2FA 4M3WA 1LWEA 3MAQA 1XHXA 1KTQA 4IDKA 4E7HA 4RG2A 3RRGA 1UWBA 3LAKA 4FLXA 5J2MA 1B92A 4BE0A 1NKEA 4J2BA 1QQCA 2X4YA 4C8LA 3LZJA 1NOYA 3G0ZA 4UQGA 1UA1A 4XIUA 3AO5A 1JL1A 4CK2A 3SPYA 1NK4A 3SPZA 3DOKA 4ELUA 1S5JA 2RHIA 1S1VA 2FBXA 1K6YA 4IFYA 2YNIA 2G8WA 2XY8A 4K8ZA 1TAQA 3OYCA 1IKVA 2K3YA 3OS0A 1BGXT 4CIGA 4II1A 4IKFA 2NLUA 2WONA 4FZZA 2BGGA 3H08A 3SZ2A 4QAGA 4G1QA 3QEXA 1SKSA 5M9OA 2HHSA 2OYQA 1BL3A 4FK0A 4N41A 5FDLA 3TI0A 2HVHA 5CY4A 4HUFA 4JS5A 2Z1JA 4B08A 1ASVA 3V9ZA 2QQRA 1ASWA 3MP1A 4CEEA 3ZT1A 3ZT3A 5D6XA 1KRPA 2K3XA 3E9GA 4CJUA 4CFDA 1XI1A 2B8AA 1RT2A 4EDUA 3L2UA 3SI6A 1CXQA 1A5XA 1JLGA 2LRQA 2P0KA 1LV5A 1KFSA 2RI2A 1JLEA 3UT1A 3QLHA 4CHPA 3M8PA 1HMVA 4NCGA 3OYNA 4RW8A 4KHSA 4IUUA 5IAYA 5JS1A 1RT5A 2R57A 1NK9A 3K5NA 1S9EA 1L3SA 3DLEA 4RW7A 4Z4HA 2X6NA 3RRHA 3ZT4A 2R5AA 4W5NA 1NK6A 4Z4IA 1X9MA 3LGFA 1RTIA 3PO5A 4CJKA 3P8DA 2FBYA 5J1EA 3OYHA 3V1QA 1VRTA 1SV5A 3I8DA 1W0HA 1BIUA 2EQKA 1S6PA 2HNZA 3NTKA 4RG8A 3KKSA 5HRNA 2EQUA 2PYJA 3MEDA 4F4KA 1SUQA 2D9TA 3LALA 1TAUA 2RHUA 3TABA 2Y1JA 4F8RA 3P8HA 4DQQA 1NOZA 4KHNA 3AA4A 2HQEA 5KGWA 3DLHA 1RBTA 1GOCA 3OYMA 4M3ZA 2BUDA 2GFAA 1VRUA 4N4HA 3M8SA 5E41A 3VQ6A 3AA2A 1TV6A 4PY5A 3NNQA 2IOCA 4KHWA 3AVMA 1C0MA 3ZSVA 4DTOA 3NH0A 2DFEA 1ZBLA 2M1HA 4GMJB 3LPTA 2O4XB 4F3TA 1ZBHA 3MEUA 3S6WA 3P5JA 2HMIA 3DM2A 3MECA 4C8KA 3AA5X 1O1WA 2OPQA 3CYMA 1RNHA 4CEOA 3L3VA 4CFBA 1WLJA 1GOAA 1NKCA 2HHUA 3EYZA 2JLEA 2F8SA 5HRRA 1QSLA 3SUPA 4AHSA 4C8MA 1IO2A 4FJMA 1BQMA 2RJFA 2YNFA 4QVZA 3ISNC 3P83D 2R7YA 3SQ0A 4AHVA 4FZYA 3NBPA 2DFHA 4CCHA 2RJEA 1U48A 1RT6A 2LTOA 1BI4B 3C6TA 4AH9A 3LWMA 4IUTA 4DWIA 3V6DA 4CEAA 1J53A 2MWPA 3QEPA 3M8RA 3AO4A 4DF8A 4FLUA 1VSFA 3QESA 4W5RA 2E6MA 3G10A 1REVA 2A1SA 4CEQA 4Q5WA 1RDCA 3MEEA 1HNIA 2OPSA 3AV9A 3NGZA 3RR8A 4I2QA 3QO9A 4HCCA 1D8YA 3MEGA 3CQ8A 4HUGA 5KRSA 4DU1A 1HQUA 4H4MA 3QNNA 2RPIA 3DB4A 1TKDA 3RR7A 1XHZA 4J2DA 2HHTA 2HQXA 3SYZA 1S9GA 3AVAA 3T3FA 2XY5A 4CJ4A 3PNWC 3HSTB 1S6QA 2JGUA 1TK0A 2KQ2A 3DLGA 2BDPA 5IN1A 4DTJA 1HYVA 3L42A 4IURA 2RJDA 1WJRA 3SV3A 2KTQA 1JLAA 4CGIA 2G3RA 2E5QA 4E0DA 4DMNA 2VWKA 1WSIA 5HP1A 3PO4A 1C0TA 4CHZA 3NAEA 4B9MA 4DS5A 1X1PA 5SWMA 3GOXA 3KLEA 1NJXA 4FM1A 3LZIA 2M16A 5I42A 3DRRA 3KK1A 4C5GA 1ZBFA 4CK1A 4CGDA 1WJSA 2OPRA 3TAGA 3HVTA 2VG5A 5J39A 5D3GA 1OI1A 1R0AA 4AILC 4UC4A 2X6SA 1Z26A 4FJ9A 3AVGA 2RJCA 1EXQA 3V9WA 4BDZA 3HPOA 5HBMA 3CFOA 5CYQA 1RT7A 3V9UA 4E7LA 3F70A 5KE2A 3ZSZA 3VQ9A 1QS4A 4FJLA 1FKOA 4L59A 1SKWA 2P51A 1D9FA 2X78A 1VK0A 3TANA 3AVBA 3DLMA 3VN5A 4BWMA 2QKKA 3NF8A 3T1AA 1Y97A 3V1RA 4FK2A 1I39A 2IG0A 1GOBA 5J2PA 4FCYA 3ZSRA 3ZCMA 3KJVA 1IG9A 1JLQA 2B6AA 1S1XA 3S9HA 2R5MA 4OPKA 1HRHA 3SUQA 3E9FA 1J9AA 5DK5A 1LAWA 1J54A 2G8FA 1NK0A 3I0RA 4KI6A 4OVLA 4W5TA 2RO0A 4E7KA 4CERA 1NJYA 3B6PA 2FBTA 5K14A 1KLNA 3THVA 3MXMA 2JTFA 4PUOA 1LAVA 4FZXC 2RHZA 3V81A 2YNHA 3ME9A 3TWHA 1C1BA 4AHRA 4KFBA 3VA3A 2ITGA 1L3UA 3DOLA 4FJNA 4Q5VA 1LW2A 4DFMA 1VSIA 1U4BA 3MEWA 3SD4A 4N47A 3B6OA 4DS4A 4DQPA 4KV8A 3LWLA 3HXMA 3LP1A 4BACA 4IFVA 4CE9A 3MP6A 3OYLA 4IUVA 4AHUA 2HNDA 1SL2A 4E1NA 2IGIA 3L2VA 4OLBA 2HVIA 4DLGA 4CJTA 1KLMA 4KAZA 4FJHA 1RDBA 4O4GA 2X74A 5KGXA 3TR8A 3AVLA 2X4WA 1RI0A 4DLEA 4I9QA 4R5PA 4M3RA 3SV4A 4M3UA 1BQNA 3PX4A 4DSEA 1DTTA 4Z4GA 1B9DA 2HB5A 2IC3A 1OZ3A 4CHQA 4A4EA 3K58A 5C24A 4CEDA 3RMAA 2QXFA 2F8TA 2F96A 5HRSA 4JLHA 1RTJA 3O8VA 3AVFA 4CJ3A 4KHQA 3FC3A 1C1CA 2QKBA 1IKYA 1BCMA 3PFSA 4AHCA 3IRXA 3SUOA 4F2SA 3NF9A 2XDPA 4FLVA 3O4NA 4DG1A 5KCHA 3ZT2A 4C5EA 4M3XA 2GF7A 3LDSA 4B8AB 3L8BA 2PZSA 1L3TA 1I3AA 3O4QA 4JS4A 2FBVA 4QOZB 4FM0A 4OLAA 4BE1A 3CM6A 4GVMA 1XC9A 3QIOA 2EFIA 5J2NA 3EAEA 2CKKA 4CJVA 4CJQA 4CGHA 4FJKA 2LDMA 2L89A 4DSJA 4FW1A 4DQRA 4NZGA 4E19A 3OY9A 1B9FA 3DMJA 2P5GA 4OGEA 4EZ9A 3ASKA 3DYAA 1RBSA 4DSIA 2AJQA 2R58A 3CM5A 3L2RA 2LSNA 2ZQBA 4OJRA 5CZ1A 1RBRA 5JS2A 4MQ3A 3OMGA 3DRPA 1U49A 3ZSYA 4CJLA 3V1OA 4CECA 3SUNA 4CGJA 4B3OA 3T19A 4KHUA 4K8XA 2ETJA 4X34A 4B9SA 1RT1A 1D5AA 3O3FA 5C25A 4LH4A 4ELVA 3NGYA 4KO0A 4ID1A 2EX3A 3OYJA 1Z25A 4IUQA 4QCLA 3ZSOA 4L8RB 1IKXA 4FYDA 1FXXA 2X35A 1Q9YA 3LYIA 1KFDA 3O3GA 4FL6A 3PUFA 3LH0A 1ITGA 3CG7A 4HUEA 4Z4CA 4OKEA 1TK5A 1VSLA 3FLGA 3OYIA 2KFNA 5KRTA 3SQ1A 3HL8A 3MP8A 2VG6A 2XRIA 1DLOA 5J2QA 2YRVA 1ASUA 1RCHA 3KLIA 3EZ5A 2G8VA 4E7JA 3KIOA 1EP4A 4NCBA 3L3UA 1HNVA 1HQEA 2D5RA 4KPYA 3OYBA 3C95A 3VQ7A 1T05A 2X4XA 4I9LA 1JLFA 4F3OA 4EZ6A 4BDYA 3HP9A 3K59A 4BDPA 2HHVA 4GW6A 3MEVA 1KVBA 4HCZA 4KRFA 3PMIA 4CJEA 2D0CA 4KTQA 3KK2A 3QEWA 4HVJA 3RMBA 4HTUA 4DF4A 2Q3SA 1ZYQA 4MFBA 1RBVA 1HPZA 3PMTA 3IG1A 3NTHA 1RDDA 3JSMA 4FLZA 1QSSA 4PLIA 4YFUA 3P1GA 1OZ2A 1UA0A 1MU2A 3ZEHA 4ZHRA 4O0IA 1W9HA 2D0AA 4J2EA 3K5MA 3VQEA 4CEFA 3QBYA 2OA8A 1SKRA 3KLFA 3MXIA 3D0PA 4EP4A 4KB1A 4HCBA 4E89A 1HYSA 1EX4A 3LLRA 5KCOA 4ELTA 4E1MA 4M3YA 3RWUA 2JZ2A 5T7BA 4DTPA 1VSHA 2O4GA 3AA3A 4O55A 4BE2A 3LP3A 3VQBA 3ALYA 3KD1E 4IG3A 1T7PA 3HPHA 