3OYIA

Crystal structure of the pfv s217q mutant intasome in complex with manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyiA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyiA03
1QHTA 5J2NA 4NCGA 2YKNA 2IC3A 2MWOA 3RMAA 4B9XA 3HVRA 2IS3A 4M3TA 2RJDA 3ISNC 2R58A 4E7LA 3CM6A 3PV8A 1HPZA 4CJKA 2XY5A 1R0AA 4M3WA 3SPYA 1UA0A 2HHUA 1D9DA 4KRFA 3OYLA 4QQGA 3CYMA 1OYXA 3KLIA 1SUQA 3CQ8A 3KD5E 3NF9A 1WSHA 4E7JA 3VQ7A 4H4OA 5SWMA 3P5JA 1HJRA 3JYTA 2E6NA 4DSFA 3MEWA 1Q8IA 2KW4A 1BI4A 4CECA 2DY4A 3O4QA 1UOCA 5C6SA 1NJXA 4PLLA 1ASVA 4DS4A 4KI4A 1W9HA 2EX3A 2QK9A 4QOZB 3MP6A 4PY5A 3MO8A 2JGUA 3LAMA 2XK0A 4DS5A 1IG9A 1J53A 3ZCMA 3AO4A 2R7YA 4DTUA 2YHBA 3TAEA 4KFBA 3QEWA 1ZBHA 1J9AA 1RDBA 1MHNA 4IUQA 3AVCA 1FK9A 2RF2A 2LTOA 2E4LA 4H4MA 2HNDA 1RT7A 1OZ3A 4CF0A 4O4GA 4CHYA 4RW7A 4AHTA 4FM0A 4DSEA 3RMCA 2OYQA 2HHTA 3OYBA 3QBYA 1RT4A 3PFSA 3NNQA 3AVLA 3NBPA 3K59A 1VSEA 4FLXA 3NTHA 4DTNA 1QSSA 3KLGA 2RJEA 2LCCA 4CHOA 3LPTA 4CHQA 4KREA 2XO7A 3EZ5A 1LWCA 3OYIA 2GV9A 3G10A 3OS0A 3AO2A 3ITHA 3WNHA 4B9LA 2BANA 2X74A 3AO3A 4CJWA 2DFFA 4FLWA 3O8VA 1LW0A 3ZSZA 1JKHA 3PX0A 3AA5X 3TARA 3OYJA 4ELTA 3ZSRA 4AHVA 3S6WA 4N47A 3MXJA 3OYMA 3NF8A 3VQCA 3ZSQA 4OPKA 1SL0A 4HUFA 2GFAA 2RHXA 1T7PA 2RI5A 1BISA 4FJLA 3HK2A 4F3OA 1UWBA 2EQJA 4CJQA 3E9GA 3SQ1A 2DTUA 1NK0A 3PNWC 3SPZA 5JS2A 2O4GA 2EFIA 2FC0A 1RCHA 1NKCA 1KVBA 3LP3A 3K57A 3V1OA 3OJSA 3LZJA 4FLYA 2YRVA 2Z1IA 1SL2A 1L5UA 1Q9XA 3KK2A 1JLAA 4N76A 3DRPA 2YKMA 2HHQA 2FBXA 4FJ8A 1WAFA 2E6MA 3V9ZA 1FXXA 2HNYA 3QNNA 4LH5A 4J2DA 5D6YA 4OVAA 1G15A 3AV9A 3SI6A 4OGEA 5I42A 3CEYA 1TL3A 2PY5A 3MP1A 1VRUA 3HXMA 4CK1A 3PO5A 4BACA 3LLRA 3OYHA 1VSFA 3F70A 1CZ9A 3P1GA 2EKOA 2KQ2A 1XWLA 1JLQA 4FW2A 1RBSA 3TAPA 2FHDA 3DB4A 1KTQA 4N56A 1C0MA 1KFDA 2P5GA 4CRIA 2DIGA 1IKWA 1BHLA 1SKSA 1KLMA 1EX4A 2IGIA 3LP0A 2GF7A 2RO0A 3AVFA 4ELUA 4BDZA 1N5YA 3MXIA 1LWEA 1LV5A 3ZT0A 4FJNA 1UA1A 1YTUA 3L2WA 2F8SA 2WONA 4TSXA 2R57A 4B3OA 2D0BA 3RR8A 3PUFA 2M0OA 5T7BA 3LX7A 2K3YA 4N4IA 1WN7A 4BWJA 4CIEA 3QJ6A 4EZ9A 3DLMA 1WGSA 2A1SA 2Z1HA 4CJUA 1N6QA 2ITGA 2RJFA 4OLAA 2YNHA 3KLEA 2BUDA 3DLRA 4A4FA 3ZSOA 3ZT3A 4LSNA 4XIUA 3V1QA 1RBUA 5C24A 3TWHA 4KO0A 5HLFA 4Z4IA 3LDSA 3I8DA 1RDCA 1XC9A 4B9NA 1NK8A 2RHYA 4IBNA 1ASWA 2ZE2A 4ICLA 3U3GA 4CGJA 3DLEA 4GY5A 2D9TA 3OYAA 4CF9A 1NK4A 4M3ZA 4DU4A 2Q3SA 2VYTA 5C0MA 4CFCA 3EAEA 4N4GA 4J2EA 4OJRA 3NTIA 3IS9A 1NK6A 4QQDA 4CJTA 3AA3A 3AVJA 4CF1A 3DLHA 2X4WA 3P8DA 4I2PA 4B8AB 4CJRA 1RI0A 2E5QA 2A1RA 3VQ6A 2OZMA 4FJJA 1C1AA 3BGRA 1WAJA 3S3NA 4BWMA 3T19A 1WNSA 3HL8A 4MQ3A 1B9DA 4CFAA 4KHUA 1BQNA 3C94A 3DMJA 2K3XA 3VQQA 2FBTA 4AHUA 2HVHA 4O44A 4F8RA 4KTWA 4M45A 1JLEA 5E41A 3V9UA 2QKKA 1TKZA 3C4SA 2G3RA 1NJYA 2GUIA 1MU2A 5KI6A 1S9EA 3AO1A 5J2PA 4M41A 3MEDA 5FRMA 3NF7A 4W5NA 3SUNA 3AVGA 4QQ6A 3GOXA 3P83D 3ZSXA 4C8KA 4CEQA 4FK2A 3UT1A 1WSFA 1LAWA 4RW4A 1J54A 3CFPA 4L59A 3L2UA 4FVMA 4KB0A 3K5MA 2G8UA 4RW9A 3WNEA 3V81A 4IURA 4HVJA 4B9TA 2P0KA 3HSTB 3VQ9A 2VWKA 4ZTJA 1CZBA 3H8ZA 5KE2A 4CEDA 3C6TA 4DMNA 4O5BA 4WE1A 4CGIA 3KD1E 4DSIA 2Y1IA 4YFUA 3MEVA 2HB5A 2EHGA 4DQQA 3V1RA 1HQEA 3VQ5A 4Z4EA 2BDPA 3QIIA 3LGLA 3ZSYA 3ZT2A 4BD3A 4DSLA 1JLCA 4E0DA 2BGGA 2LRQA 1C0UA 2DIQA 3ME9A 4I9LA 1HNIA 1RT2A 2KTQA 1YT3A 1RTHA 5KTQA 4F2SA 3QESA 3EY1A 3V6DA 2Y1JA 2PZSA 4Q5WA 1W0HA 4KPYA 4DSJA 4RW6A 5KGXA 4FZYA 3RR7A 4DTSA 3WNFA 2RJCA 4IUUA 1BIUA 4OKEA 1ASUA 3NDKA 3KJVA 2LVMA 1X9MA 1NK7A 4CJVA 4C8NA 1HMVA 4CK2A 2VG5A 2EQUA 4NS5A 2HQXA 1G5VA 3LP2A 1QSYA 3NE6A 4RG2A 3LANA 1SKRA 4B9MA 3DYAA 3O4NA 2QXFA 3LP1A 4FLTA 3SUPA 2D0AA 2HHXA 3IRXA 3L3UA 4C8MA 3MP8A 4LD6A 2DFEA 1I3AA 4PUOA 4DTPA 4FJKA 4Q0BA 3U3YA 4HCZA 1RNHA 3TANA 1NKEA 1VSMA 4E19A 1U04A 2G8WA 1JL2A 4W5OA 4CEAA 4OPJA 4N5SA 1C0TA 1QTMA 3NH0A 5C25A 4PLIA 1JLGA 1RBTA 4IFVA 2HW3A 2YHAA 2JZ2A 2GBZA 1NJWA 1S5JA 3VQ4A 4DTRA 4QVZA 2ZQBA 3ASMA 5CYQA 3K5OA 3DB3A 1RT3A 1EP4A 2QKBA 2G8HA 4DTOA 3ZEHA 4FJIA 3SUQA 2KFZA 1NKBA 4FLZA 4GVMA 1U45A 4FJXA 4HTUA 3LPUA 4CIFA 4N4HA 2OZSA 3ZT4A 4E89A 3SV3A 1U48A 4JRPA 3VQ8A 3SJJA 4AHCA 1ITGA 1L3UA 4CF8A 4KKOA 4OLBA 1TGOA 2XRIA 3B6OA 3FLGA 1NK5A 1I39A 4ZTFA 2QQSA 1B92A 1KCFA 2B8AA 1RTJA 3AVAA 3OMGA 1A5VA 1GOAA 1QE1A 3C95A 3HP9A 2PYLA 4ELVA 3DLKA 1BL3A 2F5KA 4FZZA 5HROA 4J2AA 3DI6A 2OPSA 5C42A 4FCYA 4FJ5A 3KUFA 1SSFA 2VWJA 1VSIA 4O55A 1RT1A 3VQEA 3RTVA 3RRGA 3F73A 4DSKA 5KH6A 1CXUA 2B5JA 4Z02A 2PYJA 4BE1A 2XDPA 3OS1A 4E7HA 4A4GA 3DRRA 3SNNA 4FJHA 4DG1A 1TAUA 3SQ0A 1XI1A 1SL1A 1KRPA 4KHSA 3MEUA 2OPQA 3HO1A 1TKDA 4KTZA 3AVMA 3VA0A 1XHZA 1HYSA 4RG8A 4KHWA 4M3YA 2O4XA 1WSJA 3KLFA 3D0PA 2P51A 4KHQA 4QAGA 2HHVA 4Z0UA 3OY9A 3VQPA 5J1EA 3OB9A 3OMCA 2G8VA 4B08A 1VSLA 4CGFA 3L8BA 1RT6A 4CHNA 1KHCA 4CIGA 4CE9A 2X35A 5CZ2A 4F4KA 4K8ZA 1BQMA 1TK0A 2X78A 3IG1A 4DQRA 4B9VA 5HRPA 1LWFA 3QETA 1C1CA 4J2BA 3G0ZA 4FJGA 5D6XA 1CXQA 4KHNA 1Z26A 3Q1JA 2RHZA 1VSHA 2BE2A 3CFOA 2I5JA 4CFDA 4II1A 1S1WA 3V9SA 1KLNA 1T03A 1YTAA 4GMJB 4CJEA 4Z4CA 4KI6A 2HHSA 2DAQA 1RTDA 3T3FA 1WSGA 4C8OA 4CFBA 1KVAA 2XY8A 3DOKA 1F21A 4PQUA 4LH4A 