3OYIA

Crystal structure of the pfv s217q mutant intasome in complex with manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyiA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyiA03
4I2PA 1S9EA 2YKNA 4FM0A 2D0BA 4OKEA 2MWOA 4FK4A 4LD6A 3P5JA 2RKIA 4DQSA 4CEZA 4CEOA 3V1QA 4CJVA 1J5OA 5CZ2A 5IAYA 4OLBA 4CJPA 5DMRA 1VSKA 1TK5A 4B9UA 2ZE2A 3ISNC 1F21A 4LY7A 4O0IA 3LZJA 4CGFA 2VYTA 1RILA 3RR8A 4RW4A 3BDLA 4CJFA 4FJNA 3QIOA 3QEVA 4IBNA 3KUFA 4CJ3A 4CEDA 4PA1A 3VA3A 4DQQA 3CQ8A 4RW7A 1IH7A 3L2VA 2IS3A 3OQ5A 3AVFA 1C1BA 4CJ5A 4F4KA 3M9QA 3H6ZA 5I42A 1HYVA 1C0TA 4RW6A 4OLAA 2NLUA 1L3UA 4ZHRA 2Y1IA 4DSLA 4Z4FA 4B3OA 4NCAA 2LRQA 5J2PA 1LW2A 2D5RA 3ME9A 4Q5WA 4DQPA 1OYXA 3A2FA 3NCIA 3NTKA 2HNDA 4W5RA 1HYZA 3LX7A 3IG1A 3Q1JA 2HQEA 1CZ9A 4AHRA 4OGEA 2LSNA 2JZ2A 1JL1A 5HROA 3LWLA 4CGGA 4KHUA 1GOBA 2YHAA 3ASMA 3ZT0A 1L3SA 3QEIA 4IUVA 1VRTA 1BI4B 1U45A 1HNIA 1OZ3A 3TAGA 4FW1A 3V1OA 5J26A 1LWEA 3AVJA 1RBVA 3TARA 3OS1A 3LP3A 3LH0A 1IO2A 4YFUA 1T05A 1VSJA 4HCCA 4EP4A 2HNZA 4DS4A 2B8AA 2XY5A 4FVMA 2G8FA 1DTQA 3DLMA 1R0AA 1JXBA 3LAKA 1RBTA 2OPQA 3EZ5A 1Q8IA 3AO2A 2AJQA 1KVAA 4W5QA 1ZBUA 1XWLA 1MU2A 4CEFA 3NF9A 3K5MA 2DAQA 3K58A 1HPZA 4AH9A 1QTMA 3OYNA 4F3TA 4FLVA 1SUQA 3HSTB 3S3OA 1JLCA 2HNYA 3MEDA 4IURA 2VWJA 3QEWA 4W5TA 4FJIA 2RHYA 3DOLA 2E6MA 3O8VA 2KFNA 1HJRA 4JRQA 4CGHA 2B4JA 3L42A 2G8UA 3ZSYA 1J53A 2HHXA 5KH6A 1C6VA 3DRPA 2EX3A 2XK0A 3OYCA 1X9MA 3OMGA 1BL3A 1SSFA 4FLZA 2HVHA 2PZSA 3FLGA 3MECA 1A5WA 1EETA 3META 3WNGA 2F96A 4FU6A 1WNSA 2W42A 4DQIA 3HM9A 3C4SA 1HQUA 1QQCA 4I9QA 3U6FA 2DFHA 3ZT3A 1NJYA 1RCHA 2ZD1A 4OKKA 5JS1A 4CJTA 3WNHA 2YKMA 1RDAA 2R7YA 4CEBA 4C8LA 4CJKA 3RMBA 1ITGA 3EAEA 1S1WA 3AVLA 3I8DA 4CF1A 3QESA 1U49A 3M8RA 5C6SA 1H3ZA 1KFSA 3HPGA 3LANA 3LWMA 3ITHA 3V9SA 4JS5A 2G8KA 3TABA 3AO4A 4KTZA 1Q9YA 4NZGA 3F70A 4CIEA 3RRHA 3H08A 3OMCA 3ZT2A 3SPYA 5HLFA 3L2UA 3HYFA 1TK8A 2VG6A 4KI4A 3P8HA 3QIPA 1G5VA 1UOCA 3CYMA 2HHVA 1RT7A 3V4IA 4B9VA 1NJXA 1WSJA 3K5OA 1U47A 2E6LA 4LD0A 2IGIA 4LSLA 1BISA 1I39A 4H8KA 2RPIA 3SPZA 4KHYA 4Z4CA 4DMNA 3NF7A 1S1XA 1BCOA 4CCHA 2G3RA 3NGIA 2M0OA 5C24A 1QHTA 1SKWA 4CF2A 3AVBA 2O4GA 3HXMA 3VQ7A 1C1CA 4B9NA 4Z4EA 3DLHA 4CF0A 2HB5A 2QKBA 1QE1A 1WGSA 4KREA 4DLGA 4O5BA 2RO0A 4CEAA 1SL0A 3SQ4A 1WLJA 1JKHA 4OVLA 1TK0A 4R5PA 1RDBA 4CJUA 4DFJA 2RI5A 4FJLA 4OPJA 3E01A 4KI6A 4H4MA 1IKYA 4FK2A 4CK2A 2P5OA 4QQ6A 3OYHA 2L3RA 1WSFA 1QSLA 4LH5A 3AVCA 3FDRA 1YVUA 4H4OA 3CM5A 4BD3A 4HHTA 4CIFA 4QW2A 4L8RB 2ATQA 4PY5A 3OYAA 3OYJA 4IFVA 3ZEHA 3KJVA 4OGCA 2QKKA 2IC3A 4FJKA 5HRNA 1HQEA 1NK5A 4B9LA 1S1UA 3TI0A 3K5NA 4DSJA 1B9DA 1TKZA 2RJEA 1KFDA 1J54A 1RT5A 5D6YA 1ASVA 3ZSZA 2R5MA 2E6NA 4E1MA 4KTQA 1VSDA 1KSPA 4YNQA 2O4XA 1ZBLA 4AHTA 3PX4A 2NUBA 4A4FA 2FBVA 1NK7A 3O3FA 4QAGA 4HTUA 3GOXA 2G8VA 4CFBA 1JLEA 2B6AA 3VQ9A 1O1WA 3SV3A 2HHWA 4BDPA 4O0JA 4UQGA 1IKVA 3ZSOA 4RG2A 4CEQA 3AO1A 5KCHA 2R58A 4CIGA 2HW3A 1RBSA 1IKWA 2P0KA 3OJSA 1C0MA 3MXIA 4KHSA 4CK1A 1ASWA 3QKJA 1L3TA 2DY4A 3OYLA 4CE9A 4I2QA 2XY7A 4A4HA 1JLFA 4EDUA 5KE2A 3LP2A 3AVAA 2DFEA 5KGWA 4EP5A 3SQ1A 3NH1A 2L89A 2PYJA 3SD4A 2IOCA 4Q0BA 2G8WA 4MQ3A 1RTHA 3OYKA 4O55A 4J2DA 4ZTJA 2VG7A 3SV4A 3MEVA 2VG5A 1L5UA 3M8PA 3NGYA 3ZSWA 4FJ8A 4C8KA 2HVIA 4Z4HA 4FYDA 2EQUA 3MP8A 4RW8A 3MEGA 3QNNA 2FC0A 1EKEA 4K8XA 3DLRA 5JS2A 1UAXA 4CJSA 4B9XA 4DSKA 2Z1JA 3M8QA 3MEUA 1NOYA 2WONA 2Q3SA 3B6PA 3MXJA 4KPYA 2JLEA 3AO3A 4NCBA 2ETJA 3VQ8A 1NK0A 1WAFA 4EZ6A 3BDPA 4QQGA 3AO5A 3AVNA 1S6PA 4M3TA 3PUFA 4CGDA 4B9SA 2LDMA 1VRUA 4HCBA 2LTOA 4CJLA 5C42A 4IFYA 3ZSVA 2P51A 3HP9A 2GBZA 3CM6A 4E19A 4BWJA 3LZIA 3KLEA 2P5GA 1C0UA 1VSHA 3NH0A 3MXMA 2GF7A 2JGUA 2X6NA 3QEXA 3HJFA 3EY1A 4B8CA 1OI1A 4NS5A 5T7BA 3RMDA 1LAVA 4DSIA 3V1RA 4DF8A 2GUIA 1TKDA 3SQ2A 4E7LA 1XHXA 3G10A 4HUFA 4FLWA 3MEAA 2MWPA 1J9AA 1RT3A 4N76A 3UT1A 1NOZA 3VQ6A 3VQCA 2PYLA 2X6SA 1KLMA 4RG8A 4M3XA 3T3FA 2RJCA 3CFOA 4C8MA 5J39A 4HUEA 1QSSA 4N56A 2Z1IA 3TR8A 3THVA 2B5JA 1KRPA 4CGJA 4AHVA 2M1HA 3PFSA 2CKKA 1CLQA 3BGRA 4OKJA 3RMCA 2A1SA 2YNIA 1HYSA 1Q9XA 2O4IA 2R57A 4E89A 4M45A 1BI4A 1LAWA 3ULDA 3QLHA 1LW0A 4KB0A 1Z25A 3OYDA 2DFFA 1S5JA 2KW4A 1BIUA 3RMAA 4PUOA 4ICLA 4ID5A 3AA2A 3F73A 2IDOA 4M3UA 3NAEA 3LAMA 3IS9A 2FBYA 3SYZA 1REVA 3VQBA 4FJ5A 5J2QA 2KZMA 1BQNA 1QSYA 3NF8A 1KHCA 5E41A 5CIUA 4PLIA 3QETA 4FJMA 1T8EA 3HPOA 3AVIA 1DTTA 4IG3A 4BDYA 1ZBHA 4DLEA 5KCOA 1FXXA 4FJ9A 1JLQA 3HO1A 4ID1A 3AVGA 1JXEA 4J2EA 3OYEA 3OVNA 1RBUA 3LP0A 4E0DA 2WACA 3AVHA 1D9FA 1BQMA 3K57A 2A1RA 4DTXA 1JLAA 1ZYQA 3O3GA 4Y1DA 4KTWA 1TV6A 3SQ0A 1VK0A 4J2AA 4RW9A 1KTQA 3U3GA 1YTAA 2RJFA 1TVRA 1W0HA 2XDPA 4CECA 2D0AA 3KKRA 4CFAA 1WSEA 3U3YA 4O4GA 4CEEA 4NCGA 3K5LA 4L59A 3OJUA 2M16A 4BDZA 3S3NA 5CYMA 2EKOA 4O44A 5HRRA 1CXQA 2F8TA 4Z0UA 3P1GA 4KB1A 3C6TA 1RTIA 3KKSA 4ELTA 2XO7A 3NTIA 1X9SA 4CHPA 4IKFA 1RTDA 1WJSA 1LWCA 2I5JA 1G15A 3CFRA 1WN7A 2EQJA 2YNGA 4B9TA 4BACA 4CRIA 2E4LA 4Z4GA 3VQPA 1XHZA 3L3UA 3TAFA 3V9WA 3QINA 4M42A 4KHQA 1XC9A 4WE1A 4CJWA 5J1EA 1WSGA 4DU1A 2X4WA 2XY8A 1K6YA 4E7HA 3L3VA 2BIVA 2LVMA 