3OYIA

Crystal structure of the pfv s217q mutant intasome in complex with manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyiA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyiA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyiA03
4DFJA 1NK0A 1HMVA 3QNOA 3VN5A 3SQ2A 4OKEA 4IFYA 4CEAA 2X74A 4CJFA 4CJVA 1TAQA 1X9WA 3UT1A 4LH5A 4OGEA 3OS0A 4FJNA 4N76A 2Z1GA 2DFFA 4CK1A 2RI3A 3VQ5A 3L2UA 3QESA 2B4JA 4DSFA 4KTWA 4PY5A 2B5JA 5FDLA 2P0KA 3KUFA 1X9MA 1WSHA 3ZSYA 1LWEA 3C6TA 4A4HA 3KLIA 4LSLA 3BGRA 1SL0A 5KCHA 3ZT1A 4M3TA 1NK4A 3AA3A 2QXFA 3NHGA 2HHSA 3LDSA 4IDKA 3NGIA 4BDYA 4O5BA 5SWMA 3QEPA 4DTMA 4CFBA 4C5EA 2DFEA 4FW1A 2YHBA 1NJWA 3K58A 1IO2A 4JLHA 2L89A 4B9XA 1N27A 3ZCMA 4KHNA 3LZIA 1UWBA 3AVMA 3L2WA 3EY1A 4FJXA 2BE2A 1XWLA 3JSMA 3DRRA 2XY5A 2YNFA 2YNHA 2X6NA 4KHSA 3ZT2A 3G10A 3FEOA 2YNGA 3SQ0A 2RJEA 2FHDA 2EQJA 2P5GA 3K59A 1KRPA 1EXQA 1S1WA 5CZ1A 2KTQA 5C6SA 3LP1A 4HCBA 3L2VA 4DU4A 3G0ZA 3QNNA 3VQ6A 2R58A 4KREA 2QQSA 4KB1A 2EKOA 3OYBA 2LVMA 2YRVA 5DMRA 4IURA 4OJRA 3NE6A 4E0DA 5KRSA 1VSLA 3PY8A 2BANA 3U3GA 4FYDA 3FFIA 3PV8A 4E7KA 4PLIA 2I5JA 3RMAA 1I39A 3DB4A 2EQMA 4W5QA 2VG7A 5D6XA 4H8KA 3QIOA 4AHTA 4PWDA 2YNIA 4CJ3A 1KVCA 3ASMA 4TSXA 1S6PA 1CZBA 3KLFA 2IC3A 1VSDA 3KJVA 1VSEA 1WSGA 1FK9A 2HNYA 4DTSA 1QE1A 3VQ7A 3SCXA 1IKYA 4LH4A 1KHCA 3LALA 2FBTA 3LPTA 1Z26A 3JYTA 3ZEHA 2YV0X 5I3UA 2O4XB 3H6ZA 3KLGA 1J53A 1L3TA 5T7BA 4CJKA 4FVMA 4N47A 3O4NA 1JLEA 3AVKA 2EQUA 4CF1A 3KK2A 1BI4B 2D0AA 3I8DA 2M16A 2O4XA 4L59A 1IG9A 5J1EA 2HHQA 2LSNA 3K57A 4BACA 1TL1A 4O0JA 3O3HA 4E7LA 2D9TA 3TAEA 4CFAA 3K5OA 2G8IA 1TKZA 3OYCA 5K14A 4CFDA 4KHYA 4J2AA 4O0IA 4FM2A 3TAGA 4IUQA 2XRIA 4FZYA 4BE1A 1JL1A 1I3AA 4F2RA 4KKOA 1KCFA 3AO4A 3ZSRA 4N5SA 4AHRA 4IG0A 2RHIA 2LTOA 4ELTA 3MEEA 3H8ZA 2IAJA 1FKPA 3QEVA 3KTQA 1XI1A 1RDAA 1FKOA 4PL6A 3AVJA 2XO7A 1N5YA 4ID1A 2XY7A 3BDLA 4CGGA 1MHNA 4CJWA 3LP3A 3QKJA 1VRUA 1NJXA 4QQGA 3K2PA 1QHTA 3ZSOA 3V1RA 4J2DA 2WONA 4CIFA 1LWCA 2WOMA 3HSTB 4FK0A 2F8SA 4KI6A 3V4IA 3KLEA 3LAMA 4C5IA 4CF8A 3HVRA 4OVLA 1SKRA 1LAVA 3ZSVA 4FJKA 3NH1A 4DFMA 4DTXA 4BE0A 3TARA 1VSIA 4IBNA 3HK2A 3OYIA 3V9WA 3DLHA 3NFAA 2BGGA 2G3RA 2VYTA 3HT3A 3V9XA 1QTMA 4Z4EA 4BE2A 2F8TA 4A4EA 2L3RA 4GY5A 2ETJA 4FXDA 1HNVA 1C0UA 1B9FA 1WJRA 4FJ9A 3CFPA 4A4GA 1ITGA 1ZYQA 4CHQA 2Z1IA 3MAQA 3HP9A 1DTTA 1TGOA 3SUPA 2IG0A 4DQIA 4CK2A 3LWMA 4ZTJA 3OYGA 2RJDA 2DY4A 4CEQA 4HUEA 5CYQA 2DTUA 3AVCA 3CFOA 4ELUA 1HPZA 4CJTA 3LP0A 1MU2A 2GF7A 4DFPA 4RW4A 2HMIA 1S1XA 3BDPA 1A5WA 3AVFA 5KCOA 3U3YA 4FLYA 2W42A 3D0PA 2Z1HA 3M8PA 3AA4A 3LLRA 1RDDA 2G8VA 4F4KA 2OPSA 3TWHA 3ASKA 4W5NA 2OPRA 1HQUA 3V9ZA 3SD4A 4AHCA 3O4QA 4DF4A 4DMNA 1VSFA 1EETA 4I2QA 3OJSA 4FLZA 1SV5A 1TVRA 4M3WA 1C1BA 3MXMA 3KIOA 4BD3A 1ASVA 3AA5X 1WGSA 3H08A 2M0OA 5C25A 3SV3A 3OY9A 5HBMA 4C8MA 3LGFA 3OYKA 4CEDA 4DTRA 3LGLA 4QW2A 1CXUA 3PX4A 4RG2A 3MEUA 1GOCA 4Y1CA 4NCAA 4MFBA 3NGZA 2EQKA 1HYSA 1TL3A 4FJHA 5C24A 3EYZA 3DI6A 4PQUA 3NTIA 1YVUA 2G8KA 1VK0A 3RRHA 4LD0A 4CF2A 4B8AB 3SPZA 1WAJA 2PYLA 2ATQA 4FM0A 2RHUA 1BGXT 2GBZA 3NTKA 1OZ3A 4M42A 1RBSA 4CEOA 4QVZA 2RJFA 4Z4HA 2G8UA 3MEGA 4RW9A 1L5UA 3AVIA 1KFDA 3UIQA 4B9MA 4Q5VA 3HPHA 3KK1A 3MEAA 3P83D 3KK3A 2VG5A 1L3UA 3MXJA 4BWJA 1RDBA 1D9FA 4EP5A 3MEDA 4ZHRA 1LW0A 1TKXA 2DFHA 2HVHA 4ID5A 1U47A 3TAPA 3DB3A 3PX6A 1SL1A 5KRTA 3HPGA 2IS3A 1WSFA 1HYVA 4CF9A 3OMGA 4CEZA 3HJFA 3DOLA 3S9HA 3SV4A 4MQ3A 4OGCA 1SKSA 2RHYA 2PYJA 3AO3A 2JTFA 3VQ9A 4CFCA 2FBYA 4OKJA 2FC0A 1CXQA 1C0MA 1LV5A 3OYEA 2GFUA 3AVBA 2P5OA 4QCLA 3RMCA 4FJ5A 3V1OA 1ZBLA 2KFNA 2IOCA 3NH0A 3MP8A 2KZMA 4C8NA 3VQAA 3MO8A 2ZD1A 4CE9A 1SL2A 4I9QA 4Y1DA 3AA2A 3I0SA 2K3YA 3RR7A 3DOKA 3QINA 1A5XA 1BIZA 2RHZA 1EP4A 3M9QA 4G1QA 3SJJA 1T05A 2EFIA 3S3NA 3O3FA 3M8SA 1BL3A 5J2NA 2JGUA 3HYFA 3PFSA 3AVLA 4N4IA 4FJLA 1TV6A 1NJYA 4Z4CA 1WAFA 4FM1A 4CJUA 1IKVA 3OYAA 1WSJA 4Z4IA 1XHZA 3P5JA 3CFRA 2RN2A 1DTQA 4E1MA 1HNIA 4B9WA 3ZSQA 4FJMA 3IRXA 1W9HA 4PUOA 1ZBUA 4DTUA 2O4IA 4AHSA 5IAYA 1IKWA 4CIEA 5HROA 5DK5A 3HO1A 1YT3A 3ZSXA 1ZBFA 4FJJA 3NF8A 2LCCA 1WJQA 4I9LA 1Q9XA 3SUNA 3QIPA 2E5QA 4B8CA 3K5NA 4NS5A 2B6AA 1TK5A 4K8ZA 4B9UA 2HVIA 5IN1A 1TKTA 4A4FA 3KD5E 4OPKA 4NCBA 2RJCA 3NTHA 1JXBA 4FLTA 3OYLA 2FBVA 2EHGA 4II1A 1JKHA 2HHUA 3L2QA 1NK5A 4R5PA 2LRQA 2B8AA 4XIUA 1S9GA 1C1CA 2XDPA 1NKBA 1RBUA 3E01A 1RBVA 3PNWC 3IG1A 3WNEA 4H4MA 1S6QA 4CJQA 1QSYA 3C94A 4KAZA 3PO4A 2AJQA 2L8DA 1W0HA 1RILA 3OYFA 1NKEA 3NGYA 3ISNC 3TR8A 4F2SA 1NK9A 5D3GA 3KD1E 1HYZA 2MWOA 4DSLA 5KGXA 4J2EA 3OS1A 2X78A 3ZT3A 4DS4A 1G15A 1WLJA 1Q8IA 3WNFA 3CM6A 4FZXC 3AO1A 1J54A 1Y97A 4CF0A 2D0BA 3F9KA 5EU7A 4QQ6A 2DIGA 4I2PA 2BDPA 4QOZB 4DLEA 3SQ1A 3ITHA 3KLHA 4FLVA 1U48A 3V1QA 1WN7A 3VQ4A 2JZ2A 3ZSZA 1RTHA 2BKDN 4M3RA 3L3VA 3B6OA 4Q5WA 1B9DA 4C8KA 3TAFA 4E89A 5FROA 2E4LA 5HRNA 3NF6A 3OYNA 2R5AA 3FDRA 4DSJA 3QIIA 4DG1A 3UWNA 4AHUA 5HRPA 2RI2A 3NAEA 3QEWA 3IS9A 1X9SA 4CGIA 4E19A 1L3SA 4GVMA 5KTQA 3SUOA 1XNIA 1C0TA 2HHXA 2D0CA 4AH9A 2HHWA 3TAQA 4IG3A 3DLGA 4DQPA 3T19A 5E41A 2XY8A 4FK4A 3LX7A 4QQDA 3SNNA 2M1HA 