5SZTA 2KZZA 4O0IA 2EQKA 4JS4A 4M42A 2OPRA 2X6NA 1U47A 3BDLA 2HNZA 4CGHA 1TAQA 3ZSWA 4C5GA 4PA1A 4N41A 5HRNA 1Z25A 3S9HA 3LAKA 4ID5A 2FBVA 5KRTA 2RHUA 5D6WA 4CJFA 3D45A 3QO9A 4I7FA 3SZ2A 4M3XA 3TAQA 4DFJA 3L42A 4E7KA 1IKVA 1NJZA 3HPHA 4Y1DA 3AO5A 4CJPA 4DLEA 3RMDA 2IAJA 3CFRA 3WNGA 3QEXA 1J5OA 4FK0A 3OQ5A 4CHZA 3O3FA 4HCBA 3KKRA 5HRSA 4RW8A 3HM9A 1S1UA 3NGZA 4LD0A 1DTQA 3DLBA 3C6UA 3HJFA 4AHRA 2CKKA 4CJ5A 3AVIA 2NUBA 3PX6A 3HVTA 1IH7A 1RBRA 1TV6A 3CM5A 4O0JA 3HYFA 4GW6A 3VQBA 3NH1A 4CK3A 4DLGA 1X9SA 3TR8A 2YNIA 4IDKA 1TK5A 4DU3A 3NTKA 3SQ2A 4CJLA 3IAYA 3KLHA 1DLOA 3E01A 4EDUA 1U49A 1K6YA 1L3SA 4CJ4A 4G1QA 2Z1GA 5DMRA 3EYZA 4Y1CA 4Z4FA 1QS4A 4DU1A 1RDDA 4OVLA 3SYZA 3UWNA 1TK8A 3ASKA 1RDAA 5EU7A 4BE0A 2B6AA 4CCHA 1IKYA 2F96A 2OPPA 4B9WA 1X1PA 2JLEA 3I0SA 3DRSA 3OVNA 1TVRA 2M1HA 4I2QA 5K14A 4R5PA 3V9XA 1FKPA 3QINA 2HVIA 3OYDA 1WJQA 3ZSVA 4W5RA 3L3VA 1OI1A 4BDPA 2XY7A 3B6PA 4FJ9A 4HUGA 1VSKA 4IG0A 4FZXC 1LAVA 3VN5A 4CJ3A 3AA2A 3JSMA 4QCLA 2PQWA 1ZBFA 3ZT1A 2HHWA 1JL1A 3OYGA 3OYEA 3BDPA 1LW2A 2IDOA 4AHSA 3TABA 4B9UA 4UQGA 3QEIA 4FK4A 4CF2A 4PWDA 2IG0A 3NCIA 2G8IA 3NHGA 3AVBA 3H08A 3MEEA 3E9FA 3AVHA 1QSLA 1O1WA 1NOZA 5FDLA 4DTMA 4UC4A 2D5RA 2JTFA 3M8SA 1YVUA 1BCOA 4C5EA 2L8DA 1WLJA 4M3RA 4CEFA 2FBYA 3QNOA 1JLFA 3NH2A 1XHXA 3CG7A 4KB1A 3FDRA 4IG3A 3META 3L2RA 1TKXA 4ID1A 4EP5A 2HMIA 3MXMA 4OGCA 1RILA 1SV5A 1WSIA 3LZIA 2M16A 3V4IA 3V9WA 4KAZA 4FJMA 3TAGA 3OYNA 4FYDA 2B4JA 1IKXA 3VA3A 5IAYA 4IKFA 4B9SA 1GOBA 1HRHA 3SUOA 4OKJA 3NAEA 1A5WA 3RWUA 1S1VA 5J39A 5KGWA 1NOYA 3ULDA 3O3GA 3SD4A 1VK0A 2XHBA 3MAQA 2IOCA 2DFHA 5I3UA 4FM1A 1FKOA 1ZBUA 4CEEA 4EZ6A 4CEZA 4IUTA 4BE2A 2LSNA 4E3SA 2X4YA 4IUVA 4X34A 1B9FA 3QIOA 4LSLA 3VQDA 4Q5VA 4FLVA 2L3RA 3NGYA 3SV4A 1NK9A 1ZYQA 3K5NA 4C5HA 5HRRA 3LWMA 3PO4A 1RBVA 4DQIA 4EP4A 3K58A 3P8HA 3DOLA 1QQCA 4DF4A 4FLUA 1U4BA 3M8RA 2QQRA 3NF6A 4CEBA 2WOMA 3PY8A 2ATQA 4DQPA 4FU6A 3KTQA 2VG7A 4W5QA 5FROA 4IUPA 4FJ7A 5J26A 4CJSA 3QKJA 3OYKA 4HUEA 1EETA 4IFYA 4CESA 4NYFA 4M3UA 1RT5A 4NCBA 1H3ZA 1D8YA 1TKTA 2O4XB 4W5TA 3FC3A 4YNQA 3DM2A 2XY6A 2KFNA 3O3HA 5M9OA 3AA4A 5HBMA 1SKWA 3KIOA 3QIPA 4HHTA 4DWIA 5DK5A 4PL6A 1TL1A 4AH9A 2D0CA 4DTJA 2E6LA 1WJSA 4H8KA 3S3OA 3K5LA 2O4IA 2X6SA 3TAFA 1S9GA 3LH0A 2P5OA 2YV0X 1BIZA 3LYIA 1GOCA 1S6PA 4OKKA 5HP1A 4QW2A 3QEPA 3S3MA 3TI0A 1JLBA 5J2MA 5IN1A 1A5XA 3MECA 3F9KA 4NCAA 4B8CA 4DTXA 4BDYA 1BGXT 1EXQA 3MEGA 3FFIA 1HYZA 2RPIA 3L2VA 1ZBLA 4I9QA 2RI3A 3OS2A 1HYVA 2BIVA 4C5IA 1C1BA 3QERA 2RN2A 2Z1JA 3L2QA 5D3GA 4NZGA 2KZMA 1UAXA 1D5AA 5CIUA 4FM2A 1Y97A 4L8RB 4F2RA 1WSEA 4CGGA 3RRHA 1KFSA 4DF8A 1VSJA 2G8KA 3U6FA 3I0RA 4MFBA 2R5AA 3UIQA 1XNIA 4E7IA 4JS5A 3NFAA 3T1AA 3DLGA 2RI2A 4CERA 1KSPA 3HT3A 3RMBA 1REVA 2MWPA 4DFPA 2AJQA 1ZBIA 4A4EA 1JXBA 1KVCA 3HPGA 1T05A 2LDMA 3LGFA 5CYMA 3HP6A 2W42A 1X9WA 3MEAA 4E1NA 4DFKA 2L89A 4CEOA 4Z4HA 1L3TA 4KTQA 1EKEA 1BI4B 1S1XA 4FL6A 3VQAA 4E1MA 4KHYA 2YNFA 1DTTA 3OA6A 2R5MA 3M8QA 5CZ1A 2NLUA 3HPOA 1L3VA 4FXDA 2X4XA 1OZ2A 3M9QA 2HQEA 3SQ4A 2G8FA 5FRNA 2OA8A 3PX4A 2RHIA 3K2PA 3TAMA 4K8XA 3OJUA 3A2FA 4C8LA 4JLHA 5KRSA 1BCMA 1JXEA 1C6VA 4CGDA 1Q9YA 4Z4GA 1CLQA 5KCHA 3ALYA 3NGIA 2WACA 4A4HA 1HNVA 3M8PA 3SCXA 2ETJA 4DFMA 1D9FA 4NYNA 4FW1A 1WJRA 5KCOA 4CHPA 3THVA 4DQSA 2RKIA 2F8TA 3KK1A 3LWLA 3PMIA 1VSDA 5J2QA 3H6ZA 4KV8A 4LY7A 3AVNA 1HQUA 2BKDN 3KK3A 4F3TA 3PMTA 3FEOA 2ZD1A 3QLHA 4AILC 1S1TA 5JS1A 3OYFA 2VG6A 5CY4A 2P1JA 4HCCA 3LALA 1T8EA 1N27A 1S6QA 3OYCA 1VRTA 2YNGA 4ZHRA 5KE3A 3AVKA 4JRQA 1IO2A 3QEVA 2GFUA 3KKSA 1RTIA 2EQMA
chains in the Genus database with same CATH superfamily
1HKBA 1MBHA 2IS2A 4E9FA 4ABZA 3T8TA 3SPYA 1UA0A 4C0FA 5GJVB 2P0WA 1OYXA 3KD5E 5LBQA 1LE8A 1Z77A 5KYYA 4DSFA 2DA5A 4LB6B 1I0CA 1VQKT 1UHWA 3DBLB 2XI9A 1CKAA 1MHNA 2XROA 2HNDA 5KN9A 5F04A 3NARA 4M7DC 3LPTA 4BRKA 2CZ1B 5GANj 3OYIA 4ESRA 3ITHA 1BG3A 4B1WB 3CD6A 3DEUA 2EGCA 2VKVA 3MXJA 3NF8A 3HTRA 4BRAA 4A2BA 1F1ZA 1E3MA 3K57A 2D1VA 1PU8A 3J81O 2FUG2 4U7DA 3I0WA 2K2VA 2PY5A 3I9QA 4CK1A 3BDDA 1GXPA 2FZKB 4LIUA 1VQ7T 4BDZA 1HX1A 2LY1A 2F8SA 3HRUA 3L2WA 3VS2A 3H46O 4MLEA 2FJ1A 4JNEA 5AIQA 1KHIA 1YIJA 2HKXA 2QA4A 3O8HA 2VKHA 3TP0A 7AT1B 2Q3SA 4N4GA 1BI0A 1SG5A 2X4WA 2LBFB 3IAM2 3JSOA 3M4OJ 3JRHA 1XSXA 2CUBA 2M3AA 5LHIA 3ABUA 4PL7A 5GAOr 3QWYA 2H3EB 3FHNA 2YT6A 3UT1A 4OB3B 3K5MA 1N78A 3I4NJ 4XORA 4CCNA 3H36A 2EH3A 2OQRA 1M3AA 4YFUA 1VUBA 1HQEA 3PIPL 2A07F 3HTSB 3CJBA 4AFZC 3PQKA 3R60A 2WV1A 2XDVA 1DP3A 3REBB 1M3BA 1D5VA 1PC0A 1W0HA 3GTQJ 2BH1A 1UTIA 4C0DC 2AS5F 4CJVA 3JCMP 2K5CA 3IV5A 2V75A 1JXSA 4YEJA 3O4NA 3TSPA 1WHMA 3VEOA 4OFEA 1MMNA 2D0AA 2P5LC 1SFOJ 2FQ3A 4E19A 2B7EA 2X6XA 1JLGA 2IIRA 4IFEA 3AY9A 2CREA 3U23A 3S2DJ 2CYYA 1RT3A 3E7LA 5L3DA 5E1WA 3ZEHA 2DT6A 5EVZA 2XMFA 2O5RA 4JRPA 3CETA 1NG6A 4RM2A 2M45A 3IWZA 4BHCA 5IHIA 3W6KB 2VQFK 4PJOD 4AIAA 2VWJA 3WTWC 2E2IJ 2F4IA 3BR5A 1CXUA 4BE1A 2XDPA 4P96A 4ESBA 3CCMT 1FY7A 3C2GA 3EKSA 4RB2C 2PQ8A 4KHWA 3UATA 3EQLF 5J1EA 1JT6A 2L3PA 3ZMVA 2L7KA 3D2EB 2EV5A 5HDGA 3W6JB 1GUUA 4OIQF 5AQWA 2ATCB 