3OY9A

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese at 2.55 resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oy9A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oy9A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oy9A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oy9A03
1VSEA 2OZMA 2HHWA 3SI6A 3LANA 4CFDA 4W5TA 2YHBA 1C6VA 5FRNA 2OPQA 4FLZA 4KREA 2BE2A 3ZSQA 1CXQA 3ZT0A 3OS1A 4OPJA 3T19A 1MHNA 3OVNA 2LCCA 2KW4A 2XRIA 2QXFA 4M41A 2BUDA 3L8BA 4DF8A 2OPSA 1RDDA 4RW4A 4CHNA 4B08A 4C8KA 4CF8A 4JS4A 3TR8A 1JLEA 3K5MA 4FJXA 1HQUA 1JXBA 4YNQA 3M8PA 1NK6A 4MQ3A 2IC3A 3LPTA 1C0UA 4KI6A 1LW2A 4CEFA 2F8SA 1ZBUA 2RN2A 5KH6A 2DAQA 5KRSA 3CFPA 4DU3A 2KTQA 3PX4A 1SUQA 4M3YA 1KTQA 4ZTJA 3D0PA 3CG7A 3KUFA 3ZT2A 4FJJA 1C0MA 4GMJB 1J5OA 4IFYA 3SQ4A 2PYLA 1D9FA 4FJNA 3LGLA 4F2SA 1RILA 1ITGA 3S9HA 4H8KA 4CGGA 1BCMA 3AVGA 2BKDN 4FJHA 3M9QA 2D9TA 5CZ1A 5KGWA 5CY4A 4O55A 3LX7A 4W5OA 1VSKA 1T7PA 3K57A 1GOCA 2F8TA 3VQ6A 1LWCA 3IS9A 4Z4GA 4M3UA 2XY6A 1VSJA 2RJEA 3KD1E 4QVZA 4F2RA 3AVHA 1OZ3A 4CF1A 4OGEA 2PYJA 2L3RA 1RDAA 3TAQA 4B9XA 2DFHA 3CFRA 1D8YA 4CJVA 4C8MA 3KLFA 1KVCA 3RRHA 1TKXA 1Q8IA 2BIVA 3AA4A 3JSMA 4DLGA 3UT1A 4KI4A 1U04A 2FBYA 3DLEA 4EZ6A 3PUFA 4IBNA 2DFEA 1DLOA 1RT7A 3O4QA 3DRRA 4HUGA 3AVBA 4CEOA 3NCIA 1BQMA 3OYLA 4ELVA 4OGCA 4FJMA 1WAFA 3META 4CFCA 3KJVA 3C6TA 1JLGA 2LTOA 4OJRA 4O44A 4XIUA 5D3GA 4NYNA 1JLQA 2OPPA 3LYIA 1QS4A 1GOBA 4CJFA 1REVA 3HJFA 3LPUA 3AO2A 3DLRA 4CIGA 1C1AA 4CJRA 3LP2A 1F21A 4GVMA 2RHZA 3ZSVA 1S1TA 4CJUA 2R58A 1W9HA 4KO0A 3ISNC 4KHYA 4IUPA 1WLJA 3VQ8A 2YKMA 4FLUA 1CXUA 3S3OA 4AHVA 1BQNA 1JL1A 3ZSYA 4HCCA 4IKFA 1L3UA 3MEDA 3VA3A 4C8OA 4BWMA 2P5GA 2K3YA 1UAXA 3AVCA 1KCFA 4E7LA 3PY8A 1L3TA 4Q0BA 3DYAA 3NFAA 2X6SA 4FM0A 5HROA 2GUIA 2RJFA 4II1A 4PLIA 3KTQA 4L59A 3OYGA 4FJ9A 1WN7A 1NJYA 4FZXC 4CK1A 4KB0A 2G8UA 4BDYA 5C42A 1VSDA 4DTSA 4KB1A 3VQDA 2HHVA 3MXMA 1KRPA 1EXQA 2B8AA 3OYEA 3D45A 3ZT4A 4CHPA 3ASKA 4C5HA 4K8XA 4HCBA 2RF2A 4BDZA 1IG9A 3I8DA 1CLQA 1XI1A 1SL2A 4M3RA 1WSHA 1RTHA 4OKJA 1BIUA 4ELUA 1LV5A 2DFFA 3OA6A 3U3YA 4FJGA 4CE9A 3M8RA 3CM6A 2EKOA 4PY5A 3HP6A 4CJWA 2QKBA 3MP1A 1I39A 3LDSA 3PFSA 3I0SA 4J2AA 1LW0A 1NK8A 1QTMA 1KVBA 1KFSA 2WACA 3AA5X 3OYHA 3A2FA 1YTAA 3DRSA 1TK5A 2F96A 1K6YA 2RI5A 4IFVA 3E9GA 4NYFA 1IKWA 1BI4A 1YTUA 5C0MA 4Z4HA 1JL2A 1X1PA 4CRIA 2X4YA 3RR7A 4NCBA 1N5YA 4C8NA 1WJQA 4CJEA 5SZTA 3RMDA 3K59A 4C5GA 4UQGA 4OKKA 1TKTA 1R0AA 1BHLA 4AHTA 1DTQA 3MEGA 1S6PA 2HMIA 4FK2A 4FJLA 1IO2A 1XHXA 3DOLA 1GOAA 3PMTA 4E1MA 3MECA 3OYJA 1S1UA 3QNNA 2JTFA 3MXIA 4R5PA 3NAEA 3AA3A 3VQ9A 4M3WA 3TI0A 5J26A 3S6WA 3ZSXA 4KHWA 1YT3A 4E7JA 4LD6A 3Q1JA 4DFJA 1TAUA 3OS2A 1IKXA 1B9DA 2P0KA 3NTHA 2B6AA 2G8IA 4HHTA 3H6ZA 2YHAA 3QIPA 4CEDA 1S9EA 5J2NA 1Q9XA 4KV8A 4N47A 2A1SA 2HQXA 1BI4B 2FBXA 4C5IA 3LZIA 3L2VA 1FK9A 3PV8A 4DLEA 4J2BA 1T03A 3FC3A 1LWFA 5CYMA 1XHZA 4B8AB 1JXEA 5EU7A 3PX6A 3TAGA 4CHOA 1JKHA 1VSIA 5K14A 4Z4EA 2EX3A 3C95A 4O0JA 3HYFA 2RHYA 2Z1GA 4OLBA 1WAJA 3QBYA 4BE0A 3C4SA 1YVUA 2D0AA 3TARA 2O4IA 1RBSA 2PZSA 1XNIA 4NZGA 1ASUA 3DLKA 4DU4A 1NOZA 4CHZA 2G8FA 4FLWA 2EQMA 3AVNA 4I9LA 1ZBFA 1UA0A 2R5MA 3SJJA 1O1WA 1UWBA 3NTIA 2RHXA 3K5LA 1Z26A 3L2QA 3PMIA 3DLHA 4I2PA 4E89A 5D6XA 4B9VA 2EHGA 2MWPA 1N6QA 2Z1HA 1WSFA 3CQ8A 4DG1A 1S1VA 3V1RA 3QEWA 2P1JA 3KLEA 4FW1A 4FM1A 3B6PA 4QCLA 1HYSA 3OQ5A 1X9MA 3P1GA 4B9MA 4J2EA 5IAYA 2NLUA 1SSFA 2VWJA 3NH2A 4F3TA 1XWLA 1WJSA 3AVMA 2QQRA 4W5RA 5D6YA 4ELTA 1HPZA 3U6FA 1N27A 5HP1A 1EP4A 2PQWA 1HYZA 1RT3A 3SQ1A 3TAMA 4ZTFA 1A5XA 4J2DA 3HPGA 4M3ZA 1VSHA 4KFBA 2YV0X 4E3SA 3U3GA 2X4XA 4DSLA 3TAFA 3KIOA 4I9QA 4JS5A 2VG6A 2E4LA 3O3HA 1JLBA 3QINA 4JRQA 3LP0A 4KRFA 4CGJA 2IGIA 3QEVA 4DTPA 1S1WA 1BGXT 4AHCA 4AHUA 3QIOA 4LY7A 4OPKA 3MEEA 3MEVA 1WGSA 3OY9A 4DTJA 4FXDA 4CJTA 1RTIA 3KK1A 4RW8A 4N4HA 2JZ2A 3NF8A 4B3OA 4Y1CA 2F5KA 1A5WA 2B5JA 1NK5A 4HTUA 4N56A 3VQBA 1LWEA 3ZSRA 4A4GA 3O4NA 5SWMA 2HNZA 1VRUA 2XDPA 1S6QA 3MO8A 2FBTA 3PX0A 2WOMA 3IG1A 1KLMA 4DFMA 2EFIA 3DM2A 3P5JA 3BDPA 1EETA 3WNGA 1U45A 2IAJA 4B9TA 1QHTA 4CJLA 3MP8A 2XY5A 2RJCA 1VSFA 1TV6A 1RDCA 1SKWA 2HHSA 2LDMA 3ME9A 3DMJA 3G0ZA 1RCHA 3MXJA 4OVLA 4HVJA 4MFBA 4IG3A 2VG5A 2RKIA 4QQDA 4CFBA 3TAEA 3VQ5A 4RG2A 4IUVA 4IDKA 4CGDA 2L89A 2P51A 1EKEA 4A4FA 5J1EA 5I42A 1A5VA 4EP5A 4PL6A 2Z1IA 2O4XA 3KK3A 2R57A 4ICLA 4PA1A 4HUEA 5KTQA 3C6UA 1RTDA 1VSLA 3TABA 1OZ2A 2E6NA 3OMCA 1HNVA 4C8LA 2XY7A 3F9KA 2Z1JA 1BISA 5FROA 4QAGA 2X6NA 3LZJA 3CFOA 2R5AA 1X9WA 3EAEA 1ASWA 4IUUA 4FM2A 1NK4A 4BD3A 1HRHA 3OYDA 1RT4A 3HVTA 2D0BA 4KTWA 1IKVA 3F70A 3G10A 3V1OA 1HQEA 2OPRA 4EP4A 2RI3A 2G8VA 2KZZA 4KHUA 3VQEA 1U48A 4LD0A 1JLAA 2E6MA 3CEYA 4FL6A 2BGGA 3SPYA 2Y1IA 2EQKA 4CGIA 2G8HA 4PWDA 3AO5A 3LALA 2GBZA 3VQ4A 3M8QA 3K5OA 3QNOA 2O4XB 3VN5A 4CJKA 2YRVA 1LAWA 3QO9A 1UOCA 4QOZB 3FDRA 1TKDA 1IKYA 1OYXA 3HPOA 4DMNA 4YFUA 2GFAA 5T7BA 2OYQA 3HM9A 1X9SA 4RG8A 2YNGA 1J9AA 3KD5E 2RI2A 2RHUA 2EQJA 4FVMA 3V9XA 3LWMA 4KHQA 5C6SA 3L2RA 3OJUA 1SL0A 5CIUA 4DTXA 4CJ3A 3SQ0A 1WNSA 2DY4A 4Z4IA 3LAKA 5FDLA 4W5NA 