2IGIA 3V9SA 4CJPA 1HJRA 3RMBA 4ELVA 4O55A 1XC9A 2BIVA 4CGJA 2PQWA 1EX4A 4FCYA 2P1JA 1QSSA 3OYHA 1JXEA 3CG7A 1NOYA 4L8RB 3C6UA 1GOAA 3DLRA 2IDOA 1UAXA 3F70A 2VWJA 1WSEA 3ZSWA 4FLUA 2HHVA 3SQ4A 5J26A 2HQEA 5M9OA 1RDCA 3P1GA 2OZSA 3AO2A 3E9GA 3AO5A 2Q3SA 3LPUA 3VQCA 2QKBA 5CZ2A 1VSJA 4N41A 1REVA 1RT2A 1YTUA 3WNHA 3AVAA 3HPOA 4Q0BA 1BIUA 3QO9A 4DF8A 1BQMA 4BWMA 4EZ6A 1QSLA 4YFUA 4FW2A 4FJGA 2KW4A 3O3GA 2QK9A 3VQDA 4LD6A 5J2MA 1CZ9A 3NH2A 1O1WA 3NDKA 3OA6A 2ZE2A 4CERA 3RRGA 4FLXA 4DU3A 4DSIA 3NCIA 5FRMA 3OYMA 4HVJA 2HQXA 3MP1A 4DFKA 4B9VA 4CCHA 1RBTA 2XHBA 3HM9A 3V6DA 1NK8A 4BDZA 1LWFA 2HB5A 2X4XA 3TAMA 4Z4GA 4IUVA 1C1AA 3T1AA 3SPYA 3GOXA 4IUUA 2E6NA 1SSFA 2XK0A 1QS4A 4CGDA 3L2RA 4YNQA 4E1NA 4IKFA 4B3OA 3OYDA 3C95A 4PA1A 3FC3A 1S9EA 2RKIA 2X4WA 3DRSA 4WE1A 4DTOA 4W5TA 3VQQA 3LAKA 2CKKA 4IUPA 2OA8A 2ZQBA 4RW7A 4CECA 3AVHA 4Z0UA 4C5GA 3KKSA 3QERA 3SUQA 2NLUA 5KH6A 1WSIA 3CYMA 3DLKA 3DLMA 1D5AA 3NF7A 3VQ8A 5JS2A 2P51A 5CYMA 1WNSA 1SKWA 1L3VA 4KHUA 1S5JA 1RTDA 1K6YA 1BCOA 1RI0A 5HRSA 1WJSA 3SI6A 2X6SA 1TAUA 3DLBA 3P8DA 4B08A 2YKNA 5HP1A 1ASWA 4CGFA 2R5MA 2R57A 2RI5A 1RCHA 3Q1JA 1VSMA 3EAEA 4K8XA 4UQGA 4E3SA 1C6VA 4CHYA 4N4HA 1G5VA 3FLGA 5CY4A 4ZTFA 3O8VA 1TK8A 1FXXA 1U49A 4DQRA 3VQEA 2WACA 2OZMA 1T03A 2HNZA 3ALYA 4CJEA 1RT7A 3OVNA 3ULDA 2G8HA 4QAGA 3VA0A 1NK6A 2F96A 2E6MA 3HP6A 5I42A 2QQRA 1HQEA 1UA1A 1R0AA 1GOBA 2D5RA 1IH7A 1HRHA 2RPIA 3THVA 3CM5A 2OYQA 3META 3P8HA 4O4GA 3AVGA 3MXIA 1VSHA 1U45A 4KFBA 3TI0A 4AHVA 2Z1JA 4KHQA 1ZBIA 2GV9A 4Z4FA 4E7IA 4CEEA 4EDUA 1TK0A 4C5HA 4LY7A 3LH0A 3ZT0A 4CHOA 4HCZA 4HUFA 4DU1A 4CHNA 3WNGA 1BCMA 3U6FA 4F3OA 3S6WA 4JRQA 4FJ7A 2HW3A 1UA0A 1RT1A 5KE2A 3V81A 1LAWA 3B6PA 2BUDA 1QQCA 4AILC 2OPPA 3RMDA 3KKRA 2GUIA 2HHTA 4M45A 1B92A 1NK7A 1KTQA 4DWIA 2KZZA 2FBXA 4F3TA 3L42A 1RBRA 2HNDA 4KO0A 4KTZA 1YTAA 2EX3A 2Y1IA 1RNHA 4FJ8A 1RTIA 4IUTA 2PZSA 2VWKA 2DAQA 2A1RA 1LW2A 3CEYA 4DQSA 5C42A 1RTJA 3AVNA 2QKKA 4NYNA 4B9NA 1ASUA 1RT4A 1U4BA 4N4GA 4F8RA 4OPJA 4DTJA 1F21A 4W5OA 4CGHA 3IAYA 4W5RA 4FZZA 1KLNA 2G8WA 4CRIA 1UOCA 4UC4A 4B9TA 1JLCA 4M3ZA 4CJ5A 3SYZA 3C4SA 2Y1JA 5CIUA 2PY5A 4RW6A 3VA3A 2R7YA 5KGWA 4NYFA 1KVAA 2NUBA 3VQPA 1KVBA 2XY6A 3E9FA 4DSEA 2VG6A 1DLOA 3K5LA 3OJUA 2X4YA 5D6YA 1A5VA 2ITGA 1T8EA 1NOZA 5D6WA 1RT5A 2O4GA 3RR8A 1TKDA 3OB9A 4ICLA 4RG8A 3MEVA 1BI4A 4HHTA 4OLBA 3PO5A 1OYXA 3LANA 4EZ9A 3MEWA 1JLGA 3DRPA 4DTPA 2MWPA 3PMTA 2K3XA 2KQ2A 1NJZA 3OQ5A 4CHZA 3QJ6A 3V9UA 3LYIA 4NCGA 1XHXA 1KSPA 4J2BA 1H3ZA 1ZBHA 1BISA 1S1TA 3QLHA 5KI6A 3ME9A 3OMCA 1J9AA 1VSKA 1JLBA 4JS4A 2GFAA 3DMJA 3QETA 4C8OA 4GMJB 5KE3A 4FK2A 3M8QA 2OPQA 3RWUA 2F5KA 4E7JA 4RW8A 4B9LA 2RO0A 4FL6A 3AV9A 4OKKA 4Z02A 4N56A 5FRNA 3L8BA 4M41A 4PLLA 4M3UA 3DYAA 4CJSA 5SZTA 3ZT4A 1D9DA 3OS2A 1T7PA 4M3XA 4FLWA 4KHWA 4HUGA 1Q9YA 3QBYA 4C8LA 4KV8A 5HLFA 2YKMA 1BHLA 1RT6A 4FJIA 1D8YA 3TANA 3S3MA 4DTNA 1X1PA 4CJ4A 3RTVA 3NNQA 4CJLA 4KB0A 5HRRA 3LZJA 3PX0A 4H4OA 2RF2A 3OYJA 1JLFA 4OLAA 5JS1A 3NF9A 2A1SA 4JRPA 3QEXA 5J39A 4CESA 4CEBA 3LWLA 4CHPA 1KFSA 3NBPA 1JLQA 3VQBA 3PUFA 4HTUA 4FU6A 4BDPA 3TABA 3CQ8A 1RT3A 3EZ5A 4KI4A 4DQQA 1S1UA 3D45A 3DLEA 4GW6A 1JLAA 1JL2A 3SZ2A 4CK3A 3HXMA 3QEIA 4IFVA 1N6QA 5J2QA 4X34A 4EP4A 4HCCA 4LSNA 1SUQA 1S1VA 2JLEA 3A2FA 3K5MA 3L3UA 1Z25A 4CIGA 4DLGA 4DS5A 3M8RA 5C0MA 3MP6A 4OVAA 4KTQA 3HL8A 4KRFA 1J5OA 2YHAA 1IKXA 1EKEA 1OZ2A 3I0RA 4I7FA 4O44A 5J2PA 3S3OA 1VRTA 4KPYA 4DSKA 1BQNA 3MECA 1U04A 3T3FA 3DM2A 1NKCA 1OI1A 3LP2A 4E7HA 4CJRA 3HVTA 3PMIA 2KFZA 1KLMA 3F73A 4M3YA 1CLQA 2DIQA 2LDMA 4NZGA 2G8FA 2X35A 4B9SA 4CEFA 4JS5A 2RHXA 2E6LA
chains in the Genus database with same CATH superfamily
3A5MC 3EGXB 4IFYA 2L54A 3FXMA 2EIFA 3K70D 2Z1GA 4A54A 2DXUA 4DUYK 2DDBA 3EHQA 2OC6A 2RI3A 1X69A 3DJCA 1SFUA 1K9MC 4A3MJ 4FSSA 4EFHA 1M1KC 3F8NA 3CQYA 4CCOA 2L2PA 3KWGA 4MIMA 1LWEA 2P9PB 1SVMA 1R4NB 5EEAA 2QYZA 3GPLA 2JWLA 4AIHA 1SL0A 4ZDLA 2HD0A 3TSUA 4H5WA 5KCHA 3ZT1A 4M75A 1RRSA 3AA3A 4N0BA 3LDLA 2P9LB 2HHSA 1WZ2A 4YY3K 2F5TX 3MZHA 2PTKA 5CKHA 4AM3A 2MLKA 1KC8C 4RA2A 1U2WA 4LUEA 3VFZA 2VXDA 1BO5O 5CVIA 4ON0A 2HZDA 1Y8RB 4B1ZA 3B6AA 4WX9A 3IH7A 3RYRA 2O3FA 3D7SB 2W4SA 4ABZA 1HW1A 2Y9YA 3M5RA 4D9JA 4FYVB 5DYMA 5AIQA 1SF9A 5FU6B 4CCJA 4YPRA 4MQ9F 4BR4A 1QKWA 3CC4A 1SFXA 3L2ZA 3DRRA 2MA3A 3LWIA 2YNFA 1QVUA 4O5VA 3ZT2A 4K43A 1BWFO 3K59A 1RUWA 4FASD 2EZIA 3WTXC 4I7HA 4WFAL 5C6SA 1R49A 1KG2A 4M78F 2XGDA 5M5XJ 3AAFA 1QVFP 4HCBA 4DU4A 1V1CA 2DO3A 2M8GX 2R58A 2H8WA 1CSKA 2EKOA 3OYBA 4OWRB 2Q8KA 2X48A 5DMRA 3HOYJ 4A63B 3NE6A 5H6RA 1VSLA 3GUDA 2BANA 1YJ9I 2HXIA 4FYDA 3DCFA 2RHKA 3VTHA 4XRSG 2KFDA 1X9JA 1XB4A 4P1WA 3UNGC 4X66K 3GTOJ 3HYIA 1UHWA 2NRTA 1K76A 1QGPA 1WVRA 4J9HA 2WUSA 2EQMA 4W5QA 1M3QA 1W4SA 1J0RA 1IN4A 4XLAA 2NZTA 2V9KA 4QPOA 3CMEA 4F92B 1UB9A 2JMAA 2AA4A 1KZHA 2WB1N 1ZRDA 3K4KA 4AHTA 3WGIA 4C8QD 5CCAA 4CJ3A 1W0UA 4TSXA 2M4KA 1K9AA 5AQOA 1FC3A 2XKPA 3THYB 2EAYA 2DJQA 5LGNA 4LF7K 3FJ5A 3T8TA 3CCSA 3RZOJ 1Q86O 5GANd 4G12A 3U23A 4Z89A 2PZ1A 3L1AA 1FK9A 1E4GT 2EQIA 5IT9Z 2HNYA 5K7ZA 4KITB 