3OYIA

Crystal structure of the pfv s217q mutant intasome in complex with manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyiA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyiA03
1RBUA 3P1GA 1X1PA 2E6LA 4AHUA 2DTUA 1LAVA 1F21A 5KTQA 3U3GA 4HUGA 1TK0A 3T19A 3KLGA 1CLQA 1NK8A 1KFDA 2IOCA 2RHZA 2P5OA 4BDZA 3KUFA 1JLEA 2FBVA 2FBYA 4DLEA 3C6UA 3P83D 4CIEA 3HT3A 1NKBA 4CJEA 1KFSA 3QIIA 1Q9XA 3QEXA 2B8AA 1RILA 1RDAA 4IFYA 3VQQA 4NYNA 1LAWA 1L3SA 3K58A 2X6NA 2X74A 2QK9A 3HM9A 2PYJA 2EQKA 5HRNA 1C0MA 1WGSA 3PMTA 2Q3SA 3HVTA 4DQPA 5D6XA 2RHIA 3AVLA 3K5OA 3KK1A 1S6PA 4LH5A 4CEOA 3THVA 4E1NA 3ASKA 4RG8A 1XI1A 2OPPA 5KGWA 4HCBA 1S5JA 1RTIA 2RI3A 4BE2A 2XDPA 2KFNA 2P51A 1KLNA 2FC0A 3OYHA 3AV9A 2L8DA 5C0MA 4DWIA 3TAMA 1HQUA 4MFBA 1RT5A 4WE1A 4KI4A 1BIZA 4Z4HA 3TABA 1U47A 3AA5X 4OPJA 4FK4A 4CGFA 5KRSA 4KPYA 3HJFA 2VWJA 2W42A 1CXUA 3CFPA 4AH9A 1TK5A 3OYCA 4LSNA 4DQQA 3PMIA 3KK2A 3SV3A 2D0CA 5J2PA 1NK5A 1TL3A 5D3GA 3TARA 4FJMA 3C94A 1ZBHA 1LV5A 4HTUA 3RMCA 1A5WA 2RHUA 3DRRA 4CEFA 2E5QA 4BE1A 2E6NA 1XWLA 3SYZA 3DLBA 1YTUA 3OB9A 1S1UA 4E0DA 3GOXA 4OVAA 2RI2A 1EP4A 1WSJA 4OGEA 2D0BA 4FJ8A 4FJKA 3AA3A 4FCYA 2Z1JA 4EZ9A 3K5LA 4B9TA 3SUPA 1J5OA 3S3OA 3G0ZA 4C5IA 1VSDA 2M0OA 1D8YA 4W5TA 2RJCA 1HPZA 2IC3A 2G8FA 3KD5E 4QCLA 2JZ2A 4N4GA 1L3VA 5D6YA 1DLOA 5C42A 3RR8A 2LCCA 3S9HA 1RBVA 4M3ZA 3V1OA 3L2VA 4LD0A 4CGIA 2JTFA 3DMJA 2G8UA 4B9LA 3NF9A 2YRVA 1A5XA 3HPHA 1IG9A 1JLGA 4I7FA 4CK3A 1T7PA 4FJLA 3OYJA 1NJXA 4B3OA 2M16A 3DLMA 3AVNA 2NUBA 4CJFA 4F4KA 3OYFA 2R58A 2R5AA 3VN5A 3LZIA 4Z4FA 3LDSA 2RN2A 3M8RA 1J53A 4FM0A 3VQ7A 1HNVA 1I39A 2K3YA 4IUQA 3QEPA 3TAPA 3HK2A 4IFVA 1KHCA 1LWEA 2HNYA 2CKKA 3OYNA 4E7IA 4QW2A 4ELUA 2KW4A 4DSKA 3C95A 4L59A 4B08A 4CHOA 4Z4CA 2KQ2A 1S1XA 4DS5A 4PLLA 3ISNC 1KRPA 2F96A 4BDYA 2MWPA 3VQPA 4CIFA 4O55A 3V1QA 3MEAA 4QQ6A 4CJVA 1Y97A 3HP6A 3LAKA 4L8RB 2X4YA 1VK0A 3TANA 4KHYA 4DSFA 4FK0A 4KO0A 4DFMA 3NGIA 1S9GA 1N27A 3TAEA 2O4XB 3OYDA 4O4GA 3NHGA 4E3SA 2YNIA 2NLUA 3AO3A 4CEBA 5JS2A 4CJQA 3LANA 1UA0A 3SV4A 4KREA 3FDRA 2IS3A 1QHTA 3KK3A 1WSFA 3ZT1A 3AO5A 2WONA 1VSJA 2IDOA 4G1QA 1Q9YA 4FYDA 1RDCA 1JLAA 5CYQA 3OYGA 1S6QA 4N41A 4IG3A 3D45A 2P0KA 3V9WA 2X35A 2GFAA 2HB5A 4CJUA 1XHXA 5C24A 3M8PA 4NCGA 4CEDA 2HQEA 1OI1A 4E7JA 3IG1A 1VRTA 4HVJA 4W5NA 4ZTJA 4QVZA 1VSKA 3ZCMA 4JRPA 4DTXA 2YV0X 4A4EA 3RMDA 3BDPA 4QQDA 3EZ5A 4B9VA 4QQGA 2RPIA 2D0AA 3NCIA 2ZD1A 5CY4A 3DLRA 1RT3A 3O4QA 4DU4A 2BDPA 1BCOA 3KIOA 1VRUA 2XRIA 3LPUA 3D0PA 1TAQA 2A1RA 4O0JA 1ASVA 2XY6A 4II1A 1N5YA 1VSFA 1BI4A 2OPSA 3ZT0A 3LWLA 4FLWA 4ZTFA 1JL1A 4KRFA 1B92A 1OZ3A 2VG5A 2R57A 4DTOA 2GV9A 3L2RA 3ULDA 4R5PA 3DOKA 2G3RA 3MEWA 3S6WA 4E89A 3TAGA 1ZYQA 4KHWA 1IO2A 1B9FA 3B6OA 4FJ5A 4DTUA 1RDBA 4KV8A 1TV6A 2XY7A 3AA4A 1FXXA 4N4IA 2VG7A 3AO4A 4OKJA 4I9LA 5SWMA 3LAMA 1BGXT 3SD4A 3RRHA 3MP8A 1UAXA 1FKOA 1Z26A 4CF1A 3L8BA 3V9UA 4YNQA 5HP1A 4FLZA 4DTSA 3PO4A 3PX0A 5KH6A 2B6AA 2LVMA 1ZBFA 4FL6A 5J39A 3TAQA 4K8XA 5HRRA 1VSEA 1NKCA 5C6SA 3NGZA 4CF2A 5J26A 4IUTA 4MQ3A 3F9KA 3L2WA 4CHPA 4CHQA 1XHZA 3MECA 4HCCA 1JLFA 3V4IA 1T05A 3MEVA 5DK5A 1UA1A 1BL3A 4W5OA 4DQSA 4FZZA 4Q0BA 5D6WA 1BCMA 2ATQA 4TSXA 3NTIA 3OA6A 3ITHA 4DMNA 4CJKA 2DAQA 2M1HA 3NTHA 3SNNA 5KI6A 2BKDN 2OYQA 1JXEA 3LP1A 3V1RA 1T8EA 1EKEA 3DYAA 4LH4A 3VQ6A 2BANA 1KVBA 4UQGA 3OQ5A 3SUNA 3SZ2A 1X9SA 3AVCA 4CK2A 1D9DA 4PLIA 1YT3A 3QO9A 4N56A 1SV5A 4K8ZA 1K6YA 3AVJA 3FFIA 3UIQA 3H08A 4AHVA 4IKFA 4NS5A 1WN7A 1C6VA 4A4GA 3O3GA 2HQXA 3HPOA 1SL0A 4B9SA 2HVHA 3B6PA 4KTQA 1ZBLA 1HJRA 2Z1GA 3DOLA 2LTOA 4FLUA 3QNNA 5KCOA 4J2BA 5IN1A 1KVAA 4OGCA 1BISA 1G5VA 1LWCA 1HYVA 1JXBA 4AHCA 2G8HA 4QOZB 1EX4A 1VSLA 4DU1A 3TI0A 1GOCA 4HCZA 3AO2A 4IBNA 3CFOA 3OYAA 2HHUA 4H8KA 1KVCA 3QEVA 4N47A 5C25A 4IUUA 4NZGA 4I2PA 4H4OA 2GBZA 4KFBA 3NAEA 4CFCA 4FM1A 4IURA 4C8KA 4CHNA 3UWNA 3HL8A 3FC3A 1LWFA 3DLKA 1L3UA 3DLEA 3QERA 1TL1A 1KCFA 3SQ0A 3JSMA 3OJUA 3AVKA 2YNGA 3PO5A 4O5BA 3CFRA 4JS4A 3L3VA 1NK7A 1JL2A 4FJGA 5CZ2A 4N76A 1JLBA 3OY9A 3QLHA 3TR8A 1CZ9A 4CEEA 2EQMA 1KTQA 2RO0A 2VWKA 4FLXA 2Z1HA 4J2AA 1IKYA 4Z0UA 4EP5A 4I2QA 3V6DA 4CHZA 1RTDA 1TAUA 4JLHA 4FZXC 4Q5WA 1CZBA 4E19A 1QTMA 3AVHA 5DMRA 3VQ5A 5K14A 4BACA 1GOAA 2O4GA 2QKKA 5FDLA 4F3TA 4M3XA 1XNIA 1H3ZA 1IKVA 1REVA 1WSHA 4LSLA 1WAJA 3QNOA 3RMAA 1JLQA 3KKSA 1C1AA 4CGDA 3NH2A 4B8CA 1TK8A 3Q1JA 4CE9A 1RCHA 4KI6A 5T7BA 2EQJA 3IS9A 1SKRA 2L3RA 1QS4A 2DIQA 3QINA 1NJZA 1IKWA 2G8KA 1QQCA 4Y1CA 5HRSA 2QXFA 3K57A 3M8SA 1WJQA 2FBTA 4OPKA 3SPZA 4AILC 3ZT2A 3TWHA 3PUFA 2PYLA 2HNDA 3DLGA 3OVNA 1SKWA 4OLBA 1ZBIA 2HHXA 3AVIA 4ZHRA 2KFZA 1WAFA 3HPGA 4FW1A 4Z02A 2QQSA 1W0HA 1NJWA 3NNQA 3AVMA 2G8IA 4RW8A 3VQDA 2HVIA 4CFDA 3KLEA 4DLGA 3QKJA 3MP1A 3CEYA 4OKEA 5HRPA 4EZ6A 3OYIA 4FJNA 2LRQA 3ME9A 4AHSA 4CF8A 5HLFA 3VA3A 1NK9A 4X34A 2B4JA 4CECA 3SQ2A 2R7YA 3RR7A 1C1CA 3RRGA 3A2FA 1MHNA 2RF2A 2YHBA 3ASMA 3MEGA 4FVMA 2P1JA 4NYFA 2Y1JA 2Y1IA 5JS1A 2GFUA 1U04A 2KZZA 2VG6A 3C6TA 4CJWA 2DY4A 2X4WA 2YNHA 3L3UA 3RTVA 4PUOA 3BDLA 3ALYA 3QBYA 4PQUA 4E7LA 1BQNA 1HNIA 2YHAA 