3CWTA

Crystal structure of an alka host/guest complex 2'-fluoro-2'-deoxyinosine:adenine base pair
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cwtA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cwtA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cwtA01
2JG6A 1EBMA 3G0QA 4B22A 2NOZA 1XQOA 2NOEA 1N3AA 3FSPA 4E9GA 3OH9A 2YG8A 4EA4A 4E9FA 2NOIA 4EJZA 1MUDA 4UOBA 2YG9A 2NOHA 1KO9A 1RRSA 1PU8A 3F0ZA 1KG6A 4YOQA 1KG2A 4EW4A 1M3QA 4YPHA 4HSBA 4AIAA 4B24A 4E9HA 4EVVA 3S6IA 4UNFA 1XG7A 3F10A 1N3CA 1P59A 2I5WA 1KG7A 2OFKA 1PVSA 1YQKA 1PU7A 1MUNA 1KQJA 1M3HA 1NGNA 2JHJA 5AN4A 3CWSA 2JHNA 4OFHA 1RRQA 3N5NX 3CVTA 1WEGA 4OFEA 1DIZA 5CHZA 5KN8A 4PIIA 3KTUA 3D4VA 1N39A 1PU6A 3N0UA 1HU0A 4B21A 3CWUA 3OGDA 3KNTA 1KEAA 2H56A 1MPGA 1LWYA 3CVSA 1WEFA 3IH7A 2OFIA 3CWTA 2ABKA 4YPRA 1YQLA 4AI5A 1VRLA 1LWVA 2XHIA 1XQPA 1FN7A 4EW0A 1P7MA 4OFAA 4EJYA 2NOBA 3I0XA 4EA5A 1ORNA 1WEIA 4B23A 3OH6A 4AI4A 1KG4A 1ORPA 3FHFA 1YQRA 1KG3A 3CWAA 4E9EA 1LWWA 1KG5A 3IHOA 1YQMA 3CW7A 3FHGA 2NOLA 4DK9A 3I0WA 1NKUA 5DPKA 5KN9A 2NOFA 1LMZA 1MUYA
chains in the Genus database with same CATH superfamily
1E42A 3OYNA 4BDZA 2MJ7A 2NOZA 1XQOA 3DPTA 1N3AA 1NH2A 4EAIA 2Z0FA 4E9GA 3OH9A 3OS2A 4EJZA 4ZTFA 3KRMA 5BMPA 2HL9A 3OY9A 4QG5A 2Y8QA 2R5XA 3F0ZA 2IV8A 4EW4A 4D7RA 4E9HA 1D3UA 1N3CA 3SNSA 2O3OA 1W80A 2I5WA 3OYCA 5IYBP 1NGMA 5AN4A 2D0CA 3CWSA 2V9JA 2JHNA 1RRQA 2QR1A 4RODB 1B9KA 1QN3A 1WEGA 2D0BA 4BJUA 5KN8A 3KTUA 3ENOC 3OYIA 1KY7A 3N0UA 4B21A 2Z8UA 1KEAA 4MRQA 2G30A 1XSZA 4WX8A 1MPGA 3S3NA 3OYJA 5KL0A 4BE2A 5FRNA 3NA5A 4EW0A 3OYFA 4OFAA 2EHBD 3VW4A 1QNAA 3OSMA 2H4LX 1NVPA 2JPSA 1KG4A 4ZTJA 2HZMA 1LWWA 1KG5A 1YQMA 3CW7A 2HKPA 1NKUA 4IKFA 1J3MA 1QN6A 3OSTA 1KFIA 5KN9A 5FROA 1UL7A 2YH5A 2JG6A 2PWWA 4E7HA 3PDKA 3OYHA 2NOEA 2F7LA 4C7PA 2QRCA 2H5AX 4E9FA 1YTBA 1MUDA 4UOBA 4Q11A 1VOKA 4PY5A 4ROCB 1QTSA 3OYKA 4E7JA 1KG2A 1Q9UA 2NVMA 3ULXA 4BACA 1RM1A 4B24A 3EAYA 1PCZA 3OC3C 2QRDA 1U84A 1XG7A 5JN5A 5IYDP 1KG7A 3OLPA 1YQKA 3N89A 1TBAB 4NZGA 2W04A 3L2VA 4WXAA 3CVTA 3UW2A 5EPCA 4ROEB 5CHZA 4PIIA 1VTLE 