1TVRA 3SCXA 3LP0A 1EKEA 1JLBA 5HLFA 1Q9XA 4CHNA 2M0OA 2XO7A 2ZD1A 4QQGA 4RW6A 3QIPA 2Z1IA 4TSXA 3VQPA 5KH6A 1MHNA 4ZTJA 4FW2A 3M8QA 4PLLA 4CJPA 4PQUA 4CGFA 1BISA 3F73A 1KSPA 4CF0A 1U47A 3H8ZA 4B8CA 4DTNA 4FVMA 3AVJA 2L8DA 4IUPA 3F9KA 3VQCA 4Y1CA 3QEVA 3VQAA 4W5OA 3OYFA 4CHOA 3AVCA 3HVRA 2HHQA 1KVCA 3U6FA 4B9UA 3DB3A 1IH7A 2E4LA 1YVUA 3OYGA 2VWJA 2L3RA 1WJQA 2D0BA 3SJJA 5EU7A 4C8NA 3ITHA 3SNNA 1NJZA 5D6WA 4M41A 1NK7A 3LAMA 1BIZA 3ZT0A 3TAFA 4CF1A 1WSJA 3TARA 3IS9A 2O4IA 2HHWA 2EKOA 3PV8A 1S1WA 1Q8IA 3HT3A 2NUBA 3K5OA 2G8HA 2KZMA 4ZTFA 4OKKA 2IAJA 3K2PA 4HHTA 2YHBA 1BCOA 3ASMA 5CYMA 3NF6A 2QK9A 2MWOA 2HHXA 3VQ5A 1OYXA 4CK3A 4FJGA 1C1AA 3VQDA 1JKHA 1LW0A 3VQQA 2DIQA 3KUFA 3I0SA 4KTWA 2FC0A 2PYLA 4DTXA 3NHGA 3UWNA 2BANA 5I3UA 2OZSA 1RTHA 5J26A 1HYZA 1N6QA 3OYEA 1IKWA 2A1RA 1TKXA 2IDOA 3EY1A 5FROA 1XWLA 3OB9A 3NF7A 4E3SA 1S1TA 3IAYA 2GBZA 3NFAA 3OJSA 3OS2A 4C5HA 3OVNA 3BDLA 4IBNA 1F21A 1VSJA 3MXJA 4DTSA 2G8KA 5FRMA 1G5VA 4QQDA 3AO3A 1N5YA 4EP5A 5KTQA 1X9SA 3VQ8A 1SSFA 3HPGA 4N4GA 4AHTA 2Z1HA 2EHGA 1EETA 3RMCA 4LH5A 1WGSA 3UIQA 4CEZA 2XHBA 4CRIA 2YHAA 2G8IA 4GY5A 3C6UA 4DU3A 4Q0BA 3L2WA 2QQSA 1VSMA 1YTUA 3TAPA 1RDAA 3WNGA 4A4HA 3Q1JA 2I5JA 2BKDN 4A4FA 3PX6A 3NCIA 4FK4A 2RN2A 2FHDA 5C42A 3VA0A 3DRSA 4LY7A 4DTRA 3TAMA 1RT4A 1CZBA 3ZSWA 3OYKA 1CZ9A 4FLTA 4FJ8A 2BIVA 2PQWA 5HROA 1N27A 4C8OA 3NGIA 5SZTA 3L2QA 1UAXA 3VQ4A 1TKZA 3HP6A 4BD3A 2IS3A 1WN7A 2PY5A 3CFPA 1CLQA 3MEAA 4DSLA 2EQJA 2VG7A 3PY8A 4N5SA 2HNYA 4RW9A 2XY7A 2P1JA 3META 3HJFA 3KLGA 4KTZA 2F5KA 3NDKA 3H6ZA 1VSKA 1JXEA 3LPUA 3HK2A 4DFKA 2DTUA 4KREA 2XK0A 1JXBA 3QERA 1TL3A 1FKPA 3AO2A 1C0UA 2GV9A 1SL1A 3AVHA 4B9WA 2Z1GA 3D45A 4B9TA 4FJXA 4N76A 3PX0A 1L5UA 1CXUA 1NJWA 3SQ4A 1WAFA 4LSLA 2GFUA 2RI5A 3KK3A 2YV0X 1XNIA 4JRPA 3LP2A 1NK8A 4CFCA 1RBUA 1G15A 4CFAA 2DY4A 2HW3A 5KI6A 4JRQA 1U45A 1JLCA 3ZSQA 4FXDA 3FDRA 3HM9A 4B9XA 4A4GA 3JYTA 2E6LA 4Z4EA 5C0MA 2KW4A 3QJ6A 4F2RA 3TAEA 3M9QA 2WOMA 3KD5E 1LWFA 3ZSXA 4QW2A 2YNGA 3SQ2A 2P5OA 3HO1A 4J2AA 2OPPA 1A5VA 4DSKA 4DFJA 3K5LA 1NKBA 2RHXA 3OMCA 2W42A 4C5IA 3S3NA 4CJ5A 4PL6A 1SL0A 1VSEA 4LD0A 3BGRA 1WAJA 4PA1A 1QE1A 4FU6A 3E01A 4ICLA 4KHYA 3OYAA 3QETA 1TK8A 3WNHA 3K57A 2DFFA 4CJWA 3NH1A 1YT3A 4N4IA 5DMRA 2GUIA 2YKNA 4DTUA 3LGLA 4M3TA 4E7IA 4CESA 4KKOA 1NK5A 4CF2A 1T8EA 1LWCA 2E6NA 3U3YA 4FJ5A 3C4SA 2RI3A 3NE6A 4B9VA 3HYFA 1QSYA 2WACA 4IG0A 3AVIA 2O4XA 3V4IA 4N56A 2YKMA 4DU4A 4OGCA 1RT3A 1KVAA 1HJRA 3FEOA 4BWJA 4OVAA 2G8UA 2OZMA 1KHCA 2KFZA 1C6VA 4H4OA 1QTMA 4DTMA 4CJFA 3OJUA 4O5BA 3LANA 4FJ7A 1KCFA 3KLHA 2LVMA 4W5QA 1WSFA 2RKIA 3DLRA 2Y1IA 1TL1A 3AVKA
chains in the Genus database with same CATH superfamily
4ID5A 4W97A 1WQ2A 2RNAA 3LSKA 4LSNA 4MZTA 1RDUA 4QQ6A 4RW4A 3SJHA 2GOXB 1FJGK 3QNOA 3EG3A 5TKYA 4B9LA 4O44A 1TGOA 3SEQA 4Z02A 4BGAA 1W36D 1U84A 1HR0K 1RAHB 1WH7A 4FWNA 3IH2A 2RHYA 3BFMA 4KI4A 2M1BA 2I5UA 1V76A 3V8KA 3ZMUA 2KIFA 4J8OA 3WGGA 3CMEA 3DLKA 2LJ1A 2NOGA 1XSXA 4ZGDB 1AWWA 2O8XA 4YRVA 3QWXX 1A35A 1TKTA 3EEQA 2W1OA 4HRIA 3CQZJ 1H3HA 4NYFA 2R0QC 4W1UA 3PNVA 4H8KA 3I71A 2WB1A 3ASOH 2K9LA 2MFZA 5B3SH 3O9TA 1D9DA 3CD6I 3V9SA 3MZ8A 1PYVA 4BU2A 3H0DA 1N9SA 5AFUH 5GAEP 4XRSA 1MMDA 3GFMA 1N6AA 2DBMA 2YX4A 1T0HA 5HRPA 2LF7A 1VQOI 2XIGA 2CT3A 1N8RC 4A5BA 3AO1A 5D5UB 3A02A 1J6ZA 3M1FA 2L2OA 2WV1A 1YTAA 2KZZA 3VFZA 2W04A 2M45A 1YITI 3TSPA 4DV4K 1XCBA 4FT8A 3HDDA 3ULEB 2BE2A 1YN8A 5CVJA 3ZQ7A 4M77B 1JI8A 1W7PB 2BYVE 1TU0B 2MLGA 1F1BB 2HSEB 3AVNA 3T9NA 1WVRA 2ZGZA 4PSWA 4YNQA 1WPYA 2O6GE 3NVMA 4D9JA 1YI2A 2ITMA 5AZIB 2ME0A 3MO8A 5LD2C 2B4JA 3B8AX 1LWYA 3OYDA 5IP7J 4JI0K 4CEBA 3F8BA 1X69A 2CSOA 2R7FA 3KP4A 4EJYA 1WNSA 4EHTA 4A3IJ 4CCLA 1YW7A 4FYWB 2XGEA 4II3A 1GLDG 3I55N 2L3PA 4I6MB 3KFWX 2IVNA 3D7SB 1U04A 3WG9A 3FXQA 5KK1A 1ATSA 2P84A 2R7TA 3U3GA 1FK9A 1N25A 1I6HJ 1OH6A 4YG2F 1LNWA 4I0AA 2H1LA 2GQQA 4CJSA 1YQMA 4Y1DA 3A2FA 1K73U 4M3WA 3MAQA 3I56T 1ZBJA 3OOUA 1WZOA 1KTQA 4IDKA 2WUSA 4C30A 1HD3A 3RRGA 3DTEA 2F6CA 1UWBA 1MNDA 4WXCA 4FLXA 5J2MA 4J2BA 4ENNA 3AFHA 1ABQA 2KAFA 3AT1B 3JCMQ 4UQGA 3PO2J 4XIUA 4B1XB 1X2NA 3SPYA 2XUBA 1NMNA 3FJ5A 3ATUA 3L6QA 3CCRA 1K8AO 1RESA 1U6ZA 2HBJA 2OD5A 1LE8B 4LC9B 4M7DG 4PK4A 4JV5K 1JCFA 3O6BB 3C1DA 3ZX0A 2PZ1A 2XY8A 4PCQA 3DTKA 2UXCK 2K79A 2K3YA 3OS0A 1OJLA 1E17A 1CKAA 2HNHA 4A6EA 2MAMA 4ZH4F 3C7NB 4IKFA 1H0MA 3TOBA 1QVUA 2L7KA 1VAZA 2DXBA 4BJ6C 2EYXA 4OMZA 4QAGA 1I94K 4ZGEB 3WE2A 4AIAA 3VUZA 1GV2A 5M9OA 3CMEN 3I5UA 3R4KA 4F52A 3X26B 4G6TB 1ABOA 3A8HB 4NC6A 2R5YA 2HVHA 5CY4A 3IQLA 3CWTA 1T0FA 5GAN7 4IXCA 2HNIA 3HKZA 3N0UA 2DJQA 1ASWA 4CEEA 1JUMA 1S7OA 2K9QA 5D6XA 4LIVA 4LDXA 5MLCQ 3L4QA 2QYZA 3CMEQ 1BM9A 3K0LA 4MIMA 2EZLA 2RI2A 1KFSA 3K9TA 3CJ7A 4CO8A 5IAYA 2MABA 1XD7A 2HVQA 4WXHA 5AQWA 3BROA 3H5NA 1SVLA 1RAAB 2JA6J 1JT6A 2AS5F 2D5VA 2RC4A 2KRMA 2ZJPL 5C2FA 3ROUA 4XH1A 2LRDA 2ME6A 1KD1O 4DBFA 1KQ9A 1TQPA 1BI2A 3OW2M 1RTIA 3GUDA 3CBMA 