4PA1A 4HUFA 1FKPA 2IAJA 2ITGA 3IRXA 1L3TA 4DU3A 2K3XA 4M41A 1RT4A 2QQRA 2WOMA 3O3FA 1TKDA 1OZ2A 3OMGA 4IUPA 1RT7A 3HYFA 2L89A 3DLHA 5J2QA 3SCXA 1SUQA 2ETJA 4CRIA 5M9OA 2XY8A 3NH1A 3EYZA 1NK6A 3E9FA 4BWMA 4M3YA 1WSEA 3V9XA 5J2NA 3NGYA 4B9UA 2O4IA 2OPRA 3UT1A 4CESA 4DSLA 4Z4IA 3OS0A 2HHSA 4M3TA 2EQUA 1RBTA 3EAEA 1EXQA 3NF8A 3WNGA 3ZT3A 3LZJA 3QEIA 2G8WA 4KHSA 3OYMA 3NDKA 4OVLA 1VSHA 2OA8A 3I0SA 1U49A 1KLMA 3NH0A 3LLRA 4DS4A 4CJPA 5EU7A 2IG0A 3ZSWA 4B9NA 1HYSA 1QSSA 4A4HA 3K5NA 3K5MA 3MO8A 3U3YA 3DRSA 1NK4A 4DG1A 3CG7A 1RT6A 4IUVA 1SKSA 1L5UA 4CGJA 3OYEA 1FK9A 1Z25A 1SSFA 4CJ5A 4CK1A 3VA0A 4CHYA 2PY5A 2DIGA 3HSTB 4FJHA 4FXDA 2GF7A 5I42A 4C5EA 2Z1IA 3AVGA 3H6ZA 1RTHA 3LP2A 4CFAA 2BUDA 3TAFA 2E6MA 4CGGA 3HVRA 2RJFA 1WSGA 4E1MA 4FLTA 2RI5A 1N6QA 1TKTA 4KB0A 1I3AA 1J9AA 2D5RA 3ZSVA 4M3UA 3OMCA 3QIOA 4E7HA 3LYIA 1BHLA 1HYZA 1QE1A 4FZYA 3MEUA 3K2PA 4KHUA 1U48A 3ZSOA 3LALA 3OS2A 2LDMA 4FU6A 3V9ZA 3MXIA 1OYXA 4RG2A 3PY8A 1XC9A 4W5RA 4F2RA 1NKEA 2AJQA 1VSIA 4NCAA 1QSYA 1RDDA 5KRTA 1TVRA 3K59A 4F3OA 1HQEA 3SJJA 4DFJA 2BE2A 4RW4A 4CEZA 3LWMA 4FM2A 3LP0A 4KTZA 1RT2A 4FJIA 1WSIA 4FJXA 3MEEA 3VQ9A 3FEOA 3F70A 4ICLA 2JGUA 3KKRA 1D5AA 3EY1A 3V81A 3SQ4A 2PZSA 2OZMA 2HHWA 3NFAA 3DI6A 3PNWC 4B8AB 2HHVA 1JLCA 1RT1A 2XO7A 3L42A 2R5MA 3F73A 1WJRA 4PY5A 1U45A 3T1AA 3LPTA 3QETA 4DTPA 2QKBA 1G15A 2XHBA 1GOBA 4LD6A 5CYMA 4RW6A 3CM6A 3KLHA 5KGXA 3QEWA 4F8RA 4OLAA 2HHTA 4CJ3A 5FROA 3WNHA 4IG0A 3KD1E 2F8SA 4IDKA 4A4FA 3HXMA 3LGLA 4ID1A 4M45A 3SI6A 4B9MA 3NE6A 1CXQA 3ZSQA 3OYKA 3C4SA 3OYBA 4W5QA 3ZSRA 3HP9A 2P5GA 3P8HA 2YNFA 1Q8IA 1SL2A 2X78A 3SUOA 3AO1A 4CGHA 4KHNA 3LP3A 4CF0A 1TKXA 2XK0A 1TKZA 3MEDA 1R0AA 3IAYA 2HMIA 4M42A 1RBRA 3QJ6A 2ZE2A 2BIVA 4H4MA 3NF7A 2O4XA 1LW2A 3VQ4A 3M9QA 4GY5A 3VQAA 3VQCA 4Z4GA 1C0UA 2G8VA 2RKIA 4FJJA 2B5JA 4HUEA 3PV8A 4CERA 4CJLA 3E9GA 1IH7A 3DM2A 3QIPA 3META 4C5HA 4KHQA 3AVFA 3BGRA 4Z4EA 3NBPA 1JKHA 2X4XA 2KZMA 3G10A 3VQEA 1NOZA 4EP4A 4DQRA 3DRPA 5HBMA 3ZSYA 4M3WA 5IAYA 1C1BA 3RWUA 4LY7A 3H8ZA 5J1EA 4CFBA 4Q5VA 4FJ7A 3NF6A 5E41A 2A1SA 4YFUA 3ZEHA 1RNHA 3I8DA 3V9SA 3QESA 1UWBA 1DTTA 5I3UA 1LW0A 2YKMA 3L2UA 4DFKA 1T03A 4FK2A 1S9EA 2D9TA 3SPYA 4CJSA 4C8LA 4O0IA 3FLGA 4PWDA 3KTQA 4BE0A 3S3MA 1RTJA 2OPQA 3CQ8A 1RBSA 4JRQA 4B9XA 2RHXA 1ASWA 4DQIA 4F2SA 3LX7A 5KE3A 4BD3A 3PX6A 1X9MA 3LH0A 3PFSA 4CIGA 3AVAA 4DTJA 4OJRA 4KB1A 2RJDA 1B9DA 1W9HA 4CEAA 2OZSA 4FJ9A 3RMBA 4C8MA 4ID5A 4DFPA 4RW7A 5CZ1A 5HROA 4BWJA 3AVBA 4AHRA 4N4HA 1MU2A 2BGGA 3VQ8A 4DF8A 3NTKA 3CYMA 4KAZA 1S1TA 3MAQA 1BQMA 4ELVA 3I0RA 3O8VA 5KE2A 3DB3A 3S3NA 1BIUA 4CJRA 1NJYA 2WACA 4JS5A 1KSPA 1YVUA 3ZSZA 4E7KA 3KLFA 4CCHA 4I9QA 2FHDA 3MXJA 3JYTA 1WLJA 3ZSXA 4CJTA 1TGOA 3P5JA 4NCBA 4DTRA 4DTMA 3ZT4A 4DSJA 2RHYA 3MP6A 3LGFA 5FRNA 4FLYA 2XY5A 4DSEA 2EFIA 5KCHA 4GMJB 3U6FA 4PL6A 5J2MA 3SQ1A 1X9WA 2F8TA 4CF9A 2MWOA 1BI4B 1UOCA 2EHGA 4GVMA 3VQBA 3T3FA 3L2QA 1DTQA 1D9FA 2YKNA 1HMVA 3OJSA 2RJEA 1J54A 1S1WA 4Y1DA 1NOYA 4C5GA 1O1WA 4O44A 1YTAA 4B9WA 1C0TA 5FRMA 3PX4A 3E01A 2ZQBA 1QSLA 2FBXA 4GW6A 4J2EA 4M3RA 4HHTA 4ELTA 2F5KA 3KLIA 3O3HA 4FLVA 4BDPA 2HW3A 3MXMA 3HO1A 4C8NA 4FW2A 2DFHA 2GUIA 3P8DA 4CJ4A 4DF4A 2KTQA 3SUQA 1A5VA 4C8OA 1NK0A 3WNEA 5SZTA 2EX3A 1VSMA 1RI0A 2LSNA 2HHQA 1SL1A 1WNSA 1S1VA 4KTWA 4DSIA 1IKXA 1HRHA 2HNZA 4UC4A 2X6SA 2VYTA 2EKOA 3DB4A 5CIUA 4OKKA 3WNFA 3KJVA 2E4LA 4J2DA 1EETA 3OYLA 4EDUA 3O4NA 2IGIA 4N5SA 2DFEA 4XIUA 3AA2A 2PQWA 4DTNA 1ZBUA 1U4BA 2DFFA 2JLEA 4AHTA 1WJSA 3M8QA 4KKOA 2I5JA 1ITGA 4CEQA 3CM5A 1ASUA 4RW9A 4QAGA 3OS1A
chains in the Genus database with same CATH superfamily
3BTJA 2KKZA 5KTQA 1KFDA 2P9KA 3C6UA 1KFSA 2M9HA 1RILA 1U3OA 2LFBA 1WGSA 4FYWB 2GTDA 3AVLA 2GAUA 3KK1A 2XICA 3GFLA 5CQXA 2RQRA 1WOQA 3CD6N 3G4SI 1WQ2A 3BPVA 5IHKA 4C1NK 4B6MA 1NG2A 2W42A 5IH2A 4H0TB 1DIZA 1GLBG 3KK2A 2D0CA 2P7CB 3OW2A 4WQ5A 3AA3A 2A3SA 1KQ1A 2NRTA 2KEAA 1WEIA 1KG3A 3CCEN 4KH5A 4CGIA 5HOOA 1A5XA 1T7PA 1LEAA 3B6CA 3IRRA 5DM7F 5B1BH 2MLGA 2P81A 3CMEQ 2K3YA 4IUQA 1QMCA 4EMKA 1WKMA 4UXNA 2KW4A 2QTXA 5GAOq 4KO0A 3DXJF 1R4MB 2V9PA 4B47A 4G1QA 5CYQA 3TOBA 1QVGS 3S8PA 2VBZA 3CMEI 3HFOA 1YW8A 4XN0A 3I4MJ 2DBMA 3F8NA 1M1EB 3M1CA 2D0AA 2HKQB 4E6KG 1UB4A 4A3JJ 2ZJRL 1Q81C 3CQTA 1M2VA 2R93J 1YUWA 2LC4A 1BI4A 1YWPA 2R7OA 4HAMA 1OEBA 1GHCA 2XV4S 4DTUA 2K86A 3ZQHA 5GIPA 1YJWI 1JJ2S 2C06A 5AQOA 1B72B 4CF1A 2FOWA 5M1FA 4O3MA 4LDUA 3CCUQ 2CV0A 1T98A 4A3LJ 3N05A 5J26A 2M1BA 2ECCA 3X28B 3S32A 3L2CA 5DK5A 3T1HK 1ZC6A 4DR5K 5MLCQ 4I01A 2AZSA 3HGYA 2ZPIB 4CK2A 1IN8A 2EIKH 3GTGJ 4NO7A 3A02A 1HNWK 4JZ4A 5GAN5 3U2RA 2VJ5A 3DOLA 3CCEA 3TI0A 3VYTB 3QEVA 4BRNA 3S1NJ 3M8FA 3UWNA 2Q0UA 3H0GJ 2EA4A 3FC3A 3QU6A 1KCFA 2OTLT 1D09B 4M77A 2LJ3A 3TR8A 4E9EA 3HI0A 2QEXA 2ZXWH 5LJ5d 1TNTA 5AQIA 1AVZC 3HUGA 3K9JA 2K4BA 1U1SA 3OH6A 4CO8A 4UVAA 2H27A 3VS6A 4DR2K 1LNXA 4EJTA 4IVNA 4S04A 3Q0UA 5GAMf 4C1NI 5K7ZA 2DLLA 3RMQA 3CEYA 4JI3K 2WBMA 1SD6A 4M7AA 3VEVA 4CCJA 5DLQE 3JW4A 2CQ7A 5LJ5j 4KNYA 3C6TA 4MZMA 5EX5A 5LEKA 2NOLA 4FWRA 1YJ9N 2NNNA 4IZ9A 3QB0A 5EZHA 