3LAMA 4CGHA 1C1BA 4E7KA 3NF6A 4E7IA 1C1CA 1HJRA 3AVJA 2M1HA 1SV5A 1HYVA 3QJ6A 3DI6A 2HVIA 3OYAA 2I5JA 3CYMA 4CEEA 2VG7A 3TWHA 1S5JA 3QEIA 3AVLA 4CK3A 1T05A 1KVAA 3IAYA 2CKKA 4B9LA 2GV9A 1WSJA 1Q9YA 3LWLA 3HO1A 2FHDA 3OYNA 3ASMA 4B9SA 2P5OA 4RW9A 4N4GA 4KHSA 3ITHA 3KKRA 1NKCA 4FLXA 4M45A 3WNHA 2HHXA 1RDBA 1WJRA 3F73A 2ATQA 2ZE2A 4L8RB 3KLGA 2QK9A 3KKSA 5HRNA 3VQAA 2EQUA 1ZBIA 1B92A 1RBTA 4TSXA 4DTRA 1W0HA 4M42A 4HCZA 2R7YA 4Q5VA 3ZSZA 1JLCA 3AVKA 4CF2A 3MEWA 3PNWC 1XC9A 3QETA 3OYIA 4CEAA 4FZYA 4PUOA 1MU2A 2HHTA 3MEUA 1OI1A 4ID1A 1G15A 2D0CA 4E0DA 5I3UA 1L3VA 3V4IA 2QKKA 4DF4A 3SYZA 5J2QA 4Z4FA 2X4WA 3E01A 3V6DA 4G1QA 3OYMA 2IG0A 4IUQA 1TAQA 2RJDA 3NF9A 4FK0A 2M16A 3NGZA 3AO4A 4DFKA 2IS3A 4DSFA 4LSNA 3DLGA 1NJXA 3I0RA 1U47A 4DQSA 1SKSA 2KZMA 2FC0A 1TL3A 5D6WA 2RHIA 3AA2A 4DSEA 3QLHA 1HNIA 4N76A 4FJ8A 3C94A 1RBRA 1RT2A 3LP3A 4Z02A 1KLNA 4FU6A 3ZEHA 1FKOA 2LRQA 2BANA 4DTOA 1FXXA 4RW6A 2BDPA 4B8CA 2G3RA 4CEZA 4FLYA 3O3FA 5C25A 4KPYA 4CJSA 4ZHRA 4CK2A 3L3UA 4I7FA 3ULDA 2VWKA 4CEBA 3MEAA 3NGYA 1IH7A 1TVRA 3OJSA 3O8VA 4DQPA 3ZCMA 1TK8A 2JGUA 3AVIA 2GF7A 3DLBA 3JYTA 1NK9A 4EZ9A 3HXMA 1RI0A 3O3GA 4CESA 3RR8A 2WONA 3L42A 2ETJA 1J54A 5HRSA 3LLRA 3VQPA 4FW2A 3NGIA 3RWUA 1ZBHA 3LP1A 4F4KA 5J39A 4DTMA 4PQUA 3V9SA 4E1NA 1T8EA 1S1XA 1NKEA 3FEOA 1BL3A 4LH5A 3OYFA 3UWNA 4O4GA 1EX4A 4M3TA 3KLHA 4FZZA 1QE1A 3QEPA 4CF9A 4N4IA 3HPHA 1WSEA 3HP9A 4ID5A 5DMRA 1B9FA 4CF0A 1RBUA 1BIZA 2X78A 3P83D 4I2QA 2X35A 2LSNA 2KFNA 2Y1JA 3LGFA 3RTVA 4CEQA 2NUBA 4N41A 3AO3A 4FJ5A 3T1AA 2QQSA 5JS2A 2YNIA 1Y97A 5HLFA 3SQ2A 3BGRA 4AHSA 4QW2A 4CJPA 1TL1A 2HHUA 2HNDA 2W42A 4LSLA 3P8DA 4DTNA 1G5VA 4FK4A 2MWOA 4FLVA 3RRGA 4KTQA 2A1RA 4AILC 4DWIA 3S3NA 1D9DA 4CHYA 4Q5WA 3SUOA 4DFPA 4AH9A 1RTJA 3SNNA 4BE1A 3K58A 1D5AA 3RMCA 4O0IA 2ZD1A 3RMBA 3S3MA 1RT5A 1ASVA 2E5QA 1UA1A 3SUNA 3V9UA 4DQQA 1KHCA 3HL8A 1TK0A 4E7HA 3PO4A 1VSMA 3M8SA 4CHQA 4NCGA 4CJ5A 3RMAA 2ZQBA 3H8ZA 1WSGA 3SUQA 3QESA 5KRTA 3HVRA 3V9ZA 4FLTA 3VQQA 3KK2A 3T3FA 4B9UA 1NK7A 2OZSA 4W5QA 2XK0A 2HVHA 4LH4A 4IURA 4CECA 3NDKA 4AHRA 3WNFA 4IG0A 2G8KA 3V1QA 4EDUA 2L8DA 3SD4A 5J2PA 3VQCA 3DOKA 2FBVA 3TANA 2OA8A 4QQ6A 4CFAA 4CGFA 3SUPA 3VA0A 2LVMA 4FJKA 4DQRA 3QERA 2M0OA 3AO1A 4HUFA 4DTUA 3QEXA 4DS5A 2E6LA 3PO5A 1VRTA 2HB5A 4Z0UA 3EZ5A 5J2MA 2AJQA 2DIQA 4DSIA 3FLGA 2XO7A 4N5SA 4OKEA 1NKBA 3MAQA 1SL1A 3WNEA 3B6OA 3NNQA 3NH0A 4CJ4A 1C0TA 3DRPA 4KTZA 4BDPA 2YNFA 4K8ZA 3OB9A 1CZ9A 4CERA 2RPIA 4NS5A 1J53A 4DS4A 3AVAA 4DSKA 4CIFA 3BDLA 5M9OA 2HHQA 1CZBA 1RT1A 1L3SA 3AVFA 1U49A 5HRPA 2VYTA 3LH0A 3FFIA 1SKRA 4B9WA 4H4OA 3L2UA 3HK2A 2G8WA 5KCHA 5FRMA 4OLAA 1ZYQA 4F8RA 4JRPA 1RNHA 4E19A 3EY1A 3OYBA 3UIQA 3AV9A 3NHGA 1S9GA 2X74A 1TKZA 1NJWA 4IUTA 1FKPA 5CZ2A 1NOYA 3NBPA 3E9FA 4H4MA 2YNHA 3P8HA 1QSYA 1ZBLA 2B4JA 5DK5A 3ZSWA 4KHNA 3K5NA 3ALYA 4KKOA 3OMGA 4DSJA 3HT3A 4B9NA 3SV4A 3L3VA 3V81A 4FYDA 3OS0A 4FJIA 2YKNA 3SPZA 3SCXA 5KCOA 1NJZA 4BE2A 1QSSA 4Z4CA 4OVAA 1TGOA 3EYZA 3HSTB 5C24A 4C5EA 3MP6A 1QQCA 3NH1A 3QKJA 1NK0A 4KAZA 4CJQA 3KLIA 2HQEA 3NF7A 5HBMA 5KI6A 4Y1DA 3K2PA 3ZT3A 4JLHA 4BACA 4PLLA 4UC4A 2PY5A 4FJ7A 3DLMA 4A4HA 3THVA 2ITGA 4GW6A 1I3AA 3VQ7A 1WSIA 4NCAA 4GY5A 1JLFA 3CM5A 2HW3A 3L2WA 3NTKA 4DQIA 1BCOA 4DU1A 1VK0A 5CYQA 3OYKA 2KQ2A 3OYCA 5KE2A 1KSPA 4WE1A 2JLEA 1U4BA 2DIGA 1HMVA 1Z25A 2HNYA 4BWJA 2DTUA 5KE3A 2IDOA 4RW7A 3ZSOA 2XY8A 2O4GA 4FCYA 3NE6A 1QSLA 4CCHA 1RT6A 5KGXA 3IRXA 5HRRA 3ZT1A 2XHBA 1KFDA 3V9WA 5IN1A 4CIEA 2GFUA 4X34A 3QIIA 2Q3SA 1DTTA 5JS1A 1LAVA 2KFZA 2IOCA 3SV3A 4O5BA 1H3ZA 4QQGA 3DB3A 5E41A 3H08A 3DB4A 2K3XA 2RO0A 1L5UA 2D5RA 4A4EA 1RBVA 3SZ2A 3GOXA 4M3XA 4F3OA 3TAPA
chains in the Genus database with same CATH superfamily
2E8AA 1D3YA 1BU6O 1EH7A 2O8EB 1XG7A 1TQMA 4BRMA 4ESJA 5IP6A 5GAOl 5JHFA 5FRNA 3VF2A 4M72A 2E2QA 3CERA 4F04B 2FBIA 1CXQA 2MC4A 3ZT0A 4OPJA 3T19A 4FYYB 2Y69H 2R7ZJ 4JZ4A 1FOXA 4CCNA 3RPQA 2LCCA 1D8KA 2BTFA 4DF8A 4PFOA 4CHNA 1M3QA 4B08A 4B1WB 1T6CA 3CC2A 4LF7K 1N8RR 2GXGA 5LJ3j 1D0ZA 1U78A 2V1UA 2RK2A 3M8PA 3IAM2 1IBLK 4MQ3A 2IC3A 4CEFA 2PMZA 1UAAA 3G6EA 4M7DC 5KH6A 2DAQA 3EH2A 2IXSA 3VPZA 3DF8A 3P9CA 4JYKA 5CVJA 2KTQA 2VIXA 1X2QA 2TCTA 5HDKA 2DNUA 2RQWA 2P9PA 1XGSA 4H0VB 3BG9A 1ZREA 1MUNA 4XONA 1I50J 4FYVB 4IVNA 3O4WA 4FJJA 5GAN5 5GAHJ 2AO9A 4FPAA 2MH2A 3H1VX 3QBWA 5I21A 2PYLA 4Q5SF 2P81A 2QWNA 1EJ9A 3CQXA 4CGGA 1VQ5N 3AVGA 1OQKA 4F3QA 2QAZA 2BKDN 4LF6K 3QPTA 1LDJA 5CZ1A 1SAUA 3IWZA 3CCLA 4YOTA 5DS9A 1RR8C 3LL7A 3CMAN 4F91B 5LL6Z 1NEGA 4KFCA 1LVKA 2COYA 2E65A 3RKXA 3HPWA 2MH9A 4BQOA 3S2HJ 4C92E 1CKAA 2LX7A 1GOCA 1U6ZA 1H1VA 1O13A 2ETHA 3IRRA 4L6V5 3OW2A 3DXMB 3M1EA 2VLAA 4XLAA 4CCJA 3KD1E 3HGYA 2KLOA 5KYWB 3CC2Q 2J06A 1Q81C 4CF1A 3JS6A 4OGEA 1YITI 2L3RA 2VKNA 3GTGJ 4RLFA 4S04A 3TAQA 3GPLA 2UXBK 1WBBA 4B9XA 3CC7T 3CFRA 5JLFA 1EF4A 3A5ZB 3JAMO 1D8YA 3G6EQ 2DI3A 5LL6S 3T69A 2BIVA 3JSMA 1U04A 2FBYA 3DLEA 3T1HK 2LY9A 1V5FA 4G9YA 2DFEA 1M8MA 5DY9A 3ASNH 2HDAA 1C6VX 4HUGA 3CUOA 1VQ5I 2NVTJ 1WWXA 1QVGS 1BQMA 3UNGC 1SEMA 4ELVA 3UE5A 3WHBA 2FA5A 2X4JA 2KFDA 