3CWSA

Crystal structure of an alka host/guest complex 2'-fluoro-2'-deoxyinosine:thymine base pair
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 88
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cwsA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cwsA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cwsA01
1PU8A 1WEFA 4YPRA 2JG6A 1WEGA 4EA5A 3FHGA 2NOBA 1KG4A 1P7MA 3CW7A 3OGDA 1FN7A 1LMZA 1MPGA 1KG2A 3OH6A 2NOEA 3CWTA 4OFAA 5AN4A 5KN9A 2I5WA 4EJYA 5DPKA 1KEAA 4DK9A 2OFKA 2YG8A 5CHZA 2ABKA 1XG7A 3FHFA 4EA4A 2JHJA 4OFEA 1N3CA 1M3HA 2YG9A 1MUDA 1KG6A 3I0XA 1VRLA 4B24A 1N3AA 3CVTA 4B21A 1XQOA 4YOQA 2NOZA 4EW0A 1P59A 4E9EA 2NOLA 3IH7A 4PIIA 3CWUA 4E9HA 4AIAA 3S6IA 1ORNA 1KQJA 1PU7A 3OH9A 3FSPA 1KG3A 4AI4A 1KG7A 4EVVA 4B22A 1MUNA 1WEIA 1DIZA 1NKUA 2OFIA 2JHNA 4OFHA 4B23A 1M3QA 2H56A 1N39A 1PVSA 3KTUA 2XHIA 3CVSA 1RRSA 4EJZA 1XQPA 1YQKA 1LWVA 4E9FA 1PU6A 1YQLA 4YPHA 5KN8A 3CWSA 3N5NX 1RRQA 2NOIA 3KNTA 1YQRA 4HSBA 4UNFA 1EBMA 3N0UA 2NOHA 1LWWA 3G0QA 1KO9A 1HU0A 4UOBA 3CWAA 1NGNA 2NOFA 1ORPA 4EW4A 3I0WA 1KG5A 1MUYA 4AI5A 3F10A 3F0ZA 3IHOA 1LWYA 3D4VA 1YQMA 4E9GA
chains in the Genus database with same CATH superfamily
2H4LX 1JDYA 2JG6A 3S3MA 3NA5A 4EA5A 3SNSA 1T6AA 2DKCA 1P7MA 2HL9A 3OYHA 5EPCA 3OH6A 4OFAA 2HKPA 1QN9A 5DPKA 2YH5A 1MP9A 3T4NA 3I3WA 1J3MA 2V75A 2D0CA 2OOXA 3H1ZA 1LXTA 4C7PA 1N3CA 2QLVA 3OS2A 1MUDA 3D7QA 1KG6A 1KFIA 5IYDP 2D0BA 1C4GA 1QN6A 4BJUA 3R2XC 1M5Q1 2HZMA 3L2WA 3OYNA 3IH7A 1ORNA 2V9JA 5FRMA 1KQJA 1PU7A 3BKQX 3FSPA 4B22A 1WEIA 1NKUA 4D7QA 2OFIA 2JHNA 2HZSA 3OYEA 1K35A 1B9KA 1M3QA 1YTFA 4BE0A 3KTUA 1VOKA 2R5XA 1YQKA 3N89A 3ULXA 1CDWA 1PU6A 2V8QA 5IYBP 1RRQA 1KYUA 3L2RA 1YQRA 2F7LA 4UNFA 3ASMA 1EBMA 1R4XA 2HL8A 1HU0A 1NGNA 2FUVA 3OYAA 4NZGA 3EAYA 4BDYA 1AISA 4EAJA 4WXAA 1QNAA 4E7JA 1WEGA 2NOBA 1U84A 3PMGA 1NH2A 1KG2A 2NOEA 3CWTA 5HSHA 2I5WA 4ZTFA 3L2UA 3VW4A 1KEAA 1VOLB 4ZTJA 1C47A 2OFKA 1QN8A 2YG8A 2NWVA 5CHZA 2IV9A 2ABKA 1XG7A 4EA4A 1VKLA 2OOYA 1M3HA 4BDZA 3I0XA 1VRLA 4D7RA 1NVPA 3RPJA 4B24A 4RODB 2FKMX 1QN3A 4B21A 4YOQA 2NOZA 1QNEA 4E9EA 2IV8A 3S6IA 3OH9A 1C9BB 1KY6A 1XSZA 2DKAA 4IL8A 2W03A 1DIZA 1D3UA 4EAGA 3OYIA 1VTOA 3L2VA 5FRNA 1QTSA 3KRMA 4WX8A 3RSMA 1XQPA 1E42A 2PWWA 1YQLA 3N5NX 4IKFA 2V92A 5JN5A 3OS0A 1QNBA 3OSTA 1LWWA 2DKDA 4Q11A 2QR1A 1MUYA 5F9CA 3EIKA 2NLVA 