2YHAA 2YPRA 5DM6F 4N9HA 1MJ9A 3TGNA 1UG0A 4IUPA 1K9MR 5E3OA 4LG3A 5HKCA 5J2NA 3CC2N 3S17J 2M7BA 2V6CA 3AFHA 4XL9A 1MMSA 1R7JA 5LGNA 1TUDA 3RI4A 2RK2A 1EXQA 1VSHA 1KLMA 2EJGA 3GCMA 1J59A 4LF9K 2LREA 2NVXJ 5AT1B 5LHGA 1RESA 3BTIA 1SKSA 3GO5A 4ENMA 2VQFK 1YW9A 4JKHA 3JAMZ 2RJFA 3QAHA 1HYZA 2L9NA 3R0AA 1KQ9A 3HBLA 2OTJT 3MJXA 4G6DA 4PKHA 2A5XA 5TJJA 1RT2A 1KA8A 4CI0C 1RUNA 3FKIJ 1IV0A 3DI6A 3F73A 3IRQA 2XI9A 3T1AA 3K2AA 4MMKA 3HOVJ 4RW6A 4CJ3A 4B9QA 2NVTJ 3HXMA 1W2BM 3I55I 3N5BB 1SSHA 4PFPA 2I5WA 4KHPK 4KUIA 3ZSRA 3CBPA 3ZFJA 4C92A 5ICCA 3H35A 1JXSA 1XB4A 4JK8A 1VQ7Q 3BW1A 4C5HA 1K83J 2NRHA 2X4XA 2KZMA 2V1NA 2E88A 1V5FA 4L9JA 2CG4A 2E60A 5E41A 1I07A 1QVGP 3K7AJ 2JM9A 5DM7R 2K3FA 1LW0A 2V52B 4XK8E 1PC0A 3J8AA 4BC4A 3UATA 4LF7K 5HLTA 1IBMK 4HCKA 2CP5A 5CZ1A 5GAMg 3AVBA 3CPWS 3NTKA 5E8GA 1ZRFA 3M0UA 2NRAC 2FHDA 3SBTA 4B4CA 1QPIA 4DSJA 1TWHJ 3GLLA 2JPSA 1UOCA 5FKKA 4RAZA 3F0ZA 1S1WA 3G6EQ 1LVAA 1X6GA 4AFSC 2CRGA 3H0FA 3L4QA 4ILGB 3OMYA 3GYHX 1IN4A 1M30A 2DPNA 2ZFWA 4V19K 4CJ4A 1UZCA 4O6JA 2EZIA 3LNQA 2YLBA 4BQZA 2OU2A 3MZHA 3CCEQ 2P9UA 5AZIA 2X4JA 4LD9K 4OMNA 2L0KA 4FM4B 4EMGA 2KLOA 3I5UA 4Y7NJ 2ZSHB 2QWMA 2LBFB 3CJ7A 1VQ9N 2WWYA 4PCQA 5HLIA 2FBYA 2R5YA 3CC2A 3VQQA 4C8QE 2DXCA 2RHIA 2LKPA 4MZPA 2YLCA 4CZIA 4BXUA 2FC0A 1GLNA 1U2VA 1RT5A 4KI4A 3TABA 4Y15A 4OPJA 5LMNK 2CH6A 3GNGA 4LDVA 2A0FB 2DA1A 2HI3A 5J2PA 2WAFA 3PIPL 2CFOA 2BZ8A 4PHTX 1A5WA 3C2HA 3OB9A 2E70A 4CA0A 4GNIA 3ZL7C 2CP2A 3K5LA 2JJ9A 4M7DB 1I1JA 3CPFA 3VF6A 3BR1A 4HVUA 3HKZA 4M3ZA 3V1OA 4LD0A 4FE7A 3G1JA 3W3CA 1KFZA 1H1VA 4BC2A 3CJTB 1SHGA 5HNFA 4HNUA 1FIPA 4P5NA 1EWRA 3NPFA 3QEPA 5ILSA 2GWJA 4QW2A 2DK5A 1I1GA 2OQGA 4OFEA 2QQ9A 3V8JA 4O55A 4QQ6A 2V8KA 3EGDB 3NHGA 2OZUA 4CEBA 3SV4A 2KDSA 1XMOK 5KCMA 3LSTA 1ZLJA 2BOLA 5M5XJ 3M59A 4FISA 1WRJA 5L3CA 2HMPA 1ZRCA 2PVGB 1UAAA 4ILJA 4RS8A 3SHFA 5CY4A 4RM2A 3K0SA 2O7OA 3E1SA 4FWSA 2XY6A 2RM4A 4ZTFA 1B92A 2VGNA 1IDZA 5IXBA 3L2RA 3DOKA 2MA3A 1B7TA 4QIWN 1NMNA 3E3VA 3PGGA 2H8RA 3B6OA 3LA2A 1ZR4A 1EIFA 1VQ4T 3P8BB 3ERED 5FPNA 2VXDA 1N36K 5F6FA 2D1VA 4OFHA 3E6DA 1VQ8T 4PJOG 4MDAA 2DT6A 1ZBFA 4C2TA 1YIOA 4IUTA 1F36A 1BR4A 3HKZN 1N78A 2HZYA 1X4OA 2M4KA 2O8EB 4XTVA 2OV7A 3GUDA 3SNNA 1FBQA 4ZJZA 3G73A 1XQSC 4IO9F 4BI3A 1K73R 2HBPA 2VYPA 4PL8A 3JCMX 4N56A 5AIPA 4IKFA 1LDKB 2ELHA 2R7UA 1HW1A 2V7YA 2WAQN 3VGMA 1BUPA 4C8KA 5AQXA 5AZJB 5FW9A 5GJWB 1JO8A 2V79A 2JT1A 1I0CA 4XTWA 2FJ1A 2VWKA 4XTYA 1Z7UA 1IKYA 4MMLA 4AT1B 4Q5WA 2GEMA 3VQ5A 1VQKQ 1WI3A 3QNOA 2W48A 2EKHA 1A5JA 1TQIA 1FBSA 1Z3XA 4E7ZA 1YIJA 2CSIA 3R6SA 2W7NA 1ZELA 3M54A 2FBTA 3VEZA 4OPKA 4XTXA 2F4OB 4IEIA 3N4MA 2KFZA 1MW7A 3QP6A 4OX9K 3AVMA 2BY3A 4CFDA 1MZBA 3T1YK 4EZ6A 1Q95G 2HBWA 2DMTA 1YJNI 2VXFA 5I21A 3GX4X 1NK9A 2QBYA 1M1KU 4JJNK 4UUTA 3SQ2A 3RR7A 5GAN2 4CJWA 2OTJN 2DA4A 4HOBA 3ZQLA 1W97L 5BQTA 4M41A 3DLHA 1SUQA 4Q48A 2FEIA 4M3YA 3VS4A 4B9UA 3OS0A 2R3SA 1MA9B 3EAEA 4YY3K 1BR2A 2Z33A 3KLNA 2M2EA 3CD6T 4MO7A 3D2EB 1RRQA 1U49A 2RH2A 1QBJA 2RE2A 3P31A 4X64K 2X9DA 3OYEA 5L3BA 3NWTA 2EIFA 1IXCA 2GWKA 5AZJA 1WSGA 1VQKA 3SDZA 1I3AA 4GRIA 1K78B 4JUVA 2TCTA 3H1CA 3LYIA 2UXXA 1W36C 4IQJA 3CCLN 1ODDA 5AN4A 2ZWHA 1TUYA 4HT8A 1QSYA 4M7DF 2LNHB 4DFJA 2IIMA 4RA2A 5GAMd 3FEOA 3F70A 3RDIA 2QA4N 2VOPA 3HKSA 4ZDLA 3MPUB 1HNXK 1RT1A 5K5OA 1UGQB 3F23A 2DEQA 5GAN6 1NYGA 3FM5A 1K0SA 2F8SA 2NOIA 4KT0E 3PT9A 3LH5A 4I98B 3QWLA 2E12A 5CHZA 1R0AA 2CZ0B 2ZJQL 3HRGA 4CCKA 3RUXA 2IA2A 2BE5F 1RUWA 1HK9A 1YIJT 3EYIA 5HBMA 1C1BA 2Y90A 3LSGA 1CKAA 3V9SA 2QAZA 1QCFA 4C92E 1PG5B 4CYDA 4AYBA 3M55A 1QWFA 4BD3A 3M0QA 2EJRA 4ESFA 4EMKC 5C4XJ 3RMBA 5HROA 3ASOH 3C7NA 4A5NA 1Z67A 5H2FC 4FT2A 4I9QA 3K4KA 5E8IA 2A3LA 5ED4A 2RQWA 5I11A 2FA5A 3I55N 4FLYA 3MP6A 4EJYA 4GMJB 4BR5A 1V4RA 1QVGM 2HDAA 3ABTA 3OJSA 2DRKA 2GZWA 3HGGA 3QFPA 2XF5A 5C2FA 1KG2A 4LDXA 3IKVA 4DHYA 4ELTA 1GLLO 4BRAA 3LDQA 3O8MA 4JLGA 1GLDG 4JD2B 1SAXA 4RTXA 4IXCA 4CH7A 3U8XA 3CERA 1OKRA 5CAIA 3QWXX 1W2BP 1KXPA 1U4BA 3TSZA 3EFOA 3UB5A 4EGYA 3HSBA 4XOPA 1FSEA 1DKGD 2DTUA 3CCST 1RDUA 1CLQA 4MTEA 1F4KA 1MWMA 2PBDA 3I9QA 3TEDA 2EGEA 2HYGD 2L2OA 1YE9A 1AWWA 4NYNA 5B66C 1YCYA 1BB9A 1XQPA 3HVTA 4DQPA 4OIPF 4BVOA 4GKJK 3NGPA 3THVA 4YHHK 2F9TA 2JQ7A 4LG0B 1KG5A 2R4GA 2P51A 4JKFA 3D6RA 2VV5A 2ABKA 2KY9A 1VQ8Q 2KT0A 1ETYA 2DTRA 2A42A 3T7ZA 3I0TA 3LCNA 2XHIA 3BT9A 2KT1A 1S29A 4PSWA 3RESA 1SF9A 1EP4A 3E0JB 2Z1JA 2EIJH 3S3OA 4A3IJ 5KYXA 2RJCA 3S93A 3GVAA 5B1AH 4Z6YA 1HOMA 5D4SA 5JVHL 4HA8A 2FO0A 2M16A 1M90O 1E17A 3M6GA 4XR6A 2W6KA 3LDSA 1P9QC 2FZCB 2IPOB 4EIKA 4J9CA 2Z99A 2MWPA 4CIFA 4C8QD 2X4YA 4DFMA 1LWYA 2JTEA 2DA9A 5FWBA 4RGRA 5GANg 2WONA 1IF1A 1EBMA 1RDCA 1OKJA 4XSXF 4C2MJ 2PAVA 1SANA 1S3XA 2R7DA 4IOXA 4L6V5 3CCET 2RPIA 2H94A 3DBLB 1FTZA 3CCUN 3BTCA 2V8IA 4RDUA 3UPUA 3GFMA 3AG3H 2O8CA 1U9NA 2R57A 2OTLA 3M07A 2MK5A 3JSOA 4AI5A 1KGSA 2COZA 2E7WA 5J1UA 2K5IA 2NVQJ 4XIDA 5SWMA 4FPAA 2KP6A 2LKSA 3SD4A 3MP8A 1UAXA 2QA4A 3SAGA 3REOA 4BJ6C 2LVMA 3LWHA 5J39A 3N0UA 5C6SA 4DR1K 2XGDA 1AOYA 1WYXA 3L2WA 1WPYA 2G7HA 1DPRA 3D1NI 2K9NA 