3OYIA

Crystal structure of the pfv s217q mutant intasome in complex with manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyiA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyiA03
4Y1DA 3SI6A 4FJ9A 4FU6A 3PV8A 4E7KA 3HXMA 4DMNA 1L3VA 3RMBA 4NCGA 1QS4A 5D6WA 3KD1E 1ASUA 2ETJA 4H4MA 2D0BA 3RRGA 3ISNC 4BWMA 3K2PA 2QKKA 3FLGA 2MWOA 4O55A 4NYFA 3DMJA 2BE2A 1DTTA 3HVTA 3V4IA 2XHBA 4ID1A 2X6SA 3NF8A 5CY4A 4I9QA 3AO3A 3OYNA 1J9AA 2G3RA 1HPZA 1XC9A 4QQGA 4C5GA 2YRVA 1C1CA 4HUFA 3V9UA 3KIOA 4I7FA 2DIQA 2PYLA 4CEZA 3CFRA 3QNOA 3BGRA 3OA6A 1RBVA 2XY5A 1RT4A 4HCZA 3LGLA 2RJDA 1HQUA 1SKWA 1RDAA 1IKWA 3NGZA 3LWMA 4E7LA 2GV9A 1VSIA 4F2RA 3AO2A 1CZ9A 3HM9A 4FL6A 2XY7A 3QEIA 4DFKA 1WNSA 4CIGA 4CGGA 4BDZA 2EX3A 5EU7A 3Q1JA 3SNNA 4X34A 1JLGA 2YNGA 3SJJA 2M0OA 2DY4A 3TI0A 4TSXA 3MXIA 4CGDA 1LWCA 4FM1A 3V9XA 3DLHA 2Z1HA 5KE2A 1Z25A 1VK0A 4MQ3A 4M3UA 4KAZA 4DLGA 2YV0X 2DIGA 4DSKA 2IDOA 2OZSA 3U3GA 4PL6A 3CQ8A 5M9OA 4DQPA 3V9WA 4HUGA 4O0IA 4OKKA 1C1BA 3NGYA 3QESA 4L8RB 2Z1IA 4Z4FA 4C5EA 4IDKA 4JRPA 3PMIA 1HNIA 4M41A 3SUQA 4OKEA 4Z02A 1TL1A 4DTRA 3PX6A 1XNIA 4B9VA 4O4GA 1KRPA 3OYGA 3SPYA 1LV5A 3AVAA 3VQEA 1SSFA 2JTFA 2IS3A 4G1QA 2BGGA 2IC3A 3AO4A 4B9WA 3AVHA 1TK8A 5K14A 4IUUA 5SZTA 1S1UA 3K5OA 5FROA 2B4JA 1TAUA 3DLEA 1LW2A 1VSLA 1JLBA 1RCHA 2B5JA 1Z26A 3K57A 4KKOA 4LSLA 3SUPA 4PQUA 3NH2A 4CIFA 5KRSA 1T8EA 4QCLA 4CF0A 4KHUA 3ZSWA 1REVA 3RMAA 5HRRA 5J2NA 2RF2A 2BDPA 1CXUA 1RT5A 2XRIA 3HSTB 4CHZA 4B9SA 3OMCA 2X78A 4Q0BA 4QQDA 3IRXA 4CJKA 3MXMA 4OVAA 2RI3A 3FEOA 3ITHA 4CESA 3V1QA 2Y1IA 3RR7A 1GOAA 2X74A 2YNHA 3CYMA 2QKBA 3P8DA 3LZIA 2R57A 3V6DA 3LZJA 3PX0A 3AVFA 1G5VA 4UQGA 3SQ0A 1RBRA 4Q5VA 1RTDA 3VQ8A 3LWLA 1XHXA 3OYBA 2HHVA 3MEEA 2G8UA 4PA1A 3HK2A 2O4XB 5CYMA 4CK3A 3S3MA 4CJSA 3F9KA 4OJRA 1DTQA 3SQ1A 1Q9XA 3LP0A 3E9GA 3ULDA 5HP1A 4CGHA 2PY5A 3LDSA 3AO1A 1ZBHA 1QQCA 4H8KA 4RW4A 4M3RA 3K5MA 4CIEA 1VRUA 3HPGA 4CFBA 2DFFA 3DLMA 4YFUA 2D0AA 4LY7A 1RTHA 4DTNA 3BDLA 1Q8IA 3MP6A 4CJRA 3KD5E 1C0TA 4CEOA 4OGCA 4R5PA 4CHYA 1NK9A 4RW6A 3AVMA 3MEUA 2HHUA 3TAEA 1DLOA 3EZ5A 4FJGA 3NH0A 1ZBUA 1LAWA 3QIPA 4NZGA 3M8RA 2X4WA 4HTUA 2ZQBA 4FJXA 1Q9YA 2HHQA 2YKNA 1JKHA 1FXXA 1T7PA 3QJ6A 4B9TA 4KHYA 4A4FA 3MXJA 2A1RA 4CJPA 4OPJA 2E6MA 2NLUA 3H8ZA 4O5BA 4W5TA 2RJFA 4F2SA 3QKJA 4IG3A 3LYIA 1U47A 3P8HA 3TARA 4DF8A 1VSDA 1X9MA 3ZCMA 3GOXA 4QAGA 4DFMA 4M3YA 1JLCA 1EX4A 4AHTA 3K5NA 3AA3A 3IS9A 1BCOA 3ZT0A 1A5VA 5J2PA 4M3XA 2GFUA 4C8MA 1R0AA 5KI6A 2XDPA 3P83D 3KJVA 2F5KA 4KHWA 3VQ6A 1ZBFA 4YNQA 4B9XA 3OQ5A 4QOZB 4FYDA 3LP3A 4N56A 3L2QA 3ZEHA 2RKIA 4AH9A 1YTUA 1KLMA 2Z1JA 4KTZA 3CM5A 1NKEA 2ZE2A 4IUPA 4OPKA 2FC0A 1NK5A 4FZZA 1HNVA 3VQBA 3IG1A 1QHTA 1RBTA 3LX7A 2FBYA 4KPYA 1NKCA 1FKOA 4ICLA 2QK9A 1C1AA 3OS0A 4FJNA 4CK1A 4HHTA 3TAPA 2FBVA 1UWBA 2WONA 2P0KA 4W5QA 4GVMA 4E7JA 3LP2A 1SUQA 3ZT2A 4N4IA 2RJEA 2RPIA 3F73A 2OA8A 3NGIA 3RMDA 2X6NA 1S9EA 4GY5A 4FZYA 3ZSZA 1SKRA 4EZ6A 2P1JA 4II1A 4KHQA 3ZSOA 1NKBA 1TVRA 4QVZA 4FXDA 2G8VA 4MFBA 3ZT4A 4N4HA 4J2AA 1HRHA 3OYHA 3HL8A 3ME9A 3DLGA 4F8RA 3NF6A 1TV6A 1WN7A 2EQJA 3VQ4A 1ZBIA 3U6FA 4CRIA 1TGOA 4FLXA 1VSKA 4E19A 2GFAA 4LD6A 3AA4A 5KGWA 1N27A 4HVJA 3G10A 2ITGA 3OYAA 2RHZA 4PUOA 2R7YA 4GW6A 1KCFA 4CEQA 4IBNA 4RG2A 1OYXA 3ASKA 1JLFA 1NK8A 3S3NA 4BWJA 1GOBA 3T3FA 3ZT1A 3FFIA 5CIUA 2BKDN 4CEEA 4WE1A 4CJUA 4C5HA 4KHNA 5C25A 3KLGA 2HVIA 4QQ6A 3AVGA 3QLHA 1BL3A 1WAJA 3NTIA 4PLIA 1RNHA 1JLQA 1OZ2A 4CHPA 5J2MA 3O4QA 2MWPA 2ATQA 4CJEA 4B08A 3NTKA 3OYJA 4C8OA 3NTHA 2XY6A 4KB0A 4FW1A 3VQDA 2BANA 4CHOA 1BGXT 3AVCA 4DLEA 4AHVA 1TAQA 4FLVA 2PZSA 3RRHA 4FJMA 1ASWA 5DMRA 4BE0A 3A2FA 4J2EA 5C0MA 1S1VA 3LPUA 5HROA 4DSEA 2LSNA 4HCCA 3LAKA 3K5LA 2KFZA 3AVBA 5CZ1A 1WGSA 4IKFA 3G0ZA 4B9UA 3DLBA 2YHAA 1WJQA 1SL2A 1L5UA 3AVNA 2IAJA 5KCHA 2M1HA 4CEAA 4IUTA 3QBYA 2IG0A 3MEAA 2L3RA 1IH7A 3VQQA 2EQUA 3DRRA 4C5IA 3AVKA 5HLFA 3CM6A 1ZYQA 3QEVA 4W5RA 1S1TA 1LAVA 1QSSA 1OZ3A 4RW7A 4CJ3A 4DQIA 2DFHA 3MAQA 3OYDA 2ZD1A 5FRMA 1NJZA 3MO8A 1NOZA 3KUFA 4DSJA 2BUDA 2OPQA 3S6WA 2L8DA 3DOLA 1CXQA 4DQSA 2VYTA 1Y97A 4M3WA 3WNFA 4KV8A 1KVAA 3NF9A 2PYJA 4DFJA 3ZT3A 3V1RA 3V1OA 4IUVA 4N47A 1BIZA 3NCIA 4DSFA 3K58A 4ZTFA 1WAFA 2HQEA 2FBTA 1S1XA 1ASVA 3MEWA 3DLRA 4KB1A 3K59A 1B9FA 3KKRA 3KTQA 2HMIA 1BCMA 4IURA 1SV5A 1WLJA 2W42A 2P5GA 3QNNA 2D9TA 4M45A 2GUIA 3NE6A 4I2QA 5JS2A 4CE9A 2QXFA 4LSNA 2XK0A 3META 2YHBA 3AVIA 1IKYA 5D3GA 3TAQA 4N5SA 2FBXA 1F21A 3EYZA 3V81A 3E9FA 1RI0A 4QW2A 2OYQA 2L89A 1B9DA 1D5AA 3H6ZA 1MU2A 4CJLA 3OYEA 3L3UA 4RW9A 4C8LA 1RT2A 1RT1A 2QQRA 4BDYA 3U3YA 4E1NA 1BQMA 3VQ5A 4I2PA 4HCBA 1WJRA 3B6PA 2EHGA 3C94A 2KZZA 3KK1A 1IO2A 2IOCA 4CFAA 3L2UA 1RDBA 2G8HA 2HHWA 2QQSA 1S5JA 1BQNA 3PFSA 4OLAA 3QIOA 1IKVA 3VQPA 2DTUA 1J54A 3NHGA 1RT6A 4N4GA 4I9LA 4KFBA 1EP4A 3QEWA 3RTVA 1TKXA 1RBUA 3ALYA 3I0SA 4CJ4A 4K8XA 4FK0A 4B8CA 4OVLA 2YNFA 3DOKA 4FM2A 1JXEA 2Z1GA 4OKJA 3C95A 3C4SA 5CZ2A 2LRQA 1C6VA 3T19A 2FHDA 3I8DA 5KGXA 2HB5A 3VQAA 4PWDA 4CK2A 3HT3A 4HUEA 3O3GA 3KK3A 1SL0A 4J2DA 2PQWA 3CEYA 4DTUA 4ZHRA 5HRPA 2XO7A 