3M57A 3QOPA 4XH4A 5FLMJ 2NAZA 1F21A 3RZDJ 1WHLA 2EQKA 3P38A 1O75A 2O9LA 3VRYA 2XGCA 3L42A 4YOWA 3RMQA 4LD0A 1NJIC 2P6TA 1VQ7A 2NUBA 4V19K 3HVTA 2M02A 3IAYA 1TUYA 3IC7A 4LDUA 1K6YA 1L3SA 3J7ZI 1HOMA 2Z1GA 2MH2A 3QBWA 1R1TA 4DU1A 4BR5A 1FYMA 5EU7A 1RAGB 5LHGA 1UJYA 3TU4K 4GY2B 2NVYJ 2K9NA 5LGUA 3OYDA 1UDLA 1P4AA 4NC6A 4DUYK 1LAVA 4XTZA 3M0PA 1ZBFA 2HHWA 1X3MA 5J4YA 4UQGA 1RAIB 1S1NA 3ZMUA 3VS6A 2VBXA 5F1JA 2VIXA 1WLJA 2Q36A 4S05A 4ID1A 5GAN5 3CP8A 2FBHA 2B4JA 4X0GA 1N32K 2BBYA 1SZ2A 4EIKA 2H6CA 2FA5A 3IUCA 3CLOA 4XH5A 4UVCA 3E9LA 4AWXB 3CJNA 1TQPA 3C0CA 4DB3A 5HCKA 4JJDA 3LWMA 5HRRA 4E9HA 1GRIA 2NXNB 2V9VA 3I53A 4A12A 3CJ1A 3QKJA 1VQ9Q 2HZDA 4KYWA 4WYBA 1H641 1IGQA 4HOBA 1LFUP 4I99C 3AA4A 1XQSC 1T6DA 3R0JA 2HYFA 4FE7A 4BEHB 2G9WA 3M1EA 3WGGA 1Y64A 2IGKA 2AHJB 4GLKA 2L7FP 3FHGA 5D4SA 1VQ9I 1T6CA 3ASOH 2YCHA 3CCUN 5E3LA 3M9AA 2CYZB 4MZPA 3CC4N 2W6LA 1LDJA 4L8RB 2IA2A 3FSPA 5EG0B 2VKEA 1ZHFA 1KVCA 1YJNI 3CCST 1S3JA 4E1NA 5IP9J 1L3TA 2P7VB 5JI6A 4TV7A 4FXDA 3CXCS 1L3VA 4BXUA 5FPNA 1E2XA 3Q9VA 5KRSA 4JI3K 3W0LA 2K2MA 3CJRB 3JCMg 2RDPA 1VSDA 3Q0VA 4KV8A 5GINA 1NH3A 5LJ5g 3BR2A 1DEJA 1RTIA 2CT4A 4DBRA 3HVRA 1YIOA 5B66C 1I3QJ 3CM6A 3PV8A 3ULEB 1U0JA 3A0IX 1XC3A 1F43A 5IXBA 4CECA 4FSXA 3O4QA 4BVPA 4C30A 2KZVA 1XQOA 4FT4A 1VQON 2EWNA 3ZCMA 2A3ZA 4RA2A 4DK9A 3QERA 2RF2A 1POGA 2NUZA 4LDVA 1BW5A 3VYHB 5K7HA 5GMKh 2F5TX 3PFSA 3K59A 1GLAG 2CGHA 3ZN0A 2QENA 3AO2A 3ECHA 4JK9A 1IGNA 3U9GA 3TARA 2ASMA 4AHVA 2VWBA 3CCSA 2XASA 1KD1U 3VQCA 2WB1A 3WHCA 2A3LA 3BW1A 2EQJA 3CCQA 1WJFA 2DOEA 4N76A 2YHWA 3Q3SA 3V9ZA 4B1ZA 1I50J 1NLPC 1KQ0A 1YJWT 3ZL7C 3DQVC 1ZREA 3LLRA 2E10A 4L0ZB 4CH7A 1WFXA 2FSWA 5GAN6 2KKZA 3M1CA 1QQIA 2E5NA 1K8KB 3CCJT 3MXIA 2UYTA 3CCUQ 4B3OA 4XRSA 1SVLA 4KIBA 3AG4H 1G6NA 3K7AJ 1NPPA 1PNJA 1ASWA 4OMOA 4ICLA 2Q1NA 3UPUA 2OAWA 2D4WA 4PJLA 5AN4A 2L4AA 1T95A 3G71Q 1QKXA 2V51B 2FX0A 4RB0A 4A5BA 3BCBA 3I5UA 3K2ZA 1Q7YR 4QQDA 1YHQN 2TDXA 3T7ZA 2GEMA 4MQ3A 3CCMI 3F8FA 1ZSGA 1YCSB 2CZ0B 1CF7A 3PM1A 4M3DA 2QWQA 3O5ZA 1ZBJA 3LSPA 4J19A 3CCLI 3O1WA 3OS5A 4GKKK 4CI6A 2JZYA 2HQ5A 4BC2A 4CI0C 2YJEA 1QKWA 4Z4EA 1M1KU 1YIJT 4E0DA 4XKVA 1GFDA 3ME9A 2V52B 2DQRA 2JA8J 3QESA 3V6DA 1Q82C 5KGXA 1PG5B 2M8GX 1KONA 1NK7A 3DXKA 3LFKA 3ZQIA 1S72I 2R7FA 2KDZA 4CHUA 1UG1A 3G71A 4BG9A 2EVRA 1KD1O 2KDSA 1RNHA 1JUMA 3QZ9B 2CH0A 1A0NB 3JAMZ 1RR7A 4H5TA 2OTLN 3ASMA 2KIQA 1ETXA 5FFZA 3LPUA 1L3UA 1MDMA 4CF8A 1DU6A 1ABOA 2WSEE 4M73A 1QCFA 3GUDA 1B92A 4HDVA 4OIRF 2OBPA 3BTIA 1FYNA 2YG8A 1WDXA 1SS6A 1TP4A 1KQJA 4CGZA 2IPOB 4PJOB 1IJJA 2ZXIA 1ORPA 3UDCA 4PHTX 3PLAA 4YORA 2ZXHA 3CCJN 2HHVA 3KLFA 4R79A 1LMZA 3MKYB 3OMCA 1HKQA 3PUBA 4CGFA 5D6FA 1ZUYA 3OH6A 2F1LA 2DO7A 5D6XA 1CXQA 2R5YB 1FWZA 3CCVT 3CCRI 3M0UA 4JZ3A 4CZHA 4F17A 1NGCA 5HRNA 2JA5J 1VQ4I 4CJFA 2NVXJ 1XS9A 5DYMA 1HU0A 4M77A 2R0QC 3H0FA 4JHDA 4M77D 1B07A 4JJCA 1LPLA 1DIZA 2C06A 4D1QA 4EIAA 2UV1A 3OMYA 4FHTA 2KYMA 1M4ZA 3E01A 4EDUA 3VOEA 4HX8A 3B73A 1VF9A 2P9IB 3HOTA 1TWHJ 1RDDA 4OVLA 2B6AA 4I6MA 3S93A 3O9TA 2DMPA 3DAWA 5JLHA 3N05A 1YUWA 3CCSI 1D5YA 4FZXC 4BJ6C 3OSFA 3VF4A 3I56Q 3BDPA 3EGXB 4CF2A 4J9GA 1VQ5A 4ZC3A 2GXBA 1Q1VA 2FPEA 4DTMA 1W7PB 1YVUA 2ELKA 1Q86C 4JOMA 1NWKA 4B3XA 2HOSA 1OEBA 4JJBA 4PJMA 1R0BG 1GV5A 3BPVA 2F6CA 4E9GA 4CZIA 3OSSC 1OR7C 4CVNE 2COMA 2P9NB 2OANA 5H2FC 2A37A 4C92B 4X34A 4LSLA 1DU0A 3VQDA 5GAOp 4NQWB 2VPRA 2HQRA 1K1ZA 3LWHA 1NGDA 4EQQA 2WOMA 4DQPA 4IFYA 4CESA 4JV5K 3K4JA 2TCTA 4ZZLA 2HVSA 1VQ9A 1PSEA 2X51A 3URGA 1F5TA 5LJ3h 1VQLT 3OR2C 1F36A 5JICA 2R7WA 1JGGA 3LH0A 2LCSA 3K1PA 1XTDA 3A01B 3JCMf 1TTYA 3OR1C 2GCXA 4B8CA 2DODA 4MMKA 1ZBLA 4F7ZA 1XSDA 2XU8A 2JS0A 3HDDA 5TKYA 3ZBDA 3JRCA 4YFNF 2H94A 3RI4A 2FNAA 3QSUA 3HPGA 3LGFA 3HP6A 3KZYA 2M0MA 1RLPC 4C9YA 2M9UA 3MN5A 1UB4A 1S1XA 4KHYA 1G3TA 3M8QA 2F2EA 4YOUA 1IB8A 3J80K 1R6RA 2LQNA 3SQ4A 5FRNA 4C8LA 5CO7A 1Q81C 1K9MO 2MK5A 2E2OA 5GAHP 3VUZA 1N27A 3MD2A 1VRTA 4PCQA 4M75A 3KKSA 1UELB 4LF8K 5JHFA 4B9XA 1NMDA 4EW0A 4UB6C 4HXJA 1S7AA 3BTLA 2R93J 3CMET 2XKPA 1WSHA 3ZMSA 4GV6A 2JWTA 5DS9A 3FZHA 1RFQA 2E6NA 3MEWA 4J8FA 1YJ9Q 4G6TB 3DKWA 2LK2A 3E6DA 2NNYA 3OYYA 1J53A 2YHBA 3VEZA 2DERA 5EG2A 2C0OA 1HLVA 4OPJA 3RMCA 4DSEA 1PUFA 5DTDA 4XTYA 1FP2A 4G9YA 4J2AA 1YQRA 1N9RA 1VSEA 2EWSA 4C8QE 4CHQA 3EZ5A 4B9LA 4FLWA 4EJOA 3TOBA 3ZSZA 1M2OA 3JB9J 1WYXA 4N47A 1D1CA 2VBYA 4F91B 5E17F 3E9GA 4ON0A 1SC7A 3VEXA 4M7AB 1X3UA 1AOJA 3THXA 3OJSA 2E1NA 2YKMA 2MYSA 1WAFA 4FASD 5D6YA 2EB7A 1NG2A 2O6GE 2ZKZA 4BACA 4I09A 5CVUA 4IRGA 1X58A 4DV1K 1IZ6A 3UA6A 3MAJA 2YHTA 3VJPA 2JVGA 3WTTC 4X9CA 1N5YA 4FJNA 2Z0WA 1UA1A 2R5ZB 4EZ9A 1G99A 3DPUA 2VXDA 5GANh 3DLRA 3ZT3A 1MD0A 3V1QA 1RBUA 4XIUA 3H3NO 3H0HA 4JKCA 1ATSA 1JKRC 4DQ8A 4GLMA 2MD5A 2MCNA 3U9DA 3K70C 1PP7U 2LQKA 3JCMc 3P8DA 4I2PA 4IOAF 2E2QA 1J5YA 1K8AU 3EPZA 2GTJA 3F23A 2E1YA 3H9NA 2HFHA 2VOOA 4C3IJ 4IIMA 3AO1A 3LSGA 3GOIA 1VQ7N 2JRMA 4L3QA 4Y15A 3I64A 3I56N 1AWCA 2L9VA 2RN7A 1CZBA 4B1YB 1ZN2A 4O5BA 2DKGA 3G71N 1OISA 3M0TA 2M34A 1Z3XA 1JBMA 3LGLA 2K6DA 1EO1A 2EFQA 4JI8K 2MLKA 