5F27A 5HDNA 4CJKA 2M1HA 3CMAQ 2KKOA 3SEZA 3LP1A 3DYAA 2BANA 1P6RA 4BRHA 3KZYA 2E1MB 1VYVA 2B9SA 2IJLA 1Q82R 2JTMA 3LSIA 2CP3A 4M4ZA 1FMVA 3AO2A 4B1VA 3AAPA 5EVZA 4KFBA 1NK3P 3HL8A 2EVRA 3DLEA 3L3VA 1Y1VJ 4B1YB 4J00A 1LJOA 3M4GA 4DBQA 2DVJA 1GCPA 1PU7A 2Q2EB 4CC4B 4M73A 4RAFA 3CWSA 2KNBB 4JDSA 2YG8A 4F3TA 3C2BA 1R1VA 1S72N 2OTJA 2XB0X 2JM8A 3IS9A 4DV4K 1SKRA 3KBGA 4FWQA 2RNJA 3EGDA 2K2VA 2DQRA 4UVBA 3ZQ7A 3LL3A 3OVNA 2DOAA 1NJWA 2KPMA 3KLEA 3WGHA 3BF1A 2EH3A 4EA4A 4BEHA 2JS2A 2F9WA 4M75D 2F8TA 1G8XA 5EGOA 2Y1IA 1WJ5A 1ZYRF 2YNHA 1B34B 1D3BB 2DL4A 1VQNA 2E71A 3IH7A 3OMGA 3ZRGA 2QA4T 4D5FA 1IRXA 3CQXA 2P4TA 4LF4K 5ICEA 2KGTA 1QZ6A 2QEXT 3A5LC 2JSPA 4CC3A 1ON2A 4FTHA 4X9CA 3NH0A 4DS4A 3GDQA 5EU7A 3BG3A 1YQRA 2QSHX 2R5ZA 2OFIA 4YOQA 5FLXO 3A0BC 5E20A 4DG1A 2O8FA 3JRCA 2XD0A 1T0FC 3PIPA 4CFAA 3CXCA 1ZXOA 4MZTA 1N6QA 1R36A 1BG3A 3QOEA 3A01B 1QE1A 4JZ3A 2MSYA 3MCPA 1RKWA 4WYBA 3QYEA 1LFUP 3QSUA 3CMMA 2GXAA 1TVRA 2QQAA 2DTIA 1QP3A 4OU0A 4WTOB 1NPRA 1RPWA 1SMYF 1M3HA 1JLCA 4J9HA 4LFAK 5BOXA 5C10A 3HFNA 1MSEC 1DUXC 3X24B 2CU7A 4XRSG 4WF2A 3BTLA 3CCVT 3ZSQA 4RMOA 1HKCA 3SUOA 5LJ5h 2XK0A 1S72A 1KC8O 3GEZA 4HUEA 2VUBA 5CKEA 3META 2YXYA 2OJ2A 4FX4A 3ERMA 4ZH4F 5J1EA 1ZKGA 1QLYA 1TTYA 3QYHB 2IGOA 3CPEA 3R6OA 3JCMd 5GTHC 3S3MA 4JKDA 2PJPA 3WE2A 2X6YA 4LITA 1UFFA 3JCMh 4Y17A 4RKUE 1S1TA 4B3MK 3JR9A 1F43A 2MMPA 3O8VA 5D5WB 4XONA 4KUDK 2FBIA 3P5JA 2XY5A 4RB0A 1RAHB 1VNDA 5JVTA 2ISYA 2MWOA 2QQBA 1Q7YC 4F7ZA 4HG2A 3KP7A 5GTIC 1HMVA 4RB1A 4Y1DA 4B9WA 5K5RA 3BJOA 2E5KA 1K8KA 5DEQA 2ISZA 4FLVA 4FW2A 4HX8A 4A3EJ 5F1RA 1RI0A 3SDBA 2HEOA 1S1VA 4J2EA 2DMUA 2QUFA 2VYTA 5LFAA 2XAQA 1XGSA 2IGIA 5GANd 2QW9A 4XLCA 1F1ZA 5DM6L 1LCKA 4CZMA 4I76A 1TK0A 1MGTA 3BPXA 3ATVA 3URGA 1P7IA 2J7IA 1B8IA 2VN2A 3I4NJ 2I7PA 3DKWA 3PMTA 2ECZA 4AFQC 3O1BA 1ABQA 2P9PA 3ZX3A 1SFEA 4MQVA 3VUBA 3CCVA 2JUGA 2LLKA 3HB9A 1HKQA 2BHZA 3F2KA 3UKUA 4I0AA 3MFKA 1U47A 2WUSA 3HJFA 3D2FB 4YEJA 4DQQA 3CC7T 4EA5A 2W85A 4S05A 3TARA 2KDOA 1XWLA 4LG0A 4E0DA 2HEQA 4OGEA 4FJ8A 4GLMA 4B9TA 3SUPA 3JB9H 1OYWA 2XKOC 1FMKA 1D8YA 2DX1A 1HPZA 2ZNZA 4FSXA 4M78F 3S9HA 1IXRC 2HBJA 1HSQA 3FZHA 4FJLA 2PMZN 5ERIA 3TCJA 3WG9A 1W1FA 2HWVA 5KYXB 4NOYA 2BBYA 2FB7A 2WV0A 1OVYA 3ISNC 4BDYA 3HP6A 3V1QA 2X3XD 1BOTO 1XG7A 4FT4A 5FU6C 4FK0A 1WBBA 2O9SA 3BJAA 3A4CA 5KQ8A 2HQAA 2W4SA 4ESRA 2GQQA 1SVLA 4OMMA 3LDNA 2IDOA 1Q9YA 5FO5A 4IG3A 1JKRC 3GFJA 3IG1A 3GZ6A 4GLKA 2YV0X 2ZMEC 5DUIA 5EEHA 1O75A 3CBOA 1E6GA 2OANA 5FWCA 2AK5A 1BCOA 1VRUA 3E6CC 1I8FA 1TAQA 4HSRA 1PCXA 5FU6B 1WHKA 1Z1DA 4FLWA 1GFCA 1W6XA 3QPSA 4R5PA 2G3RA 3MEWA 2DILA 1SVMA 1DQUA 1K6OA 1YITI 3LAMA 2R7XA 3EUKL 3E5UA 1A6IA 2BUPA 5GAHJ 3TU4K 3TAQA 4H5NA 4IZZA 4JD2A 1K0XA 4MQ3A 1IXSB 2P9KB 3QHSA 3CCUA 3NHNA 3DU5A 2PU9B 4HXJA 2K9MA 1D3YA 1UG2A 3ITHA 1MMGA 3E66A 5K7HA 3V1RA 3U1KA 3EFRA 4FSSA 5LGUA 2NYSA 1IC8A 5KYUA 1RABB 3AVCA 3SK3A 4PGGA 1YT3A 2D1KA 3JCUC 2Z0WA 4PUOA 5CKHA 2EZHA 3J81O 5LRSA 1KVAA 4JJCA 2DA5A 3DTEA 1G3WA 5C25A 3GTLJ 2UUZA 1XMKA 3CCMA 3G4SQ 3MX5A 2PTKA 3RKQA 1NNEA 3JSMA 3Q7CA 4CZJA 2M4GA 3CHWA 1KTQA 5FFXA 3TSPA 2NRXA 1V76A 4Z0UA 2JN0A 3A0IX 4J9IA 2YU3A 5E18F 4WXHA 2RV8A 2JVGA 1VQ8A 4A5MA 2A6HF 3QYFA 4QKUA 4KI6A 1W5CC 3WGGA 5T7BA 5AQJA 2Y9ZA 3G1LA 3FHGA 3QINA 1NJZA 1W5SA 3I33A 4JV5K 3BZ6A 3VWBA 1WJDA 4OLBA 1AOJA 3JCMV 3NNQA 3F22A 4M75E 3QKJA 2LQKA 1HBXG 2LRQA 3HZ6A 2R7YA 1MHNA 2RF2A 5AYFA 2VG6A 4CVNE 3HOWJ 2X4WA 2DO3A 1LE8A 3EO3A 5GMKl 4E7LA 4HUFA 1Q18A 4UNFA 5HS9A 4M75C 4BG9A 3JB9I 1NK6A 4D8DA 3VRZA 1YWOA 2HHSA 4J19A 4YOXA 1S1NA 3K4MA 3CJQB 2FSNA 4H5TA 4MDWA 2W82A 1VQ5A 3OSFA 4UHTA 3MO8A 2I10A 3CG7A 1BU1A 4IUVA 3O2PE 1IJJA 3CVSA 1NGFA 2R7RA 2DIGA 2ZAEA 3M1FA 5J40A 2L3QA 1WNLA 1QQMA 2OZ6A 5I2MA 1HSJA 4B1RA 1W2BS 4RUGA 3THWA 5CVUA 4KN7X 3K2PA 1N77A 4F2RA 3N4QA 3QBXA 2XAFA 1IN6A 2P9IA 1LNWA 3K59A 2F4IA 1TL8A 5GANf 4JI7K 2HGCA 3M57A 1WXTA 1VQKI 1YBYA 1YJWT 3DXKA 1G6NA 2NOBA 5M1KA 1U45A 1VQMQ 3QETA 1G15A 5CYMA 4OLAA 3CC7A 2GXBA 3M0RA 4H5VA 1S9HA 3OYKA 4B09A 3HP9A 2NUPA 1MV3A 3G3ZA 3AARA 5LJVA 1JE8A 4M42A 2LSOA 1R9TJ 3JRDA 4FJJA 1HC8A 1JKPC 3J7AP 2ZJRF 4L3QA 5HK0A 3F5TA 3I55Q 1P4XA 2VC1A 4J7IA 3HPWA 4CFBA 2VLAA 2STTA 2LC2A 1X6OA 5M1NA 1UWBA 1B59A 4CJSA 2ROTA 2JXBA 2RK1A 2RHXA 2EV6A 4UVCA 1FMWA 2D45A 2BGGA 5FLXE 1MU2A 4DF8A 4ELVA 2DETA 1FOXA 4JS5A 1K4TA 5ICGA 4KH1B 3QRFF 3OH9A 4DEYA 1APLC 4DTRA 4XKVA 3TW6A 5KCHA 2ICWG 1MIJA 2LF7A 3KEQA 1FNNA 1O1WA 3MX2A 1YTAA 2DDBA 3E5QA 3ECOA 4YIRX 3DAWA 1Y0UA 4GCVA 3LDOA 4C0DC 5KYWB 4M77G 5FPEA 4DF4A 4HZFA 4GV9A 2QCOA 1P4AA 4YDUA 1QZEA 2EFNA 1IREB 4D6WA 2O8FB 3EG9A 2E4LA 1EETA 1UGVA 4BG8A 1OVQA 3I0WA 1WJSA 5D3GA 2CH5A 4JKGA 1JLEA 1HDDC 2JVHA 4XLEA 4EEFG 3O80A 2B8AA 1YJWA 4A0XA 3RZDJ 4BRLA 2QK9A 1C0MA 3UNGC 2RB6A 4H4KC 4WFNL 3M5AA 1XQOA 1RTIA 2R7SA 4K42A 1OMIA 1V1CA 5KNLA 3D0SA 2D6FA 3J80Z 4E1JA 3I59B 4JX4A 2VWJA 4DIQA 4LF5K 3PE0A 3CC4I 4A3GJ 5GAEP 4KDPA 3CCLA 4KIBA 2D0OA 1NGDA 2QEXI 3RBBB 4KH0B 1RR8C 1Z3YA 3MK6A 1ZLKA 2M0OA 2O31A 2BY0A 4DQ2A 3I56I 3HPHA 4I7FA 1NJXA 