3OYIA

Crystal structure of the pfv s217q mutant intasome in complex with manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyiA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyiA03
3TAFA 1TKDA 2VG6A 2OPSA 4AHUA 2DFHA 3L2VA 1SL1A 3U3GA 3QIOA 5KTQA 2I5JA 4QVZA 4OGCA 5KGWA 4W5NA 1YTAA 4HCCA 3LPUA 3OYMA 1XHXA 3HYFA 2BIVA 4CJPA 4DSKA 2HNYA 1ZBLA 4OVAA 3QERA 1CXUA 3OYBA 3VQQA 4AHTA 2KZZA 3UWNA 3AVLA 3V6DA 3C4SA 3U3YA 3DOLA 3LAMA 1KRPA 4KKOA 3K5OA 4ID1A 3ZEHA 4FJ9A 5IAYA 4EZ6A 4F2RA 2XY7A 1KTQA 4PL6A 2RJCA 1YTUA 1BIZA 3P1GA 2OZMA 3IAYA 4DTMA 3UT1A 3NF7A 3NTIA 3GOXA 2P1JA 2YNHA 4CIFA 4FU6A 4AHVA 4B9MA 3ZSYA 1LAWA 1RNHA 3LWLA 3AO2A 4DWIA 4E1NA 1R0AA 2XY5A 2W42A 1RTDA 4E7IA 1VSMA 2Q3SA 3HVTA 4CK2A 2XHBA 2D9TA 3MP8A 5HP1A 3VQ4A 4M42A 4KAZA 1S6PA 1JLEA 3TAGA 3F70A 3DYAA 1LWFA 1FXXA 4NS5A 4HUFA 3ZSWA 2GFUA 4PWDA 4DTJA 4JS5A 2RO0A 3EY1A 3FEOA 3K5NA 3C94A 4OVLA 1RCHA 1BQNA 5CYQA 1T8EA 2ATQA 2JZ2A 3QEVA 3AVIA 2PZSA 3DLRA 4RW8A 5KCHA 4WE1A 4AHSA 4CEDA 3NF9A 1Q8IA 2RJEA 3MEUA 2LSNA 4DMNA 4CJEA 4FJJA 1OYXA 2QXFA 3AO5A 4RW4A 3VQ7A 1BCMA 2B8AA 2DFFA 4C5EA 3K2PA 3HPHA 4DU4A 1NKBA 3AVFA 4FJHA 3OA6A 2D0CA 4OLAA 5C6SA 1ZBUA 3OYIA 1J53A 4N41A 3S3MA 2LCCA 4OKKA 4FJKA 1OI1A 4LD0A 3SPZA 1LW2A 4QAGA 1HYSA 4M3ZA 1Q9XA 1S1UA 3KK3A 2Z1HA 1Z26A 2FHDA 4N76A 1TV6A 2IG0A 1CXQA 4M3TA 4CF9A 3ZT4A 2L89A 4TSXA 1UA0A 3AA3A 1NJWA 3MXMA 3KLFA 4DLEA 3OYJA 2HQEA 1X9SA 1CLQA 4OJRA 3LYIA 3KJVA 4KREA 2G8VA 3NGYA 1XI1A 3TWHA 3DLEA 1WJSA 3ZSVA 4AHRA 4FM1A 3MXJA 2PQWA 4E1MA 1TVRA 3VA0A 4CE9A 3VQAA 3L2UA 3PMIA 4ZTFA 4CIEA 2DAQA 3HK2A 4FJ5A 4CHNA 3DB4A 2RHUA 4Q5WA 4FZZA 1UA1A 4FLUA 2F8TA 3G10A 1J54A 3QBYA 1RTIA 3OQ5A 2AJQA 4J2BA 4BD3A 4F2SA 3KD1E 2X6SA 3CFOA 4B8CA 5J2NA 1VSHA 4CJVA 1C1BA 4Y1CA 4IUPA 4B3OA 2OA8A 4B8AB 3QETA 4CEEA 3TAQA 4GW6A 3G0ZA 3V9ZA 4C8OA 3IRXA 3RR8A 4K8ZA 5J1EA 4DFPA 4DTSA 3ZT3A 4DF8A 3PX0A 2L3RA 3KLIA 4Z4HA 3V9WA 2MWOA 2KFZA 3AO3A 4NCAA 3LP3A 3KLHA 3TARA 4CK1A 3V1RA 4FK0A 1DTTA 3LZIA 4CEOA 1RBVA 3T1AA 4KHNA 3O8VA 2E5QA 4F3TA 1LAVA 4O0IA 4GVMA 1ZBIA 4QOZB 1TL3A 3SNNA 1G5VA 3VQEA 1FKPA 1BIUA 4E3SA 3RR7A 3SI6A 2HHVA 4CGGA 1WAJA 1BHLA 1TKZA 4EP4A 4NZGA 3SUQA 3OMGA 4I7FA 4DSJA 1JLQA 1RDBA 3M8RA 3AVHA 2WONA 4E89A 3QINA 4BWMA 4C5IA 4KB1A 4FK2A 5C24A 5CIUA 3MEEA 1XC9A 1F21A 2B4JA 1HMVA 4KTZA 1J5OA 2KW4A 3ZT1A 4DS5A 2EQMA 2KQ2A 1IKXA 4DTPA 1U04A 3DLGA 4KO0A 2KTQA 4CCHA 1S6QA 4CGIA 3WNEA 4FJXA 3HXMA 3MECA 3HO1A 5FRNA 4Z0UA 3K57A 4CEZA 2EQKA 1J9AA 4FLXA 3C95A 4Z4CA 3FC3A 1GOCA 4OPJA 4CGDA 3OYHA 4XIUA 4FXDA 3O4QA 3KIOA 3O3GA 4ID5A 2X35A 4PY5A 2FBXA 3D0PA 1IG9A 3DB3A 1IO2A 2G8HA 3L3UA 3EYZA 3NTHA 3NF8A 3K5MA 2VG7A 3T3FA 1XNIA 3RMAA 2OPPA 3HJFA 4O0JA 3AO4A 3LANA 2OPQA 3RRHA 5HLFA 2IAJA 2LRQA 3OYGA 3SV4A 4FL6A 4IUUA 3OYAA 3V4IA 2BE2A 2K3YA 3MAQA 1OZ3A 4C8KA 2XY6A 4FZXC 5C42A 2EQUA 3FFIA 2LDMA 2K3XA 5KI6A 2MWPA 2FBYA 4CJ3A 4E7KA 4M3YA 1BCOA 5E41A 2P5GA 3RMCA 4CFAA 5JS2A 4ELTA 4CJWA 1VSEA 3KK1A 3T19A 3QO9A 4W5QA 4O44A 3SZ2A 4CEAA 2EKOA 2ZQBA 3SUNA 1KFSA 1QQCA 2YHAA 4CEBA 3TI0A 1U47A 4K8XA 4QQDA 3AVKA 3V1OA 2GUIA 2DIQA 2RPIA 2JLEA 2RKIA 1U45A 1VRTA 4AHCA 5KRSA 4F3OA 3SQ2A 5CZ2A 4CJRA 1U48A 1ITGA 3QLHA 4IKFA 4C8MA 2F8SA 3CM6A 2QQSA 3OYKA 1ZYQA 3HPGA 2HVIA 4FLWA 3M8QA 1Y97A 4KI4A 1RT5A 1IH7A 4OGEA 1NK0A 3IG1A 1VK0A 1IKWA 5I42A 3PUFA 3NAEA 4B9XA 3LAKA 3VQCA 4HUEA 3I0RA 2G3RA 3ASMA 4KV8A 3QJ6A 1A5XA 1C0TA 1C6VA 2XY8A 2P0KA 2X4XA 1S1VA 4BE2A 1YVUA 3FDRA 4IUTA 3QEIA 1TGOA 1RBUA 1TK5A 4PA1A 3DI6A 4DFMA 4FK4A 3OS0A 3CG7A 5J2MA 4CEQA 2HB5A 3NDKA 4Z4IA 3AVJA 1EXQA 4M3RA 4C8LA 3LP2A 4HUGA 4PQUA 3LZJA 1A5WA 5KH6A 5HRRA 3AO1A 4DLGA 2HQXA 1GOBA 3ZSOA 4W5TA 1NJXA 3WNGA 1WSFA 3ASKA 3MEWA 3P8HA 3L2QA 3QEPA 3S3NA 5HRSA 5HRPA 5C0MA 4DSEA 4KTWA 2O4XA 3OYCA 1NK8A 4LD6A 4DF4A 1HYVA 4MQ3A 1WAFA 3SQ0A 5EU7A 4M45A 4CF1A 2BUDA 1BL3A 4LSLA 1Z25A 1ASVA 4FLYA 4Y1DA 3V1QA 3VQ5A 3PMTA 2YHBA 2KFNA 4CIGA 1XWLA 1NKEA 2DTUA 1N6QA 2B6AA 4E7HA 3SV3A 2P51A 4W5OA 3NE6A 4RG2A 4CECA 4IURA 3K58A 4DSIA 1VSFA 4CHZA 2RHYA 2F5KA 1REVA 1ASUA 3QIIA 4FJ8A 5KRTA 4KPYA 3PX6A 3DLHA 2G8WA 3AA4A 3E9FA 3VQPA 5SWMA 1VSIA 1WNSA 2EHGA 3CFPA 2EFIA 3SYZA 4DQSA 3AVMA 1FK9A 1WSIA 3NFAA 3TAMA 2YNFA 3M8PA 3L2RA 1GOAA 3U6FA 3OYLA 4N4GA 3UIQA 3THVA 4CJTA 3H6ZA 3ULDA 1QTMA 1RI0A 2HW3A 1UWBA 4CFBA 1X1PA 1W0HA 4CFCA 2FC0A 5DMRA 4DTUA 3RMBA 4IG0A 5HROA 4C5HA 1S1TA 4IBNA 3I8DA 4CJLA 4B9VA 4BDZA 3VQ6A 1KVBA 3ZSXA 1NJZA 2P5OA 5KCOA 3NH1A 1TK8A 4O4GA 5J39A 2RHXA 1I3AA 3HP9A 4FVMA 3LGFA 1HYZA 1SKRA 4J2DA 1D5AA 4ZTJA 3H08A 5FRMA 4A4HA 4RW7A 1HQUA 1SV5A 3PY8A 1HNIA 4BWJA 1JKHA 3MEDA 2HNDA 3EAEA 4B9LA 3S9HA 1S5JA 1OZ2A 3S3OA 2D5RA 4CF2A 3KLEA 3RMDA 4FLVA 3VA3A 3VN5A 3BGRA 3V9SA 2ETJA 1CZ9A 1WN7A 1TK0A 3KK2A 3HM9A 1JLFA 4KI6A 5KE3A 4M3WA 3TR8A 4CF0A 1JLGA 2KZMA 2Z1JA 5D6WA 1NJYA 4I9QA 1G15A 4FYDA 1K6YA 4H4OA 1T05A 2E6NA 1EETA 3PNWC 1RILA 2DFEA 3LALA 4B9TA 1BGXT 1C1CA 3LP1A 2PYLA 3DLKA 4IUQA 4L59A 1VSKA 4B9WA 2HMIA 3TAEA 3P83D 3VQDA 3LWMA 4FJNA 2E6MA 3SQ4A 1QS4A 4EDUA 3BDLA 4HVJA 2O4IA 