1LDDA 3M55A 4FE4A 2PZSA 3KJVA 3F8NA 1Q7YU 4QS9A 1BKBA 5TRDA 2X48A 3QPTA 2NOFA 3MEXA 1U5TB 4M77B 4A3FJ 4B23A 4J9FA 1I3AA 4DTPA 4HCZA 5LJ5f 4AYBA 1VSMA 5BPMA 1RIOH 4EEFG 1C0TA 2JVHA 4HRIA 3QPLA 3S1MJ 2OCCH 3HEFA 3QXEB 3JCMQ 2CP7A 2Q2EB 3VFZA 2G8HA 2LD5A 1YI2I 4HTUA 3S14J 1I6XA 1LQ1A 4AHCA 4ORZA 1RTJA 2JS2A 1NGEA 1BI3A 1DKGD 1GBQA 2Y2ZA 1YRNB 3JTHA 2F5EA 2B5JA 1FJGK 4EMKC 3OS1A 3BFMA 1HNWK 4KHSA 4BBRJ 3G1LA 5D5WB 3CCVA 4Z8AA 2O31A 2NUPB 3VEVA 3CCRQ 1WQ7A 3O2PE 3VPRA 1Z21A 4F4KA 1VQ9T 3I71A 3FXKA 1VQ8I 4BHPA 2V7ZA 4A2AA 3CPWA 5BQTA 1MUZA 4KISA 1D4XA 2ECZA 3ZQHA 1R77A 1XN7A 4A6DA 1QO0D 5SZTA 2OPRA 2GXAA 2FBVA 2EZKA 5KRTA 4L18B 4CDGA 2ZSHB 4Y1DA 2ASOA 2DL5A 3CCUT 3TMOA 1AHDP 4KUIA 1N25A 2CP5A 3HJFA 2BE7D 2YJFA 1YITI 4C8QA 3UKGA 4C92G 4FPBA 4GW6A 4BREA 1TK5A 1X6OA 1TNSA 3O9SA 3SYZA 4N9HA 1BA1A 2L9SA 2OPPA 2X85A 2ESNA 3CCVQ 2XY7A 1NHAA 3CDHA 3VB2A 4CJ3A 1ETYA 3HRGA 2IG0A 4JBAA 1I07A 4VUBA 1XX5A 4PJOE 1NOZA 1M1EB 5DY9A 2QDYB 1D0ZA 1T44A 3KETA 2KRNA 4KICA 3FDRA 3L0QA 3M0SA 1TKXA 3F8BA 3M4YA 1VQOA 1SV5A 3H9QA 3EFOB 3SWNA 2K79A 1U5TC 1IKXA 2QA4I 3PJRA 3TCJA 3ID8A 1MBEA 4A54A 2BZ8A 5JLWA 1EV7A 3OW2S 2W03A 3SFIA 1FKOA 4JAXA 5CKBA 2X4YA 4BR0A 4EJZA 2IT0A 4RAYA 4DQIA 1ZYRF 1XSVA 3NVKA 1R58A 2GIZA 2M7BA 2AQFA 4RTZA 3GNGA 3PFYA 1KIKA 1QBJA 1ZHIA 1MNEA 5FKMA 3ATVA 3V42A 3CF5F 2YS9A 2O4IA 3HG9A 5LJ3g 3BDUA 1MH4A 4CZCA 1JTYA 1EXQA 2K9LA 1VQMN 3VS1A 3OS2A 1JCEA 2RN2A 2Z1JA 5BNGA 4NZGA 2A61A 3JRBA 1HCRA 4X64K 4HVWA 1F1BB 3T1AA 1O3SA 2JJ9A 1JXBA 2AP1A 3KEQA 2W42A 2K02A 2J6OA 4DFKA 3TEEA 4LLLA 2DBBA 1B59A 4IRIA 1N8RR 2XSDC 3CBMA 1OZ2A 3M9QA 2G8FA 2QEXQ 2RHIA 4IOAL 4JLHA 1JXEA 1Z1DA 4XL9A 4PSWA 1MZBA 1H89C 3F22A 1ZRDA 1WJRA 1KGSA 2ESWA 1T08B 3T69A 1K8KA 3F8CA 2O2OA 1S1TA 3Q5FA 4N4NB 2DTHA 2DW4A 4CGHA 4DOVA 3SFZA 4LFCK 2IS3A 3NPFA 2W1OA 2IIMA 1D8JA 1NBWA 3JSCA 4J5YA 5BR8K 1VYVA 1B34B 4PKIA 1UOCA 1NJXA 1V4SA 3O4WA 1NJIO 4PY5A 2JT1A 2IVOA 2R7YA 3QEWA 1ZBHA 1RDBA 3G0QA 3K0SA 1BIBA 4CF0A 2OZSA 3O80A 3ZCOA 1REPC 3DLLF 2W4SA 3IP4B 1VQKA 4LUDA 4HX4A 4D7MA 2A36A 1IAWA 4LD5A 3OYMA 2ME6A 2RHXA 4FJLA 2FSNA 2LZ6B 1W0TA 1X3ZB 1NK0A 1RCHA 1Q7YO 4FLYA 3VENA 4RMOA 4LLNA 4GYIA 1JLAA 3DPLC 1S5LC 5J1YA 3EUAA 1TL3A 2BGCA 2O9SA 3KEOA 2JPCA 1LB2A 2OJED 4BR4A 4N56A 3ZP5A 3JCMV 2RO0A 1OVQA 1FPQA 4TSXA 3JB9F 5CK9A 1FMVA 2Z1HA 4MDBA 5DV5A 4PIIA 4A4FA 1VZ0A 1IHVA 3K70D 4HWIA 4FSVA 1LNXA 5IP7J 4CXFA 1HSJA 4Q5SF 1UAAA 2D9TA 2NRAC 4AIKA 2LVSA 5AQQA 2FVUA 4F3QA 3VDXA 4QPQA 1K8AO 5HK0A 1WZOA 2VXEA 4EJWA 4BWMA 1OCZH 1KQSA 4CFAA 3G71T 2AZSA 1SAUA 5AQNA 5AQKA 4AHUA 1JLEA 2JA7J 2KYBA 5LJ3e 4M41A 1ETKA 2AQEA 3GOXA 4HF1A 4KB0A 3SQNA 2DPNA 5GAHJ 1OH6A 3VF6A 2VUBA 3VQ9A 2MLGA 3TQ7P 3MKLA 2LMJA 4A3KJ 2OU2A 3CDIA 4UUSA 3QG1A 2MC3A 4DQQA 2FU4A 3JRIA 4UB8C 2DIQA 4XTVA 1X01A 2R5YA 2QG9B 1YJNT 2DYSH 3C2HA 5AZJA 3SFMA 1RZ4A 4PJ0C 4OPHA 2Y0SA 3PFIA 1JB0E 2A5YB 3SUPA 2HHXA 1M90R 1UJ8A 1XPXA 4FJKA 4C1NI 3MZ8A 5IYDJ 3QWXX 1OFCX 4RB1A 2W25A 2QQ9A 4HVVA 3WG9A 2QK0A 3CLQA 2ESHA 1UGSB 4ZTFA 1KCFA 3C95A 3DKMA 3ULQB 1A5VA 1X1DA 3HB9A 3DLLA 2EYZA 2LP5A 3J80Z 2QGUA 3L7WA 1VQPT 2ZFUA 2NVUB 1SFEA 4M77C 3ZQLA 4PK4A 1A04A 3EUHA 2LQWA 1U5TA 3EFRA 1TAUA 1IF1A 4H0XB 1R5HA 2BW3A 2CV1A 3MEUA 5FPEA 4CUGA 3S41A 1BUPA 3ENHA 4IEIA 1KC8O 1RT6A 4M7XA 1PKSA 1HXDA 3QP5A 2OTLT 1VQLA 3V9SA 3LQRA 1RR8C 3KPHA 4Z4CA 3F2KA 4KH6A 1WI3A 4PJNA 5DD4A 2HNZA 4A3MJ 3P31A 3SZ2A 3CO6C 3QYHB 5ERIA 1MMDA 1M3HA 3RPQA 3HPHA 4KGVB 4DV6K 2VGNA 3SHWA 2OFKA 2DU9A 3ULRB 1DLOA 1U49A 5HS7A 4FTHA 3FXJA 1E0EA 1IRXA 5LMNK 5IHKA 3UWNA 2F96A 5I21A 1YW8A 1X1PA 4RCHA 5IXFA 5E8IA 4BDPA 4N4OB 3DV8A 2RQWA 3VN5A 2FXUA 5K5OA 3UKRA 2RQQA 1JL1A 3CC2A 3M0QA 1LW2A 4B9UA 4HSTA 3AG1H 2QM1A 2DFUA 2EV0A 5F08A 1JE8A 2VASA 4R56A 4XSZF 3G6ET 4E6RA 5L3GA 1IUFA 1NGGA 1WSIA 2MIOA 4F9OA 4OKJA 2BXYA 3RJPA 2O7OA 3EH1A 3CMEN 2CSOA 3SD4A 4A3CJ 4CEEA 5GANf 1VQ5N 4FLVA 1BJZA 1VQNQ 5KVRA 1B7TA 1KU3A 3AL0C 2CZ7B 2L3RA 2DI3A 3RKWA 3K58A 4RS8A 4FU6A 1OCTC 5K5QA 4CJSA 4HUEA 4M3UA 2PFUA 3U1KA 3H92A 2EBIA 1ZQ1A 4CSWA 3A5OC 2L7ZA 3TTDA 1WIEA 5LY3A 5EYRA 4A3EJ 3ISPA 3VYGA 4AI5A 1R7JA 1S9GA 3FMQA 1GOCA 1X2MA 3GF2A 4NCAA 2RPIA 2JM8A 3G2BA 1V3FA 5E1XA 1VQ6Q 3BQYA 4RCCA 3O5BA 2QQBA 2QASA 3BF3A 4OFAA 4G6DA 4MIMA 3KBGA 4M77G 4M75C 4MDAA 4AG1C 1W7PA 4MQVA 1IGUA 3PGGA 4BRGA 2E60A 3MEAA 4ZN3A 4QSHA 4E1MA 2N8GA 5D5VB 3CXCP 1DTTA 3COAC 4M7AF 3BR6A 1FN7A 1OKJA 3P39A 1XNQK 5EZGA 4BXXJ 2LBFA 1NJIU 1MH3A 2KFZA 4FW1A 3M59A 4QIWN 1X75C 1QVGM 2ZD1A 2DM1A 3BT9A 2PG4A 1YIJN 3LALA 4UY8I 3ZEUB 1UHSA 2RB6A 4HUFA 5HKCA 3CCMQ 4M75D 3FBNB 1K73R 4M3TA 3H0DA 2FSKA 1U3OA 3O6BB 1K9AA 2ZGYA 3T1HK 4XONA 1I1GA 1D9DA 1T3SA 1XNRK 2L3SA 4QQGA 3CYMA 1RABB 5FW9A 3KP2A 2GBQA 2GWJA 4C2UA 1GXQA 4C92E 1W9HA 1TWBA 4E70A 1BI2A 4WCGA 2LY9A 1WX6A 3K4NA 2XPVA 2YLCA 3F3XA 2HHTA 5GMKe 1RT4A 2CRGA 3KLGA 2DETA 2O8EB 3WNHA 2DZ9A 2X74A 1O9SA 4OPKA 4AU7A 5CQYA 1BBZA 2HBJA 5BREA 1O7FA 5LGTA 2Z1IA 3QYFA 2XKOA 1EWQA 4WQ4C 2VL8A 4X66K 3QNNA 4OGEA 3ERMA 1OCOH 1J59A 4CCKA 2HL3A 5M5XJ 4CJ7A 2VJJA 