1PG5B 4LF4K 1X58A 1IKYA 5GAOp 1IHWA 3SWNA 4CZGA 3BROA 5E17F 1U5TA 4OMQA 4Y33A 3ZQIA 1USTA 3VV0A 4BRHA 4MZPA 3KLGA 4I6MB 1W2BA 2CP5A 5GAN3 1VQKI 2STWA 3CPWS 2F2XA 4CVNE 4FVMA 2IGMA 2XAJA 1D1BA 3W2VA 2FPDA 1YWOA 3KK2A 1EBMA 1X2QA 4G9YA 4CZKA 1WNLA 3CJCA 3R6SA 2O4XA 1D5VA 1YJNA 3L4IA 1IG9A 4FPBA 5J1EA 2O8FA 2HHQA 4FL9A 4BACA 3BZKA 3M9AA 1WX6A 5EZGA 2EZHA 3JAMO 2DRMA 3TU4K 4FWKA 4CFAA 2G8IA 1VTNC 1OH8A 3C0CA 3OYCA 4KN4X 2DZCA 3G6EA 3FXQA 3VYSB 3TBIA 3IC7A 4IUQA 3LSKA 4AMCA 4FZYA 3CWSA 1I3AA 1LQ1A 4F2RA 2BXYA 2CT3A 1KCFA 2EFPA 1ARKA 3LW5E 1SD7A 4N5SA 4AHRA 5H1SQ 4GYGA 4JK1X 4XKBA 3K4JA 3M8EA 4IG0A 1TL8A 3I55T 1EJ9A 4D5FA 2AKLA 4ELTA 2KGTA 2WBMA 3MEEA 3H8ZA 4OFHA 2FG0A 3QEVA 1XI1A 3R6MA 3AVJA 4K42A 4M3FA 4M72A 1Q82O 1QVGM 4NC6A 4VUBA 4JK8A 1GCPA 1K78A 3F8BA 1Z1DA 3TEDA 1MHNA 3EG1A 4JI2K 1DKGD 2CQQA 4BUPA 4Y3OA 3CW7A 3CCJN 4JYAK 3VRZA 2A42A 3V1RA 5CVVA 4CIFA 3V4IA 5AQGA 3LSIA 5M5WJ 3K9JA 2BOLA 1WB9A 2PEXA 1GLBG 1KG4A 3O6WA 2B0LA 1EH6A 1LAVA 3MVPA 4J83A 3ZSVA 4FJKA 4HPQA 5FFZA 1HKGA 2YUPA 4DFMA 2AKKA 2ME0A 2OAUA 4FWMA 5GAEJ 2F9WA 3TQNA 2ELJA 4A57A 3M56A 4XTYA 2VKNA 1VIFA 5A2QO 3DLHA 5L23A 5F1RA 1GUUA 2VYTA 4DR3K 2F5VA 3HT3A 2E1OA 3V9XA 2YXYA 3NAUA 4IIOA 4LMYA 4BE2A 1N3CA 2F8TA 3JCMc 1LKXA 3H3VK 3J81O 4FXDA 3BTJA 1C0UA 3AG3H 3JRAA 1KA8A 4MO4A 3HGGA 4MZMA 3CFPA 3CPFA 2A5YB 4N9IA 3MN2A 1E17A 3SFMA 1QQOA 4Q48A 2CUJA 5LJ5f 2UUBK 5AJ3K 1YITN 3CC4I 1POGA 2K3FA 1VQ8A 2NOZA 2WBNA 5ICGA 4BR9A 4DQIA 1WJBA 3E66A 4CK2A 2RN7A 4ZTJA 1H8KA 2UXDK 4QKUA 3ESWB 2K9SA 3V7CA 1KQSS 5CYQA 1FX7A 3ZQGA 2OAZA 5KYXB 1HPZA 2O03A 1F4KA 3LP0A 5B66C 1U9NA 2Y30A 5CR2A 3ZMZA 2JXBA 2FLOA 4EMKB 4QLCU 3VODA 1S1XA 1DP7P 4M9SA 4PJOB 3RSEA 3TGNA 3Q9VA 3H0FA 3JRFA 4KISA 3WU0A 3F23A 4HDVA 4JZ4A 3AA4A 1WH7A 5JVTA 3DBRB 1GBQA 2MGQA 5IXFA 1Q86C 1YIJI 4EJOA 4M9ZA 2E35A 1XMOK 1SG5A 3L2CA 4W5NA 4AG2C 2OPRA 3H5NA 4ZGJB 4LD5A 3J80E 4EJVA 3SD4A 2DZ9A 1MUNA 1UMQA 3LOCA 1VIEA 3KFWX 4PK4A 1HA8A 2KK4A 1J09A 3JV3A 1NLVA 3U4LA 1TTYA 5LGTA 2VL8A 1GXPA 3C3WA 2P4RA 5JLHA 2HDCA 1XGMA 2M0OA 2EILH 5C25A 3IQLA 3CI5A 3A0BC 5HBMA 3LQQA 3UKRA 4XLEA 3LGFA 2PVOB 4ENMA 2EGCA 4DTRA 2OCEA 4M7DE 4J8OA 4C30A 3WXJA 1JXMA 1GOCA 1N8RO 5DM7L 4MFBA 1E7OA 3RMSA 3JREA 1O3SA 1ZSZC 4DBFA 3IRQA 4F3QA 3J7AO 1RNLA 1R5HA 2ZPHB 4H0EA 1LOTB 2KIMA 3CCRT 3NTIA 2QAZA 1YVUA 3SK3A 4IF4A 1BC8C 1T98A 3ZQLA 2H94A 3SPZA 3PIOL 3PGGA 1ABOA 3FMQA 1YN8A 4FM0A 5CHIA 1UGRB 4V2GA 2AS5F 1SPKA 3ZMDA 1OZ3A 2CP0A 3CUQA 1E3PA 1WHKA 4PDKA 1NLOC 3M58A 3MEGA 1KFDA 1B72B 3I3LA 4JZ3A 3P9CA 4Q5VA 3HPHA 1Z7LA 2Z0WA 3CCVN 3ZQHA 3MEAA 3P83D 3WVDB 1L3UA 1HSQA 1CKBA 1I27A 1P7MA 5KYUB 1W7AA 1RR7A 1D9FA 3CPWA 3FHNA 4B3AA 2ELHA 1YIJQ 4ID5A 1VI0A 2VT3A 3PM1A 3G6EI 2CYZB 3QQAA 2DI3A 3CP8A 5KRTA 2DBBA 3HPGA 1K61A 1WSFA 2P84A 5FLXK 1Q82C 1PU6A 2D0OA 4CF9A 1H89C 5CE3A 3JCUC 3HJFA 1AOYA 2A61A 3ZMUA 1MH4A 3EG0A 1FSHA 2HOEA 3SV4A 2ESHA 4EJYA 2JTFA 3VQ9A 2JT1A 2FBYA 2MI6A 3QSUA 3JRCA 4DIQA 5HLTA 5EY4A 3CCLN 4ZH4F 2DYBA 1YOVB 3K2AA 2LCLA 4QCLA 4BRGA 2GIZA 2XB5A 2DF6A 4CGZA 2VXFA 2KE9A 2QWNA 3I55A 3E5XA 1TXQA 3O5ZA 2FEZA 1GCQA 3RCOA 4MO7A 3NH0A 3WODF 1VFCA 2ZPBB 1TW3A 1MSEC 2GELA 3EPZA 2HVRA 1VQLT 5FWCA 3VQAA 3RPUD 3E1YA 2ZD1A 4CE9A 3THWA 4OINF 2DOAA 4YFNF 5EC7A 2ID3A 2NS8A 1FOXA 3BFMA 3D4VA 2MF2A 2G9WA 2LCSA 2ZO4A 4MLEA 1LDDA 4JKHA 1MUZA 4RCBA 2W6LA 4IIMA 5C10A 2HF4A 3HBLA 1ZTRA 3S3NA 3O3FA 1Q7YO 1R58A 2XPUA 2WA0A 4OX9K 2RE2A 1WUAA 3OR1C 3K7AJ 3HYFA 2O2OA 3FZLA 1ZELA 4B43A 1NMDA 4Z4CA 1WJ5A 4CJUA 1GHCA 4G7ZF 1ZR4A 2HMPA 1OYYA 4Z4IA 1XHZA 3CBPA 2NOJB 3CWAA 1R59O 1D0YA 1QVFS 2HQRA 4IHXA 3CLOA 2EYYA 1W4MA 3BWGA 2VC0A 1MDUB 6AT1B 1HJDA 1M3AA 5BREA 4FJMA 3FXRA 4M75G 4UVBA 1RAEB 1NHAA 1D3BA 2O4IA 1JI8A 5JICA 1WBBA 2VXEA 2K7AA 3E5QA 4EW0A 2Y4XA 3A0IX 1JJ2M 4RAYA 2MG4A 4U7BA 4KHPK 1VQ9Q 4TV7A 1N34K 2VC8A 2EA4A 1NGNA 1VQOQ 5GANe 1WJQA 3JCMP 2NNWA 1LOJA 3QIPA 1S1NA 4YFKF 2E5QA 1YW7A 2OAWA 3I59B 2E71A 4NS5A 3KK7A 1TK5A 2A6AA 2HVIA 5IN1A 2OQRA 4AC0A 4Y7NJ 1NG6A 2DXTA 5I9EB 1JXBA 2HGCA 4WFBL 2O6GE 2DETA 1JKQC 2FOKA 2CP3A 2DA3A 2R7FA 1PC0A 3IAM2 5K5OA 1OYWA 4HYEA 1LE8B 5DM7F 1U2VB 2NVQJ 4CJQA 3M0UA 1PVSA 5F0CA 3HTUA 3M53A 2PU9B 3A5OC 3QB0A 3THKA 2XGEA 1N5ZA 4CICA 2AJQA 4AG1C 4HNUA 4IOXA 4N0AC 5M3MJ 1QHAA 1M1GA 2LJ1A 1FJGK 3H0GJ 1RADB 3ISNC 2H1KA 4HDUA 1N8RC 2CQNA 3TR8A 1N3AA 4F2SA 4M73A 3PIOF 4G9ZA 3IWZA 2PMUA 3A5LC 1X2MA 2RGVA 2P0QA 1H8AC 3MKZA 2CH4W 2FB7A 3A5NC 2A69F 2A6TA 2O8KA 2X78A 1G15A 4U87A 4HLXA 1Q8IA 3WNFA 4IRGA 3I4PA 3WHCA 1J54A 5BPIA 4CF0A 3GBGA 1KHIA 1PRLC 2LT4A 4E9HA 3BE3A 4EJZA 3I58A 2OTLN 2UXXA 2HKQB 2FBHA 1YHQT 4IZ9A 2PQ8A 3BTLA 2V75A 2PVGB 1AOJA 5KPZA 1D09B 4L5GA 3LWFA 1ZXOA 2D0PA 3CETA 4M3RA 3CBOA 1KEAA 4Q5WA 2P0WA 4EGYA 3OH9A 2EW3A 2FU4A 5I11A 3CCRA 2VYPA 3P9KA 2VGNA 3FGUA 4M3EA 2E4LA 4JKGB 2HAXA 4H5NA 2CH5A 3OYNA 3P31A 3IH4A 4MO5A 1VAZA 4XONA 1NG7A 1ETYA 3OYYA 2J5OA 3WXMB 4RAFA 5GAN8 1MKMA 2EFOA 2JRMA 5F1JA 4IQJA 3QEWA 4BY6B 1X2NA 4NHJA 2E4HA 1ZKGA 1L3SA 1NGGA 4GVMA 1QHHD 2O9VA 4KUDK 1YJWN 4IXCA 5KTQA 2DPPB 2YHYA 