2VYTA 4KHSA 4I2QA 4CJUA 2IOCA 3DLBA 2RI5A 3PFSA 4O55A 3LX7A 5CZ1A 3P5JA 3RRGA 1WSEA 3K5LA 2R5AA 1I39A 3KTQA 4Q0BA 4PLLA 1BI4A 1EP4A 3VQ9A 2XRIA 1KVCA 3RWUA 1VSLA 4A4GA 3ME9A 3AA5X 4E0DA 1NK7A 1UAXA 1L3SA 3AA2A 4IG3A 2OZSA 4IFYA 4N56A 4JLHA 4CF8A 4DTOA 4UC4A 2VWKA 2Y1JA 4R5PA 2XDPA 4J2EA 4FJGA 4E19A 4W5RA 1TL1A 4M41A 5DK5A 1T03A 2CKKA 3MXIA 1MHNA 3QNNA 3CM5A 3LPTA 2M0OA 1C0UA 3AVBA 3OYEA 2RI2A 4Z02A 2X4WA 4FJ7A 3QESA 4KFBA 3CEYA 3L8BA 1EKEA 3QNOA 5C25A 4JRQA 4BDPA 4FW2A 4CJ5A 1WJQA 5KE2A 4CJFA 4ELUA 2PY5A 3DM2A 2HHQA 4CHYA 2E4LA 2EQJA 3ALYA 3DRRA 2X78A 1WSJA 3KUFA 2HHSA 3M8SA 4QQ6A 3H8ZA 2PYJA 4NCGA 5K14A 1NK4A 3DLMA 2HHXA 2RF2A 2M1HA 4H4MA 3B6PA 4CJKA 1JLBA 4RW9A 5T7BA 1NK9A 3OVNA 4H8KA 3O3FA 2G8FA 5SZTA 4CK3A 3S6WA 3QEXA 2D0AA 4B9NA 2YRVA 4FLTA 3E01A 1NKCA 4OPKA 3O3HA 3TAPA 1SL0A 4YFUA 4N4HA 3DOKA 4N47A 4F4KA 4DFJA 2HNZA 2G8UA 2QK9A 1QE1A 3KD5E 3P8DA 3SUPA 3ZSZA 2A1RA 2HHTA 4B9UA 2OPRA 1D9DA 1H3ZA 2XK0A 1WJRA 3FLGA 2Z1IA 3QEWA 1W9HA 4DQPA 4A4EA 1JLAA 4CERA 2EX3A 1QSYA 3AVCA 1S9GA 4ICLA 4DQRA 2E6LA 4CGJA 2RJDA 3DRPA 1TKTA 1KVAA 5J2PA 4E7JA 4O5BA 4LSNA 4DSFA 1KHCA 1X9WA 4LH4A 4C8NA 5D6YA 1L3UA 3ISNC 1ZBFA 2OYQA 3V9XA 3A2FA 1RT4A 1IKVA 4KB0A 5FDLA 1X9MA 1QSSA 4CGHA 1LV5A 2RHZA 1JXBA 2Z1GA 3EZ5A 2A1SA 2FBVA 3SD4A 3SJJA 2YV0X 4I9LA 1TAUA 1RDCA 2F96A 3ZT0A 1RDDA 4CEFA 3LH0A 3V81A 1SKWA 4CGFA 1YT3A 4FJMA 1QHTA 1NOYA 1RBTA 3NHGA 1RT1A 1HRHA 1JL2A 4KHYA 4DG1A 1BQMA 5M9OA 3DMJA 3NGZA 5HBMA 4FJIA 3L42A 4X34A 2R57A 3TABA 1HPZA 1L3TA 3I0SA 1KCFA 4FCYA 4UQGA 4YNQA 3OB9A 2WOMA 1TKXA 2GV9A 4CHQA 1RDAA 4FLZA 4PLIA 4IUVA 3RTVA 1KFDA 2HHWA 4NYFA 3HSTB 4CFDA 3ZSRA 3D45A 3M9QA 3HPOA 1WSGA 3QIPA 3NF6A 1U49A 5D3GA 4DQQA 1RT3A 4ELVA 1WLJA 1UOCA 4FZYA 3K59A 1S9EA 3OYDA 4GY5A 3KLGA 3JSMA 1KSPA 3SPYA 3NCIA 3AVGA 1RT7A 2X74A 1L5UA 3CQ8A 3ITHA 1DLOA 1B9FA 3NTKA 2R5MA 1SSFA 1L3VA 4KHQA 5HRNA 1SL2A 2VG5A 1WGSA 3F9KA 4M3XA 4CJSA 4CESA 4GMJB 1ASWA 1RBSA 4QCLA 4N5SA 1D8YA 3SUOA 2LVMA 4DSLA 4KTQA 4KRFA 4FW1A 3PO5A 1VRUA 1RT2A 3PO4A 3MEAA 4CJ4A 4FM2A 1BI4B 1S1WA 1C1AA 3ZCMA 2G8KA 5I3UA 2NUBA 4RW6A 4EZ9A 2GF7A 3AV9A 4NCBA 4CJQA 2YKNA 3OS2A 1B9DA 4NYNA 1IKYA 2L8DA 4DFKA 4F8RA 2QKKA 4CHOA 4OKJA 2R7YA 4KHUA 1B92A 1D9FA 1XHZA 4JS4A 4CRIA 2O4GA 1JXEA 1HQEA 5J26A 2D0BA 3OJUA 1RBRA 4DTXA 1TAQA 2BGGA 3DRSA 2GBZA 4Z4EA 3O4NA 2LTOA 3IS9A 1Q9YA 3OMCA 3C6UA 4II1A 5IN1A 1NK6A 4B9SA 1A5VA 4BE0A 1RTJA 1VSJA 4I2PA 3KKRA 4Z4GA 3QKJA 3PV8A 5D6XA 3OJSA 3CFRA 2BANA 2YKMA 3NGIA 2ZD1A 5FROA 4LH5A 4DU1A 4JRPA 3E9GA 1HJRA 1QSLA 3Q1JA 4G1QA 1JL1A 4OLBA 3AVAA 4L8RB 1RT6A 4QW2A 2QQRA 1WSHA 3ZT2A 1JLCA 4OKEA 1ZBHA 3SCXA 3NBPA 4Z4FA 2G8IA 3LGLA 4M3UA 2X4YA 1CZBA 5CYMA 4A4FA 3HT3A 2BKDN 3LLRA 5JS1A 3OY9A 4EP5A 4HCBA 3C6TA 4LY7A 2X6NA 4BACA 2R58A 3MP1A 4DU3A 1NOZA 4CHPA 4RG8A 1DTQA 3CYMA 3LDSA 4IDKA 4AH9A 1LWCA 3PX4A 3L2WA 1SKSA 1U4BA 2Y1IA 4FJLA 2RN2A 4DTNA 2RJFA 1T7PA 3BDPA 2IDOA 4J2AA 2DIGA 2NLUA 1O1WA 4E7LA 2FBTA 3OS1A 2GFAA 3ZSQA 3LP0A 4BDYA 3F73A 4DS4A 5KGXA 4AILC 3WNHA 3TANA 1MU2A 2HHUA 2BDPA 4MFBA 1SUQA 4FM0A 3NH2A 3SQ1A 3MP6A 4IFVA 3OYNA 4HCZA 4HTUA 4HHTA 2DY4A 3VQBA 1N5YA 2YNIA 5CY4A 3V9UA 1HNVA 3JYTA 2QKBA 4ZHRA 2IS3A 1S1XA 4PUOA 3NH0A 1NK5A 4C5GA 3NNQA 2RHIA 3MEGA 5J2QA 3WNFA 2XO7A 3MEVA 4N4IA 2JGUA 1VSDA 3KKSA 2RI3A 3AVNA 3HVRA 2ZE2A 3OYFA 4BE1A 4Q5VA 1C0MA 3VQ8A 3L3VA 2VWJA 2IC3A 2WACA 1KLNA 1BISA 1FKOA 3HL8A 4DTRA 4KHWA 4DQIA 1LWEA 1LW0A 2B5JA 2ITGA 4B08A 3HP6A 2M16A 3MO8A 1N27A 2O4XB 3B6OA 2YNGA 2HVHA 4QQGA 3META 1EX4A 1KLMA 2JTFA 1RTHA 2IGIA
chains in the Genus database with same CATH superfamily
2NUPA 4LDYA 2L3DA 1N9RA 1TKDA 2EKHA 2OPSA 2DFHA 2BY1A 2KY9A 4LLGF 3L2VA 3M59A 4M77F 3QIOA 5HNHA 3CCEN 4B47A 3MDQA 1M3CA 2JM9A 2DL8A 4HT9A 4HCCA 1IV8A 2UXXA 2JHNA 2VWBA 1WJFA 2F5VA 3HOXJ 3A8MB 5GAN4 2E1MC 5AQUA 3KX2A 2PN6A 4B9QA 1LEBA 4C8QC 2K27A 2BIVA 4DSKA 3D7EO 5CVRA 4OVAA 1Z05A 1X3WB 3J7ZO 3QERA 2GTOA 4BBRJ 1CQTA 1U0JA 5FFXA 2EBPA 1T38A 1LOJA 2VQGA 3CUQA 4PSXA 2LC4A 2VKDA 3QYEA 2OU2A 3UWNA 5CKTA 1T56A 2LLKA 3V6DA 3C4SA 3U3YA 1YFNA 3ISPA 4OIPF 3DOLA 3CD6N 3M4OJ 2YSQA 3LAMA 4GBQA 2HBLA 3VGLA 2LK2A 3CC7I 1RADB 3FJPA 3OW2P 1FMWA 3H0GJ 3LSTA 4PKGA 4HLXA 4HSBA 1V4TA 1YTUA 2WUSA 2VKHA 3TSPA 3HHHA 3ROUA 4NOYA 4A0XA 2ISYA 2QAZA 2QKLB 2QWOA 3FISA 3O6WA 2P1JA 2K5IA 4CIFA 2EA2A 4A5BA 2R5YA 4JAXA 4AHVA 3AG2H 4I6MB 2DQLA 4DWIA 1KG6A 4XKWA 3BEXA 2W85A 1R0AA 1DP7P 1DUXC 1BI2A 4A2AA 2W04A 1FBUA 3MP8A 3E6BA 3WHCA 4M42A 1G2BA 3E19A 1JLEA 1YJWI 3TAGA 3F70A 2FEZA 1LPQA 3AG4H 3M1FA 1CGPA 4LLNA 1G59A 2BHYA 2SRCA 2K79A 4DTJA 4JS5A 2RO0A 1VYTA 5GIOA 4IJAA 2FPFA 3EY1A 3K5NA 2JS0A 5LRSA 4OVLA 2EYXA 1RCHA 1BQNA 1OCRH 3DAWA 4H5NA 1IGUA 3ZOBA 2CMPA 3K9TA 3EG9A 1QQJA 1OU9A 4WE1A 2HDDA 2CQ7A 4XSZF 1Q8IA 1XCBA 2EGAA 3CCJT 4DMNA 2IJLA 5E3OA 3AO5A 1T2KA 4A61A 2K85A 4AC0A 4C5EA 4IRGA 1WXBA 5KYYA 2D1VA 3AVFA 4IHWA 2EJFA 3BOQA 4X64K 1V29B 2KROA 5EOYA 4OLAA 2A42A 5C6SA 3JSOA 2ZF5O 4C8QG 4EMHA 4OKKA 1S72T 2HSEB 5CQYA 4LD0A 4M7AF 3M07A 1HYSA 1Q9XA 3NEUA 2AZVA 2JN0A 