4I7HA 1XWLA 4AQYK 1YF5L 2FHDA 2G0EA 1KFDA 4CRIA 3FISA 2GF7A 3SAFA 1S7EA 3O08A 1GXIE 3WU1B 3JRGA 4BWJA 2FBIA 4EVIA 5LJWA 2EA4A 1IN6A 4XN3A 1NK8A 1STZA 1NK4A 1JHFA 3BTJA 2VYTA 3EAEA 3C1DA 1AD5A 3F0ZA 2G6FX 4J9EA 3G4ST 3AARA 2JNGA 1KG5A 4DGWB 3G4SI 4F8RA 2EA2A 3G6EI 3C4SA 4KI4A 3MZYA 2STTA 3MWMA 4RW4A 4L59A 2A6AA 3JCMh 4FVMA 1ZC6A 4L5JA 3RSEB 4MZTA 2CUFA 4WE1A 4H0OA 1WXTA 4M78G 2EJRA 4A4KA 2JM9A 4J01A 2BDPA 5LL6Z 1H92A 3E9PA 3ZSYA 1RT2A 2HXIA 3DLAA 2Y1JA 3NWSA 4BRNA 1BBYA 2RJCA 1X9MA 4H0PA 3SEQA 4MNUA 1N3AA 1CF7B 2BTFA 1VQNN 4HBLA 1AZGB 3K1NA 4L9TA 1LDKB 2KI7A 3PL8A 1J0RA 4PUOA 1IBMK 2G8WA 1QTMA 5I22A 3WQUA 1RBTA 2M8EA 3M8FA 2EKHA 5AQRA 2WUSA 1I4K1 1FC3A 4WFBL 2FLOA 3CUQA 5E8GA 1U45A 2LTPA 3ZQQA 4CIFA 4OLBA 4NLBA 4RB3C 4IXCA 1WGXA 1VQLN 4DV0K 2EZLA 3IUOA 1HR0K 3EYYA 5B1BH 2KNBB 3FJPA 4Y3OA 4FJHA 4YHHK 2PMUA 1I6HJ 1E3OC 1T0FC 4KUDK 2Y4XA 4HNTA 2NRTA 1UHFA 1UE9A 1WJEA 4U0WA 1BIAA 3J81Z 4PFOA 1HW2A 2WBMA 5AQPA 4J2BA 4RCBA 3PIOF 5IT3A 1S1WA 2IRFG 2DAQA 4QLCU 4CFBA 1S7OA 3DXMA 4PQUA 2R7DA 4BS9A 3ONQA 2XUBA 1LWWA 8ATCB 1YJWA 2E2NA 3CF5L 5BPIA 3WVEB 4BJ5C 2QAZA 5GAN8 5HOOA 1U9OA 3DEWA 5JLFA 3HYFA 3G6EQ 5L3FA 3I56A 4MO4A 1BM9A 3DU5A 1WH5A 2DPUA 1GLCG 3ABKH 4S0HB 3IRRA 3ZETB 4Y1CA 4NB5A 4BAYA 2DL3A 2YI1A 5LHHA 3ASKA 1IKYA 2WTEA 3H1QA 2M1HA 2V4JC 3WODF 2JPSA 3UKRB 1QQOA 3CCET 1W7PD 2RNJA 3OYGA 1YFNA 3JREA 1A6IA 2ZPIB 5EDNA 2KXDA 1MMGA 1BCOA 4A57A 5E3NA 2RQRA 4KB1A 3A5ZB 3ABMH 3K4LA 3QZ5B 3Q0WA 2Q8KA 4L9NA 2YDLA 3TAGA 4B3RK 1UGRB 2M0YA 4Z2YA 1HYOA 1K8AR 1FX7A 3O3GA 4HLYA 2MAMA 1GHCA 3AFHA 4C0DB 1VQKN 1LWVA 4BE2A 4IUVA 3CMAN 5FLXE 4ILGB 4CCOA 2OCEA 1YTYA 2PJPA 3A5MC 2W10A 3J7AO 2J6FA 2EIFA 1UFMA 2ACJA 4WK8F 2JOYA 4WFNL 2FBKA 2KISA 5M9OA 5HBMA 2MSYA 1KQSM 4M7AA 2KP6A 4B44A 4EJTA 4XICA 3GNFB 3DLLL 5FLVA 2R7SA 3WGIA 2YV0X 3LYIA 3OWTA 3A02A 3QEPA 1TOVA 4RBOA 4CYCB 3EYIA 3MEGA 3ZMZA 3FMSA 3GLXA 2IA0A 1C1BA 2WY7Q 4PZJA 1ITYA 2QF7A 1YI2T 2DXBA 5DLOA 1W4MA 4DBHA 1T3VA 5LJ3f 1WSEA 4OMYA 1XNIA 3CMYA 2CV2A 4NXMK 1QWEA 2WC2A 1KSWA 1D8KA 1ZGAA 4F7UG 3CC4I 4EMKB 1D3BB 2EYWA 1IRFA 3FXLA 2ECCA 4BRDA 3UA7A 4LY7A 3CQTA 4F3TA 5LLQA 1NYGA 2O03A 2VG6A 2QEXI 3OYCA 2P9KA 2X4HA 2YHXA 4CJ4A 1GDTA 4LN2A 5AZIB 2E7WA 4ETSA 1Q1HA 3WU0A 1TT5B 3RIRA 4PKHA 5KK1A 4M9ZA 4OF1A 5GAEJ 3R2XC 2KHMA 3CF2A 2FEZA 4X65K 4PJJA 1MSFC 3IH7A 4J83A 3MP6A 1IG9A 1AWJA 4OMZA 1NYFA 2UXBK 3GZ6A 5J1UA 3R0AA 3WXIA 4M72A 2ZMEC 2E5KA 4M7AE 2L5QA 3ABLH 4FWNA 1IV0A 1R23A 3TSUA 2LMDA 4M7DE 4GNIA 3IHUA 1MSEC 1NG9A 3OYJA 2E65A 1ZQ3P 4JI4K 4M74A 4BNCA 3HTVA 2RA2A 2RQVA 2AHQA 4C2TA 2DTUA 4M71A 3KYLA 4DR7K 2EYXA 1LJ9A 5DM7R 1EH6A 2I7NA 1S9HA 1QP2A 5FFXA 2FBXA 2E6MA 1N75A 2HWVA 4AF1A 4QTRA 3W2VA 1YWOA 1CZ9A 4I98B 3WVDB 2Y9YA 2NVQJ 3BPXA 1VQPI 1MBFA 1KLMA 2B9SA 1JJ2M 4WF9L 4YTLA 3OSGA 1M8MA 2ZNYA 3NQOA 2A05A 3BR1A 4A3DJ 2Y48A 1ZA1B 3M8EA 4HNVA 2D0NA 5C24A 2HDDA 1KQ1A 2MI6A 1VQPQ 3F9MA 1R9TJ 4HTLA 1GVDA 3EGDB 4DU4A 1CKBA 2RK1A 4CFCA 3QPHA 4J7FA 1K73U 4BUGA 2LF8A 3PIOL 3CCEI 3RESA 1YX3A 2PVGB 1C1AA 4G7ZF 2P9PB 2K27A 3T19A 1WNSA 5TISC 3H41A 1SANA 3R6SA 3GMEA 4M45A 3MWPA 2CMPA 1N8RO 1YO5C 3NF7A 4CC7A 3AAQA 3TSZA 1ZSZC 3OOUA 4CEQA 3CJCA 1XMXA 3VS7A 5LD2C 1IW7F 4F7UF 4HVJA 3L00A 1B8IB 2E1ZA 2VWKA 3QFUA 2PFBA 5E26A 3C6TA 3C0BA 4A0YA 4DSIA 3HOYJ 2Y1IA 3JCUC 2BOLA 3ZT2A 3FBIB 1G4DA 1MV0B 3KP6A 3GTOJ 1PDNC 4UUTA 4Y13A 2YXYA 5EXWA 3RQ4A 4IUUA 3JRZA 2CSIA 1QSYA 3KWGA 2O8FA 4E9EA 2V6EA 2WSCE 3GPLA 3MP8A 4GV9A 3P9CA 1MGTA 1U04A 4W5OA 4CEAA 1Y57A 4GO1A 4DHYA 2YHAA 3KHYA 4XKBA 2J05A 3MQ0A 1SAZA 5CYQA 2M2EA 1WXUA 5GAN3 1MJBA 2DCEA 2ZPEB 3EFOA 1O57A 5BPLA 3JRDA 4PKGA 3VQ8A 4BG8A 1VQ6I 1E6GA 4KKOA 5DLQE 3OMGA 1QE1A 5L3EA 5GANe 1E3PA 2BY3A 2OTLI 2OTJT 3D5SC 4IOCL 3EGUA 2JRTA 1JKQC 1XI1A 3OW2M 3H3UA 2O88A 4HSBA 5BR9A 2LOOA 4M3YA 3EG3A 1EF4A 2E3IA 3GWZA 1AKHB 2XIDA 4CE9A 5C10A 1GCQC 1C1CA 2O61A 4L5IA 2BTTA 2RHZA 2C6YA 4II1A 3BF1A 2K5FA 2QEXA 4JLIA 4BI4A 3KFWX 2EK5A 3VYSB 2XY8A 4JP0A 2RMOA 4N41A 4A0XA 4O5VA 3L2ZA 3K6GA 3QO9A 2PX9A 1QQJA 4DLEA 4B4CA 1RAFB 4YIFA 4M75F 3I59B 5DM7F 4BQOA 4E1JA 4NBQA 3OQ5A 1UG0A 5GAGP 5JMVA 1ON1A 1AWWA 5GAMh 1YS7A 3CBOA 3FM3A 4O0JA 3E66A 5CR4A 1VQ4N 2Z2SB 4KGZB 3I58A 3MMYB 1KFZA 3IDHA 4B47A 1IN7A 2Q0OA 2PLYA 3DFGA 1KXPA 5K14A 4XU0A 3CTAA 1FKPA 1WJQA 5KYUB 2OD5A 1A36A 2VN2A 2PMZN 3E6MA 4FWLA 1HW5A 3AVHA 5AFUA 1QSLA 4C8QD 2JWKA 2VYPA 1WHGA 1A6QA 1YOVB 3M5RA 1N8RU 3FKJA 4C8QG 2HVRA 3LZIA 1B34A 1OQKA 2NRXA 5IAYA 4IL6C 1W6XA 5FWBA 1S1VA 1OX8A 2XHBA 2VBWA 1VQOT 3P9IA 2WA0A 4FSSA 4EM1A 2E20A 3VERA 3PO2J 1V29B 2EV6A 3P8HA 1V76A 3KTQA 1R49A 1BW6A 3PT9A 2H27A 5GAMd 2OV7A 4FWRA 3JAMO 1UFFA 3V7SA 3CD6I 4OP0A 3KIOA 3ZR8X 4OMFB 1NLVA 4U7BA 4H8KA 5DDGA 4CZEA 3GTMJ 1U1TA 5EGOB 5J2MA 1A5XA 1BR2A 1GLDG 4BY7J 2QWPA 3J80E 1QZ6A 3L2QA 3S1RJ 2A68F 3ROUA 1ZSZA 1N3CA 4B3MK 1Y97A 4OB2B 1KFSA 5FB2A 2UUZA 4M78F 3EG1A 4ATOA 2DPPB 1OYIA 3VMFB 3JB9G 3T1YK 3D4VA 4FWSA 3WTUC 1DGWY 2V79A 5HLIA 2KMUA 4KTQA 3VQAA 3DP7A 4BYYA 1VQMA 4QPOA 1IV8A 4CZFA 3G3ZA 3KXTA 4K8XA 3O1BA 1FIAA 4RWTA 