1UWBA 2HMIA 2HHQA 4A4GA 5KTQA 4CHZA 1LWFA 4DTUA 2XY6A 2BUDA 2XHBA 3FFIA 4ZTFA 4DFKA 1RDCA 3L2RA 1WSHA 1T7PA 4FJHA 1WAJA 3KD1E 4C5GA 4FM1A 1VSEA 3VQEA 3NTHA 1TL1A 1X1PA 3I0SA 4CGIA 3KLGA 4JLHA 4PL6A 1VSIA 1D5AA 4CJ4A 1N27A 4DTJA 3JYTA 1S1VA 5C0MA 2RHZA 1S1TA 3AVMA 4AILC 3LGLA 4Z02A 4CF8A 4ELVA 2KFZA 3P83D 1D8YA 3CFPA 3DRRA 3TWHA 4C8NA 2FBTA 4FCYA 2DIQA 2ZQBA 3LPTA 4TSXA 3MP1A 1TL3A 2QQSA 3NF6A 4BE2A 4DQRA 1BGXT 5KRTA 4FJJA 2GV9A 3KLFA 1S9GA 2YRVA 4QQDA 3HL8A 3LYIA 4N41A 4DF4A 3SCXA 4BWMA 4KV8A 3UIQA 1DLOA 1YT3A 3NE6A 2GFUA 1TKXA 3L2QA 4C5IA 1B92A 3V9XA 1ASUA 3QO9A 2L8DA 4BE0A 2EQKA 2GFAA 3DM2A 1B9FA 5HBMA 4FJ7A 4FZXC 3AA3A 2Z1GA 1S6QA 3HT3A 3ZT1A 3RR7A 5FRNA 2OYQA 3T19A 3M8SA 4FL6A 4DG1A 4FLYA 4MFBA 2PY5A 4FZYA 4NYFA 4B9MA 3OYIA 4AHCA 5C25A 3PX6A 1RDDA 2IG0A 2E5QA 2DIGA 2RI2A 1EX4A 3T1AA 4J2BA 4IUQA 4OVAA 3AA5X 3O4NA 4DFPA 2LCCA 1RT1A 3NNQA 4I7FA 3CEYA 1TAUA 3SUQA 3TAQA 2BE2A 1N6QA 4CFDA 5D3GA 3S9HA 3AVKA 1NK4A 4E1NA 2HHTA 2YNHA 4CHYA 1Y97A 1LV5A 2DTUA 4DU3A 4IUUA 1BHLA 4X34A 4KHNA 1D9DA 1RT6A 4FK0A 3TAPA 4M3YA 4CJEA 3VQ4A 3PMIA 3V9UA 2X4XA 1N5YA 4JRPA 1NJZA 4N47A 4KAZA 3RTVA 3WNEA 3MO8A 4CFCA 1SV5A 1EXQA 2KQ2A 5D6WA 2FBXA 4CJRA 3HPHA 2G8IA 5I3UA 3E9GA 3ZSQA 3QJ6A 4A4EA 4CK3A 1Z26A 5EU7A 4FJGA 1UA0A 1RT2A 5FDLA 4GVMA 4OJRA 1IG9A 4M3ZA 1JLBA 4PWDA 4FXDA 1U4BA 4W5OA 4K8ZA 4BE1A 4AHSA 4LH4A 1CZBA 2QQRA 1TKTA 1WJQA 4E3SA 1CXUA 4GMJB 1A5VA 3F9KA 4Q5VA 2X74A 4N4GA 1KVCA 5KRSA 3OYMA 5HP1A 4DTMA 4DTRA 3IRXA 4KKOA 3VA0A 3V6DA 3S3MA 4DWIA 1YTUA 1UA1A 3NH2A 4E7JA 4KHWA 3DLBA 3CG7A 1EP4A 5D6XA 2EQMA 3VQ5A 3SNNA 1OZ2A 3OS2A 4CHQA 3KK3A 4FW2A 3P8DA 2PQWA 4M3WA 2OPPA 4XIUA 1HNVA 1NK9A 3B6OA 2YHBA 3SI6A 3UWNA 2RHIA 3PNWC 1WSIA 1FK9A 1SL2A 3DLKA 2RI3A 1RBRA 3O3HA 5FROA 1C1AA 4NYNA 3WNFA 4LSNA 2RHUA 4IUPA 5KI6A 3TAMA 1ZBIA 4B08A 2RF2A 3QNOA 5J2MA 1L3VA 3LP1A 5CZ1A 3E9FA 3C94A 5HRSA 2X4YA 3FC3A 2QK9A 4M41A 4QCLA 3KD5E 1QS4A 1KLNA 1KVBA 1TAQA 4GY5A 5KE3A 3H8ZA 3RRGA 4CHOA 4CHNA 2FHDA 3AV9A 3MP6A 3C95A 1NKCA 4HVJA 3OS0A 2X35A 3LALA 3LGFA 1I3AA 4B9WA 4M3RA 4B8AB 2KTQA 1NK8A 3K59A 5CY4A 3L2WA 1XNIA 4PLLA 2G8HA 4IG0A 4CERA 4Y1CA 1GOCA 1WJRA 3KK2A 2D0CA 2HQXA 2K3YA 3SZ2A 3KTQA 4IUTA 4DFMA 1ZBFA 2R5AA 3PO5A 3K2PA 5DK5A 1XI1A 1RNHA 3TAEA 4Z4IA 1FKPA 3MEWA 3KK1A 4DSFA 4GW6A 4DU4A 3SUOA 4FM2A 4CESA 3O4QA 1GOAA 3OYGA 4DTNA 5M9OA 3DLEA 2WOMA 1IKXA 4F8RA 4QVZA 1NK6A 1X9WA 4F3OA 2Z1HA 1T03A 3EYZA 4E7IA 2HHSA 4FLTA 3DB3A 3PMTA 3ALYA 4G1QA 3DYAA 1VSMA 3L8BA 3JSMA 2IAJA 3NHGA 4C5EA 2RN2A 3OYFA 3OYBA 3S6WA 4FZZA 1TGOA 3MEEA 3SJJA 3OB9A 4QOZB 1VSLA 4E7KA 2F5KA 3ZSRA 1RI0A 2KZZA 3ZSXA 1SKSA 5FRMA 3IAYA 4OPKA 1JL2A 3DLGA 3TANA 1SL1A 1RT4A 1VSFA 4AHUA 5HRPA 4II1A 3ZT4A 3FEOA 2RHXA 2BKDN 3NFAA 3SUNA 3KIOA 1NJWA 3VQAA 4UC4A 4PQUA 4EZ9A 4F2RA 3KLIA 3AA4A 1U04A 2XRIA 4F2SA 4DTSA 4DSEA 3OA6A 3PX0A 5SWMA 3D0PA 4N4HA 3HVRA 4FJXA 1KCFA 4KRFA 3DMJA 4N4IA 2QXFA 3VN5A 2X78A 4C8OA 4IDKA 3DOKA 1BIZA 3SUPA 4JS4A 3NBPA 4DTOA 1BCMA 4KO0A 2RJDA 2O4XB 4CF9A 2HHUA 4FLUA 3LLRA 2OZSA 3ASKA 4C5HA 5CYQA 3VQDA 2OPRA 1FKOA 2BANA 3MAQA 3DB4A 3PV8A 2OZMA 2OA8A 3HVTA 3PO4A 2VWKA 3D45A 2EFIA 3QEPA 2BDPA 1JLGA 3QERA 2F8SA 2K3XA 4FLXA 2D9TA 1HMVA 1HRHA 2JTFA 3DRSA 3VQQA 1RTJA 3KLHA 3QIIA 5IN1A 4DS5A 2ITGA 5J2NA 2YNFA 3LPUA 1U48A 2YV0X 4N5SA 2Y1JA 2OPSA 1MHNA 3NGZA 3V81A 4I9LA 1W9HA 3OY9A 3G0ZA 3I0RA 2BGGA 1SKRA 4HCZA 3V9ZA 5KGXA 1A5XA 1NKBA 4HUGA 5SZTA 3C6UA 2EHGA 5K14A 3NDKA 3HP6A 3PY8A 4DTPA 3QBYA 3ZCMA 3RWUA 4ELUA 4CJQA 3HK2A 3DI6A 4KFBA 3LDSA 1NKEA 4W5NA 2P1JA
chains in the Genus database with same CATH superfamily
1HBXG 2ZM6K 4WF2A 3CMAA 1K9MC 1M1KO 4NQWA 1GLJO 1B34A 2DXCA 2QENA 1EIFA 2QQBA 3MKZA 2EYXA 2W41A 1NGNA 3H0FA 2O8EA 4MDBA 4FK4A 1EF4A 4D5FA 4QS8A 4LD6A 3WQUA 2LVSA 4IOCL 1YX5A 3CJRB 4OB0B 4DQSA 4DR7K 2KIQA 4DUZK 5F0HA 1Q1HA 2DPPB 4CEZA 2VQGA 3FZFA 2TCTA 4CJVA 3VF4A 2VCPA 2QK0A 4G9ZA 4NC8A 5KQ8A 3KZZA 1KONA 1DU0A 4J9HA 1ESVA 4OLBA 3MZYA 1W7AA 2EZLA 3OR1C 2WSFE 1IN4A 2KRCA 3R60A 3G71A 4DV0K 3JRAA 2JG6A 4XLFA 2KT8A 2Y48A 5A0LA 2XHIA 4F7UB 4V19S 4RW4A 4FJNA 1JUSA 3QEVA 1TLHB 2LCSA 1PRLC 4RTUA 4CJ3A 4CEDA 3VA3A 1WKMA 4DQQA 5LRSA 4JRKA 3I55N 1C0FA 1U5TB 4JKGA 3OQ5A 2O88A 2CYYA 1C1BA 4F4KA 1ON2A 3NMZC 4LFUA 4RW6A 4OLAA 4YHHK 1YIJT 1OR7A 1A5JA 4AIKA 1JKQC 1I0CA 5AQXA 4B3OA 2ZNYA 4YFXF 4NCAA 2R7FA 2BYVE 3LSPA 5J2PA 1LW2A 2FQ3A 2F5FA 4U0YA 2GOMA 1OYXA 4DUYK 1OISA 1KG3A 4BHCA 2UXBK 3A2FA 2E7XA 2DBKA 3NTKA 1WJCA 3B73A 4BRQA 2DMTA 1FOXA 1IZ6A 2D1XA 3EZWA 1KC8R 2R3SA 3WU1B 3HDDA 1EH7A 2HQEA 1CZ9A 5JI6A 4A93J 4WK8F 4XORA 4BREA 5HLIA 2L9VA 2FBHA 1NM7A 4C2UA 1JL1A 3IMXA 4QVCA 4LF9K 5ED4A 2YHAA 4PCQA 3KK7A 3MEXA 2VXFA 1I4K1 2Y69H 2WC2A 1BI4B 3EKSA 4B6MA 3RMSA 1ZG5A 1RETA 4NXMK 3CHWA 3CC2Q 2EQRA 1KD1O 2NRZA 4EW0A 5ERIA 4AM6A 1IJWC 2QKMB 5IP7J 4JKEA 5I2MA 4YFUA 2M87A 2A6EF 4HCCA 3K70D 2HNZA 1VQ9I 4DS4A 1U3EM 2X48A 2XY5A 3CDIA 3BG9A 4ESRA 5GAGJ 3OSGA 4Z94A 3DLMA 1R22A 2XKOC 1JXBA 4XRSA 1LWYA 5D5WB 1R5GA 2JWTA 3ZX2A 1YG2A 1RBTA 2FXUA 3L09A 2JUGA 3AO2A 