2EBPA 1WAFA 3META 4JQFA 1R58A 1PCXA 3CMAI 1IF1A 4XIUA 1LJ9A 1K73C 4X6AJ 1QVFM 1KG2A 1ZSZC 2F4VK 3CCLQ 3ZQGA 1C1AA 3LP2A 4GVMA 4ILHA 2DA5A 4E9EA 4J7IA 2KGTA 3U9GA 2ZFUA 4KHYA 3M0PA 1S72T 5CKFA 3GMEA 1KG5A 1WLJA 2YKMA 4BQNA 1WHJA 3I5RA 1VQMN 3CCET 4JAXA 1JBMA 4C8OA 3O8HA 2ZFWA 4E7LA 5JMVA 1ZN2A 4EM2A 4N4OB 4MTEA 4H5TA 4EVIA 1QVGP 5BRDA 2X6SA 4QWQA 5D6FA 1WI3A 5CLSA 2N8GA 2RJFA 1JKQC 4PLIA 3KTQA 1WJEA 4Y91A 3QOPA 3DBLB 5M1OA 3I54A 3DTEA 4JP0A 4BS9A 1NJYA 4FZXC 4BROA 4BDYA 2CH4W 2LNHB 1VSDA 5C42A 2KDOA 4RTFD 1GV5A 4DV3K 4J9IA 3SZTA 3SDZA 2ZSIB 1TYQA 3MXMA 2ZGZA 2I8DA 5HS9A 3I35A 2O5RA 1DGKN 2MF2A 4AM7A 4FVUA 2HDCA 4RWTA 4C5HA 2EZKA 1WXUA 4C8QA 1NJIU 1U8BA 2O9SA 3I8DA 2K7LA 2EV0A 3WTUC 2J5PA 5FKMA 2MCNA 1K9MU 2L7KA 3D2FB 2LD5A 2DMNA 4OMQA 1VQMI 1HW5A 1JXOA 2YR2A 5FLMJ 1AOYA 2OU2A 3FMSA 2DFFA 2EZIA 3OA6A 3CZ6A 5D6EA 1HBXG 3ULRB 4RLQA 2GWKA 4XLFA 2DPPB 2GELA 1BA1A 2KMTA 3CCRI 3E5QA 3FZVA 5KYUA 3H35A 3HP6A 5B1BH 2CH5A 1AWJA 3F8CA 2ID6A 3MP1A 5DV5A 2E2PA 3PFSA 4ANJA 1WH7A 1NK8A 4E7SA 2PZ1A 4C2TA 4A63B 4M3DA 4JK1X 4B3XA 5JVHL 5IOZA 1PWTA 1YTAA 1TK5A 1GXIE 2CP6A 3AL0C 3BG5A 4NYFA 4YIIA 5GIOA 2ESNA 3CXCM 2KZVA 5C0MA 1JL2A 3KNTA 2COBA 2EAYA 2NAZA 4C3JJ 4DUZK 3M0RA 3BR5A 4CRIA 3E97A 3LL3A 2IRFG 4DR3K 4CUGA 1SVMA 1ZR4A 4C8NA 1M1GA 4CJEA 4CI6A 4MO5A 1IN5A 3RMDA 1VQ5A 5A2QE 2E1MB 3VERA 3F0CA 3OBWA 4B3MK 1O9SA 4F92B 4OKKA 1TKTA 1R0AA 1T39A 1R36A 2JTVA 3TQNA 2HPMA 4AHTA 4LFBK 1HSJA 4F52A 4ENNA 4EW4A 4JJNK 2O3FA 3J81E 4Z8AA 3CMAA 2D8JA 1HW1A 2P4TA 1Q81O 3TMOA 1S6PA 1ETYA 2OFKA 4FK2A 3J7AP 2O8EA 2WY8Q 1S9HA 1OH6A 2QKMB 1NPRA 1QW1A 3MXIA 3NEUA 3NAEA 2CP3A 3PFIA 2EGAA 2W04A 4M3WA 1NH3A 3S6WA 4KHWA 2GIVA 3MCPA 3HOZJ 2NRHA 4Y28E 2E34A 1YT3A 3H9GA 4LD6A 4RB2C 4FO0A 3Q1JA 3OS2A 3NTHA 4M7AD 3IH2A 4A93J 4Z89A 2BE5F 2XF6A 1LDDA 3SFMA 2LQKA 3QU3A 3CWUA 1Q9XA 2ATCB 5L3CA 1WI7A 5AQRA 1QRYA 3O1WA 3LZIA 1GLFO 1H92A 2EA4A 1K73O 4DLEA 4ELZC 4J2BA 3VFZA 3R6SA 1SFOJ 4FT2A 2PAVA 3ONQA 4B8AB 2QDLA 4HX4A 1JXEA 4MQVA 5LJ5g 2QK0A 2FX0A 1VSIA 4YOQA 5IT9O 3C95A 2M3AA 1PSFA 1WAJA 1YUWA 1VQ5Q 1KG1A 2XIGA 3FK6A 4EM0B 2J6OA 5E3LA 2JSPA 2GWJA 4BJ5C 2X1CA 3NRVA 4JK9A 2FQ3A 4EVVA 1ASUA 1J0RA 3CMAQ 3DLKA 3ZXSA 3GNFB 4DU4A 4KN4X 3UA7A 4H5NA 1M2VA 4WF9L 2H1LA 1RRJA 2ELJA 4ESFA 4BQAA 2JA2A 3SJJA 3K9JA 4HVUA 1UWBA 3ZMDA 4FT8A 1VQMA 1ZELA 2KRFA 2K5IA 2ENMA 5L3FA 3L2QA 3PMIA 2CRGA 2ZC2A 4ZYGA 4E89A 1ESVA 4B9VA 3VENA 3DXMA 2EFQA 1QU3A 1JRIA 4XLHA 3G2BA 4DG1A 2ZO4A 2P1JA 5HY6A 4EJTA 4IF4A 1O7LA 2H6BA 1R1TA 5GPAA 3A8LB 1S72N 2LF7A 2ZWHA 5EG0A 2VE8A 3GNGA 1NGCA 3K1NA 1QVFS 4HLXA 4GGGA 1RRSA 3FWEA 4PNOA 2VWJA 2HXOA 4F3TA 1XWLA 3CC7I 3U23A 3CCEN 1WJSA 3E0JB 4OFEA 1LWWA 5FB2A 1QBJA 2P5KA 2OTLT 3GTOJ 3L09A 3CESA 3DQVC 5ICGA 1FP1D 1HPZA 3U6FA 3QDRB 2FYKA 1ZRFA 2M7AA 1EP4A 3IUOA 1WEIA 3SQ1A 4GV3A 3PO3J 1SVOA 3HPGA 3VKIA 1F36A 4E3SA 3U3GA 1QQNA 4M75D 2V1RA 2AHJB 5EEAA 4I9QA 1BYMA 2BY2A 3KETA 2O8CB 3HBLA 3THYA 4LXCA 4M7AF 2CP7A 5DM6F 3DU6A 3VYHB 4DV6K 4HF1A 5GAMg 2X1DA 4FE7A 4IEJA 3WT0A 3QEVA 4DTPA 2R7UA 3CCQN 1UE9A 1VQMQ 4AHCA 3FHFA 1OFCX 1P90A 2H3EB 4LY7A 4OPKA 4L5EA 4H4KC 2HSEB 3VWBA 3OY9A 1S72I 5LEJA 4IRIA 2L3SA 4RTWA 1U0JA 3KK1A 3OIQA 4RW8A 4I2OA 1N9RA 1SEUA 3HEFA 2W41A 3CCEI 2F5KA 1TSFA 1D5YA 4HTUA 2X6WA 4N9IA 4BHCA 4N56A 4BRHA 3WE3A 3H0DA 3CWAA 3LSMA 4ZDLA 4K25A 1LWEA 4ZDOA 3ZSRA 2G0EA 2XRNA 4XQ3A 3NQOA 3O4NA 4LN2A 4XKBA 2D6FA 1P2FA 1WYXA 2RQUA 2KT1A 4XN3A 2XDPA 3EHQA 1S6QA 3ML6A 1MMAA 5EOYA 3WXLA 4LG0A 4ZJZA 2XHKA 2FBTA 1Y64A 4JDSA 3IG1A 1KLMA 2EFIA 4FWLA 1WJ5A 3BDPA 2WSFE 2A69F 3WNGA 2F4IA 1IJJA 3MEXA 1X4OA 2V9PA 5KYNA 4RCHA 4A5BA 4DR1K 4CC3A 2DVEA 3V8KA 3N5NX 3CPWM 1TV6A 1WJFA 1RDCA 1SKWA 2H09A 4EMSA 1JO8A 4KISA 3QYHB 5D4SA 3S15J 5FJ8J 3W3DA 5FLVA 4M7AB 3VEWA 2YWWA 2VG5A 4PK4A 1V3FA 5E20A 3BQZA 4BR5A 4W97A 4MDXA 3HZJA 2LMJA 4F9OA 4YDUA 3WXKA 4BQQA 4LFUA 2L89A 2XKPA 4A4FA 5I42A 3QP5A 4XH1A 1A5VA 4EP5A 3R8EA 4UV9A 1GUUA 2Z1IA 3ZFJA 4OFHA 3KHYA 1WPYA 4HUEA 3GF2A 2PU9B 3C6UA 4FSXA 3LWFA 2HYGD 5AQZA 1RTDA 1OZ2A 2E6NA 3G1OA 1I8FA 1SVLA 2XY7A 3R6OA 3K4KA 1BISA 1WCMJ 5FROA 2I7NA 2OI3A 4CYCB 6AT1B 1MWMA 3H3NO 3ZMZA 4ORZA 2EIFA 1M90R 2J5OA 1PM3A 3CFOA 4FWKA 1LOTB 2M87A 1V5GA 4HA8A 4NB4A 3EAEA 2NOJB 3DLLA 1ASWA 4JPBW 1ZLMA 1KQ9A 3HTRA 2F6CA 4ZYDA 4V2FA 2HZTA 2I0NA 4IXAA 2HDDA 1RT4A 1W5CC 3JAME 5FU6C 3M8FA 1Q82R 2LC4A 4OIRF 3CQYA 2KXDA 2UWMA 4KTWA 2A40A 2LQ8A 3J7AF 4HSTA 1IKVA 2EK5A 3QFUA 3G10A 2VQGA 3LCNA 1M1KO 2NVYJ 4D6WA 2ZJPL 5HLHA 4M7DA 2RI3A 5CJ9A 3VQEA 2MABA 3CEYA 2V1DA 5LEKA 3QWLA 3J7AO 2PJPA 2EQKA 3JCMd 4RM3A 2L9SA 1DKGD 2LR8A 4NL3A 5CR4A 4R1HA 2HXIA 1VQPT 3FZMA 4TV7A 4M78C 5FPNA 1S72A 3QYEA 1YIJN 2HOTA 2IVMA 3MWTA 2XGXA 2E41A 2ID3A 2M9HA 3FDRA 3ABTA 3T9NA 1OYXA 2YUSA 2LYCA 3CCEA 2R7WA 2YT6A 1IV0A 3LWIA 2GFAA 2QWMA 2Y4XA 5T7BA 1D09B 2F1LA 2QBYA 2YUOA 3EKUA 2BZTA 4JD2B 1IC8A 1NM7A 4RG8A 1YS7A 2DTOA 2FBHA 2GA1A 5KAFC 1T0FC 3V9XA 3FE1A 1ZGAA 4KHQA 5CVRA 4S0HB 3OJUA 1SL0A 4CJ3A 3SQ0A 3PM1A 2V52B 4D5FA 1WNSA 2E3HA 3LAKA 2DOAA 4OOIA 4X0GA 1BI0A 1C1CA 5IH2A 