3ABLH 4DEYA 5GAGP 2FBYA 1M9SA 5J1EA 1KGSA 4HEA2 3DP7A 5GANj 3VS5A 3P9IA 2FZGB 5F27A 4EVIA 9ATCB 5HKCA 4IO9L 1W0HA 4DV1K 5JICA 2F4IA 1G6NA 4HLYA 4D7MA 3THWB 3CCMI 3LSTA 5FKLA 3CO7C 2Z2SB 3NTKA 2FNAA 5CQYA 2JA8J 1QU3A 3HOWJ 4RG8A 3OGDA 4JKHA 2K86A 3MEDA 3B02A 3CWUA 2V7FA 3S32A 2YSQA 5AQXA 1YRNB 4EEFG 3ULQB 5KGWA 3DLHA 4M3ZA 3I3LA 1BOBA 2LKXA 2K6DA 4CZKA 2GFAA 1VRUA 1Q86C 2HYJA 2E2OA 2O5RA 4ESFA 1YI2Q 1BI0A 3L9FA 2CH4W 2LJ0A 2IOCA 4KHWA 2NOZA 1VQKI 3BY7A 4UUTA 3JB9G 4UVCA 3VRYA 4IQ4A 3DKYA 2OCCH 4H03B 2MSYA 3VMFB 3MK6A 3I0WA 4LF6K 3TDUC 2GBYA 3WTTC 2IA2A 2C0OA 2IIMA 2M3AA 5HCKA 5TRDA 2QKLB 4L5GA 1YIJN 4BRAA 1WLJA 1LWWA 1NKCA 3EN9A 2MH9A 3ERMA 1BL0A 2XAUA 3A0HC 5M3FJ 1GCQA 1YTYA 2KVQG 4HVWA 1QSLA 4DOZA 2MMPA 3CCRN 1G3TA 2CGLA 1H9TA 4JI8K 2VKNA 4B21A 5IXFA 2PMUA 5C4JJ 1S3XA 3GTOJ 2GA1A 5DM6F 1NGBA 5JLFA 4D5CA 4AHVA 4FZYA 4CHUA 2DFHA 3WXLA 5GAOn 2RJEA 4RAGA 3LSPA 1OKRA 1W0TA 4BQLA 4L9NA 1R8OB 3DAWA 3C6TA 2XGDA 5IT9Z 1HKCA 4A63B 5LJ5e 2NRAC 1Q1VA 5D8LB 3V6DA 4YTLA 1AA7A 2M51A 2DYBA 3CCRQ 2MWPA 5LY3A 2ATCB 2TCTA 1MV3A 3N4MA 2HMAA 5IH2A 3CDLA 1QVPA 4IHWA 1UHMA 4F7UE 3QESA 2JZYA 2E6MA 2HXOA 3G10A 1REVA 4RGSA 4CEQA 2A5XA 1GXQA 2GTDA 3HKZN 4Q5WA 1RDCA 3MEEA 2XB5A 1JCGA 2OPSA 4GV3A 1BC7C 4E9GA 3QO9A 4C92F 2ETHA 5FW9A 1F5TA 3IAM2 1D8YA 3MEGA 3CQ8A 4PDKA 1BKBA 4A0YA 3LWIA 2DILA 1TKDA 5HDNA 2NXNB 4OB3B 1G59A 2HHTA 4BYYA 2F5EA 1YCYA 2EPDA 4F93B 3VPRA 1KC8R 3AVAA 3EUAA 2HBPA 3T3FA 4CJ4A 3J81Z 3PNWC 3HSTB 1S6QA 4KN7X 2JGUA 1IAWA 2OX7A 2EPFA 3RYPA 4J9EA 1R1UA 2P4TA 3JCMe 1NH3A 1UGPB 1RAEB 3L42A 2L01A 1U5TC 1REPC 3HTUA 1S9HA 3QO3A 4G94A 4J5YA 4XICA 2KTQA 2M4KA 1JLAA 4CGIA 3GCMA 2G3RA 3FK6A 2HSTA 4QPQA 4XBFA 4ISGA 3LL3A 3CC4I 2M34A 4PFOA 3M59A 2VV5A 2KIMA 3IWZA 4BY1J 4LOCA 5HP1A 2XF5A 2RM4A 3PO4A 3DU6A 2KIUA 1C0TA 4CHZA 4B9MA 3CMMA 2R93J 2K3PA 2HL5C 1NJXA 2FNPA 3Q0VA 2W40A 1N78A 1BW5A 3KK1A 4B4CA 1YQLA 3RI4A 1GT0C 2P6SA 2VASA 3CVSA 3FX3A 3I4MJ 1PC0A 2VG5A 3LFUA 5D3GA 3LDQA 4O8UA 2GM4A 1VQ4A 3HHTB 2YJEA 2OTJA 4DOVA 1WIEA 3VB2A 4XLHA 1JXMA 4MDBA 1W6XA 4LUEA 3DEUA 1KQSM 4LDYA 2OZUA 4FJ9A 4BBSJ 5HBMA 5CYQA 4FWMA 2L7ZA 4ANJA 2BZXA 1LKXA 3JS6A 3J80O 2QGFB 3NRVA 4QKUA 3L00A 2YSRA 3BDDA 1A0NB 4H0XB 4L59A 2A7YA 1SKWA 2P51A 3EPZA 3A1PA 3G4SQ 5GAN8 1T56A 4F14A 2X78A 3X24B 2X3XD 2CP0A 2KEAA 1VQ9A 3M1CA 2JT1A 4OMQA 1X2QA 1K9MR 3C65A 4RGRA 1EIFA 1UMQA 1PNJA 2QYOA 2O03A 4UY8O 3O08A 2AK5A 4X64K 4DV7K 3TEDA 3OW2A 4AD9A 5J2PA 4KIBA 3IUOA 2XRNA 1JLQA 3F6VA 2JOYA 3S9HA 4MHGA 1AWJA 4XLFA 2CP5A 3SUQA 2K9NA 1OCCH 1J9AA 3RVCA 2NUTA 1LAWA 3EFSA 1NM1A 4BAYA 1TOVA 1XJWB 2JWKA 3WU1B 2R5YB 4PKGA 2R7WA 3LAPA 3JRCA 4KI6A 2VQGA 4WQ5A 2E36A 2RO0A 4CERA 1U5TB 3DBLB 1QVGP 1KLNA 2HQ5A 3THVA 4NNJA 2PEXA 4PUOA 2KE9A 4PJOF 4M75D 2P7VB 4KH6A 2EB7A 3ME9A 1C1BA 4BRMA 2P6TA 2JPBA 2DM1A 1EH6A 2M02A 4AHRA 2JW4A 3LDNA 1L3UA 2DF6A 3HGYA 4CC4B 3DOLA 1RNLA 4Q5VA 2YLBA 1VSIA 2MH2A 2CW7A 1VQOA 4HF1A 1LDDA 1OVQA 5AQIA 5AR0A 1VQ5N 4DQPA 4KV8A 2KXDA 2GXGA 3OYYA 1K61A 4K43A 3LP1A 2GELA 4BACA 2KRNA 3V7SA 4HF0A 2P9UA 1QHAA 2EW3A 1D4XA 4H0PA 4OMYA 1NBWA 3GYHX 4RTWA 2CMPA 2IGIA 2KLAA 2M9UA 3C6AA 5IT9O 5J6XA 1W2BP 3O1BA 3IH4A 4CJTA 5GAOr 3RKWA 3I56I 3PTAA 3S15J 3G73A 2X74A 5KGXA 2K40A 3H36A 1ORNA 1VQNT 2COWA 4L0ZB 2IGNA 3H9GA 5GPCA 2HPMA 1BQNA 3PX4A 4DSEA 1FPQA 2YUOA 2XD0A 3NFCA 3E7LA 5BREA 2A5YB 5I2SA 3BF1A 2NYSA 3K58A 2HXIA 3I33A 4BR2A 2HYGD 2H09A 1FC3A 3M0QA 2EJGA 5JMVA 2LD5A 4G6DA 3M0SA 3H9NA 4RLQA 2EQIA 1V1CA 1DIZA 1BIAA 2DOEA 2A08A 5E3MA 3AVFA 4CJ3A 1VQ4N 2P4WA 1BBZA 1MDUB 2J6FA 2OAZA 3IHUA 1GHCA 4UNFA 2KDOA 3VGKA 3IRXA 1ZHIA 1IHWA 4AI5A 3EGXA 3VENA 1NMDA 4BQNA 3E5QA 4LDWA 2FX0A 5KCHA 3ZT2A 4C5EA 3FM5A 1O9SA 2YUNA 2V7ZA 2JUCA 1E0EA 4XH4A 4Y13A 2PZSA 1L3TA 4BREA 3DLLF 4JS4A 2V9PA 3M1EA 4QOZB 5DLOA 1YS6A 3CETA 4JAXA 3K4LA 3J81O 1K4US 3DEWA 5HVQC 2AKKA 2FL7A 4M6XA 1VQ4Q 1PWTA 2OTJQ 2YU3A 5GANh 1F1ZA 4M3DA 1SD7A 2B63J 5BPMA 1NG2A 4PKHA 4E19A 3DMJA 3EKSA 2QM1A 3OH9A 5D6EA 1QZEA 4EZ9A 5AQJA 2VJ5A 3DYAA 2AJQA 4A59A 1W5SA 1S3JA 5FKOA 3CJBA 1MUYA 1WCMJ 4OFHA 1R5GA 1MBKA 3VYRB 5CZ1A 1WQWA 3HHHA 3PO3J 5JVGF 3TGNA 1VQ9Q 3SJMA 4YORA 1F36A 3HM5A 2IAIA 4XLCA 5CK9A 3H3NO 2RK1A 3K4NA 2CREA 1AT1B 3SUNA 5FKMA 1TWHJ 1FTTA 4CBXA 3DKWA 2B86A 2ETJA 4FT4A 4BGDA 1OU9A 4B9SA 3FHFA 1U9NA 1QQMA 3O3FA 3FM3A 4JKGA 4EATA 4L0YB 2E7WA 4RTZA 2VGNA 5L3EA 2E5LK 3KCCA 2EX3A 1HKQA 2LP0A 2M8EA 4IUQA 3SDZA 3WEEA 5GMKj 5GANg 4FYDA 3PIOF 5DM6L 3LA7A 3LYIA 4TV7A 4CZFA 4M6VA 1KQSA 2TRTA 1ITGA 1LOTB 4OAYA 2WAFA 2J4RA 4JRIA 1W5TA 3FLGA 3LQRA 3A03A 3OYIA 3Q7BA 5JLWA 2KFNA 3EHRA 4WQ5C 5CE3A 2ROLA 4F9OA 3MP8A 2VG6A 1WXTA 3VU3C 2DMOA 1RCHA 1WJFA 3R6OA 3KIOA 1R7JA 3H5RA 4FWPA 2CUFA 2ZKZA 5IPAA 1SC7A 4AM7A 4Z94A 3CCLA 1VQOQ 2KJCA 1PP8F 2D5RA 1YOVB 3F5TA 2DMTA 1P4WA 3WUHA 1ZG3A 1T05A 2X4XA 4FX4A 1AEYA 3G1LA 4EZ6A 4BDYA 2HHVA 5LGTA 3ZR8X 1J09A 4CJEA 1R6RA 2D0CA 2VBZA 2X4JA 3FKJA 