2AJQA 2AO9A 1ZBUA 3ZQQA 4F04B 2R7SA 3NF9A 1ZARA 3K5MA 5D4RA 4KH5A 1HPZA 4AH9A 3FBIB 2H09A 4I6MB 3NQOA 5J4YA 5L23A 2CT4A 3QEWA 4KH1B 3UF4A 2P9LB 3THWB 5D8LB 3FIWA 2RHYA 3CMAI 5BS6A 3JCMQ 1VQ8T 4IHTA 4XKVA 3O8VA 1BN5A 4P9FA 1F9NA 4MFDA 3EFSA 4PHTX 2COMA 2D1HA 4AC0A 2KSSA 4UV8A 3RPUD 2DMPA 1QVTA 2NWMA 2DE0X 4F14A 2BGCA 4DA4A 3ZSYA 3M0QA 1VQON 1OU9A 3FZMA 3EQLF 2DPDA 1LCKA 4K0KK 1UGPB 3OYCA 1AHDP 3OMGA 1OVQA 1S9HA 3HM5A 3QU6A 1MBKA 2PEXA 2PZSA 3CC4A 1EETA 2MD5A 4MMLA 1BC8C 2F96A 2F69A 1Y7XA 4GV9A 4PDKA 5BREA 3M8JA 2JUCA 4CCOA 2ZC2A 3G71I 3VERA 3VPRA 1OPKA 2W42A 3QYFA 3TVTA 4DQIA 1AEYA 3CWAA 1QQCA 5KNLA 3K1PA 1KQ0A 2HVQA 2FSJA 3E1SA 2YX6A 1VTNC 3U6FA 3ZT3A 2DA7A 3JCMX 4XN0A 3AY9A 2ZXJA 2X1EA 2JJ7A 3OL4A 1YW9A 3U9DA 3A02A 1XN7A 5D6FA 1Y1VJ 1FZPB 1ZG3A 4CEBA 4KNYA 4C8LA 3ECOA 1S1WA 3AVLA 4BRKA 3WGGA 2QDLA 2M2EA 2CZ0B 3CBOA 3CD6N 4B4CA 4BY9C 1D8KA 2W0ZA 2UUBK 2G8KA 3TABA 3AO4A 4BY6C 1Q9YA 2OTLA 1QZZA 4NZGA 4B9QA 3WU2C 3RRHA 1ENHA 3LWFA 4HOBA 4BY6B 2L01A 4H0EA 2EZHA 3L2UA 2HI3A 1JGGA 1IN5A 1G5VA 4H5RA 2HHVA 2JTMA 2PTKA 4XLNF 3LA7A 1NJXA 3LFUA 2DVEA 4BYYA 3VV0A 1WHJA 2EWNA 1SVOA 3GFMA 5H20A 5F1XA 3A0HC 5E3OA 3PFYA 2E6LA 3LWHA 2FPDA 2IGIA 1BISA 5I21A 3VGMA 2F4MB 3EYYA 5DY9A 3KP6A 1ZGAA 1DEJA 2RPIA 5GAN6 4KHYA 4XRSG 1FBQA 3S14J 2QQ8A 5L3BA 2KIUA 4PKGA 1R1VA 3G4SQ 4FOEA 3S8PA 2P4TA 1EA3A 1QMCA 5AQZA 1OULA 4A4KA 3D5SC 5AN4A 3PJRA 4B9NA 2GOXB 3F23A 4B1YB 3TSQA 1Y0UA 2HB5A 3GPLA 4KREA 1P6RA 5LFAA 2KLOA 5LGTA 2RO0A 1XDSA 1IZ1A 1NGIA 1JKHA 5GMKi 3U21A 1SEUA 1TK0A 4M71A 4WFNL 4UNFA 2HVRA 3CMEA 2NRAC 4DFJA 3FXLA 4OPJA 4KI6A 1XMOK 1R1TA 2N8GA 1HCRA 1QVGP 3VF6A 4CK2A 2LC2A 2NYXA 1VQKQ 4LD5A 4QQ6A 1LEAA 4UVCA 2L3RA 2ZXIA 1K8KA 1WSFA 2OJ2A 1QSLA 3AVCA 5B3SH 5FKNA 4NO7A 4CIFA 2D0NA 4HG2A 2HXIA 3E97A 3CCLA 4B09A 3OYAA 4AI5A 4IFVA 3KEYA 4QSHA 3ZEHA 1VQ7T 4OGCA 2QKKA 3DU5A 1JGSA 1WNLA 4FJKA 1K9MO 2P9IA 4MDWA 3BG7A 3V4GA 3T1HK 4BEHB 1AWJA 5LD2C 4B9LA 5AQYA 1Q86R 3ABLH 3KXTA 1OQYA 2V8IA 5GTIC 1B6AA 1K8AC 3Q9VA 3CC4I 5ICCA 1ASVA 2UUCK 4ESFA 2V7ZA 4BHPA 1K73C 4KTQA 1VSDA 3WHBA 1YHQQ 1A04A 4MO4A 2M8GX 4OPAA 1S72T 3ID8A 4ZYAA 3SJMA 1Z7LA 1ZBLA 4ZDOA 4AHTA 1KQSM 4A4FA 2LY2A 4RTTA 4A6DA 1NK7A 2M9HA 1IRZA 3O3FA 3T1BA 2A07F 1TT5B 1E0EA 2B6AA 3CCRT 3CWUA 4O0JA 3SEMA 1IKVA 5FU6B 3K7AJ 4OFEA 4CIGA 4DK9A 4LMYA 1MBEA 2J6KA 1R5HA 2FSWA 2W7NA 3MXIA 2EGAA 4CK1A 3LSRA 3M0UA 3QKJA 1L3TA 5GAMj 4BNCA 3JCMW 1XSXA 3KZBA 2XY7A 1V29B 3FZVA 1JLFA 3J7AO 2OTLI 1WGXA 4ILGB 5HS7A 1POGA 1M90C 3SQNA 3AVAA 5FPDA 4EP5A 3SQ1A 3SD4A 4PL7A 3OGDA 2LQNA 2NUPB 4XONA 3JB9J 1JT6A 4JOMA 2DK3A 5BPNA 2GBYA 2HQHA 2FYKA 4BI3A 1L5UA 5BMZA 3M8PA 3ZSWA 4JK1X 4A5NA 2A3SA 3VUBA 1N8RU 4Z4HA 1SAZA 3DKWA 2LSOA 2PBIA 2J05A 4RW8A 2HBMA 2FQ4A 1PU6A 4XOTA 2F9TA 4K8XA 5JS2A 1UAXA 4B9XA 1JQQA 4FWMA 5K5OA 1PC0A 3HSRA 2QGGA 4ZDLA 4JJDA 1AWWA 5GAOn 3VDXA 1BBYA 1ZUUA 2ROLA 2KPMA 3LSJA 1SRMA 3GYHX 2K5CA 4XQFA 1IBKK 1UG0A 2ETJA 3D1NI 1V4TA 5CPRB 3WXLA 1S6PA 5C0YA 1AVZC 2EILH 5J8CA 3H9NA 4LK1F 3CMEI 2XC7A 1XGSA 5LMNK 3O9RA 2CYZB 2JMCA 1VRUA 2PQ8A 4JI3K 4C0DC 3MVPA 5DTDA 4EJTA 4NC6A 3LMMA 1FOYA 3O1BA 1NG2A 2GBZA 4C0DB 3CM6A 1ZHFA 3LZIA 1KK7A 4CZZA 2QCOA 1NBEB 1O9SA 4KN7X 2G6FX 1VSHA 1MMGA 4F52A 3NH0A 1LDDA 4U0WA 1GLLO 4R1HA 5BPIA 1VQ6A 3HJFA 4B3XA 3MX5A 2VASA 1BUPA 2L02A 2WA0A 3CCLI 3CCUT 2XGCA 1YI2N 3VYUB 4EM0B 1X1BA 3QZ5B 2TRTA 3X20B 5GAGP 1JE8A 3FMRA 2K9NA 2EA4A 3CJAA 1BU6O 2P9SB 3V1RA 2QA4A 2HF3A 3JCMc 1T8IA 2GUIA 1TKDA 5AZIB 4KBMB 2WADA 2FBIA 2CSQA 3G10A 2DJQA 1JJ2P 3CP2A 2BVLA 4MQ9F 1B4AA 4HVVA 2FNPA 5H6RA 1KZHA 4N76A 1PKTA 3JRCA 2SRCA 3VQCA 3SYTA 3WTXC 2PYLA 3T3FA 2CUDA 5J39A 1IBLK 4HUEA 2KHOA 1PG5B 4LF8K 2O8DA 2E4HA 3THKA 3TCJA 3HSFA 3U2RA 1TQPA 1RRJA 2ENMA 4HNTA 2M1HA 2F9WA 4X66K 3N4QA 3U1DA 1SAUA 1CLQA 3BGRA 5E26A 4ZN3A 4KISA 1Q9XA 3VOEA 3BOQA 1VQMA 4M45A 3TQ7P 2EV6A 1JJ8C 4PSWA 2RGVA 1LAWA 2YUQA 1K1ZA 5HVQC 3HKZA 3QLHA 4CYCB 1LW0A 4D6WA 3FJ5A 2CDTA 2EGCA 4F7ZA 2DFFA 3OYDA 2QWRA 3BJAA 1HKGA 4AYBN 2A28A 1VQOQ 1Y56A 2BHZA 4ICLA 3PGGA 3AA2A 1YJNT 2O8FB 3KTUA 1JHFA 4M3UA 1VQ4A 1E4GT 2VPRA 3C0CA 3NAEA 4M7AA 4YIRX 2LQWA 1PU7A 4XEIA 1TYQA 2LCLA 2FBYA 3SYZA 2GXBA 4BQLA 1WIEA 3I33A 5GIOA 1JUMA 4LB5A 5GAHJ 4K2EA 3CIPA 3QQAA 4EJVA 4QPOA 5E41A 4PLIA 3ZN0A 5GAEJ 1T8EA 4JZ3A 4BDYA 4FPBA 2DL5A 3QJYA 1QVFA 4FJ9A 2KRMA 3KYLA 2K57A 4FE4A 5DCFA 4ID1A 2R7XA 3CF5L 1MWMA 3OW2M 3K4JA 4FETA 2YUNA 5KPRA 2WTUA 3BTLA 1ITYA 4B48A 4M75C 3VYRB 1Q81C 3HBLA 3VSLA 1WEGA 4ELYC 3CD6Q 2IVPA 3GO5A 2LY1A 2DA9A 4M75B 2WAQA 4JPBW 3K57A 1T56A 3FKJA 4PZJA 3PNTA 4IHVA 2ACJA 4G7OF 1JLAA 4ASNA 1YTAA 1ZLKA 4FIBA 2NUTB 4M6YA 2FZKB 1JJ6C 5LJ5e 2F5VA 4EJYA 4CEEA 2ZSHB 4NCGA 3K5LA 4BI8B 3CCEN 2M16A 2V51B 3E66A 2GWJA 5CYMA 1T0FA 2XPWA 4O44A 5HRRA 1FOKA 1CXQA 1EWRA 1WHUA 2BY2A 3OR2C 1HF0A 4MTDA 3HRGA 1VQ6I 3BR5A 1TXQA 5FWCA 3KKSA 1R4NB 1IDYA 4BQZA 3NTIA 4RAGA 1UFMA 4RGSA 4KH4A 1G15A 3ULRB 3CFRA 2EQJA 1V5GA 5GAOm 2YNGA 4CRIA 1H89C 3CJNA 2LF8A 4FWSA 3V9WA 1ZN2A 1ZG1A 1VYUA 2VE8A 3VEYA 3J81K 4M42A 2CW8A 4KHQA 1XC9A 