3UWNA 3L8BA 1WJSA 4AILC 4Z4HA 3DB4A 3PUFA 2LDMA 4DU1A 3OYMA 4JLHA 3RR8A 4FK2A 1J53A 2GF7A 4EZ9A 3AVLA 3TAMA 1KSPA 3VQ7A 1EKEA 4DTMA 5HRNA 3L2VA 3PMTA 2AJQA 3LAMA 2G8KA 4B9LA 1KLNA 3IAYA 3CG7A 3SV4A 3TANA 4EDUA 3PO5A 1TKTA 5HRSA 3ZSYA 4A4EA 1LWFA 3DRSA 1BI4B 3AO5A 3SZ2A 4DU4A 3MP8A 2D5RA 3SQ2A 1SKSA 4NCBA 3B6OA 1EETA 4CECA 3SV3A 3PY8A 4Z4GA 2KZMA 3LH0A 5CYQA 1C0MA 3FC3A 4CF2A 1UA1A 1IG9A 2B8AA 3L3VA 3VQCA 4BD3A 4NCAA 2RI5A 1X1PA 4CF8A 4M3ZA 3ZSXA 1HQEA 2RHYA 2HNYA 2RJCA 3O3FA 4DQQA 4DQRA 3O8VA 4A4GA 1XHZA 3HP9A 1A5XA 3PNWC 3M8QA 1SL1A 4W5OA 3WNHA 1H3ZA 3DI6A 4NS5A 3HJFA 4B9NA 4IFVA 1HYSA 2JGUA 4CGJA 5E41A 2Q3SA 3HYFA 1TK0A 1U49A 5KH6A 2RN2A 4FW2A 4N41A 3DLKA 2R58A 1XWLA 2Y1JA 3EY1A 3NBPA 4CHNA 1L3TA 2DFEA 5C6SA 1EXQA 3KLIA 2HNDA 1QSLA 4E1MA 2VG6A 3TAFA 5FRNA 1FKPA 5KCOA 1K6YA 4DTPA 2RI2A 5T7BA 1L3UA 5C42A 3OYCA 1U48A 2O4GA 1O1WA 1TK5A 3H08A 3NAEA 4LH4A 3WNEA 2OPPA 4O0JA 4BE2A 4CEFA 1X9SA 1HJRA 1TKDA 2LVMA 1GOCA 4UC4A 3OYKA 3JSMA 5KRTA 3LLRA 2HW3A 2X4YA 1S6PA 4C8KA 4DTSA 4FJ5A 2VG5A 4DTJA 4ELVA 3OJUA 5IAYA 4OGEA 4KO0A 4IUQA 4CGIA 2LCCA 3RMCA 3QO9A 3RWUA 4B9MA 4KREA 4FJLA 4Z4IA 1RILA 2OPRA 3MP1A 3NDKA 1RDDA 4Z4CA 2E6NA 5HBMA 1U4BA 4ZTJA 1ITGA 4B3OA 3MECA 2G8IA 4LH5A 1C0UA 4JS5A 1NK4A 1OI1A 4CERA 2VWKA 4K8ZA 1TKZA 1VRTA 1ZBLA 3HVRA 3HP6A 3DRPA 1RT3A 2HQXA 4BDPA 3FDRA 3QEXA 3NF7A 2WOMA 4DS5A 2BIVA 4FLUA 3O3HA 2D0CA 1WSGA 3F70A 1KFSA 4AHRA 3THVA 4FZXC 3NH1A 4FLTA 2XY8A 1KVCA 2B6AA 2RO0A 1LWEA 1KHCA 1WSIA 4CHQA 4A4HA 3OB9A 2R5AA 4JS4A 2E4LA 4FJJA 1CZBA 1XI1A 3CFPA 1WSEA 4M42A 2HHXA 4W5NA 1QTMA 2EQMA 3SUOA 4CEDA 2JZ2A 4RW8A 3ZSVA 1JL2A 1FK9A 3OYLA 3M8PA 5D6XA 1NK6A 5J26A 4BACA 1NK7A 4GMJB 5IN1A 4FLYA 3DB3A 3E01A 1HMVA 4ELUA 1KVBA 2EKOA 4KI4A 2WACA 2K3YA 3OMGA 4O44A 4CJQA 3TAGA 1A5WA 2GBZA 4H4OA 1LW0A 1KFDA 3NFAA 4DFPA 2O4IA 3LPTA 2EQKA 1T05A 4FJIA 3HPOA 1YTAA 3QERA 4CJVA 5J39A 3KLHA 5KE3A 5D6YA 4ID5A 1T03A 1I39A 3TR8A 3HPHA 3VA3A 3KLFA 4ELTA 4IFYA 4AHCA 1QE1A 4E0DA 4FK4A 2F96A 1YT3A 4KRFA 1VSMA 3KK2A 4FVMA 3PX4A 3QEPA 3LP1A 4KTWA 3QINA 2P5OA 1U45A 1UOCA 3L42A 3P5JA 3P1GA 2KW4A 4DF4A 4Z4EA 5JS1A 3VQ9A 3I0RA 2A1SA 1NJWA 2KTQA 4CEBA 1BISA 3AVJA 4CF1A 2X35A 3OY9A 3M8SA 4FM0A 3OVNA 3OJSA 1CLQA 4CFDA 1NOYA 2O4XA 4M3TA 4CGFA 1U04A 1JLAA 1UA0A 2RHIA 1NJXA 3OS2A 3SPZA 3DM2A 4E7IA 4J2BA 4F4KA 2KFNA 4NYNA 4CCHA 2CKKA 3EAEA 4FJ7A 4IG0A 1KTQA 2RHXA 1D8YA 5I42A 3PO4A 5I3UA 4E3SA 5J1EA 1W9HA 3SYZA 1N5YA 2P51A 3ZSQA 4Z0UA 3AA2A 4BE1A 1WSFA 1VSFA 4RG8A 2E5QA 2R5MA 4FJ8A 1RDCA 3D0PA 2HHSA 3AA5X 3UIQA 3CFOA 3TABA 1RT7A 2X4XA 2OPSA 4DSLA 3D45A 3MEGA 1RTJA 1BHLA 1QSYA 4CJ5A 3OYFA 4KHSA 4CFCA 3KLEA 1WSJA 1W0HA 2VG7A 2G8FA 4EP5A 4CJFA 5SWMA 5DK5A 4F3OA 3M9QA 4FLZA 3SQ4A 4FCYA 1J5OA 4CF9A 3VA0A 1RTIA 3WNGA 3HO1A 2HNZA 4FJKA 4OLBA 4FJHA 5FDLA 4DTOA 2E6LA 1S9GA 2NUBA 3KKSA 3S3OA 1RBSA 3OYIA 3UT1A 2YNIA 1JXBA 1L3SA 1TL3A 4CJTA 2G8WA 1BIUA 4KTQA 1S6QA 1D9FA 2K3XA 4XIUA 5KTQA 3SUNA 4KI6A 3NNQA 3T1AA 1MHNA 1S1WA 4F3TA 4LD0A 2KQ2A 1NJYA 1VSJA 4PY5A 1BI4A 4DS4A 1HYVA 4DTXA 2OZMA 4DG1A 3QETA 3LGFA 1NK0A 4DWIA 3LANA 4Y1CA 4DSIA 2IGIA 3JYTA 5C24A 3VN5A 3S9HA 4L59A 1IKXA 1VSHA 3TWHA 2F8TA 4FLWA 1JLEA 3V9ZA 3L2RA 3C6TA 1UAXA 2HVHA 2VWJA 4JRQA 2EFIA 2DAQA 1WSHA 3L2WA 2I5JA 4EP4A 1B92A 5J2QA 3C6UA 4B8AB 4Q5WA 2RHUA 2M16A 3V9SA 3O4NA 4E7HA 4PLLA 1I3AA 2JLEA 4C8NA 3MEVA 3AV9A 3SCXA 2LTOA 3QIIA 4AHUA 1YVUA 3ASMA 4DU3A 3LALA 2HHTA 1G15A 1VSEA 4N76A 2YKMA 1X9WA 1N6QA 3DYAA 1D9DA 4AHSA 4E89A 4CJWA 3OS1A 3SD4A 3ZSRA 3MEDA 2F8SA 1HYZA 3BDPA 1JL1A
chains in the Genus database with same CATH superfamily
2HMAA 4BL0B 2P9LB 4NL3A 2EW3A 5J1YA 2RPNA 1FYNA 1XQOA 2DPUA 1TNTA 4JYKA 1F9NA 5LJ3g 2DL4A 4MZPA 2QSFX 3PNVA 4PNOA 3JS6A 1OVQA 1WHHA 3RERA 2ETJA 1HOMA 3RKYA 1WI3A 2D0BA 2NOJB 5E1XA 3V7SA 2QKKA 3P7NA 2MWOA 2QWNA 1VQ8A 4O55A 4IJAA 2CYYA 4M77B 2HS5A 1NJIU 2XHBA 4ID1A 3DFGA 4EM0B 2BGCA 1QVFA 3OYNA 3DLLF 1B59A 4HCKA 5EEGA 5CVVA 1A31A 1EQYA 1XC9A 2DEUA 1UAAA 4C30A 1HW1A 4C5GA 2YRVA 1MJ9A 3S16J 2LY1A 4F7UA 4Y17A 3EUKL 3CFRA 1JXSA 1RBVA 3A8LB 4N9HA 5KYUB 4M72A 1CKAA 1KZHA 1C0GA 3FXQA 2R7SA 2VPLA 1GFCA 3VUZA 1HQUA 1SKWA 5GANj 2ASMA 2KLOA 4E9HA 2IGKA 1CZ9A 4ZYEA 4DHYA 2E5ZA 1LWWA 5FLXO 4G7OF 2BTTA 1Y0UA 1V5GA 3SNNA 3I4NJ 2VGNA 3DWLE 1SMTA 2YNGA 1OH5A 5GAEJ 2IPOB 4E70A 1TYQA 3ZQCA 3F10A 1LWCA 3TO7A 4BS9A 4IWVA 3N05A 4IO9L 4F7UE 1BB9A 2VIXA 3AT1B 4M77E 2YUQA 1U8RA 3O80A 4KUIA 4MQ3A 1LQ1A 4KAZA 5L23A 2DIGA 2VXEA 1SQKA 4J9HA 4Q5SF 1NGBA 2IDOA 2LCLA 2CGHA 4RTXA 4HXJA 2OZSA 2VBXA 3CQ8A 5A0DA 4O0IA 1VQ6T 4OKKA 1C1BA 2COZA 1NM1A 2DMPA 3LQQA 1NMNA 1R9TJ 4MZTA 2E88A 4Z4FA 1JCGA 4ZC3A 4C5EA 2K86A 1QQJA 4IDKA 4WF9L 3B02A 4LLLA 1FPQA 1VQ7Q 1KQSA 4M41A 1IHVA 3OOUA 4OKEA 4BGDA 3TTCA 1UJ8A 1TL1A 1VQNI 3JRCA 1JXMA 4ORZA 2GGRA 3K0SA 1JT0A 3CXCA 1YI2N 3JCMQ 5GMKe 2DU9A 5DM7R 4G1QA 3VERA 4CVNE 3AO4A 3AVHA 3CETA 1N5ZA 3DXMA 2W04A 3N5BB 4CC7A 1WLPB 4JK8A 5FLXK 1YI2A 3ZYYX 2UUBK 2CW8A 2J6OA 2KHOA 5TISC 2DT5A 1TAUA 4XRFA 1LW2A 1VSLA 1E6GA 3JXUA 3QYEA 3M58A 1RCHA 