3ZX2A 2FHDA 2AKLA 3VKIA 2KDZA 1ZUYA 4LUEA 4V19S 1JHHA 3JB9D 3ZT4A 1G83A 2GXAA 2IXSA 3D6RA 1E4GT 3PIPF 4TSXA 2M0YA 1OPLA 2P9SB 2K2MA 2JSPA 1W7PB 2XF5A 3MXMA 4ZN1A 3OYJA 2HQEA 4BY6C 1OPKA 4NLCA 3EUHA 2PZ1A 3P31A 4OJRA 4LF6K 3SEZA 3MX2A 5IWAK 1R4NB 2D1KA 2W40A 1VQ9A 2XHIA 3ZGKA 5GAOl 3BZKA 2QEXA 4HT8A 5C12A 1YE9A 5LY3A 1Z6RA 2JHJA 2V52B 4CC3A 1OVQA 3R0JA 2FXAA 4E1MA 3VA0A 5DCFA 3N05A 2L3QA 4NXNK 2FQ3A 3K4CA 4ESRA 2RHUA 4UNOA 3ULQB 4Q5WA 1PNJA 5IT9Z 1J5EK 4D7NA 2DPUA 3OSFA 4DZJA 3C7NB 1BOBA 2AZSA 3S1QJ 4WCIA 1JGSA 1N78A 1YHQI 1BU1A 1LMZA 3WT0A 3OQ5A 3ZR8X 4J2BA 2EZIA 3CQYA 5EG0B 3FXJA 4JHDB 2X6SA 5GAMj 4P5OA 3CFOA 5DPKA 2JPBA 3R6MA 1F5TA 2NYXA 2FOKA 1MBGA 4MZPA 4ILGB 2YCHA 1NM7A 4IUPA 2VJJA 3CCJN 4JZ3A 5CKEA 1VQ7A 3DU5A 2OA8A 5JMVA 2YRDA 3GTGJ 3VRZA 2ASMA 3V9ZA 1JJ8C 4K8ZA 3CMEI 1QRYA 3I35A 1T3VA 3ERED 3SEQA 2WAQA 3SYTA 3B6CA 2C0OA 1VQOA 2ZC2A 4DF8A 3NQOA 4I98B 3KLIA 1S72N 2A6EF 2VV5A 4Z4HA 2O03A 3DXMB 4GYIA 3PFIA 1UMQA 3VSLA 4BRLA 1XTDA 4NCAA 3TARA 3V1RA 2AA4A 1DTTA 4CEOA 4N4OB 3I5RA 5C2FA 2YT6A 4KHNA 5HCKA 3O8VA 3ZRGA 3GTPJ 4FYXB 1MWMA 3WU1B 4F9OA 2DA7A 3CC4I 1KXPA 1MMGA 1J6ZA 3G71Q 3IP4B 2COWA 1ZRFA 3K10A 3VQEA 3BTIA 1BIUA 5EZGA 3BCBA 3G3ZA 4JK8A 1VQLI 3SI6A 3X2QH 5B5EC 3H6EA 1D8JA 5DD4A 3A01B 4CGGA 1JKRC 5LJ5g 1YJ9A 1TUUA 3FZHA 2X4JA 5CR4A 2ZJQF 2OPTA 4GO1A 4EP4A 4ZYHA 1IV0A 1IN5A 5A0DA 1ZGWA 1LDDA 1RUWA 4J5YA 3QJYA 3DLLL 2FNAA 2QI2A 1USSA 4C5IA 2A40A 5CPRB 2VI6A 3OOUA 4BQAA 4FK2A 3O8GA 3E1SA 2GQQA 2QTXA 1Y96A 4H5WA 1J5OA 3Q0UA 2QEXT 3ZT1A 4DS5A 1JKPC 1B7TA 4KO0A 2V1NA 2KTQA 3HKZA 3HOSA 4JN4A 4M75D 2LKPA 4CGIA 4EJUA 3JRHA 4CCJA 2QDYB 4Y3OA 3HXMA 2EBIA 9ATCB 4PJOD 3K57A 1MDUB 1X43A 2EQKA 3BR3A 3C95A 4Z4CA 3FC3A 4CGDA 4IEEA 1NM1A 3OYHA 4XIUA 1RR7A 4MIMA 2GQIA 1ATRA 2X35A 5FU7B 1GFDA 4OU0A 2W6LA 1GVDA 3R8EA 5DY9A 4PHTX 4PY5A 2FBXA 1ZG5A 2DMTA 1W7AA 2DZCA 1AKHB 1UGQB 1YUWA 1VQ7T 3FMRA 1IO2A 3E6CC 3GL1A 2LY9A 2NVTJ 2ZMEA 3NF8A 1NGCA 2DXBA 2A5WA 3H9JA 2IS1A 3BF1A 4BBSJ 3K5MA 1LFUP 1U1TA 1CZAN 3E3VA 5GP9A 3A5LC 3HJFA 1K6OA 1VQOT 4FWRA 3AO4A 2GOXB 5L3EA 2G7HA 4BUGA 2DAOA 2OPQA 2IAJA 4XBFA 3CCUA 1HLUA 3O4WA 4C92B 3OYAA 3TOAA 4O6JA 1OZ3A 1MZBA 7AT1B 1VQ8I 4JKHA 3T69A 1YIOA 3VS2A 3IWFA 3C7JA 5C42A 2ZAEA 2IPQX 3KYCB 1UG1A 4LF7K 3TGNA 4DYCA 3KPHA 4I02A 2K3XA 1P4WA 2FBYA 4C3IJ 3LWIA 2L9NA 1WJDA 3SJHA 3A0HC 5BS6A 5E41A 2P5GA 3RMCA 4CFAA 2K3PA 1SG5A 4CJWA 5BN8A 1OCPA 1I5LA 1R1VA 3URGA 5GMKl 2QEXN 1YJ9T 3F10A 2PEXA 3S16J 2YDLA 1CKAA 2BZTA 1M90C 3TI0A 1U47A 3CXCP 4K8XA 2YHTA 3OW2M 3ZMUA 2GUIA 2CSOA 4G6DA 3UR3C 1YITT 2B63J 5EGOB 1FWZA 1X3MA 2IEKA 1U45A 3I54A 3PSIA 4X62K 1YIJA 2EV0A 4RGXA 4AHCA 5CZ2A 4CJRA 1U48A 1ITGA 4R56A 4FE7A 3QODA 2F8SA 2RQQA 4NDLA 4YORA 3OYKA 1JU5C 2KI7A 1VQ4Q 3CCLQ 4B4CA 2CUFA 1RAHB 3OMYA 4DA4A 2J6FA 1Y97A 1ZLKA 1VQ7N 2L02A 2UUAK 4J9GA 1RT5A 4OGEA 4FE4A 3IG1A 4ZN3A 4WQ4C 1IKWA 1YQRA 4BGAA 3ABMH 2FXUA 3PUFA 4MLHA 3NAEA 2WAQN 2LDUA 4F91B 2L0KA 1JXMA 4B3AA 3E1YA 3ASMA 1VQON 3KP2A 3QJ6A 2RQUA 1DPUA 3WODF 2X4XA 1J3TA 3H9QA 1YVUA 4FL9A 1RBUA 1QQNA 1ZYRF 3DI6A 2IVOA 2W6KA 3N4QA 4F7UF 2QWQA 2PJRA 5TJJA 4QS9A 2XDDA 1EXQA 2ZJPF 2LX7A 2FBKA 3EG0A 1Z9CA 2IRFG 3LP2A 4EGYA 2CH5A 4PQUA 4HYEA 4BQOA 3LZJA 2H8HA 3J81K 5HRRA 3RYPA 1M1KR 4CZHA 4LB6B 4M4ZA 1AZGB 5HLHA 2NRHA 1YJ9N 5AQTA 1NJXA 3JCUC 3HBLA 1X6GA 1WGXA 4CO8A 4LK1F 4ENNA 3L2QA 2K57A 2DPNA 1BA1A 3S3NA 4M77C 5C0MA 2ZBKA 2RPNA 4BS9A 4KTWA 4ESBA 2OTLI 1ZSZB 2EJRA 2CUEA 1R71A 1YITN 1Q7YC 4H0XB 4YIRX 4G7ZF 4DF4A 3VF6A 4M7AA 3DPTA 3SQ0A 1OULA 4CF1A 3JB9H 3DV8A 1BL3A 3WG7H 1IF1A 1B9MA 5AQQA 5FLVA 3U1DA 3HKZN 3V1QA 3PMTA 3QP6A 2HF3A 3H0IA 2VXFA 3SV3A 1GLFO 1GCPA 5IT9K 1SVMA 5M3MJ 4Z6YA 1I1SA 3T1HK 3T5XA 3PTAA 2E8AA 1YIJT 4RTTA 1TNTA 4RB2C 4OFAA 2ZXHA 4FJ8A 3RIRA 5KRTA 3R4KA 4KPYA 2COYA 2QBYB 4BJ5C 4PSWA 5KYUB 2G8WA 3QU3A 1U5SA 3VFZA 2Y48A 3VQPA 3ZP5A 2VXDA 3H5RA 2EFIA 3VGKA 3SYZA 3HOTA 4AG1C 3PJRA 1IHWA 2WV0A 4L0ZB 3TDUC 1T08B 1HNXK 3LM2A 4XTYA 2DTHA 2YNFA 1IXDA 3OYLA 4Y91A 3JRFA 4CJTA 4L9NA 1FJLA 4MDBA 1ZGJA 4XH4A 1QMCA 3AFHA 1D1BA 3QHSA 2WBNA 3U9GA 2FMYA 2KE9A 1QVGP 4CFBA 3M54A 5ILVA 3OL4A 4BB7A 1ETYA 4IG0A 2EFOA 1KD1C 4JJDA 2HF4A 3BPVA 5L23A 3I56A 4BQLA 2I2LA 2MK5A 4IBNA 1WJCA 2RK2A 3OSSC 1OH8A 1TYQB 3SHWA 3JCMg 2DJZA 1TK8A 1XG7A 3EGDB 2NUTA 4M7DB 4C92C 3ENHA 2A5XA 2RHXA 4FVMA 2COMA 1HYZA 4CA0A 2JRMA 4J2DA 1D5AA 4HF0A 1D1AA 3L09A 4PL7A 1SV5A 4HV6A 2JWLA 1JKHA 4M77G 3QWLA 4XRFA 1TTYA 1YFHA 2YUSA 4I01A 2XV4S 1OZ2A 2HNIA 1LPLA 2LSOA 3S3OA 3L7WA 2MCNA 5ED4A 1HLVA 5AFUH 3QWXX 2FRYA 3RMDA 1H92A 1GLDG 4FLVA 3VA3A 2BXYA 4IRHA 5J1UA 3WG9A 3M0QA 1HW5A 2CQKA 3BGRA 3TREA 2KYBA 2RV8A 1QVTA 1I81A 1YIJN 1XTAA 1J9IA 1TK0A 2E2JJ 3FKIJ 4KRTA 3THWB 2HXOA 3M8JA 1I94K 4BRPA 2M4KA 4OIOF 4Z89A 3INZA 4Z8AA 5CKHA 4XH1A 2H09A 4PK4A 4I9QA 3ECHA 5F64A 3I9V2 5DV5A 2F69A 2F4IA 1T05A 3FXRA 1IW7F 3LALA 1N6AA 2YU9J 4B9TA 1QWFA 1Q1HA 2NUPB 4DUZK 3LP1A 3CC7A 3VS4A 4GY2B 2E1ZA 2CV1A 3C2BA 5A2QZ 2H1KA 4KT6A 1NGFA 4IUQA 2IIMA 4KJZA 2DFUA 5IYCJ 1FY7A 4K11A 5D4SA 3ZMTA 5AZIB 