3D4VA 3L2UA 2JPIA 1P5DX 3R2XC 3T4NA 5BMNA 1QN4A 1QNCA 3KNTA 1TGHA 2NLVA 4E7IA 1LWYA 1VOLB 1QN9A 4TPSA 2V75A 3IH7A 2VJ0A 3EIKA 1QNBA 1XQPA 3S3MA 1K35A 2OOXA 1P5GX 3I0XA 3D7QA 1WEIA 4AI4A 1ORPA 2ZFDB 1C47A 2NOLA 3OSEA 2D0AA 3I0WA 3NNQA 2LAEA 1QN5A 1KY6A 1QN7A 3HS8A 3HS9A 3FSPA 2YG8A 1VKLA 4EAKA 2NOIA 2YG9A 1M5Q1 2DKAA 2NOHA 2HZSA 4EAJA 1RRSA 1TUOA 3L2QA 1AISA 3OYGA 1M3QA 2W03A 4EVVA 3S6IA 4BDYA 4UNFA 1TBPA 3F10A 2V92A 3S3OA 1P59A 1PCMX 1C4GA 3TE5A 3OCIA 5F9CA 1PU7A 1MUNA 1KQJA 1NGNA 1PZDA 1WQAA 3L2WA 4OFHA 2QREA 3OYDA 1EUVA 3RPJA 1DIZA 5HSHA 4CFFA 1N39A 2HL8A 3OYEA 2OOYA 1KYUA 1V5SA 1T6AA 4E7KA 1VRLA 1LWVA 2XHIA 1FN7A 2FUVA 1P7MA 4EJYA 2NOBA 1ORNA 3ASMA 3OH6A 1QNEA 3I3WA 3OYLA 3FHFA 1KG3A 3CWAA 4E9EA 3RSMA 1LXTA 3IHOA 2YA3A 2NWVA 1YTFA 4IL8A 4DULA 2NOFA 1KFQA 4HJHA 4WZSD 4D7QA 2FKMX 1EBMA 3G0QA 4B22A 2FKFA 4B0AA 1PCJX 2QLVA 4EA4A 2Y8LA 2IV9A 3PMGA 1KO9A 1PU8A 4YOQA 1KG6A 3H1ZA 2FGTA 4YPHA 4HSBA 4AIAA 3LCNA 4EALA 1UT4A 3C04A 2MZ8A 3OS1A 3OS0A 1JDYA 1UT7A 2OFKA 1PVSA 1M3HA 4BE0A 1K2YX 2JHJA 4I8OA 3TDHA 2JOIA 3N5NX 5IYCP 2DKDA 4OFEA 1JFIC 5FRMA 3BKQX 1KYFA 1PU6A 1HU0A 3CWUA 3OGDA 1R4XA 2H56A 1KYDA 3OYMA 3CVSA 1WEFA 2OFIA 1MP9A 3CWTA 2ABKA 4YPRA 1YQLA 3OYBA 4AI5A 4E7LA 2DKCA 1VTOA 4BE1A 2V8QA 4EA5A 1WJWA 3DPUA 4B23A 1CDWA 1QTPA 3VN5A 1QN8A 1YQRA 1C9BB 3FHGA 5JMVD 4DK9A 3L2RA 3ENCA 5DPKA 4EAGA 3OYAA 1LMZA 1MUYA
chains in the Genus database with same CATH topology
2JG6A 1EBMA 3G0QA 4B22A 2NOZA 1XQOA 2NOEA 1N3AA 3FSPA 4E9GA 3OH9A 2YG8A 4EA4A 4E9FA 2NOIA 4EJZA 1MUDA 4UOBA 2YG9A 2NOHA 1KO9A 1RRSA 1PU8A 3F0ZA 1KG6A 4YOQA 1KG2A 4EW4A 1M3QA 4YPHA 4HSBA 4AIAA 4B24A 4E9HA 4EVVA 3S6IA 4UNFA 1XG7A 3F10A 1N3CA 1P59A 2I5WA 1KG7A 2OFKA 1PVSA 1YQKA 1PU7A 1MUNA 1KQJA 1M3HA 1NGNA 2JHJA 5AN4A 3CWSA 2JHNA 4OFHA 1RRQA 3N5NX 3CVTA 1WEGA 4OFEA 1DIZA 5CHZA 5KN8A 4PIIA 3KTUA 3D4VA 1N39A 1PU6A 3N0UA 1HU0A 4B21A 3CWUA 3OGDA 3KNTA 1KEAA 2H56A 1MPGA 1LWYA 3CVSA 1WEFA 3IH7A 2OFIA 3CWTA 2ABKA 4YPRA 1YQLA 4AI5A 1VRLA 1LWVA 2XHIA 1XQPA 1FN7A 4EW0A 1P7MA 4OFAA 4EJYA 2NOBA 3I0XA 4EA5A 1ORNA 1WEIA 4B23A 