5A2QO 3QEWA 3J7ZI 2P9SA 2CZ1B 3M3ZA 4XLPF 2XAQA 2H3GX 5KYNA 3HBLA 5DLQE 4D5FA 4IPAA 1I3QJ 4MO5A 1X6OA 5K7FA 4MFBA 1HPZA 3GBGA 1HYOA 3BZCA 2OAUA 1QVFP 2ZJRF 4FLZA 3A8GB 4AYBA 4QVCA 1MU2A 3EG9A 2K4JA 3K1MA 2EBPA 2D0AA 1GXIE 2X3WD 4ISEA 3K5MA 3VQEA 3KWIA 4UHTA 2XHIA 5FPNA 3M55A 3IL2A 2JNGA 1Y8RB 2ISYA 1W4SA 3CVTA 4HNUA 4I01A 4KB1A 2LCSA 3SEMA 3JCMb 3LLRA 2COMA 3LSIA 3DQVC 1YBYA 1YX5A 1M90O 3MN6A 3FK7A 2O4GA 2NOHA 3A0BC 1ZH5A 3P8BB 1P7JA 2BE9B 3KD1E 4MZMA 4CZLA 3I4PA 1UZCA 3VGLA 1OH7A 4BC3A 4EMGA 5GJVB 3MKWB 2C0IA 3U2RA 4BHBA 2FRYA 2KZVA 2NUTB 3JRZA 5DD8A 4B3RK 2W00A 2JN0A 2VXZA 4BB7A 4KDPA 2XO7A 4XQFA 4PKCC 3F8CA 1K8AU 3VQPA 3I9V2 2Q0RA 2DVEA 5FFZA 1Z3YA 1MHNA 1P90A 4LK1F 4PLLA 4CGFA 2F4MB 1KSPA 3ECHA 4CF0A 1U47A 2JMAA 3JAMZ 3MKZA 2XHCA 2EINH 1S7AA 3OS5A 4LFUA 4NLBA 3VS0A 4DA4A 3IH7A 4Y1CA 4ENJA 3VJPA 4CHOA 1UFMA 3U6FA 4M78D 1M2VA 3KP2A 4HNTA 3CCQT 2VOPA 4A62A 3UKRA 1R22A 1MPGA 2QWOA 2PVDB 3G6EN 1Q81U 1KZHA 1WJQA 4L9VA 1OFCX 3ITHA 2P9UB 2LVSA 4BS9A 4XM3A 5E3LA 1NK7A 4BRHA 2EYQA 2GCXA 3K6GA 3ISPA 3FJPA 2M9HA 2NVXJ 3CCLN 2RVCA 1RADB 1JTYA 3EGDA 1WSJA 2DFUA 3E9PA 3RKYA 2H6BA 3CC4A 4G9ZA 3VF2A 1S1WA 1Q8IA 1UTIA 1Q82U 4L5IA 2KZMA 4Y91A 5KYUA 5AQSA 2IAJA 4ILHA 5EG2A 4YOXA 3H3ZA 1BA5A 1S5LC 3GZ6A 5CYMA 1ZKGA 1ERDA 2GZWA 4EM1A 1SFOJ 4V19S 5FLXZ 1BI3A 4HQEA 1EZZB 3CCLQ 5LJ5f 4CK3A 2LYCA 4BRCA 4FJGA 3VEZA 2L0KA 4CA0A 4IZ9A 2K4BA 1LW0A 1FZPB 1SAZA 4G9YA 4P96A 3W6JB 5ED4A 5J3BA 2DIQA 3I0SA 2D6FA 1MW7A 3EGXB 4K11A 2CUDA 1WA7A 2FRWA 3HRGA 2MD0A 3L2CA 4HBLA 2QWQA 2OZSA 3IMXA 2YRCA 1HYZA 5F0HA 1ETWA 4XMYA 2Z3YA 4DJAA 4BRLA 5HDGA 2HBKA 1JHHA 4CZGA 2KR3A 1S1TA 3IAYA 4C3IJ 3DFGA 3OJSA 1I8FA 4BY6C 2RF0A 2R7SA 1DP7P 4IBNA 2O7OA 2O9SA 4AFQC 3THYA 1Y6IA 1IC8A 1A6IA 3BTCA 5K5OA 2LH9A 3CERA 5IP6A 3ZMTA 2K27A 1KG4A 2XKPA 4AG1C 3EUHC 3HZJA 2XV4S 1JB0E 2AKLA 2NOLA 3VYUB 4AM6A 2QUFA 4PGGA 3K9KA 1PG5B 4IHVA 1MUZA 3AO3A 2Y75A 3J7YJ 1N5YA 3DKXA 2V1UA 1NGFA 5KTQA 4KJZA 4ZYHA 2UV1A 1YQRA 4N4GA 3IH3A 1TSFA 1ITYA 3ULRB 4B44A 1JGSA 2NNWA 5E79C 2HS5A 2PUOB 4YOWA 2Z1HA 3OSGA 2A42A 1J9IA 3JCMf 2EHGA 2YHAA 1OH5A 2G8IA 3PM1A 3HEFA 4LN2A 4BY9C 4MO7A 3ID6A 2HBMA 2XGCA 1VYTA 1XGOA 1ZHFA 5L23A 2Y31A 3DLLL 4KH5A 3HC7A 4JKGB 1NEGA 3GMEA 3WNGA 4A4HA 3A1YA 1GLAG 4RMOA 2HQRA 2I5JA 2QQBA 2BKDN 5KYYA 4A4FA 3VS6A 3PX6A 3NCIA 2JG6A 3WEEB 2RN2A 2QDYB 1YCSB 1RIOH 2Z5UA 3UE5A 3VYTB 5FKNA 1N8RU 3BW1A 5BQTA 2YUPA 1VQLN 3W2VA 4M77F 2FQ3A 3DRSA 4LY7A 1VQNI 3TAMA 3Q9SA 1JJ6C 1ENHA 1NGDA 4B43A 1FSHA 4MNUA 3ZSWA 1N32K 3I55T 5E3OA 4P5OA 4WCIA 1XB4A 5E1ZB 1NG7A 2PQWA 1N27A 2ZPHB 5CQXA 5JVGL 1FYLA 1UAXA 4CD3A 4CZHA 5GAOp 5TJJA 5GP9A 2LTPA 2KMTA 2QASA 3LAJA 1P59A 5ICEA 2IA1A 4DSLA 5LL6Z 1F9NA 3FXLA 4O3MA 1ZUYA 2XRLA 3PY8A 3I56A 3LW5E 1LOJA 1YNZA 2P1JA 2FXAA 4Q47A 2F5KA 3KNTA 4C8QG 5KAIC 5E8GA 2EGAA 4CDGA 4HDUA 2P9NA 4Y4RA 4DFKA 4BY6B 3QERA 3A8OB 2VCPA 3O80A 2AQFA 1TWFJ 2GV9A 2P9SB 4JZ3A 3D45A 4B9TA 4EPCA 4FE7A 2PMHA 3LA3A 3PX0A 1CXUA 4O6JA 3JSPA 1OULA 1NPPA 2DJIA 2UZKA 5GMKh 4LSLA 1VOMA 3WQUA 2E1ZA 4C23A 4JRKA 3E6MA 4KGXB 3CC4Q 3L4IA 4A3BJ 1BO5O 3BWGA 3COAC 1NK8A 2CT4A 4CFCA 1W36C 3EG9B 2NOEA 3EZWA 2LDUA 2JWLA 1NE8A 1J3TA 3CCSN 4IDHA 2WC9A 5BR9A 1U45A 4YOUA 4IHSA 5AQHA 4XL9A 3A8LB 1H641 3ZSQA 4FXDA 2ASOA 4CYDA 3FDRA 4AI4A 4PIIA 2E6LA 3CMET 3F8FA 2V52B 3DXKA 3OTOK 4M3BA 1E6HA 3TTCA 3I4NJ 2XAJA 2B0LA 2M5WA 3ONQA 5GANe 2H6CA 4LF5K 3I0TA 2BVLA 3GNFB 2YNGA 2KHMA 1Z05A 2OPPA 4C92A 4MMLA 4N0AA 1T98A 3CF5F 4DSKA 1NKBA 2P9KA 5JVTA 2ED0A 3TEEA 4F91B 3FRNA 2AZVA 1PJRA 1Q7YR 2NVTJ 4LD0A 2ID6A 1HCRA 1XMQK 4FWRA 3CW7A 3S1NJ 5GAN6 2ZJRL 1SFUA 2ABKA 4ICLA 4RTUA 2BY0A 3KZYA 1BJZA 3WG7H 1UJ8A 4ELZC 3ZMSA 2ZNZA 4CJWA 1GRIA 5DMRA 2YKNA 2NLXA 1M5Q1 2OI3A 1HQCA 5D4RA 4AMCA 3LGLA 3JAMK 2P81A 4M3TA 4AFUC 1ZARA 3BPVA 3UNGC 1KYWA 2ZBKA 4DBRA 2NRTA 3K70D 3JR9A 3JRHA 1NK5A 1YJWA 1N39A 2QGUA 2DD4A 2MK5A 5CKBA 3C4SA 2RI3A 3ECOA 1EH8A 2YU9J 1NJIR 1M2VB 1BB9A 4RTVA 1K0XA 3CPWM 4P1WA 4DV2K 1O57A 3V4IA 2V1NA 1WXUA 3UKRB 1RUWA 4JD2A 2P5VA 4LDUA 1ZBSA 5D5VB 4OGCA 1Z1DA 1KVAA 2K9MA 3HOTA 4XTVA 1V55H 4H4OA 1DU0A 2FOKA 5CVRA 4DTMA 4CJFA 2D0NA 3EO3A 1MWKA 1BA0A 2M2EA 1ON2A 1KCFA 1WSFA 4CZMA 2MYSA 1VQ8A 2GWKA 3H1QA 3VTIA 4YHHK 4O0JA 1N33K 2W48A 1ETKA 3EGDB 3WHBA 5C12A 3CFRA 3K4CA 3S41A 1JUPA 1M1EB 3G1OA 1HPMA 1L3VA 4CZIA 2IXSA 2BGCA 2KY9A 1VQ6N 4EAHD 4NL2A 5KYUB 3FBIB 1XNQK 1Q86U 4CGGA 1YIJT 5CKHA 2QQ8A 1T39A 5EEHA 3FF5A 2NS0A 3QIIA 5FLXK 1Y56A 1ZLMA 4M75E 3CCRT 2Q2EB 4I7FA 3HFNA 3QBWA 4HAMA 3I56Q 4MLOA 4H0OA 1J5OA 1TW2A 2VL8A 1T3SA 1WSEA 3QEIA 1IN7A 2XGXA 2O8EB 4M7AA 1B6AA 4DGWB 2ZWHA 2HKOA 2A3ZA 2JUGA 4IRHA 4IOXA 4XKBA 1FYMA 2H3JA 1ZBUA 3F8NA 3LX7A 3CEYA 2L9RA 3S3OA 3I5SA 5CAIA 3O2PE 1PVSA 4LXCA 2QEXA 1QMCA 2YT6A 2WA0A 2DJZA 1KQSP 4KIFA 3THYB 2RF2A 1TG0A 4QS7A 2EYZA 4NCAA 1MA9B 1WSGA 3FMQA 4OKJA 1M3CA 2DA3A 4IJNA 2XDVA 4N4NB 4FLYA 4PZJA 1DTQA 2HFHA 1ZBIA 4NS5A 