2AHQA 1YWOA 2VASA 4CIFA 1BOAA 2HTSA 2KISA 3WODF 1YJ9T 4CF0A 4JI2K 4M4ZA 2QBYA 3ZSWA 5E8IA 3RPUD 3FK7A 3RMAA 5LRRA 2OTJQ 4BRCA 1ZGAA 4DIQA 1XQHA 2BVLA 1CXUA 4RTVA 5KVRA 5HL7L 1Z1DA 4DR2K 5J8FA 5JMVA 4B9SA 3OMCA 2X78A 1KQ0A 4A3IJ 1VIFA 3IRXA 4CJKA 4OVAA 4XM3A 1DGRM 2ED0A 3V1QA 1FYMA 1YCSB 5MLCQ 5FKLA 1GLFO 2XGCA 3JCMX 3JRFA 4NQWB 2YUSA 3B6CA 3LFKA 2K3BA 2R57A 3R6OA 2LT4A 3PX0A 2EVRA 4UQGA 3BROA 2IEKA 1PVEA 1TG0A 3TSZA 4Q5VA 3CC4N 3G6EQ 3HFNA 2O01E 2L3SA 2GNCA 2FVUA 2WC9A 4K0KK 2HHVA 2W25A 2NVYJ 2P0PA 3NVKA 3CC4A 2RV8A 4QKUA 2DERA 3WTXC 4CK3A 3EYYA 3IWZA 1VQ4N 4XLHA 4CJSA 1S9HA 1DTQA 3CO7C 3F0ZA 3HFOA 3SQ1A 2BHZA 4G94A 1HF0A 4LE9A 3KE2A 1VQ4A 2KAFA 1HUXA 1OEBA 4H5NA 1X1BA 3EFSA 2EFNA 4JJDA 3BEXA 4DV0K 2ECZA 4BR4A 2E41A 4DV7K 1W4SA 3TMOA 4JKGB 5ELZA 4YFUA 3DLMA 3WXLA 4HX4A 2MG4A 1QVTA 4CC4B 2F1LA 1VUBA 3MZYA 1QO0D 2GA1A 3A01A 4A5NA 4E9EA 1REPC 4JX6A 3CLOA 1LPLA 4R5PA 4CHYA 4RTTA 3IH2A 3BTJA 3ZMDA 2HHUA 3TAEA 3EZ5A 4FJGA 4M75F 1R0CB 2HDDA 2WUSA 4L5EA 4U0WA 5AQVA 3M8RA 1VQ8T 3L00A 3EHQA 1UECA 2VUBA 1FEXA 1Q9YA 3QU6A 5IY5H 2DETA 1WBBA 2WV0A 3WHCA 2ZC2A 4XQ3A 1SFKA 3ZQIA 4GLMA 3X20B 1E3PA 1UUEA 1YJNN 2QWQA 2E6MA 4RGSA 2F4MB 2JA5J 4F2SA 3LYIA 3P8HA 4KN7X 1IC8A 3ZCMA 2O8DB 1RRJA 2WWYA 1JLCA 3TEEA 5GAN2 1KO9A 4KITB 2CH4W 2BE5F 3ZT0A 4M3XA 2PVGB 3MKLA 3CCYA 2V9VA 2GWRA 1R0AA 3UF4A 4RM2A 2XDPA 3P83D 2LVSA 2JOYA 2VV5A 1O3RA 1ZBFA 1SF9A 1ORNA 2K40A 2LZ6B 1DU6A 4FYDA 4N56A 3L2QA 2CV1A 1BJZA 3ZEHA 2RKIA 2A37A 4K43A 4RDUA 2CUBA 2M4GA 3T0YA 4EHTA 2QM3A 2ELHA 3D1NI 1NG7A 3CZ6A 2HL3A 1KAYA 2OV7A 4BGAA 2FC0A 3VOEA 5H6RA 3DV8A 4YY3K 4JKDA 3VQBA 1RLPC 2E36A 2RQPA 3LX7A 2DO7A 2WC2A 1T39A 2QK9A 2PJPA 1C1AA 4CXFA 4DZPA 3OS0A 2OCCH 3EUHA 1XMOK 4HHTA 2KL4A 2FBVA 1O3QA 2KIFA 3VEYA 1RESA 2P0KA 3ABTA 5ICEA 4YHHK 3CO6C 5GAHP 3LP2A 5KHDA 4O6JA 4Q47A 2O7OA 3MMVA 1EFNA 5BS6A 1PVSA 3P31A 3IDHA 2XPWA 3G2BA 4A3BJ 1FY7A 4CZJA 1YI2T 2R7DA 4GY5A 2ACJA 4NLCA 2P1JA 3JW4A 4II1A 2VB6A 4FHTA 4QVZA 2R7RA 2FBHA 2JK3A 3CJRB 4D0PA 2G8VA 1LWYA 2FOKA 2Y4YA 4BJ6C 3AARA 1RDWX 4N4HA 5BR9A 1XG7A 3R61A 1IRGA 4A3JJ 3FZHA 3HL8A 3BQZA 2K7LA 1XMKA 3DLGA 1OU9A 5AZJA 5F27A 1RNLA 4XK8E 4EV0A 4OPHA 1FSEA 1BC7C 1ZBSA 2EQJA 2E71A 1PKSA 1KG1A 4YOVA 1DKGD 3ZL7C 1WJ5A 2E1CA 1M3QA 1U3OA 3H5NA 1Z0XA 1BR2A 3U6FA 2DA9A 2JN6A 4XN0A 1SRLA 3QP6A 4FLXA 4E19A 1GLLO 3I59A 2J05A 3PVLA 2RN8A 4HVJA 4ZDOA 2ITGA 2FJ1A 4BR0A 2G6FX 1WFXA 1U78A 1NG2A 5AQLA 3TKYA 1NLVA 3TSWA 4KH4A 4XH4A 4C0GA 1GOBA 4Y91A 3T3FA 1NPRA 4NO7A 2TRTA 2EA4A 4O8KA 2A6AA 2L7FP 1SD7A 2KEAA 4WE1A 1USSA 2I5WA 4OAYA 1AOJA 3CC4T 3WTTC 3SWNC 4XH5A 3CCRI 4AIKA 2XICA 4QQ6A 1WHGA 3LWIA 1U84A 1I8FA 3QLHA 3HYIA 4ME7A 1BL3A 3VOVA 1R23A 3F23A 1PP7U 1Y56A 3TL4X 1PM3A 1MH3A 1RNHA 1VQ4T 1MJAA 3VSKA 1X4PA 4IHTA 2HYFA 4HA8A 2W4SA 4XKCA 2M02A 3O4QA 4Y13A 2HAXA 2ATQA 3H36A 1C0FA 2XG8D 2J4RA 2RVCA 1XPXA 3J80K 3VTIA 4KB0A 4FW1A 3M0TA 3I55A 2BANA 2KYBA 3AVCA 4FISA 1LB2A 4CZHA 3GO5A 3CBOA 4GYIA 4FLVA 2HI3A 4J9GA 5BRHA 3SAGA 1VQ9N 3MX2A 1DGWY 3JTHA 3GNFB 2QEXN 4BRIA 2YWWA 2XSJC 4HNVA 1S1VA 4M63C 1VQ9A 2X0LA 4DSEA 1UHCA 2QEXA 1KQ2A 3CD6Q 3LAKA 5D4RA 3FK6A 4C9YA 5ED4A 1T44A 4PJLA 2KRSA 5L3GA 3URGA 1JJ2A 2D1HA 3DLBA 2DF6A 1WJQA 1L5UA 3AVNA 4ZYGA 2CH0A 4J6XA 2IAJA 4S05A 1FOYA 3CMEN 4A2AA 4F17A 3R6MA 3SDBA 4B24A 2QQBA 1EH7A 3EGDA 3MEAA 1GXPA 2RM4A 2V7ZA 5DM7L 1IH7A 3M1CA 5LJ5d 4ELYC 4ESRA 2GELA 3R0AA 1OX8A 4LK0F 5HLFA 2K02A 1WX6A 2R5YA 2P9UA 2LLKA 1WQWA 2E1YA 3VPZA 1IB8A 3MAQA 1IO6A 3G71N 3FZLA 3MO8A 4L0ZB 1M3CA 1T3SA 3KZBA 3LWFA 4DSJA 5DLQE 2L8DA 3DOLA 3G71A 4MNUA 2P9PA 1Y97A 1DJ7B 1KVAA 1WJFA 1WHKA 4U67L 2BEOA 3M1FA 3ZT3A 2A5WA 2LTPA 4A3FJ 2UXDK 1OCRH 2L02A 1D8JA 1TWFJ 4DSFA 4A3DJ 2HPMA 4EMKC 4ZTFA 1AZEA 2HQEA 3W3DA 3MEWA 4TVRA 3DLRA 3BTLA 1WQ7A 5FWCA 2HMIA 1JUSA 3BP8A 5I22A 2FUG2 4BRMA 1SV5A 1I6HJ 4F7ZA 4BQNA 4OFHA 1QRYA 5HLHA 1EZZB 1LE8B 1SRMA 2QQ9A 5JS2A 2QXFA 2HVSA 5CKDA 3QWLA 4WQ5A 2YHBA 5CKHA 1UGPB 1PRMC 2VCPA 4B1RA 3VYTB 5KQDA 1IBMK 3CCQI 2EFOA 1F21A 3EYZA 5HKCA 3GLXA 3A02A 4PFZA 4QW2A 2PLYA 3JB9D 1JUPA 1HKGA 2OAZA 4A53A 2OYQA 2L89A 1D5AA 4ZYDA 1D5VA 3MCAB 1MU2A 3GF5A 4KJZA 3HDDA 3F8BA 3PIOF 3HKSA 3CCMI 1B7TA 5BPIA 1RT1A 1R7JA 5ILVA 4XRSG 1UCRA 3TQNA 2BY0A 5IYDJ 4BDYA 1HSQA 2GXGA 3B6PA 2NRHA 4WXCA 3EG9B 2KDSA 3KK1A 5GMKh 1ZA2B 4CFAA 1X01A 1X4OA 4II2A 1RDBA 4LFAK 1HDPA 4Y92A 2A69F 1S5JA 3TGNA 1OH7A 1I94K 4H0YB 1VOMA 3TP0A 3VESA 3TREA 1VQ7N 1WXTA 1IKVA 2JMAA 3VQPA 5E20A 3MN2A 4DB3A 2DK8A 5C10A 1YBYA 2QWWA 3REOA 4KUMA 4A0XA 1X9JA 4N4GA 1VQ7A 4I9LA 3TOBA 3VV0A 5ILUA 2W57A 3JAMK 1GXQA 4AIJA 4XTXA 4B09A 1TKXA 3I0SA 4K8XA 3CCJQ 3CCEQ 1JXEA 3QSUA 4OKJA 1WEIA 3DCFA 2M0MA 3C95A 2ZJQF 2JZYA 3ULRB 3THWB 2C6YA 1ZARA 4F9OA 3GXOA 3K0LA 5KGXA 1Z05A 4FL9A 1PUFB 4F16A 3T69A 3GTMJ 1F5TA 1GXIE 2OTJN 1KA8A 3NWSA 2PQWA 3CC2Q 5HRPA 3S1QJ 2I5UA 1R6RA 2IP2A 5CHZA 2V4JC 3L8BA 4XR6A 4DBQA 1RZ4A 1J59A 4IDHA 1OYWA 1WHMA 3EYIA 4ZYAA 1MMSA 1R5HA 1VZ0A 4Z4HA 1HX1A 2X1EA 4BXUA 2LDMA 4FK2A 4LN2A 3FFKB 2Z16A 1RUWA 1DPUA 1KSPA 3VQ7A 3H9NA 1U5TA 