2PYJA 3Q7BA 2COYA 2XAQA 4F14A 2M51A 1HQUA 3PMTA 3A8LB 3X2QH 2EBPA 3CUQC 3ZMDA 5KE3A 2R5ZA 1HC8A 4XQ3A 5BPNA 2Z16A 4G7OF 2IC3A 1YJ9I 2IVMA 3M1FA 3G6EA 1VAZA 3EG9A 2ROLA 5HODA 3DPTA 3GTGJ 2HI3A 1P6RA 3VQ7A 1CGPA 3TGNA 1HSQA 3EGDA 4GXOA 1H9GA 4DYQA 2EQRA 3MN2A 1OCCH 3HI0A 3BJOA 3AO4A 4DTUA 3VETA 3L2CA 3TAEA 3LH5A 1DPRA 2LTOA 4FM0A 2HQHA 2OYQA 4IEJA 4XRMA 1Y07A 2R7TA 3NBPA 5BRHA 1QSSA 2GQQA 2QZ8A 3NTHA 1MMSA 2GV9A 2GX9A 1MDUB 4M7DA 3PX0A 4ELTA 2WAEA 1K4US 4XLCA 4L5GA 3FB9A 3TTFA 1T7PA 5CYVA 4AIHA 4CJQA 5M3FJ 3LDNA 5JS2A 5ECAA 4BI8B 3CPFA 2HNYA 2M7AA 1VI0A 2EZIA 3M07A 3REAB 1UUEA 2CP0A 3MP1A 2DO3A 5ADXA 4FW2A 3E1YA 2MGQA 1SKSA 2GIVA 4B1VA 1LWEA 2DTIA 4KRTA 2R57A 1RI7A 2VT3A 2A1SA 2KGTA 3KLEA 4YOXA 4DZJA 2ZE2A 1VIEA 2Z33A 3LDPA 4DOWA 2MBFA 1U8RA 2RQPA 2DF6A 3NWTA 3PTAA 4OO1J 4BKXA 4ENKA 5ILUA 5AQLA 4CJRA 3SAHA 4DA4A 4MLHA 4GKJK 2H6BA 4X1VA 3DWLA 4QT7A 5AQGA 2BHZA 1YITQ 2ZJ2A 4HCKA 4KTWA 3KP3A 5KN8A 4BY6B 5J2PA 1V5GA 4E47A 3SMSA 5KHDA 2G8UA 5FU6B 3F21A 3EG9B 3P4IA 4HEA2 2K9GA 4CICA 3BOQA 2V8JA 4CGIA 1IHWA 1RNLA 1MUYA 1VRLA 4GRIA 1IBLK 2UXCK 1C0UA 2STWA 5GAN4 2ZJRL 2OZ6A 5KTQA 4F2SA 5JVTA 3VS0A 2RNAA 3BG9A 2KIMA 2YUQA 3FZMA 3JW4A 4UHTA 3QO3A 3L1PA 2ID6A 2W6KA 1G5VA 5IH2A 3E97A 2V1RA 2IP2A 3ZQGA 2GLOA 4H0TB 3V7CA 4JLGA 1PJRA 1XGMA 2HW3A 4CZJA 4C92C 2GOMA 2A6TA 5M1NA 2HS5A 1WSUA 1NJWA 2R7ZJ 2ZQBA 3ZGKA 1X1BA 5BS6A 3BZ6A 3KZIC 2CFXA 2YUOA 1QP3A 1SMYF 2B8AA 1YJWI 4EJYA 2MPXC 5ICFA 5C42A 2JSPA 3DTIA 3F73A 3IH3A 2DJZA 4IHYA 4A4GA 1ZH5A 1QQNA 2D5VA 1AKHA 1T2KA 1LEAA 4RG8A 4II2A 2M30A 2ZAEA 1KHCA 3HKSA 1V5FA 1O4XA 3IG1A 4PGGA 2GWRA 1Z26A 2DXCA 3J7AP 2IGNA 2I5JA 2L0AA 2GTDA 4CJEA 3BZKA 1RTDA 5BRFA 2NOHA 2OTJN 2HOAA 2UXDK 3WXKA 4QKUA 1U47A 5IHNA 3F6OA 2JA6J 2AXTC 4FYVB 4FO0A 1YRNA 3TAQA 4IVNA 1NGHA 1VQ8N 3AO5A 4PGHA 1TTHB 4Y7NJ 2E1MB 2QQAA 3KK7A 2O01E 4XTUA 5HRSA 2JMCA 3I5RA 2JQ7A 1RBRA 1IH7A 1ZRFA 5F6FA 3I4PA 2O3FA 4S04A 3ERED 1NMNA 2DRMA 2DMNA 3CCLQ 1R00A 1P2FA 3BC8A 4GDFA 2CQQA 1KG4A 1RDAA 4EAHD 3UKUB 5HLGA 4B9WA 1SFKA 3JCMX 1B1BA 2O8XA 3S8PA 4LNPA 3PNTA 5TKWA 4FYYB 5GAMj 1BU1A 3H08A 1MBKA 1ONVA 1ZG3A 5DPKA 5E3MA 4YG2F 2CU7A 1QHAA 1SAXA 3CCEA 3META 4M78E 4BRLA 5F0XA 4EP5A 1ATRA 4JEPA 4M77E 2IVNA 2M16A 4BGDA 4FYDA 3VA3A 4IKFA 2COZA 4DR2K 4H5WA 4ISEA 1ZKGA 3MAQA 1AEYA 1H88C 2DE0X 2ZO4A 3NGYA 1Q81U 1ZYQA 2L01A 3MZHA 1DDNA 1VQ8T 1BO5O 3WEEB 3HKZA 1U3EM 1XOVA 2HBLA 1IXCA 1HF0A 1QHHD 1X4PA 2P9SA 3GL1A 1GT0C 2Y31A 5DM6F 1PD0A 5FU6C 5FGMA 3OW2P 1AVZC 4XMYA 1X3NA 2YG9A 3S3MA 4BY6C 1ZX6A 3U21A 2M4KA 1MNDA 1FTTA 4YFKF 2RI3A 4YOQA 5HNHA 4O5FA 1JQQA 4A6EA 3UF4A 1LOJA 5L8RE 3IKTA 1NTCA 3T5XA 3RSNA 5HDKA 1VSJA 4MFBA 2R5AA 4JKBA 2DOFA 2AJQA 4DFPA 1VQMI 4A4EA 2FF6A 1H8AC 1T3LA 1K9MC 4LG3A 3HPOA 3ZPLA 1NE8A 3CCUA 4YIRX 3I4MJ 3FJ5A 1Y39A 3CC2I 3LFUA 4E6KG 3GO5A 4P9FA 2BY1A 4AI4A 3KK1A 2DL8A 1QU3A 2PVDB 5CY4A 4D0PA 2P1JA 1IO2A 5J2NA 1J9IA 2RGVA 3V8KA 3QOEA 1N36K 3HRMA 2XY5A 2I5WA 2NS0A 4DJAA 2HHUA 3DTEA 4EV0A 1FOYA 3IQLA 5GPCA 4CA0A 1YQKA 3FZLA 2DY4A 4Z94A 4BRFA 4I02A 2QSHX 2EX3A 1T33A 2ZJRF 1M90O 3LAMA 3QBXA 3LMMA 2YU9J 4X6AJ 5AQJA 2E4LA 1SD6A 4AHTA 1JUPA 1P7IA 3REOA 3AVLA 4H5RA 1XD7A 3G10A 4JKGB 3KTUA 5B1AH 4ZNXA 3BLYA 3ZSRA 1AWXA 2O8BB 4EJUA 3O9QA 5H20A 1B6AA 2NUTA 1Q81R 2HKNA 3WTZA 2JN0A 2VQLA 2Z1DA 2O4GA 1L5UA 3KEYA 1G3WA 3DRPA 3HOZJ 3EO3A 4M7AD 4LC9B 2KLOA 1USTA 3L1AA 1VSFA 3LA7A 3F70A 2VC1A 4M3EA 4IO8A 4MEYF 2F69A 1KK7A 3PNVA 3LP0A 1XB4A 1V4TA 1YTUA 4MFEA 1YFHA 3M3ZA 2Z99A 3B02A 1W36C 1WN7A 4CIEA 3DLMA 1KAXA 4J6WA 4PUSA 2DNUA 2M1BA 4B9NA 3U3GA 5B8HA 3CPWM 4BRHA 5E79C 1HDPA 4JQFA 1P7MA 2MH9A 3OYAA 1OLTA 4GFBA 3EFSA 1PVEA 4DV5K 3I55Q 1RC9A 3NTIA 1UMQA 3DLHA 3RRGA 4B8AB 2JJ7A 4R8HA 5BOXA 2ENMA 4UVAA 3C2BA 4OOIA 3JB9H 4IDHA 3K4MA 2DL7A 1WOQA 1S9EA 2W82A 4FK2A 4C8KA 1W2BA 3L2UA 2KRSA 4EM0B 3AG2H 2LC2A 5C44J 2P9LA 5F2RA 2Q2RA 2LNBA 1VQ4A 3HSTB 2M5WA 1IN5A 4M7DD 3H8ZA 1VQ4Q 4HNUA 1I5LA 5GADP 1IUYA 4A63B 4LLGF 1JLCA 3FZVA 3WHBA 5HK3A 2ETHA 2O8CA 1UHCA 3CCLT 2LJ0A 3KP4A 1IRGA 4HVUA 5IOYA 3GXOA 1OYWA 2LT4A 3DYAA 3LP1A 4I0BA 2JHJA 4LG0B 4ENNA 4LOCA 1QVFA 2L02A 1H3HA 2O8FB 1R5ID 2BHYA 2HDWA 3QUIA 2ZBKA 5C25A 4ESJA 5KAFC 2JZ2A 1GLBG 4AT1B 4JKAA 1S5JA 3SEMA 4DTRA 4QVZA 1WHUA 4BXFA 1EP4A 5AQXA 4OFHA 4FJIA 4ZYHA 3DBHB 1YCYA 1N5ZA 1I1JA 4LF9K 1I5ZA 2ITMA 1GCQA 4HX7A 3SBGA 3A5LC 1Z6TA 1NK5A 2M0CA 4YRVA 1JJ6C 2JTEA 2F5KA 1XG7A 1ZR2A 4B3AA 2VQGA 5GANg 4JHDB 3O8GA 2FNPA 1NG7A 1Q95G 2O8DB 2R7UA 4Y17A 2PN6A 3OA9A 4JPBW 1WSJA 1AWOA 4Z0UA 2KT8A 4KIFA 5D6EA 3OB9A 1RKTA 2CS3A 2DJIA 2R3SA 1Z6RA 3I55N 2RE2A 2X78A 1DJ7B 3E6BA 1VQKQ 2L0KA 4B6MA 3X20B 1KYZA 1MJAA 3Q9SA 1DGRM 1T03A 5JVGL 1WSGA 5J47A 1Q82U 3BDLA 3BE3A 1M1GA 1OU8A 3CCEQ 1NJZA 4QS7A 4RW8A 2FYKA 4M7DF 3I59A 4AHRA 2DA6A 2KJCA 4DLGA 2NNNA 5KYNA 3NMZC 2DMTA 2NOBA 1YAGA 3CPWS 3SBTA 2DA2A 4BE0A 5HS8A 2WAQA 3OVNA 4KI6A 2WTUA 3V9XA 1VQNT 2VPLA 4H0EA 3L3VA 2YUNA 4FJ9A 1HW1A 2CQKA 4RGSA 4EMSA 4BB7A 1M9SA 1ENHA 2HOEA 3PE0A 4AHSA 2CT3A 2QBYA 2AK5A 1NGBA 2G8IA 3ABTA 1RAEB 1WQ2A 