2ACJA 3I8BA 3IL2A 5HK3A 4F4KA 2M7AA 4M3GA 4B3XA 1T56A 5CQGA 2VWFA 1ONVA 1ZA2B 2TDXA 1E6HA 2CKKA 2KR3A 4JKGB 3MAJA 2HCKA 4E9GA 4L59A 1Y57A 3X20B 4B08A 4QWQA 2Z5UA 4WFAL 2DJIA 4KHYA 5HCKA 4NLBA 1RAGB 4LB6B 4ZYGA 1GDTA 2RKHA 3EG9B 4YOVA 1XJWB 4FYDA 2CYYA 2HB5A 2LJ0A 1VRTA 3CLOA 4JRPA 3CF5L 4QQDA 2RDPA 3DLRA 2HMAA 3FSPA 1WX6A 2A1RA 3FZMA 3FKJA 1JUMA 4IEEA 4QTRA 1V5GA 4P5OA 1XNQK 3N5NX 1O4XA 2I0NA 4PNOA 3UE5A 3VFZA 1FKOA 4MDBA 1HCRA 3CCVN 3FZVA 3WHCA 1YRNA 3M58A 3PNTA 2ASMA 3NARA 3DWLA 2JUFA 4XKCA 3ZMZA 3JB9G 1JLFA 2D8HA 5CE3A 2QXLA 2YJEA 1T8EA 3KE2A 3QZ5B 5KN9A 3KVGA 3H08A 2GQIA 3HPOA 2HVHA 3H3ZA 2E20A 5CVRA 2YT6A 3QZ9B 2E2JJ 4C92B 1LWCA 4B43A 1KQ0A 4M3FA 1VQNT 4I2PA 1AWCA 3WXIA 3CD6I 3QERA 3CUQC 2OCCH 2YWWA 4JS4A 1JL2A 2A36A 4RTTA 1E3MA 1WJFA 2OF7A 4FZXC 3SB2A 1BC8C 3O8GA 2DKGA 4CZCA 4LUDA 4LSLA 4CGDA 1U5TB 3NH2A 1PUFB 5J4YA 1YQKA 1D8KA 3CD6Q 4BVPA 2GOXB 4B1UB 5A2QO 4BXFA 3AT1B 3ZEUB 3DFGA 1WJBA 2X4HA 1YP5A 2DAOA 2HXIA 4LE9A 3BR0A 3CCJN 4LLNA 2QWPA 4RLFA 5GANe 3DTIA 3NRVA 3WU0A 4DV5K 4WCEL 5CPRB 3MP1A 4OKEA 5HRPA 2O8XA 3M8EA 4A57A 1GBQA 2E2PA 4M3DA 2XF7A 3A2FA 3ASMA 2XAGA 2P1JA 3AG1H 1OX9A 4CZEA 2KZZA 3ALYA 1BA5A 5BPDA 3RJPA 4HRIA 3N4PA 1MDMB 1I4K1 4RB3C 2KRCA 1M1KC 5JVGL 3BZCA 1TYQA 1BO5O 5FPMA 1UFMA 2A5WA 4BWMA 3V9XA 3IWZA 3ZQCA 1S72T 4H0VB 4NB4A 5ADXA 5FD6A 3CWAA 1Y96B 5AQGA 1IBLK 5TISC 1XTAA 2H8HA 4CK1A 3CC7N 3FDYA 4BEHB 2E6MA 4KB0A 2IS6A 3BG6A 3LSRA 3CXCP 3ZSVA 4A5AA 4A69C 1Z91A 2UXNA 3MXIA 3PY8A 4Z8AA 1XGNA 2Y48A 3VPRA 4JJBA 4NCAA 4DYCA 4FM2A 1C6VX 1GBRA 2O0YA 4RB2C 1WI7A 2VJIA 2QEXN 1B1BA 2AQFA 3CM6A 2H8WA 2YUOA 1WFXA 1XGOA 4A3FJ 1H88C 4LXCA 1TKXA 1Y0MA 2E3IA 4H4MA 3M9QA 4LK0F 2E2QA 1MBHA 2K57A 3BGRA 3NBPA 4ORZA 2CV2A 3KNTA 2YI1A 4LY7A 1XOVA 2NNWA 2KXDA 1E0EA 1S9EA 3RSEB 1N33K 1RTJA 4KA4A 1T6DA 4O5FA 3VUZA 4CCNA 2F1LA 2E10A 3PFSA 2DERA 1Z9QA 2RJDA 3BDDA 2NWMA 4DFPA 1KD1U 1HNZK 3KXTA 2O8BA 3GMEA 4I09A 3FHFA 2CP0A 4NBQA 1UJ8A 5F08A 3KETA 3NVMA 1W7AA 1NJIC 3MVPA 4DZPA 4H0EA 4PL6A 2QGUA 5DM7L 3DKYA 3L2QA 4O44A 5H20A 2HS5A 3E9LA 2HKXA 3OIQA 1T6SA 1M1FA 4GW6A 3HRSA 3DCFA 2AXTC 1HLUA 4HHTA 1J5EK 2F5KA 5BPMA 3ZN0A 3GTQJ 3L00A 3BOQA 1OH6A 4KT5C 1NK0A 2FPEA 4FE4A 2XAHA 4CSWA 2DFEA 2MABA 1ZBUA 1Q82U 3WTTC 2YHTA 4AIKA 5M1OA 4XU3A 3HBTA 2DA6A 2XKOA 1W4SA 3KP4A 4DLEA 1YJ9T 1ZG1A 1ZH5A 3EE9A 3BJ6A 4ZDOA 2CUEA 1AKHA 5J8FA 3P9KA 1NGIA 1RDAA 5AQKA 1FOWA 1L3SA 2JHJA 3VEOA 3MCZA 4ME7A 3H9GA 4OO1J 5D6XA 1DEJA 2KZVA 2WV1A 1O9SA 4RG8A 1QHHD 4DEXA 4CYCB 4QS7A 4D5CA 1BIZA 2GOMA 1R1UA 4CGFA 1VF9A 5CKFA 3ZX0A 5DPKA 2W03A 5BR8K 1NK5A 2IGMA 3JRIA 3OSGA 2L7MP 1LV5A 3JB9D 3CCVI 1S1UA 3V8LA 2EK5A 3EDPA 3I55A 1W0UA 5KAIC 1VSDA 1YI2A 2ABLA 1VQOI 2JZ2A 1KQSM 4LC9B 4CXFA 2LCCA 3GBGA 4XU1A 2EGCA 1B3QA 1YHQI 4F04B 2DYSH 1X1CA 2R58A 2EYYA 4Y3OA 1AHJB 4FM0A 3PVQA 2CMPA 4AWXB 2IT0A 1N6AA 3HC7A 3LAKA 1WWXA 4DSFA 3F21A 2LMJA 3J7ZI 1N27A 4C8QA 2AHQA 5GPAA 3VV0A 1VQ8N 5L23A 2VPRA 1M1KR 1O3QA 3THYA 5CQEA 2K4JA 1S6QA 1KQJA 4BR0A 4Q4ZF 5C24A 3M8PA 1GT0C 3BROA 4QVZA 3EZ5A 5J4VA 4OMYA 5JMVA 2DI3A 3FHZA 2ZD1A 2M8GX 4GYIA 2A69F 3SYTA 5CJ9A 1VQ7N 4AIJA 1ZSZC 1N5YA 2A6EF 2E6ZA 1TQMA 1JJ8C 5KPTA 3DXMA 4OINF 3LQQA 1V55H 4D8KA 4EVVA 3H36A 3CJAA 3L09A 3TSUA 3TDUC 1IO2A 1IBKK 3QWYA 3Q9SA 1K7AA 2XY7A 2PEXA 1BGXT 3ZQFA 4M72A 4BH9A 4NLCA 4KBOA 4JI2K 1A04A 2KROA 2WC9A 3CCSA 3CCMN 1WH7A 1ZSZB 4KN4X 1HW5A 3MEVA 3J7YP 1SRMA 2LF8A 1RTDA 3LSHA 3SJHA 4GYGA 4HKEA 4LH4A 3VQ6A 2C0OA 1YI2I 4B8XA 3OQ5A 1Z05A 1L3LA 4UNOA 1FYLA 1KG1A 4K8ZA 1SV5A 1M8VA 3JCMQ 1R0BG 2GBQA 1U0JA 2P0WA 1TUGB 3A5NC 1O57A 1PUFA 3FLCO 5L3FA 4CICA 1XC3A 1KVCA 4I6MA 2DPPB 3BUZB 1L3UA 1X75C 1O7FA 1WJEA 1KU3A 1LKXA 4N76A 1JCGA 5B3SH 2A6TA 2JPBA 1UHCA 5GANh 4M63C 3K4BA 3D7EO 4MFDA 3ISPA 3ZXSA 3FX3A 3IAS2 4JP0A 1LMZA 3M1EA 3M8JA 1K4SA 1H0MA 1TG0A 5AQQA 3WTWC 1JCEA 1S5LC 4KISA 2DIQA 3QG1A 3CCLQ 4JHDA 4XLHA 2EV5A 1LUJB 2LQNA 3VESA 1X43A 4X1VA 3AVIA 4ZHRA 5LHIA 4FW1A 3SAHA 3I56A 2G8IA 1W36D 5HLFA 2OTLQ 2K6DA 2A6AA 2CGJA 3ENHA 1OH7A 1KC8C 1NWKA 5FKMA 2CP7A 2NYXA 1FKPA 2W6LA 3IH4A 1RT7A 2DYBA 3SCXA 3I54A 1RAEB 2O4IA 1EFNA 4JEPA 3LOCA 3QEIA 2G8WA 4Y28E 3DKMA 2OBPA 4JX5A 4BRFA 4ANJA 5ILUA 3TW7A 1TUUA 4PJ0C 3E6BA 2IPQX 2FL7A 5JHUA 1WHMA 1AZGB 2X85A 1JT6A 1O3SA 2JWLA 4PZJA 4DV1K 3MZYA 3P9CA 1K1ZA 3IV5A 3SHWA 2O2OA 3MEUA 4MTDA 2MG4A 4DCHA 4XQ3A 2OD5A 5GMKj 2W04A 1TNSA 1RDDA 2RNGA 5GAN4 4C3JJ 1IGNA 2K7AA 1WSUA 4NL2A 3EUHC 2JGUA 5AFUA 1VQ4N 1YO5C 2K3PA 2PMZA 4PY5A 2L9RA 1PDNC 2YU9J 4LD6A 4EM1A 5KN8A 1IJWC 4ESBA 2VOOA 3OYBA 1LE8B 2YNFA 3CIPA 1KQSA 4KHNA 4OB2B 3I55T 3DLBA 3G71I 2IBDA 4UV9A 4Z4GA 2CYZB 5KYUB 1QVFM 3E9GA 4JLIA 4WX9A 1VQ5T 1ATRA 1NGCA 1MH3A 1POGA 4J6YA 4BHPA 2MFZA 2VASA 5E79C 2XRLA 3HM5A 3SWNC 2RQPA 4IXAA 5EEAA 4OMLA 3WTSC 1XN7A 3RIRA 4BQAA 1EH8A 3K2ZA 1TH7A 5M3FJ 2ZCWA 3SFZA 4BI4A 2SEMA 1RETA 1BQMA 4H03B 2JMAA 2WACA 3ZSZA 2X9HA 1X27A 3JYTA 3KP2A 2ZPEB 5FU7B 2RHYA 1W70A 1USSA 1WA7A 2ED1A 2YKNA 1J54A 4OAZA 4YFNF 4DR3K 4M3RA 3PM1A 4KGVB 2ME6A 2HW3A 2DZ9A 3H1VX 2GUIA 2BXZA 3P8DA 