2L7ZA 4CSWA 1KHIA 4DTMA 5HRNA 3RCOA 5M5XJ 4KFCA 2P4TA 2FEZA 2X85A 4M78C 1TW2A 4LG0A 1BBZA 2I2LA 3DEWA 3H0GJ 3I55T 2ZJRF 1KLNA 5ERIA 3IAYA 3SV4A 3TANA 4UHTA 2IA0A 2E7WA 4IL6C 3PO5A 3KX2A 1TKTA 3CI5A 1QCOA 3ZSYA 3VB2A 2NYSA 5K7FA 5KN8A 4BREA 1MUYA 5IYBJ 2IA2A 2W6KA 3GTJJ 5KPRA 3H41A 1SAXA 1EETA 1BJAA 4M78G 1UTIA 1OLTA 4V2SA 4Z4GA 2KZMA 1N36K 1C0MA 2DL8A 1VQ9T 2ZNYA 4PKIA 2B8AA 2QEXT 2ZXIA 2YR2A 3VQCA 5EDNA 4P5NA 4BD3A 3OW2P 1B4AA 3K70D 4CF8A 3HBLA 4PFOA 2MGQA 4DV1K 1Y39A 3BG7A 2XAGA 3M59A 4ESJA 4PJMA 4FM4B 4ESFA 2P81A 3O3FA 3TO6A 3VEPA 1S72I 2HKOA 3K6GA 3REBB 3TW7A 3G4SN 3CJ1A 1LDJA 3N4QA 4KHPK 1D0ZA 3M4GA 3NEUA 1SL1A 3G4SA 2ENMA 4L9JA 1ON2A 3ZXSA 3WNHA 3DI6A 4MFEA 4JAXA 4NS5A 2FBIA 4M7DC 3KZIC 3ZGKA 3HOZJ 5AQFA 1HYSA 3FIWA 1K8AU 2JGUA 3G71T 5L3FA 2YLBA 1TK0A 2CQ7A 2FPEA 1U49A 1ZSGA 1EH6A 3BC8A 4RGXA 3BJOA 1R36A 2B86A 4B3RK 4CHNA 4M7DG 1L3TA 3H3VK 4PJOF 5AYFA 2JWTA 3OL4A 2E2OA 1WVRA 1TT0A 1YRNB 3TAFA 2OA4A 5FRNA 4P96A 1UB9A 2XKOA 4MLOA 4YIFA 3EE9A 2MK5A 5T7BA 1KONA 5JLFA 4LIUA 1L3UA 2N8GA 4IHWA 2OFIA 1VQKQ 1XDUA 3X28B 3H9JA 5E3OA 3NAEA 3ISPA 4G6TB 5CVRA 1O4XA 3D2FB 4EJTA 2OPPA 4O0JA 2QYOA 1SPKA 5GMKi 3GZ5A 1X9SA 2DL7A 3JSMA 5CQXA 1OCOH 3CCLQ 1EWQA 2HW3A 5F0XA 1GVDA 2IBDA 2LQKA 1VHXA 3JSOA 3KWGA 4ELVA 4MDXA 3OJUA 3F21A 4OGEA 5BR8K 4XSXF 4IUQA 3EG0A 2LCCA 1H9TA 1KD1U 3RMCA 1T0FC 4PFPA 3QO9A 5FD6A 2COMA 4Z4IA 3ABUA 4JI1K 4IEEA 1XUPO 1RDDA 2PUOB 2ZPHB 3MECA 2G8IA 1U9NA 2YX7A 3SWNB 3AAPA 4CERA 2BY3A 4BG9A 2PTKA 4BC2A 3L9FA 3EDPA 3OW2M 3O5BA 3DRPA 4H0PA 4BDPA 2ZFWA 2NUPB 2FNPA 4JK7A 1WUAA 1YG2A 5KYUA 4QVDA 2XHKA 1Q81R 2D0CA 3J80E 3ZR8X 1N8RR 1Z7LA 1H8KA 4AHRA 2YG9A 1T98A 5LLQA 2B0LA 3O6BB 3G1MA 4B1YB 1ON1A 2E2NA 4CHQA 3THYA 3A8HB 2XAHA 1VQ7T 1G59A 4A4HA 3EO3A 1VNDA 4B3MK 3FJPA 1BWFO 4XLFA 3RVCA 1Q81C 3CWUA 3WTUC 5GANf 1SAZA 2FF6A 3JR9A 1N8RC 4M42A 2JM9A 3VETA 1XC5A 1LOTB 2EQMA 5JR3A 1UMQA 4XLEA 4F04B 2ELJA 1GRIA 1CSKA 1VQPQ 4HG2A 2MLGA 1M2OA 5HS9A 5LJWA 3CCSN 1ZGJA 2XKPA 1Z6RA 3FIFA 3BCBA 2YU9J 1NE8A 5D6XA 1NK6A 4CYDA 3CCSA 1HW2A 1K9MU 3EHRA 3IWFA 1G2HA 4PZJA 4Q48A 2WSEE 1NK7A 3CJ7A 3W0LA 3EKSA 3MKDA 2ZJ2A 3Q3SA 1ZUYA 3IQLA 3BG3A 3J7AP 4M7AE 1HMVA 2KSSA 1ZX6A 2I7NA 2I7PA 5J3LA 1M2VA 1W97L 4EM2A 2LY2A 4CJQA 3TAGA 2GBZA 4JI6K 3J7ZI 4M9ZA 2DEQA 4CI0C 1SS6A 4YEJA 1YQLA 5BN8A 4B3TK 2Y0MA 3FXLA 2KGTA 2EQKA 1TUDA 3VKIA 5CCAA 3DAWA 3IKMA 2VVKA 1ZG1A 1ORPA 3VEOA 5D4SA 1OOTA 4ZH4F 5JVTA 3H1CA 3QERA 4FSVA 2WTUA 5J39A 1IXCA 2RAEA 2OF7A 4LF8K 2X51A 3MVPA 2DMNA 5D6YA 1T03A 1NLPC 5AZIA 1MV3A 3QDFA 1G99A 1XX5A 3HPHA 1W5TA 3VA3A 3JREA 3KLFA 3TP3A 2QWMA 2OZUA 4ELTA 4D9JA 3FMSA 5GIOA 1YT3A 2Y0SN 1I1JA 4V2GA 2FRHA 3KK2A 4ATOA 4KTWA 3BG6A 3FM3A 4UUVA 4X6AJ 1V29B 4JKBA 2WSFE 1UOCA 1IRFA 1XMQK 2K5CA 3P5JA 2E35A 1TLHB 1FYKA 1PSFA 2ASPA 1WFWA 3VS0A 3KBGA 1JXOA 3ZETB 5GAEP 3G4ST 2EZIA 1VQOQ 1WGXA 2CYZB 5C4XJ 4XN3A 2GOXB 3AVJA 4N0BA 3KNTA 3FKJA 4CYCB 5F6FA 2XU8A 4FM0A 4LB6B 5AR0A 5E3NA 1NOYA 4B48A 4B21A 1UFFA 5DCMA 5FLXZ 4X66K 1U04A 1YIJQ 3E5UA 3E66A 1UA0A 3WVEB 3DBRB 3OS2A 1UEBA 2JT4A 1B72B 3MJXA 3DM2A 2QXLA 1G3YA 4AC0A 2LY9A 3RDVA 3R9PA 3JRZA 4NYNA 2CKKA 4FJ7A 4IG0A 2A7YA 1ETWA 4J19A 1CZAN 4QS8A 2MIOA 1RC9A 5C12A 2P9KA 3X26B 1SANA 1YQAA 1H1VA 2NRTA 3WXKA 3PLAA 4E3SA 2QWOA 2B63J 2J06A 1RFQA 2XPVA 2V75A 3GF2A 2QTXA 2DKGA 2CRGA 3JAME 4BE1A 2DYRH 2P84A 2P9IA 3SJHA 2CJJA 1WJDA 2FOWA 2JPSA 2F4OB 2MD5A 1YJWQ 3D0PA 1QZZA 1IAWA 3QHSA 3CFOA 3PIPA 3I5SA 2RK1A 2OPSA 2ZPIB 3WXMB 4DSLA 1N78A 3MEGA 1N3AA 4FYYB 3OYFA 4KHSA 1VQ6I 5IP7J 1QWEA 2V1QA 5LY3A 1IV6A 4E6KG 2D0QB 2E2QA 4C23A 1QVGP 2ECCA 3VEZA 1UHWA 3EG2A 1TZLA 3M9QA 4C8QB 2XIDA 2LKPA 4A2UA 1J5OA 1GUUA 5IOYA 1RTIA 1BO5O 3KLOA 3GTLJ 3SDGA 5EZHA 4FJKA 2HZDA 4OLBA 1WZOA 3RUXA 3Q0WA 3PTAA 4DTOA 3MCZA 2E6LA 1S9GA 2OAUA 3OWTA 3RSEA 3KKSA 5E8GA 1XCVA 3DF8A 2D8JA 3UT1A 1X1AA 4M78B 1JXBA 1YS6A 1L3SA 2H8WA 1YJ9I 3EETA 5LHHA 4DQ8A 2DTOA 3MKWB 1D9FA 1KAZA 1YN8A 5KTQA 1OFCX 3C2HA 4XK4A 2CP7A 3T1AA 5J47A 1D4XA 3WHBA 1X6BA 4LD0A 5EX5A 2KQ2A 1NJYA 2PMZA 1BI4A 4DS4A 2E1NA 3T5XA 4FT8A 3LGFA 1I81A 1G8XA 3WQTA 2J6FA 3LANA 2VXDA 3S15J 2AZVA 3VN5A 3VS1A 2ZGWA 2CZ6B 2AA4A 3TSQA 2RK2A 1P7JA 1U9OA 4C8QE 3CCST 1M90R 3I71A 1JLEA 3L2RA 3PQKA 3Q0VA 1UGQB 2OFKA 4JPBW 2EFIA 2CV2A 5IYCJ 1VQ5N 1KC8O 3L2WA 2I5JA 2LMDA 1B92A 4ANJA 4YTLA 5J2QA 2QW9A 4M7XA 2P9NB 1JB0E 4Q5WA 2A5XA 3QBWA 3ULEB 1Z21A 3CCJN 1VQ5A 3CCEN 1I3AA 4BG8A 1M90C 4M7DB 1BK2A 2CZ7B 1ETXA 4M78E 1IGUA 4AHUA 1YVUA 2K9GA 1M90O 5LJ5e 4YFXF 1YFHA 1G15A 4N76A 2EPFA 1E3MA 1N6QA 1D1BA 5CVIA 1M27C 1T2KA 3CC2N 4CJWA 2KIQA 4A5AA 1R77A 2DYSH 1PG5B 3SD4A 4MQVA 3VEWA 1KEAA 1VQNQ 4NC8A 3BUZB 1QVGM 1HNXK 1YFNA 3JCMW 1U2VB 3BDPA 4L9VA 5KPZA 1R58A 4DQ2A 3E97A 1YITQ 3HG9A 4BBRJ 3R1XA 2H6BA 4DMNA 1Y0NA 3CC7A 5CQEA 5LMNK 3RMBA 1GCQA 4NCGA 1HKCA 1QS4A 1WIEA 2CO5A 1ZK8A 3KD1E 2L9SA 4RAZA 1XN7A 2GIZA 3RKWA 5JVGF 2E2HJ 4IIOA 1BOBA 3RRGA 4BWMA 1VQ8I 3K2PA 3BFMA 4UV8A 2QTVA 5H2FC 3QYBA 4NYFA 4RLQA 2ZSIB 4NC6A 3HVTA 3ROUA 4HKEA 1J7KA 3FZVA 2HQ5A 3C7NB 4LF9K 