4M45A 2ZXHA 4B47A 2ZSIB 4ABZA 1Y0UA 1FY7A 2V8KA 5ILVA 2XPWA 4NYNA 3SLCA 2R92J 1OCRH 3DI6A 1S1UA 3AL0C 3VWBA 3CCQI 2IGMA 1P8ZA 4M9XA 2V1QA 4M75G 4OPJA 2MG4A 2ZFUA 3DLAA 1LEBA 1VSDA 4NLCA 5F0XA 3BTLA 4FJJA 4EMKA 3S3MA 1JL2A 3ZRGA 4IHYA 3KKRA 3RKQA 4CF9A 3C2BA 2ZJQF 4G6QA 2QF7A 1JRIA 4N0AC 4NC8A 4PJJA 1QVGS 1YJWN 2HQHA 4ZNXA 3G25A 5KYYB 3JCMV 3RPUD 4HOBA 1ZELA 2EK5A 2KKOA 5HK0A 1ZQ1A 4BE0A 4DIQA 2P5LC 1UGVA 2L5QA 1AVZC 3K4BA 2X4YA 1XQPA 2PBDA 1NEBA 2DA9A 3LZJA 2ZC2A 1ACMB 5D5XB 1NOYA 3LFKA 2VQFK 4RAFA 3G0ZA 1ZQ3P 1OX8A 1UA1A 1OCTC 1NKUA 1YHQA 1M1KU 1WWXA 1YJWQ 1FP2A 4CK2A 3A5LC 3TREA 1MUDA 1NK4A 4ELUA 4ZDPA 1S5JA 4DR1K 2E34A 3R0AA 2RHIA 3LA2A 2XAHA 1T3VA 1VQ8N 3J7AY 2FBXA 3QU6A 4IFYA 2G8WA 1RAIB 1YFNA 1D1AA 5BRDA 1XG1A 4XLNF 3MAJA 1TAQA 3QOPA 2DOFA 1IKVA 1WPKA 4ENMA 4BKXA 4Y3OA 4IQJA 2DU9A 3DLLA 1W2BS 2OCEA 2W82A 1GLJO 4WFAL 3QJYA 4FZZA 2WONA 2BGGA 4E2FB 2WAQN 1SG5A 3H08A 3SZ2A 4G1QA 3KX2A 4F55A 3VERA 1V5GA 1SKSA 4M7DD 1LFBA 4E4HA 1LJOA 1VQ8Q 4DR7K 2HHSA 1R4NB 4EJWA 1AD5A 1BL3A 1A5JA 2FO0A 1NZ9A 3TTDA 2VKHA 5FLVA 3O8MA 3A8MB 2A40A 2H8WA 1B3QA 3ABMH 2L9VA 1QRYA 4HUFA 4MTEA 4JS5A 1FYNA 4A0ZA 4RKUE 3V9ZA 4FPAA 1BBYA 3MP1A 3E6CC 3BJ6A 2IRFG 3ZT1A 3ZT3A 1RUNA 1KRPA 4PSXA 3TCJA 4FT2A 2JUFA 3MWPA 1YYVA 1PCXA 2B8AA 2BXZA 1X19A 1S72N 3GIBA 4EDUA 2VLAA 3L2UA 4RCCA 3AL0B 1CXQA 1NHAA 1HW5A 1USTA 1JLEA 4CHPA 1X6GA 1HMVA 4RTYA 3OYNA 3TQ7P 2FF4A 5TGTA 4RW8A 4CH7A 2K7LA 4IUUA 5JS1A 3DXKB 1P2FA 3K5NA 3PE0A 3S2WA 3CPWA 1CF7A 4E7ZA 3DLEA 4PL7A 4RW7A 5L3BA 1TT5B 1GUUA 3RRHA 5J4YA 4KNYA 3M07A 4IXAA 2E2PA 5LJ3d 2ZGYA 4C92B 5KPZA 1YFHA 1NK6A 5FKKA 4Z4IA 2P9KB 3W3DA 2QQAA 3F21A 1ZSGA 2YHTA 3D2EA 4PGHA 1X3ZB 5FPMA 1JTXA 2JSPA 1K7AA 4M7AC 3JTGA 3OYHA 3V1QA 1VRTA 5C3EJ 3PIOA 1SV5A 3I8DA 2V75A 5AQGA 8ATCB 4JI5K 2QEXQ 1BIUA 1S6PA 4FYXB 3JCMW 4FWSA 2NRHA 2ZPBB 4PJLA 4I99C 1FOWA 1DT9A 5HRNA 3ZX3A 2NS7A 4F4KA 1TNTA 3LALA 4XTZA 2LBFA 1VQ5T 2EIKH 1D3BA 1KG2A 2J6KA 4DQQA 1I5OB 2F9WA 1R9TJ 3CJ1A 1M3AA 1RBTA 4A5MA 3VYHB 3I55I 3M8SA 1T0JA 4BRNA 5ILSA 3AA2A 1HDPA 1TV6A 4PY5A 3WTXC 4LGWA 1KQ2A 2ESHA 1Z67A 4HPQA 1Z7UA 4BRIA 2CSQA 1X2KA 4DTOA 4GMJB 2KNBB 3O4WA 4F3TA 3CF5L 2ZF5O 3S6WA 2HMIA 4JD2B 4X9DA 4IF4A 5J47A 1R23A 3MECA 4WQ4A 4NC7A 4R1HA 5GJWB 1YITN 2OPQA 3CYMA 1RNHA 1YHQN 2X48A 3FDYA 1R0CB 4QIWN 1FOKA 3REOA 2F8SA 4AIDA 4OPAA 5AQMA 5ICCA 3SUPA 4AHSA 3JCMc 4MDXA 3GXOA 5GAEJ 1BU1A 3D2FA 4FJMA 1VQ4T 1BQMA 2YNFA 1EWRA 1GXPA 4IWVA 4M9ZA 2R7YA 2F7TA 3SQ0A 1A04A 4CCHA 1H89C 3E6DA 2GTJA 1QPIA 2RQWA 2V7YA 2JTMA 1YHQQ 3SZGA 2CRGA 1V4TA 1VTNC 1QZZA 4NB5A 4UY8I 1XMXA 4IUTA 4DWIA 4CEAA 1I6XA 1DDNA 2ZXIA 1KD1R 2LY1A 4MQ9F 6AT1B 3AO4A 2D2WA 4DF8A 4FLUA 4XKWA 3LDOA 2W41A 3CMEI 2DN0A 4W5RA 3FHZA 1TWBA 5CVVA 2A1SA 3CMYA 2PN6A 4DEXA 5KNLA 5GMKe 5I9EB 4BH9A 3M8EA 5LJWA 4NOYA 4M78E 4M7AB 4M7XA 2M7AA 3K0SA 1QVFS 1VIEA 2EV6A 3RR8A 4GLMA 1R4MB 4I2QA 1IGNA 1F4KA 3DTIA 4OMPA 3O5ZA 2NS8A 2OJED 2RQUA 1Z7LA 1IJJA 4N4OB 3A4CA 3WU0A 1TTHB 1ZRDA 1D0ZA 4H4MA 4BI4A 2KJBA 5DCFA 3QPLA 5EX5A 2L3QA 3SYZA 1QCFA 5AQOA 3SWNC 3BG3A 5AZJA 2QVOA 2P4RA 2CW8A 1KC8C 1KIKA 1JXOA 4M75C 2NVYJ 2W4SA 1SD4A 3AHUA 1ORKA 2RJDA 3R61A 1J5YA 4BRPA 4NXNK 5BNGA 5JR3A 2CV1A 1KO9A 3SV3A 3PGGA 3MX2A 3KE2A 4JK1X 1M3QA 2UU9K 1WEGA 2M0MA 3KFVA 3JB9J 3GEZA 3I35A 3CXCP 1X1PA 3DV8A 3KLEA 4I2OA 2M16A 3J7AO 4EMKB 5I42A 3DRRA 4J9HA 4YFKF 4CK1A 4CGDA 1TLHB 4B22A 4IZZA 1XCVA 3C0BA 1LQ1A 1WFWA 2AT1B 1Y0NA 2XAFA 1LVAA 1R0AA 2X6SA 4DHYA 1IN8A 2EGEA 1Z26A 4H5NA 1I5LA 1R59O 5F04A 2RJCA 1EXQA 3V9WA 1ODDA 1QW1A 3HPOA 3ZLJA 3CFOA 1WX6A 2LZ6B 3AGRA 3D7EO 3V9UA 3WXJA 5FU6C 4L3QA 4M3GA 3O8GA 2GQIA 1RZ4A 3ZSZA 4A3GJ 2UYTA 1DKGD 3VQ9A 4C2TA 1QS4A 4XK4A 3NMUA 2YHWA 1NGEA 3PFYA 3FLCO 2FZCB 1WJBA 1YIJI 2Z33A 1ZGJA 2CQXA 3RTRA 3AGKA 1VK0A 3AVBA 3DLMA 3VN5A 1H8AC 3RQIA 3CCRI 3EFOA 3QWLA 3KHYA 3CWAA 2QKKA 1MBHA 1G3SA 2IP2A 3CCMN 2LY2A 5HLIA 3V1RA 3CUOA 3RMSA 4DQ8A 1I39A 4AC0A 1GOBA 4JLGA 1WJEA 3TQNA 1K9MC 4FCYA 2BY1A 2Q8KA 3ZSRA 3PQJA 5GANf 1IG9A 2ZJQL 2VVKA 2LQKA 1VQPA 1UELB 2QDLA 4WQ4C 1XSVA 2DA4A 3CCVA 5E20A 3U21A 2VKVA 3ZFJA 1BK2A 1J54A 5GAGJ 1NK0A 2QBYA 2RQPA 5IOYA 3TVTA 1PKSA 3MCPA 4EM0B 4OVLA 4BRQA 1FOXA 4GLKA 2Q2RA 3B6PA 1LFPA 3CPEA 2BBYA 4FM4B 2RQVA 4Y28E 2W6LA 4M78A 4JKCA 3PIPA 4AU7A 2RHZA 5KPTA 2W7NA 4CCOA 3QYHB 3FMSA 5E3NA 3J8AA 3O9QA 1NTCA 2YHYA 4OIRF 1TC3C 1U4BA 3MEWA 1MBFA 2BV6A 3RQ4A 3HYIA 1NGGA 2F1LA 1IG8A 1CF7B 3B6OA 2MC4A 1MBEA 2KL4A 1WHKA 2NRXA 2HQNA 2BUPA 3FBNB 4C0DC 3HXMA 2E2HJ 1IJWC 3B73A 2DL3A 1Y39A 1EBMA 5BR8K 1WBDA 4UUVA 3SHFA 4A3LJ 4IUVA 3U23A 2DDAA 3BR0A 5JHUA 3D2EB 1U2VA 2ICWG 1C0FA 2LX9A 4GO1A 2E3IA 4GV9A 2L4AA 2O2OA 2VN2A 3QXEB 2HVIA 4DLGA 2IPQX 4F7UF 5LJ3j 1RDBA 4O4GA 3AVLA 4FISA 5TKWA 3C18A 2X4WA 1RKTA 5BN9A 1D3BB 3G6ET 1TYQA 1K78A 1DTTA 4Z4GA 5CVUA 1B9DA 1PUEE 3S1MJ 3VPZA 4HLXA 2CGJA 2CGPA 4A6DA 1M8VA 2X6OA 4KULA 1HDDC 4A4EA 4CHQA 3C6HA 5C24A 3K1NA 