3OH6A 4AI4A 1KG4A 1ORPA 3FHFA 1YQRA 1KG3A 3CWAA 4E9EA 1LWWA 1KG5A 3IHOA 1YQMA 3CW7A 3FHGA 2NOLA 4DK9A 3I0WA 1NKUA 5DPKA 5KN9A 2NOFA 1LMZA 1MUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JG6 A;  1EBM A;  3G0Q A;  4B22 A;  2NOZ A;  1XQO A;  2NOE A;  1N3A A;  3FSP A;  4E9G A;  3OH9 A;  2YG8 A;  4EA4 A;  4E9F A;  2NOI A;  4EJZ A;  1MUD A;  4UOB A;  2YG9 A;  2NOH A;  1KO9 A;  1RRS A;  1PU8 A;  3F0Z A;  1KG6 A;  4YOQ A;  1KG2 A;  4EW4 A;  1M3Q A;  4YPH A;  4HSB A;  4AIA A;  4B24 A;  4E9H A;  4EVV A;  3S6I A;  4UNF A;  1XG7 A;  3F10 A;  1N3C A;  1P59 A;  2I5W A;  1KG7 A;  2OFK A;  1PVS A;  1YQK A;  1PU7 A;  1MUN A;  1KQJ A;  1M3H A;  1NGN A;  2JHJ A;  5AN4 A;  3CWS A;  2JHN A;  4OFH A;  1RRQ A;  3N5N X;  3CVT A;  1WEG A;  4OFE A;  1DIZ A;  5CHZ A;  5KN8 A;  4PII A;  3KTU A;  3D4V A;  1N39 A;  1PU6 A;  3N0U A;  1HU0 A;  4B21 A;  3CWU A;  3OGD A;  3KNT A;  1KEA A;  2H56 A;  1MPG A;  1LWY A;  3CVS A;  1WEF A;  3IH7 A;  2OFI A;  3CWT A;  2ABK A;  4YPR A;  1YQL A;  4AI5 A;  1VRL A;  1LWV A;  2XHI A;  1XQP A;  1FN7 A;  4EW0 A;  1P7M A;  4OFA A;  4EJY A;  2NOB A;  3I0X A;  4EA5 A;  1ORN A;  1WEI A;  4B23 A;  3OH6 A;  4AI4 A;  1KG4 A;  1ORP A;  3FHF A;  1YQR A;  1KG3 A;  3CWA A;  4E9E A;  1LWW A;  1KG5 A;  3IHO A;  1YQM A;  3CW7 A;  3FHG A;  2NOL A;  4DK9 A;  3I0W A;  1NKU A;  5DPK A;  5KN9 A;  2NOF A;  1LMZ A;  1MUY A; 
#chains in the Genus database with same CATH topology
 1E42 A;  3OYN A;  4BDZ A;  2MJ7 A;  2NOZ A;  1XQO A;  3DPT A;  1N3A A;  1NH2 A;  4EAI A;  2Z0F A;  4E9G A;  3OH9 A;  3OS2 A;  4EJZ A;  4ZTF A;  3KRM A;  5BMP A;  2HL9 A;  3OY9 A;  4QG5 A;  2Y8Q A;  2R5X A;  3F0Z A;  2IV8 A;  4EW4 A;  4D7R A;  4E9H A;  1D3U A;  1N3C A;  3SNS A;  2O3O A;  1W80 A;  2I5W A;  3OYC A;  5IYB P;  1NGM A;  5AN4 A;  2D0C A;  3CWS A;  2V9J A;  2JHN A;  1RRQ A;  2QR1 A;  4ROD B;  1B9K A;  1QN3 A;  1WEG A;  2D0B A;  4BJU A;  5KN8 A;  3KTU A;  3ENO C;  3OYI A;  1KY7 A;  3N0U A;  4B21 A;  2Z8U A;  1KEA A;  4MRQ A;  2G30 A;  1XSZ A;  4WX8 A;  1MPG A;  3S3N A;  3OYJ A;  5KL0 