3BWGA 2EPDA 2DYIA 2ZM6K 3PNYA 3F0CA 4HVVA 3C6AA 3L7WA 3ELKA 3BG5A 5D5XB 1OV3A 4QQGA 2KHMA 4E2FB 2M3AA 4EGZA 3V9UA 4NL2A 3KIOA 2GTJA 4CEZA 3OA6A 4L0YB 4KIGA 4LDYA 1IV8A 2IXSA 1KG6A 2H3GX 2X1CA 3LGLA 4FIBA 2RJDA 3A0BC 2LRDA 5I11A 2GTDA 4DCHA 1G4DA 1IKWA 3NGZA 2ATCB 3LWMA 2GV9A 1WQ2A 2O5RA 1VSIA 2JUFA 3AO2A 3HM9A 2E2PA 3OTOK 1XMAA 1APLC 3QEIA 3MPUB 1B9NA 3QU3A 1ZUKA 3MMYB 2ETHA 1PNJA 2NOGA 1OPKA 2CUFA 3DLLA 5AFUA 1QLYA 3HIFA 2DY4A 3EG1A 2CSIA 4CGDA 3KTUA 4YFNF 4OF1A 3V9XA 2DA1A 1S3XA 2LP0A 4ZJZA 2PUKB 1VK0A 4CH7A 2KI7A 2W41A 2KP6A 2YV0X 4ILHA 2NS0A 4DSKA 3O8HA 3M6GA 2K9MA 3SBGA 4OPAA 3N4MA 4DQPA 3V9WA 2BZXA 4HUGA 1UJYA 5JVHL 2Z1IA 3GPLA 2O3FA 3PMIA 2ZMEC 3VS4A 2QAZA 4RTZA 1HNIA 2Q2EB 3SUQA 4IVNA 2DA6A 1MA9B 4JX5A 2XGDA 4B9VA 4O4GA 3E5QA 3SPYA 4J6WA 3AVAA 3VQEA 3EGUA 1SSFA 2IS3A 4XLAA 3V8JA 3M55A 2LKSA 1YI2I 2AK5A 4OMNA 4IUUA 3CCLN 2ZBKA 3BZ6A 1S1UA 4H03B 4H0OA 4FX4A 3ATVA 2VE8A 3U1DA 5FROA 2FSNA 2P7CB 1Y1WJ 1KU2A 2Y31A 3N97A 2A28A 2B4JA 4N9IA 2DRMA 4IOAL 1ZRCA 1GLDG 3J80Z 1BU1A 3C1DA 1NK3P 3K57A 5E79C 5CAIA 4RCHA 1W0UA 2JUGA 4PQUA 2HPIA 3M7GA 3F6OA 4KUDK 1ODDA 4QCLA 1L3LA 2XC7A 4O3MA 4HV5A 1REVA 1HD3A 2BDPA 3HSTB 5F08A 1MMDA 2DA7A 1JT6A 3ERED 4C3JJ 3LDOA 2BBYA 5DM6F 1Z7UA 1K79A 1QKWA 4Q0BA 3LDLA 2E60A 3FEOA 4DV4K 3ZQHA 4JJBA 2Y1IA 1BC8C 2CH6A 2V8IA 3RR7A 2G9WA 1TWGJ 3CYMA 3LZIA 2XB0X 4ITVA 2KIUA 1X69A 5LBQA 4JQFA 4HX7A 5IHNA 4OIQF 3PSIA 4A6EA 2PJRB 1NGAA 3E5XA 1JQQA 3K10A 2V1DA 3EH2A 4J9IA 1YS7A 2FQ4A 3LA3A 3ASOH 2VUMJ 3GP8A 4N0AA 3CC4I 2NRVA 3GNGA 4E9GA 1Q82R 2G8UA 4PA1A 2GAUA 1VQ5T 1RR7A 2Y30A 3WG9A 3SXYA 4AFSC 3IMXA 4I7HA 1NNEA 2O31A 3TQ7P 1VQPN 5FLMJ 5C44J 5CHIA 1VQ4I 2FQ3A 4E1JA 3ZOBA 2YHWA 1FOKA 4CGHA 4NOYA 2PY5A 1Q82C 2O8EA 5IT9O 1ABQA 4GVEA 2ZF5O 3VRZA 2QWLA 4C0ZA 3CCUN 3CJNA 1NU0A 1ZBHA 3JV3A 1QQCA 4H8KA 3JCUC 2ZGZA 1JEGA 4CIEA 1SHFA 2YXYA 4KMFA 1Z9QA 4VUBA 3CCUA 4CFBA 5AQMA 2D0AA 4I01A 2PBIA 2DOAA 4LY7A 1FMVA 1RTHA 4DR7K 1JJ6C 3MP6A 2VKHA 5FFXA 2CZ0B 1R59O 2VKVA 2VBYA 1MD0A 1YHQQ 1BIBA 3S1RJ 3CC7T 2IVMA 4C2TA 9ATCB 3VGKA 2ZCFB 2PMUA 4NZGA 7AT1B 2ICWG 3ZQQA 5GAOl 2I8DA 4C0DB 4L5JA 1LMZA 5I2MA 3KLNA 2KBTA 2ZQBA 3THWA 4FJXA 3W2AA 3OBWA 1MV0B 2HHQA 1XQPA 2WSCE 1FXXA 2M34A 4B9TA 4EW0A 2MBFA 2MD0A 3FHZA 3MXJA 4JD2B 1IXRC 5IT9K 2DI3A 1XC3A 1YIOA 2OJED 2P8TA 5IP6A 1AKHB 1U47A 4DF8A 1T3VA 2X4HA 1IXSB 2XAFA 4L5GA 3A1YA 2AHJB 2CUEA 4LDUA 4QAGA 2H6CA 3M5RA 3LL3A 2O03A 1M1FA 1EX4A 3JB9I 3D2EB 3K5NA 4XNFA 3IS9A 2ZXHA 1BCOA 1A5VA 4M75A 2QYZA 5C4JJ 2ZZDA 5CKTA 4C8MA 4F93B 3KJVA 5GAMf 1JE8A 3H92A 5CVUA 3HB9A 5IOZA 1VQON 2IS1A 2F5KA 4LLGF 1SHGA 3CCVA 2J6KA 4HTLA 3BJAA 1XSXA 4IRIA 4B9XA 1X2MA 4QOZB 4WWCA 1O9SA 3LP3A 4AH9A 4HF0A 1SFXA 3TBIA 2Z1JA 2LC4A 4BROA 3JAMZ 1NKEA 1T6CA 2ZE2A 5KYWB 2G7HA 1YIJN 1HNVA 2EFWA 3IG1A 2DFUA 1R49A 4GYGA 5DV5A 1BW5A 1S5LC 5DS9A 2FBYA 3BY5A 5M1KA 2HKXA 1YIJA 1FKOA 2MMPA 2EFQA 3NWTA 4ZNXA 1FYLA 2O9VA 3TAPA 1SFUA 4MIMA 3F2KA 1ZLKA 3S8PA 4S04A 3C18A 3JRGA 1RPWA 1BUPA 1UGVA 1S7AA 4E7JA 1D3BA 1GBRA 4N4IA 2RPIA 1B8IB 1WCMJ 4RB2C 3MAJA 5EG2A 2WY7Q 4ZN1A 1YJWN 1DPRA 1S9EA 3ZSZA 3PT9A 4KHQA 5M1FA 1YJWA 4OB2B 4UVBA 4M3EA 3I33A 4FXDA 1O3SA 4BY9C 4EEFG 4HT9A 3ZT4A 4I98B 3I9V2 1NEBA 3SYTA 5AQYA 4A3LJ 2F2XA 3TDUC 4F8RA 2R93J 4LK1F 2DRKA 4BGBA 3OH9A 5B3SH 5GMKl 3NF6A 3RJPA 3VQ4A 1VRLA 4M77F 2FL7A 3R6NA 1ZBIA 1ENHA 4CRIA 8ATCB 2AKKA 2CGLA 1IG8A 4BY6C 2EBPA 1VSKA 2V9PA 2CW7A 4LD6A 3G73A 3AA4A 5KGWA 2GQVA 2PQ8A 3JCMd 1IREB 5AQZA 4CCKA 2RHZA 3NVMA 5K7HA 3DU5A 2R7YA 3BPVA 2K4YA 3D2FA 4GW6A 2LBFB 4IBNA 4RG2A 2O8KA 3OV8A 3ASKA 2E64A 1JLFA 2P4WA 4HLYA 2LQWA 2HCKA 4BB7A 2K2MA 2CG4A 3ZT1A 2VQGA 4H5RA 2IGNA 4CJUA 5C25A 1BR4A 2HR3A 3AVGA 5HNFA 4FWNA 4F7UG 4XONA 4B1VA 2IA1A 4C92E 2EYZA 3R4KA 5AQNA 4BVOA 2ZO4A 2YI1A 2JVHA 1JLQA 4DZJA 1NGJA 2GEMA 4QS7A 2E12A 4AWXB 2NUTA 3OIOA 3CCQQ 4NXMK 2L3DA 4EJUA 1SC7A 5LJ5h 5LFAA 3I55I 2HU9A 2UUCK 5DPKA 2NUPA 2UXBK 3CCUT 1OQKA 3CCMQ 2PZSA 2KZGA 3CDIA 4X1VA 2Q97A 1ASWA 4EAHD 5DMRA 2KK4A 5L3DA 3CBMA 2PBDA 1JGGA 5AIQA 4J2EA 1VQ9I 1LDDA 2DD4A 2PN6A 1P4AA 1A5JA 3VYHB 2P5KA 3C12A 1AWWA 2F2VA 1ESVA 5HS8A 3VYRB 3WTSC 2KFZA 1PRLC 2Y69H 5CZ1A 1DU0A 3G0ZA 3I5UA 2RE2A 3THXA 4EQQA 2VONA 4IO9F 2YHAA 2HKQB 4WTOB 1NEGA 1XQSC 2E1HA 4DR4K 4CEAA 1FBSA 2GA2A 4HSRA 4RM3A 6AT1B 3QYHB 3O9QA 2IG0A 2L3RA 2RN7A 1X3NA 2E3HA 5BREA 2NVTJ 4M6YA 1YF5L 3FXUA 8AT1B 3NHNA 2EQUA 1N6AA 3AVKA 5C0YA 1YITN 1TTYA 1ZYQA 2ZMEB 3QEVA 3H9GA 1FBQA 1LAVA 1OZ3A 3OSVA 4CJ3A 1NKUA 3OYDA 1YX5A 1VF9A 1YITA 2BXYA 1NOZA 4G12A 2DMQA 1W4MA 3G71I 1N33K 2OPQA 3S6WA 5FJ8J 3SBTA 5KPTA 4M3WA 3WNFA 4W97A 3CPWP 1BG3A 2QENA 5GANg 4CI6A 1CGPA 2NOLA 1G6NA 3V1RA 3V1OA 1ZAOA 5GP9A 2HDCA 1Y96B 4V19S 1BIZA 3NCIA 3UKRA 3CCVT 2NRWA 4WXHA 3HUGB 2CH4A 3NAUA 4UVAA 2DBKA 2FPFA 1WAFA 2EQRA 3LSRA 2ESWA 3HHGA 1YLFA 2FXUA 1CF7A 4HNUA 3KKRA 3KTQA 1TWCJ 2UYTA 4IURA 3HHHA 2HNHA 1WLJA 4DR5K 1I27A 4BR5A 5AQQA 1GDTA 4EMKA 3GX4X 1P6RA 4ZZLA 3NE6A 3FXJA 4KDPA 4DK9A 3DPUA 4CE9A 2AXTC 3VF4A 3CF5L 1J2XA 1ZXOA 2AIRB 2XK0A 4IX7A 4XTYA 3HSFA 