1ZQ1A 3GNFB 4MDAA 2R7RA 2B86A 2LT4A 3ZXSA 4FJNA 4HXJA 2K5LA 1YX5A 5E3LA 4I2QA 4AF1A 1VQKI 4H0OA 2IOCA 3PFSA 4O55A 4OP0A 2PFUA 1WSEA 2DQRA 2R5AA 2ZPGB 3KTQA 4Q0BA 3K69A 4IOCL 1YCSB 1BI4A 3VQ9A 4EMSA 3SWNC 4A3BJ 2E64A 1TQPA 5LJ5e 1YJNQ 5E3NA 1BIBA 4A4GA 1RETA 4LOCA 1YJWA 3CMMA 4AT1B 2PU9B 3TTCA 3H3UA 1WQ7A 5D5UB 4OFEA 2V8IA 1FOKA 3QICA 1TQIA 4F55A 2W03A 1UFMA 4IFYA 2VPRA 2AO9A 4L0YB 2L9SA 2D8JA 3I56T 4XIDA 2FZGB 4UC4A 2DI3A 1WXTA 1DEJA 3HSRA 4IHXA 3SHFA 4FJGA 4E19A 3R2XC 2DX1A 1TL1A 3QPTA 1XC5A 2CKKA 1MHNA 3LPTA 1W4MA 4CSWA 3LDLA 4WQ5A 5F0XA 3MKWB 3IH7A 5FD5A 3M57A 5GJWB 1M1KO 3LMMA 5FKOA 5M1QA 5J1YA 3AAFA 4FJ7A 1TUCA 3CEYA 1VQKQ 1V5EA 4U7DA 2ELJA 5C25A 3IUCA 4FOIA 1WJQA 3H36A 2AIRB 1ZELA 3PSFA 4DK9A 1M2VA 2FLOA 4CHYA 2EQJA 5IHNA 3W0LA 3DRRA 1O9SA 3FRNA 2LZ6B 2H27A 2K9MA 3KUFA 4IHTA 4U0YA 1NGIA 2PYJA 1JTXA 3HTSB 3OBWA 3ID8A 4JUVA 1NEGA 5FKNA 4S0HB 3REOA 1ACIA 2HHXA 2RF2A 2HL3A 3X20B 3B6PA 2RQPA 1JLBA 1ONVA 3OVNA 1JI8A 3O3FA 2CGPA 3Q3SA 3S6WA 2D0AA 2MAMA 3ZQ7A 3F8NA 3DBLB 1VQ6I 1BR2A 2VKVA 3CW7A 2BHZA 3J81O 3FXMA 3MWPA 5H1SQ 1A31A 3FMQA 3G1OA 2KDSA 3CCVI 4N4HA 5I2MA 3DOKA 4F4KA 1GXPA 2E36A 3DBHB 2HNZA 2QK9A 3RMQA 1V55H 1Q1VA 3ZSZA 4D5FA 4CCOA 1T0HA 1D9DA 1VIFA 2XK0A 2WWYA 5FFZA 1NGNA 2E19A 3K9JA 1YXQA 5K1YA 1WQWA 1W9HA 3SDBA 4DQPA 2GTJA 4BR0A 1YHQA 1GCQC 5J47A 1XG1A 3ELKA 4DQRA 4M78F 4WK8F 1YJWT 2ELHA 2Q1ZB 3DRPA 1JUSA 1WPKA 2DJIA 4O5BA 2R7FA 4LSNA 4DSFA 2CH6A 1X9WA 2V1UA 2LY2A 4L6V5 1LCUA 3ISNC 1ZBFA 5DLOA 1PHTA 3RNJA 3CMEA 3J7AO 1QHAA 2P9PA 5FDLA 1O3SA 4KNYA 1QSSA 1LV5A 1ZX6A 2RHZA 4CXFA 1WZ2A 1OVYA 2Q1NA 4M7DC 1ZH5A 3EZ5A 4FIBA 1A36A 5DDGA 4KUIA 3SD4A 2XB5A 2FYKA 4PKHA 3EFRA 1BIAA 1TL8A 3NMZC 1IXSB 2DMOA 4F14A 1MGQA 2JA5J 2XRNA 4JPBW 5EJCA 1T3SA 2MH2A 3H1QA 1JT6A 3OW2A 4DV7K 4DZPA 3J7YP 1SSHA 3VEVA 1R77A 2QENA 2LQWA 3CC4A 5JFRA 5I21A 1M1KU 5C0YA 1TUGB 1VI0A 1JL2A 1KAXA 2BUPA 1M3QA 4KHYA 4DG1A 3ZYYX 1W2BP 3CIPA 4ILJA 3K6GA 1VQLA 1BG3A 1KK7A 2RH2A 2E70A 5FW9A 3W3CA 3A1PA 4FJIA 2WA0A 3GE1A 1KC8C 3TABA 4DR2K 4L3QA 3H5AA 4MFDA 1OJLA 5LJWA 1ULYA 4YNQA 3A1YA 3I58A 3RDIA 4QT7A 3HOVJ 1Q86R 4IL6C 1IV6A 2WOMA 1TWHJ 2XSJC 2KZVA 4XN3A 2HPMA 1DQUA 2NRZA 2HYFA 4ISEA 5AQVA 2KVQG 3OBYA 1D0ZA 1WXUA 3VTHA 4B3XA 4CFDA 4B43A 2VXEA 1VQMI 4FWOA 3C3WA 4HTLA 3GTQJ 2CT4A 4EW4A 1S9EA 2YHYA 2OFKA 3VB2A 1YJWN 3SK3A 2F1LA 4BGBA 3SPYA 3I4NJ 1LDKB 3ZN0A 2X74A 2A08A 1QVGM 3CJNA 4FWMA 3BT9A 2HMPA 5AR0A 1BI1A 2OANA 3BE3A 2HQ5A 3LWFA 1SL2A 3K2ZA 1YHQT 2DDAA 2DILA 2W82A 2V1QA 4CJSA 1IDYA 2MC4A 2X6XA 1ASWA 5DUIA 1RBSA 4QCLA 3DKXA 2YX4A 2FOWA 2V26A 2F48A 4N5SA 2M9HA 3SUOA 3B73A 4DSLA 4UNFA 1MUNA 4QVDA 4M7DG 2K5CA 3CMET 4C9YA 1VRUA 1G3TA 5FLXO 2XI9A 4D5CA 2JK3A 4JOMA 2JOYA 2W7NA 1GRIA 3PO4A 1T39A 3EL2A 4Y17A 5ADXA 1C1AA 3LOCA 2YI1A 4RKUE 2G0EA 4RW6A 2VCPA 4M3EA 2JXBA 3AV9A 5KK1A 3WTVC 3OS2A 1UTIA 3K4LA 1PCXA 1IKYA 3Q7CA 5A0LA 2JTVA 2WSFE 1PUEE 1QZYA 2QKKA 4CHOA 1PKSA 5LEJA 1NPRA 3H0HA 2R7YA 3CC4T 4KHUA 1WLPB 2YHXA 2V9KA 1IGQA 4RM2A 1HQEA 4BI3A 5CLSA 1VQLT 4RTFD 2P6SA 2LKSA 3AARA 3ABKH 1XQOA 4J00A 2GIVA 3E6DA 1OX8A 2LTOA 1HUXA 3DCFA 3U9ZA 2R7OA 1H1VA 3C6UA 2BOLA 5IN1A 1WA7A 4OMMA 4FPBA 3W2AA 3D4VA 4FHTA 5AONA 3PV8A 1Z91A 4HX7A 3JCMe 4C30A 3HZ6A 4GCVA 4BR5A 2W1OA 2XF6A 3OJSA 3HUGA 2BANA 3RTRA 5AYFA 2ELKA 4LH5A 1TBXA 5CK9A 4JRPA 2MC3A 1WYXA 3E9GA 1YHQN 1Y07A 1WPYA 2X6YA 4OLBA 4PJJA 1O4XA 1PYVA 5CVJA 3B02A 3JRAA 2ZJRF 3M1CA 2Z5UA 1Q82C 3C0BA 3FZMA 2HGCA 3VUBA 4JKEA 1JLCA 3JCMb 2ME6A 4EMKC 1X6OA 3NBPA 5AQPA 4LMYA 1BR4A 3CMEN 5CYMA 1UHWA 3R6SA 2DLPA 5HL7L 3OY9A 2PAVA 4DBFA 2P9KB 2BW3A 2ACJA 1J75A 4HA8A 1FLIA 2X6NA 5LLQA 2QQAA 4IIMA 5LJ3j 4DU3A 4UOBA 3J8AA 2UXCK 2ZCWA 3UNGC 1MD0A 1DTQA 4BH9A 4F3QA 1KQSM 4F7UG 2HYJA 3LFKA 1LOTB 2KRCA 4HG2A 3CC4N 4EJOA 2VGNA 1SKSA 2LREA 3J80E 3ASOH 4FJLA 3OIPA 2K6DA 1VQ5Q 2RN2A 1TOVA 1U2VA 1STZA 1J7KA 4B8XA 4DTNA 1VQLN 2KT0A 2AXLA 1I1GA 3CMAT 3JCMW 2OTJI 4E7LA 3VEZA 4HQEA 4XLEA 1B34B 2HXIA 5D8KB 2EZKA 3HL2A 3ZSQA 3SMSA 3VWBA 2VJ5A 3LP0A 3F73A 1ETOA 1QCOA 2M8EA 4AILC 2FBIA 3BROA 5GANj 3RZOJ 2OTLA 2MABA 3IAS2 3RJPA 4OAZA 4M75E 3MP6A 2OI3A 2KRSA 4IHYA 1YYVA 3TQNA 1NTCA 3OYNA 4F16A 4PJOE 1Y57A 2KFDA 1K1ZA 1A0NB 4CCLA 2YNIA 4H5RA 1O3QA 4FETA 3JYTA 1YOVB 1Q86O 3V8KA 4YEJA 3K70D 3KWGA 2XC7A 4M7XA 2YR2A 3WNFA 4E9FA 2C06A 3CCEI 1E4FT 2GIZA 1VSDA 3JW4A 3S14J 2RD1A 3JXUA 3HVRA 1MV3A 3EEQA 2VLAA 4XLNF 4Z88A 1C0MA 2HDAA 1I4K1 3C6AA 2WACA 4CCMA 1FKOA 1U2WA 3HL8A 4KHWA 3OL3A 2HZYA 1Z7UA 2PQ8A 3KEYA 3THYA 1RACB 3H0FA 4KUDK 3G73A 3CPEA 1B07A 1OR7A 3COAC 3META 2IS4A 1KLMA 1RFQA 1QZ6A 5BRFA 2K2VA 4OIQF 3GUDA 2VG6A 4ZDPA 3WGGA 4BAYA 4XK8E 3U3GA 3S8PA 2A5YB 5KTQA 3TMOA 4Y4RA 3GZNB 4OGCA 5LRRA 1N3AA 4W5NA 2FB7A 3CF5L 3LPUA 3CQTA 3QPSA 1N34K 1Z3YA 3CCEQ 1S29A 4HSTA 3PVQA 3CMAN 1G2HA 5TGTA 2YLCA 1HQCA 2V8KA 3HYFA 4CJPA 2HKQB 3CDLA 2EINH 3M9AA 3VYHB 1JGGA 3VEPA 1YRNB 1NGAA 1TP4A 3VQQA 1VQNA 4AHTA 2MPXC 3VOEA 3OYYA 5HDNA 3QXEB 3VMFB 3ZX0A 1JT0A 4R55A 2DL5A 3E5UA 3K4KA 1NHAA 1PU6A 1RL2A 4RBOA 4MZMA 1KRPA 4AM6A 