A;  4BE2 A;  5FRN A;  3NA5 A;  4EW0 A;  3OYF A;  4OFA A;  2EHB D;  3VW4 A;  1QNA A;  3OSM A;  2H4L X;  1NVP A;  2JPS A;  1KG4 A;  4ZTJ A;  2HZM A;  1LWW A;  1KG5 A;  1YQM A;  3CW7 A;  2HKP A;  1NKU A;  4IKF A;  1J3M A;  1QN6 A;  3OST A;  1KFI A;  5KN9 A;  5FRO A;  1UL7 A;  2YH5 A;  2JG6 A;  2PWW A;  4E7H A;  3PDK A;  3OYH A;  2NOE A;  2F7L A;  4C7P A;  2QRC A;  2H5A X;  4E9F A;  1YTB A;  1MUD A;  4UOB A;  4Q11 A;  1VOK A;  4PY5 A;  4ROC B;  1QTS A;  3OYK A;  4E7J A;  1KG2 A;  1Q9U A;  2NVM A;  3ULX A;  4BAC A;  1RM1 A;  4B24 A;  3EAY A;  1PCZ A;  3OC3 C;  2QRD A;  1U84 A;  1XG7 A;  5JN5 A;  5IYD P;  1KG7 A;  3OLP A;  1YQK A;  3N89 A;  1TBA B;  4NZG A;  2W04 A;  3L2V A;  4WXA A;  3CVT A;  3UW2 A;  5EPC A;  4ROE B;  5CHZ A;  4PII A;  1VTL E;  3D4V A;  3L2U A;  2JPI A;  1P5D X;  3R2X C;  3T4N A;  5BMN A;  1QN4 A;  1QNC A;  3KNT A;  1TGH A;  2NLV A;  4E7I A;  1LWY A;  1VOL B;  1QN9 A;  4TPS A;  2V75 A;  3IH7 A;  2VJ0 A;  3EIK A;  1QNB A;  1XQP A;  3S3M A;  1K35 A;  2OOX A;  1P5G X;  3I0X A;  3D7Q A;  1WEI A;  4AI4 A;  1ORP A;  2ZFD B;  1C47 A;  2NOL A;  3OSE A;  2D0A A;  3I0W A;  3NNQ A;  2LAE A;  1QN5 A;  1KY6 A;  1QN7 A;  3HS8 A;  3HS9 A;  3FSP A;  2YG8 A;  1VKL A;  4EAK A;  2NOI A;  2YG9 A;  1M5Q 1;  2DKA A;  2NOH A;  2HZS A;  4EAJ A;  1RRS A;  1TUO A;  3L2Q A;  1AIS A;  3OYG A;  1M3Q A;  2W03 A;  4EVV A;  3S6I A;  4BDY A;  4UNF A;  1TBP A;  3F10 A;  2V92 A;  3S3O A;  1P59 A;  1PCM X;  1C4G A;  3TE5 A;  3OCI A;  5F9C A;  1PU7 A;  1MUN A;  1KQJ A;  1NGN A;  1PZD A;  1WQA A;  3L2W A;  4OFH A;  2QRE A;  3OYD A;  1EUV A;  3RPJ A;  1DIZ A;  5HSH A;  4CFF A;  1N39 A;  2HL8 A;  3OYE A;  2OOY A;  1KYU A;  1V5S A;  1T6A A;  4E7K A;  1VRL A;  1LWV A;  2XHI A;  1FN7 A;  2FUV A;  1P7M A;  4EJY A;  2NOB A;  1ORN A;  3ASM A;  3OH6 A;  1QNE A;  3I3W A;  3OYL A;  3FHF A;  1KG3 A;  3CWA A;  4E9E A;  3RSM A;  1LXT A;  3IHO A;  2YA3 A;  2NWV A;  1YTF A;  4IL8 A;  4DUL A;  2NOF A;  1KFQ A;  4HJH A;  4WZS D;  4D7Q A;  2FKM X;  1EBM A;  3G0Q A;  4B22 A;  2FKF A;  4B0A A;  1PCJ X;  