2F8TA 1EO1A 1MMGA 1KQ8A 4JLHA 3HPWA 1RTJA 1X3WB 1AHJB 3R3LA 1TUUA 2KT0A 2LQWA 4Y7NJ 2ZSHB 1TWGJ 3VTHA 1OISA 4KHQA 3FC3A 2V4JC 1SAUA 2QKBA 4BXXJ 1IKYA 1C0WA 2I5WA 3CCLT 4AHCA 2DA6A 2PVOB 3SUOA 4HVVA 4FLVA 5H20A 5HS7A 4PL8A 2DLLA 2GF7A 1K8KA 5K7ZA 3LDSA 9ANTA 4RGXA 4JJDA 4KH4A 2XROA 2R7DA 2F9TA 3KYLA 1PU7A 3HKSA 1OX9A 3IUCA 2BY3A 1QQNA 4OLAA 3E2UA 2QSFX 3GLLA 3S14J 1OYYA 5J2NA 2EFIA 4EMHA 2CKKA 4CJVA 4CJQA 3SAFA 2QWPA 5IP9J 2Y0SA 2XASA 2GIVA 2CZ7B 2LDMA 2DBKA 2L89A 4ME7A 3D2FB 3VRZA 4BROA 1UHWA 2YLCA 5BS6A 1I0CA 4F16A 3ZL7C 1B9FA 3S2DJ 2RQRA 2EH3A 3ZX2A 4OGEA 4AG2C 4IL6C 1MD0A 3ASKA 1KG7A 3UDCA 2R58A 3L2RA 3SFMA 2LC2A 5BPLA 1VQPN 3TDZC 3H9JA 4OJRA 4YIIA 1RBRA 1EA3A 3CCVN 2XVCA 3DRPA 4HV6A 3W6VA 4C0DB 3CJCA 4CJLA 3A98A 1QWEA 4KRTA 3PT9A 8AT1B 4HNVA 4K8XA 2F4OB 1JJ2M 2GNCA 1B34A 1T3LA 1LJ9A 3MEXA 5AQZA 3QWYA 1R1TA 1RT1A 4LFBK 1HA8A 5C25A 2DJNA 2VB6A 4JI7K 1STZA 2WY8Q 1VQPQ 4LH4A 1YX3A 1VQ7A 3FIFA 3CCEA 3W2AA 4GXOA 1APLC 4KO0A 3CCVQ 3CTAA 1HNXK 3CJRB 3BTIA 4QCLA 3ZSOA 1IV6A 3WTWC 2X35A 1Q9YA 2BE7D 2OQGA 3CCUA 1Z9CA 3JB9I 4PJOE 1BN5A 3WGHA 4BXFA 3CG7A 2K5LA 1Y96A 5AZJB 5LGNA 3G71N 1VQ5I 2V26A 3AG1H 4OKEA 1TK5A 4B23A 3FZLA 1PD1A 1X1AA 4RDUA 2UWMA 1OLTA 2CS3A 1DPRA 3UR3C 3NHNA 1DLOA 3H41A 5C0YA 4ORZA 1WI7A 1HX1A 3PNYA 3EZ5A 4M78C 3JCMh 1PM3A 2F48A 1Z6RA 1BR4A 3BG9A 5LJ5d 3QP5A 3TSWA 1HNVA 4KPYA 1O4XA 4M73A 4XTUA 3GTLJ 3C95A 1VQLT 3VQ7A 3ZGKA 3MDQA 3OOPA 1JLFA 2PMZA 2FQ4A 4F3OA 1XMKA 1G2BA 2RPNA 4BDPA 1Z0XA 4A0XA 3MEVA 1KVBA 1G3WA 2QZ8A 4H0TB 3FE1A 3PMIA 3LCNA 2BH1A 4R56A 4KH0B 4ZN3A 1ZC6A 2F5VA 2KLOA 3IAS2 3H1CA 2CQ7A 3BG6A 2GWJA 4HVJA 4RB2C 1HF0A 1E4FT 3CP8A 3S1QJ 2MI6A 3RMBA 3D4VA 2LQNA 1DGWY 2LKSA 1Q95G 1LVKA 4LF7K 1YJ9A 3REBB 4GY2B 2IPOB 3IG1A 3NTHA 1WSUA 1RDDA 4GKJK 4Z2YA 4J7IA 4BRGA 1VQ4I 1SPKA 2OQRA 2RNGA 2VYPA 1K9MO 4YFUA 4KMUX 4FETA 4R0KA 2J05A 4PJOG 2VBXA 4O0IA 1N36K 1W9HA 1NK2P 4OAZA 4OFAA 3LWHA 4MO4A 2ECZA 5FU7B 3OA9A 3MXIA 2ZNYA 1M2OA 2RK2A 2O8BA 3E5UA 5LHGA 2BHYA 1OPCA 2Y0SN 1OH8A 2HDCA 2VQEK 4E89A 3R8EA 4DKWA 1ARKA 3IFRA 1HYSA 3EFOB 2EV5A 2HEQA 2M30A 3WTSC 1JCEA 1QQIA 2AHJB 2DNUA 4M3YA 2JZ2A 3V4GA 3K2AA 4DTPA 2AXLA 4PJNA 4O55A 5CJ9A 1ILYA 3ALYA 1KA8A 4KIGA 1T44A 1LPQA 3ZP5A 3BCBA 1ETOA 1HC8A 5EGOA 3THKA 2MLKA 1D5VA 3H3VK 2A07F 5A0DA 2O8DA 1J7KA 1EV7A 2FPDA 1GLLO 1N3AA 3TKYA 2ZD1A 3MMVA 2QBYB 3BLYA 4RTXA 5KH6A 1EJ9A 1KAXA 4CI0C 1SS6A 1DU6A 3G2BA 4YELA 3A8YA 4K0KK 5AQYA 1BISA 5AQRA 1PU6A 1YXQA 1T33A 3H8ZA 3AY9A 3T1HK 2FBIA 4M78B 4FWKA 3AVJA 1WZ2A 1JKPC 3B6AA 2L8DA 1ESVA 1VQ7N 5LEKA 2XSJC 4L5JA 4BUPA 3CCEN 2MC3A 1YJNN 3QEVA 3VQAA 1NLPC 4W5OA 2KROA 4DR5K 2IGKA 3AVCA 3HVRA 3EH2A 5J8FA 3DB3A 4PJ0C 5AYFA 1YVUA 2O8FA 3CCUN 2GUPA 1KAYA 2G7HA 3OYGA 3D1NI 5HK3A 4HCKA 2VWJA 4LB5A 4N9HA 4MMKA 2KKZA 1KQSS 1SHGA 5C10A 2VC1A 1VQ7Q 3O3KA 3CCEQ 1HJOA 1XC3A 4BY7J 1IDYA 1U2VB 5D6WA 4M41A 1KHIA 3PFIA 3HIFA 2DYRH 4B1UB 4BI3A 1OVYA 4B48A 3CCUQ 3LSMA 4M7DE 4DYRA 2RMOA 3TARA 4X9CA 3D6RA 4K42A 2PMZN 1TYQB 1ZUKA 3PV8A 1K78B 2X6WA 3QDFA 2O3FA 4G7ZF 2K3FA 5BN8A 1TQIA 5EG0A 3MHXA 2E7XA 4OKKA 3K2PA 4HHTA 2RNJA 2YHBA 1TBXA 1E3PA 2MWOA 1M90R 2FJ1A 3DPLC 5CKFA 3WVDB 3PQKA 4RB1A 4XONA 1YJ9N 2ZB9A 3GZ5A 4BQAA 1U78A 2L4MA 4DV3K 3EETA 1X4PA 5CYVA 4F3QA 4A3FJ 2DCEA 4B1VA 2BXYA 1MJ9A 5IT3A 2ELJA 1JJ2A 3EH1A 3K1PA 2KSSA 2H56A 2L2PA 2HF4A 1K8KB 4DTXA 2R4GA 3FZFA 3NHGA 5L3FA 3UWNA 5I3UA 3Q9VA 4DYCA 4CW7B 1VYVA 1U8BA 4LK0F 1N6QA 1VQ6T 3ZN1A 2HVSA 1TKXA 4IHTA 2IDOA 3EY1A 3H0FA 5GADP 3I55Q 3NF7A 2CH6A 3S2HJ 1YJ9Q 3NFAA 3OS2A 5FB2A 4J6WA 3OVNA 3BDLA 4L5EA 1YIJA 3CI5A 1F21A 5DM7F 2QTXA 2G8KA 1O13A 1G5VA 2FPEA 4XU2A 1KU9A 4EP5A 3BOQA 2D45A 3HPGA 4YOQA 5LL6S 4C2MJ 3BY5A 5H6RA 2KRFA 4VUBA 2JMCA 4RBOA 3GDQA 1IRZA 1MH4A 1KU7A 4LH5A 1WGSA 3K9JA 4CEZA 4CZEA 1W97L 3TBIA 2W24A 3IV5A 2FA5A 5HL7L 2WV0A 4ZJZA 4YY3K 4GY5A 1QHGA 4AFSC 3EHQA 1FBQA 4DU3A 5KQDA 2ZM6K 2E2QA 1B34B 4Q0BA 2QQSA 1VSMA 3K10A 1Q81O 4C3HJ 4XTYA 3VOEA 3MZYA 1HSTA 3TAPA 1RDAA 4KUDK 2JRMA 5KCMA 2VBWA 3QPTA 2Z99A 2WSFE 1U5TA 4U87A 5EDNA 1BJAA 1NU0A 2FHDA 2DFIA 3M57A 1IUFA 1W1WE 5C42A 2L54A 1WHJA 5BRFA 2DO7A 2EYYA 3UB5A 2EFOA 3H5AA 5LJ3g 4DTRA 1RT4A 1Y96B 1CZBA 1KG1A 1CZ9A 3G6EI 3DPTA 2LKPA 1YLFA 3K70C 4FASD 3K4JA 4LDVA 3J80Z 2BIVA 2UUBK 1X43A 4C8OA 1N77A 5F0FA 1XS9A 5SZTA 1ZRCA 1Q82O 4KYWA 3URGA 3L2QA 2KQRA 3VQ4A 3HP6A 1YJWT 2OU2A 3WTZA 4H0EA 3CFPA 2YUQA 5DPKA 3TSZA 4YIFA 2A6AA 1N5ZA 1ATNA 3MWTA 4EW0A 2HNYA 3CCLI 2XY7A 3H1VX 4QLCU 3META 4ASNA 3HTVA 1VI0A 5AQTA 3H6ZA 1KU3A 1JXEA 1IBMK 1XNRK 2ZJ2A 3VYGA 3BT9A 3LPUA 2DTUA 2FSKA 1O3QA 2DZCA 2E1MC 4H0VB 2H8HA 2K2MA 3GTQJ 3VF4A 3AO2A 2F5TX 5K1YA 1C0UA 1SL1A 2VXFA 1QWFA 3AVHA 5I11A 3SBGA 3CJTB 1XDSA 4QT7A 3GTPJ 2Z1GA 4XK8E 1G83A 4CJ7A 1VQ8T 1V29B 2KYMA 3I59A 4LD5A 2GFUA 1MMAA 2YV0X 1XNIA 4C8QD 4M63C 4RAYA 3IHOA 5KVRA 2NNYA 1H1VA 1MWMA 2DMPA 1AOYA 1D0XA 2DY4A 1EFNA 3WU2C 2JS2A 1TQMA 3OSSC 