3R4KA 3SUQA 1IRFA 3VGKA 4ZGJB 3TQ7P 4YFXF 2EINH 1ETOA 2V26A 1VIFA 3M0SA 5KQDA 2MH2A 2TRTA 3K70C 1XPXA 2CDTA 4YOWA 2FF6A 4CCLA 3CMAT 1Q82O 2E2OA 5LY3A 1TYQB 4DGWB 2QDLA 1NK8A 4F9OA 2CUFA 4BR9A 3P83D 2LOOA 4PGHA 1Q82C 2LG4A 1NGGA 3K58A 3HM9A 2ZMEA 3CCQQ 1YI2N 2H56A 4EJVA 1K78A 3CO7C 1YHQA 3DU6A 3WGIA 3J7AF 4M7AD 2KFNA 2RI3A 3UDCA 3BE3A 2NRRA 1KLNA 4GV3A 1OQYA 4ELZC 2GM4A 3I64A 4Z4HA 5HLGA 1GVDA 3CFPA 1TK5A 3X25B 1X2QA 3CF5F 2E5QA 3JRAA 1D5YA 5IXFA 1QQNA 2JNGA 1VZ0A 3HUGB 2QZ8A 2IC3A 2PJRA 1YITN 2WAQA 2NUPB 5BPIA 3L2VA 3ZQGA 3CCRN 4EW0A 2JOYA 4CK3A 3DLMA 2G6FX 3VN5A 1QKXA 3JCMb 1J53A 5LJ5e 4MEYF 3PQKA 3TAPA 3HK2A 2HNYA 1QPMA 5DCMA 1T8IA 1UE9A 2RREA 1KRPA 3Q9VA 3R6NA 3CWUA 3QDFA 2WY8Q 2XG8D 1ACIA 2YNIA 2HU9A 4KREA 2EFOA 2KIUA 2IS3A 2A07F 3ZT1A 2CGPA 3JAMK 5EY4A 2P0KA 3QP5A 1ACMB 1NGHA 2HQEA 1SG5A 1QVTA 1CSKA 5LEJA 2ESNA 4A4EA 3TO9A 2VB6A 2NLXA 4PFOA 4LB5A 3D0PA 1OPLA 3CCLT 3O9UA 2ZF5O 4II1A 2AKKA 2CQKA 3ZPLA 3UF4A 1MKMA 3LWLA 1RACB 1VQ6I 2NVYJ 1VQON 2GLOA 3C7NB 2MC3A 3C2GA 3T9NA 3E97A 3THKA 4JYAK 3SBGA 4I9LA 2LJ1A 3J81Z 1Z26A 4A61A 3D4VA 2G9WA 1I6XA 1IG7A 3TREA 2IVOA 2UUAK 1VSEA 1OYYA 2FPFA 4M9SA 4CHPA 4ZYEA 4OB0B 3DF8A 4CJ7A 4FOIA 2P6TA 4FZZA 3Q0WA 3NWSA 1NJIU 4I0BA 3GIBA 4K0KK 1CGPA 1TZLA 4NNJA 1DJ7B 4N0AC 1M3BA 2IGNA 5KVRA 4BREA 3O3GA 3UA6A 2LTOA 5F0XA 2XKPA 1SZ2A 1EX4A 3HSFA 3MEXA 1KO9A 2VI6A 1ESVA 2NVUB 4GDFA 1XSXA 4XTZA 1TUCA 3GWZA 2E1MC 2QWQA 3HRUA 4E19A 4ISFA 3E9PA 1EV7A 1UJYA 2QTVA 3WXJA 3SFIA 4CE9A 2E5NA 3BY7A 3O8HA 2R7WA 1VAZA 3O9RA 5HRSA 1QVGA 4F7UG 4HX7A 4GGGA 3DLGA 4G9ZA 2QQSA 5I9EB 1PRLC 2YRCA 5GAGP 4FJNA 4KT6A 4CF8A 1O3RA 2Y1JA 3A03A 3MWTA 1TOVA 2QBYB 3L3UA 3BDLA 5GMKh 1BQNA 4HLYA 4ZGDB 2DXUA 2FQ4A 2K3XA 4FZYA 3H3VK 3VYUB 3E9FA 4JPBW 4IQ4A 4PJOD 1N3CA 4IFEA 2DE0X 3LLRA 2XRNA 4M3BA 2Y4YA 1XX5A 1RT6A 4HV5A 1FK9A 3ZMVA 1SD4A 4MIMA 5C44J 1AT1B 3LP2A 3KX2A 3H9JA 2I7NA 2NOEA 1NTCA 2K9QA 1OU8A 3CCUT 4E7HA 1BHLA 3JSPA 3CDHA 1K4US 4FU6A 3U23A 1P90A 1R5ID 5GADJ 4OMPA 1FYMA 4YORA 4RW4A 2E64A 1R77A 3NFAA 2HHVA 2VKEA 3L42A 1WJRA 2IEKA 2GXGA 3QPLA 2ZJ2A 3KD1E 4WXDA 1FW6A 1OX8A 3L4IA 1ETWA 4DR7K 4F7UA 2CFXA 3B02A 1E4FT 1SL2A 3RKYA 3CC4T 1TKZA 2QM1A 3ZQIA 4NB5A 1Z77A 2IAIA 2MBFA 5CKBA 2G8VA 4BRQA 3SMSA 1IH7A 4KHQA 5HS7A 3J80O 4MHGA 1C0WA 4QVDA 3RPQA 4YFUA 2L3PA 2DOEA 2L5QA 3QESA 1IN5A 3AL0C 1KD1C 4DFKA 4BRKA 1LQ1A 4C23A 5AJ3K 3F6VA 3Q3SA 4XKWA 3H0IA 1VQPN 4IJAA 4OJRA 1YAGA 3SJMA 4FJ9A 1VQPI 4AHRA 4KAZA 1D8JA 2VKDA 2JHNA 1U2WA 3MAQA 5EZGA 5KE2A 3QO3A 1R58A 2GIVA 1NBWA 1M90U 3WTXC 3G6ET 4L0YB 3ZT4A 1YI2T 2K85A 3FWEA 3VQBA 2PUKB 5AQLA 1GV5A 5KYNA 4CGZA 2DOFA 4MDXA 8AT1B 4C2UA 3ESWB 4HSTA 2LY2A 1FYKA 2HHQA 2OFKA 3CMYA 1N3AA 2ZGWA 1MJAA 4HW0A 2CZ6B 3CUQB 2W00A 2HL5C 4XIUA 1UGRB 3FZKA 3M8QA 3O9QA 1X6BA 3OS1A 1RBUA 2RQTA 2O6GE 4AFUC 5A2QE 3RSNA 2IOCA 2RHZA 2P5OA 5H6RA 1R8OB 4FYYB 5BPLA 2COBA 2V1QA 2Q3SA 1YJ9Q 4M3EA 3CMET 5LJ3j 2MOXA 3GG4A 1Y07A 1U6ZA 1KIKA 5KGWA 2RQUA 2IS2A 2DLPA 2BY2A 3U4LA 1S7OA 4MFBA 1MBGA 1OR7A 1Y7XA 1UHMA 4XH1A 2YG9A 2F48A 1ZUYA 2WADA 1IZ1A 1KG7A 2HTJA 1J0RA 4CEFA 4L0ZB 1X2NA 1ILYA 2M87A 1J75A 1DP3A 5AFUH 2QA4I 3ULEB 3AAQA 3CCSQ 2HPMA 2CUZA 3ZQQA 5D6YA 1RAIB 1HW2A 1MDMA 3OYJA 1Z6TA 5ADXH 1KONA 1HQCA 3VQ7A 1I39A 2CW7A 3Q5FA 3WODF 1Q86C 3R6MA 1R5HA 1KQ2A 3VQPA 5FFZA 4EMSA 1OV3A 5H1SQ 1FN7A 4P55A 3TANA 1XG1A 3NGIA 3I58A 3ASNH 2O4XB 2NOFA 4XN3A 2KMTA 3CCJI 1T44A 1AZEA 1Z9ZA 1QHTA 5LBQA 2P9UB 4F14A 3ZGKA 2LCSA 1JLAA 2CQXA 2JW4A 2DNUA 3ID6A 1P8ZA 4ZTJA 5M5WJ 4B9VA 1FYNA 1OJLA 4QQGA 3C65A 1TC3C 3OR2C 1GFDA 4DU4A 3LPUA 3WT0A 1ASVA 3ENOA 3BR6A 5FJ8J 3THWB 2H09A 4HQMA 1D1BA 4P9FA 2WTUA 2VKNA 2BXYA 3S6WA 3K1MA 1UB9A 4FVUA 4C30A 1ZYQA 2VODA 4M7DD 3FXMA 1K8KB 1MUNA 2O8DA 1Q1VA 1HKSA 3HTRA 2VG7A 5D5VB 3ZX2A 1WFWA 1U84A 5FLXK 3A8GB 4DTSA 3PO4A 4FL6A 3CMEA 1QQJA 4K8XA 1GL5A 1NKCA 4ZC3A 1S7AA 2NS0A 1XHZA 1T05A 4BR7A 3OA6A 2MD0A 5JR3A 2ETHA 2DTZA 4F93B 2KXCA 2X1CA 4K11A 2VCPA 1XTDA 4L5JA 2E35A 1VQLN 1P59A 2B63J 3AVJA 3UIQA 4AHVA 3EGUA 1WN7A 4B9SA 4MLHA 2HDWA 5BRHA 2E65A 4C0ZA 2L2PA 4AHCA 3AY9A 3QICA 3I4PA 1QCOA 3S41A 4H4OA 3CC4A 5LJ3d 3G0QA 2WY7Q 1EJ9A 2STWA 4FHTA 5LJ5f 4J9BA 1W5TA 3VYRB 3PO5A 1MV0B 2RNAA 1Y71A 4EP5A 3M4YA 4X66K 3RPUA 1A36A 4F55A 2HHHK 2Y69H 1WZ2A 3MKZA 1IKVA 3HRMA 1WSHA 2KYMA 4YRVA 2WFBA 4YELA 1PJRA 4JI4K 5F04A 3I3LA 2G8KA 2LP0A 2VPLA 1HJOA 3SPZA 2SRCA 1W7PA 2K9SA 3CCSI 2PQ8A 1ENHA 4IL6C 3KEOA 3MWMA 5AONA 3ME9A 2AP1A 2ZJPF 3EG3A 4J6WA 4FASD 5I22A 2LX9A 2DA2A 1U04A 3GP8A 2EJFA 3QBYA 3TL4X 5J2QA 3U21A 2IVWA 4C8QB 3HL2A 1YVNA 3I0SA 1Y39A 3IP4B 2ID3A 4OOIA 5FD5A 1NZ9A 3GF5A 3PIOA 1QZYA 3CC4N 3ABLH 4CHYA 3FE1A 3EL2A 5DD4A 4IRHA 5GMKm 4BROA 2RI5A 2D5RA 2L9VA 1B9MA 1UJ0A 3DEEA 2QG9B 3OS2A 2EFPA 4RG2A 2CT3A 4ISGA 2F5TX 1WQWA 4M7AF 3SQNA 4CEZA 3EQLF 3LWMA 3V81A 2DTHA 1HYSA 2DZCA 2LT4A 3SQ4A 2HHWA 3LDLA 3EG1A 1IHWA 1GOBA 3LM9A 2UV1A 5FROA 3WNHA 3L2ZA 3A8MB 1VQPA 1CXQA 4L5EA 3P8HA 4CZHA 2ROLA 3WU2C 1RBRA 1G83A 3LZIA 1XQHA 5E1WA 2RKIA 2W10A 2J5PA 2QASA 5GJVB 3U9DA 4YOYA 