2E6ZA 4U88A 1SV5A 2OTLN 3RQ4A 2O9LA 2HVIA 5K7ZA 2VG7A 4PFZA 3HSBA 2DT7B 4H5VA 4MZPA 3CCQA 3LDQA 1NGJA 4JI4K 1T56A 3OHRA 1KVAA 4M9XA 2ZJPF 3IAYA 3FZFA 2CKKA 4IHSA 1X27A 2MG4A 4K43A 4G7ZF 1NLOC 3A02A 4U0WA 3MKYB 1WSJA 4KRTA 2ZBKA 1Q9YA 3LWLA 3HO1A 1S8NA 2HEQA 3QPSA 4BGDA 5AN4A 1S72Q 4KH4A 4I02A 4EM1A 4O5FA 2CZ1B 2VONA 1X3ZB 3J81K 1NKCA 2Y9ZA 4M45A 3CCEQ 3KZYA 1QP3A 3J80E 2KSSA 3QPLA 3A4CA 2HHXA 2V9VA 3IMXA 2FSJA 4CZHA 1ZSZA 2Q2RA 3F0ZA 4L8RB 2ZE2A 3JRHA 2DERA 1PU7A 5FKOA 2OTJT 3KLGA 5HODA 2KI7A 4A2AA 5CKBA 2A42A 1W0HA 2NNYA 4I01A 2OTLI 1TT5B 1ZBXA 2MD5A 2P9SA 4YPHA 3MEWA 3PNWC 1SFEA 4AI4A 4RKUE 2ZCWA 3EFOA 1R23A 2DXCA 4CEAA 1OPKA 4PUOA 3VEYA 2HHTA 3NVKA 5FKKA 3ROUA 1G15A 3JCMc 1L3VA 3JRFA 3V4IA 4M3EA 2O8CA 3SYZA 4NOYA 5BN8A 3CCQQ 3E01A 3IUCA 2R7OA 4G1QA 2IG0A 2HOSA 1HKSA 1HSQA 3C6HA 1R71A 4B1VA 1NJIC 4HV5A 3G73A 2XROA 1IHVA 9ATCB 5LJ5d 1FW6A 4JI2K 2RQRA 4EATA 2CDTA 1F9NA 2V8IA 1NU0A 1YJ9T 1VYTA 2W03A 2RHIA 3GWZA 5C44J 1T3VA 4IQJA 2E36A 4FJ8A 5F27A 3J7ZO 1HSTA 3LP3A 3VS6A 2FU4A 3FXLA 4I6MB 4DTOA 3HTVA 4FWPA 2ZZDA 5EY4A 3CPWS 2BDPA 3R2XC 2E2HJ 2X48A 3A8OB 2Q0RA 1IG8A 1W2BM 2YSRA 1T2KA 4CK2A 1KAZA 4RCCA 4JBAA 1AZEA 2MLGA 3BCBA 3HRGA 2VWKA 1SAXA 3NGYA 1IH7A 2KLAA 1TVRA 2LMDA 3OJSA 3O8VA 5BRHA 2JGUA 3VYUB 1GHCA 2LZ6B 5IYBJ 2HKQB 3OA9A 4XR6A 3HXMA 2F4MB 5HS7A 1FSEA 4HQMA 5GMKl 3JB9H 4C9YA 5F64A 5HRSA 1JKOC 3LLRA 2GZWA 3VQPA 1XNRK 2A36A 5DUKA 3RPUA 1VQ6T 1IHWA 2H94A 2LVSA 3RWUA 3JRAA 2F5DA 2QQ8A 5IT9E 4DTMA 4BL0B 4BH9A 3ZLJA 3MWMA 1JCEA 3T5XA 4E1NA 4EGZA 1T8EA 1U3EM 2WFBA 3EYIA 1BL3A 4BC2A 3JCMP 3UWNA 3BDUA 3KTUA 2KY9A 2D0OA 4B4CA 3K4NA 2QWLA 4BUGA 4DIQA 3DEUA 3V7CA 2AQEA 2ASOA 3UDCA 3HPHA 3H0FA 1WSEA 3HP9A 4OMLA 1TL8A 5FWCA 4ID5A 2HGCA 2ECBA 1OV3A 4GNIA 3PNVA 1GL5A 2IA1A 4YTLA 3FZLA 2YJFA 2LSNA 2OX7A 4J5YA 1QVGA 2F7TA 1FJGK 1VQPN 1PVSA 5GAMd 2NUBA 1WZ2A 1QCNA 2YNIA 5HLFA 2FEZA 4DEXA 4LD5A 2KRSA 5LJVA 2HKOA 4AIKA 1VQKN 1TL1A 3VTHA 2W42A 2CV1A 1Z6RA 4LSLA 3SZGA 1H9GA 3P8DA 4LIUA 5K5QA 2NRTA 1G5VA 2MWOA 2OTLA 3ZX0A 3HG9A 4FLVA 2A3ZA 4KTQA 4G12A 2A1RA 4AILC 2JPBA 4XSXF 2LCLA 2J05A 3OIOA 3H5RA 4BRAA 3BE3A 3LSIA 2D8HA 2J4RA 4DFPA 2OJ2A 1BA0A 1RTJA 2ZXWH 5JLXA 3BPXA 1VIFA 3U2RA 1M9SA 2NOHA 2ZD1A 3OV8A 4MLHA 2IAIA 3G1MA 5IY5H 2H6CA 3RMBA 2D1KA 5D7UA 2L2OA 4UUVA 3ZN0A 4DQQA 3GW2A 1KHCA 3Q5FA 3O3KA 1KEAA 4LDXA 3ZQFA 2JN6A 3OSSC 1TK0A 5CK9A 1Z6TA 3T8TA 3JCMh 5GINA 3RYRA 2DU9A 2RB6A 3MX5A 4KUDK 1S29A 4UB8C 1VQPI 3KK2A 3EG3A 2B9SA 1VQ8N 1XQOA 4MEXF 3NARA 1K83J 3SZPA 1PUEE 3W6VA 2JVGA 3E6CC 2VWBA 4JKAA 3C6AA 2W0ZA 3L1PA 1XCVA 4AHRA 5J3BA 1ZBJA 2XKOC 1RFQA 4M7AE 3IL2A 5JI6A 2DA9A 2FBVA 4C2UA 1FBUA 2IGKA 2HDWA 4KBMB 3M1FA 4DV1K 3SLCA 5ECAA 2MLKA 4CBUA 3JCMf 3G4ST 4CFAA 4HZFA 1RKTA 3ZOBA 2NS7A 1NJIO 3VA0A 3GFMA 5JLHA 5K5OA 2OTLQ 4XKCA 4C0DC 1FT9A 4DQRA 1WOQA 3QERA 4J6WA 2XB5A 4FWNA 5E3NA 5K1YA 3AO1A 3QEXA 1K9MO 2JA6J 2OUMA 1FMKA 2E5LK 5DUIA 1U5SA 1X58A 3ZQCA 3KEOA 1OOTA 5J2MA 2OTJN 2KJBA 3DCFA 5F0CA 4DQ2A 3SMPA 2RPNA 3COAC 2DIQA 2K4BA 1W97L 4DSIA 3DTIA 1UGPB 3SDBA 3MAQA 3BFMA 3TEDA 3DRPA 3VGKA 4BRNA 4BDPA 2MSYA 3OB9A 4OB3B 2BTTA 2RPIA 3AVAA 4CIFA 1SKUB 2JS2A 3BDLA 3J7ZI 3FX3A 1HX1A 1CZBA 2DXIA 3GTPJ 1QA6A 1RT1A 5I2MA 1L3SA 4HVWA 3PVLA 4A3GJ 1Z9CA 3CP2A 3AVFA 1I1GA 3I55N 2CUFA 1JJ2M 1RAHB 3R61A 2P9LB 3LSHA 3JAMK 1SKRA 4HNVA 4CZIA 5GAN2 4B9WA 1KAXA 2D2WA 2RD1A 2M9UA 4C3IJ 3DPTA 2SEMA 4JRPA 5GAN7 5C2DA 3EY1A 4A3CJ 3OYBA 3UIQA 5L3BA 2X74A 4MNUA 4HF2A 3HFNA 1S7AA 1E3PA 3TP0A 1WEFA 1TKZA 2HBLA 1YJ9N 1F4KA 2AXTC 2UU9K 3VRYA 5CZ2A 3E5XA 2ZPFB 1NOYA 3NBPA 3BG6A 1TTYA 1DPUA 1CF7B 2DE0X 4RMNA 4G8XA 2B4JA 4UB6C 5M5YJ 4V2SA 1ETWA 4AG1C 2NYXA 4DSJA 3S32A 1QHGA 4BRKA 2L5QA 4CYDA 3V81A 2KDSA 4E47A 1N8RC 1W4SA 3IHOA 4MDBA 4HBLA 1KHIA 3SCXA 4NB5A 1NJZA 3EYZA 3HSTB 4HNUA 1M90U 1TP4A 1IZ6A 2ZPGB 3JB9I 5C3EJ 3NH1A 5FPMA 3WGHA 1NTCA 3KLIA 2K2VA 2XAJA 2HQEA 3OSVA 3HBTA 8AT1B 2CG4A 2KQRA 3UPUA 1W2BS 3K2PA 3UKUA 3F2KA 1NG6A 4UC4A 3VYGA 3E1SA 2PY5A 2E3IA 3FRNA 2A3SA 1Q82U 3EUKL 4CJ7A 1J75A 4DZPA 3THVA 4CCLA 1VQ6N 2E1OA 4GW6A 5BR9A 1U2WA 1YJ9I 1FN7A 2E64A 1LE8A 3VQ7A 3D6RA 3M5RA 4NCAA 4GY5A 1JLFA 3S17J 2KRCA 3RERA 3OSFA 5DLOA 4DU1A 1VQPA 5CYQA 3UKGA 2L3DA 1K61A 4AQYK 2KQ2A 1HNWK 3WTYC 4YY3K 1ZR2A 3W6JB 1BUPA 1Z25A 2DTUA 2IDOA 2Z0WA 2Q0OA 4LE9A 2XY8A 3U9DA 2VQEK 1VQKA 3EETA 3BTIA 5K7FA 1N5ZA 2O88A 4CCHA 1RT6A 5BMZA 1TBXA 4R8HA 1CSKA 3G3ZA 2PTKA 2ELHA 3DPUA 5CKEA 1WRJA 2VXDA 4CZKA 2F9TA 2XHBA 1KFDA 3V9WA 4CCMA 1HA8A 5FD6A 2OFIA 1JU5C 3MDQA 3QIIA 2LTPA 3TW6A 1DTTA 1IGUA 1QCFA 1U5TB 2IS2A 1UZCA 3M59A 2ISZA 4O5BA 2FL7A 2BV6A 1P4WA 4QQGA 1B9MA 3H08A 2Q2EB 4LDUA 2WBMA 2K79A 2RO0A 3QOEA 2NRVA 4A4EA 2VGMA 4F17A 1TC3C 3FZHA 3GOXA 2DK5A 3JCUC 2ITMA 5AQWA 3TAPA 2OJED 1VSEA 1VQ6I 4O8UA 5TGTA 3R4KA 1YX5A 5AQFA 3G0QA 1BR4A 3EG9A 5LGNA 4EGYA 1QVFA 1WZOA 3S14J 3CCJN 3OS1A 5HNFA 1VQ8A 3QPHA 5HNHA 2OC6A 4CDGA 2GAUA 1N6AA 4JI5K 1HXDA 2NUTA 4F7UG 1RDDA 1VQPQ 4L5JA 4NDLA 1X6GA 4C8KA 2R92J 3D5SC 1EQYA 3H9QA 3TR8A 3I4NJ 1HQUA 4E70A 1Y96A 4U87A 1IBMK 1R59O 1R22A 