2LMDA 3GBTA 3BG5A 2VJ4A 3RDVA 2VJJA 2LNHB 4KHPK 4M4ZA 4FWQA 3HM9A 4UV9A 3JYTA 2O8BB 3HOUJ 4KGZB 2Y4YA 3AAQA 3DF8A 5H6QA 1WLPB 3RZDJ 1UHSA 1B4AA 4FE4A 4B3XA 4ZZLA 4U0YA 2CJJA 3KD5E 5EY4A 3QAHA 4GFBA 2HR3A 2O31A 4FO0A 3V7CA 2ZAEA 3SFZA 1A5VA 1YAGA 3K5LA 1W5CC 3OMCA 1GBQA 5M1NA 1KU2A 1ZR2A 1QKWA 1SL0A 5JFRA 5C4XJ 5EGOB 1S72T 2HOSA 4G8XA 3AAPA 3BGRA 2O8DB 3R6SA 1AZGB 4PA1A 3UKGA 3QOEA 1QE1A 3U8XA 3DWLE 1YIJQ 1Q7YC 3OR1C 3BC8A 2ROTA 4FU6A 4X62K 3QFPA 4B3SK 2QEXT 4EJZA 4QS8A 4QWQA 4KHYA 1N8RO 3OYAA 1I5ZA 3QETA 1TK8A 3M56A 2IEKA 1NG6A 3K57A 1YT3A 4N4IA 3H9QA 4CC7A 4PNOA 5GINA 4E7IA 4Y92A 4KKOA 2HZTA 3HRSA 1OEBA 3BCAA 2DL5A 3LH5A 2X6YA 2DQRA 3DBRB 1KSWA 1LWCA 4HV5A 4FJ5A 4GYIA 3K7AJ 2LK2A 2CUBA 4CZCA 2UUCK 4BVOA 4B9VA 1QBJA 2O8FB 2EJRA 3VYSB 2V1RA 2J5OA 1FMWA 1KQJA 4N56A 1NJIC 1VQLI 2YKMA 1RAFB 1RT3A 1HJRA 2VPRA 3QZ9B 1JKQC 4EVVA 2EIJH 4BWJA 1P4XA 1KHCA 2CFXA 1VQ5A 1HKGA 1HUXA 1SZ2A 2M8GX 1HU0A 2QWWA 1B9MA 1H92A 3LANA 5E1XA 2JJ7A 4FJ7A 3KLHA 3I64A 3P9CA 2Y1IA 2RHXA 3KZZA 1TL1A 3C94A 1M1KC 3E9LA 2DXCA 2W6KA 2ZE2A 4NQWA 2YWWA 2PUKB 1UOCA 2AQEA 3DXMA 3M4OJ 1MSEC 2R5ZA 3ENOA 3J7AF 4WCEL 1WHMA 1T8IA 1RILA 1WSHA 1BI4A 1X9WA 1T03A 3R6MA 5FRNA 1S22A 4LE9A 4BQQA 3N05A 4AVPA 2DT7B 4HQMA 3LMMA 2ZO4A 1VNDA 3CCJA 4DQSA 5EG0B 5BRHA 2KBTA 2I7NA 1YHQT 3TW6A 5CIUA 3WNFA 3CXCS 3E1YA 2V6EA 4XU3A 4KA4A 5IHNA 4BHPA 2EVRA 2E88A 4B9NA 3V9XA 2FBHA 4E9EA 1LEAA 2OA4A 3TO6A 2XC7A 3BE3A 2KDSA 2V9KA 4HW0A 2DDBA 5K5QA 3JRBA 5HODA 2DMQA 2CP3A 4MEYF 2HL3A 4Z4FA 4OF1A 3M4GA 4I2PA 1GVJA 2QG9B 2YX6A 1UGQB 5C6SA 4A61A 2DAQA 4M7DC 3DEEA 1BHLA 4ISFA 2CV0A 4X6AJ 4FTHA 2GQVA 4RA2A 2E5ZA 3KTQA 3NTIA 3FFIA 2UUAK 2CYZB 2EILH 4M77G 3NQOA 1TTYA 4J83A 2Y0MA 1WXBA 3FHNA 2DODA 1L3LA 5ICFA 4DSFA 3F72A 3S8PA 4HYEA 4PWDA 4EMSA 4BNCA 4B6MA 5FWCA 5AIPA 3QINA 2ZXWH 1I07A 2CO5A 2LCCA 1HJDA 4CF8A 1D8KA 3DKMA 1SEMA 4CHYA 2DPNA 1WHHA 3U1DA 1W0UA 3FZMA 4BQZA 4M42A 2C06A 1R58A 5FO5A 5EEGA 1QQOA 4M7AF 3OQ5A 2NOJB 4A57A 2B5JA 2JPSA 4EJVA 3NH2A 1Y71A 3QFUA 4E1JA 3TAQA 2YX7A 1JQQA 4D0PA 2Q36A 3KWGA 4U7DA 1A31A 4EHUA 1O3SA 5GAHP 4UV8A 3OBYA 2JVHA 2CGHA 1BIBA 2HPIA 2YI1A 1TW3A 3QICA 4F7UA 4FJIA 2FOWA 2MA3A 1QA6A 2E35A 5A2QZ 3OA6A 1QP3A 4XSXF 4J7FA 3IDHA 3V42A 2BY2A 5FWBA 4RG2A 3FXJA 3JCMP 3LAKA 1M3HA 5DM7L 3G7ZA 4LD9K 2M87A 4B1WB 1QQJA 1Q18A 2K5CA 5KYWA 3KK7A 3O1WA 4HTLA 1W2BM 1KC8U 1K9AA 2EFNA 4FIBA 1UG2A 3J80K 3RR6A 3AO5A 2ZMEA 4D8DA 3WTYC 3PSIA 2A36A 3MZHA 1Q86O 2HBLA 2UXNA 3MN7A 4R8HA 2KMUA 1XTAA 3P38A 1KJWA 1JE8A 3IKMA 2V1DA 4RGUA 2JWTA 3ABKH 4X0GA 4DUZK 1BGXT 4CIGA 2VGMA 3M53A 1VQ5Q 5J4VA 4RCBA 1UJYA 3CCJN 4JEPA 4JX6A 3BG7A 1L0OC 2I0NA 1VQ6I 4DCHA 2MGQA 3MFKA 5K5RA 3GOIA 4J19A 1VQMN 3S1RJ 4JYKA 4N41A 5FDLA 3EGUA 3MPUB 2ZPFB 3V8LA 2K57A 3I59B 3H45C 1SRLA 2L0AA 2Z1JA 3INZA 1BG3A 4BR0A 4ZYAA 3VEPA 1ASVA 2JHNA 3G3ZA 2QQRA 2VT3A 2E1CA 2XHKA 4XRFA 1RRQA 4AVZA 5M1FA 1ZK8A 3CCJQ 1VHXA 3HSFA 2K3XA 1HXDA 4A3KJ 3E9GA 3HJEA 1WFXA 4KMFA 4CFDA 3ZN0A 1ACIA 1XI1A 1QGPA 4XLEA 2GOMA 1PU8A 1JXSA 3J80E 1A5XA 1D5YA 2YS9A 2P0KA 1LV5A 3UT1A 3GFLA 4LF9K 1K83J 2JT4A 2BW3A 4KHSA 1PRMC 3HRTA 2K3BA 1KONA 1S9EA 2HU9A 1L3SA 1QZYA 1FTZA 2ZCFB 4M72A 3SBTA 4Z4HA 4Z6YA 5DS9A 2GWRA 2DPPB 2R5AA 4W5NA 3B6CA 2DYIA 3EKUA 5LJ3e 1O3RA 3GP8A 1R5HA 3HL2A 3PO5A 1K9MU 1FX7A 5HNHA 3FHGA 5AQNA 3KXTA 1SFKA 4K41A 3BP8A 3E1SA 1TL8A 1IG7A 2YCHA 2DRMA 2VODA 2HEOA 2EQKA 4DR2K 2HNZA 5IHKA 5IT9K 2G0EA 5IY5H 2EQUA 2VC0A 1R49A 4XIDA 1P9QC 2WY7Q 2JPCA 2Y1JA 3P8HA 4OWRB 5F1JA 2MOXA 3LQQA 1NOZA 1BA1A 2FG0A 4LFAK 1SD5A 2E65A 1XPXA 1GOCA 1MMSA 1D09B 2GXBA 4N4HA 2ADUA 4XOPA 2LX7A 2IS1A 4PFZA 5JI6A 1U3OA 4IRIA 1M1KO 2QWNA 2OFIA 1G4DA 5M1PA 3NNQA 2XI9A 5DV5A 3AVMA 5FPDA 5HNFA 2XMFA 1YJWI 1PUFA 5DM7R 1U2WA 1OCPA 5M1OA 3VEWA 5CQGA 3HUGA 4I7HA 3NH0A 3MN5A 5KYXA 4XQ3A 4G7OF 2XPUA 3MEUA 3P5JA 3QDRB 2P9PA 3DM2A 3SK3A 4HVUA 4LNPA 1O1WA 2RN7A 1Y1WJ 4EJUA 4CEOA 3L3VA 4CFBA 3JCMX 1GOAA 3G6EA 4A3CJ 1J0RA 1N9RA 3EYZA 2JLEA 1FP1D 1KAZA 3J81K 4A54A 1FIPA 5LJ5g 3JSOA 3GFIA 1Z6TA 2RJFA 1FIAA 4NQWB 1TH7A 3ISNC 5IT9E 3P83D 1VQ8I 3DXMB 1UECA 2R5ZB 3BR3A 3O9SA 4XKVA 1U48A 3KP5A 2LTOA 1BI4B 3BEXA 5L3DA 4WF2A 4ATOA 1XX5A 3CC2N 2CSIA 1QVFM 3GF2A 3FXRA 1C6VX 1J53A 3O9UA 4J9CA 3MMYB 3QEPA 1OMIA 3M7GA 1EWQA 1QVGA 2QM3A 1LUJB 2ZMEC 1VSFA 3CQXA 4CZJA 1KFZA 3F2KA 3V8JA 3JRDA 2EKHA 2STWA 3CMAN 4XRSG 5DCMB 3TP3A 1YWPA 4U88A 2Z0WA 1XUPO 2FEIA 1K73R 5ERIA 3EUHA 4HX4A 3L1PA 2RV8A 1YO5C 1NGJA 3ZEUA 4B3TK 4HXJA 4HUGA 2HOEA 5GAOq 4ZZDA 1VQPT 3E5XA 2CGKA 1S72I 4EA4A 5LRSA 3QNNA 3DB4A 3CCVT 5GAMd 1XHZA 3J81E 3BR1A 1KYZA 2J7IA 2QEXI 3VDXA 4CI6A 1T6DA 4EGYA 3KLNA 4UB8C 2M4GA 1WBBA 3O8HA 4X66K 2Y2ZA 2GIZA 1W2BA 2KQ2A 3DLGA 2BDPA 1WI9A 5IN1A 3M5AA 1XGMA 4IOCF 4YIRX 1HYVA 4DTJA 1OR7C 4IURA 4ZYGA 4FVUA 1ZN2A 5JVHL 2JTEA 2P7CB 4QVDA 4A2BA 2IS2A 4B8XA 1M4ZA 5GAOl 2QENA 1ZSZA 3BTJA 1YS7A 2H94A 4LJZF 4JK7A 3D0SA 2AHQA 2DO3A 4E0DA 