1K9MR 2QBYA 2XMFA 2JSPA 2E20A 3U21A 3TAQA 3H5RA 3DLGA 1OH7A 4J01A 3T19A 2IA1A 3VS5A 3RZDJ 3S17J 4HNTA 2JSCA 1KQSM 3BUZB 1QQNA 3FHZA 4KMUX 1Z0XA 4ESRA 3AG4H 2DTOA 3R3LA 4LF9K 2CV0A 1HJRA 4M78B 1BW6A 3VS1A 3JSOA 3RMQA 1XC9A 4HVVA 4GV3A 4CGJA 4A6DA 4ME7A 3VYTB 1BW5A 1HSJA 4FCYA 3OYHA 1NJIR 2QZ8A 3VUZA 3CG7A 5AQLA 2QA4N 3DLRA 1W36C 2O61A 4Z8AA 1Q7YC 2HKXA 1WJDA 4C8QF 3F70A 2VWJA 4HRIA 4C23A 2ZZDA 4XAXB 5J26A 5M9OA 1XC3A 3LPUA 3CCUQ 2YX6A 1T38A 3VQCA 2W0ZA 5J1RA 2C0IA 1VQLA 1REVA 5I21A 5KYYB 1YTUA 1PP7U 3AVAA 5DD4A 1DU0A 2FOWA 2KISA 5JR3A 2RQTA 2L2OA 3EUHC 4JBAA 1H641 2J6FA 4KH6A 4YTLA 1Y64A 3AFHA 2HKNA 1ORKA 4PJOE 1WBDA 2FZCB 3E0JB 3OV8A 1IGUA 4J8FA 4LFCK 1RAAB 4D5CA 1KAYA 2Y31A 1IO6A 2D6FA 5J2MA 1CZ9A 4EEFG 5HVQC 3S93A 1WQ7A 4A2AA 1Q18A 3J7AY 2DERA 2IPOB 2JOYA 4DU3A 4DSIA 5KAFC 4XK8E 3OYMA 2ISYA 2DQLA 2NOFA 3CMYA 2WTUA 2PNIA 3DXMB 5DM6L 2HQXA 4PJ0C 2K86A 1GLLO 2OZ6A 4G6QA 2SRCA 2XHBA 3SQNA 4BDZA 1H0MA 2L0AA 3A0HC 4OMZA 1K73O 3SHFA 1N9RA 4Z4GA 4IUVA 3E7LA 1NGJA 2N8GA 3CCEQ 2KR3A 4YIIA 3UR3C 2OZUA 1XG1A 4J6YA 3C65A 2LKXA 1J5EK 5C4XJ 4IRIA 1QVFA 1RGIA 3CUQB 3L2RA 1O75A 4BEHB 5D5UB 1DPRA 4I01A 2ZJ2A 3OYDA 4RTUA 4OP0A 1VNDA 3BJOA 3C95A 4OMMA 5DCMA 1OCOH 5M1KA 5ELZA 3DRSA 4W5TA 3K2ZA 2CKKA 4XTWA 2ZQBA 4RW7A 4D0PA 2VJ5A 5HOOA 2HF3A 2KKZA 4C5GA 3KKSA 1BI1A 3E19A 5BRDA 3CC7I 1WSIA 3CYMA 1T39A 2FQ3A 3KP7A 1XQSC 4UOBA 5JS2A 2R93J 2FRWA 2SEMA 1WNSA 5IH2A 5LHIA 4B48A 1P2FA 1TWBA 4RGXA 2JMWA 3S8PA 3VGMA 3PIOA 4KHUA 4ZN1A 2JQ7A 5LD2C 2W85A 1YIOA 3SI6A 2HOAA 1TAUA 3P8DA 3X28B 2A36A 1ZUUA 4BRPA 4JYKA 2RI5A 3C7NA 2RN8A 3HJEA 5LJ5j 4C3JJ 4PUSA 1KG3A 5LJ3e 3Q1JA 1VSMA 1P4WA 1RRQA 4K8XA 1EQYA 4DQ8A 4LDWA 1P9QC 3CJTB 1R00A 4E3SA 2JM8A 1VQ5N 3J7ZI 4KH0B 3ZYYX 2RV8A 4CHYA 4CBXA 3NVMA 2VN2A 2KROA 3L7WA 1KD1U 3EGDB 3KTUA 2EPDA 3THWB 2JZYA 2OZMA 2WACA 3IKMA 5AQFA 2DILA 4IXAA 1RT7A 3ULDA 4H4KC 2ED0A 2G8HA 4QAGA 2GLOA 3VA0A 2ZGYA 2KRHA 2W82A 3VESA 5GAMf 2OTJQ 3TW7A 2ED1A 2DKGA 5F1XA 3A01A 4PL8A 1P59A 3JRGA 2HYJA 1R0AA 1WYXA 4DV3K 1IH7A 2WSFE 2H8HA 1YHQA 3WE2A 4JI4K 5LRSA 2XVCA 3THVA 4YRVA 1ON2A 1UG0A 3P8HA 3H0HA 1Z67A 3CCRI 2W57A 2NOEA 1U0JA 5AFUH 1YI2N 1U45A 2BZXA 5J3BA 2D0NA 5GPCA 3CC7Q 2PFUA 1VQMQ 1ZBIA 2GV9A 4GYIA 2RNAA 3LH0A 1Q81O 3VS6A 4HCZA 4HUFA 3OSGA 2AO9A 4R8HA 1S29A 2DTRA 1IDYA 1TWHJ 1D3BB 3S6WA 1DQUA 3BY6A 2DX1A 3HRUA 3L09A 2CGKA 5AYFA 1FOKA 4ESJA 3ABKH 1W1FA 1M5Q1 1LAWA 4GDFA 4J9IA 4XR6A 4OMLA 5F27A 2HHTA 3QYGB 3SZPA 3G71N 1HNXK 4YG2F 1PSEA 5IWAK 3URGA 3N5NX 4UY8I 3FM3A 4WQ4A 3I5UA 4XLNF 3G4ST 4DWIA 2KZZA 4C8QA 4KGZB 2VUMJ 1FYNA 2QENA 2K9QA 4W97A 4RTFD 2GTOA 2HNDA 2OD5A 1MDMB 2EX3A 4QT7A 4FJ8A 1RTIA 3O80A 2P9NB 1LW2A 1PSFA 2KT1A 1YS7A 1SKUB 4DQSA 2WAEA 1U8BA 5C42A 1JXOA 1UUEA 2KJBA 3AVNA 4HX8A 3GCMA 2L4MA 1I5LA 1ASUA 4XU2A 1MBJA 4LIVA 5DM6F 2DJIA 4F8RA 3GF2A 4OPJA 1MMNA 2HDWA 2MH2A 4UUSA 3CCMN 5H20A 4W5OA 1VQLI 5GADP 4FZZA 2YLCA 3OTOK 4CRIA 1HXDA 3WXKA 3CCYA 1UOCA 1V5EA 3CJNA 1IUFA 4CJ5A 3ZRGA 1BBYA 1PU7A 3CMAN 3C2HA 1TZLA 2NAZA 2W1OA 1K73C 5A2QZ 1Y07A 4BXUA 4EV0A 1ZR2A 2HQNA 4NYFA 1VQ4Q 2CUEA 4BRLA 2YG8A 1TSFA 1KVBA 1VQ6I 1K7AA 2G7HA 3K5LA 3CC2T 3MHXA 4L0YB 4O8UA 1T8EA 2MK5A 3B02A 1U1SA 4IRHA 1NBEB 1RT5A 3MCPA 2Y9ZA 1KIKA 3D5SC 3HM5A 3D5RC 5HDKA 2LYCA 2AQFA 4FYYB 2JNGA 3H1QA 4NB4A 2MFZA 4DOWA 5F08A 3GP8A 2QYOA 4DQ2A 1PYVA 5D5XB 2YUNA 4F9OA 1YFHA 4AYBN 1GDTA 1K8AU 4EW4A 4CHZA 2LH9A 1WDXA 3IL2A 2L7FP 1DIZA 2Q2EA 1A6QA 4NCGA 3HOUJ 4M7AB 4CZJA 1XHXA 1KSPA 1H3ZA 3M1FA 3TMOA 4UHTA 4FIBA 4FHTA 4F7ZA 3JR9A 1S1TA 1MMDA 2LSOA 3QLHA 3OMCA 1J9AA 1K0SA 1R71A 1JLBA 5E3LA 2B7EA 4BRIA 3ZLJA 2O8EA 1PJRA 4MLOA 2YDLA 4DK9A 2JT4A 2QTDA 4AU7A 2AHJB 1VQNT 1J59A 3WGHA 1Y1WJ 3M1EA 3KHYA 1KQ9A 2QBYB 2I5UA 2QVOA 4OPHA 2QW9A 3K0SA 5GANh 4Q5SF 3I0WA 5BN8A 3AV9A 4NDLA 2BY3A 1W2BM 4OKKA 4M6YA 3ER0A 5FPNA 3K6GA 2V9PA 4DV5K 4LG0B 4AIAA 4M41A 4PLLA 1SAZA 1VQ6Q 2P6TA 4JI7K 4R79A 3QZ5B 4DR7K 1T7PA 1LWVA 2V7FA 4FLWA 3J7YJ 4KHWA 1MMSA 3HOVJ 4HUGA 1XDSA 1YE9A 3D7EO 4FSXA 1BI3A 2XHKA 1ZA2B 5FU6C 3ULEA 5HLFA 2JN0A 4IPAA 1BHLA 3DXKA 5B1AH 4CH7A 4DBRA 1SFEA 3S3MA 2FZKB 4M78E 1X1PA 3R60A 5JI6A 2ZF5O 2LKSA 5GTIC 4CJLA 1S5LC 2K6DA 5FLXE 4II3A 3QFPA 1F36A 3TTDA 4WXCA 3PUBA 3ZPLA 3JCMg 1J3TA 1BI2A 4H4OA 1Q82R 3OYJA 3UKGA 4OLAA 5TISC 2EZKA 4BR2A 3P38A 4LN2A 3GTGJ 5J39A 1N25A 4F91B 4F04B 3LWLA 2FSKA 3K4LA 4NC8A 1A35A 3EETA 5L3FA 3D0SA 4JKAA 2Y75A 5KK1A 4RS8A 2GIVA 1YJ9N 2OCCH 1IXDA 1ETQA 1QO0D 4JRKA 2HR3A 3TABA 2XKOA 2NUZA 3ZEUA 4BG8A 1T0FC 3S2WA 3HFOA 3EZ5A 4QPQA 2DXCA 3BOQA 1WJFA 4DQQA 3D45A 2PJRA 1EV7A 4CCLA 4P55A 1JT6A 3HXMA 2OQGA 1TTHB 3VPZA 1SUQA 5GAN5 4BC4A 2ZMEC 1Z25A 1TUYA 1FPQA 2MLGA 2Y4YA 1ZGJA 1N75A 2QQ8A 4CD3A 4JKFA 3FFKB 4KRFA 2W41A 4UB8C 4KN7X 3W6KB 3I0RA 1SEUA 3C6AA 4HVUA 3S3OA 1IF1A 3IKVA 1BQNA 3MECA 1ZSGA 3DM2A 3MMVA 4MTEA 1VQKN 1TH7A 2ZFWA 3OBYA 4E7HA 4XKWA 3G4SA 2KFZA 3QDKA 3VOEA 1S22A 4NZGA 3DPUA 4OAYA 4GKJK 2E1MC 3G1JA 3BCBA 1YYVA 2MBFA 4KIGA 3CCQT 2E6LA 3IP4B 4EHTA 2QK0A 2W04A 1TUCA 4DFJA 3LNQA 3ZL7C 3I8BA 1HMVA 3QNOA 1YUWA 