1BOAA 2V6CA 4GXOA 3ZEHA 3HSCA 4EZ6A 1JUMA 1UE9A 1WEGA 2XY7A 1KTQA 1K0XA 2RJCA 3CD6Q 2OTLT 5LHGA 4FQGA 2NVQJ 2KJBA 3A02A 2EYZA 5F0FA 1NYFA 1FNNA 2OZMA 3IAYA 1WWXA 1AD5A 1XNQK 2PVOB 3NTIA 1SEMA 3GOXA 2YNHA 1PSEA 2A05A 2LTPA 3D2FB 5AQNA 1IRXA 4B1YB 4JX4A 1DGRM 2O9SA 2W42A 4E7IA 1VSMA 1EWRA 3HVTA 2XHBA 2GA2A 5D5XB 5HP1A 4E7SA 3VQ4A 4I7HA 2GOMA 3NVMA 4H03B 3HSBA 1S6PA 2R7TA 4CZFA 3DYAA 3WTXC 2CRGA 4HUFA 4FOEA 4ISGA 4JK7A 4DV3K 4G8XA 1Q86U 3M6GA 2A3LA 3LW5E 1ZTRA 5CYQA 4A6DA 1T8EA 5JR3A 3FZVA 3AVIA 2HBKA 1TWAJ 4LC9B 3LQQA 1G3YA 5KPRA 3DLRA 4CC2A 4RW8A 4AHSA 3EFSA 2DXUA 3KP6A 2RJEA 2LSNA 1RAEB 2IGOA 1OYXA 4RW4A 3VQ7A 3E9OA 4C2UA 4XU3A 1SEUA 1KQSS 4DU4A 3E97A 2EWNA 4XLFA 4FJHA 2KAFA 1OOTA 1QA6A 2D0CA 2LQ8A 1G8XA 2KEAA 2L0AA 3OYIA 4N41A 3BR0A 4RMNA 5GAMg 1QLYA 3DFGA 4Y33A 3CLOA 2DT6A 3S3MA 4M78C 3J80Z 2LCCA 1ENHA 5IH2A 3O2PE 3NARA 3G25A 2X0LA 1BC8C 1XNRK 2ZXJA 5LHIA 2PJPA 3QYGB 3F8FA 1L0OC 2GWRA 1Z26A 5IP6A 1M5Q1 4XONA 1TV6A 2DYIA 6AT1B 1CXQA 4M3TA 2CP3A 5BN9A 2L89A 2OTLN 1SRLA 1VQNT 2QXLA 5CQXA 3AA3A 2ZXWH 2GELA 2Y30A 2ETHA 4DLEA 2EZHA 4B21A 3I55A 4PKIA 4RAYA 4UUVA 1H641 4I0BA 3M8EA 3GFMA 4AM3A 4BQNA 3K4JA 4QS8A 2YU3A 1D1CA 2PBDA 3CCJI 2P81A 2JPSA 1TG0A 4X66K 4AHRA 2P9UA 1HKQA 1U5TB 2LNVA 3KZIC 3MXJA 4A53A 2A36A 4C0ZA 3ZMSA 2PQWA 1QHGA 1TVRA 3HSEA 4CE9A 3VQAA 4ZTFA 4JX6A 2IPOB 4XLCA 1WI9A 1AWXA 4FJ5A 3G1LA 3S1MJ 3WVEB 2QUFA 3LSMA 1QZ5A 2M02A 5AQHA 2VXZA 1TWCJ 4E7ZA 4FZZA 5FWBA 1QWEA 2DA4A 1UA1A 2KSSA 5GMKe 4F7ZA 1S72I 1V5FA 1ABOA 3G10A 3EUKL 2CP0A 4DKWA 3G6EI 3RSEB 1WI3A 3IQLA 4KT5C 3G7ZA 1QVGA 1VQ6A 2HQNA 4F2SA 1EZZB 4DR3K 1S9HA 3O3KA 3I59A 4JI2K 5J2NA 4CJVA 5CVUA 2KMUA 1VHXA 6PAXA 2A3SA 3CCVA 4GLMA 1AWWA 2DLLA 4B3OA 4B8AB 3QETA 4CEEA 4MLEA 4QSHA 3FHGA 5KPTA 1M2VB 4PJLA 3K4BA 5J1EA 2IGMA 1KJWA 1DJ7B 2QG9B 1OQKA 3ZT3A 2JUCA 3CPWP 3S1NJ 3CZ6A 3A8HB 1WVRA 2JJ7A 3O1BA 2XB0X 3FXUA 4IPAA 1X4OA 2HOEA 5JLFA 2R93J 3DTEA 3NGPA 3V9WA 4U0WA 2AHJB 3QB0A 2KFZA 3N4MA 3AO3A 5AN4A 2LC2A 3VYRB 1ZUUA 1JE8A 3KLHA 2DEUA 1BR1A 1M4ZA 4F3TA 3TW6A 4M78G 1LAVA 3M7GA 4M7AD 1VQNN 4O0IA 4OO1J 1E3HA 1ZBIA 1N8RR 4LGWA 1MBKA 2ED0A 1TL3A 5AJ3K 3ZMZA 3SNNA 1G5VA 1KG2A 1IZ6A 1D3BA 4JEPA 2PFBA 4E3SA 1RLQC 5ICEA 3HM8A 3FKJA 2AHQA 3U8XA 2HHVA 5KQDA 1FYNA 4J9IA 2RGVA 2D1XA 3SBGA 1BHLA 3JRDA 3ESWB 4G9YA 3HG9A 2HDCA 4DSJA 1JLQA 2PNIA 2DBKA 3S41A 2WONA 2IT0A 4N0BA 5AZJA 2ABLA 3HRTA 4C2MJ 3LA7A 4XLHA 3I55T 2GUPA 5C24A 4Q47A 1KG1A 2BXZA 1F21A 4B3MK 3GZ6A 3F3XA 4OWRB 4BL0B 2IVNA 5AQRA 3SLCA 5JICA 2L2PA 1JO8A 3ZQCA 3C1DA 3IRQA 1GT0C 2O8FA 4A57A 3DLGA 1SFEA 2LQNA 4U88A 2IA2A 4A3GJ 1NWKA 4BEHA 1VRLA 1MMSA 1Y71A 2JW4A 3IAM2 1BBZA 2PMZA 1RZ4A 1IRGA 4EM0B 3HO1A 3A2KA 4PFZA 3EFOA 5ERIA 4G6TB 2UZKA 3KEOA 5CQGA 2ZGYA 4FLXA 2P9PB 1QQOA 2CZ6B 4OPJA 2X85A 1UGPB 2Y31A 3O3GA 3K4MA 2LP5A 1EH8A 1TT0A 3BLYA 3S32A 2Y9ZA 3QAHA 1DPRA 2CQNA 1B8IA 1OCZH 4CBUA 2O0YA 3GBGA 1PG5B 3DB3A 5CKBA 3CCVT 3IKMA 1VQMA 1BUPA 2RREA 2IS2A 3T8RA 1ZG1A 2OUMA 3A8GB 5DLQE 2HQAA 3PNYA 2GTDA 1CSKA 4C3JJ 1I50J 1HPMA 2XICA 1EFNA 2VG7A 3FZLA 3EETA 2QYZA 2QEXI 4O0JA 4UUSA 2P5LC 3LSKA 2JMCA 2LRQA 4CZCA 3OYGA 3SV4A 1UFFA 4FL6A 4J6XA 3R6OA 2BE2A 3GG4A 2HVQA 4BRIA 2ZFUA 1QU3A 3HOZJ 3IKVA 2RB6A 1ZSGA 3THXB 2CW0F 2XG8D 3FFIA 2LY1A 2V9VA 4KICA 1W1WE 3CCQI 5ICGA 2P4TA 2VWFA 2DXIA 3AL0C 2P5KA 3MKLA 2V1DA 1QVFP 1VAZA 1UHSA 5GMKi 5KI6A 1CKBA 4CJ3A 1LJ9A 1LUJB 1K79A 4M3YA 4XTVA 1BCOA 2LJ1A 4IX7A 1T3LA 3I55N 1Z7LA 1BA5A 1YW8A 5JS2A 4E9EA 4C23A 4IDHA 1VSEA 3KETA 5K7HA 2IGKA 2E12A 2M4GA 2IW5A 2FVUA 3ZQIA 3SZ2A 3UKGA 2YUOA 2J6KA 2EKOA 4CZGA 1B72A 1NG7A 2X9DA 3GO5A 2BTFA 4KH6A 2HYGD 2J6OA 4LITA 4CZIA 3QFPA 4FSXA 1VQ9Q 1Z21A 3BZCA 3PIPL 2QEXQ 1P90A 3FM3A 4RM3A 3MKDA 2ESHA 2FG0A 3O9QA 4QQDA 1RRSA 1V3FA 2E41A 3V1OA 4TVRA 2RA2A 1ZKGA 3WTYC 2E1HA 1RAGB 5FPEA 1VQOI 3QDRB 4JKGB 4X1VA 2JLEA 1YWOA 2L9RA 2GXGA 2Q2EA 2DKGA 1U5TC 4AIJA 5KRSA 1PC0A 3GEZA 4MMLA 4F3OA 3O5BA 1XMAA 4BHPA 5D5VB 3CM6A 4JK1X 4C1NI 5GANd 1KQ2A 1F1BB 4J9CA 3EG1A 2KXCA 2KRNA 1HOMA 3CCVN 4KI4A 3T9NA 4ZGDB 4QS7A 3HZJA 3QYBA 1NK0A 4RTXA 1BI3A 1VK0A 3RUXA 4Y7NJ 1N36K 4XAXB 3P9KA 1W0TA 5CVVA 2JWTA 5GPCA 1VQ7Q 1ESVA 3VQCA 4HUEA 3I0RA 2X1CA 4C8QE 4E6KG 4KGVB 3JRBA 2R7WA 3E2UA 4KV8A 1D0XA 1AEYA 3GTLJ 3BR6A 3HRGA 3T1BA 2XY8A 3SDZA 1W1FA 4IUTA 1AHJB 3CJQB 2L2OA 1VQOQ 3QEIA 2FQ4A 2XROA 4PA1A 1XQHA 5F2RA 4DFMA 3OS0A 4K41A 5J2MA 1YITI 2DL4A 4RTVA 1HSTA 2TCTA 2KQWA 2E10A 2F4MB 2EQRA 2NOBA 3TTDA 2ESWA 1MKMA 4BRHA 4HEA2 2DTZA 3QZ9B 2KRMA 4DLGA 1SANA 4XLAA 3DWLA 1Q18A 2KYMA 2QM1A 2B9SA 1FMKA 1WEFA 2BY0A 3VTIA 1GLNA 2F6CA 3MEWA 1X27A 2E5LK 2LQKA 1N8RO 3QEPA 1WX6A 5HRSA 2LJ0A 2DVJA 1YJ9Q 2BE9B 4ATOA 3EQLF 3F2KA 2O4XA 5B1AH 4RTWA 4IVNA 2VQFK 2R7SA 3F6OA 1HYVA 1RAIB 5HY6A 4MQ3A 2VC1A 3RCOA 3FXQA 4FWKA 2NVUB 4KUMA 2DTRA 4CC4B 1YI2I 1ASVA 4RUGA 1K9MR 3M0TA 4JDSA 2LG4A 4NQWA 1NKEA 2PMZN 3JAMO 2P51A 3EYIA 5IT3A 5AQJA 2QSFX 2OTJA 4FWLA 4LF9K 1IRFA 3FE1A 3KEQA 4CECA 4IURA 2FSKA 4ZH4F 3FMSA 3DP7A 1MJBA 1EH7A 4M3FA 2RHYA 1VOMA 3VUZA 1T44A 2F5KA 2HSPA 5D5WB 