2HQRA 5FO5A 1VQKQ 1NHAA 3RQIA 3A01A 3LPTA 1DDNA 5J8CA 3HI0A 3VUBA 2RN2A 1N39A 3KYLA 1G3SA 4A5NA 4FYWB 2XC7A 3M7GA 4C1NI 3T1BA 2W84A 1OCPA 2OTJA 3I64A 4CZMA 1SUQA 1KTQA 4M78A 4ZTJA 2Q8KA 4OPHA 2E19A 2KIUA 3KUFA 2E2IJ 3LFKA 3BR0A 3GXOA 4MDAA 5IHNA 4MGRA 3SHFA 2EQIA 2I10A 2YCHA 3SQ4A 1N77A 5KYYA 1R8OB 1PUFB 1D9FA 1HNXK 1JJ8C 4FJNA 3M4YA 3SAGA 3S9HA 1XDSA 5GAMf 2QM1A 4HT8A 1BW5A 4W1UA 4OB1B 3M9QA 1BN5A 5BPNA 4AUXA 2EFPA 4IZZA 3WHCA 3I55A 1QMCA 4CZZA 2D1VA 1NGIA 2FOWA 1T0FA 3TBIA 4AM3A 2DJNA 4F16A 3CCUT 1FLIA 1MKMA 3CTAA 2KEAA 4PDKA 1VQ8Q 2H8RA 3FMQA 4C0DB 5AZIB 3ULEB 2F8TA 2NXNB 2GQQA 2JK3A 4PFPA 1MBHA 2B86A 2Y4YA 4IHVA 1Q18A 4IHYA 4B09A 3ABLH 1YJ9A 4RDUA 4Z4GA 1R1VA 1VSJA 2RJEA 2PLYA 2A5WA 1W7PD 2K9MA 2A5XA 3WXIA 1WHKA 3AARA 3LAPA 5AIQA 3MN5A 2OZ6A 4RB1A 1RDAA 2VXZA 1O3SA 5IT9K 5HS8A 3M0SA 3QMLA 1MMGA 4R56A 2DYBA 2DXUA 4CJVA 3F10A 5JICA 2K4JA 3KLFA 4CBWA 3L0QA 1SSHA 2ESHA 3ZGKA 4IZ9A 3UT1A 2RNGA 4EZ6A 3O1BA 2HQHA 3TDZC 3IWFA 2VCPA 3G4SI 1W5TA 2EIKH 2OTJQ 1HKGA 2RV8A 4FX0A 2V79A 3HRTA 5D5VB 2KAFA 4GV6A 1JJ2S 4Z94A 4R55A 1X19A 3OYLA 4HEA2 3PVQA 3ATUA 3TKYA 3LQQA 1JT6A 3KJVA 2M45A 1JLGA 2LTOA 1K0SA 2VPRA 4OJRA 4O44A 3DBRB 5FFXA 4NYNA 2A6AA 3LYIA 4KH6A 2WAQN 3QWYA 1WLPB 1PYVA 1M1KR 3DLRA 3I55Q 4M6YA 1OCRH 3VW4A 1AKHB 3GFIA 1VQ6A 1IN6A 2RHZA 2E1HA 4RS8A 2E60A 3C2BA 2CGHA 4CJUA 5E8GA 2E12A 5H2FC 3JCMV 2BGCA 4Q47A 3VQ8A 3FXRA 1YJ9Q 4BXUA 1CXUA 1R77A 2CH6A 3O5BA 1BQNA 2VODA 5A2QZ 2PUOB 3VEZA 4IKFA 3MAJA 2DO7A 2P5GA 3VYSB 5TRDA 3RVCA 3PY8A 3IKMA 3D2EB 3SJHA 4C2MJ 2L7MP 1CF7A 1WJCA 4M3FA 5D8LB 4AFZC 4PKHA 1XSXA 2FBKA 2M0CA 1YTYA 1PRMC 2FG0A 2HVSA 1WN7A 1BIAA 4CK1A 4KB0A 3WTVC 3DTKA 1Z0XA 4DTSA 2EGEA 4XK4A 3W6KB 2EWNA 3DKYA 3H1QA 1OCZH 3H46O 1FMVA 2EYZA 1X1DA 3WU0A 5FLXZ 1FX7A 2HYJA 5BNGA 1NEBA 1NGDA 3P8BB 1VQNT 2HF4A 1JE8A 1Y39A 4OMYA 2YLCA 4B3SK 3PIOF 4OX9K 2RF2A 4BDZA 3S8PA 4RB3C 3ENBA 2KISA 4BBSJ 4Q4ZF 3HFOA 2JUCA 3DEWA 2UV1A 3WTZA 4ME7A 3CCJA 3GCMA 2G6FX 1XI1A 1VQ6Q 1SL2A 4L9TA 2M51A 1WSHA 3CCVT 3P7NA 1SRMA 4ELUA 3ATVA 3U3YA 3DWLE 5AQGA 3VDXA 4CD3A 1PD0A 1DQUA 4FJGA 4ENJA 5IHIA 3M8RA 2EKOA 4PY5A 3V8JA 5B1AH 2MIOA 2DXTA 1YWOA 4LDWA 3ASOH 4PZJA 1H89C 5EYRA 3VODA 4IHTA 1HDPA 1Y8QB 2NLXA 3R3LA 1ZH5A 1LW0A 1KVBA 2XI9A 2VJ5A 3V4GA 5J1UA 4NQWB 3A1YA 4A3MJ 2KR3A 3LSPA 2FF4A 2ROLA 2F96A 1K6YA 3KZBA 1LPLA 1BI4A 3SXYA 1OYYA 1X1PA 1X2KA 5EX5A 1KD1R 1MGQA 2R7DA 3RUXA 4L9VA 3OL4A 3RI4A 1QHHD 2NS8A 1S7OA 1WJBA 1R0BG 4G6TB 2MYSA 5BOXA 1TW2A 1UELB 5CQGA 4DKWA 1TWFJ 5CQYA 5EGOB 3QWXX 4C5GA 1I0CA 2GQIA 1ILYA 1JT0A 2Q2EA 1TUDA 3WTSC 3JCMe 3MEGA 1Y0MA 3CCJQ 1KONA 2M2EA 1IO2A 2LT4A 2DQRA 1XHXA 4J9DA 3DOLA 1GOAA 3CDLA 5GAOm 3PMTA 4Y0WA 3ID6A 3MECA 2NYSA 4JX6A 4M77D 1ETXA 4HX8A 1HKBA 4JLIA 4R5PA 3S1RJ 1IXRC 4BJ6C 1UMQA 1UHFA 5LRSA 4B48A 4QKUA 3TI0A 3E9LA 2YU9J 4HSBA 3N05A 4KJZA 1TAUA 3CCUN 2FVUA 1PVEA 1B9DA 3MCZA 2CP5A 4HHTA 3H6ZA 1MW7A 1LFUP 1OQYA 3QIPA 2O2OA 2IA2A 3HRMA 1WSUA 4CEDA 1S9EA 5J2NA 1XJWB 2RK1A 4N47A 3JW4A 3L2VA 2A6HF 3PV8A 5GP9A 4IOCL 4XTWA 3FC3A 5FU7B 1NZ9A 3PNYA 5CQXA 1KQSM 2Z2SB 2ELKA 1XHZA 1KO9A 5M5WJ 2E2JJ 1F1BB 3PX6A 3VPRA 1D3BA 1OH7A 1JKHA 5K14A 3M53A 4Z4EA 4E6RA 3FXKA 2E5NA 3C4SA 3ZX3A 3HRSA 3THWB 2JNGA 2WAQA 2O4IA 2R7XA 2PZSA 1KA8A 4L5IA 3VESA 1TNSA 1PUFA 3R60A 4NZGA 2DW4A 3IKVA 2Z1DA 1N32K 5AQPA 2XKOA 1PJRA 1XN7A 2EQMA 4I9LA 5CVVA 3MJXA 4G94A 2R5MA 1ENHA 1X75C 4B9QA 2KL4A 2BY3A 2PVOB 2ZCFB 2FE3A 3TOAA 3CPWA 3CCUI 4U0VA 2RHXA 2O7OA 3H36A 1B72B 1RAGB 3J7YP 4BVPA 3KEYA 2GXAA 4CZLA 4RAZA 3F22A 1QNTA 5D6XA 2EHGA 2MWPA 1N6QA 4AIAA 1T95A 1U3OA 1NBEB 1S1VA 1D5VA 5IHKA 3KZZA 4PSXA 5IYCJ 4XRSG 3B6PA 2DLLA 3U21A 2NNNA 1X9MA 3P1GA 4J2EA 4ISEA 5AQMA 1EH8A 2ICWG 3NH2A 2FF6A 2QQAA 1XTAA 1KIKA 4IOCF 3HGGA 5D6YA 1SQKA 4ELTA 1UHCA 3U8XA 3FB9A 2HR3A 4M77F 1HYZA 1W70A 1RT3A 1XNQK 4ZTFA 3AG3H 2VT3A 4Y52J 2QTDA 1HQCA 5GAEP 1JCFA 3S1MJ 3C0BA 1E17A 4BY9C 2YV0X 4OIPF 2RAEA 3QZ5B 4JK8A 3K70D 5LJ5e 3TAFA 1WQ2A 4X9DA 1P92A 4J9CA 3SWNC 1T0HA 1HLVA 2K3BA 4PJ0C 1JLBA 1EV7A 3MWPA 2QA4T 4FASD 4FHTA 1M90C 1AKHA 4CGJA 3WG7H 1VQLT 1VQNN 1MH3A 1ZC6A 2VJJA 5GMKh 3A1PA 1BGXT 4KUMA 5FKLA 3JCMQ 4J8FA 3H6EA 4GBQA 1T08B 2STWA 3QG1A 1Z77A 3BPVA 3LOCA 1Z7LA 4YOVA 3A2KA 4C92G 1A36A 2QZ8A 4KA4A 2PG4A 1LUJB 1XQPA 1Q82C 1QQMA 2OCCH 2L9NA 1RTIA 2QUFA 3CCVN 4Y1CA 4DEYA 1X1CA 3VU3C 1NK5A 1SMTA 3RTRA 3LSRA 4L5GA 3D2EA 1FYLA 1JJ6C 2MC3A 5FD5A 4KH5A 4HX7A 3DEEA 3C7NB 4UUSA 4H5WA 1ORPA 1FTZA 2H8WA 2XGCA 3E6DA 4DV7K 4FE4A 2DA6A 4BRIA 2HBMA 2YHYA 3WQUA 1B8IB 2IS1A 3PX0A 2XU8A 3ECHA 4E7ZA 4AMCA 3OIPA 3S1QJ 2NUZA 2VKVA 4DFMA 3DM2A 5DD8A 3JXUA 4M77B 1EETA 2IW5A 1K9MR 1PP7U 2D0QB 4CJLA 1VQNI 1FPQA 4BU2A 3JRGA 2RJCA 5H1SQ 4RTZA 1BBZA 1E3HA 1A6IA 2HHSA 3M4GA 4RMOA 3CVTA 1RCHA 2VT2A 4MFBA 2RKIA 4QQDA 3QJYA 3TAEA 3CCVI 4IDKA 3AAQA 1DPRA 4RGXA 2QENA 4JJCA 3CCUA 1E6GA 5J1EA 2EGCA 5GAMe 4PJLA 2KT8A 5AIPA 3IV5A 1Z3YA 2WTUA 4K41A 2CS3A 3JSCA 1O4XA 2O4XA 1YVNA 2DZCA 5F2RA 5KTQA 4DR5K 1IGNA 4NLBA 1WFWA 4JJDA 5D8KB 3OMCA 3F9KA 3O9RA 1NMDA 3HHGA 4FSVA 5A2QO 4JV5K 4M71A 