4GLKA 5J4VA 4Y52J 1YIJT 2EWSA 3P9IA 3TAQA 4N5SA 4FOIA 3ID8A 4DBRA 1XTAA 2FBXA 3ZMTA 2VC8A 3GTGJ 1XOVA 4BJ5C 3E9FA 3VRYA 4YPRA 5CKBA 2HD0A 4M75D 1WRJA 2LSOA 3LSGA 1B9DA 2M9HA 2RC4A 3OYEA 3L3UA 1K4US 3PE0A 1RAFB 2VGMA 3KZYA 5JI6A 2A68F 4BBSJ 2QQRA 2XHIA 2A6HF 4D5FA 4E1NA 3BR0A 1NYGA 3LNQA 1WI9A 4HCBA 3C94A 2STWA 2RQQA 1W70A 3LSHA 4B1WB 4AT1B 4CZKA 4HVWA 4F52A 2HOEA 5KK1A 3I0TA 3L2UA 2FZCB 2OI3A 1YJWT 1ZUUA 1S72Q 2NRAC 4KULA 2HHWA 1KFZA 1BQNA 2YJEA 1FBUA 1Q86R 2Y90A 2D2WA 3QZ5B 1ZLMA 4GV3A 4KMUX 1ABOA 1VQ7I 3K2AA 3U9DA 1RT6A 5A2QK 2IRFG 2DA3A 2R7UA 4DV3K 5I2SA 1DEJA 2DPDA 3PIOA 4CO8A 1W2BP 1B6AA 5GINA 2UUZA 3RTVA 3SZTA 1Q86C 1GLJO 3ZQ7A 3ALYA 4OVLA 2YNFA 3CJBA 4R0KA 2ISYA 2GCXA 4DR3K 1K83J 2W48A 3JB9J 1BL0A 3UKUB 3M8FA 4XTWA 2P5VA 4P1WA 3T19A 3CPWM 1JHFA 3R6SA 4RTUA 3QP5A 3TO9A 3MWMA 4PWDA 2XROA 1JBMA 3G0QA 1AHJB 3JRIA 5GAOp 4N4NB 3CEYA 2KDZA 3GLLA 1NJIR 1WJSA 1T33A 3AL0C 3OW2S 1Z3XA 5AQOA 3HBTA 1I1SA 5F0CA 4C2MJ 4JK1X 5CKEA 5HLIA 3OYMA 1J53A 4BH9A 4JOMA 2RDPA 2NOFA 4BAYA 4BRQA 2EJGA 3SDZA 5L3EA 3KEQA 4IEJA 1ERDA 5K5OA 1NJIC 4HZFA 2AJQA 4GGGA 3JB9G 1JU5C 4I02A 1HKTA 1RKWA 2Q8KA 1P4XA 1MZBA 3F8FA 1PSEA 4A62A 2GM4A 3R60A 2HDWA 2Y9ZA 4IPAA 4Y4RA 4A4EA 3DRSA 1PKTA 2STTA 1EF4A 1LKXA 2OX7A 4MDBA 4RS8A 2RKHA 3H3ZA 3RPQA 4FYVB 5LL6Z 4NCBA 3SV3A 3EUHC 2HBJA 1LJ9A 5CYQA 2VC0A 3FXOA 4CZEA 3OBYA 3X2QH 2KZVA 4LFBK 1JKPC 3CMAI 2DLLA 3SJMA 5KAFC 4M3ZA 2DTHA 3HTUA 5F1JA 3HGGA 3GFMA 4ZDPA 3K4BA 4DBHA 4MLEA 1LEBA 5D8KB 1TWAJ 1J0RA 3M0RA 2RJCA 2OU2A 3A03A 1H8AC 1WOQA 4F91B 4DQRA 3H5RA 4A4GA 2H3JA 1XHZA 2CH5A 3I0WA 3F6VA 2WA0A 3HP9A 3G4SI 2O88A 1QVPA 4QVCA 1A5XA 1IRZA 3PNWC 2QA4A 2YX4A 2P5LC 4OWRB 5M1OA 3SFIA 1IF1A 4K25A 3CDHA 2LX7A 1YHQN 1QKXA 1YWPA 5ILSA 5LJ5j 2K4BA 1W2BM 4B9NA 4HLXA 2EGAA 1YITT 1DP3A 1YHQA 2KKZA 3GIBA 5E41A 4M71A 3HYFA 3ULEA 1FMWA 3FBNB 4PKHA 3M4OJ 2RH2A 5KH6A 3BTCA 4E7ZA 3DLKA 3WXIA 2Q0UA 1SMYF 2ROLA 2DFEA 4H0EA 4XBFA 5C6SA 1EXQA 3L4QA 3FE1A 4DTPA 1K6YA 2DXTA 1HLVA 4FYXB 3WEEA 4EJWA 5B66C 1NHAA 2O4GA 1B1BA 1O1WA 3H08A 3CUQA 4YOUA 2DODA 5J1UA 4LH4A 3J7AF 2QQ8A 1G3TA 3SAHA 3CTAA 3OS5A 1Q7YO 4LFUA 4BY6B 2AT1B 3QOPA 2JTVA 1TKDA 1MMAA 1ZREA 3OYKA 2HZTA 2QKLB 2F7TA 3LSPA 4DW6A 3K70C 1S6LA 2OTLI 4MEXF 2X4YA 4BI4A 2HSTA 2VOPA 4DTSA 2VG5A 3I8BA 4PJOA 4F7UB 1BA5A 2VKNA 3RWUA 1M3AA 2CDTA 3TTFA 4B9MA 1Y64A 2K79A 2EIFA 3CP2A 4FJLA 1WH7A 3M53A 3CVSA 5DTDA 1WXUA 2E5LK 4Z4CA 3EUAA 4B1UB 3HOWJ 2HVQA 1U4BA 3J7AO 1ZA1B 2MPXC 4I6MB 4BUGA 4LH5A 2EZKA 1C0UA 3WTZA 1TQPA 3HC7A 3TSPA 1JRIA 1VRTA 4NUBA 1NGNA 2WOMA 5BOXA 4OOIA 4CBUA 3F70A 2ECBA 1AWOA 4JKCA 3THVA 1HNWK 1W36C 4FLTA 2XY8A 1KVCA 4NXNK 1WSIA 3K4CA 2EYQA 1RI7A 3ABKH 1IGQA 1KC8U 3OB9A 2R5AA 2CT4A 3I4PA 2MSYA 4MHGA 1P59A 3CFPA 2HHXA 1Y0MA 4BRGA 5GAOq 3FMRA 4JUVA 3ZRGA 2HBMA 3QWXX 1FIPA 1M90U 4HWIA 4J8FA 1MBFA 2JZ2A 3LCNA 3F22A 3HHTB 4R56A 3QPSA 4WFBL 4RW8A 3ZSVA 4LUEA 1Y1VJ 5CLSA 1FK9A 3CQXA 5EVZA 3UNGC 3CCSI 3M8PA 3QMLA 1YXQA 2LJ0A 2IVPA 1MWMA 1XB4A 2E20A 4BY7J 2CP6A 3GYHX 3BDUA 2DMTA 3DXMB 2DOFA 4HF2A 4GMJB 3DXJF 5C15A 5ICFA 3IRQA 2DVEA 4AI5A 5DM7F 2L4MA 3AGRA 2EKOA 1V4TA 3K1NA 4ELZC 3NRVA 3FMQA 3OMGA 2VT2A 1Z91A 4XLCA 4O44A 3JB9H 2QSHX 1OH6A 2JPBA 5GAN6 4UY8I 3A5MC 1MUDA 4A2BA 2NOEA 2FA5A 3NFAA 4OMPA 1UHSA 3OOPA 1D0YA 3M57A 4PHTX 1VQ6Q 3LPTA 2QZ8A 1T05A 1SVMA 2KJBA 5GIPA 4XKWA 3BY7A 3E6MA 1TW3A 1Y6IA 4WQ5C 2CFOA 3BW1A 5KE3A 4A0YA 4BQLA 3U21A 5HK3A 2W24A 4ID5A 2NNWA 1MDMA 3A0IX 2QWPA 2ID3A 2RA2A 3H1VX 3RR6A 4HF1A 5IHKA 1LUJB 3QFPA 2IGOA 3O08A 2F96A 3L09A 1NH3A 4KRFA 4EJOA 4FVMA 3HKZN 2W6LA 3QEPA 4GFBA 4NLBA 2DXBA 1YJ9Q 3PNTA 1U45A 2IIMA 3L42A 3CW7A 3CCMN 1X3WB 3HKZA 2D4WA 1OH8A 3E6DA 3P1GA 4C1NI 3W2WA 3PVQA 2KW4A 4DF4A 5JS1A 2QA4T 1T6DA 2MFZA 1NJWA 3H0FA 3F3XA 2PJRA 2KTQA 1F36A 1HK9A 4A54A 1NPPA 3JCMJ 3LOCA 2Q31A 3OY9A 2HSPA 1IUFA 4FWPA 1YHQT 4UB8C 3KWIA 4YIIA 5BPMA 3MKYB 5EOYA 3OSSC 4CZZA 3A8YA 4M3TA 2DJNA 3LH5A 2E2JJ 3C7JA 4CCLA 4JN4A 1F1ZA 1JTYA 3E3VA 3ZMZA 2EH3A 3QOEA 1NJXA 3EGXA 4IZ9A 4J2BA 4I76A 4GXOA 1QVGS 5KYYA 3A01B 5JICA 1RLQC 2DO3A 2MCNA 2GWJA 2P0QA 1W6XA 5C3EJ 3LAJA 4D6WA 3ABMH 1NZ9A 1TNSA 4KISA 1YX3A 2LKXA 3FXMA 1IJJA 4YOYA 5A2QE 5I3UA 5J1EA 2PVOB 2OPTA 3O6WA 1S1NA 3CIPA 4CDGA 3CBPA 3ZSQA 1WYXA 5EG0A 2LOOA 4EVIA 2Z1DA 4G6DA 3VS3A 1N9RA 5EY4A 4FJ8A 4A5MA 3FXRA 3KHYA 3GFJA 4XOPA 4M74A 4PL7A 3TABA 5EZGA 2GIVA 1YO5C 3D45A 4H5TA 2DOEA 3VS5A 2BZ8A 2EYWA 3BG9A 3UDCA 4CFCA 1IZ1A 2NAZA 3FISA 5D5WB 1MIJA 3MN6A 3MN5A 4ENNA 3JCMe 4AM6A 2G8FA 1ZGWA 4EA5A 3V8KA 4BU2A 3NMUA 2BUPA 5DK5A 4J01A 2GOMA 4FLZA 2LNHB 3JCMc 2VBWA 3AL0B 3VA0A 1YCYA 3WNGA 2AQEA 2VJJA 3GZNB 4XIDA 4KRTA 2HNZA 3HO1A 3I0XA 4WXDA 4AIDA 1PU6A 4A12A 3I9QA 5LEKA 1K8KA 2FSWA 1YJNA 4CGZA 1VQ8Q 2CV0A 3HXLA 1RGIA 2NS7A 2LX9A 1K73R 1KAXA 1JJ8C 2MW8A 4HT8A 1RDUA 1K78A 3OYIA 2VBZA 2SRCA 1TL3A 4CJTA 1RRQA 4CD3A 2LR8A 1S6QA 3JRDA 4D8DA 4JKEA 4F14A 1V3FA 1QQMA 2K3XA 4XMYA 4EVVA 3EFRA 3EKUA 3VDXA 1AWCA 2XB5A 3SUNA 4RMOA 2FMLA 1TUUA 3VEVA 4UV9A 1K73C 4PJOD 3P38A 4UUSA 3T7ZA 2HTJA 3I64A 