4UC4A 1YYVA 4F04B 1V55H 1X2KA 2L8DA 2XRLA 4LFBK 2HMIA 1LVKA 1UGPB 1S72Q 1VQ5T 2NOJB 3BCAA 1QVGP 3NAEA 3ZETA 3M4GA 2CP6A 3FF5A 2IOCA 1LFPA 2QTXA 5IWAK 1ZBUA 3B6CA 4E3SA 4Q5VA 1ZXOA 4J9HA 1RBVA 2FO0A 4U0VA 1GL5A 4DF4A 3X24B 4M78A 4FLUA 4HW0A 4D5FA 4OMLA 2ATQA 3TTCA 1NLOC 4NQWA 1PCXA 5LJ5j 1FYLA 4J7IA 1TKTA 5FU7C 4V2SA 2KFNA 3O3HA 1ZRCA 1LE8B 1KG2A 5KYYB 3H35A 2VQHA 3SDZA 5C3EJ 4PL6A 4AH9A 4L9VA 3WT0A 2X6SA 4F52A 3SDBA 1S6PA 3WQTA 2J7IA 4KULA 2XAHA 1RRJA 1N77A 1TSFA 5J8FA 3SAGA 1ABQA 3ZQFA 2GWKA 4HF0A 2GTOA 2KZMA 4KT6A 4RTTA 5BRDA 1VQ9N 3L09A 3U6FA 3NFAA 1REVA 3V8JA 3JCMd 1YI2A 3CCUI 1VQ8A 1X9WA 1R0CB 2CP3A 4CYDA 4RTXA 3OA6A 2YSQA 2MA3A 3PX4A 4KH4A 4OMPA 2DMOA 4PKCC 1NU0A 3FXMA 1YJNN 2F8TA 2RKIA 1Z9CA 4O8UA 4LF4K 1ZK8A 3JB9D 3GFIA 4ZHRA 4BQQA 1NGJA 1QHTA 2R4GA 2MWOA 4J6XA 1KQ9A 2ZJPF 2R58A 1OX9A 3OBYA 1M3CA 1HPZA 2DXUA 3D2FB 3OYLA 3NF9A 1C0WA 2CFOA 3P5JA 1YIJI 3C6AA 3JYTA 5ILVA 2YHYA 3BR0A 2DAOA 2QK9A 5EEHA 1LNWA 1OMIA 2ZPGB 1FYKA 4IUQA 1WH7A 4RW7A 2NS7A 1QZ5A 3HZ6A 4NC7A 2DZCA 2EIMH 4FLXA 1P59A 1J09A 4XOPA 3VPZA 1Z91A 2KAFA 2BYVE 4MQ9F 2FXAA 1I94K 1FZPB 4M7DB 4XU2A 3I35A 4NL3A 2L7MP 2RI5A 2FD5A 3ZRGA 2V9PA 3SZGA 2FC0A 1WJDA 3CC7A 1OCRH 1SL2A 1B72A 5GIPA 2E5LK 4LH5A 2Q2EA 2JXBA 1IRZA 4OVAA 4KHPK 5I42A 1PP8F 2QLZA 3CEYA 4P5NA 1VRUA 1B9MA 5M1QA 2MW8A 3MHXA 1FTZA 4BBSJ 2DVEA 2CV0A 5F1RA 2W57A 4F93B 1JO8A 1QVPA 1QMCA 3FM5A 3PUFA 1X19A 3I56T 3QJ6A 2I8DA 4CZKA 2V26A 1XC9A 3I8DA 3JV3A 4CZGA 1VQMT 3GTKJ 5M1OA 2Z5UA 3G4SQ 5D8LB 2A08A 4P5OA 1SHFA 4RGUA 3ENOA 1U2WA 3AA3A 3DWLE 3A4CA 4M7DG 3UE5A 5MLCQ 3CCRT 5F1XA 3S3NA 3DMJA 3LWIA 2RVCA 4U87A 3W2WA 3VQQA 1VQOQ 1YJ9A 2QKKA 2FPDA 3ASNH 4A3BJ 4BC3A 3GW2A 3THYA 3CBPA 1PM3A 2BZXA 3WNEA 3V81A 2VT2A 3CCMN 3C12A 3H0GJ 2LP0A 2YR2A 5E18F 2VUMJ 1E4FT 4A3GJ 3G6EN 3EKUA 5GAMg 3A03A 2NRHA 2CW0F 2O9VA 2OUMA 3CCLN 3HFOA 2L4MA 3EHRA 5IT9E 4UVBA 4Q5WA 4DTSA 2EPFA 4CK2A 3ZYYX 4NS5A 2RK2A 2RPNA 3NE6A 4IO9L 2E19A 3MDQA 4B1RA 3L3UA 2LQ8A 1VNDA 1PWTA 3QU6A 5D5UB 2ZFWA 5FLXZ 2QKBA 3SB2A 4B09A 3SUQA 1NKBA 4V19S 1JUSA 3ZT4A 4ELZC 4M6VA 1FOKA 1WZ2A 4U0YA 2WAFA 1U84A 1PHTA 3GLLA 2JUFA 3HP9A 1GOAA 4OB0B 2P9NA 2BVLA 1MUDA 2OA4A 2H56A 1XCVA 3VQEA 5ICGA 2VQEK 4E7HA 3IAS2 3T1BA 2B63J 3H5AA 4EHUA 4XLNF 2VXFA 3SLCA 2LG4A 1XHZA 1HYSA 1T39A 2K5LA 2XGXA 2M87A 4RTFD 1VQLI 3CMEA 3VQPA 3MCZA 1D3YA 3GFMA 1TXQA 1V1CA 3WTSC 3D2EA 5CZ2A 2HBKA 1IXDA 5C15A 1DPUA 1VSHA 1ARKA 2WY8Q 3K69A 4I6ZA 3HFNA 1TWAJ 1MV3A 4LDWA 2H8RA 5M1FA 3CCJI 4ZYAA 2I7PA 3JB9I 4RAZA 3CWTA 4LJZF 1FP1D 1BA5A 1BYMA 4C5GA 4PA1A 2COBA 3S9HA 4JKEA 2KXCA 5DM6L 3AAPA 1T38A 3D45A 1PU6A 4I7FA 1ZSZB 4DFJA 3R3LA 3BY5A 1J75A 1MWKA 3H0IA 2O8DA 3HUGB 4KN7X 2CGLA 3HM9A 4GVEA 4AFUC 5GAMe 3FXRA 3SQ2A 3OHRA 3E9OA 4ANJA 2V7YA 3LW5E 1L0OC 5DMRA 2HQAA 4LGWA 1D0YA 3CMEQ 2E34A 1U2VB 3CUOA 3P8BB 3ZMTA 3W6VA 1EFNA 3VV0A 2PU9B 3TABA 3VW4A 1Q7YC 1K9MR 3MEEA 3B6AA 5LJ5e 3DXJF 2UZKA 1JTXA 3CC7T 4AM7A 5AQSA 1S29A 4IG3A 4LD9K 2DA3A 1IO6A 1YITA 4B1XB 3HSEA 3JCMb 1WCMJ 2OJ2A 3RMSA 1KG1A 5C4JJ 2DXIA 3K5NA 2ZXJA 4CC3A 3BTCA 3HRTA 4BR2A 2CQNA 5FJ8J 2QQRA 1UCRA 4XIDA 5C2DA 4FX4A 1VQKI 3FRNA 3PSIA 1AZEA 3A0HC 1Z05A 4ITVA 5LJ3d 3MWTA 2E6LA 5LGNA 4M6YA 1D1AA 5HP1A 2XHCA 4QW2A 5M1KA 2KK4A 3HHHA 3AT1B 1GLNA 2ZGWA 3PVLA 3CVTA 1HYVA 4FM2A 3CJ7A 3FKIJ 1VQ8Q 2KR3A 2H3JA 1JI8A 5JR3A 1ZBIA 1W36D 2VGMA 2HL5C 3WE3A 4O3MA 4XTWA 3ML6A 5BPDA 1EKEA 1TT0A 2B0LA 4PDKA 4UXNA 2BV6A 4A5MA 4LMYA 4A62A 4IZ9A 2OA8A 3TAMA 1CLQA 4IHTA 4Z4GA 3SCXA 2HAXA 3I5SA 5EZHA 1K79A 3A01A 3MN7A 3HRSA 1R4MB 1LJOA 1T56A 2XGEA 1U06A 3AVNA 2UXNA 1VFCA 2MABA 1R71A 5F27A 4JRQA 2VCPA 1VQ5Q 2PNIA 1KQSP 4NCGA 2LKSA 3TQNA 3RBBB 1X1AA 2UU9K 2R7OA 4A5AA 2X9DA 3VS5A 1VQ4T 4BEHA 1Q8IA 1K9MU 3QMLA 2OTJA 3EE9A 4NXNK 2FZCB 2Y90A 3CC7N 3K9TA 2E36A 3PIOA 3AGRA 4C3JJ 2RAEA 1QW1A 1RUNA 3S2WA 4OIOF 4JD2B 2MFZA 4MMLA 1WKMA 5I11A 5GAOl 3F5TA 2DFFA 2R7XA 3S6WA 1K78B 1W1FA 2ED0A 3GCMA 5CVRA 3VGMA 3L9FA 4CD1A 5HLHA 2JA2A 4KH1B 2C0TA 4FJ8A 1QZYA 3F6VA 1K73C 1ETWA 5GMKl 5IT9O 3M8JA 2AKLA 3TAPA 3LQQA 4HPQA 1YX5A 1IDYA 2P5GA 2DIGA 1EX4A 1ACMB 2D6FA 1NNEA 1BOTO 3I3LA 3LX7A 4WQ4A 4ZDOA 1WGSA 2PUOB 2R92J 3CC4Q 4BRMA 3G1OA 2ZJQF 2H1KA 2BUDA 5GJWB 3WUHA 2K9SA 1RDCA 3EL2A 2K3PA 2P5VA 1VQPN 4CGJA 3DLEA 3R6NA 1TUUA 2V8IA 5C0MA 4ZJZA 4J2EA 4OJRA 5K7ZA 4CJTA 1RDUA 3G1MA 3A8MB 4FJJA 2LREA 3QU3A 2HKQB 1H0MA 2P9UB 5A2QZ 1BQNA 3GYHX 4RTUA 5KI6A 1HUXA 4QQ6A 2PBDA 4DV2K 1IG8A 5GAN2 1HDDC 2Y0SN 4KGXB 5KYWB 4ASNA 4CEDA 1PSFA 3I33A 3HSFA 3QWLA 4DNCA 2R7QA 3HOXJ 1DUXC 3LDLA 1YNZA 1SRMA 3GZ5A 3OSVA 1GLFO 3WXJA 3DCFA 3TU5A 1MBGA 2LRQA 2D1XA 2F5DA 4M78C 3EY1A 3AL0B 2EFWA 4DSJA 3IKVA 4RW6A 3RR7A 1O13A 1U9NA 1TUGB 1ZELA 1RDWX 4CW7B 4JI1K 2LYCA 1SKRA 2X6WA 1IN4A 1W7AA 5C2FA 4E2FB 3DBRB 1O7LA 3SHFA 4IEEA 4YPHA 1X3WB 3QQAA 4V2GA 4GVMA 1V54H 4N4HA 1M1FA 4E89A 3CUQB 1U48A 4R55A 1TGOA 2FRHA 3FLGA 3SPZA 2XC7A 1WLPB 1YQMA 1G3YA 3KUFA 1SSFA 3M7GA 1YJNQ 3BJ6A 2EW3A 2GQVA 4AM3A 3SQ0A 1QVUA 3FZKA 1RPWA 3HO1A 2FRYA 5J3LA 3D0PA 1PU7A 1G2BA 1SD4A 1Q86U 