3ZMUA 4CZGA 1TS9A 2QEXT 3EGUA 4ESBA 3I8BA 1W0UA 3LZJA 3EKSA 3VJPA 1X9WA 3CETA 1NG7A 4IUUA 1I27A 2JN0A 1NGFA 1HDDC 1MJBA 1ZUKA 3CC4T 4BD3A 4NO7A 1HRHA 2CUEA 4JX4A 1TWHJ 2BEOA 3QYBA 2ME6A 3AAFA 1XSDA 2JVHA 3NWSA 1GFDA 4DJAA 3J80Z 2D0BA 2Y90A 2O8BA 3OSGA 3CF2A 3RKWA 1AWCA 3V1OA 2YX4A 4KN7X 2IVPA 3BJAA 5FLXO 3DFGA 1MJ9A 1NYGA 4IJAA 2DMQA 1JLAA 2OQRA 2YU3A 1KQSS 2E6MA 2BGGA 3SPYA 2Y1IA 2NRWA 3PJRA 1AHJB 4KITB 4CGIA 4F7ZA 3C12A 3CCUQ 2ROTA 2OAUA 1MUYA 4XTUA 3VEOA 1Y07A 4QS8A 2H27A 2QVOA 3TEEA 3K4LA 2YUQA 1QVGM 4JEPA 2Q31A 4QOZB 1TKDA 1K78B 2V6CA 4DMNA 1LOJA 4J19A 4HW0A 3DKXA 1YFHA 2DQLA 1DP7P 1X9SA 2VN2A 4JKEA 2CUBA 1GLBG 1TZLA 4L18B 5CAIA 2YNGA 1J9AA 3KD5E 4LD9K 3PSIA 2RHUA 4HF0A 2KROA 1M90O 3OR2C 1VF9A 4YEJA 3L2RA 3LDPA 4B22A 5CIUA 4BJTA 3CJ7A 3LDLA 2DY4A 4TVRA 1ZK8A 4CZJA 2M0MA 4W5NA 2CYYA 1C1BA 4E7KA 2DBBA 4FL9A 4E7IA 1HJRA 2C0TA 3DI6A 5BQTA 5CKHA 1Q82O 3X25B 2LP0A 3FXMA 2DZ9A 2RGVA 1VQNA 3ZQ7A 3QEIA 5GTHC 2E2NA 3D7SB 3QYGB 2EYXA 1A5JA 4B9LA 3KP3A 1DIZA 1UB4A 5L23A 4BRLA 2GV9A 2LK2A 2H3JA 1WB9A 4PHTX 2Q97A 3CCVA 1B72A 2XF7A 3TO6A 2DJQA 2JXBA 2A07F 4B9SA 3CCRT 4EQQA 2VKEA 4GO1A 2W24A 3J7YJ 3KKRA 4FTHA 1OKJA 4KIBA 3AG1H 4FLXA 1UGVA 4LFCK 1JI8A 2UZKA 4LMYA 4HOBA 2CZ0B 1E6HA 3FFKB 2P9IB 3WNHA 1L0OC 3SWNB 4C8QG 1QCOA 1TG0A 3QU6A 1RDBA 4NLCA 1QO0D 3EG1A 3CLQA 1ZRDA 2FRYA 2KMUA 4EPCA 2ADUA 4RB0A 2ATQA 1XDUA 4C1NK 4XTXA 2CSOA 1ZQ1A 3KKSA 3RJPA 5HRNA 2F2EA 3BW1A 1RBTA 4TSXA 5C10A 4DTRA 3H41A 4HCZA 3IH4A 2R7YA 2EJRA 3AVKA 1IW7F 4CF2A 2ZGYA 3DKWA 1KG3A 4A57A 4XNFA 1M3AA 1VIEA 1MU2A 1RPWA 4ENMA 4H03B 3MEUA 4BR9A 2ZXJA 4ID1A 1SD7A 4OMNA 2D0CA 1VFCA 1ZG3A 5I3UA 4Y4RA 4XAXB 4DF4A 5GAEJ 1VQNQ 1KD1U 1SD4A 2W6KA 3I59A 4Z4FA 1YP5A 3CJCA 5CO7A 4ZN1A 3V6DA 4IUQA 2GA2A 1TAQA 2EBIA 3F8MA 5I9EB 2M16A 3NGZA 3Q9VA 4A5AA 1V4TA 2QA4I 4LSNA 2QWQA 4IRGA 3DLGA 1NJXA 1I1SA 1WUAA 3KWGA 4L9JA 4DYQA 4A3JJ 2JJ7A 1RIOH 3GLLA 3I0RA 1MZBA 1VQLI 1NMNA 3GX4X 1SKSA 3CCVQ 3GVAA 3NGPA 2KZMA 2KHMA 1I81A 3JTGA 1VOMA 5D6WA 5AQUA 2BZYA 1KQ1A 1AVZC 4DSEA 4G6QA 4DCHA 2D0NA 4K0KK 4DBQA 1HNIA 4LFAK 4RTYA 1RBRA 3FSPA 5GAOn 2L3QA 4Z02A 3KVGA 1KLNA 4FU6A 1O75A 1T6SA 5ICCA 2L2PA 5LHIA 2E1MC 2BANA 2E7WA 5AQIA 1FXXA 3NHNA 2M02A 3AAPA 5GAOq 3KLNA 5L8RE 1B34A 2PBIA 1K1ZA 3JRDA 4B43A 2AKKA 3BJOA 2M7BA 3H3UA 1T98A 2JT4A 2K27A 1V4SA 4A5MA 1U9OA 1YITN 1B8IA 2CMPA 3VETA 2DAOA 3EPZA 4B1YB 3BG3A 2Y0MA 3B6CA 1JCGA 4AD9A 2JSCA 3ZCMA 1TK8A 3BJ6A 1RL2A 2HOAA 4JKCA 2LC2A 4M74A 2LNVA 1IJWC 4DOWA 4QTRA 3AVIA 3CMYA 3JYTA 2QEXN 1RAFB 4FOIA 3BR3A 3O3GA 1FBQA 1IV8A 4IXCA 3L42A 1JXMA 1MA9B 2DD5A 1J54A 4CZCA 1M3CA 5E3MA 2FNPA 3F6OA 2DF6A 4FW2A 3NGIA 3OR1C 2ZPEB 3FK7A 2QTXA 4PQUA 2L4AA 2K4YA 2EFOA 4XQFA 1IO6A 4ZZDA 4IEEA 1NKEA 5JLWA 2E70A 5AQNA 5AQKA 4YELA 5FWBA 4EAHD 4V19S 3S93A 4CF9A 3UF4A 2LJ0A 3AHUA 2M4KA 5E84A 2CUZA 5E1WA 4LG3A 2DA2A 1HR0K 1HKCA 1JJ2A 4MO4A 2X35A 2P0PA 3LM9A 2V75A 3SYTA 3A0HC 1J9IA 2RNAA 4OMMA 4HTLA 4N41A 1LEAA 1S5LC 2QQSA 3T1AA 3BF3A 3P31A 1Y97A 3SQ2A 2DVJA 3WQTA 3R6MA 5ILSA 2LRDA 4CD1A 4QW2A 3HM8A 2DPDA 2QEXI 5GAN3 3V8LA 1KK7A 3D7EO 1IN4A 3L00A 4D7NA 4DTNA 4WF2A 3RDVA 1G6NA 2QM3A 3L6QA 3RRGA 4XLNF 1KU7A 4WFNL 4A3EJ 1Z9QA 4CHYA 4CHUA 4Q5WA 3CJ9A 3CC4I 4CH7A 1UGQB 4EMKB 3WUHA 1OR7A 1IDYA 2YG9A 3MMVA 5GMKi 3RMCA 1ETVA 2DJZA 1A0NB 3GG4A 3IP4B 4D9JA 3RSEB 4KGXB 2WUSA 2VOOA 2K02A 1GXPA 2E5QA 1TU0B 1UA1A 2F4OB 3SUNA 4LF8K 3PFYA 3CF5L 3KP5A 1X2MA 1PSEA 2D5VA 2BE7D 4E7HA 4UHTA 2NOFA 2VOPA 4CHQA 4H0EA 4PJOD 2HEOA 3OW2P 4JZ3A 2ZQBA 2K86A 2HOEA 3H8ZA 4M77E 3QESA 5KRTA 3GTKJ 2BYVE 2RC4A 3LNQA 4FLTA 2VI6A 4MMKA 4M6XA 2E1NA 4B9UA 1NK7A 1U06A 3E5UA 2XK0A 2HVHA 1K78A 4IURA 4CECA 2FQ4A 4UUTA 1OEBA 2BW3B 4BI4A 3ZN1A 4XU1A 4XU3A 4B3RK 2JWKA 4A4KA 1TWCJ 4EDUA 3V1QA 1RRQA 4BUPA 3SD4A 3CCRN 3GOIA 3KFVA 2ED1A 3TANA 3GIBA 4QPOA 3GTLJ 4CGFA 2FSNA 1UHMA 2DODA 1XB4A 2LREA 2KE9A 1VAZA 2LVMA 2DTRA 3CQTA 2W10A 2M0OA 1YRNB 4HUFA 3EHRA 1MJAA 3X2QH 5M3MJ 1I4K1 3PO5A 1QZZA 1VRTA 1P7IA 1O7FA 2XASA 4QIWN 3LA7A 1PC0A 3E19A 1K8KB 1EA3A 2X85A 1XQHA 5BPDA 5GMKe 2XDBA 3FLGA 4K2EA 1I3QJ 3DXJF 4UVAA 1MBFA 4OKEA 3WNEA 4LLGF 3NNQA 3NH0A 1QWFA 4CJ4A 1C0TA 5GJWB 2FEIA 3TDUC 4C92D 3N97A 1AU7A 2YNFA 4K8ZA 4GV9A 4NS5A 1J53A 1SHGA 3CF5F 3J80O 1N75A 3MZYA 2KYMA 3TSWA 1RAEB 4PKIA 3HSEA 1U49A 3FJ5A 5HRPA 3DKMA 2HU9A 3LH0A 4JRKA 3FFIA 2GX9A 2HTJA 1OPCA 3CCMT 5HLGA 4I09A 1W7AA 4UOBA 5ERIA 2A0FB 3B8AX 2G8WA 4OLAA 2XPUA 1ZYQA 3TO9A 1O3RA 1JUMA 1Y71A 2D1HA 2H8HA 1J5YA 3AV9A 3NHGA 1S9GA 2W82A 1AHDP 1ZLJA 4GYIA 5GAN4 1N3CA 3SWNA 5IP7J 1H9TA 1BK2A 4O3MA 2W4SA 2AZSA 2ZMEC 2L01A 3GTMJ 1DP3A 1TUUA 1VA7A 1YITA 1OULA 2YNHA 3O9UA 3CCYA 1QSYA 3MZHA 4XLPF 4JKDA 1ZBLA 2EZLA 5GJVB 2YX7A 5DK5A 1R5GA 4XK8E 1BI2A 2YRCA 4KHNA 4KIFA 3MHXA 2RQVA 4ZGEB 4KKOA 4BXXJ 1W36D 4BQZA 4M7AC 1K4US 4BI8B 2A28A 3HT3A 4XSZF 3SV4A 3CCST 2QEXA 3KP6A 3GL1A 3L3VA 4KIGA 2CQ7A 4E9HA 3VSKA 3IQLA 3QZ9B 3H1CA 4FJIA 4WFAL 4PJOF 5K5RA 1Q1HA 2FPEA 2Y48A 2JOYA 1K9AA 3MN6A 3GF5A 3ZPLA 5KCOA 1TGOA 3VS1A 1BWFO 5C24A 4B1UB 3MP6A 4GRIA 2CZ7B 4KMUX 