5DDGA 1K73O 1T0HA 4CD1A 3X25B 1TC3C 2EIKH 3ABLH 4DG1A 2Z2SB 3RQIA 5LHIA 2FXAA 1LVAA 1S72N 2F4IA 4OFEA 1IZ6A 4CBXA 1WWXA 3JYTA 4LUDA 5LJ3e 4L59A 1S72A 4DV5K 4HSBA 3VPRA 1K61A 4JV5K 1FC3A 1R1TA 3PM1A 2UXNA 3V9ZA 2L54A 5KN9A 4JRQA 2ME0A 1N39A 1LCKA 1ETYA 2YU3A 1ZRDA 4DYRA 2NOBA 4EP4A 3V8LA 2TDXA 2L9NA 4PCQA 1U5SA 5IT9Z 3NPFA 1VQ5I 3NARA 4E7HA 5GAMg 2E19A 4OB1B 3VGLA 3SCXA 1KU7A 1N77A 2LTOA 2XKOC 3QIIA 1HSTA 1KSWA 3IAS2 1B34A 2GBYA 2BH1A 5AZJB 4OB0B 1IW7F 3K1PA 3H46O 4RA2A 2HDAA 4LIVA 3S1MJ 4PJNA 2ZSHB 3DYAA 1D9DA 2VXFA 3LDNA 1I4K1 3K9JA 1BM9A 1QZEA 3OS1A 4Y28E 5GAMh 3VF6A 2IVOA 4ENJA 2JN0A 4CC3A 3I59B 3BTIA 2F8SA 3NQOA 3AFHA 1HYZA 2EV6A 2HZYA 1YE9A 3T9NA 1T8IA 3N4PA 4BC3A 4Y1DA 3BCAA 4CZGA 3OA9A 3PV8A 3J80O 3FHNA 1YI2Q 4HOBA 2NWMA 4E7KA 3CC7I 2LC2A 1O3TA 2MI6A 4HQEA 2HGCA 4OIOF 2NVXJ 2QUFA 1H92A 2NRZA 1NTCA 2D5VA 1Z9ZA 1OMIA 3V4GA 1VTNC 3OIQA 3ISNC 4M3GA 1R0BG 3FLGA 1AA7A 4BC5A 2KRNA 2DPPB 2BTFA 1DTTA 3VSLA 2ESHA 3WGHA 3FB9A 3Q9SA 2MAMA 4HPQA 2DM1A 4M7AF 3V4IA 2DA4A 3VENA 2X6SA 5DUKA 4IOCL 5CY4A 3AO3A 1J9AA 2O8CA 3LSIA 5EXWA 5A0LA 3SEZA 3HOSA 2R7VA 1V5FA 3M1EA 4AIAA 2J5PA 1HPZA 2L5QA 4AFZC 3L2ZA 1I0CA 1VQLI 1C1CA 1WEFA 4I7FA 2DIQA 2PYLA 3G1OA 3BGRA 3BE3A 3FXKA 2QG9B 1LWVA 2O8BA 3U4LA 2XY5A 1WH5A 2DX1A 4HCZA 4FWOA 4M7AC 4XTZA 4UUTA 2ASOA 1RDAA 1JI8A 2DT7B 4MQ9F 4F2RA 1HLUA 3R0JA 4FL6A 1ARKA 3CC4Q 1WNSA 4CIGA 4IRHA 4CGGA 2EX3A 3Q1JA 1E0EA 4M7AG 2V52B 1UHFA 5AQUA 1YOVB 3VYGA 3SJJA 3GUDA 2M0OA 4D7NA 1ITYA 4AVPA 2DZCA 1ZHFA 2NYXA 1VQ4Q 4FM1A 2Z1HA 3LW5E 5KE2A 3SB2A 4CZLA 3VFZA 1J09A 4BQQA 5FPEA 3PUBA 4QTRA 2X6OA 3AKZA 2ZXWH 3TU4K 1M1GA 1QVFP 1TXQA 2K57A 2EK5A 2P9UB 3ZN0A 3Q7BA 2X9DA 1X1DA 5FKKA 3O8GA 4P55A 4DUYK 5AQGA 2BXZA 3I56N 2ZCWA 2AS5F 3PGGA 3FRNA 4JRPA 2SEMA 3QPLA 3LQRA 1FJLA 4Z02A 1ATRA 2COBA 2P9PB 3I56A 4DTRA 3CMEA 3PX6A 1XNIA 1KRPA 3OYGA 2XI9A 4IFEA 4B3SK 4N4OB 2PAVA 2JTFA 4AFQC 2IC3A 3O9UA 1R1VA 2ZMEA 4B9WA 1TK8A 2WAEA 5SZTA 1TTHB 2V9KA 1YJNT 4Y7NJ 2H27A 5AQXA 2KROA 1BBYA 3DLEA 5HOOA 5ICCA 3SEMA 3I3LA 1FTTA 2B5JA 3WUHA 1Z26A 2XAUA 4KKOA 2M4KA 4LSLA 5LRSA 3VEXA 1T8EA 1J9IA 4G7HF 2A08A 2P6TA 1P90A 4KHUA 2M30A 2XGEA 1SKUB 3A1PA 4ZGJB 4DBFA 2RF2A 1K9AA 3WU2C 6PAXA 1FWZA 1RT5A 4EMGA 4CHZA 3DXKB 3HUGA 2EZLA 1WI7A 2CMPA 4IZZA 4QQDA 2HF3A 1MBKA 1HU0A 5A0GA 4CESA 5BPNA 4X1EA 1OX9A 3ZMSA 1M4ZA 4E4HA 1XJWB 3D7EO 5AQKA 2HQHA 1GOAA 2YNHA 1BA0A 4BRKA 2QKBA 5CJ9A 2CUDA 4NB5A 2HEQA 1S72T 2A36A 5JLWA 1G5VA 1KQSP 1UJ0A 1P9QC 2A3SA 1C6VX 1I5LA 3JAMO 2LREA 1RBRA 1SEUA 2GZWA 2DN0A 1WEGA 3CXCP 4BHBA 1XHXA 4BR9A 2F5FA 5EGOA 1SAUA 4LDXA 2A41A 2JNGA 2K6DA 3OYBA 5FWBA 1T38A 1SD4A 3TCJA 3HK2A 2F5VA 2UXXA 3FBIB 2DT6A 5GAGJ 1X2QA 3TPQA 2DAOA 4OIRF 1VQMQ 1O57A 5GAN8 3LP0A 1YVNA 2Q1ZB 3NMZC 3E9GA 5HP1A 3P8BB 5HDGA 2JSCA 1XG1A 2DTIA 3MHXA 3A8GB 4AD9A 2VOOA 2KYMA 2KPMA 4HAMA 1QVFM 5L3CA 2BY1A 4FVUA 4XTVA 2IS6A 2HBLA 4CCOA 4RW4A 2P6SA 2F69A 1W7PA 4BHCA 2HF4A 3K5MA 3CCUI 4L5IA 1VRUA 1T0JA 1S22A 1RAGB 4ILGB 3PQJA 4DTNA 3ZX3A 2FZKB 1N75A 1QU3A 3ZX0A 4C1NK 1Q8IA 4YDUA 4ZGDB 2E34A 1C0TA 1IRXA 4CEOA 4R55A 2EJFA 5CO7A 2GBQA 2ZPEB 1EH8A 1Z6TA 2YSRA 3LMMA 4PJJA 1NK9A 1ZSZA 3DJCA 5B5EC 3AVMA 1PP8F 1VQ6N 4C8QF 1DLOA 3M5AA 3NH0A 1ZBUA 4OMYA 3IL2A 2DJQA 3QIPA 4B8XA 4BNCA 4KGXB 3AAFA 1Z3YA 5LGNA 5E3MA 5LD2C 2E65A 4GRIA 3I54A 3EG3A 1D8KA 4HTUA 3RYPA 1KXPA 2LFBA 3KP3A 1EV7A 4CCNA 1MDUB 4WCEL 4A4FA 1OULA 4KGVB 4M78F 3H35A 1M3BA 5HLGA 3F8CA 4XU2A 2NLUA 3H8ZA 4O5BA 4C8QC 1QCNA 4I0BA 1Z67A 4Y15A 2CP2A 2OTJA 2C0TA 4LG0B 1IV0A 3TARA 2W1OA 3M0QA 5GAMj 3H9QA 3GOXA 3K9KA 4DFMA 3V42A 3SFZA 4GBQA 1N34K 2EAYA 1YJ9N 4RKUE 4AHTA 1PCXA 4XAXB 1IN5A 1VIEA 5J2PA 1EIFA 4MMKA 2GFUA 1G2BA 4C8QG 5KI6A 1KQSM 4AVZA 2FB7A 5GAOr 1IUYA 5J1RA 4B1ZA 3CCVI 3G6EN 1NGIA 2V26A 3O4WA 4QLCU 4G9ZA 3VQ6A 3CXCM 4E7SA 5AQJA 2LYCA 3WG7H 1RI9A 3CPEA 3KP6A 5A2QZ 3G6EA 1YTUA 3LWHA 4A5BA 5IWAK 3GTOJ 1X6OA 3E6BA 1KLMA 3QQAA 1IG7A 4NHJA 3A98A 3ZX2A 1MSEC 4Z94A 2EQIA 3O9SA 4OPKA 4YELA 1UGSB 4FZZA 1DDNA 3IP4B 2NOHA 2KT1A 1QHTA 1RBTA 1J75A 4PUSA 1V4RA 4G7ZF 1QWFA 1YIJI 3ZEUA 1DIZA 1S3JA 1C0WA 3I55Q 2BW3A 3W2VA 4M7DF 4ICLA 2LDUA 4AQYK 5B1BH 4QPOA 2E1OA 1UWBA 2YHTA 4AMCA 2OANA 3N5NX 3DKMA 4W5QA 4WCGA 1V55H 4MLHA 3I56T 1VQ9Q 3S14J 3CMET 1K9MR 3Q9VA 3J81K 2HHHK 2JS0A 5BRDA 4EA4A 3ZT2A 1Y57A 3NGIA 2UWMA 4ENKA 2X6NA 2CT3A 1TWBA 2M8EA 1LFBA 2H1KA 3KFVA 1STZA 5AQTA 2K5IA 2YUNA 2VWFA 1YJWI 3W6VA 1K9MC 3ZSOA 1NKBA 4GV6A 4FASD 4RUGA 1LOJA 3WTVC 5F0FA 2CWEA 5LJ5f 3ZN1A 3CQTA 3OYHA 5FFZA 5IXBA 3OR1C 3ME9A 1DQUA 3FF5A 2GXAA 1IJWC 1KQ1A 3PFYA 1OCPA 1TV6A 4M9XA 2CQNA 4E9FA 5M3FJ 2EKHA 2ABLA 2DE0X 2NNNA 5IXFA 1RRSA 3NGPA 2PEXA 4FT2A 3G71Q 3EFOA 1VQ8N 2GFAA 4JI8K 3CESA 3CWSA 1U6GA 2I10A 1XGNA 2ZKZA 5EF6A 2VLAA 4PUOA 2P9LA 4JI5K 5DUIA 3RBBB 3K9TA 3MWTA 4JHDB 4CEQA 2ZAEA 3M0PA 2UV1A 2DLPA 1OYXA 3GEZA 1NK8A 3CWAA 3S3NA 2XV4S 4B47A 4BWJA 2PX9A 5LJ3h 3DWLA 3C65A 1U6ZA 4EW4A 1X6GA 1DUXC 2OQGA 1GLEG 1CKBA 3UA7A 5CYVA 5CIUA 4CEEA 4CHUA 1N25A 4C5HA 4KHNA 2JVGA 4IHVA 4B9QA 2HSEB 4M77A 1PD0A 