4LDVA 1ASUA 3QIIA 1REVA 4Y13A 1RRJA 4WCGA 1P8ZA 5M1KA 4KH1B 1UJ8A 3DTIA 3SZPA 3PM1A 5EC7A 3LCNA 3E9FA 4EJYA 4BC4A 2KR3A 1VSIA 4EIAA 2EHGA 3GTMJ 3E0JB 2ICWG 5HS7A 5GAMe 3KP3A 5F1XA 3RI4A 2Z1DA 3NFAA 4XU0A 4OPHA 1FP1D 3TAMA 4IEJA 3H41A 1GOAA 3EG3A 3U6FA 5KAFC 1YQAA 1AZEA 3ULDA 4PFOA 1WHKA 1K7AA 1U2VB 1U84A 1X3NA 2FC0A 1ZXOA 5DMRA 4C2TA 1Y6IA 4RTUA 3QSUA 3WQUA 3BPXA 3CCUQ 2NRVA 5H6QA 3CVTA 1Q81C 4CJLA 4B9VA 4B09A 4OAYA 4P9FA 1N5ZA 1NJZA 4AIHA 1S5LC 5E3MA 1B6AA 5C3EJ 2VQEK 2Q31A 1FYKA 4YPHA 3HP9A 3W6VA 3V42A 1VUBA 4BJTA 3VGMA 4ZTJA 5FRMA 2LX9A 4K25A 4BVPA 3PY8A 1HNIA 1IXRC 1MSFC 2CQXA 1K78A 3IH2A 3S9HA 1NJIC 3LSHA 5AQWA 1SKUB 1GLCG 4HWIA 2STWA 3SAGA 2PI0A 4M72A 1NMDA 3TO6A 5EXWA 2NOLA 2WB1A 3KLEA 2DK5A 3GFLA 2GNCA 2O8KA 3VN5A 5L8RE 2RNAA 2QA4A 2HAXA 2QQBA 4JJCA 3V9SA 2F5FA 4WF2A 2VT3A 2HEOA 4AG2C 3IL2A 1N8RU 1JLFA 3TO7A 4ON0A 4M3WA 3RKXA 4CF0A 5GANf 4DOZA 3DKWA 3WEEA 2Z1JA 1S6LA 1YIJQ 1TQMA 1NH3A 2AT1B 1FEXA 1EETA 4BQQA 4JRIA 2OTJT 4FX4A 1WJAA 4A3DJ 4F04B 2V4JC 2X1EA 5LGUA 3DLKA 1UGVA 5LL6Z 3DXKB 2K3FA 2IBDA 4FISA 4BR4A 2VOPA 2E35A 2L3PA 9ANTA 2NOFA 2DU9A 4QPQA 4GV6A 4RAFA 4B9WA 3CCMI 4LK0F 4WX9A 2F9WA 4M71A 2H3EB 4KISA 1MDMB 2Z9OA 3CI5A 3JS6A 1ZQ3P 3R61A 5FKKA 1QS4A 4YRVA 4JI8K 2JZYA 4DV4K 2VYTA 2O4IA 3DKMA 2FA5A 2XGXA 1GBRA 4CJUA 3IUOA 3DLBA 3O9RA 3MZ8A 4C8QA 3WTUC 2HOSA 2QKMB 1BKBA 5CZ1A 1SHFA 4WXCA 3K5LA 1I39A 1BWFO 4B1ZA 2CGLA 2DBBA 4PGGA 4JI7K 1I3QJ 1EP4A 5AQYA 1YCYA 1WRJA 4I99C 3SJMA 1KVCA 1VSLA 4ZJZA 5E8IA 3S6IA 1QVPA 4LG0B 1K8AC 3ME9A 3ZQGA 4M6VA 1NK7A 4KFCA 1F36A 1WB9A 3KVGA 3PFYA 5I2SA 4OFHA 4ENKA 3J81E 5TRDA 2RMOA 3FJ5A 3OGDA 1RESA 1WHHA 1JJ2M 3DLAA 1XD7A 4CICA 4WXHA 4R5PA 3KZZA 2XDPA 3FFKB 4M41A 1T03A 4AD9A 1A04A 5I22A 2AQEA 2CZ0B 3RZDJ 2ZJPL 4H5VA 3QNNA 3CM5A 3CLQA 1C0UA 3OYEA 5FKMA 4P9UA 1SS6A 2RI2A 1RAAB 3VRYA 3OR2C 3I0WA 2KIQA 4BRDA 1SD6A 2XHKA 4D6WA 3QNOA 4ZZDA 4BDPA 2FL7A 1JCGA 4LF5K 2HKXA 3K1PA 4CYCB 5GTHC 2RKHA 4CJFA 3EHRA 2PY5A 4ELUA 3DM2A 3TPQA 4B1UB 1R5HA 3W2WA 2NNYA 1CF7A 2QWPA 5GANh 2RAEA 2O8EA 3F21A 5AQSA 3M8SA 3O5ZA 2ZGWA 2EJGA 1VF9A 3FBIB 1WQ2A 2QA4T 2OTJN 2W00A 3MQ0A 2M7AA 4GGGA 4NCGA 1SC7A 2L54A 3L2CA 4KYWA 1DIZA 1UG0A 2KHOA 2OBPA 4CW7B 4RW9A 5T7BA 2BZYA 2CREA 1K9MO 4AQYK 4H8KA 2BZXA 2JN6A 1TWFJ 2G8FA 1XB4A 1QQMA 3HGGA 2ECBA 4ZYAA 4B9NA 1UGRB 1PUFB 4YOXA 3HBTA 2HTJA 3BR5A 1ZHIA 5M1OA 3R3LA 4XH5A 1ZBSA 2QF7A 3O3HA 3ATVA 3CCJA 3TAPA 4DFJA 1WHJA 2R7VA 2VONA 2FRHA 1QE1A 5GAN5 3ZETA 3KD5E 3CP2A 3K9KA 3P8DA 2E7WA 2M0CA 2EA4A 2YUPA 2CO5A 2OPRA 2LH9A 3V7CA 1H3ZA 1F9NA 3F0ZA 1VIEA 3MCPA 3EE9A 1WJRA 1NMNA 3TO9A 2Z1IA 2ASPA 1N39A 2DD5A 3H9NA 1S72A 4KH4A 1ETVA 4LIUA 2EX3A 1QSYA 1EBMA 4ORZA 1MNDA 3G6EA 5AT1B 2GLOA 3DJCA 1I6HJ 3PNVA 2PLYA 2CGJA 1MIJA 4ICLA 2PUOB 2K9NA 2KXDA 3I56Q 2E6LA 2UXBK 2XASA 3WXMB 2RJDA 4PJMA 1WFWA 2EIKH 1ORKA 4JI4K 2XSDC 1RABB 2V79A 4E70A 4C8NA 3KFWX 5D6YA 3QMLA 1O57A 3LL7A 1TH7A 3I4PA 1QP2A 3M0SA 3V9XA 3A2FA 4UVAA 4QPOA 3WTWC 2MMPA 2GX9A 4M75B 2P9UB 2CUJA 5IP7J 2Z1GA 4BGDA 2WB1N 1QZZA 2A1SA 4PJOB 1RUNA 1SPKA 1RC9A 3O08A 2XVCA 1MUDA 2QA4N 2Y0MA 5KN9A 3VS0A 2RVCA 1ILYA 1RDCA 3V7RA 2CUZA 3ZT0A 4YDUA 2AQFA 2OCEA 2UXDK 1JRIA 2ZWHA 3LH0A 3V81A 5DCMB 2Z16A 4XTZA 1NOYA 3NHGA 2XGDA 3LAJA 1HR0K 1IBKK 1HRHA 4GKKK 3ENBA 4HZFA 2P0QA 5BREA 1GBQA 5M9OA 1HNZK 1NLOC 1ZARA 1J09A 5J6XA 4KMFA 3NGZA 4BRFA 4LIVA 2LD5A 1M1EB 1KSWA 3L42A 4X34A 4CI0C 2DL7A 4MO4A 4YFKF 4MGRA 1H8AC 1QKXA 1U3OA 2EH3A 5FLXE 2AXTC 3CC7Q 1FOYA 3A98A 3PQKA 2R5ZB 4FT2A 5A2QO 4UVCA 4C92F 5FWCA 1KIKA 2YWWA 4CHQA 1RDAA 1MMNA 1K9AA 1K9MU 3OSGA 3K1MA 3G1JA 1O13A 3ZSRA 2Q0UA 3P39A 3HTUA 4UY8I 2L4MA 1H9GA 3QIPA 3NF6A 5D3GA 1UG2A 2K02A 1TC3C 1RT3A 1WLJA 4YELA 1DT9A 4A59A 1X1BA 3KLGA 3FXKA 3CBOA 3AVGA 2NOHA 2GWKA 2DTIA 4GDFA 3VYSB 1DLOA 4CZJA 3CO6C 4AI4A 1B9FA 4ZYEA 4M77E 1YJWQ 3NTKA 5J8FA 3G6ET 1JJ2S 1U1SA 4KITB 3C12A 3J81Z 4OPAA 3PO3J 2CT3A 1LE8B 1BJAA 4ZGJB 4GMJB 2IA0A 4BRCA 3VS3A 3PVLA 5LFAA 3BG7A 4ANJA 4KMUX 4QVCA 4HQMA 4M9SA 3V8JA 2EV5A 5DEQA 5BNGA 5ECAA 1JB0E 2CP5A 2DFIA 4MTEA 5C15A 3ZBDA 4FW1A 5HLTA 1RI9A 4LF8K 3ZEUB 2O8FB 1E6GA 3N5BB 3ZCOA 2D45A 4ITVA 5GIPA 1S1WA 1T0FC 2G8KA 2NUBA 3IC7A 4EZ9A 3PIOF 4NCBA 4RMOA 4RLQA 4ESFA 2DZ9A 3VERA 4MFEA 4IZ9A 4OMQA 2MFZA 1YW7A 3NWTA 3GTKJ 3P9IA 2L8DA 1IN7A 3C2GA 4DFKA 4F8RA 3L1AA 1HSJA 3WU0A 1P7JA 2XKPA 3CCQA 1FMVA 2RM4A 1YF5L 4BXXJ 1D9FA 4MO7A 1XHZA 1SAUA 4JS4A 3CC2A 3BCAA 2EIJH 2GEMA 2DOEA 2RE2A 1OU8A 4D8DA 1U8RA 5J26A 2D0BA 2JVHA 3GXOA 4W97A 3TSUA 2WY7Q 3EDPA 3JR9A 2KGTA 5LJ3g 4DTXA 4BXFA 4PL8A 4DV2K 1TAQA 4Y52J 2BGGA 3DRSA 4Z4EA 3TW7A 4P5NA 3KK7A 3OMCA 1SMYF 2EPFA 4MHGA 5GAGP 2ABKA 4L5JA 1NK6A 3M0RA 3EPZA 1DU0A 2E65A 2ZPHB 1A5VA 4BE0A 3ULRB 2FSJA 3O9SA 2B7EA 3R6NA 1YO5C 5M5WJ 2FBHA 3ZMDA 2ASOA 5D6XA 2E1OA 1AOJA 4A69C 3BG5A 1UUEA 1GFCA 2K4YA 2VC8A 2QSGX 3EGXB 2WBMA 3G6EN 1W4SA 2QQ9A 3I0XA 5KVRA 3SZGA 3Q1JA 3DXJF 4GNIA 4CZEA 4Q48A 1JL1A 5GANg 4HVVA 3JB9G 4QW2A 4ESJA 4KGZB 1YHQQ 3M56A 3VDXA 2FSWA 3PT9A 3ZT2A 2YG8A 3CJRB 1PU8A 2EK5A 1ZBHA 4Z4FA 