2A5WA 4CI0C 2QA4I 2IA0A 1U2WA 3RPQA 4XU1A 2QBYB 2P9UB 4CC2A 2XY8A 4AT1B 1K6YA 2OUMA 2HHQA 4CHUA 2P6TA 2XAFA 5KTQA 4CHZA 1EBMA 4M6XA 1LWFA 4DTUA 3RJPA 3FFIA 3G1OA 4ILJA 1FEXA 3RSEA 3I59B 2X51A 4J7IA 2EYYA 5J3LA 2FXAA 4AG2C 1K8AO 1YWPA 4C92A 2ZBKA 3DKMA 4GGGA 4AIJA 1K73O 4CZJA 2K9MA 2JWLA 3NTHA 3CUOA 1TWFJ 5C15A 3E7LA 1X1PA 4JLHA 2XDVA 1ZRCA 1N27A 4V2SA 4CBXA 1MJAA 4M7AG 4RM2A 1S1VA 3PNVA 3LGLA 4S04A 3PO2J 3ML6A 1VQMI 3JCMb 4ELVA 3EFOA 3GBTA 5M1PA 2QSHX 1HOMA 2WFBA 1U9NA 4J00A 2FB7A 2L4MA 4AMCA 1OYWA 1MDMB 1VQNT 2FBTA 4CCLA 2CV0A 3JAMK 1WDXA 2KROA 5K7FA 2XIGA 1ZR4A 3W2AA 3QDFA 1QZYA 3VEXA 4DQRA 3G71N 5KRTA 2JRTA 4BBRJ 1LWVA 2GV9A 3ZEUA 2RNJA 1XB4A 1VQ4I 3SXYA 4N41A 2BY1A 4FSSA 2WC9A 1GVJA 4I0BA 2R7DA 4L0ZB 2RF0A 4L6V5 1DLOA 1M90O 4AI4A 1SPKA 3A1YA 4BGBA 3CJ7A 1TKXA 1P92A 3G3ZA 4FVUA 1B72A 4I98B 2RPNA 1SFOJ 1BJZA 1XQPA 2L8DA 2GFAA 3A1PA 3LL3A 4OMFB 4HA8A 3KX2A 3FMSA 3AA3A 2Z1GA 1R6RA 4IJNA 5C3EJ 2MPXC 3T8RA 2NYSA 2OYQA 2Y0SA 3NHNA 3S15J 1A36A 2J7IA 4MLEA 1UHFA 4DG1A 2EB7A 1Q82U 5CR2A 4XU3A 1DT9A 2KT1A 2VWBA 4DYQA 4B9MA 4CZFA 4NC7A 5C25A 3CJTB 2R5YA 1MBHA 2KBTA 1FP2A 1X3NA 4BHBA 1U2VB 3DEWA 1NGJA 4M9SA 2X6XA 2DIGA 2KDSA 4EGYA 2RI2A 3TOBA 4IUQA 2IRFG 1ZTRA 4OVAA 3AA5X 5CAIA 3CEYA 2KMTA 3O9TA 1TAUA 1T33A 3REBB 1K7AA 2YU9J 1N6QA 4HQEA 2A7YA 1OPLA 5D3GA 2HKOA 4DCHA 1YQRA 1K78B 3ZMVA 3P7NA 5BR8K 2FEZA 5JVGF 4ANJA 2XF7A 5IHIA 4X34A 2DA4A 3N0UA 3IKVA 3EG2A 4KHNA 1J5YA 3CPFA 2OZUA 4M3GA 1QCOA 4C92G 5KYUA 4PFZA 4IRIA 5D7UA 4FE7A 2YPRA 1SMTA 4M3YA 2CU7A 2EBIA 3L9FA 3NEUA 2YJEA 2OV7A 1N5YA 2QLZA 5LY3A 4KAZA 3W6KB 2F4IA 4BI4A 1DUXC 4Q47A 3M1EA 1GBRA 1NLVA 5ADXH 5CQEA 1RAEB 4Z2YA 4CFCA 3GNFB 2DA6A 4HF0A 2KQ2A 3S6IA 3MKLA 4BR2A 3RNJA 1JXOA 1T2KA 4CJRA 3E5UA 2Q2EB 2D45A 3GTGJ 1XQSC 3E9GA 1REPC 4A4EA 4ENKA 1WBBA 3DPTA 2JPCA 3CJCA 2RQVA 1Q7YC 2E7WA 1G59A 4BC4A 1RT2A 5FDLA 3VU3C 1IG9A 3SMSA 4IX7A 3CCVN 3U9ZA 3ULEB 1KG5A 2I0NA 2OPTA 4GCVA 4M3ZA 2ZPGB 3TKYA 3LOCA 3I56N 4AHSA 5AQLA 1CZBA 1VQ7N 5TKWA 4G6QA 3R1XA 1BO5O 3GBGA 2HWVA 5DM7R 1YAGA 1TKTA 1CXUA 3ZXSA 3PFIA 5ADXA 4RLFA 1YI2Q 2X74A 1KVCA 3LSHA 4PJOC 4DTMA 4H03B 4DTRA 3IRXA 2A0FB 4L5GA 3M3YJ 3R6MA 2GZWA 2E1MC 1X1CA 4PJOB 1YTUA 4E7JA 1VQ9T 2E1YA 3DLBA 2L2OA 4QKUA 3E5XA 2IPQX 3VEPA 5K5RA 5LJ5f 5CHZA 2EQMA 1OZ2A 2LLKA 4CHQA 5BR9A 1WBDA 2YR2A 2KDOA 2YHBA 2V1RA 4QS9A 3WTVC 5JR3A 1BI2A 3PNWC 1WSIA 3GP8A 2ZSIB 1RBRA 3O3HA 1QP3A 4JX5A 4NYNA 3Q9SA 4IZZA 4IUPA 2RD1A 3TAMA 2LREA 4GV3A 3KE2A 3VYTB 2OTLN 2HQAA 5KPTA 1L3VA 4KIGA 4RMNA 3E9FA 4O6JA 4DV6K 5AQRA 3NFCA 3N4MA 3TPQA 2X4YA 3FC3A 1XQOA 2DI3A 4K42A 4QCLA 4C3JJ 3BEXA 3KD5E 2BY3A 3SAFA 3H3UA 1TAQA 1RUOA 1Q81O 3VF2A 2DXTA 3RRGA 1NTCA 1XD7A 3QP5A 1SHFA 4L0YB 2UV1A 3MP6A 5GAHP 5J3BA 3F3XA 4ZYDA 2QKLB 3ONQA 1KC8C 5GAEP 2AK5A 2X35A 4M3EA 4AVPA 4BKXA 4RCBA 2VKEA 3JTGA 1WOQA 5LGNA 4V2FA 2KTQA 2GXGA 1ORKA 3BC8A 3G2BA 2B7EA 1DIZA 1WZOA 2MIOA 2XKOA 3C3WA 2K6DA 2XSJC 5EF6A 1TSFA 2KT0A 3KK2A 3SZ2A 2J4RA 4NLCA 4M7DD 4KT0E 1YITN 3QYBA 4CZIA 4CZHA 5CK9A 3K2PA 1XNRK 1N9SA 4IHWA 2P9LA 5I9EB 3FJPA 3THWA 1YIJQ 4R0KA 1WHHA 1TTHB 2QF7A 4GW6A 1N36K 3ROUA 4DU4A 1GOAA 3V8KA 2OD5A 2HBLA 2WOMA 1IKXA 3R6NA 2H94A 3R61A 2V7YA 1MNEA 1QO0D 1UGQB 4NLBA 1X9WA 4F3OA 2DL7A 2EJGA 3ESWB 3OIOA 1T03A 1WQ2A 1ZKGA 3CC2A 3C6HA 3X2QH 1O57A 2ZXHA 1WRJA 4FLTA 3ALYA 5DEQA 1I27A 3C6AA 3CCEQ 3JV3A 1BI3A 1HJDA 4A12A 3H1VX 1E3MA 3SZGA 2O6GE 4B44A 1X2NA 2UXNA 3ZL7C 1M3HA 3PIPF 2P84A 2E8AA 3KZIC 1RUWA 4ORZA 1TGOA 1Z3XA 3SJJA 2EA2A 2JW4A 4M77D 1U06A 1R23A 4OFAA 3HGYA 2YDLA 4E7KA 1M1GA 1ZBSA 2V75A 2F5KA 5EEGA 1M2VA 1TWBA 1Z9QA 3IAYA 3AL0B 2R93J 1TWAJ 1RABB 3ZBDA 4DBFA 4JYAK 5HRPA 2PG4A 5HK0A 4M78C 5C12A 5GP9A 2OA4A 2DTOA 3HOSA 3LWIA 2MYSA 2LP5A 2DERA 3M59A 3OOPA 3WQTA 4XU0A 3ZETB 3CPWM 4EVIA 2E88A 2OX7A 4TV7A 3KIOA 3INZA 4U87A 2C0TA 3B6CA 1QVFP 1T08B 1NJIC 3KLIA 3EKUA 3EGDA 4BY7J 4CZMA 3C7NB 5AONA 2BZYA 4KMUX 3CUQC 4DTSA 3KVGA 1K6OA 1AKHB 2EW3A 5SWMA 2NOFA 2DLPA 1GLNA 4N4OB 2QM3A 5TGTA 1TUGB 3CUQB 2QEXN 3DMJA 3T69A 4MFEA 3AHUA 2QXFA 1O3TA 4EA5A 4KULA 2X78A 4C8OA 4IDKA 3REAB 3DOKA 1XGMA 2F48A 2GIZA 2CWEA 3NBPA 4EQQA 3D2FB 2OAZA 2ZWHA 3BZ6A 3DCFA 3LLRA 2QG9B 1VQLN 2VJ5A 5HDKA 2OZSA 2BOLA 4A2BA 3H3VK 1BR4A 3I4MJ 3FMQA 2OPRA 1FKOA 3CWSA 3CC4T 2OU2A 3MAQA 2OA8A 2QYOA 3HVTA 1W36D 1R49A 1SQKA 2QI2A 4IVNA 5ILSA 3D2EB 4HX8A 4A3FJ 3CTAA 3MKWB 4E2FB 2K3XA 4XU2A 3QFPA 4XH5A 2QWLA 1X27A 4FLXA 4BC2A 1FIPA 4PGHA 3BF1A 1KQSP 4CCKA 1FP1D 4BC3A 3QIIA 5IN1A 5M1FA 3GX4X 1IB8A 1U48A 2Y1JA 2Y9ZA 1MHNA 1P4AA 1FPQA 1YFNA 4HVUA 3LSGA 3MX2A 1SKRA 1HYOA 3HXLA 5KGXA 1QVUA 3GMEA 4A3BJ 2DXBA 5M1QA 2OFKA 1UHWA 5GAOl 1W7PD 1WXUA 3T0YA 1R9TJ 3O8HA 4N0BA 3WGHA 2DETA 3RWUA 2YCHA 1XMAA 4HX7A 1UG2A 4E6KG 3DI6A 3VB2A 4BH9A 2FEIA 3G4SA 4OB1B 2D8HA 1VNDA 2MW8A 4OINF 1NKEA 3H3OB 4A6EA 3CC2I 1EQYA 3JCMJ 3IDHA 1N34K 3C18A 1O75A 1N78A 1S9EA 3J8AA 4FM0A 2D0BA 2W57A 1RAGB 2CH4W 2EVRA 2LX7A 3SWNC 2HOAA 4LN2A 1E6HA 4DR2K 4Y15A 2RKIA 1Q7YO 1F36A 3SWNB 4ESBA 5GANe 3IC7A 4OAYA 4D1QA 4I02A 2XSDC 1RAAB 