2VI6A 2E1OA 3L8BA 4CHNA 1E4GT 2X35A 1R59O 1Z7UA 4O6JA 1TWGJ 5HRPA 2W40A 1PYVA 1K7AA 4CFDA 2P9UA 1AA7A 2QXLA 5F0HA 1JCFA 3U9ZA 1T0FA 4M42A 1X6GA 4ILHA 2HPMA 2Q0UA 4C92F 5D6WA 2D1HA 3KCCA 4M3XA 3GBQA 3MVPA 3ER0A 1YHQT 3ZQCA 2OQGA 2DYRH 2ASPA 4KH0B 3D0SA 3WTYC 3D7EO 4DR4K 2CUEA 5FKLA 1RACB 2NUPA 3KLHA 4EJVA 1ORKA 4JK7A 3JRFA 4QVDA 4OAYA 3RQIA 1ERDA 3EUHC 2VV5A 4ZN1A 5KAIC 1QVFP 4CJ5A 5HDNA 2A0FB 1YITN 4KBOA 5I9EB 3ZSVA 1G59A 3FE1A 3RCOA 4XRSG 3VRZA 4QCLA 2PQWA 2HBPA 4MO5A 3OYEA 1K0XA 3DF8A 2D0PA 3QEIA 3WU2C 1HNZK 3JCMJ 1FIPA 1JJ8C 2L2PA 2CO5A 1O1WA 2JTVA 2NOZA 2ZM6K 1RUWA 4C5EA 1SEMA 3JSPA 3QNOA 3UNGC 2DPDA 3S1NJ 2FOKA 4OGCA 2QYOA 1YE9A 4FJMA 2OI3A 1BDGA 1HKCA 4AMCA 3GIBA 1N9SA 2X3WD 4XLPF 4DR3K 2DFHA 3R8EA 1WFWA 2BZTA 4LXCA 2MOXA 1J3TA 2IBDA 1XJWB 2BUPA 3M8RA 2PMHA 3E5QA 4M78D 4WTOB 2O8EA 1XDSA 2YU3A 2HF3A 3LSRA 4NCBA 4OU0A 5H6RA 2O4XB 4F7UA 1P92A 3F8MA 1ETOA 2FG0A 2E71A 3FXOA 1KG7A 4ZYGA 2KL4A 2BY2A 2W41A 4EM2A 1HSTA 2WADA 1FJLA 4QWQA 2A3SA 4DTXA 4BY1J 4I2OA 3FFIA 2C0IA 1T6SA 3TSWA 3F72A 3CPWP 5BN8A 2HTJA 3LSTA 3FFKB 1KD1R 3FHZA 1WWXA 2IVPA 1TNTA 3O6WA 3HGYA 2VQCA 1WEGA 3RMBA 3VS3A 2MWPA 2VONA 5CYMA 4JX6A 2MMPA 3BZCA 4BRCA 3A98A 1XGOA 3EZWA 2X4XA 4WQ5A 3EE8A 1K61A 2HNHA 4XNFA 1UZCA 4IQ4A 3THKA 5KCMA 2WACA 3KWIA 1UJ0A 2ZGZA 3V8LA 3OL4A 2DJQA 3M56A 2KHOA 4M75B 3EUKL 1ACIA 4XOTA 4JKGA 4MLOA 1SFUA 1LCUA 1BB9A 1TUDA 4GYGA 2V1NA 1EIFA 4XTXA 4JDSA 4CJKA 4M3WA 1ZARA 2J5OA 3OTOK 1SUQA 3BUZB 3HKZN 4ENJA 3NEUA 1HJRA 2FSJA 1PD1A 5C6SA 3ZX2A 2DXTA 3H5RA 1HPMA 4P1WA 2CG4A 4D7NA 5BN9A 1J9AA 2LT1A 4CHYA 3H3ZA 2F5CA 5M5YJ 4D9JA 1Q18A 2JK3A 2ZMEA 3OGDA 2FOWA 3L6QA 3LM2A 2WBNA 4KREA 3ZLJA 2XO7A 2HYJA 2P6SA 2P4RA 2D0OA 3MK6A 3HHGA 1JKHA 3AA5X 1KA8A 4CZZA 1OU9A 3ZSQA 4F3OA 2HTSA 3SQ1A 2IJLA 4WX9A 2VJ4A 1KVBA 4DYRA 2HHQA 2F5VA 4IO9F 4J2DA 5GTIC 3VF2A 3KE2A 4AVZA 3OYHA 3FZFA 1RBSA 3DB4A 1KTQA 1IJWC 3CJ9A 2CUZA 3LL3A 3O9UA 1YHQA 4J9IA 3ZT0A 4OIPF 2K4YA 2KPMA 4CCJA 2RKHA 4JI2K 2HKOA 5E3OA 4RDUA 2Z9OA 2X1DA 4UV9A 2CW7A 5CHZA 4LDXA 8AT1B 2HMPA 2E41A 1I8FA 1OR7A 2P0QA 1V5EA 2ZWHA 1NGFA 3D1NI 3SWNC 2E5QA 5DEQA 2ZPHB 3MMVA 3OOPA 3BJAA 2HSEB 5L3CA 1TWFJ 2A42A 3TW7A 3DXMB 3QB0A 1JKPC 3QJYA 4W5NA 2IXSA 4R0KA 3CCRA 1J54A 4H5VA 4F55A 5KYXA 4BI3A 2L9NA 3INZA 4MGRA 4B9TA 2P0KA 1D1BA 2Z3YA 4WWCA 3X25B 1OPLA 1B8IA 2HVQA 3MEVA 1MWMA 3RPUD 2MD0A 1S72N 3E5UA 5CE3A 4LIVA 2NRZA 3CMMA 5GAEP 2HZYA 1OH7A 2AZVA 3VSLA 2HPIA 1ZLMA 3I54A 2JHNA 2Y9ZA 4ELYC 3VEYA 2ZMEB 4FK4A 4FPAA 1WBBA 4NL2A 5EJCA 2HR3A 1FBSA 4HT9A 3CWAA 1YI2Q 4LD6A 2DFEA 3F0CA 4M4ZA 2CSQA 4IFVA 2UUAK 2CGJA 2EAYA 1KAYA 1VQ6A 2XF5A 4U88A 3DB3A 4R1HA 3E3VA 1A31A 4DTOA 5AT1B 2ELJA 3TO6A 4B1UB 4NC8A 2K5IA 4ZGJB 2YUSA 3C7JA 1JT0A 2PAVA 2DT7B 4LE9A 3CW7A 4Y0WA 3CQYA 5HROA 4C92A 3NVMA 4FJ5A 1XG1A 2XB0X 1RT1A 4DSKA 1BR4A 2GGRA 3NMUA 3HZJA 1SL1A 1KRPA 1LWYA 3C18A 3F10A 2Q97A 3WXMB 4LK0F 1YJWN 5AQVA 3CCRN 4BVOA 4QAGA 3GTPJ 2UUBK 2BXZA 3OY9A 4NO7A 2P9SB 3H6EA 1VSLA 2FEIA 4H0VB 1DQUA 1Y0NA 4A61A 5CKEA 2JMWA 1FLIA 5A0LA 2ME0A 4FJGA 3FX3A 3KYDB 2WV0A 2BE2A 1IN8A 4J9BA 1WJAA 3EDPA 4JN4A 5A2QE 4QVCA 4DUZK 2JMAA 2KRMA 4DOZA 2X6NA 4M77F 2NVTJ 4K43A 2PBIA 3D7SB 4A93J 2NOLA 1VIFA 3DEEA 3KKRA 3EN9A 1Y0MA 3CC4T 3E1SA 1TV6A 1K6OA 1JRIA 3HM5A 3NTKA 3CCMA 1W2BM 1NPRA 2LKPA 1YHQQ 4N0AC 2XICA 4Z4FA 2G7UA 1QS4A 2X1CA 5DD8A 3LAJA 1XGSA 1FOXA 2KQRA 4Z89A 2XAFA 2I5UA 5GIOA 5F64A 2HVIA 3E6CC 1IC8A 3FLCO 3K9KA 4IG0A 2H8HA 2QVOA 2WC9A 2DN0A 4JK8A 2BEOA 5C4XJ 2RQUA 4PWDA 3FK6A 4E4HA 3NHGA 3AVBA 2KQWA 1DGKN 1QRYA 2D5RA 3CJTB 3S16J 4M3RA 1E3HA 1JLFA 2A5WA 1TG0A 2LC4A 3AAFA 5I2MA 1TBXA 3ZOBA 1NGIA 2FB7A 1MDMB 4CYCA 4FT2A 3QHSA 4IUTA 4IPAA 2E2JJ 2XSJC 1UEBA 3RKYA 2XIGA 3NF6A 2QDLA 2GAUA 2QGFB 3CCQN 1RESA 2E35A 4NYFA 4CBWA 3N0UA 1G3SA 1D8YA 3LSJA 4W5TA 2AXLA 3DM2A 2ICWG 4J9DA 3O9RA 2I10A 4HV5A 1SKWA 4DWIA 4EMKA 4TVRA 4DTJA 4EGYA 3K5LA 4MTDA 2P5OA 2P4WA 2L3DA 3MX5A 4OKKA 5JVHL 3LSMA 4ZH4F 1MGQA 1M27C 3T0YA 1KC8R 2BIVA 2W84A 1WI9A 4C5IA 2P9KB 4K41A 4AIDA 4W97A 5IP6A 4MTEA 2AA4A 4F2RA 3CJAA 3I0RA 2VWFA 4NB4A 2RI2A 4XLAA 1KG6A 2NUTB 1T05A 2LDMA 5CQEA 1T0HA 4F7UB 3W2AA 2NWMA 2FPFA 2QWNA 4KNYA 2JUGA 3DTKA 2XB5A 3PO3J 1BCMA 2ZB9A 3ALYA 4DR1K 2Y0MA 3M8PA 4DFMA 4NYNA 2W7NA 5KCOA 1KAZA 5GAN7 3FXQA 4A0ZA 3QLHA 3QFPA 1YVNA 3OYFA 2DMUA 4XR6A 4FVUA 3QEVA 2YKNA 3RMAA 3THYB 2F2VA 3CC2Q 4BR7A 1FSHA 1V4RA 2HD0A 1XC5A 3SDGA 4M3GA 4JKFA 3SK3A 3M54A 4KRFA 3GTLJ 4BU2A 4B24A 1RAAB 1HKSA 5TJJA 1ASVA 4DS4A 2GELA 3TDUC 3E5XA 4C0GA 4RTYA 2QEXT 3ENBA 4KFBA 1LUJB 4G94A 3WTXC 1QVTA 1HKGA 1HJDA 3KP7A 3HM8A 2YRCA 4M9XA 2LCCA 2DDBA 5J8CA 5DM7L 4XH1A 4JI7K 2HYGD 5AZIA 2ROTA 2GFAA 2ABKA 2D0QB 1FT9A 1EH7A 4ZYEA 2XG8D 3V1OA 3LZJA 4WXDA 4JKHA 4DBQA 6PAXA 1RADB 1G15A 3SI6A 2O8CB 4KBMB 3QRFF 1ZBXA 3SXYA 2XAGA 3P1GA 1QGPA 3MN6A 2D8HA 2YX7A 1C0MA 4OB1B 1W5CC 3AVFA 2H3GX 4EMGA 2DTZA 3LM9A 5GMKm 2K3YA 4UOBA 2HHHK 4YPRA 2QGGA 2RD1A 2JSCA 2FE3A 5JFRA 2KZGA 2A40A 5GMKj 2GBYA 2XD0A 2A5XA 1NK6A 3CCVI 1VQ7I 5IT9Z 4EPCA 3I56I 1Y71A 2KFDA 1BA0A 1S3XA