4M3UA 2HD0A 1CZBA 5F6FA 1B72B 3ZQHA 2NNNA 3A8YA 3QWYA 2ITMA 4DGWB 2HBWA 2V7FA 2O8BA 5J4VA 3HT3A 5JS1A 2XKOC 4EP5A 2BEOA 2P9SA 2ID6A 1W7PA 2MBFA 4CH7A 4IQ4A 3DEEA 1GDTA 1SRMA 3CMEQ 2XDBA 4RCBA 3C6TA 3CCRA 5GAN3 4M7AE 1V4SA 2LT1A 4LY7A 5DM7F 1BJZA 3CHWA 5ADXH 4A54A 3MP1A 3BY7A 4EMGA 1NOZA 3W2VA 4RG8A 4CD1A 2DF6A 1I5ZA 4JX5A 1BK2A 1NG6A 3CYMA 3LDSA 1YITA 4M75C 3V7SA 1X01A 4R0KA 2BTTA 4AH9A 2NVXJ 2E2PA 5C4JJ 2XRLA 1QBJA 2PMHA 3L2WA 4PJOC 3CP8A 5TKYA 4ZYDA 1U4BA 2CZ1B 4BJ6C 4WXDA 4M3GA 3KNTA 2DK3A 1WIEA 1A35A 2ZM6K 5BRHA 5LBQA 2FRWA 3CC4Q 2RJFA 3BDPA 1E3PA 2XAQA 5CR2A 3AY9A 1O1WA 3C7NA 2FBTA 4FWPA 4JNEA 4EV0A 1BOTO 3OS1A 2Q97A 2CYYA 4EEFG 2GFAA 1SAZA 4WQ4A 1VQLQ 2E3IA 2CS3A 3G1MA 1WSUA 3CCQT 1ABQA 4CJ7A 4EHUA 5EG0A 2E1CA 3CC2T 1Z6TA 2BDPA 2ZO4A 4MFBA 1NJIO 5IOZA 4FM0A 2V1RA 5CKDA 4A4KA 3SQ1A 1NYGA 5J1RA 4HVWA 3M3ZA 1SVLA 1JBMA 3LDNA 4ZYGA 4J01A 2QWNA 4HTUA 2DY4A 1K73C 4HVUA 4OMPA 1YI2A 3V9UA 1WOQA 4IHSA 4M7DF 4P1WA 3UKRA 2NRAC 5HKCA 1Y1WJ 3GLLA 4PUOA 1X69A 3NH0A 1C0GA 1YQMA 4B3RK 2RHIA 3MEGA 3FM5A 1HKTA 3TQ7P 5J2QA 4C0FA 2IGNA 2XO7A 5IHKA 2W10A 1U3EM 4FSVA 1G99A 3KKSA 2RI3A 1TWBA 3ZQLA 2QLZA 4J83A 2ZE2A 1KFZA 5J3BA 4BE1A 4A2UA 2ROTA 2UV1A 2E1NA 2HPIA 1KYWA 3L3VA 3CMAI 1KLNA 3BY6A 2KLAA 4MNUA 4DQIA 4M77A 2HU9A 2Q36A 4D8KA 3HP6A 2O4XB 1JJ2A 2YNGA 2HVHA 5ELZA 2OV7A 3ZMVA 4OMZA 1R9TJ 1UJYA 1IG7A 1MMAA 3S15J 4A3JJ 3A01A 3EZWA 2Y4YA 1SD5A 3JREA 4FM4B 4AHUA 2E5ZA 1KQ8A 1QZEA 3H3ZA 3KFVA 4OMYA 2I5JA 1TTHB 3L1PA 4QVZA 3MZHA 1JCEA 4RAZA 2OAWA 5D8LB 3CCRT 2A3ZA 4ELYC 3OYMA 3GTJJ 5M5YJ 2Y90A 1XHXA 1TSFA 1ITYA 2M1BA 4N0AC 4HKEA 1M2OA 1J5YA 1XPXA 1T0JA 4EAHD 2RQTA 4EJZA 4PJOG 3G4SI 3VS6A 4IQJA 1YTYA 4F93B 4JK9A 2HNYA 1OH6A 1W5CC 1ZBLA 1VQ8Q 1N32K 3CCQN 1HKBA 2ME0A 1ETQA 3CC2N 4DEYA 1CXUA 2UXNA 5KYXB 3N4PA 1WHUA 1KG7A 3WE3A 2DVEA 3AVLA 2KIMA 5C44J 4JD2B 4JBAA 3GTOJ 2ISZA 1XUPO 1GHCA 4KKOA 3K5OA 4ID1A 2MLKA 4FJ9A 5LJ5d 2EFPA 2P0WA 1GV5A 3J7YJ 4F2RA 3Q0WA 4L18B 2V51B 3IDHA 1Y8QB 4JI1K 2D8HA 1AKHA 4B22A 1W36D 2Q8KA 1I07A 5TKWA 3NF7A 3FK6A 2WAEA 3S17J 2CH0A 4PJ0C 1XDSA 4FU6A 3F22A 4OOIA 3BR1A 4B9MA 3ZFJA 2LBFA 2FPEA 1YI2T 4L5EA 1LAWA 1RNHA 3LWLA 2CP2A 4NB5A 3AO2A 4E1NA 4DW6A 4H4KC 3ONQA 2XY5A 4DYRA 2DPPB 4CK2A 1HSQA 4C92A 3GNGA 4KAZA 1VQPI 5EVZA 1LWFA 1EA3A 1FXXA 4NS5A 1KG3A 4IO8A 3ZSWA 1MWKA 1PD0A 4BU2A 1UHFA 3CCMA 4D9JA 3S2DJ 2MG4A 2ATQA 2JZ2A 3QEVA 4XKVA 2H94A 2MD5A 3CCRN 2PZSA 2ZJRL 3VU3C 2OQGA 5KCHA 3HIFA 3NF9A 2VVKA 2MIOA 3W3DA 2E71A 5BQTA 1WJ5A 4CJEA 4FJJA 2L3SA 2QXFA 1UECA 5AQZA 2B8AA 2DFFA 2QWRA 2DRMA 2A6AA 4WCEL 3JRCA 4EVVA 3HB9A 4RB1A 4EFHA 1NKBA 3WEEB 2RQWA 3IH3A 2NRTA 2PBIA 3V8LA 1IC8A 3I8BA 4DBQA 4CZZA 3PIPA 4FJKA 1OI1A 3PL8A 5E17F 3SPZA 4ENMA 4M3ZA 4FASD 1S1UA 2Z1HA 2Z3YA 2O8CA 4F92B 4JI3K 3IH4A 1TW3A 2NS7A 2JMAA 4N76A 1S8NA 2IG0A 3GIBA 5H6RA 2VBWA 4IFEA 2O8DB 4CF9A 4QWQA 1AT1B 3NHNA 3OH6A 4DBHA 1UA0A 3FF5A 1QVUA 1NJWA 3QYFA 1P59A 2I7PA 5B66C 1XDUA 1WKMA 4E2FB 2Z33A 3M5AA 4LFAK 2F2XA 1X9SA 1SFOJ 1CLQA 5GAOq 2OTLQ 4C8QB 4LJZF 3M5RA 4KREA 2K5FA 2O7OA 2G8VA 3NGYA 4ABZA 3U21A 1R5GA 1YI2N 1XI1A 3TWHA 4E9HA 1WJSA 3ZSVA 3S2HJ 1GLJO 3SWNA 3GWZA 4XNFA 2DYSH 4JLGA 1OEBA 1JUPA 4JKDA 2KBTA 5FU7C 1FT9A 3X26B 1QPMA 3G2BA 3PMIA 4EJVA 3CWUA 3HK2A 2OJED 2XIGA 3DB4A 2YX7A 5FKLA 3AG1H 1OCTC 3K0LA 4C1NK 5EG2A 4FLUA 2F8TA 5BPLA 2ZNZA 1ZREA 3QBYA 4YPRA 3UKUA 2CWEA 4BR2A 4BD3A 3KD1E 4RGSA 4C0GA 1VSHA 2FO0A 3BW1A 1C1BA 4Y1CA 2X51A 2YUQA 2KRFA 3VEXA 4LDWA 1VQNI 4F7UE 4HDVA 5AQOA 3TAQA 4J6WA 4GW6A 2DNUA 2VPLA 4BY9C 3CCMT 3F8MA 3IRXA 3BDUA 3RR8A 5JVGF 4DOVA 1R58A 1OQYA 3GP8A 3RDVA 1CF7B 4DTSA 2MOXA 5E18F 2O8EB 3A8LB 1NG9A 1YS6A 3N97A 1FC3A 4B23A 2RNJA 2K4JA 2L3RA 3WE2A 3OW2S 2MWOA 3TEEA 2R7ZJ 1IXCA 3L4IA 1OMIA 5JLWA 3MAJA 3DBRB 4B3TK 4CK1A 4EATA 3TEDA 5JVHL 5LJ3e 3O8MA 3T1AA 3WGHA 1UAAA 3F8CA 2E5QA 5F1JA 2A68F 4C0DB 1GVJA 3KWIA 2Y69H 2K40A 5EEAA 4GVMA 1C0WA 2PVDB 3U23A 3D0SA 1FKPA 1XOVA 5GAEJ 5LJ5f 1FSHA 2O61A 3RR7A 1VQNQ 2X9HA 3FLCO 1UELB 4ELZC 3KZYA 2DMNA 1M90R 1WAJA 4ZDOA 2NS0A 4IXAA 5GAHP 3ZETB 5BPIA 4DB3A 3OMGA 4I7FA 2AS5F 5FLXK 5KYUA 3ULEA 3PE0A 1TS9A 2K9QA 2R7UA 3QINA 4BWMA 4AIDA 2HZTA 3FZKA 2E20A 5CIUA 3MEEA 3VETA 1R4MB 2VB6A 1GL5A 1Y8RB 2B4JA 4KTZA 2IVPA 1O7FA 3E5XA 2O9LA 1IKXA 4DTPA 1U04A 1SZ2A 1X6BA 4MO5A 1K8KA 4CCHA 1X3ZB 4FJXA 1DGKN 5GJVB 1IN4A 4BY6B 2DERA 3CUQB 3MECA 2ECCA 4WF9L 2X3XD 5HVQC 3A0BC 5GAN8 3CVSA 2L4AA 4CEZA 2EW3A 3HSFA 3CCYA 2LOOA 1FTTA 3BG3A 1LQ1A 3CCMN 3IHOA 3RKQA 4TV7A 2O88A 4IO9F 1RR8C 3EGDA 4M7DA 3KIOA 3O4QA 4C92G 3OR1C 1ZRDA 2R7QA 2JNGA 4N9IA 1W5TA 4V19K 3EYYA 4G7OF 1IG9A 5FB2A 2CW7A 4M7YA 2G8HA 1JXSA 1XGSA 3KBGA 3L3UA 5AQIA 2DA5A 3NTHA 4BVOA 3ZX3A 1MSEC 3W6JB 1J0RA 3I55I 2HOAA 3K0SA 2R5YB 3E5QA 4OMOA 4HX4A 2JVGA 1XNIA 3RMAA 4HF1A 2OPPA 2DE0X 5F04A 2HTSA 2OFIA 3LANA 4V2GA 2HS5A 1WNLA 3RRHA 4B1XB 2D0NA 2ESNA 1ZSZC 1NK3P 1PM3A 4JYKA 2VGMA 3JB9J 2CS7A 1DKGD 4OB3B 3CXCM 2X3WD 4PFPA 4HX8A 5LJ5h 2IVMA 2A07F 2XY6A 4FZXC 4EA4A 3OA9A 1IB8A 1LNXA 1S3XA 3HKSA 4CC7A 4BNCA 3T8TA 5LD2C 