5E84A 2VC1A 3IKMA 1U8RA 2L3DA 3S16J 1QRYA 5CZ2A 2UXDK 5FWBA 3LSTA 5IT9E 4GKJK 1VQKA 4JKFA 1Q86C 2KFDA 2VXEA 3U1KA 2ZPIB 4GYIA 5KCMA 4LDVA 5DMRA 2JHNA 3G1JA 1TK5A 4B9UA 2ZE2A 1VZ0A 4O0IA 4L9TA 3ENHA 3A5LC 5LJ3e 2PFUA 4M4ZA 2WAFA 2DU9A 3CMET 1NG7A 3KUFA 2M5WA 2JPBA 4PJJA 3MWPA 1OFCX 2DYBA 1NM1A 4FT8A 1ZYRF 4EHTA 2G0EA 5LGUA 3CQ8A 3W2VA 2RV8A 2VBYA 4X64K 2CREA 2NRRA 3AVFA 2ME0A 4E70A 1BM9A 2OCEA 5I42A 1HYVA 1C0TA 2CFOA 2VC0A 1U1SA 3KWIA 3CCVQ 2NLUA 4E6RA 1L3UA 2MABA 3QSUA 2V6EA 4RTWA 2Y1IA 5JLFA 4KN4X 4EIKA 4DSLA 3SBGA 2KRFA 3KPHA 4LF5K 3I56Q 4A3EJ 3ME9A 1MBFA 1YHQA 3ZGKA 4WXHA 1VQ7Q 4YG2F 2JXBA 1Y0NA 2I7PA 4LG3A 1UB4A 3MMVA 4F93B 4W5RA 2XHCA 2ZAEA 1MMDA 3DWLE 1HYZA 3GFLA 1W97L 1IUFA 4ZNXA 4JKCA 3CLQA 3I35A 4EM1A 2MCNA 3Q1JA 3JRFA 2X1CA 2ZB9A 4AHRA 4IQJA 4IOXA 4OGEA 1SVMA 2P9NA 2HDDA 4WCIA 3PL8A 1Z21A 3I0XA 5DCMA 2AQFA 5HROA 3O5ZA 3VEWA 2K5LA 4KHUA 5M1OA 2KJCA 1FYKA 1GOBA 3ASMA 2VKVA 1L3SA 1GLDG 4IUVA 4C8QC 5FLXE 3F72A 4LLNA 2E2IJ 5DLQE 1IRFA 2YRDA 1KC8O 4H5NA 3P38A 3TMOA 3QICA 4FW1A 3V1OA 1BW5A 1LWEA 2RQRA 1FBSA 5AQMA 3AVJA 2DTZA 2HTSA 2J5OA 5DUKA 3LH0A 1H88C 3TGNA 3JCUC 4J6YA 1BIAA 1Z0XA 5D8KB 1UHSA 1EJ9A 2KIMA 4P1WA 2B8AA 4XTXA 4FVMA 2OTLQ 3HOXJ 1AT1B 5HLHA 1P2FA 5C2FA 1H1VA 3VODA 2DJNA 2MH9A 3ABMH 1KVAA 5DDGA 4W5QA 5F64A 1YIOA 3KLNA 1XC3A 3BR1A 3GFJA 1Y64A 3HTVA 4CEFA 1HSJA 5KN8A 2X4JA 3RSNA 5IOYA 1HC8A 3TP3A 5AQQA 2EV0A 4A3IJ 3G4SI 4F3TA 4LGWA 5AZIA 3PLAA 2HNYA 3REOA 1K9AA 3OBYA 3QDKA 3EE8A 2XB5A 4AIDA 4GDFA 4GLKA 2GTJA 4FJIA 3I4NJ 2ZFUA 1NHAA 3H0HA 3CETA 3I8BA 3DOLA 1R77A 4DJAA 1R0BG 1NLPC 1RUNA 2V7FA 5EEAA 4JRQA 1RESA 1LB2A 2B4JA 2ICWG 1WJBA 2RA2A 3ISPA 2OQRA 2HHXA 4UHTA 1YITQ 3SAHA 1C6VA 2E5LK 1S7AA 2JNGA 1BYMA 2EX3A 2WAEA 5J40A 4LUDA 3MAJA 1SSFA 2KL4A 1VQKI 3OW2P 3MECA 4A54A 1GLBG 3J7YJ 4FU6A 2Y30A 1WNSA 4DIQA 5CKBA 5E17F 3VESA 1OX8A 2GQQA 3C4SA 3BPXA 1KIKA 1YVNA 3PSFA 3HRSA 5BN9A 2DFHA 4JJNK 4J5YA 1RPWA 4OKKA 2O8FA 2DO7A 1QA6A 4CJTA 3FDYA 2KK4A 4M78F 2YKMA 4I01A 4DV7K 1ITGA 3I8DA 2EFPA 4OMMA 2NOLA 1U49A 4UUTA 4RTZA 1H3ZA 1P9QC 3DU6A 5GMKj 1KFSA 3HPGA 4H0XB 3LANA 5IWAK 1TT0A 3IH7A 1CSKA 4JS5A 2J6OA 1NJIO 3TDUC 2BHYA 3OSSC 3DJCA 1S7OA 2XDDA 2V79A 1VQ6T 5JVHL 1TS9A 4IXAA 2Q97A 1Z05A 1YHQI 1T44A 1FMKA 5B1BH 1YXQA 2JVHA 3ZT2A 3SPYA 1R1UA 3BY7A 5FKMA 1SKUB 1H3HA 1UOCA 5L3EA 3V4IA 2M4GA 4M77E 4B9VA 3LDPA 2E2PA 4XLEA 2QA4T 4ESJA 3K5OA 4M75A 3O9QA 3IUCA 3H0IA 2HD0A 1QCNA 2FNAA 3H92A 2BXYA 4KGVB 2ESNA 3HL2A 2E2QA 3EH2A 1KQ8A 1YQMA 1S1XA 3EEQA 2KYMA 1RAIB 3K0SA 3K4CA 4MZMA 2RQPA 3NGIA 3VGLA 1VQ5N 4EHUA 4C2MJ 2WTEA 4CF2A 1RR7A 2OFIA 3GTQJ 3K4NA 2K9SA 3AVBA 5JVGL 2F2XA 3HXMA 3VQ7A 3SMPA 5GPCA 1VQOA 1A6QA 3HZ6A 4Z4EA 5GANf 4A3MJ 2QKBA 1QE1A 4Q5SF 4DLGA 4O5BA 1MKMA 1YTYA 1MSEC 1T6CA 1WLJA 4CD3A 3O3KA 3CC7N 1VQMT 5L3DA 2W82A 5CQXA 2QEXQ 1WFXA 2DODA 4O5FA 3JCMe 3C1DA 2PNIA 5AQOA 2XKPA 3UPUA 1FSHA 1I1GA 1R8OB 1J09A 2FJ1A 4YELA 3A8OB 4HDUA 4IHYA 5LJ3f 1JKOC 2JPSA 4NOYA 1OCOH 1MNDA 4UY8O 3EG9B 1VQLQ 2LNVA 2ZMEB 5FLVA 2QBYA 2D1VA 2P9UA 1VQ4T 5KAIC 2FMLA 2K86A 2ZJ2A 3U9GA 3QXEB 4YOYA 1JEGA 3CM5A 4F17A 2MBFA 1IRGA 3CD6A 2LZ6B 1ZHIA 5CVRA 4ILHA 8ATCB 3WG9A 4QW2A 2L7MP 3I59A 3FKIJ 3S1QJ 1F4KA 2MI6A 1UEBA 3TREA 3KJVA 4NUBA 4A5BA 5EZGA 2IC3A 1PNJA 2HF4A 4D5CA 1IW7F 1X69A 1O3RA 3BQZA 2FU4A 3H0DA 1S1UA 3K5NA 4DSJA 2DBBA 2M3AA 2X6OA 2XROA 1JTYA 4IOAF 2HSTA 1PSFA 2BTTA 1RT5A 5D6YA 1DGRM 4BUGA 1HW5A 3CCMN 1MIJA 1LDJA 4E1MA 2K9LA 3A03A 3WVEB 4KIBA 1KSPA 1BOTO 3JCMP 1Y1WJ 1GBQA 2L9NA 1Q86O 4BC5A 4EJWA 2X3XD 3PX4A 2NUBA 2FBVA 1M1KR 4D9JA 1V76A 3K1NA 4QAGA 4J83A 5KYYB 4OMLA 2HPMA 5HK3A 3JRZA 4CFBA 3RBBB 5C4XJ 3HFNA 4AU7A 3J80E 3IKTA 4BDPA 2VUMJ 2F1LA 4M9ZA 3P9IA 3L2ZA 1G3TA 1R71A 4YOUA 3JR9A 1N75A 2ZPBB 4X1EA 1D3BA 2R58A 4A57A 4M75G 3QYEA 4PSXA 1RBSA 2P0KA 3M57A 4C23A 2FRWA 4CC4B 4E9HA 1ZGJA 4DR4K 2IW5A 1X1DA 4BU2A 1BW6A 3NPFA 2W4SA 4CE9A 4I2QA 4FOIA 2XDBA 4L3QA 1W2BA 2W85A 4LDXA 3LP2A 5JICA 2BZTA 3HTUA 1SG5A 4E7ZA 4Y13A 4JX4A 4DBRA 3NH1A 2E20A 2IOCA 4CICA 3I9QA 4MQ3A 1RTHA 4FX0A 4O55A 4J2DA 1SEMA 3SV4A 2IVMA 1UCRA 4M7DC 2VG5A 1ZBJA 2DX1A 3NGYA 4C8KA 1TTYA 2CO5A 1IV6A 4M7DB 3GTLJ 3PT9A 2GA2A 1J7KA 2NVTJ 2LQ8A 1U2VA 3E6MA 2V1NA 4LF4K 1UGRB 1KAZA 2VV5A 5FGMA 5M5YJ 3CXCS 4EAHD 4H0PA 2L7ZA 4M74A 5D5VB 5FFXA 4LG0B 2VOPA 2DDBA 5ICEA 1RFQA 1P7MA 4JD2B 1K83J 4DBHA 1VQOI 4KPYA 3MXJA 2EZIA 3SFMA 2JLEA 4C8QF 2IP2A 4CUGA 2YUPA 4RB0A 3EUAA 1K78A 2XU8A 4F9OA 4EMKC 1WJ5A 2W84A 1OEBA 1P7IA 3AVNA 4JN4A 3O9UA 5TISC 2LJ3A 1JU5C 1RAHB 2JN6A 1TQIA 4EMKB 2NS7A 1ODDA 3PUFA 1NKUA 2MG4A 3BQYA 5AQVA 4HCBA 4CJLA 1IDZA 2BE5F 3ZQCA 3OWTA 2C06A 2QAZA 4G9YA 5IYBJ 3V7SA 4OMOA 4BWJA 4EMGA 1FMWA 1ACMB 3NWSA 3KLEA 2EIFA 4XNFA 3G6EN 1LOTB 2WBNA 1VHXA 1N8RR 5LHHA 4OFHA 1NNEA 1KD1R 2MLKA 3QWLA 4PJNA 2JGUA 2X6NA 3CD6I 4M77B 3MN5A 2HQRA 3ABKH 2Q2EA 4HV6A 1OOTA 4B8CA 4AVZA 3MPUB 1OI1A 4NS5A 2LBFB 3GTMJ 1DPRA 2V6CA 1YCYA 1O7LA 1WHLA 2PLYA 1M8VA 4JI4K 3CBMA 3PIPL 3QBXA 4DSIA 5KVRA 3OOUA 5F1RA 5LJWA 2QWNA 3R0AA 4DF8A 3D0SA 3SQ2A 4E7LA 1XHXA 2A3LA 