1YCYA 1VQ4T 1OJLA 5F08A 2CGLA 2DL7A 2ZB9A 2ZM6K 2DDAA 2W85A 3VGMA 4FQGA 3CJQB 3ZT3A 1ZGWA 4BACA 2VQCA 4DZJA 4II2A 4JK7A 1Q7YR 4IRHA 5JVGL 3DLMA 4F14A 2BBYA 2ITGA 5D5WB 1I5ZA 1IREB 1XUPO 3CO7C 1WSIA 3KK7A 1K4TA 4HDVA 2PUKB 3L2WA 3A5LC 4I76A 3QBXA 5FLXE 3K4CA 2QCOA 2STTA 1OU9A 3OYCA 1UDLA 5KE2A 3G6ET 3K4JA 2DL4A 1KSPA 1TUGB 4LF4K 4DB3A 2ZNYA 3ZSOA 2P9NB 1T33A 3ELKA 1YITQ 5TKWA 1BW6A 1WJDA 2QF7A 5AQLA 4FCYA 3NE6A 3GBGA 4ZYAA 4C92F 4M7DG 3O80A 1LMZA 4HQEA 5KGXA 1RUOA 2QDYB 5HRRA 1YLFA 1RACB 5DYMA 2QEXQ 2K5FA 2NWMA 3VYTB 4HDUA 3F6VA 5E8IA 5GANg 4CIEA 4OF1A 2LNBA 3KP2A 3CC7N 1BL0A 2KFZA 1MDUB 1E2XA 3SV3A 5IPAA 1H3ZA 2E4HA 2VWFA 3CCLT 4PJOB 5GMKm 1WH5A 2K3XA 2D5RA 3GBQA 3SZ2A 4IDHA 4M3XA 4MLEA 1FIAA 1XMKA 1BOBA 1DT9A 2OZMA 3L4QA 2DXBA 3SI6A 5JVTA 1DJ7B 5DM6L 4W5TA 2YHBA 1C6VA 4M75C 2WBNA 1YX3A 3F8NA 2DN0A 1PRLC 4KREA 4P1WA 3CMET 1XMAA 3Q7BA 3IC7A 5JVGF 4D1QA 3ZEUB 2KW4A 2XRIA 3VF6A 1KZHA 1ZAOA 2QXFA 2BUDA 3ECOA 4FM4B 3M9AA 3L8BA 3S1NJ 2OPSA 1QVTA 1IG7A 3GBTA 4BBRJ 4H0XB 1NLPC 3BTLA 4CF8A 5AQVA 3CCRA 4JS4A 1A35A 1JLEA 5KYWA 1JXBA 4YHHK 4ENKA 1TLHB 3H3ZA 1ZA2B 1M1KC 2BZXA 2OA4A 2OF7A 3S16J 2FO0A 3FBIB 3GUDA 1LW2A 4YFNF 4AF1A 2VC1A 1YQRA 1ZBUA 4XEIA 4LJZF 3VUZA 3F21A 4DA4A 3THXB 5LFAA 2COZA 2HQAA 4I0AA 1YF5L 5LJ5j 1AA7A 1X43A 4M3YA 2DKGA 3D0PA 4ZGJB 3SMSA 2NRAC 5I22A 3ZT2A 4R79A 4M6VA 3MN9A 3A0BC 1C0MA 1J5OA 1GCPA 4IFYA 2RHKA 2DM1A 5AQJA 3OOPA 1O3QA 4F2SA 1RILA 4H8KA 2O01E 3RSEA 2DTIA 5F1XA 1TWGJ 4EJOA 4PGGA 5KGWA 3WVDB 5CY4A 4XOPA 3OYYA 1Y7XA 1W1WE 4EJWA 4W5OA 1VSKA 2K7AA 1RABB 4Y15A 4JRIA 1T7PA 3E3VA 4C8QD 2ZAEA 1BB9A 2QWWA 1UTIA 5HVQC 5LMNK 2K3PA 1ARKA 3AFHA 3W2VA 1IUFA 4RM2A 4GFBA 3CCRQ 3MVPA 3RKYA 4QVZA 4F2RA 3AVHA 2NUPB 1KG6A 3ENHA 5AR0A 3T7ZA 2FNAA 3BR6A 1N25A 4WCGA 3CHWA 3KFWX 4XH4A 2P84A 4FETA 5EJCA 2FPFA 2V9KA 2DFHA 1A04A 3CCMN 2DILA 1UJYA 3RRHA 3LWHA 1FC3A 3AA4A 4LUEA 4JKHA 5HLIA 4KI4A 3PUFA 3KXTA 2DLPA 2P9PB 3RZDJ 1XGMA 3U1KA 3O4QA 2HL3A 1D0YA 2DL5A 4N4NB 4DHYA 3NCIA 2MBFA 3K0LA 2C06A 4OGCA 4FJMA 5ADXH 1P7JA 2F5CA 1FOWA 1QKWA 1D1BA 2R3SA 4CFCA 2CU7A 3C6TA 1G8XA 1ULYA 4JX5A 4B1ZA 5D3GA 3CCSN 1JLQA 3UR3C 2ZMEB 2CV2A 1ETOA 1GOBA 4ZN3A 4CJFA 2HZDA 1REVA 3AO2A 4XU0A 1KD1C 1ZARA 4RAYA 4CJRA 2P0WA 2VB6A 1F21A 1ZUYA 5GAMj 3BY6A 5EXWA 4D5CA 1OLTA 4M63C 3D2FA 4KO0A 3ISNC 3TO7A 1HD3A 2O0YA 4IUPA 1VQ4N 4UVCA 4FOEA 1VYVA 4AVPA 4ELYC 2BY0A 1SG5A 2LY1A 2CGPA 4JI3K 4KNYA 3JV3A 3S3OA 4AHVA 4C0FA 1JL1A 1UEBA 3CCMI 4HCCA 2FOKA 3MEDA 3VA3A 1AOJA 2K3YA 1UAXA 2CT3A 5K7HA 3AVCA 2A08A 1L3TA 4Q0BA 1X3NA 3DYAA 5LMUK 2DX1A 5AQQA 1VQ7T 4M75F 2A5YB 4FM0A 4GY2B 2IP2A 3TSPA 1N33K 4OMZA 2HVRA 3M5AA 4L59A 4RTTA 1MMNA 3OYGA 4ZDPA 1Q86R 2C6YA 5AQSA 2CV0A 4OB0B 2HTSA 4XICA 2G8UA 3Q3SA 2YPRA 4KB1A 3CC7A 1F1ZA 4J83A 2KNBB 3SEZA 3VQDA 4BR4A 3TPQA 3QDFA 3CCSI 3S2WA 2ABKA 4C8QF 1FSHA 3VS2A 1KRPA 1EXQA 1KQSA 1J2XA 2A6TA 4Q48A 4XKVA 2VBXA 4OAYA 4J9BA 5KN9A 3D45A 2LCSA 2DA1A 3IKTA 2DRKA 3SEQA 1I5OB 4HCBA 1QZ6A 1IG9A 1NK3P 1ITYA 4IHWA 3NMUA 1NNEA 1NGAA 2RF0A 5KPRA 1VQ4I 3WU2C 2A05A 2XPWA 1MMSA 1T3LA 3ZMTA 4OMOA 5H6QA 2EPDA 4M3RA 2LOOA 1DGWY 2RQQA 4OKJA 1BIUA 1D0XA 5BS6A 1N78A 1MUDA 1HJDA 3K1PA 3SAFA 4CJWA 1M8VA 2QKBA 1GXQA 1I39A 3LDSA 1YBYA 3CMEN 1OVQA 2WACA 3G6EI 1VQ9T 4M73A 2P9NA 1ZQ3P 3AA5X 5JR3A 1KC8R 4DBFA 3A2FA 4IFVA 5IYDJ 3R6NA 1IKWA 4UY8O 2JHJA 1YTUA 4A3FJ 2VJ4A 4M75B 1WJAA 3CC7Q 3MZ8A 1YWPA 3Q7CA 2KT0A 1TYQB 3RR7A 1Y1WJ 4NCBA 2AA4A 3P9KA 2XSDC 2IVWA 3VGLA 3CWSA 4FPBA 3N4QA 2V7FA 1WJQA 1MSFC 2UXCK 4BI3A 2HS5A 3MKZA 2JUFA 4JKBA 3HOWJ 3K59A 4C8QB 4UQGA 2XAQA 1KQ0A 3WTTC 4ASNA 3CCLI 3F72A 2IT0A 3O6WA 2ACJA 1RAIB 1ABOA 5BREA 3H3OB 5IOYA 3MX2A 5CVUA 1TOVA 4H0TB 1A6QA 2FSWA 4BGAA 2JRTA 4UNOA 1BU1A 1YNZA 1S1UA 1OYWA 2DMTA 3QNNA 2WSEE 2JTFA 2LLKA 3MD2A 4FIBA 2ZJQF 4LF5K 3VQ9A 3CMEI 5KYUB 5A2QK 3ESWB 1YFNA 1QKXA 3M57A 5FPEA 4E7JA 1VZ0A 5CYVA 5FGMA 4P9FA 3W0LA 4EMGA 3CCMA 1ORNA 2P0KA 1QHAA 2B6AA 5LJ3g 2YHAA 3Q9SA 2LP5A 1NLVA 4WK8F 4QVCA 1S3JA 1BG3A 4J7FA 4KV8A 1F5TA 2A1SA 3TQ7P 2HQXA 2LSOA 1P6RA 3F23A 2FBXA 4C5IA 2O8KA 1UHSA 5GAOp 2A7YA 4OINF 1FK9A 3O9TA 2KIMA 5LHHA 1T03A 3MCAB 4YDUC 3SHWA 3EUHC 1EO1A 2QQ9A 3JTHA 1KD1O 2JQ7A 2ECCA 4CHOA 3VYRB 4N0BA 2EX3A 3P39A 3HYFA 3TOBA 5FLXK 5M5XJ 4GVEA 2B0LA 1FYNA 2JW4A 4QS7A 3CCSA 4KGZB 4BE0A 3HOVJ 1YVUA 2JWTA 1FYKA 5I11A 1LKXA 3EE8A 3TREA 2XGDA 2GNCA 3DV8A 2G7HA 5HCKA 3RKQA 2MPXC 5DM7F 5LGTA 4KYWA 4RGRA 2P0QA 5F0FA 1RLQC 1G83A 2FXAA 3LFUA 1ZBFA 1UA0A 3LM2A 1VQ4A 3BR1A 4U7DA 1K76A 1XTDA 2P4RA 4JHDB 2VUBA 4KT0E 4A2UA 5KPZA 3K5LA 3LAJA 2XD0A 2CS7A 5GANd 1Z26A 3DLHA 5F04A 3MKLA 1K9MC 1TH7A 2GWRA 2Z1HA 1WSFA 1B6AA 2Z9OA 4A3LJ 3CCMQ 4PJOE 4Y13A 3V1RA 3QEWA 3M4OJ 3KLEA 2NUPA 1WHHA 2COMA 4LF9K 1Y56A 3VEXA 2F5FA 4XLEA 4QCLA 1Q7YU 3HOYJ 1AWWA 4N0AC 3VEPA 4B9MA 5IAYA 2NLUA 2QQBA 2B7EA 2EVRA 4CBXA 4XRFA 3WG9A 2DFUA 2W1OA 4NL2A 3HHTB 2LJ3A 4IO8A 4PUSA 2WY7Q 3QUIA 1M27C 2W00A 2KXCA 2L0AA 4MDWA 4M7XA 4WQ4C 4O5VA 1V1CA 1N27A 1YJWT 2Y30A 5HP1A 1VQ7N 3VS3A 2VBZA 1XG1A 4DV2K 5GPCA 2FRWA 5HK3A 3CCSQ 1A5XA 3QQAA 