2DTZA 4OKEA 3RUXA 3REOA 4CEAA 1WZOA 1JU5C 1UG2A 1VOMA 4OGEA 4DEXA 2GA2A 4FJNA 5LRRA 1A0NB 5LJVA 2CV1A 5AQTA 4CBUA 3L2UA 3OW2A 1VQ7T 1P4XA 1QVTA 5BOXA 2HYGD 1O7FA 1VA7A 4BQOA 4RB0A 1WA7A 1ZUYA 2P0KA 4F16A 3BY5A 2FSNA 3C6TA 4GY2B 5IXBA 3HEFA 1HW2A 3BGRA 2LX7A 2E34A 1BA0A 3VS0A 3G3ZA 4M74A 3CC2A 4BHPA 2CJJA 4QS8A 3FXJA 2P9UB 2YJFA 1W1WE 3ROUA 3LDSA 4A3EJ 2E2QA 3M4OJ 2VC1A 2MD5A 4BDYA 1Z7UA 2B63J 4PCQA 2BW3A 3O4WA 4DTMA 3QYFA 4C5EA 4F7UA 2XF6A 3DKWA 3KE2A 1P92A 3GE1A 1IO2A 2UWMA 2HPIA 1UGPB 4CXFA 1S72A 2YT6A 3FSPA 3ZCMA 4XOTA 4F52A 1WH5A 2D4WA 3LZIA 1UWBA 3L2WA 3TU5A 4B1XB 2GX9A 3EY1A 4Q47A 2BE2A 1WXUA 4L18B 1XWLA 2BEOA 3I33A 1YFNA 3G10A 3RPUA 2ETHA 3ZQQA 1G3SA 2ENMA 2RJEA 1WXTA 2EQJA 2P5GA 1XUPO 1N32K 3H9JA 4CI6A 5LHGA 1NGDA 1KRPA 5KN8A 1MSFC 4FPAA 3GTQJ 3EKUA 2D1XA 2VOPA 5D6FA 3FHFA 4Y52J 4P5NA 1S1WA 3JCMV 1AVZC 1VQNA 3X24B 1USSA 2W24A 4B4CA 1IC8A 3G0ZA 2BBYA 1W70A 2ZPGB 2LP0A 2QQSA 2OA4A 2JS0A 3QG1A 3ZN1A 3KP4A 2FX0A 2G0EA 1V3FA 3BG9A 4FT4A 4LF6K 4E0DA 2RDPA 2LQNA 4HCKA 1UGSB 1W36D 3PY8A 3RI4A 4HQEA 2W00A 1RL2A 2CW0F 3LSPA 1PD0A 3MN9A 2COZA 2NWMA 2XAGA 1EH8A 1RABB 4E7KA 2OFKA 3UDCA 3RMAA 1I39A 3DB4A 4JQFA 5F2RA 1ODDA 1YTYA 3LH5A 3CCJQ 4A53A 2VG7A 2Z33A 2EJGA 4LUDA 3DXJF 1K8KB 3QPHA 3I5SA 4M77G 3FMSA 4PWDA 1KVCA 3ASMA 2QQ9A 1S6PA 1TS9A 4AT1B 3C0BA 4FE4A 4UUSB 3C7JA 4E9FA 5LJ3h 2VUBA 3FIFA 1CZBA 1X01A 3EG9A 1QKXA 4HSBA 4OB3B 2ZXIA 1SMTA 4BQNA 1KXPA 4PIIA 4DTSA 2PLYA 3KYCB 3NVKA 4EMKC 3T1YK 4BR0A 1KHCA 3SEZA 3EHRA 1BA5A 3ZEHA 3PJRA 3H6ZA 3HKZN 3CESA 1C0WA 1NPRA 3FBNB 1PRMC 1YIJN 1L3TA 2H09A 2YU9J 3N05A 4CJKA 1NM1A 2L0KA 3OGDA 5F0XA 4N47A 1ZREA 4B23A 1Z21A 2HEOA 4WWCA 3AVKA 2EQUA 2E5LK 4B1UB 1GLAG 1SMYF 4HWIA 1JGSA 2M16A 4L59A 1YITQ 1QZEA 2L9SA 1T6DA 1VQPI 1ATRA 1PUFB 4E7LA 2M45A 3VWBA 1EZZB 2EB7A 3K5OA 2QSGX 3H41A 5B8HA 1TBXA 1SQKA 3A8GB 5K14A 2NRRA 1HK9A 5GAMj 4DHYA 4KHYA 1RC9A 3QUIA 1WPYA 2VASA 4I99C 2K27A 3O3KA 3WXLA 2KQWA 1I6HJ 2BHYA 3VEPA 3JB9G 2FPEA 3GTPJ 2CQXA 4KH5A 3MZ8A 4KKOA 2DA7A 3AO4A 5CPRB 3MKYB 1HPMA 3SHWA 3CF5L 4MFDA 2RHIA 1TLHB 4I6ZA 4WQ5C 2ASMA 2Z3YA 2FNPA 2XASA 1QP3A 3S2DJ 3G1LA 1FKPA 4M7AE 3E9PA 1RDAA 3WU1B 4OO1J 3ASNH 3CPEA 2PUKB 2Z5UA 4XRMA 5LGUA 2CW7A 1N5YA 2L7ZA 4ID1A 4XEIA 3VEVA 4CGGA 3MMYB 2JUGA 3F6OA 5E3OA 2J7IA 3CCQA 5JMVA 3LP3A 1VRUA 4A3GJ 3REBB 4Y28E 5FD6A 2D1KA 1EFNA 4M77C 4QQGA 2NVUB 2VBXA 1QVGP 2E10A 3G6EN 3VOVA 1HNWK 5CKEA 1VQ4A 1M3HA 2EGAA 4PJNA 2WONA 1LWCA 2WOMA 5FLMJ 4KI6A 3KLEA 3V4GA 4L5EA 3ULEB 1WXBA 2W7NA 3EE9A 1VQ7A 4OIRF 1HLVA 2FUG2 1SKRA 2QCOA 1UE9A 1VQPQ 3NH1A 5AZJA 3M3ZA 4BE0A 4MZTA 2LBFB 4KYWA 3UATA 2DLPA 3A03A 1NYFA 3IAS2 3HK2A 1VQON 3OYIA 5M1PA 3CC2I 3TSZA 4C92G 3V9WA 1CGPA 2BGGA 1UCRA 4OAZA 1QTMA 2UYTA 4A2UA 2V1XA 3OS5A 4YELA 2RQVA 3GTJJ 2QGUA 1A31A 5HCKA 5AQYA 1IRZA 3REAB 1WJRA 2ID6A 4FJ9A 5BR8K 2KP6A 4PKIA 1X19A 1LVKA 1X3ZB 3KWIA 5FLXO 4XTUA 3H3UA 3LCNA 4L5JA 2LLKA 4G8XA 2J4RA 3O5BA 3GZ6A 2RM4A 3MWPA 5GAMh 5GMKe 3I56T 3I9V2 3V8KA 4XU1A 2DY4A 4HUEA 2ASOA 1ZC6A 4CJTA 2GF7A 4DFPA 3JTHA 4X0GA 3BPVA 3CCLQ 4FISA 1B34A 4IO9L 3BDPA 3WEEA 2E2OA 1SFKA 3IFRA 3AVFA 4BXXJ 2YSQA 1WFWA 5FFXA 1S8NA 2XPVA 4X9CA 3Q9SA 4C0GA 3S2HJ 2BE7D 1AZEA 3M8PA 3QDRB 3K4BA 3MPUB 3H36A 5ICCA 1TYQA 3ZX3A 2ZC2A 2NUPB 3TWHA 1Q95G 3BR1A 4LFAK 2DMTA 2OUMA 4ZDPA 1OKJA 1GV2A 4DMNA 4FLZA 1EETA 4M3WA 1SV5A 1C1BA 3O1BA 2C6YA 2LY1A 4BD3A 1ASVA 5D4RA 3T69A 4EJTA 1VYTA 4BJTA 3H08A 3TTFA 3LGLA 2ADUA 3VYGA 2A05A 4XMYA 4Y1CA 2WY8Q 4PJLA 3NGZA 2X4HA 2UUZA 2BE9B 2EQKA 2X6XA 2YUOA 4C92C 2CWEA 2YX4A 1UGVA 5TGTA 1HDDC 4E1JA 5AQKA 1VK0A 3CWTA 4LD0A 4B8AB 4AIDA 5KPTA 5LJ5g 2LTPA 2Q0RA 1GBRA 3BLYA 3GWZA 2JJ9A 2GBZA 3MEXA 1K9MU 4QS7A 1WEFA 2ZPIB 1WHMA 3R1XA 2RJFA 5HDGA 4J6WA 1ACIA 1BIAA 3CF5F 4RW9A 1L5UA 3T5XA 2CQ7A 2F4IA 2F5FA 1I8FA 2RH2A 4I2OA 2BZYA 1LEBA 1E6GA 4DYCA 1RFQA 4N9HA 1BOTO 4XTZA 5JLFA 3NGPA 4XRSA 1MMAA 1QHGA 2GM4A 1AWOA 1QCNA 3SJMA 3KP2A 1LW0A 3S15J 2DFHA 2HVHA 2HDDA 3RBBB 1NJIU 1YCSB 1SL1A 1P6RA 2CW8A 2PJPA 2LQ8A 3JCMJ 1XG7A 1HYVA 4BR5A 3OMGA 2HHHK 3DOLA 2AQEA 5FJ8J 1BM9A 3FXKA 4FWQA 4MQ3A 4OGCA 2UZKA 5F0FA 2E36A 3I71A 1Z77A 2MMPA 1KG5A 2IT0A 1C0MA 4A5BA 2AXTC 2V7YA 2QDLA 3GOIA 3OYEA 5GAN7 3O9UA 2MOXA 3AVBA 1M8VA 4G6TB 3LAJA 4FETA 2NOIA 2HBJA 4FJ5A 5DEQA 4A0ZA 4ZYEA 3V1OA 4JJBA 2BTFA 3SAHA 2LQKA 1WIEA 2DA9A 4BY7J 4ZYGA 2WB1A 4C8NA 1PCXA 2ZCWA 2EYZA 3BJ6A 3MO8A 2LY2A 3CCQI 1SL2A 5BS6A 3G7ZA 4BY6C 1YW9A 2IS4A 2K3YA 4BC3A 5ECAA 1WSUA 2KLAA 2WAFA 1TQPA 5EYRA 5J1YA 4XH1A 4DOVA 5KCMA 5ED4A 2X1EA 1BDGA 3DPLC 2ME6A 4IHWA 3SJJA 3UKUA 1GXIE 1R6RA 4XORA 3LWHA 1X6OA 2X1CA 3M8SA 4EPCA 1FNNA 3F3XA 2HTSA 2JGUA 1MV3A 3JCMb 2HBMA 3VTIA 1MJ9A 3AARA 1XMKA 2HZYA 3F22A 4QTRA 4FJLA 4C8QE 1TV6A 4CZCA 3KZYA 1WAFA 1IN7A 1HJOA 1IKVA 4NLCA 4EJUA 3P5JA 3CCVT 3CFRA 1YBYA 2QEXQ 1N78A 1FWZA 2RAEA 1OISA 2WC2A 2A5XA 1ZGWA 1AD5A 4A3KJ 2ICWG 2M3AA 2IVMA 3TSPA 3A8OB 4EVIA 2P9KB 4PUOA 3ZOBA 3X26B 1ZBUA 4IO9F 2ZJRL 4B6MA 3GZNB 4G94A 1HDPA 2IGNA 3TSQA 2X4JA 1R22A 1XGNA 2HZTA 4C2MJ 3H3OB 5DK5A 3HO1A 3B73A 1WLPB 