3AKZA 3M54A 3MKDA 2Q8KA 2MWPA 2GA1A 1F1BB 2FVUA 3F9MA 2E2JJ 4OF1A 3L2CA 4JKAA 4MZTA 4F3QA 2G7UA 2X6SA 2YSQA 1RADB 4M3XA 2DT6A 4ELZC 4E9FA 1D5VA 4JI7K 3GW2A 3SBTA 4DGWB 2E36A 2LMDA 2RN7A 1AWXA 4N56A 3TR8A 2B5JA 1RAFB 4PJOA 1BBZA 1SC7A 1GL5A 2Q0UA 1MUDA 1VUBA 2RKHA 1H9GA 1TUYA 1MGTA 3PFSA 2K4BA 1LFBA 3I9V2 3MWMA 3FB9A 3RIRA 1G8XA 3WTZA 3QG1A 1W4SA 3ULDA 2I5UA 1V5FA 1R7JA 4OX9K 1Z25A 1VQPN 3S2WA 3RKWA 1S5JA 3HKSA 4JKBA 3J7YP 3VS4A 4QLCU 2XHKA 2BZ8A 2IGNA 4A61A 2Q36A 3JCMf 5F04A 1HKQA 1XQHA 3CCJN 4YEJA 3ABTA 4HT9A 1QQIA 3AG1H 3EHRA 3IS9A 1FIAA 4CYDA 2PUOB 1OKRA 1ZUKA 2PI0A 1X01A 4Y92A 3VQBA 4FJ5A 2JOYA 2NOGA 1QU3A 2Z99A 1BQNA 4BG9A 1APLC 5CVJA 3SHFA 2VJIA 1IGNA 3N5BB 3GF2A 3CI5A 3NVKA 4Z8AA 3FGUA 4EVVA 4P5OA 5CIUA 5IOZA 3AVIA 1DTTA 3HPOA 5LJ5h 3T8TA 5L8RE 4DLEA 3TSWA 3UKRB 1FXXA 3FF5A 4N4NB 3P9CA 2LD5A 4HKEA 4PL8A 1OH5A 3P4IA 2NNWA 3AVGA 1YI2A 3RQIA 1LKXA 3JSCA 4F16A 1K4TA 3LP0A 4E0DA 3HIFA 5FPNA 1W7PB 3R9PA 1YJ9T 3Q3SA 4G6DA 3CW7A 1BQMA 4Y28E 2M8EA 4YOQA 3ZQFA 2A1RA 3RCOA 2DMNA 1ZYQA 3IH4A 1ZSGA 4J2AA 1VK0A 5AFUA 3COAC 3H0GJ 1Z9ZA 4X9DA 2P0WA 3N05A 2K7LA 2RJFA 4XLPF 2XDPA 4CECA 2JA5J 3KKRA 3QOEA 2QWOA 2EH3A 4K11A 3HSBA 3QRFF 4LFBK 4L59A 3KBGA 3SDBA 2UZKA 4XTWA 5CVVA 4PIIA 3CZ6A 2O2OA 4RTFD 1PKSA 2F8TA 2ZPHB 3TTCA 2H3JA 1J0RA 3X28B 1QHGA 3QAHA 5LL6Z 2D2WA 4KB1A 2YUSA 2NRXA 4ELTA 4OO1J 4LK0F 2P5KA 4LJZF 2I5JA 2ZJPF 1VQ5Q 3SFZA 4EIAA 2E19A 3L3UA 2VE9A 2JMWA 4UV9A 4XN3A 2GXAA 1IXCA 3HSEA 4PJOG 3VS3A 3HRUA 1L0OC 1WSGA 5ELZA 2CH4A 4U7DA 3AAQA 3L3VA 2VJJA 2EYZA 4A4GA 2OTJN 3CC7Q 2DVJA 4BXFA 3TTFA 2BUDA 2HYGD 2DA3A 1GXPA 1GRIA 2XHBA 1USTA 3L2RA 5I22A 1MUNA 4LDWA 1MW7A 3K9KA 3DKXA 4O3MA 4C5GA 4M7AD 3MCPA 4FM1A 4JUVA 3RESA 3TEEA 1YRNB 5A2QE 1VSEA 4B43A 1JXMA 5LBQA 1KYWA 1M1FA 1ZA1B 2BE7D 3I0SA 1JB0E 1VSIA 2MSYA 4MGRA 3JYTA 4UUVA 3KNTA 4KA4A 5FLMJ 4QS7A 2NOEA 1MA9B 2OAUA 2O8CB 5C0MA 3AVMA 2MMPA 1IHWA 4AILC 5L3GA 4Z02A 1YIJA 4LFAK 3QWYA 2VQHA 4M78A 2EAYA 2RREA 3ZETA 3CFPA 3DRRA 3GIBA 3JRBA 1GLAG 2ZXWH 4FCYA 2DIQA 2CT3A 2EFOA 2TDXA 1NGGA 1Y96B 2L7FP 3KP4A 1YS7A 4TSXA 1TL3A 4IIOA 2H8HA 2EYQA 3PM1A 4BE2A 3EO3A 1S5LC 4A63B 5HS9A 4FJJA 2W25A 2EKHA 4BR9A 1QCFA 3J81Z 3KLFA 1RKWA 1S9GA 2YRVA 1AKHA 2FO0A 1O3SA 3M5AA 1AD5A 4QQDA 4BRNA 3HL8A 2DXUA 4XRFA 3RUXA 4BWMA 3CUQA 4KV8A 1RC9A 3K9TA 1LVAA 3NE6A 3CCMQ 1GLCG 3CCEA 4BBSJ 1XGNA 1TBXA 1EFNA 2VGNA 2WSEE 4NQWB 4BRCA 2LP0A 1GCQA 2M9UA 2RHKA 3H36A 3D2FA 3V9XA 4OB2B 3QO9A 1NEGA 3DM2A 2AS5F 2QZ8A 5C10A 3DXKB 5HBMA 4FJ7A 4P96A 1IXSB 1EWQA 3ABUA 1TUCA 1F1ZA 4KT6A 4I99C 1YI2I 2HYFA 4JNEA 1C0GA 4XTUA 3G73A 3KCCA 2DRKA 2MC4A 2KE9A 3GTOJ 2FZGB 3VYHB 2D6FA 3U23A 4RUGA 4OIOF 2YWWA 3L4IA 3K69A 4FLYA 3ID6A 2Q31A 3OYIA 4AHCA 5AIPA 3JAMZ 2HZTA 4HRIA 1NEBA 4DKWA 2DCEA 2IG0A 3E2UA 4XMYA 4YPHA 1G3YA 3UR3C 2LCCA 2FF3B 4U88A 3ZP5A 5CKTA 5GAN3 3ZYYX 1QQMA 3MN2A 2FF6A 2MD0A 2CSOA 3QU3A 4Y17A 3LAPA 1RIOH 3AVKA 2HHTA 1VQ8A 5AT1B 4C92D 2VT2A 5LEJA 4V19K 4OB3B 1RKTA 1USSA 2CV1A 4MMKA 9ANTA 1BHLA 1O7FA 4WXCA 2E1HA 2D0QB 5FKOA 1RT6A 3RTRA 1U1TA 2BW3B 3AFHA 5GINA 2YLBA 2VKHA 1TWGJ 3TAPA 2CP6A 4UXNA 5CO7A 2ASOA 3VQ4A 1UJ0A 4BXXJ 3F5TA 3IWFA 2FUG2 5HNHA 5CKHA 4BRHA 2R7OA 1NJZA 5HOOA 1E6GA 2Z0WA 1Q82R 3EUKL 2STTA 1ZUYA 3RTVA 3WNEA 2HVSA 2O9VA 4M73A 1UE9A 1S3JA 3BW1A 4GNIA 3F6OA 1FN7A 3SWNA 1U5TC 5GPAA 4M78G 1EXQA 3HPHA 3M0SA 2XB0X 1G2BA 4HLYA 2VL8A 1DGKN 3OHRA 2L3QA 3PQJA 3IHOA 4I0AA 1EZZB 4ZGEB 3T9NA 5EU7A 3AG3H 4FJGA 4GVMA 4OJRA 3SAGA 2E65A 4V2GA 1X2QA 1HPMA 3NVMA 3DLLL 3MCZA 3JSOA 4PWDA 4FXDA 3G6EQ 5IXFA 3H1CA 4W5OA 3H9JA 2P8TA 3O4WA 1PM3A 1YIJI 1KG1A 2KKZA 4M7AF 3IH3A 5IH2A 5BPMA 5C4JJ 4DQ8A 1WJQA 1K0SA 3S1MJ 3F9KA 5MLCQ 2OQGA 3S2HJ 3OYMA 3M4OJ 5HP1A 1BOAA 3W6JB 3DEEA 2A05A 4KKOA 3VA0A 2HU9A 3DP7A 1Z7UA 4ZZDA 2LYCA 5CE3A 1UA1A 1MBGA 5DS9A 3RZOJ 2QVOA 4U67L 3CG7A 3SZTA 3IWZA 3VQ5A 3OS2A 1NG9A 4WQ4C 3CCEI 3BY5A 1IN6A 3P8DA 2PQWA 2VOOA 1XG7A 1NK9A 1T0HA 4BGDA 4JHDB 1ILYA 1FK9A 2M4KA 3DLKA 3E9PA 4IZ9A 1QWFA 1ZLJA 4LSNA 2RHUA 1V55H 4MDXA 1NH3A 2E1CA 2X6WA 3W6VA 3QNOA 2E5KA 4ATOA 3L1AA 4OU0A 2NNNA 5AQIA 5HL7L 4IOCF 5HRSA 1QLYA 3K9JA 2CW0F 2ECCA 3DF8A 1SZ2A 2J06A 1VQPQ 1PD0A 4C8QA 1QPMA 2PMZN 5J1RA 1CGPA 4GY5A 3UKUB 4DQ2A 5KE3A 3H8ZA 2KHMA 2LRDA 4CHNA 3A8MB 1I50J 3C95A 2DEUA 2V9KA 3BTCA 4D7MA 3UDCA 1XJWB 4HVJA 3CCJQ 1VQKT 2YU3A 2FPFA 5LJ5g 3HBTA 2JA6J 1NK8A 3HFOA 3CCVA 1WCMJ 3CCQN 4JV5K 5IT9K 3TEDA 1U8BA 3BUZB 2EPDA 3HB9A 1WJFA 1XNIA 1VQ8I 2FOKA 4ZJZA 1YQAA 3I56A 1XDUA 3WT0A 1PJRA 2X9HA 4C1NK 1VQ7A 1M4ZA 5K7ZA 2HQXA 2ELKA 4PFPA 1X58A 1XGOA 1FNNA 1ZBFA 3CMMA 4YIIA 4E9GA 1RNHA 1MUYA 5GAN5 1ORNA 4C92F 3WEEB 1S8NA 4DV2K 4Y7NJ 2OAWA 2VUBA 1IF1A 3M3ZA 5E3MA 1EH6A 3NAUA 3K4BA 1BA5A 2V52B 3ATUA 5HLTA 4YOVA 4UVBA 4FM2A 5KK1A 3BE3A 3EG3A 2YI1A 3E19A 1S72A 4YORA 2HSPA 2DL3A 4QVZA 5J1UA 3O6WA 1NK6A 5LMUK 3FXUA 2CV2A 4B3RK 3FWEA 3EYZA 4JI6K 1OCPA 4S0HB 2O31A 4IFEA 1M5Q1 1SFEA 1IBMK 1WPKA 2ZKZA 2JA7J 1H641 3NHGA 5BRDA 3GTKJ 4JZ4A 2VC8A 2Z2SB 1K79A 5FD5A 3CCSN 3ZMTA 3K2AA 3KZYA 2FD5A 1S3XA 1ULYA 