2QLV A;  4EA4 A;  2Y8L A;  2IV9 A;  3PMG A;  1KO9 A;  1PU8 A;  4YOQ A;  1KG6 A;  3H1Z A;  2FGT A;  4YPH A;  4HSB A;  4AIA A;  3LCN A;  4EAL A;  1UT4 A;  3C04 A;  2MZ8 A;  3OS1 A;  3OS0 A;  1JDY A;  1UT7 A;  2OFK A;  1PVS A;  1M3H A;  4BE0 A;  1K2Y X;  2JHJ A;  4I8O A;  3TDH A;  2JOI A;  3N5N X;  5IYC P;  2DKD A;  4OFE A;  1JFI C;  5FRM A;  3BKQ X;  1KYF A;  1PU6 A;  1HU0 A;  3CWU A;  3OGD A;  1R4X A;  2H56 A;  1KYD A;  3OYM A;  3CVS A;  1WEF A;  2OFI A;  1MP9 A;  3CWT A;  2ABK A;  4YPR A;  1YQL A;  3OYB A;  4AI5 A;  4E7L A;  2DKC A;  1VTO A;  4BE1 A;  2V8Q A;  4EA5 A;  1WJW A;  3DPU A;  4B23 A;  1CDW A;  1QTP A;  3VN5 A;  1QN8 A;  1YQR A;  1C9B B;  3FHG A;  5JMV D;  4DK9 A;  3L2R A;  3ENC A;  5DPK A;  4EAG A;  3OYA A;  1LMZ A;  1MUY A; 
#chains in the Genus database with same CATH homology
 2JG6 A;  1EBM A;  3G0Q A;  4B22 A;  2NOZ A;  1XQO A;  2NOE A;  1N3A A;  3FSP A;  4E9G A;  3OH9 A;  2YG8 A;  4EA4 A;  4E9F A;  2NOI A;  4EJZ A;  1MUD A;  4UOB A;  2YG9 A;  2NOH A;  1KO9 A;  1RRS A;  1PU8 A;  3F0Z A;  1KG6 A;  4YOQ A;  1KG2 A;  4EW4 A;  1M3Q A;  4YPH A;  4HSB A;  4AIA A;  4B24 A;  4E9H A;  4EVV A;  3S6I A;  4UNF A;  1XG7 A;  3F10 A;  1N3C A;  1P59 A;  2I5W A;  1KG7 A;  2OFK A;  1PVS A;  1YQK A;  1PU7 A;  1MUN A;  1KQJ A;  1M3H A;  1NGN A;  2JHJ A;  5AN4 A;  3CWS A;  2JHN A;  4OFH A;  1RRQ A;  3N5N X;  3CVT A;  1WEG A;  4OFE A;  1DIZ A;  5CHZ A;  5KN8 A;  4PII A;  3KTU A;  3D4V A;  1N39 A;  1PU6 A;  3N0U A;  1HU0 A;  4B21 A;  3CWU A;  3OGD A;  3KNT A;  1KEA A;  2H56 A;  1MPG A;  1LWY A;  3CVS A;  1WEF A;  3IH7 A;  2OFI A;  3CWT A;  2ABK A;  4YPR A;  1YQL A;  4AI5 A;  1VRL A;  1LWV A;  2XHI A;  1XQP A;  1FN7 A;  4EW0 A;  1P7M A;  4OFA A;  4EJY A;  2NOB A;  3I0X A;  4EA5 A;  1ORN A;  1WEI A;  4B23 A;  3OH6 A;  4AI4 A;  1KG4 A;  1ORP A;  3FHF A;  1YQR A;  1KG3 A;  3CWA A;  4E9E A;  1LWW A;  1KG5 A;  3IHO A;  1YQM A;  3CW7 A;  3FHG A;  2NOL A;  4DK9 A;  3I0W A;  1NKU A;  5DPK A;  5KN9 A;  2NOF A;  1LMZ A;  1MUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...