2VWKA 1WSIA 3M0TA 1K6OA 3R0JA 3ZMDA 5SWMA 3G71T 1OYWA 2BTFA 5GIPA 5LHHA 4DZPA 2HKXA 4CSWA 4C5GA 3H0IA 2VIXA 1WJSA 2OPRA 4F7UB 2K9SA 3OR2C 4XU1A 4MDWA 5A2QK 4BXUA 4HWIA 3CO6C 1OI1A 3WE3A 1T6SA 4UC4A 3R60A 5F64A 3IKTA 3PLAA 1WHLA 1BUPA 4F7ZA 3GZNB 2DXUA 2O8CA 4KBMB 3ENBA 1V4SA 3AVGA 1ZGAA 2XIDA 3FZHA 2VONA 1KK7A 4BDZA 5KYWB 2PVGB 1RT7A 3F70A 4ZDOA 1UG0A 1VQLA 3N4PA 1E2XA 2ZMEB 4U7BA 3ABUA 2TDXA 4FJLA 3VGMA 1YHQI 3S16J 5B66C 3UA6A 2A6EF 3C0CA 4BRKA 4JK9A 4EJOA 1D9FA 2BE5F 3TANA 3CJNA 1ZYRF 3KP3A 4BWMA 2NZTA 4JI3K 4RCHA 3NF8A 3CUQA 4XLAA 1Y97A 3T1AA 5LLQA 2COBA 4JX5A 4ILJA 2IG0A 2M7BA 2PLYA 3PL8A 1R0BG 3G6EQ 1S1XA 4V19K 2R5MA 4MGRA 5CKEA 4H5RA 4OPKA 2KFDA 2MF2A 3E9FA 1K4TA 3U9DA 5AT1B 5J3LA 2NRZA 4WFNL 4DBHA 5A2QE 2F5DA 3BPXA 2JA7J 1GV5A 2CQNA 4W5TA 1X27A 4P5NA 4C9YA 1NJYA 5EYRA 5H2FC 1MBGA 1JKOC 3O9RA 5K14A 5GTHC 1E4GT 2Q2EA 2WBMA 5KHDA 2LFBA 2JTFA 3ELKA 1SFXA 4FZXC 1N75A 1Z21A 1IUYA 2QAZA 3FISA 3E66A 3TWHA 3HM8A 2O8EA 3ZQFA 4RTFD 1W70A 2FMYA 3KBGA 3CCSA 4FJNA 2BW3B 1LW2A 2VUMJ 3T69A 2EIMH 4IHXA 3SD4A 4N47A 3BQZA 1NLOC 2FU4A 3VKIA 4DS4A 3GTJJ 3FZKA 1BI1A 3OIOA 4HDVA 4FPBA 1UG1A 4JDSA 4E6KG 1FOYA 1R71A 1WEIA 2W85A 3ERED 3MP6A 1SVOA 3OYLA 1XDUA 2M0YA 4B1ZA 1UE9A 1VQ7T 4P9FA 3GW2A 5FLMJ 3CCET 1IBLK 1F43A 1NYGA 1YJNT 4BVPA 4WFBL 4OLBA 3GBQA 1WDXA 2JN6A 1MIJA 5GAN5 4FJHA 3TR8A 4XRMA 2FBKA 4BR9A 3T0YA 1IRXA 1IXRC 3CCUT 4R5PA 4M3RA 3SV4A 4M78F 3PIPF 1DUXC 4GVEA 1OKJA 2LR8A 4NB4A 3GL1A 3GPLA 4AF1A 2CW0F 1QVFA 4A3MJ 4C8QE 3RMAA 2QXFA 2F96A 5HRSA 4K25A 3O8VA 2K5IA 3KP6A 2O9LA 2WB1N 2JK3A 4OB0B 1LMZA 1PUFB 1K0SA 1C1CA 1QPMA 1BCMA 3PFSA 4RS8A 2WFBA 3HUGB 3LSGA 1ZSZC 5KYXB 3JREA 6PAXA 4FHTA 3NF9A 2KPMA 4XORA 3O4NA 3D5SC 2Q0OA 4DG1A 4A3JJ 1B07A 2P9PB 1HNZK 1T6CA 2OJ2A 3L8BA 2MPXC 2WBNA 2RQTA 4KISA 3ZBDA 3CM6A 4GVMA 3CCYA 4ZN1A 3F10A 4UXNA 1B72A 2EIFA 4CC2A 1WNLA 4LG3A 2XDBA 4KH1B 4DSJA 1YJ9T 3VEVA 4B09A 3FB9A 2HQAA 3CC7A 1KXPA 1QP2A 2DD5A 4NZGA 3OY9A 2YR2A 3M0RA 2EZKA 2P5GA 4C92D 1YI2N 3UKUA 2KXCA 3DBHB 4C0GA 1VQLQ 1RBSA 3LSHA 3F0ZA 1TUYA 1LDKB 2KI7A 4H5VA 5FD6A 5GPAA 2P0WA 2DL8A 2RAEA 2H8RA 4CYCA 3VSLA 5JS2A 4MQ3A 2M0CA 3OMGA 2F5CA 3T7ZA 3TMOA 3OW2P 4UUSA 4I6ZA 4KGVB 3EG0A 1VQ6A 4JKEA 2HDAA 3ZSYA 3GNGA 1FMVA 2E1YA 3V1OA 1EH7A 4CECA 4E70A 1B8IA 1RRJA 1IDZA 2WSCE 4CGJA 2X1EA 4B3OA 4V2SA 4KHUA 4NUBA 1OOTA 3PIOL 3WTUC 4J6XA 1T95A 3G4SA 1D5AA 5FD5A 3Q5FA 1W7AA 3CUQC 1ZA1B 5ECAA 5C2DA 3FXMA 3NGYA 3ZEUB 2NUZA 1X75C 4FYYB 4IO8A 4BBRJ 3QRFF 4B9QA 1Z25A 3PNTA 3BDUA 4OIQF 4JUVA 4BG9A 3CJAA 3PUFA 3BR5A 3LH0A 1Y1VJ 4D1QA 4WK8F 3CQTA 2NVQJ 1MJBA 1OQKA 1FEXA 1VSLA 4JLIA 2F2EA 1TWCJ 4TVRA 4N9IA 2O01E 5KRTA 5GAMj 1MJAA 5IYCJ 2XRIA 1PSEA 4DQ2A 2YRVA 4WTOB 2CFOA 4QSHA 3CCSQ 3KLIA 1ZSZB 5LEJA 4C1NI 2QLZA 2G8VA 2K02A 1ZRFA 3IC7A 4BRFA 3SMPA 4Y33A 3L3UA 4OFEA 3FFKB 1HQEA 3OYBA 2DE0X 3VS3A 4IOAF 3KZIC 3MCAB 1U0JA 2MCNA 4GW6A 1NGCA 1USSA 2ZFWA 3EG1A 4ZYEA 1SHFA 1X6BA 4KFCA 4PHTX 1E6GA 3ID8A 4RAZA 2NRRA 4KTQA 1IV8A 4GYGA 4XU0A 1BDGA 4RWTA 2DX1A 2OF7A 4C8QA 4HTUA 2PFUA 1FSEA 3GTMJ 2Q3SA 4O5FA 1RBVA 4MFDA 1SD6A 2I7PA 3PMTA 3RUXA 3JSMA 4L18B 2OTLA 4B1YB 2O8CB 1QSSA 2DA5A 4PLIA 1U3EM 3P1GA 1OZ2A 4M7AD 1WRJA 1U1TA 5EJCA 2PNIA 2NUPA 3ASNH 4ZHRA 4IOCL 3RKXA 3H35A 4CEFA 3DCFA 2OA8A 2ECCA 2Q0UA 5M1QA 1SKRA 4KUIA 3C3WA 3P7NA 3KLFA 5E18F 3CPFA 4YPHA 2FYKA 2W57A 1RRSA 4CCJA 2UUZA 1E3HA 1T0FC 3NWTA 1EX4A 2YXYA 4HF2A 1IBKK 2AIRB 1RR8C 4IEIA 1SQKA 5KCOA 3CC7N 3CUQB 4BJTA 4PJOD 3A5NC 4LLGF 3CJ9A 4E1MA 1XTDA 5T7BA 2FF3B 1N34K 3AA3A 4DUYK 1RR7A 2KDZA 1SSHA 2D0QB 2I2LA 2HGCA 3LP3A 3TP0A 3VQBA 3JTHA 2HDWA 3K4KA 2JA5J 3U9GA 4JK8A 4IIOA 2DT5A 1T7PA 2Y9ZA 1X1BA 1IGUA 3JB9H 1TVRA 1NG9A 1HW2A 5LJ3f 4F7UG 3FKIJ 3LP0A 1EKEA 4MDAA 4CHNA 4Q4ZF 5CKDA 3NWSA 1VQPI 4RTTA 5GAN3 3VOVA 1JEGA 4XTXA 2WAQA 2QA4A 2H1KA 3VS7A 3CCVI 4QQGA 4LITA 3CC7Q 3HOSA 4ESJA 3AKZA 2Z1IA 3JAME 2E19A 5IHIA 5HY6A 4FL9A 5D6FA 4YFNF 4ZTJA 1BU6O 2P8TA 3F73A 4M71A 3UF4A 1ETQA 5F1XA 2FLOA 3G4SN 1OPKA 2PJPA 4DTNA 1IZ6A 2KRHA 1LB2A 3VEOA 3JW4A 1JJ8C 2EQRA 1G3YA 3R2XC 2KGTA 4IUPA 1G99A 3KVGA 4A2UA 3M6GA 4OMLA 1VQ6Q 3QZ5B 2HHQA 3O5BA 1KVCA 1GFCA 2ZPEB 2EV0A 1IH7A 2AZSA 1ZA2B 1DEJA 1NGAA 1S72A 1KQ1A 4GGGA 2NWMA 3I54A 1XN7A 4M74A 5D4SA 4X1VA 2D0BA 3T1YK 5EU7A 4C8NA 3MKLA 2J6OA 3G71I 3SNNA 4GRIA 1U1SA 4DK9A 4OPHA 2G6FX 5AQVA 2EWNA 3VEXA 2EZIA 2LLKA 3H3UA 4UNOA 3W3CA 2ZZDA 4YOTA 4CF1A 1Q7YU 3RSNA 2DT6A 1PP7U 3I0XA 1GLEG 3GTGJ 3AG4H 4CC3A 4Z88A 1U9OA 3HSCA 2O4IA 2HHWA 2EKOA 5LGUA 3HT3A 2NUBA 1KG6A 3K5OA 2G8HA 3LDPA 1WOQA 4UB6C 4ZTFA 5FLXE 3C2GA 5EOYA 2XF6A 1IRGA 1GCQC 2E1HA 2WC2A 3NF6A 5AN4A 2D1HA 4ESBA 5IYBJ 1W1FA 3VQ5A 3QYFA 4MEXF 4JI1K 3WTVC 3JRGA 2K9GA 3HOZJ 5CHZA 5FGMA 1C1AA 3VQDA 3BR2A 3IRRA 1JKHA 1M90C 5HLTA 2FXUA 2OTLN 3QBXA 3T5XA 2GXAA 2HVRA 2R7VA 3KUFA 3CD6A 2PU9B 2YPRA 2K2VA 1NJIU 4KTWA 3BUZB 2FC0A 1GVDA 3L2ZA 1J5EK 1ATRA 1QHHD 1UDLA 2HAXA 5J26A 4H0YB