5FLXK 3ZSXA 2LG4A 3LNQA 4OPKA 3ZQHA 1AOJA 1SL1A 1RT4A 2CGPA 4XSZF 3SEZA 3LM9A 1ZK8A 1OVYA 1K8KB 2VQCA 1RLPC 1K8AR 3F2KA 4BL0B 4YRVA 3IRRA 4A69C 3AG2H 3VS1A 2OTJQ 1P59A 1Q18A 1H8KA 1N5ZA 2EBPA 2BBYA 4ENMA 1AOYA 3HZJA 3SUNA 1YBYA 4C8QG 3B6AA 1FTTA 1W2BS 1ERDA 3PTAA 5AQPA 2JJ9A 1XG1A 4UC4A 2ASMA 4M7AE 4PQUA 1YJWN 4F2RA 1X2KA 3E9OA 5FKKA 3FHZA 1YITA 3AA4A 1U04A 3C7JA 1LPQA 3QODA 1WPYA 3Q0VA 3I55T 3PX0A 2LT1A 3UNGC 3D0PA 4N4HA 3HVRA 3J81O 4KRFA 2R7QA 4C0ZA 4A2AA 1XC5A 1ZELA 1TL8A 2DFIA 3VN5A 1QVFM 2WV1A 2EJFA 1M1KU 4PK4A 3A01A 4OIRF 4X1VA 3QO3A 3O1WA 2DZCA 4IEJA 1BCMA 2RJDA 2EV5A 1M90R 4H5WA 3WHCA 2HHUA 2VYPA 1DDNA 1KQ2A 4WFAL 3FXQA 2KY9A 3ASKA 1YN8A 1Y8QB 1TP4A 2LTPA 3DFGA 2XASA 5GAN2 1I1SA 1KEAA 2OZMA 4FYWB 2M7AA 1RL2A 3D5RC 4FT4A 3PO4A 3L00A 3K4KA 3CCVI 3BR3A 4G8XA 3CQTA 4CI6A 4CJ7A 1IXDA 1NK3P 1NYFA 1J3TA 2DRMA 2BDPA 2F8SA 2EINH 5CKEA 4B1ZA 2F4OB 3I56I 1PP8F 1HMVA 1HRHA 4GYGA 1VQ7I 1Y07A 3BG5A 2JTFA 1GFDA 2H6CA 3WG7H 4XSXF 3VQQA 3KLHA 4DS5A 2ITGA 5J2NA 5CKDA 2YNFA 3DXJF 3JAMO 4A0ZA 5M5WJ 2YV0X 1YJ9N 2OPSA 2P6SA 4I9LA 3IP4B 3ZCOA 4JJCA 4O8UA 2XAJA 2G9WA 1T3SA 3GL1A 4HCZA 5GANh 3V9ZA 4X62K 1RLQC 1NKBA 4RGRA 2CGJA 5J1YA 5HY6A 5GAMe 2EHGA 2DJZA 2E34A 2VQLA 3R3LA 4M6VA 2RQWA 4NB4A 2OCCH 5LLQA 1S72I 1SAXA 4F7UF 4ELUA 1WJDA 5FU6C 2QQ9A 3Q5FA 4RM3A 3FM3A 1UELB 3LDSA 2FZCB 1FYLA 4F55A 2P1JA 4KGXB 3O6BB 2JK3A 1M1EB 1N77A 5CYVA 2EQIA 4I2PA 5LJ3h 2YKNA 3CO7C 4HNVA 1D3YA 3P39A 2MWOA 2LX9A 3KP3A 2PX9A 1N32K 3W2WA 4C92E 3J7AF 2QEXA 3N5NX 4CEOA 5KYYA 1Z3YA 3V1QA 1IHVA 3ZRGA 4XAXB 1NGAA 2XAGA 2B9SA 3WE3A 2KAFA 2FBKA 1SD7A 5GIPA 3MDQA 5D4SA 1VQOT 5IP6A 3M0RA 4CJPA 1LVKA 1VQLA 2ZCWA 3JSPA 1VSKA 1YQLA 1KD1U 4QPQA 2P4WA 4G94A 4AWXB 5J6XA 1GLEG 2BVMA 3LZJA 2VYTA 2R7RA 1RILA 3RR8A 3BDLA 1FX7A 1UHMA 4IBNA 4L5IA 2MGQA 3W0LA 2JSPA 4JI2K 4EMSA 2JQ7A 4BB7A 1OX9A 5AYFA 1TWCJ 1C0WA 1HKBA 4RW7A 4A3LJ 1MH4A 3L2VA 1BR2A 2IS3A 3LDNA 4CJ5A 2QWWA 5DD8A 2JS0A 3M9QA 1YITI 2R7TA 3CPEA 1W5CC 4ZHRA 4M7DA 5FFZA 3GFIA 3MHXA 4LOCA 5E1ZB 1ZLMA 3O5BA 5JLWA 3RMQA 4Z4FA 2LRQA 4GLMA 3BTIA 3CD6T 2D5RA 1VYVA 4Q5WA 1B1BA 2STWA 5LJ5d 3OBWA 3NCIA 3D4VA 4M3FA 2HNDA 4JEPA 3FHFA 5DD4A 1MDUB 4G7HF 4KYWA 1U6GA 4JI8K 4WTOB 4CBUA 5IXBA 2E2NA 2KXCA 3DBLB 3IG1A 3D5LA 4Q48A 2D0OA 3JRIA 3BZCA 8AT1B 2L0KA 2O8DB 1VIFA 2LSNA 3H35A 3T5XA 5GJWB 2HKXA 3DLAA 1UUEA 1TU0B 4CGGA 3HRTA 1Q1VA 3H5RA 1HK9A 3PIOA 4XL9A 1D8JA 1KU9A 4EMKA 4W1UA 3GEZA 3SB2A 3QEIA 3TO7A 2XAQA 1P4WA 2VIXA 3GTJJ 1HNIA 1I07A 1OZ3A 3TAGA 1T6SA 3A5MC 5J26A 3E6DA 1QKXA 3OS5A 3S93A 3AGRA 3KEQA 1RBVA 1XSVA 2EFNA 4BROA 1IO2A 1C6VX 2F2WA 2HDCA 1HDDC 1T05A 1ZQ1A 2CH0A 1VSJA 3FLCO 2ZCFB 2NS8A 2H8RA 2G8FA 1FJGK 1DTQA 2F5EA 4A53A 1NPPA 1R0AA 1IV8A 3ASNH 3J80K 3OSFA 1TYQB 1JUPA 4Y3OA 3THXA 2VT3A 3EZ5A 1E3HA 2A6HF 2GIVA 3RYPA 4JBAA 1XWLA 1ETOA 2P5VA 4C2TA 1TOVA 1WYXA 1MU2A 2AHQA 1QTMA 1I94K 3OA9A 2GQVA 4FLVA 3F0CA 2AQEA 3HSTB 3S3OA 1JLCA 3MEDA 2YX4A 1UMQA 4IURA 2VWJA 1WHKA 5LEKA 1UZCA 2NUZA 1ETQA 1N8RC 4RAZA 3MWTA 1KQ1A 1V1CA 3CCQQ 3M8EA 3M1FA 5H1SQ 2KFNA 1A31A 1JI8A 4KFCA 1HJRA 4KH0B 2ID3A 4CGHA 5B8HA 1WH7A 1WFWA 4R56A 3EYIA 4RB1A 4DYRA 2FLOA 3VEVA 2FX0A 2QEXI 2O9LA 5I2SA 3M56A 1R5ID 4FX4A 1FY7A 5H2FC 5IYDJ 3A5OC 3TSPA 4AM3A 1W5TA 5KH6A 3CO6C 3GG4A 1XS9A 3DRPA 4IO8A 2XK0A 1GV2A 1BL3A 4XK8E 1O4XA 4FLZA 1BA0A 3FLGA 1A5WA 1JKPC 2WB1A 3META 2EYWA 2KR3A 1I6XA 2XGDA 3Q7CA 1VQLI 5GAOq 5ILVA 2DLLA 2ZPFB 4M7DG 4L18B 2GLOA 1YQKA 1HQUA 1IREB 1VAZA 1LFPA 4RB3C 4I9QA 5BRHA 1QHHD 3M55A 1QVGA 1RCHA 1Z67A 4LITA 2ZD1A 3BWGA 4O8KA 1B07A 1QW1A 3K2ZA 5JS1A 1WQ7A 1U84A 2NS0A 1NBWA 3WNHA 2XV4S 1YIJN 1KA8A 2KKOA 1LFUP 3RMBA 1OCRH 4RGUA 2M45A 4CF1A 2RQUA 3M8RA 5C6SA 3VOVA 3IV5A 2AXLA 3LWMA 3V9SA 4HW0A 3Q7BA 1E3PA 2Q0OA 4CZEA 2A40A 1M3BA 3UKRA 5D5UB 3BLYA 4BAYA 4DYCA 3H08A 3CCSQ 1N9RA 2VPLA 4II2A 2VG6A 4M3BA 3P8HA 3I5SA 5GAMf 4A62A 4L5JA 3FBNB 1RT7A 2E64A 4EW4A 1GFCA 4OIQF 2HEOA 4I2OA 3RI4A 4C92B 2LH9A 3M07A 4YTLA 2CUJA 1GCPA 3V7RA 1PCXA 3GVAA 1K9MU 3JCMh 1SSHA 1MWKA 1SD5A 1I39A 1MD0A 4H8KA 1PSEA 5JMVA 5EXWA 1XMKA 3DTIA 2NLXA 2X9DA 1BCOA 3N97A 4CCHA 2G3RA 2VWFA 1VF9A 2EJRA 4CZLA 3CLOA 4P9UA 1TZLA 4IIMA 1DPUA 1QHTA 1LCUA 1SKWA 4UUSA 1JCGA 4B47A 2AZVA 2O4GA 4L9JA 1C1CA 1UHCA 1I5ZA 1M9SA 1YJWQ 3DLHA 2ZGZA 2LDUA 2DDAA 2XF6A 1WGSA 3C2HA 1SL0A 1ORPA 3VS6A 3E6CC 3R4KA 1JCEA 3FISA 4HV5A 2L3SA 4R5PA 4CJUA 2RI5A 4FJLA 4OPHA 1IXRC 4Z6YA 2EFWA 4FK2A 2V8KA 4J9BA 5A0DA 3CDHA 3DLLA 1LNXA 2M30A 2DK5A 2Q1ZB 3ZQGA 1B72B 3R6OA 4LDYA 1R59O 5ICFA 1LDKB 5J47A 1VQ8N 1NGCA 2J5PA 1G99A 1ZRFA 4LH5A 1W5SA 2PMUA 2RK2A 2OC6A 2IXSA 4B21A 4FISA 3TTDA 2NVQJ 4HHTA 3HOVJ 2M34A 3LA3A 2ATQA 1MGQA 1IO6A 3K1MA 3LA2A 2CS7A 2E71A 4GFBA 5B5EC 2DMOA 3WTYC 5CLSA 3IH2A 3CF5F 1PP7U 2EWSA 1YRNA 4NL3A 5GANg 1X3WB 1HQEA 2RB6A 3KYDB 1ATNA 3ER0A 4L9VA 1TKZA 2O8CA 1YJ9Q 1KFDA 5M3MJ 3R2XC 1KAYA 1MZBA 1MSFC 2VBXA 2YLCA 3K70C 4XTVA 4WXDA 1GHCA 4YNQA 3K10A 3FZKA 2O4XA 2WY7Q 2KP6A 1Y96A 2IIRA 2X85A 3WODF 1E2XA 1ABQA 5LJ3g 1D1CA 1J6ZA 3NMUA 3GLLA 2G8VA 1JLEA 3CQYA 