4M3ZA 3E9PA 2KHOA 4RTVA 1VSHA 3O9QA 3IHUA 4DSLA 3L1AA 3KIOA 2HVQA 4JS5A 2VG6A 1M2VB 2E4LA 4CW7B 5F0XA 2ZMEA 2E88A 3I0XA 3O3HA 4RAFA 4G7OF 4JRQA 3LP0A 4MZMA 1VQ4Q 4EJZA 1I94K 2I5WA 2K9SA 2NVQJ 1KSWA 2HBJA 3NPFA 4M7AA 4AHUA 3QIOA 2RVCA 4LOCA 3MEVA 1J5EK 5KQ8A 3CMEA 4DTJA 2AKLA 1U84A 4FXDA 2XRLA 3FGUA 4EHTA 3K9KA 4M7DD 4N4HA 2JZ2A 4ZYEA 5L3EA 3NF8A 4B3OA 2FUG2 1A5WA 1BM9A 4UY8I 1U5TC 5EG0B 3PSFA 1VRLA 1OKRA 3VQBA 2DFIA 5ED4A 5SWMA 1VQ7I 5M1QA 3DLLL 3KE2A 3ULQB 1VRUA 4B3AA 2P9KB 2X3XD 1JXSA 4Y17A 2HAXA 1JB0E 3WVEB 5LGUA 1AWOA 2FZGB 4BNCA 1E3MA 2EFNA 4CYCA 3VB2A 3MO8A 1Z1DA 1VQ9N 4BXFA 4QPQA 2WOMA 2L54A 5FW9A 4CXFA 1LNXA 1U45A 2IAJA 4A2BA 1XMQK 3AGRA 2XY5A 3THYB 1BJAA 1IBKK 5ADXA 4IL6C 2PMHA 3VS0A 1GVDA 2Y2ZA 4HAMA 3RDIA 2D4WA 1X3WB 3HOSA 3ERMA 4OVLA 4HVJA 3L9FA 4C30A 2CP0A 2DRMA 3EE9A 4IG3A 2OV7A 4EIKA 3Q0VA 4Y3OA 1GV2A 1V4RA 4CFBA 2VC0A 4LITA 4LIVA 2CQXA 3VQ5A 4RG2A 4AI5A 4HXJA 4CGDA 3I0WA 3CMEQ 3UA6A 1ZX6A 4M78G 4JOMA 4PL6A 2QYOA 1OX8A 2K85A 2QYZA 3KK3A 2AK5A 2QSGX 1UGSB 4ICLA 4PA1A 5EC7A 1MNMC 1WGXA 2A37A 1FYMA 1U1SA 2JM9A 2JS0A 5E1XA 2DYIA 2A3LA 2A6EF 1SMYF 1VQ9I 1HNVA 3QFPA 2CW7A 1MDMB 1GLEG 2Z1JA 3JB9G 1QZEA 1CKBA 4JI1K 3DLLF 5ILVA 1BI1A 1R1UA 4M75A 2NRZA 4QAGA 1XD7A 1D4XA 4LG0B 4JD2A 5J1RA 1IN7A 2FJ1A 1BR2A 2GM4A 2R5AA 3I9QA 3JCMg 2IA0A 1PU8A 3ZMSA 4BEHB 4A61A 1J7KA 5GMKj 5LBQA 4E4HA 4AYBN 3RMQA 5IT3A 1XGNA 4JYAK 1NK4A 2DDBA 2IS6A 4ON0A 5D4RA 2M8GX 3OYDA 2E5ZA 3CCQT 2OPTA 1LNWA 4K11A 1BR1A 4XTZA 2XDVA 4BRCA 3HVTA 2L3PA 3HC7A 2ED0A 4WTOB 4ILJA 2COWA 4M7DF 2OANA 3F70A 4YOXA 2RDPA 2DO3A 2FZKB 4JN4A 3MKDA 1HJOA 3I4MJ 1SRLA 2Y0SN 3C3WA 1HQEA 3QYFA 3EH1A 2IBDA 3PNTA 2H56A 1R4NB 3V7RA 4DBHA 2G8VA 2VBYA 3TU5A 1GLDG 1U48A 4PSWA 1AD5A 3GP8A 4LD0A 4AM6A 4FL6A 2MW8A 2L0KA 2PQ8A 3BC8A 4C0ZA 2KBTA 3AO5A 3W2AA 3PTAA 3JRCA 2QTVA 4B6MA 3K5OA 3TSQA 2FSKA 1QWEA 3VN5A 4CJKA 2YRVA 1LAWA 4JKGB 3QO9A 1OYIA 1CZAN 1UOCA 2O8FB 2L9RA 2ZKZA 2F2VA 2D1XA 3HPOA 1WNLA 3VOVA 1BOTO 4Y33A 2DA3A 4QSHA 3LSKA 3C2GA 2EH3A 1MNEA 2BHYA 2L7ZA 2P9UB 1VQ7A 5KK1A 5E3OA 3LWMA 3DJCA 1SZ2A 5C6SA 1E3OC 2WSCE 2EJ9A 3AGKA 5GTIC 2UYTA 1OISA 1HOMA 5FDLA 3LAMA 4CGHA 2K2MA 1LCKA 2EIJH 3NF6A 2P8TA 1JGGA 4I99C 3K69A 4HRIA 4BRDA 4HWIA 1T6DA 1L3LA 9ANTA 4L9NA 5L3DA 4ESRA 2I5JA 1Q86U 4CEEA 1FY7A 1YJWN 3L7WA 2CGJA 2HSTA 1S5JA 2AHQA 4V2GA 3M3YJ 4OMPA 3ZQQA 3AVLA 2WB1N 4M7DB 2LX9A 1RI7A 4M75E 4CK3A 2LKXA 2V7ZA 1R49A 3FXQA 2X3WD 4JHDA 1XMXA 4XN0A 4NC6A 1HKTA 5LJ5h 4GKKK 2VQHA 5GANh 4WYBA 3ASMA 3RPUD 2KPMA 2P5OA 1NWKA 4CCOA 3DU5A 4NNJA 4EMHA 4C8QE 2C0OA 4N4GA 1AEYA 4KHSA 5J40A 2E71A 3FLCO 3EO3A 4J9EA 2WAEA 3I5SA 2WAFA 3H45C 3I33A 3FKIJ 4BR2A 2YUNA 3EGXB 1QQOA 4I6MA 3FIWA 2QBYB 4AU7A 4MTDA 3SFZA 1GFCA 1WJRA 1ATNA 3CIPA 1Z21A 2QGGA 3E2UA 2DEQA 3BZKA 1GBQA 2K57A 1VQ9A 4Z88A 5E1ZB 2A61A 1VQ7Q 3D0SA 3F8FA 3TU4K 2QK9A 3VQAA 4A53A 5LJ5f 2HNHA 2F48A 2CSIA 1B92A 5GANf 1USSA 3HJEA 1QQJA 4Q5VA 3ZSZA 1JLCA 2HCKA 3HIFA 2F2XA 3TGNA 3GEZA 3M56A 2X51A 1YJWI 3O8MA 4CZEA 4HV6A 1MV3A 3OYIA 4G9ZA 4FZYA 5MLCQ 1W5SA 1KC8U 4NC8A 1C0FA 1UUEA 1OI1A 5LJ3d 2M4GA 3J80K 4E0DA 2KRMA 4RGUA 2QKKA 1SD5A 1ERDA 4J8OA 3RIRA 4ITVA 3URGA 1IGQA 3PUBA 4XU2A 2VE9A 1Y6IA 1YIJT 4FK0A 4A6EA 3AO4A 4PCQA 3PIPL 4J6YA 2H3GX 2IS3A 4DSFA 1Y8RB 1MSEC 3KYDB 3Q0WA 3RCOA 2QSFX 4H0PA 1U47A 5H20A 1HCRA 2VYPA 1JQQA 2JTEA 3E9OA 4B1RA 3BP8A 1TL3A 2IGMA 3ZETB 2UXNA 2KIQA 3HB9A 2IVNA 3C2HA 1RT2A 3M54A 5CE3A 3DP7A 3E7LA 1ONVA 2WA0A 1FKOA 3N4MA 2LRQA 3T0YA 4JI8K 4FT4A 3SFIA 3RMSA 2JG6A 2HBPA 3A8GB 2E5KA 1ZSZB 2GGRA 4JNEA 2OCEA 2I7PA 4CEZA 1VQ9Q 5CHIA 2X9HA 2P9KA 2KJCA 3ABMH 1TXQA 1NGNA 1R00A 5GAMh 4AYBA 5C25A 2R7QA 4KPYA 4CJSA 4LLNA 3SBGA 2P9SB 4HPQA 1YQAA 3ZYYX 1F43A 1Y0UA 3EFOB 3M0TA 4OU0A 4DQPA 2YX6A 4DW6A 2GTOA 2GF7A 2QI2A 1NK9A 4EZ9A 2Y0SA 2X6XA 2VKDA 2CYZB 4EIAA 1RI0A 2WONA 1NKUA 2ETJA 2HPIA 3G4SN 4EJVA 3IRQA 2DOEA 2WV1A 2RNJA 2V1XA 1DU0A 4KBOA 4P5OA 4HSRA 2K9NA 3EUAA 3D1NI 3NVMA 1WIEA 1FJLA 1ZBHA 3LP1A 3ZR8X 2AXLA 4YG2F 5J39A 1H8AC 3PIPF 2DMPA 5IWAK 2BVMA 1QVFP 2R7FA 3FEOA 3BR2A 3X28B 1EFNA 4A3KJ 2DPUA 4LK1F 1FOYA 4RTUA 2L4MA 4LH5A 5FU7C 1YOVB 3MMYB 1B7TA 2KYBA 2QLZA 1EX4A 1S7EA 5DDGA 4M3TA 3KLHA 3T1YK 4P9UA 1QE1A 2XSJC 4LB5A 3QEPA 4AVZA 3CW7A 4X65K 2QG9B 2IPOB 4FWOA 1IRXA 4PJMA 2G9WA 2P7CB 4FWQA 1B9FA 1RBUA 1JHFA 2X78A 3CJAA 4BC3A 1BJZA 4C3HJ 3P83D 3HZ6A 3LGFA 4DGWB 2D45A 1TW3A 1NGBA 3RTVA 4CEQA 5KPTA 1MDMA 3AO3A 4FJ5A 3CBPA 3BGRA 3BEXA 2HBWA 2WTEA 4AHSA 3FMRA 4CJPA 3PLAA 1YQKA 4B24A 3K4MA 2HHUA 2XAFA 1N8RU 2JJ9A 2XDDA 2HNDA 4BEHA 1T8IA 1YN8A 2UUBK 1XSVA 2PFBA 2RN7A 1M3BA 4XBFA 2F2WA 1PG5B 2HMAA 2HF3A 1T44A 2E7XA 1YJWA 3DWLA 3S3NA 1D9DA 5BPMA 2GTDA 4QS9A 4AH9A 2WB1A 3SNNA 4BE1A 3CCQI 2RQTA 1Y57A 3K58A 2V8KA 1D5AA 4NXNK 3AL0B 2M34A 3PIOL 3M0QA 3CXCS 4IEIA 3CDHA 1RT5A 1ASVA 2XPVA 2PJRB 1G2BA 3I56T 3V9UA 1X69A 4GKJK 2XB0X 3EUHA 3WXJA 1R7JA 4HT9A 1KAYA 2FF3B 1VSMA 2DA4A 4IWVA 3M8SA 4E2FB 1TQIA 2WC2A 4IJNA 4CJ5A 1MIJA 4CICA 1OPLA 1KU2A 2Q1NA 1WSGA 1SHFA 2XF5A 3HVRA 3V9ZA 2P9LA 1MUZA 4JKGA 3T3FA 1UB9A 2CUDA