5J1RA 4OPAA 4KH4A 2HZTA 1R5GA 1OPCA 9ATCB 1I5OB 1VQ9I 3CQZJ 2L4MA 2OPQA 4DQIA 1RBSA 1RRSA 3LX7A 4JI6K 2QVOA 4C8MA 2G7UA 2VIXA 3IQLA 4JKEA 3IUOA 3KPHA 3DPLC 3S3NA 3HTSB 3FMQA 2FRWA 2QGFB 4E7KA 1WLJA 4BY1J 1FTTA 1E2XA 1EH7A 4DA4A 2K5FA 2DPUA 3OGDA 2RJEA 4IIMA 4OWRB 4BQLA 2DA7A 4L5GA 3LFUA 4BC3A 3S15J 3G4SA 2AXLA 2E2NA 2KTQA 3GW2A 5SZTA 1JXMA 1VSMA 1JKOC 2FXAA 2HL3A 5CIUA 3WQUA 4LJZF 4A0YA 1VQLA 3O4NA 2BZTA 3CQYA 3W6KB 1ETXA 1UEBA 2EILH 1HSTA 3HG9A 1VOMA 4KKOA 3QPHA 5CKTA 1HYOA 4AHUA 1LAVA 4RLQA 1MH4A 4HNVA 3FR0A 3T19A 5HL7L 7AT1B 3R8EA 4MQ9F 3BEXA 2XROA 3KYCB 3CUQA 1G99A 1LAWA 3CPWM 2KQWA 2CW8A 5TKYA 1ATSA 3BR2A 4NL3A 1SFOJ 4ZNXA 1XI1A 1S5JA 2XDPA 3JRGA 1RC9A 2DL8A 3TAMA 4CBUA 4BS9A 3KEYA 2MGQA 3AA5X 1NU0A 2XASA 5AQZA 4IHSA 1DU6A 2YHWA 5D5UB 4IOAL 3PMIA 4RTUA 1X01A 2F2EA 1B07A 1D0YA 3RMCA 1ETKA 6PAXA 2A41A 4CBXA 2RI2A 3VS1A 1U2VB 2COYA 3WEEB 4C5IA 4EV0A 1R0CB 2DJZA 5C42A 3O4WA 4Y33A 3NF9A 1IRGA 4HVWA 4CJFA 2LMDA 5B5EC 5GAMe 2A3ZA 4IJNA 5ICFA 4IFVA 1FY7A 2FYKA 2NRVA 3C95A 1S1XA 3B8AX 1PRMC 3MEAA 1VK0A 1E3OC 1Q81R 2WAEA 3TAEA 3G25A 3BY5A 2XDBA 3CDIA 2V75A 3THYB 1YIJQ 2EBIA 2X6WA 1WSFA 2B0LA 4C3IJ 1VSJA 3AG2H 2MI6A 3OYGA 2O9LA 4OB1B 2VVKA 4NCGA 1VQLI 2DL7A 4E7JA 1R22A 1WH5A 1HKTA 1NG6A 3CI5A 1IUFA 1S72Q 2L54A 4AG2C 4N0BA 5K5QA 4OIQF 5B8HA 3EFSA 3O4QA 1YJ9I 4CCMA 1LPQA 1IW7F 3O3KA 1ORKA 1VQLT 3REBB 1N8RR 1EH6A 2OPSA 1XDUA 4F3QA 1ZG3A 3G1MA 1BJZA 1ABOA 1GLCG 1VQMI 1PD1A 3V8KA 2FPDA 1AWOA 4J6XA 4KHWA 3M0PA 2LQ8A 1RDBA 3WHBA 2W1OA 4KV8A 2ZXIA 2QWWA 1ZSGA 3KWGA 2E3HA 3CPWP 1LFPA 2IW5A 2V9KA 2DXTA 1H641 1QWEA 3T5XA 2O5RA 2GIZA 4LFUA 3L9FA 2HBLA 3PNYA 1RAFB 3CBMA 3RQ4A 1RIOH 2EWSA 1BL3A 4G12A 4DQSA 5D6WA 4TSXA 1RNLA 1RI7A 4DJAA 3O5BA 3E5XA 3VENA 2QSGX 1I81A 2QDYB 4M7DE 1Y8QB 2BGCA 3BG7A 4FT8A 3VEXA 4PLIA 4D7NA 4ISEA 2LDUA 4JK1X 1OR7C 1QHGA 1NGBA 1K9AA 1ZBLA 3RNJA 2F5CA 4D7MA 3AKZA 1G4DA 4J2BA 1DGRM 2KYBA 4QOZB 2VQHA 3OYAA 4M7DC 1VQPT 2F5FA 4V2GA 3RYRA 3THXB 2M0YA 4IWVA 1HLVA 3CFRA 1OH5A 4CEEA 1CZ9A 4FLXA 1YG2A 3HZJA 4JLHA 2PI0A 4ITVA 2VXEA 4NDLA 5K14A 5FDLA 4M3XA 1B72A 1WAJA 2EAYA 5J1YA 4UB8C 4YTLA 3SWNA 4EJUA 3Q1JA 3VTHA 3V4GA 2V7ZA 5M3MJ 1AD5A 4DZJA 2LX7A 2FUG2 1D1AA 4I02A 3OBWA 2ID6A 2L3DA 3PTAA 5BR9A 1W7PD 3ZT2A 3TWHA 1E4GT 2HNDA 3TTDA 3JCMP 2EZKA 3A01A 4Z02A 3BC8A 2P5KA 4YPHA 4A62A 3R60A 2FZKB 2XAJA 4H0PA 4AQYK 4JKCA 1WXUA 4YFKF 2ECBA 1HNIA 4CW7B 1ZQ1A 4F7UB 2ETJA 3NH1A 2VJ4A 1XSDA 5CK9A 1I5ZA 1ZR2A 2PJRB 3CMEN 2BV6A 3ZSWA 3ZBDA 4O8UA 5IYDJ 4HVVA 3U3YA 3DRSA 1T0FA 2QEXQ 3ZEUA 2QWRA 3AVGA 2F5EA 3HHHA 4FLTA 5DD8A 1X3ZB 1BI1A 3VS7A 4A5BA 3QBWA 2HF4A 5GAOp 2J6KA 4NQWB 2MD5A 1JEGA 2V1UA 2LKXA 3D2EA 2DVEA 4FJXA 3EFOB 3FZLA 1RDWX 3DQVC 2K27A 3G6EA 1D5AA 3DTKA 3NAUA 3PNWC 2L7KA 3CC7Q 1KC8U 1PHTA 3LQRA 3DJCA 2QKBA 3ROUA 3QPTA 4IDKA 1M3QA 1ZN2A 2YS9A 2KVQG 5KPRA 1HXDA 3JB9J 3M53A 5ECAA 2A61A 1DDNA 1DGWY 2K5LA 3LP3A 4BY6B 3HDDA 3NF7A 5HODA 2A37A 4RMNA 2Y75A 3KZZA 1Q86R 5E3LA 4QS9A 5F2RA 1IV6A 3TTFA 4EP4A 4DR6K 3TU5A 3FB9A 3DRPA 2O8EA 4F52A 1M1GA 2EIMH 3NF6A 1RNHA 2DRMA 4JN4A 1K73C 2V1XA 4XMYA 5LLQA 4ZN3A 2GBYA 3CQ8A 1J5YA 2B86A 1X9MA 3TTCA 3S1RJ 4RTYA 4ZN1A 1W9HA 1WXBA 3MHXA 5AR0A 4FSVA 1VYTA 3I0RA 2EFQA 2V4JC 4M78B 3PO3J 2V1RA 3I56T 4VUBA 2RQQA 5CVIA 3KP6A 5FRNA 4NXNK 4E9HA 2EFIA 4CF9A 4EW4A 4CYCA 1D9FA 3FIWA 2VKHA 1C0TA 2JTVA 2ZQBA 3NVKA 4BR2A 1JGGA 2CSQA 4WQ4A 4C8NA 4QLCU 4U67L 3VRYA 2YX6A 5KYWA 2KAFA 3VGLA 2COMA 1SL1A 3HHTB 1MNDA 3DB4A 1PSEA 4OKKA 3VEYA 3W0LA 1SC7A 2ED0A 3OIPA 1QQOA 4RW9A 2E6LA 1MMAA 5LJ3e 1AWJA 2EYWA 4DBHA 4N4NB 2JSCA 2QA4Q 1B6AA 5DTDA 3T8RA 3MWPA 4MO5A 1LCUA 4CD1A 2HR3A 2X74A 2HFHA 2X0LA 1IHVA 2EQKA 3CLQA 3WEEA 4DYRA 1JU5C 4H5WA 3FXQA 1MNEA 4P9UA 2YX7A 2K02A 2P8TA 3OYHA 2RVCA 2E1NA 1HQUA 5HDKA 3H5AA 1MBKA 2EFWA 3TVTA 1K8AO 2XU8A 4XK4A 1SQKA 2OTJI 2HVQA 1ZBHA 3C94A 2OTLI 1IG8A 1XCBA 1K8AC 3VF4A 2E6NA 1VQ9A 3ULQB 2DT7B 4M77F 4F17A 4U0VA 4UB6C 4W5TA 4YOTA 1VRLA 5AQNA 3I5SA 1W0TA 5LJ3g 1JLGA 2IRFG 3H6EA 2R7TA 5IOZA 3CCUI 3FZFA 4Y0WA 1YCSB 1LWEA 4ELUA 2BHYA 5DCFA 1VQNI 1JTXA 3KK3A 2W25A 3CJ9A 1DPUA 3R61A 2BTTA 1N8RC 2NLUA 3AO3A 4BBSJ 3L1AA 4UUSA 1RLPC 5CQYA 3DKXA 3CCMT 2P5VA 5EXWA 3V9WA 2X35A 2NOGA 2GFAA 4CJUA 4TV7A 4MO4A 4HVJA 1AEYA 4XU0A 4WF9L 3MMYB 3BFMA 3IHUA 3S2WA 1J3TA 2NOJB 4BJ5C 2HOSA 3U1DA 3H0DA 1JJ2A 2DQLA 1ETVA 4JRIA 2YUNA 4JOMA 3PNVA 3OL4A 3TAGA 5DUKA 2CZ1B 1GRIA 1NLPC 3MCAB 1YJ9A 2J06A 1UHSA 3AO4A 2Q1ZB 4BRGA 2M30A 1QVFP 3L8BA 3JRFA 4LF6K 1WIEA 1HPMA 4YNQA 4XLAA 5KH6A 2B6AA 4LDYA 1WPKA 4ABZA 3EN9A 1KU2A 2O61A 3OOPA 4BY7J 3TOAA 2ELJA 4HCCA 2R7VA 1TLHB 3NTIA 4AI4A 3I53A 1S7EA 1LWVA 3GPLA 5FLXZ 2DM1A 2KSSA 4UQGA 5ILVA 4UUSB 2MLKA 4A4GA 5IHNA 4HT9A 5D6FA 1VSLA 1WJCA 1GOCA 5KYYB 5DV5A 1KEAA 2HHUA 1M90C 3G71A 4IURA 3DLKA 1OLTA 4FJGA 4A0ZA 2EQMA 4CHZA 5FGMA 4ZYAA 1VQMA 4M78A 4AMCA 1RAAB 2X3WD 3HHGA 4NHJA 5CLSA 5GAN7 3GZNB 3KYLA 2BZXA 5E84A 5E26A 3SFMA 1X9JA 3JB9F 2NXNB 2M0CA 2ZBKA 4FWLA 1PP8F 1J7KA 4AILC 4M75F 8ATCB 4A63B 3ABUA 5EC7A 1PYVA 4EMKB 3OYIA 4OPHA 2B4JA 