1O1WA 3SV3A 1VQ5A 3HG9A 4HTLA 1ETWA 3OH6A 1BC7C 4UB8C 4UQGA 3LL7A 1Q7YR 2HS5A 2BXZA 4RG2A 4CEQA 4FO0A 5KCHA 4CBWA 2HW3A 3WVDB 4DR5K 5K5QA 2PMHA 3OJSA 3A5NC 4KHSA 2DY4A 3CC7A 2QDYB 2Z33A 4R79A 3OYLA 4I76A 2RVCA 4BR4A 4A4HA 1OYIA 4WYBA 3DXKA 1BIBA 4EMHA 1V5EA 1FLIA 5KGWA 4K43A 4A5AA 1NPRA 2L89A 4HSRA 2PYJA 4Q0BA 3EE9A 5FD6A 4ZTJA 4KMFA 4C0GA 1Z6RA 3FRNA 2YJFA 2CS3A 1UGSB 4M7XA 2NOHA 3G1LA 4LF6K 1JJ2A 3WXMB 2QXLA 1BU1A 2HVIA 1M3CA 2HBJA 1WI3A 5HKCA 2EQUA 2P0PA 2NRVA 3MEGA 3QNNA 2FC0A 3BR0A 1EKEA 3DLRA 3VENA 4DSKA 4IEEA 5D6EA 1R58A 2VGMA 2O0YA 3M8QA 1HA8A 1B59A 3UKGA 3MEUA 1XOVA 2JTVA 1NOYA 4UNOA 3PSIA 2WSCE 2Q3SA 3B6PA 3CPWS 3AO3A 4NCBA 2QSGX 1LJ9A 4DR1K 4UVAA 3VQ8A 1NK0A 4EZ6A 5A2QK 4DV5K 3BDPA 4QQGA 2ASPA 2K3FA 1E3OC 2JA2A 3CCMA 2LY9A 5EC7A 2E12A 2P7CB 4CGDA 4NXNK 4B9SA 4JI1K 4XK4A 2Z3YA 2BW3A 2LTOA 5C42A 2JVVA 1QZEA 3H5AA 2O8BB 2JRMA 2ZNZA 1M3AA 3ZSVA 1HW2A 2P51A 4E19A 4J8FA 2ZFWA 3VPZA 3TSUA 4ZZLA 2P5GA 4F7UA 4H0VB 2OF7A 3LCNA 2MLGA 1IC8A 2CGHA 4PJ0C 3MXMA 3L6QA 4YIFA 3QEXA 3M0TA 3CCET 2NXNB 3JRHA 1ON1A 1U5TA 1ZA2B 4A5MA 4LLLA 2D5VA 3RVCA 1N33K 5JLXA 1LAVA 4C3HJ 3RDIA 1ATSA 3FHNA 3H3NO 1N8RO 2DL4A 1NZ9A 3TBIA 3LDQA 1BKBA 1DQUA 2GAUA 1B7TA 1S72N 1OLTA 4HUFA 2ADUA 1Q82C 4CCMA 1J2XA 1J9AA 4HDVA 1WQWA 3UT1A 1NOZA 3WUHA 2C0IA 3VQ6A 3F10A 3VJPA 2KRSA 1LQ1A 3MFKA 2LC4A 1KLMA 5HS8A 3CCRN 4RBOA 3X24B 4C8MA 1J59A 2O01E 3VEZA 4ZN1A 4DB3A 2KLAA 2GEMA 4J6WA 1QSSA 4LFCK 3QHSA 3THVA 1HW1A 5JHFA 2L9RA 4FSVA 2L4AA 4AHVA 3BR2A 1VQ5I 3K4MA 3CMAT 2CKKA 3RMCA 2A1SA 2YHTA 3OIPA 2LQKA 2O4IA 2MK5A 4QVDA 4E89A 2CFXA 5ILUA 1I5LA 1ZSZC 1BI4A 4YDUC 3CXCA 2XI9A 2X1DA 4KB0A 5KYXB 3KP5A 1ZSZB 4M75F 4WQ4A 4PKHA 5IP9J 2ECBA 3CC7I 2KW4A 4JHDA 2YG8A 2YSRA 4Z89A 1BIUA 3RMAA 1PYVA 4FHTA 4PUOA 4UB6C 1X3MA 1BA1A 2IDOA 4M3DA 2DTRA 3A8GB 3EPZA 4A3JJ 3LAMA 4DBQA 3G71T 3CQZJ 2ITMA 1REVA 2WV0A 1EO1A 5J2QA 2KZMA 3QB0A 1UJYA 3G6EA 1QSYA 3A0IX 2BE9B 4XOPA 1MBJA 3QETA 4BR5A 4F92B 3B02A 3UKUA 1NLOC 1D4XA 4J8OA 4IG3A 2H56A 4JRIA 1T98A 1ZBHA 5KCOA 4E7SA 4I6MA 1IAWA 2HOTA 2CRGA 1JLQA 2KIFA 4BQOA 3HO1A 4BRAA 1BDGA 3QYHB 4HVWA 2M0MA 2Y4YA 3EG1A 1NJIR 3OYEA 4IRGA 5JHUA 2FRHA 3OVNA 4X9CA 1UG1A 1BR1A 3N4PA 3CJ1A 3FZLA 2WACA 1K8AU 3AVHA 1D9FA 3SZPA 1BK2A 1M2VB 3MD2A 4F7UG 2HMPA 4PJLA 1BB9A 2HOSA 2Z1DA 1K73U 4LXCA 5DV5A 3O3GA 4Y1DA 2GNCA 4J9FA 1UB9A 1TV6A 3SQ0A 3CCMI 4BRIA 2CQKA 3F22A 3OSVA 2H3EB 3JCMg 4H5TA 4FYYB 4JK8A 3V42A 5EGOB 1JTXA 2Y75A 2K79A 4CFAA 3HOUJ 1WSEA 3U3YA 3WEEA 3VS5A 2DQRA 3HSCA 1HKCA 1TUUA 2EZKA 3OJUA 3S3NA 3EGDB 5D5XB 2EKOA 5GANd 3JB9H 4AFUC 2M1BA 2AZSA 4MO7A 3ZQIA 3CCUN 4ENJA 2K40A 4Z0UA 3M8FA 1ZRDA 2P0QA 3P1GA 4DV4K 2RE2A 3MCAB 4JI5K 2PJRB 3C6TA 4QT7A 4PJOD 1RTIA 2F2VA 3AL0C 1VQPA 1X9SA 1P4XA 4IKFA 1RTDA 1WJSA 1M90U 1LWCA 2I7NA 1IV0A 1HSTA 1WN7A 4DR3K 4M63C 4Z4GA 4B9TA 2VBZA 2E4LA 3O80A 3VQPA 1WXBA 4XTZA 2K4YA 2CSIA 3QINA 4J9IA 2E3HA 2HOEA 1NMDA 2FOWA 4WE1A 3VS2A 2E1ZA 2GUPA 4CJWA 4BJ5C 4KUIA 3HOWJ 4XKWA 5J1EA 3HTRA 2VODA 5LJ3d 3CCJA 2DBMA 4E7HA 2BIVA 3LSIA 2LVMA 1UWBA 2LK2A 4CC7A 1UDLA 2XY6A 4MQVA 2DJIA 1K4SA 3QPLA 5HDGA 4DFKA 1S1NA 3LQRA 1UFFA 2B0LA 4FJHA 1WAJA 3KD1E 2VONA 2ISZA 3KLOA 2JHJA 3VQEA 2XPVA 5AQTA 3C2GA 1VQ8Q 3HEFA 1ZBXA 3KLGA 1U78A 1D5AA 4QIWN 4DTJA 2AT1B 2CZ7B 3C0BA 1S1TA 2OZ6A 5F08A 2Z5UA 2CQXA 2DA5A 3CCVT 2KFZA 4LNPA 1MMSA 3TWHA 4RS8A 4C8NA 3DXMB 1YJNN 4HX4A 4PNOA 3H41A 5EVZA 3I56T 4WCEL 5GMKl 1KU2A 2Z16A 4KJZA 1U5SA 1BGXT 4BQAA 2HNIA 5F2RA 3E1YA 3RKQA 3BR6A 3OTOK 4MO5A 4DF4A 3SCXA 3EUHC 1FYMA 1D0YA 2BH1A 2W6LA 2A37A 3RDVA 1LUJB 4BXUA 1NE8A 4C5IA 3G6EI 2COYA 2A68F 5A0GA 3BPVA 2P81A 1GV5A 3ZQ7A 2P9PB 3OYYA 4LE9A 2COBA 2X3WD 5F1JA 4FZXC 1S6QA 2DMQA 4HF1A 4M75E 1JXSA 3HT3A 5DPKA 3ZT1A 3VGKA 2W10A 5FRNA 2FF4A 4H5VA 1BI1A 3M8SA 3URGA 5IHKA 3RYRA 3LH5A 1JO8A 5KHDA 5BNGA 4EV0A 3DV8A 2NOZA 2JA8J 2PY5A 5EJCA 1CQTA 1SHGA 2OTLT 4EATA 2OTJA 1F5TA 3PX6A 2LT4A 4BEHA 5E8GA 4DNCA 1RDDA 4AM7A 4DHYA 1R0CB 3A98A 5EG2A 2IVNA 5J8FA 3RKXA 2ZGYA 2DM1A 3T1AA 3NRVA 4CO8A 4J2BA 2C0OA 3GWZA 1VI0A 3O8GA 7AT1B 4DFPA 1AWOA 3GOIA 4I7FA 1JCFA 4XICA 4ISEA 1XPXA 5C2DA 1X9JA 3SUQA 3TAQA 2JUFA 4ITVA 2HNHA 3GUDA 1ARKA 4WQ5C 4YFNF 1XCVA 5AIQA 2YX7A 4E1NA 2F5TX 4CVNE 1Y71A 2YNHA 3ZOBA 4CHYA 1Y97A 2W04A 4CZCA 1ZR2A 5GAN8 2DTUA 4BGAA 4RTXA 3JB9G 1LJOA 2I5WA 1D9DA 1VQPI 5DUIA 5K1YA 1Z9CA 3BG3A 4H4KC 3CESA 3V9UA 4RCHA 3I55Q 2X4XA 4M78D 2XF5A 2F6CA 1YITT 1E4FT 3BJOA 3QP6A 4JRPA 1Z77A 4N47A 3WTUC 3EG0A 3CCJI 3DBRB 4PJOF 3HUGB 1OJLA 1FMVA 4AFZC 3MO8A 2P9NB 1CZAN 2NZTA 5DCMB 3GNGA 2R92J 3SFIA 2QSFX 2FBXA 5GJVB 2XVCA 2G8IA 3JB9I 1GUUA 2NUPA 5F0CA 3DBHB 5I3UA 3ZSQA 2QM1A 3QJ6A 1Q82O 4CK3A 1Z26A 3LAJA 2CQQA 4XLCA 3FHGA 5E1WA 2DMUA 3S1RJ 1Q81U 2COZA 4A0YA 1U4BA 3VYSB 1VQNN 4K8ZA 4BE1A 3GZ6A 3CCLT 4LH4A 1AZEA 4KGZB 1TW2A 4ETSA 1LPLA 1OH8A 3H3ZA 2HDAA 4CGZA 4E3SA 2JTEA 4M72A 4YY3K 3I0WA 4A3KJ 1VFCA 2NRHA 4Q5VA 2WB1N 4N4GA 2DL8A 1S7EA 5KRSA 1ZAOA 1BI0A 4JKHA 5ICGA 1QVGS 3UA6A 4JKDA 4OMNA 3S3MA 3VFZA 1I1JA 3EETA 3CJ9A 2A6TA 4BRFA 4VUBA 2MC3A 2FE3A