4F92B 3ERMA 3KEYA 4CJ7A 3OGDA 2KMUA 4RGUA 2A40A 1P2FA 2NZTA 1OZ2A 3IC7A 4X64K 4HYEA 4I6MA 5AQSA 1W1WE 2DK5A 2DQRA 5J2MA 3RZOJ 5EYRA 3THYB 4B08A 1FW6A 3NTKA 4M7AB 1UB4A 3B6AA 2CUZA 1TQIA 2FD5A 1U1TA 4RTWA 4XU0A 3VQDA 2IAIA 3M54A 1YW8A 1BGXT 4DLEA 3U1KA 1A6IA 3ZCOA 2M2EA 4KT0E 1GCPA 2LH9A 2QQAA 3RRHA 3ZMVA 2JMCA 4FJMA 4DYCA 3OIPA 3A2FA 2OUMA 1I3QJ 1NLOC 3G3ZA 2PFBA 5C0MA 1FP2A 2L7KA 3CMYA 3CPWS 2KT8A 2UZKA 4LF5K 5HK0A 1Q81O 2O0YA 4B1XB 4KH6A 2IS4A 1N8RO 4LG3A 1WGSA 2M87A 2W00A 3SAFA 4Z6YA 4IKFA 4B9UA 4GKJK 1ZR4A 2F2EA 4LB5A 1SL2A 1U1SA 4G9YA 3QBYA 2ID6A 4LFCK 4E6RA 3RZDJ 3HI0A 2V1NA 2W84A 2D1XA 1HA8A 1M2VB 1LVKA 5DD8A 2XF6A 5H20A 5GMKj 4M6XA 1W7PD 4OINF 2DFIA 1QSSA 2HNIA 2MA3A 5GTIC 2OTJT 1YITI 4OO1J 3LSJA 1NJZA 3ML6A 2KRHA 3F5TA 3E2UA 4R8HA 3MFKA 5FKMA 2BUDA 3GVAA 2D0NA 1Q7YU 5BRFA 4JEPA 5AQWA 3FSPA 1OR7A 1KU9A 3OR2C 4W1UA 1I07A 4NBQA 3A5OC 4MO4A 3NF9A 2NRXA 1WB9A 1TBXA 1K6OA 1KQJA 2PYJA 4Y0WA 3L0QA 3SZPA 5D5VB 5AZIB 2JWLA 2ZJPL 3TW6A 4KA4A 3OL3A 2NRRA 3GBGA 3FDYA 2FF4A 3QUIA 1BN5A 1Q1HA 2F6CA 4IOAF 1Y07A 1NGGA 1UGRB 5ADXA 2DXUA 2L9RA 2PMHA 4J83A 1S1XA 1ASVA 2JXBA 3G6ET 3K59A 1V54H 3C0BA 2BV6A 2W42A 2EV0A 4C3HJ 1JJ2P 4HQMA 2D9TA 2RQUA 5FD5A 4I2QA 4IIMA 3UPUA 4MO7A 3G7ZA 3RYRA 2XASA 2AQFA 2IVWA 3M4YA 1OU8A 4N0AC 4WF2A 3META 1QHGA 1X75C 2QLZA 2MLKA 5D3GA 5HVQC 2MC3A 2CP5A 2J7IA 1XCBA 5KYXB 2HYJA 3V81A 4YOWA 2D8HA 2HXOA 3RI4A 3RMSA 4NC7A 1NWKA 2Y0SA 1L0OC 4AG2C 1W2BS 2MH9A 1MNEA 4NQWA 5DLOA 2F9WA 3FZFA 1Q18A 3GFLA 4RW9A 5DCMB 1E2XA 1GLAG 1M3HA 3DP7A 3PIPL 3U3YA 3GW2A 5LL6S 3CD6N 3CMAQ 1WJRA 1I1GA 1NGDA 1AVZC 1IO2A 1AU7A 2IOCA 3CD6A 2KLAA 1NGHA 2NVQJ 2RNAA 2P9KB 2DTZA 1G3WA 1K7AA 3MKZA 3I58A 2QQSA 2Z33A 3PFSA 1VI0A 4OLAA 3QIOA 1TUYA 3HEFA 1NMDA 3T1YK 1G3SA 1PDNC 3G4SQ 3GWZA 4LNPA 2DTUA 3BZCA 1VA7A 3QBXA 2KXDA 4YPHA 3NHGA 1QPMA 2P9IB 4JNEA 4KFBA 5H6QA 3MD2A 1M9SA 1EP4A 5B1AH 2EBIA 1IN7A 5FW9A 4YOTA 1O75A 2FO0A 1X2KA 2LJ1A 4L18B 4JKGA 1RBUA 2VQHA 3FHGA 3EH1A 4FK0A 4B8CA 1I5OB 2PVDB 3JSPA 3QO3A 1UZCA 3DOKA 4FM2A 1OJLA 4ZYHA 2HQRA 2LK2A 4DJAA 3C4SA 4ENMA 4OAZA 1C6VA 3HTRA 5LEJA 4LD5A 1ILYA 2DXCA 4D8KA 3SLCA 2JA7J 3OW2A 2HB5A 4C0DC 3VQAA 2O8FB 1FSHA 2Q0RA 5ICGA 3HT3A 3O3GA 3KK3A 2X6YA 3O9TA 4J2DA 1X43A 1H9GA 4IF4A 1UFMA 3QODA 3C2BA 5JHUA 3IV5A 1FT9A 2ZXJA 4JRKA 1W1FA 3M3YJ 3ENOA 3IUCA 1HDDC 1IDYA 4AILC 4M75C 1Y8RB 1NM7A 3O1WA 2ZFUA 3JTGA 1WXBA 3RSEB 1NGCA 3PUFA 4DU1A 4JLHA 3RR8A 1P8ZA 1JJ2M 2GF7A 4EZ9A 1IN6A 4A3KJ 3GFIA 4OP0A 5HCKA 2OTLQ 3PMTA 4M75G 3LAMA 2ADUA 4BRFA 5GADJ 4I6ZA 2O8DA 3IH4A 4M3DA 4J5YA 4MMLA 3CG7A 3CHWA 3ZFJA 2UXCK 5AFUH 2JRTA 1LWFA 3DLAA 1BI4B 3AO5A 2NS8A 4KN4X 3SZ2A 2COYA 3GOIA 3MP8A 3JCMP 4RCCA 3C2GA 1SKSA 3B6OA 1M1EB 1AWJA 3KP2A 2FPDA 3PY8A 1VQMN 2K4JA 1FNNA 3LM2A 3LH0A 3RKXA 4JLGA 3FC3A 4A4KA 1UA1A 5LJ3j 3QZ9B 4JLIA 2B7EA 2ZPBB 1VQMA 3HRTA 4M77D 2LMJA 1X1PA 2A5YB 3M8JA 3REAB 1HQEA 4D5CA 4L9NA 3TSUA 3AGKA 2HNYA 2JM8A 4U7DA 4CC2A 4BKXA 1AD5A 4DQQA 4X0GA 3O8VA 2LQ8A 2R7WA 2QA4I 1KGSA 2CP3A 1BA1A 3J7YJ 3M8QA 4C92F 2HOTA 4EPCA 4W5OA 3AG2H 1D0XA 5FGMA 3E9PA 5E1ZB 2M7BA 3J81E 1YW7A 3LSKA 4Q4ZF 4IFVA 1YHQI 4RB3C 4FYWB 4XSZF 2E8AA 4FETA 3CJ9A 4FE7A 2YX6A 2QTDA 2Q3SA 4WQ4A 3CCJA 4N41A 3CCEA 4YG2F 2R58A 1XWLA 3CCSQ 4J7FA 4C92C 2DD5A 3NBPA 5IH2A 2RMOA 1XSVA 2R92J 2KE9A 2XF7A 1FX7A 4DYQA 1SFOJ 4JKFA 1FKPA 1JKOC 4IOXA 2JRMA 3T8TA 4YIRX 3X24B 1RR8C 2V7FA 1F1BB 3CC2A 5M3MJ 5EEAA 3AG1H 2VE9A 1TK5A 4C92G 5DD4A 1X19A 2JS2A 3JCMb 4BRPA 1BR1A 2EIJH 2PI0A 4BE2A 1GV5A 4CEFA 5EC7A 3DKYA 1AHDP 3RSNA 2LVMA 1DP7P 4UC4A 2C06A 5KRTA 3LLRA 1W0TA 5D8LB 3DLLL 4HBLA 2M8GX 1S6PA 4PGHA 4DTJA 2LJ3A 2E10A 4MDWA 1PJRA 4U7BA 1QVUA 1QW1A 1ZELA 4KREA 2V1RA 2RQRA 1R71A 2JJ9A 1SD6A 1TU0B 4PKCC 3EQLF 1RILA 1ZBJA 2OPRA 3NDKA 3K1MA 3E19A 3QRFF 2E6NA 4PKGA 2E2IJ 4M9SA 2YRDA 4B3OA 4OX9K 1ZKGA 1JCFA 4K42A 1UELB 3U9ZA 1OI1A 1K73U 1XGMA 1TKZA 3I55N 3OYYA 3HP6A 1UG1A 5I9EB 3FDRA 3CD6T 3BR3A 3QEXA 4DS5A 1FOXA 1KIKA 1X3ZB 1KFSA 3ZQGA 2JJ7A 4FPAA 3VF2A 4FZXC 1NK2P 2B6AA 1Y71A 2RO0A 5EEHA 3M9AA 1KHCA 4A61A 1ZBXA 3WTWC 1QNTA 5FPDA 3B73A 5BPDA 2AZSA 3PSFA 2E4LA 2D1KA 4FJJA 4ASNA 1V1CA 1XI1A 1WSEA 3UA6A 4W5NA 1GHCA 3O1BA 3I53A 4RCBA 3SUOA 5JFRA 2WBNA 2DILA 4KH5A 4P9FA 1UG2A 4CEDA 2PFUA 5GTHC 5GAN5 4BVPA 5D7UA 3DPTA 3OYLA 2FEIA 4JDSA 1Y8QB 3IHOA 4BEHB 1QPIA 2Z99A 1FOWA 3VS2A 4R79A 4DOVA 4DKWA 4B3XA 2X3WD 1EO1A 5AQHA 4MFDA 2J5OA 4BR2A 5IN1A 4BC4A 1VQKN 1HSJA 2GXBA 3DB3A 1GV2A 3E01A 4JI3K 3RKQA 2DDAA 3TVTA 2IIRA 4ELUA 1KVBA 4EHUA 4CBWA 5FKNA 5CQYA 1VQKA 2CFXA 2WACA 3J7ZO 1QZYA 2OC6A 1MGTA 1QP3A 5I21A 2DCEA 5FLXE 2W7NA 2DJIA 3EZWA 1NBWA 4H4OA 2GLOA 1OPLA 3HZJA 4A93J 3UE5A 3WTYC 2V8JA 4LF7K 2QCOA 2O4IA 3TTDA 1GL5A 4HVUA 2F5TX 5E26A 3HJEA 3VMFB 1R4NB 5KQ8A 2IGMA 1RACB 3M3ZA 3QFUA 2DJZA 3CCLA 4FJIA 3HPOA 2YHXA 2OBPA 1YTAA 3KZZA 5HS7A 4CJVA 1YW9A 2DXIA 2RQWA 3E0JB 4CCMA 1BU6O 3N0UA 3ZBDA 4AFUC 2CSQA 4LGWA 3L6QA 3GTPJ 3KP4A 1VQMT 3AY9A 1QE1A 4IHXA 4E0DA 4FK4A 3DXKA 4BR7A 2HL5C 3IH7A 4M3BA 2EGEA 1SSHA 4BQOA 2EWNA 2EIMH 2P5OA 1WHJA