2K9NA 3ZSXA 4JKBA 4FJJA 2DTHA 1FP1D 4F7UG 3HZ6A 5GIPA 1JJ2P 4CBWA 4JJCA 2GXBA 3D2EB 3GFIA 2VQFK 3GNFB 3FISA 2E2NA 2XB0X 2NNNA 2NRWA 3GBQA 1TKTA 5CJ9A 4NCBA 1JTXA 2W40A 4FLTA 2H6CA 2FBVA 1YW8A 4II1A 5IHIA 1Q81R 3L2QA 1NK5A 1TG0A 2P7CB 4R5PA 5FKNA 2B8AA 4S0HB 4B09A 4AUXA 1IJJA 4XIUA 3J7AF 3FZMA 3PNYA 3MKDA 3GBTA 4MDBA 1QLYA 3GL1A 1RBVA 2QA4Q 3IG1A 1TWCJ 3WNEA 4H4MA 1ZBXA 5C2FA 4HF0A 3M4YA 2NYSA 3PO4A 2LD5A 4Z2YA 1NK2P 1ZSZA 1U1TA 2ROTA 4AWXB 1E0EA 2ESWA 2HFHA 1HW5A 1KU7A 1NK9A 5D3GA 3OWTA 3VGKA 1HYZA 2GXAA 1ZG3A 2X9HA 4B1VA 1AA7A 3OS1A 3BG6A 2OFIA 4I0BA 4G7HF 3U2RA 4P96A 1NGCA 2O01E 4DS4A 3THXB 1XD7A 3CIPA 1OX8A 4EAHD 4FZXC 3AO1A 1Y97A 3HI0A 4RB3C 4I0AA 5EU7A 3CC7N 1VQMN 2CZ6B 3CO6C 2DIGA 4I2PA 1NGBA 3CHWA 4EA5A 2BDPA 3TTCA 3KFVA 2QQBA 1HQCA 3ITHA 2IVNA 4RBOA 5GAN4 1M2VA 4FWLA 1UB4A 1BR1A 2YS9A 4FYXB 1R23A 2JTMA 1WN7A 2LRDA 4A0YA 1RTHA 3PSFA 3L3VA 2I5WA 3VSLA 3TDZC 1B9DA 4J19A 1KD1O 2YG9A 1KQ0A 3I54A 3MKWB 1KC8O 1TC3C 4KT0E 3L9FA 4BGDA 1SAXA 5E8IA 3IWFA 4I98B 3ULRB 1I1SA 1HKQA 5KYNA 5D4SA 3QIIA 3UWNA 1I94K 2KLOA 1DDNA 3EUKL 1TOVA 4H0PA 2DD5A 3HOWJ 4CYCB 2W03A 1X9SA 4CGIA 4BAYA 5M1QA 2NRHA 4E19A 1CF7B 1Z9ZA 2MYSA 1WRJA 3SUOA 1C0TA 2HHXA 4A3IJ 1QVGS 2LNBA 4AH9A 2XDVA 3G0QA 2C0TA 4ENKA 3BW1A 4IG3A 4O3MA 2DMNA 1V4RA 3LDQA 2CG4A 4U0WA 1EF4A 2XY8A 2CSOA 2LVSA 1SFOJ 2M1HA 2CUZA 4WF9L 3V9SA 4CJPA 5LJWA 1NH3A 1ZLKA 1C0GA 1NK3P 3PVLA 1SVLA 4MQVA 3DPTA 4B22A 3CCRN 2NOBA 1JUMA 3DFGA 1W97L 2DK3A 3CCST 2QLZA 1D1AA 1KQSP 4LFUA 1IZ1A 3HUGB 4YORA 1GVDA 1OCTC 4E6RA 4L8RB 3C6UA 5LL6S 4JHDB 3QRFF 5KNLA 1ZLMA 1YQMA 1WCMJ 3KP6A 3WEEB 3M6GA 1WSEA 3ZSWA 4FLUA 2HHVA 3A1YA 4LGWA 2JTEA 1VQ5Q 2STTA 3P1GA 1Y1VJ 2OTLT 3JAMK 3AO2A 4XN0A 1BYMA 4I76A 2Q3SA 4B47A 3BPXA 4CA0A 1VSJA 4N41A 1Y39A 2L3PA 3H92A 1FYLA 3T0YA 3WNHA 4RWTA 1QRYA 3Q0WA 3HPOA 3WE3A 2EFQA 1NYGA 1X3MA 1X27A 4J9DA 1BQMA 5CHZA 3GTLJ 2EYWA 4F17A 4FJGA 2KW4A 1Y6IA 1AHJB 2JA7J 1KO9A 4LD6A 5A0GA 1U06A 3NH2A 4FX4A 3NDKA 4LB6B 2JWKA 2K2MA 5JFRA 5F04A 3DEEA 2E60A 3HOTA 2ZM6K 3CWUA 3DTEA 3EN9A 2O8CA 1MBGA 4HLYA 1FW6A 3LFKA 2Y0SN 1SD6A 1BJZA 4E9EA 4YFXF 4DFKA 1MZBA 3GZ5A 4CCHA 4LJZF 1YI2Q 1YJWT 3CCVA 1QA6A 2DD4A 4Y17A 1NK8A 4F55A 1LUJB 5GAEP 1Q1HA 4JKDA 3GOXA 1VQLN 3ABTA 5FU7B 5IHNA 1NBWA 2XK0A 1QS4A 1AWWA 4YNQA 1MW7A 1T0JA 5L3EA 2CUFA 3HPWA 5CYVA 4N0AA 2YHTA 4MTDA 1WHLA 3FC3A 1B8IA 2QWPA 5ILVA 3DLAA 2F2VA 1VQ6N 1Y0UA 2QWQA 3CCLA 4K25A 4EA4A 1X1AA 4HXJA 3VQQA 3G71Q 5DUIA 2OA8A 4CECA 1EA3A 3I56I 4M3DA 5A2QK 1YCYA 2E5ZA 3G2BA 2EA2A 1K8AO 2NLUA 3DLKA 3CD6I 3NARA 3BP8A 4E4HA 3M54A 3NF7A 2LQWA 3VQ8A 4PFPA 2P51A 5CYMA 2CU7A 4RMOA 4IFEA 1HX1A 6PAXA 1RACB 5GMKh 1PD1A 4LE9A 4MDWA 2PX9A 3BCAA 1S5JA 1M90O 1BCOA 4BRQA 1YG2A 2FMYA 2M4GA 4U0VA 2X6SA 3TO9A 3DLBA 4B08A 1Y0MA 1ETWA 2R57A 3IDHA 4CC4B 1RCHA 1WHJA 1ZG1A 3E5UA 3EAEA 3ABMH 3CCMQ 5D5WB 1U3OA 2QWRA 2G6FX 1Z9CA 3QAHA 4KNYA 4M77D 4M7AC 3O9TA 1IREB 5CY4A 1TK8A 3CMAQ 1FXXA 1KD1C 3CP2A 2GWKA 2F5CA 4BI3A 2LNHB 1KU3A 2D1VA 3N97A 1Z6TA 1T03A 1A5JA 4CJEA 1DJ7B 2ZKZA 5TKYA 1EWQA 5GADJ 3NWTA 1M4ZA 3WUHA 1YX5A 1NGIA 5ADXH 1OH5A 2V51B 3PLAA 2E6MA 4XSXF 3CJ9A 3HP6A 1QW1A 2HVSA 5I42A 1VQ8T 1XSXA 1HQEA 1XTAA 3FM5A 4JD2B 5DM7R 2RQPA 4XSZF 3MDQA 2JHNA 1HRHA 4LITA 3FMRA 3CM5A 2MC4A 1S7OA 4OIQF 1MBEA 5AQRA 2O8BB 1KG6A 4AHVA 4EHUA 1ZLJA 3CD6Q 1KQ8A 3H0IA 3TOAA 1BK2A 1ENHA 3BQZA 4CHOA 3KP3A 5DDGA 4CHNA 5FPEA 3VEZA 4DBQA 3ISPA 3U6FA 4O6JA 2VKDA 4JRQA 4FJ7A 2HW3A 3LSTA 3GYHX 3ZX0A 4C1NK 5KE2A 3MN5A 3F72A 1KSWA 2K5CA 1OCPA 3JB9D 2Z9OA 3SDGA 4KFCA 1NGFA 2BHZA 1MMGA 2IJLA 5E8GA 3PE0A 3FB9A 2E8AA 2GUIA 3KKRA 3PO3J 1B92A 1NK7A 4GKKK 2YX7A 3EUHA 2KZVA 1QPMA 2CGPA 5L3GA 2DT7B 4F3TA 1QVGA 1RBRA 3AGKA 2VBWA 2K4YA 1S9HA 4B1WB 3P39A 4RUGA 4KTZA 4RDUA 2YSRA 1RDUA 4BHBA 1RI9A 5E3NA 1YRNA 1RNHA 3M57A 5DY9A 3S14J 3WG9A 4IUTA 3DU6A 2DAQA 2NVYJ 3VRYA 2PFBA 4IJAA 4DKWA 5AQXA 3GX4X 1RTJA 2P5KA 5IOYA 3VW4A 4DNCA 2A0FB 4W1UA 4GV9A 3DKXA 2BY2A 2ZGWA 5GAMg 1GT0C 1YVNA 3EL2A 4DTJA 1HCRA 2CZ1B 2OTLA 2CH0A 1IB8A 1KLNA 3DF8A 3ASOH 3NPFA 1KYWA 4B9TA 4RTXA 4M3ZA 4EVVA 3O8HA 1UHMA 2LFBA 2Y1JA 2IS6A 4JJDA 1N33K 2YWWA 2HSPA 2PY5A 4RW6A 2BGCA 1R0BG 2LY9A 1JJ2S 5KGWA 4HSRA 3QXEB 2JN6A 1KVAA 3ZQFA 2NUBA 2TRTA 3FF5A 4LIUA 2Q0OA 2VG6A 3ZMVA 4Z94A 5D6YA 3I53A 1WHGA 4A61A 4C92D 1UJ0A 1NOZA 4R56A 2BTTA 2O88A 4UUVA 1LCKA 1YJ9Q 2O4GA 5E84A 3RR8A 1TKDA 1JUPA 4ICLA 2FL7A 2MW8A 3MEVA 4IHTA 1OEBA 2D8HA 2FF3B 4HHTA 2MPXC 1IXSB 5CKTA 3W0LA 4EZ9A 3MEWA 2M1BA 4D1QA 4KRTA 2JWTA 1ZQ1A 1J5YA 1YJWA 1XGOA 3ERED 3PMTA 2XF7A 2K4BA 2DYSH 2K3XA 2KQ2A 3ECHA 1K8AC 3FDYA 5D5VB 3OQ5A 4B44A 3V9UA 2M7AA 4J2BA 2Y0MA 1BISA 4NXMK 1JKOC 1RAFB 3ME9A 1OR7C 1M90C 4C1NI 5E20A 3LM2A 4HV6A 3A8HB 2XSJC 5AZIA 4GMJB 4ISEA 3M8QA 2HXOA 1CZAN 2BV6A 2VPRA 2XSDC 5IT9O 1AZGB 2DNUA 2VKEA 1TWGJ 1OCCH 3H0DA 2F5KA 2QASA 3GG4A 3TQ7P 2F2EA 1LFBA 1VQKQ 2FPFA 2P9IA 4DV6K 3R0AA 3GW2A 3L8BA 1YLFA 4RAZA 4PKCC 1IN5A 4JK7A 1X6BA 2DA6A 2LF8A 2KDZA 2CREA 2WV1A 1LVAA 3RIRA 4BVOA 3R8EA 2K5FA 2AXLA 4CJSA 1W2BP 3ZT4A 3EEQA 5C4JJ 1MWMA 5JHFA 