3FIFA 3MEGA 4BGDA 2NZTA 4K25A 1IDYA 3RTVA 3FMSA 4M78G 2Q97A 1MWKA 1ZLMA 3HYFA 1RGIA 5M9OA 4DK9A 2LY1A 4M7AB 4CESA 3K4LA 2KRMA 3WNGA 1QGPA 1KK7A 1NE8A 2CH4A 4CJPA 3PLAA 2IG0A 4A4HA 2DJQA 3K5NA 3FJPA 1NYFA 1IZ6A 2PVDB 4CJ5A 2EPDA 2YSQA 1YS7A 2GTJA 4C0FA 1ZBJA 4RGXA 1RTHA 2GELA 3M3YJ 1QNTA 5BS6A 1OCZH 1WZOA 4KITB 2JS0A 5AQUA 1MPGA 3H46O 2R5YB 3TDZC 1XC9A 2M51A 5BRFA 4CC2A 4F3OA 4M77B 1K9MO 2BE2A 2EGAA 3FXJA 1YF5L 1IAWA 2F4VK 3VQ9A 3EY1A 3B73A 4G7HF 4XM3A 3A8LB 2VT3A 4XLPF 2AS5F 3LPTA 5KGXA 3QEWA 2CP6A 1ZHFA 4IG0A 4A4FA 1ZSZA 3ABMH 4W5QA 2P5LC 4UV8A 3M0TA 1N5ZA 5JLHA 2KRSA 3MEDA 4E70A 3G4ST 1YN8A 2A5YB 4ZYHA 3VYHB 3CDLA 1K79A 1KYWA 2CUDA 1PP7U 3G10A 1LB2A 3VQEA 5LHHA 1YITQ 2VC0A 1UHWA 3N97A 5IAYA 1T33A 3EH1A 2A1SA 2JJ7A 3K4CA 5IPAA 1X1DA 2VBYA 1QO0D 1MUZA 2WSCE 1SVOA 1Q1HA 5E1XA 4C8LA 1N25A 2VONA 4IHXA 2KBTA 3VF2A 2O8DB 5GAN3 2R0QC 2OZSA 2YRDA 2M9UA 3QXEB 1RRJA 4EJZA 3CMAN 2HF3A 1GCQC 1SRLA 3DB3A 4BL0B 3KLFA 5JI6A 1QVFA 3FFKB 5IY5H 1J09A 3U6FA 2L4AA 4CZLA 1YX3A 2AIRB 1DTQA 3S6IA 4M75G 1NOYA 2CGLA 1ZQ3P 3GTKJ 2VUMJ 2OPTA 3E01A 2LY9A 2F69A 2ZNYA 2MH9A 1C0GA 4MNUA 1TT0A 2DFHA 3WNEA 1TTHB 4CC7A 5EGOB 2XSDC 2ZJPL 3A8HB 1NEGA 2JA7J 1W2BA 3G71Q 4BKXA 1IB8A 4AHTA 1SEMA 3CM5A 3KLGA 4NUBA 4BDZA 2XIDA 4CDGA 2XAUA 3QIIA 3QEXA 1W7PB 3MZ8A 4XOTA 3CMAI 2PYJA 1KAZA 3GXOA 1H3HA 4ATOA 3K5OA 4E1NA 3ASKA 3CCRA 2OPPA 3CCLI 2E2HJ 1ZUUA 4HCBA 3T69A 2IVPA 5C0MA 3SAFA 3CC2I 4DBFA 3S1QJ 1Z9CA 4ZYDA 4CD3A 3OYCA 2MCNA 4LSNA 4YIIA 5A0DA 2XVCA 3F9MA 1BOAA 1U8BA 4M7DG 3DRRA 4RGSA 4G7OF 4HPQA 2L7ZA 3TO6A 3LAJA 1Y8RB 3K70D 4DBRA 1XMXA 3INZA 4EZ9A 3F8CA 2WTEA 4AM7A 2XSJC 1BK2A 4M6YA 4H5RA 4RGUA 2G8FA 4R1HA 1L3VA 3JRHA 1DLOA 3TSWA 3PJRA 3DMJA 4Y4RA 4XLFA 2HQRA 1Q86U 3W2WA 4RBOA 1U3EM 2ADUA 3RVCA 2X1DA 1N9RA 4DV7K 1KHCA 2C0IA 2W57A 4PJOB 2L7FP 1YJNN 2LP5A 4PLLA 3THXA 3RR6A 4AIDA 4HBLA 3WVEB 1BDGA 4OIOF 1HD3A 3JAMO 5JS2A 3MQ0A 3OWTA 4BBRJ 4J01A 1G3YA 1IXDA 1JUSA 5GMKi 3LL7A 2RPNA 1VQ5N 2K3BA 4DOVA 4XH4A 1ZA1B 2HYJA 2F4MB 2A68F 4XRSA 2RD1A 1BN5A 3NCIA 3CO6C 5IT3A 4EPCA 4ILHA 4B3RK 3MN7A 2CJJA 4K43A 3H0HA 5DLOA 3WU1B 2ZFUA 3CMAA 3GBTA 4ASNA 4DUZK 1Z7LA 4MLOA 4KUMA 4PJOE 2VT2A 2OTJQ 1BBYA 1FXXA 1N75A 1K73U 4FX0A 1UGSB 2OQRA 2ZGZA 4Y91A 2UUCK 1YHQT 5HRRA 1NG7A 5LMUK 1WEGA 2Z2SB 4KRTA 1I5LA 4FWMA 3W6VA 5GANj 3MECA 2IP2A 1UA1A 3QYGB 4Q0BA 1FZPB 4A3BJ 3RERA 2OYQA 2FSJA 3MN6A 1YJNQ 3H9NA 1LOJA 3H41A 5IP7J 4Q5SF 2DXBA 2ZMEB 3CP8A 3W3DA 5D5XB 2HQXA 1VQNQ 1IGUA 1UUEA 3IMXA 3QNNA 1AU7A 2HYFA 3H92A 1NLOC 4R56A 1D4XA 2H1LA 2P4RA 3C3WA 3KCCA 1SKUB 5A0GA 3QUIA 1TL1A 5FKNA 3B6AA 1Z0XA 2GNCA 3SEQA 1QKWA 3AVKA 1M2VB 1XS9A 1Q7YR 1R4NB 2HOEA 3H1QA 3WTVC 4I2OA 1YJNA 4ON0A 4Y13A 1UG1A 4U7BA 3EE8A 3P7NA 1KU7A 4N0AA 4R0KA 1GOAA 1X3WB 1XNIA 3RMAA 1C0FA 1JLQA 3PFYA 4OF1A 5D8LB 1Y56A 3I35A 2J05A 2JPCA 2NUZA 1K73O 3BR5A 2DFUA 1TW2A 4Y1CA 3K57A 1WJQA 3R3LA 4PSXA 2ZM6K 2W84A 3PUFA 4A3MJ 2QK0A 1SKWA 4C9YA 2HHXA 4FETA 2JK3A 1S6LA 1WJAA 2NRZA 5A0LA 3FBNB 3VQDA 3AGKA 4DLGA 1YITT 5AQTA 3VU3C 3HOTA 2FU4A 1XMAA 3KP3A 2KL4A 2HTSA 2IAJA 5GAEJ 2QQRA 1OZ2A 1JCFA 3WE3A 1WBDA 4P96A 1SFKA 2Q0RA 4DOZA 4EVIA 3NGYA 2E2IJ 1RBTA 4MLEA 3NF8A 4CZFA 1OCOH 4G94A 3PQJA 4BAYA 1G3SA 3VODA 5HS8A 1QSSA 1FP2A 4PKCC 1UDLA 2V8JA 5FB2A 5GADP 1NM7A 5EJCA 1CF7B 3ZCOA 1YNZA 3G1OA 4HEA2 2JA2A 1MUYA 1XUPO 5I42A 2HNIA 2NOZA 4C5EA 3H6ZA 2BUDA 3CXCM 2CS3A 4E1MA 1TKTA 2Z3YA 3OMCA 2XMFA 1JJ2P 3IAM2 4LLLA 3ZSOA 3EG0A 2XGXA 3RSEA 2CH0A 5C0YA 4E4HA 4JX6A 1VSIA 4HNTA 5C2DA 3CCRT 3VSKA 4L5IA 1WSIA 5DY9A 5LL6Z 2OZMA 1F9NA 1VQ5I 1H8KA 1HKBA 3DLAA 4A3CJ 4KULA 4KMFA 4OMZA 1TT5B 1T3LA 4KYWA 2FD5A 3HRTA 3HYIA 4KMUX 3AO1A 2DK3A 4XNFA 2DO7A 2E1OA 3F8BA 2BIVA 1LW2A 2ZXHA 2I5UA 2XC7A 3PV8A 2W40A 2JWTA 4CJLA 3H3NO 4EFHA 1VQOQ 4IDHA 2XB5A 2ZXJA 1STZA 1DP7P 2DXIA 1ZAOA 5I3UA 1R71A 3TMOA 3O5ZA 2JMCA 2HSTA 5L8RE 2DMOA 4IHVA 4FK2A 4NQWA 1QVFS 1ZK8A 4JRQA 3HEFA 2P9NB 3M7GA 4F2SA 2H6BA 4LN2A 4CIGA 3F3XA 3QDRB 3K69A 3VQ8A 1UELB 4CJRA 4KH6A 5AQVA 4CCHA 3J7AY 3ZSXA 4CJTA 1CF7A 1WEFA 3LGFA 3LFKA 4JI1K 3S16J 5AQPA 3CTAA 3C1DA 5BRDA 1XDSA 1QHAA 3BZKA 1X1AA 4H0XB 3T3FA 4EGZA 1YIJI 2E1ZA 2K40A 4DB3A 1M9SA 3K9TA 2P9PB 3PO2J 2E5ZA 2H1KA 3W2VA 1HU0A 2XGCA 1O3TA 2DF6A 3VEWA 2EBPA 1HRHA 1IO6A 3GFIA 3FXOA 5EDNA 3PIOF 3QDKA 5HP1A 4JI8K 5EEGA 3CXCS 4G6TB 3GTOJ 2EYXA 2WSFE 2QWLA 3HTUA 4B44A 3LSPA 2FBVA 5D8KB 3HT3A 4U87A 1ZGJA 4PJMA 5IYBJ 1YOVB 1SD7A 4EM2A 4YG2F 4LH5A 4CEOA 1EWQA 3WXLA 1T3VA 3JTHA 1VQ7A 2NUTB 4B23A 2JUCA 4BRCA 4BB7A 4W1UA 4DWIA 3O6BB 1K8AU 1FOKA 2Q1NA 2JRTA 3SDGA 4AH9A 2FG0A 1XNRK 2AO9A 3SV3A 2CO5A 5AQMA 4FJMA 2P0PA 4BE1A 1JGSA 1HF0A 4OVAA 1IUYA 1Q81U 2Z16A 3GF2A 2D0QB 2P7VB 5KAFC 2BH1A 4M7XA 1BOBA 2CH4W 4UUVA 1IG9A 3RCOA 3P39A 2F2WA 3OYFA 1XCVA 4FWPA 1JB0E 3OTOK 3F8MA 4LUEA 4A12A 3DPUA 5I2SA 4DSKA 4Z4CA 1WHUA 3PIPF 2BDPA 4CJVA 2N8GA 1UHFA 1S9GA 4LF8K 4ENKA 3GOIA 4EIAA 2F2VA 4FO0A 1K61A 1PKTA 4WQ5C 1AHDP 4C8QF 3F10A 4BI8B 2Z1DA 1T08B 4A3KJ 1V4SA 2Z9OA 1GCQA 5CVJA 3HOUJ 2JMWA 1TWFJ 4C0DB 1NGEA 4PKGA 2O8CB 3QMLA