4B1WB 2A6TA 3FBNB 4PKCC 3JCMd 1HU0A 1Q7YR 2PTKA 4FPAA 3DPUA 3HFNA 2YRCA 4E7KA 3EG9B 3CJCA 2M0MA 1FX7A 4ELTA 1Y39A 2BY2A 2LJ3A 4EW0A 4IOXA 3T19A 4W5QA 2VN2A 4CEAA 3L6QA 5DS9A 5HDKA 2EQIA 2A7YA 3I55Q 3F23A 1KFSA 4EM2A 1W70A 5AZIA 4FVUA 3DEWA 3HM5A 5KYYB 3IFRA 2VKNA 1KYZA 3DU6A 4A0ZA 1LFPA 3DF8A 5EX5A 2DIQA 3Q5FA 2IAIA 2RKIA 1GLEG 4E6RA 1PVEA 3SQ2A 4OIRF 3EG2A 4G9ZA 3ZQQA 4C8MA 4NHJA 4C8QD 1RDWX 3E9LA 1Y64A 2OZ6A 4CCKA 2HVIA 4FLWA 1VQ6Q 3M58A 2F5TX 4KHPK 1REPC 1IH7A 3L4QA 4IJNA 4EM1A 2VKEA 3NWSA 3L9FA 1HCRA 5JHFA 1FYLA 2OCCH 3A03A 3CCVQ 1NG2A 3KP4A 3BG6A 4J19A 1FZPB 5AQFA 4YOQA 1K73O 4F7UA 2JVVA 2E2HJ 2QASA 4L5GA 5JI6A 1KD1R 3JAME 1A5XA 3IRRA 3C6HA 1FIPA 4RB3C 2FPDA 1S1VA 4BE2A 2XAUA 2NS8A 5A0GA 1TK5A 3K4NA 2DXTA 2M45A 4FK4A 1UDLA 4CEQA 5LEKA 2ZCFB 3I53A 3NDKA 5J8CA 4Z4IA 2V1XA 5K7ZA 2DM1A 3H1VX 1R00A 4M3RA 1IJJA 1JHFA 4HUGA 4WFAL 4JI0K 1A5WA 1R22A 1R1UA 1D5YA 4L9JA 3AO1A 3VEOA 4L9VA 1OH7A 2KIFA 2O3FA 5DD8A 2VUMJ 4C0DC 4W5TA 4EPCA 1EIFA 5CQEA 4QKUA 1WSFA 2O5RA 3P8HA 4J9HA 4M6XA 1XGNA 1UJ0A 4XQ3A 1IN6A 1VYUA 1Y0UA 5E84A 1SHGA 2JTMA 2QDLA 4H0TB 2KMTA 3MN2A 4DR5K 2C0IA 3OYCA 4YFNF 1XMQK 4LXCA 3AAPA 1YX3A 3FWEA 3SBTA 1M90O 3HFOA 2KRHA 1NGGA 2FF6A 4I0AA 4XRSG 5E20A 3DKYA 2DYRH 2NZTA 2BUDA 4LSLA 1Z25A 2QWMA 1FPQA 1ARKA 4CI6A 4YFXF 2NRXA 3VQ5A 2KFNA 5KAIC 1XWLA 1FBQA 1T98A 1N6QA 1N77A 4JKFA 2G9WA 2HHHK 4W5OA 3NE6A 3LL3A 4RG2A 2E1YA 2JT1A 4CVNE 4EMKA 2WFBA 3UA6A 2DMPA 4A5NA 3R9PA 1VSFA 2CG4A 4NC7A 2O8BB 1Y7XA 4M74A 2XU8A 3HPWA 3F6VA 4DUYK 2HVSA 1AA7A 1FIAA 1R0CB 5IXFA 3CUQC 3CWAA 3L2ZA 2I5UA 2FNPA 2VE8A 5K7FA 4IWVA 3CETA 3LDPA 2QTDA 3KTUA 4DQSA 3TSWA 1L3LA 3KP5A 1Y96B 4M78E 2FF3B 3M8PA 5DUKA 3L2RA 2OQRA 4N4GA 3UIQA 1ZA2B 2ZPIB 1POGA 3THVA 1VQMQ 3BG9A 1QTMA 2UUCK 3WHBA 2GZWA 2JT4A 2HW3A 2P4WA 2W41A 5GTIC 3CCSA 1Z67A 3FHNA 4DTUA 3RMBA 4DV6K 5HROA 4DR6K 3LFUA 4YDUC 2V9PA 3TKYA 1HX1A 3CXCS 3JCMf 1X1CA 3I8DA 3KYDB 3CMAA 1K73U 2Z0WA 1IUFA 4YIIA 4BR7A 4FSSA 3G71I 2LMDA 4GV3A 3AAQA 1RAFB 5KCOA 5FJ8J 2P7CB 3GMEA 1KAZA 4X6AJ 3RPUA 4RB0A 4O4GA 4RGRA 2MGQA 1SQKA 1I3AA 4J7FA 3Q9SA 3LGFA 2KKOA 4LD5A 1SKRA 3DEUA 3U1KA 1JXOA 4AFQC 4A4HA 4RW7A 3T7ZA 1HQUA 4BWJA 3PNTA 1AWJA 1LEAA 1LWYA 1M1KC 3EAEA 2ZMEB 3EHQA 3MWMA 4LFBK 4BXUA 1S5JA 3UKRB 4EVIA 1PU7A 1Q7YO 2M51A 3QP5A 3TSQA 2D5RA 4ZDLA 4CF2A 2J5OA 1XJWB 1R0BG 2W84A 3KZBA 4JI6K 3GLXA 1ZBXA 1HJOA 4YY3K 1WH7A 1QCFA 3G4SA 1N25A 4R1HA 4ZC3A 3HM9A 3AT1B 3CJ9A 5H20A 4ILHA 3GCMA 4IOAL 4XICA 1JLGA 1PRLC 4LUDA 5D6WA 5F08A 1OFCX 4M77B 1NJYA 1X75C 5DM7R 2DO3A 3JRGA 4W1UA 4MTDA 1XQSC 5TISC 2KKZA 1M90U 1BB9A 1K6YA 5DM6F 1MH4A 1ZK8A 2ZNYA 5HNFA 3PNWC 1RILA 1NPPA 2OAUA 4Y92A 2UUBK 1BC7C 1IO6A 3H3NO 2PG4A 3P8BB 1QHHD 1LFBA 2R7XA 2EFQA 1NLPC 2HVRA 1P7MA 3FIFA 2HMIA 3P83D 1VZ0A 4E1JA 1DU6A 2EWSA 4DBRA 4F17A 1E17A 4KIFA 2NNWA 3DQVC 3BDLA 4HVJA 4KHSA 4CD3A 5IPAA 1VQ9T 1K0SA 3EUHC 1KQ0A 2HI3A 1P6RA 2RI5A 5GAEP 3LX7A 1EV7A 2EFNA 3P5JA 2DDBA 3RRGA 3JAMZ 3REBB 4KH5A 2DOFA 3JCMh 1U8BA 3MZYA 3DTKA 2F9TA 1TXQA 2J4RA 5EF6A 5JLXA 1KD1O 3NVKA 3RWUA 1YVNA 1IJWC 3BWGA 1VQPA 2DT7B 2FUG2 3CCST 4E0DA 2L7FP 1UAXA 3AGKA 5KHDA 3PGGA 2HFHA 1L3SA 2H56A 4B1VA 2CV0A 3AA2A 3OTOK 3VOVA 3JRZA 4JV5K 2WC2A 4II2A 4JLHA 2K9LA 4DTOA 2NRRA 2HBJA 2VWKA 3RSNA 2Y1JA 1MH3A 4J2EA 4W5RA 2ADUA 4NUBA 3EE8A 2JA8J 2HKOA 3JCMQ 4WYBA 3ASNH 3MXIA 1WDXA 1C6VX 3LH5A 1LVAA 3QYHB 2L01A 5BMZA 3C2HA 2OJ2A 4Z02A 4I6ZA 2M87A 4LB5A 2FZKB 4KFBA 3GZ5A 1X19A 3K70C 1EKEA 1OYIA 4JRQA 4CJ5A 2LBFB 4CZKA 1Z77A 4GRIA 2FF4A 1T6DA 3JSPA 5KYWA 3ALYA 1WSJA 2TRTA 3H0DA 2PJRB 3LSPA 3TBIA 2HHSA 5IOYA 3H8ZA 3SMPA 4BG9A 1M8MA 4JP0A 2CJJA 3G4ST 1YNZA 1KC8R 2VQCA 2NWMA 1Q7YU 2M1HA 1NGEA 4H4MA 1QVGS 2RN7A 1NBWA 1NK9A 2OTJQ 2E88A 1QKWA 4GV9A 1VQ4I 3CCLI 1B4AA 3ZL7C 4ME7A 3I33A 2JA6J 1R8OB 5HOOA 1NNEA 3ZN1A 2P8TA 3E01A 1VQ9N 4A3MJ 4NO7A 2VOOA 5E1ZB 2QGGA 4YOUA 1ERDA 4YFUA 5D6FA 3GFJA 4M7AB 2K7LA 1IREB 4N47A 1QNTA 3X25B 2E2QA 3MMYB 2A69F 1H8KA 2P9KA 3M0PA 2F5DA 2P0PA 1FTZA 1NLVA 5C10A 2ED1A 2CGKA 2A1RA 1E3MA 3CCSN 2HHTA 4B9UA 3JRIA 4M78A 1S1NA 4BR9A 3NMUA 2E2OA 3QEWA 1U78A 4ZNXA 5JVTA 1W7PD 4Z94A 1QPIA 2O8CB 4A4EA 1ATSA 2QA4I 4AVPA 3ID6A 3Q7BA 4KGXB 2EB7A 1S9GA 2E5NA 3H1CA 3JV3A 2QM3A 4IXCA 4CGJA 5IP9J 1VQPT 2XAJA 3CXCA 1NU0A 5A2QE 4BG8A 1KVAA 1ACMB 3RPQA 3ERMA 4UV8A 4E7JA 4IZZA 3UF4A 3JCMJ 3ENOA 3FIWA 1L3UA 1I6XA 4PUSA 1B34A 5FD6A 2OYQA 1W97L 2E7XA 5E1WA 3MCAB 1ZA1B 2D5VA 1M9SA 1KD1U 1IKVA 1W2BM 2BY3A 2HEQA 4A3IJ 2IP2A 5M5XJ 4CGHA 2D0PA 3SDGA 4I2OA 3SWNB 1WBDA 1D8KA 3T0YA 3F9MA 3VYUB 2FBVA 5GAN6 3BJOA 4LNPA 4JQFA 1SF9A 2YLBA 3G4SN 4YG2F 2FZCB 2YV0X 2D4WA 4JKCA 1JEGA 5HS9A 1RKTA 2Y75A 2F96A 2ZMEC 4A0YA 4XTWA 1RDDA 5M3FJ 2QA4Q 3WXIA 1ZBJA 3QU6A 3VF4A 2VJIA 3HJEA 1FW6A 3UKUB 3CCUT 1QO0D 1QHTA 1RBTA 3CQXA 3MCZA 5EEGA 1H89C 1BQMA 2L7MP 2NUTB 3M53A 5C4XJ 4XKBA 3SAHA 2ZZDA 2F5EA 5BPDA 1HW1A 3WGIA 3DMJA 1M27C 4N9HA 4A5AA 1KG5A 3MEXA 5M1FA 3P4IA 3UE5A 4CZMA 4DQ2A 4MDXA 1HPZA 3I0SA 3K1NA 3LA2A 4FCYA 4U67L 3CWSA 2DN0A 5GPAA 5E1XA 4UQGA 3OB9A 3KP7A 3LNQA 3QDFA