1K83J 2Q31A 1OH6A 3EYIA 2KIUA 3QBYA 2J6OA 1D8KA 1XSVA 2TCTA 1NGAA 3FIWA 2YKMA 4H0TB 1XSDA 5J3LA 5LBQA 2E1ZA 3TANA 1HNZK 5IOZA 3RTVA 4XKCA 2RNJA 1WQWA 3CTAA 2DJNA 4NL3A 4ISFA 1HF0A 3BF3A 1YQKA 5IHKA 2LK2A 1YWPA 1ZK8A 5JVGL 3VEWA 2JPBA 5MLCQ 5JS1A 1BBZA 3U1DA 4CDGA 3QEXA 4MLHA 4JI0K 1BC7C 1T56A 2L7KA 4CEBA 4CUGA 3NBPA 3M0TA 3TDUC 2ZPFB 1OV3A 4BQLA 4BRKA 4HTUA 2ZXHA 9ANTA 4MHGA 2E7WA 5EG0A 4NOYA 2MCNA 4EIKA 3CQ8A 3MN7A 4IHVA 4KDPA 4DR5K 1RAGB 2E5NA 4ZYHA 1UECA 4GW6A 1IRGA 1QBJA 2I10A 4XKVA 2RD1A 1JL2A 2LX9A 2J6KA 4BC5A 2VV5A 3JXUA 2OJ2A 5L8RE 4HA8A 2GQQA 4UXNA 3BC8A 2EPFA 3JCMd 1N39A 3C6HA 2EQRA 5J2QA 4X34A 4EP4A 4HCCA 4DZJA 3A2FA 3K5MA 5LMNK 4HBLA 5CVRA 3GFMA 1K0XA 4J9GA 4DZPA 3ZETB 1RUOA 2GTDA 5JLWA 2CH6A 3CJQB 2DA2A 4M9XA 3MCAB 4MNUA 2YHAA 3AL0B 1B59A 1OZ2A 1AKHA 4FOIA 2DW4A 2XRLA 1HUXA 2O8DA 5J2PA 1VRTA 4WYBA 1BL0A 2DPUA 1Y96A 1B9MA 3PIPL 3CMEI 3N4QA 2NRXA 4FWPA 1NKCA 4KUMA 3QP5A 4CJRA 3HVTA 2UUAK 4FT2A 3B6CA 4OB2B 3KVGA 2X35A 4JS5A 3CCSI 4BQQA 1HBXG 3R2XC 2RHXA 2A28A 3CC4Q 3AHUA 5DLQE 3VPRA 1VQPN 1NK0A 2EV6A 2JUFA 1OKRA 4CJFA 4CJVA 1TAQA 1X9WA 4LH5A 1KG7A 3EO3A 5GANf 4N76A 2DBMA 2COWA 4PFZA 2QF7A 5CVJA 4CK1A 4J5YA 1MJAA 2P5VA 3QESA 4DSFA 2GQIA 3EGXA 3VU3C 2FA5A 3CJRB 3LMMA 4M75B 2B5JA 4CI0C 5FDLA 3NRVA 1WSHA 2EWSA 1BOAA 3GIBA 1OPLA 3RYPA 4X1VA 1YJNI 3V8LA 4K41A 4LSLA 3BDDA 2F5DA 1MBKA 2Z99A 2ZGZA 1QCOA 3OH6A 3X2QH 3WQTA 3OL3A 2VT2A 4FVUA 1QP2A 4M3TA 2A07F 3GMEA 1JJ2A 2QXFA 1QWFA 3NHGA 2FF4A 1G2HA 2XAQA 2P9PA 3BZ6A 3PO2J 2E65A 2KMTA 4O5BA 1JB0E 2VIXA 2X0LA 5SWMA 3WU2C 3LQRA 2NOGA 4CFBA 3CMEQ 2NOLA 2DFEA 4XQ3A 1T6CA 2EIMH 3G73A 2YRDA 2YHBA 2NS0A 4J00A 1ZX6A 2EJFA 2P9LA 5CR4A 4KHNA 4FX0A 4BKXA 2J05A 2TDXA 2DMOA 1MWKA 4LDVA 2YNHA 4ZN3A 2L9NA 2X6NA 4KHSA 2FRHA 1MH3A 2HPMA 1NKUA 3SQ0A 2FHDA 1RDWX 4BRCA 5J8CA 1EXQA 4RTYA 5CZ1A 4RTTA 2KTQA 2QSHX 4OMNA 1I07A 3LP1A 4QVCA 1QNTA 2EV5A 2CUDA 3QNNA 3VQ6A 1ZBSA 4A5AA 4KREA 4X9DA 3M8JA 4KB1A 2LVMA 2YRVA 4IOAL 5JVGF 4EMGA 3K1NA 4OJRA 2V1DA 1QZYA 1YJNQ 1ZRFA 3E3VA 2E1HA 2R3SA 2H27A 4V19S 2I7PA 3RKYA 3EH2A 3F10A 1LJOA 4ISGA 5EEHA 2HOTA 3G6EQ 3ZX2A 2HQAA 4WK8F 2M0YA 1T0FA 4H8KA 2KJCA 2L7MP 1F5TA 2GBQA 5C2DA 3RTRA 1OJLA 3SWNB 1XC5A 2YNIA 1WI7A 1TWAJ 3JCMW 2XGXA 2DM1A 1U5TB 4HSTA 3KLFA 2KZGA 3KJVA 1VSEA 2R7VA 1WSGA 4IX7A 4D6WA 3GVAA 1QE1A 1QU3A 3SCXA 4HV5A 4ETSA 4LH4A 4C9YA 2ZMEA 3D1NI 1MPGA 3LALA 2FBTA 1VQ8I 1Z26A 4J7IA 2BUPA 3JYTA 4DBHA 2YV0X 3HRGA 2O4XB 2HSTA 2O8FB 1PM3A 5GAOq 3VSKA 4KJZA 5LEKA 1OU9A 5HS7A 1T95A 3RQ4A 2K5IA 2DVJA 3PIPF 4FT8A 3O4NA 2DBKA 1JLEA 3JAME 1U6ZA 4E47A 2HYFA 2YRCA 2D0AA 4CD1A 3I4MJ 1IUYA 3T8RA 1KQ2A 3R6NA 4ESFA 4I6MA 2LSNA 2VQEK 1TL1A 3TOBA 1KQSA 3O3HA 4NC7A 2D9TA 5GINA 4A3FJ 4BNCA 3TAEA 3IV5A 1TUDA 2KXCA 4M63C 1UHFA 2Z16A 5FKOA 3BTCA 3MCZA 4D7MA 1RZ4A 1ZN2A 3TAGA 1D0XA 2XI9A 1DU6A 3CJBA 1JL1A 2IGKA 3PQKA 4OMYA 4CO8A 2HBKA 3KETA 1LFUP 3DAWA 3HM8A 1K78B 2FD5A 5B5EC 2LTOA 5C44J 4IHYA 4M77F 3BJAA 1T8IA 1DP3A 5CO7A 2IAJA 3H35A 2VQCA 1NJIO 3KTQA 4PL6A 3PVQA 3DWLA 4LF5K 2DOFA 4HX7A 1FY7A 4XOPA 2XY7A 2ZB9A 3M4GA 2E88A 3UA7A 3JCMX 1XNRK 2CT4A 1G99A 3H1CA 2E19A 1NJXA 2DOEA 3PL8A 3HSBA 3VDXA 4M7AD 2ESNA 2QEXN 4L0ZB 3ZSOA 4U0YA 3HXLA 2NRAC 2XIGA 4J2DA 3LDNA 4FK0A 4EQQA 3WTUC 1YS6A 3F0ZA 1YIJT 4P5OA 3K4NA 3U9GA 4CF8A 1NZ9A 5TRDA 2VXZA 3KZIC 1T3LA 3HVRA 4NQWA 5A2QE 3VKIA 2IPQX 4OVLA 4LK0F 2CFXA 4C2TA 4A3JJ 2LZ6B 2WSCE 3TARA 1VSIA 4GV6A 5BPLA 5LMUK 2XUBA 1S7EA 5DS9A 4DCHA 2EGEA 3NFAA 3ATVA 4JUVA 1M1KR 1P4AA 4XNFA 5HDNA 2VLAA 2V6CA 1G8XA 3RPQA 4KA4A 4L9TA 1DPUA 1J7KA 2L3RA 4GY5A 5KVRA 3ULQB 4HVWA 5BQTA 3CCQN 3L6QA 5LJ3f 1MNEA 3HB9A 3AT1B 3JB9F 1WJCA 1W2BS 1OVQA 5F6FA 4LLNA 1ITGA 1ZYQA 4IOAF 4HG2A 1Q81U 1QQIA 4M7YA 2V7ZA 5B1BH 4A69C 1TGOA 4RTVA 2WSEE 3MWTA 1KD1R 3I55I 5GPAA 3I5RA 1KC8R 2F6CA 4YOVA 1Y7XA 3RSEB 3GLXA 2RJDA 2FXUA 1NLPC 4MDAA 4CEQA 1OLTA 2DTUA 1A36A 4X62K 4ELUA 2K3PA 4OU0A 3ZXSA 2M87A 1PVEA 4GNIA 2IVWA 2DK8A 2HMIA 2AP1A 2A5WA 1XQOA 2GOMA 4WF2A 3F0CA 1XGSA 3RSNA 3D5LA 4CC3A 3H3NO 5KCOA 4M3GA 3SBTA 2HNIA 2KQRA 2DAOA 5KYXA 5CVUA 3D0PA 4RLQA 1XJWB 2F2WA 3H45C 3JCMe 2G8VA 1IRXA 1DT9A 1IG8A 2K4JA 3NWSA 3K9TA 4C0ZA 4EMKA 4X6AJ 1OOTA 2KIQA 2OPSA 4FE7A 2NLXA 3QYBA 3ASKA 1H88C 5I2MA 3UKRB 5D7UA 1K1ZA 3V9ZA 3BR3A 3EKSA 2YPRA 5ILUA 4RGSA 4DF4A 3KPHA 4LXCA 4I2QA 1TVRA 3MXMA 3QDFA 3KIOA 1VQ9T 4C92F 1XMAA 2H6BA 2ZNYA 3MJXA 1VQOT 4IJNA 3SV3A 3AAPA 3J80O 4UB6C 3OY9A 4C8MA 8ATCB 2EYQA 4ZGDB 1I1GA 4CEDA 2IIRA 1I1JA 3PX4A 1YX3A 2A68F 3MK6A 4RG2A 3MEUA 1GFCA 3ABUA 3DU5A 3Q7CA 2IA0A 1HYSA 5HK3A 3PIPA 3I55Q 4FJHA 5C24A 3EYZA 1JGGA 2HL3A 2GCXA 3FXOA 4M4ZA 5AQUA 3KYLA 4PKHA 2FXAA 1FZPB 3T9NA 1WAJA 2PYLA 3OBWA 1GRIA 2ATQA 1BGXT 3U1KA 4B8XA 4M42A 2JW4A 2R7WA 2I8DA 1X4PA 2YR2A 3QZ9B 2PMZA 4PGGA 4Z4HA 2HKOA 2G8UA 2FQ4A 2J06A 4A2BA 3UIQA 4B9MA 1W7PD 4WQ5A 4M75E 1MUYA 3KK3A 2VG5A 3MXJA 1XQPA 2NVTJ 3CXCM 2W48A 2BVMA 4H5RA 1RDBA 4BWJA 3SDBA 1P8ZA 3CJAA 3MEDA 5FPDA 4ZHRA 1TKXA 3F9MA 2A7YA 1WFXA 1B1BA 4EM2A 4ATOA 1NJIC 4CCNA 4B9QA 1B72A 4LOCA 4HF1A 3DB3A 2Z1DA 1WOQA 5LJ5d 1M30A 4CEZA 1YAGA 3RDVA 4M77A 2DODA 1PU8A 1HC8A 5KYUA 2YU3A 3S9HA 1SKSA 4CFCA 2K40A 4U67L 1X43A 4OKJA 3HOZJ 1M2OA 2FO0A 2ASPA 1DEJA 1R0CB 1G3YA 1DGRM 1KAZA 5IY5H 2GFUA 1LWWA 3RMCA 1I0CA 2OPTA 3F8CA 3VS3A 2RQRA 3EFOA 5EJCA 3EFRA 1HOMA 5GAHP 4XLFA 1ZBLA 4XL9A 3HL2A 1YQAA 4JK9A 2CRGA 3ZQ7A 2NOHA 4JEPA 3F8FA 3MP8A 1ZHFA 3W3DA 3FHGA 1K8AR 2QWMA 2Q97A 2RVCA 3AA2A 3U9ZA 3GLLA 2R7SA 3NMZC 2A3ZA 4K11A 3RR7A 5HY6A 3CDLA 5ICEA 2V52B 4U88A 3DOKA 3QINA 1QWEA 5FD5A 1EIFA 4BGBA 1BIZA 3BR0A 3IH3A 3RQIA 2E2PA 4M7DG 4E7ZA 3JSPA 1BN5A 3M9QA 1M90R 5HLIA 3JAMZ 2ACJA 5L3BA 4HW0A 4V19K 3A2KA 3F8MA 4BI8B 3PSIA 2E2HJ 1DUXC 2FVUA 4XH5A 3HDDA 2O0YA 3TPQA 3HKZA 3PFSA 2IVOA 1YIJA 1M27C 3M7GA 3QU6A 2HCKA 5F0HA 2HVQA 2E1YA 1O3RA 2RN2A 1O3QA 4E1MA 2X3XD 4GVEA 1M1EB 3WTWC 1HNIA 5DTDA 4E9GA 4B9WA 2ZMEB 3NMUA 4NL2A 3IRXA 4PSWA 1GVJA 2AT1B 4C0DB 1CQTA 4B3TK 1NNEA 5GANj 2BE5F 3VS7A 2V4JC 5CQGA 4CIEA 1MV0B 1U84A 2YLBA 2BY1A 3K4CA 2L3SA 3UB5A 1YT3A 5AQVA 1BU1A 4CYDA 4YOQA 2RB6A 1ZBFA 1ZGAA 5BNGA 2LCCA 4DW6A 3CCUT 5GAOm 3OR2C 1Q9XA 2K79A 1G3WA 2JUCA 1ZH5A 3WTYC 2VWBA 4K8ZA 4CZIA 4BREA 4QIWN 4RCHA 5TKWA 4B9UA 2E1MB 4AD9A 2OJED 2XRNA 3KD5E 4IZZA 2H3GX 4OPKA 2RJCA 3NTHA 4LDUA 3OYLA 2EHGA 3CCRQ 3N5BB 1JKHA 2BZ8A 2HHUA 3QMLA 4I02A 4A6EA 3I59A 3V7SA 4AM6A 5BN9A 2XDPA 3NHNA 1RBUA 3LA2A 4F14A 5CQEA 1UEBA 3JRZA 4CCKA 2ZJPL 3K1MA 3PNWC 1QSYA 3VF2A 3FXUA 2L8DA 4C92A 1W0HA 1RILA 3VMFB 1JJ6C 1L0OC 3J81Z 3SZGA 4DR2K 5FU7C 1HU0A 3CCET 3KD1E 5GMKl 2AK5A 1ORNA 1X3UA 1O9SA 1LE8A 4M7DC 1NGEA 2M30A 1U2VA 1R4MB 3CDHA 5E3MA 3ZP5A 2W10A 1DGKN 1LMZA 1G6NA 1WLJA 1W6XA 3CM6A 3I4NJ 5EGOA 1H1VA 3QOPA 1VQ9A 2D0BA 3I56N 1S72T 1Q86R 3SAGA 2FNAA 1VQOA 1MD0A 3F9KA 1MNDA 2HU9A 1KYZA 3CD6N 4JX4A 2H1LA 1UFFA 2MAMA 2NVXJ 5K1YA 1FJLA 4DLEA 4FLVA 1U48A 1QCFA 3V1QA 4CCMA 2W84A 2DL7A 4DR4K 1U78A 1ORPA 3EG3A 1STZA 4YOYA 2C0OA 4F7UF 3VQ4A 4NQWB 2BKDN 3B6OA 1ON1A 4ZJZA 4RM3A 3JSCA 3TL4X 4AFZC 3TAFA 2QKMB 2MSYA 2D1HA 3OSSC 3FX3A 4JX5A 1NPPA 1VQLQ 3OIQA 1D8JA 2AHQA 1X1CA 5AT1B 2DT6A 3COAC 1B3QA 3FDRA 2DQRA 3VUBA 5HRPA 3DKYA 2RI2A 1E6HA 1V5GA 1G3TA 2A40A 2M7BA 1T2KA 2DMQA 4M71A 3IS9A 4LC9B 3ZMSA 5J4YA 2HEQA 2PBIA 4RCCA 4H03B 1MA9B 1IBLK 1Z3XA 3TCJA 5K5RA 1V54H 4JKGA 1OULA 4JN4A 5J40A 1APLC 5E1ZB 5J47A 1REPC 2K9MA 2GAUA 3RR6A 4FK4A 3LX7A 3SNNA 4FO0A 3LM9A 2X51A 3RMBA 4ELVA 2OTJT 2RNGA 3F6VA 5J8FA 3GNGA 4O55A 4NB5A 3RKQA 2CYYA 2BIVA 2DL8A 1SHGA 4IDHA 1EX4A 3CZ6A 4OIOF 1FYKA 3FLCO 5K7HA 2P5LC 5M1NA 2EH3A 3CJ7A 2IDOA 4M78A 2ECCA 5AFUA 1KGSA 2EINH 3SQ4A 3DBLB 2GWRA 4YOWA 3CC7T 1VQMT 5EOYA 3HKSA 2V9VA 2XHIA 4J7FA 4CJ7A 3JS6A 1SHFA 3AO5A 4XTXA 1YHQI 2VCPA 4FM4B 5CZ2A 1HR0K 3C18A 1TT5B 4YOTA 3L4QA 4A62A 2D8JA 4Q0BA 4EATA 1Z9QA 3VEYA 1SD4A 4IHSA 5GAN6 4DF8A 2E64A 4BWMA 4XICA 4EZ6A 3FR0A 4YFUA 1S7AA 4YDUC 1LDJA 2DDAA 2DMUA 2LF7A 2E5KA 3BR5A 2DE0X 2FZGB 3VQDA 2DU9A 1O1WA 5KYYA 2EIJH 3OA6A 3S1QJ 1JO8A 4CERA 3RRGA 1MIJA 3O9QA 1W5CC 3VF4A 3W6JB 4FLXA 1JKRC 3Q0VA 5DV5A 2AIRB 4XBFA 4Z88A 4HVJA 3JB9I 1B7TA 3QO3A 3MP1A 4RKUE 4B9VA 5KN9A 1RBTA 2LMJA 2GUPA 3V6DA 1LWFA 1DGWY 2HB5A 1KAXA 5FLVA 2CP2A 1C1AA 4PFOA 1LCUA 3ZMTA 5DCMB 1WJEA 4FWNA 3DXMA 2BXZA 1E2XA 1SSFA 2ZJPF 1XCVA 2EFWA 4CGDA 4E1NA 1RETA 4IKFA 1M3CA 2DA5A 4XLPF 2O5RA 4ZZLA 5CK9A 2WTEA 4X1EA 3HGYA 3CCUA 5FGMA 2V8KA 4D7NA 3BR6A 5AQHA 4WE1A 1YHQQ 3KZBA 2DPDA 1HKSA 4IUPA 4BEHA 1VQ4T 3AVHA 4Y0WA 1VUBA 4RTZA 4GLKA 5KH6A 2KHOA 3HZJA 3C7NB 2BH1A 2IS1A 2DL4A 4YOUA 5HS9A 4M77B 1L3VA 5IP7J 5I2SA 4PGHA 2KDSA 5LJ3j 4M7AF 3QWYA 1K6YA 2A6EF 2WAQN 5LJ3d 5C0YA 1E4FT 3QWLA 2PG4A 3QPSA 1V4TA 4CGFA 2R5MA 4B3XA 3VF6A 2XAFA 5CKBA 1GLFO 1MJBA 3SDZA 2ZWHA 4UQGA 3EFOB 4JI3K 2QM3A 1V4SA 1C6VA 2KHMA 5FB2A 4N4HA 1TW2A 5LJ5e 3CCEA 1Z91A 1TQIA 2O31A 4JAXA 4ZTFA 3HRSA 4KBOA 3EGUA 4PJOG 3MAJA 1IN8A 1Q1VA 3A01B 3JCMh 4CZZA 3OOUA 3HRMA 2KEAA 2GEMA 2JVVA 3VQEA 2E6ZA 4H0OA 1BOBA 1VQ9I 2H8RA 3ALYA 1WQ2A 3CVTA 2E12A 2FSJA 1N8RR 1VQOI 3OVNA 1NG9A 5IP9J 2L9RA 5LL6Z 3BR2A 2F96A 1NK6A 1IDZA 2QWOA 2QQRA 4H0YB 1AHDP 2QXLA 5KYWA 3EGDA 2QWLA 2CUBA 2HQHA 1GOBA 2D5RA 2ZJQL 4M7XA 4DV2K 2DEQA 2RPIA 4BRDA 1IBKK 3ZR8X 3S1NJ 3HTSB 3AVGA 2M34A 2JM9A 1VSHA 4KFBA 4F93B 3TI0A 4KHQA 3ONQA 1VQ6T 2P0PA 1JE8A 4Z4FA 2A08A 4ILJA 1TK0A 3O1WA 2CGLA 2HBPA 4RB1A 2HQ5A 2VBYA 4RMNA 3WNGA 1H9TA 3T1BA 5B3SH 5AQPA 4O8KA 3CBMA 2YHWA 5HNHA 3AG2H 1UA0A 4C8QB 4JKEA 5EVZA 2M5WA 2NRZA 3B6PA 2EZLA 3WQUA 1QQCA 1NMNA 4AILC 3OW2P 2DA1A 2OPPA 2IBDA 3QPTA 3CC4N 4RTWA 4UNFA 3JB9J 3CPWM 3ABLH 3EUAA 1JEGA 2OV7A 3JTGA 2FBXA 4JNEA 2OTJA 4ZNXA 1YTAA 4FWOA 2PZSA 2VWKA 2A1RA 3CEYA 2KSSA 5EDNA 5LEJA 3UE5A 1R9TJ 1D5YA 4NYNA 2VQLA 3QOEA 1RT4A 2JK3A 5DLOA 3Q7BA 2DA4A 3L0QA 1MDMA 4PJOC 4M6VA 1UJYA 3IMXA 3CC7A 4C92B 1T44A 5BPNA 4O5FA 1VQMA 4W5RA 2P81A 4B1YB 2P9NA 4WCEL 2G8WA 2R7UA 2CZ0B 1FBUA 1Q7YR 3SYZA 1K4TA 3DP7A 1ETXA 3MX5A 3VA3A 3W2WA 4JP0A 1P90A 1KJWA 3CMEN 2XY6A 3AL0C 1IV0A 3E9FA 4UVAA 5EGOB 4J6XA 1D3YA 5GMKm 3MQ0A 4BXFA 2NRVA 3SEMA 4BQAA 3NFCA 2CGJA 3CERA 4JJNK 4LLGF 3CCSN 5IYCJ 4RG8A 4LG3A 2FBIA