3HS8A 3F10A 3F0ZA 1LWYA 3D4VA 2Z0FA 1EUVA 2FGTA 2EHBD 3DPUA 3FHGA 4E7HA 2JPIA 3CW7A 3OGDA 1LMZA 3ENCA 1MPGA 5AN4A 3C04A 5KN9A 3S3NA 1KYDA 3OSMA 1PZDA 1P5GX 2Y8LA 1WJWA 3DPTA 2NVMA 5BMPA 5IYCP 2D0AA 4PY5A 1N3AA 4ROEB 1XQOA 4WZSD 1P59A 4PIIA 3CWUA 1KY7A 4HJHA 2ZFDB 4B0AA 2JPSA 1QNCA 1KYFA 3OYBA 4E7KA 1MUNA 1NGMA 4OFHA 4BE2A 2Y8QA 1TUOA 4EAIA 1Q9UA 2G30A 2XHIA 2FKFA 1RRSA 3S3OA 3OLPA 4BACA 3OYLA 4EJZA 4EALA 4E9FA 1P5DX 1QN4A 4YPHA 5KN8A 4MRQA 1W80A 4CFFA 2QREA 3KNTA 1QN7A 3NNQA 3VN5A 1KFQA 2NOHA 3G0QA 4UOBA 1UL7A 2NOFA 1ORPA 4EW4A 3I0WA 1TBAB 3TDHA 3HS9A 4QG5A 3IHOA 2MJ7A 2YA3A 3OYFA 1YQMA 1VTLE 4E9GA 1PU8A 1WEFA 1WQAA 4YPRA 4DULA 1TBPA 2W04A 4TPSA 1KG4A 2MZ8A 2VJ0A 1FN7A 1PCMX 4EJYA 2H5AX 4E7IA 2LAEA 4DK9A 1PCJX 3FHFA 3LCNA 2Z8UA 2JHJA 4OFEA 1PCZA 2YG9A 1UT7A 3OYGA 3OS1A 4ROCB 3CVTA 3PDKA 3OY9A 4EW0A 4I8OA 5KL0A 2NOLA 4E7LA 4E9HA 4AIAA 3OYKA 1JFIC 3ENOC 1K2YX 1KG3A 4AI4A 1KG7A 3OYMA 4EVVA 1QN5A 3OSEA 5BMNA 2JOIA 4B23A 2H56A 1N39A 1PVSA 3CVSA 2QRCA 3OCIA 3UW2A 3OYJA 1LWVA 3L2QA 4BE1A 3CWSA 2O3OA 2NOIA 4HSBA 1UT4A 1V5SA 3N0UA 3OYDA 1YTBA 1KO9A 3CWAA 2QRDA 3OYCA 1RM1A 3OC3C 5FROA 3TE5A 5JMVD 1KG5A 4AI5A 1QTPA 1TGHA 4EAKA
chains in the Genus database with same CATH topology
1PU8A 1WEFA 4YPRA 2JG6A 1WEGA 4EA5A 3FHGA 2NOBA 1KG4A 1P7MA 3CW7A 3OGDA 1FN7A 1LMZA 1MPGA 1KG2A 3OH6A 2NOEA 3CWTA 4OFAA 5AN4A 5KN9A 2I5WA 4EJYA 5DPKA 1KEAA 4DK9A 2OFKA 2YG8A 5CHZA 2ABKA 1XG7A 3FHFA 4EA4A 2JHJA 4OFEA 1N3CA 1M3HA 2YG9A 1MUDA 1KG6A 3I0XA 1VRLA 4B24A 1N3AA 3CVTA 4B21A 1XQOA 4YOQA 2NOZA 4EW0A 1P59A 4E9EA 2NOLA 3IH7A 4PIIA 3CWUA 4E9HA 4AIAA 3S6IA 1ORNA 1KQJA 1PU7A 3OH9A 3FSPA 1KG3A 4AI4A 1KG7A 4EVVA 4B22A 1MUNA 1WEIA 1DIZA 1NKUA 2OFIA 2JHNA 4OFHA 4B23A 1M3QA 2H56A 1N39A 1PVSA 3KTUA 2XHIA 3CVSA 1RRSA 4EJZA 1XQPA 1YQKA 1LWVA 4E9FA 1PU6A 1YQLA 4YPHA 5KN8A 3CWSA 3N5NX 1RRQA 2NOIA 3KNTA 1YQRA 4HSBA 4UNFA 1EBMA 3N0UA 2NOHA 1LWWA 3G0QA 1KO9A 1HU0A 4UOBA 3CWAA 1NGNA 2NOFA 1ORPA 4EW4A 3I0WA 1KG5A 1MUYA 4AI5A 3F10A 3F0ZA 3IHOA 1LWYA 3D4VA 1YQMA 4E9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PU8 A;  1WEF A;  4YPR A;  2JG6 A;  1WEG A;  4EA5 A;  3FHG A;  2NOB A;  1KG4 A;  1P7M A;  3CW7 A;  3OGD A;  1FN7 A;  1LMZ A;  1MPG A;  1KG2 A;  3OH6 A;  2NOE A;  3CWT A;  4OFA A;  5AN4 A;  5KN9 A;  2I5W A;  4EJY A;  5DPK A;  1KEA A;  4DK9 A;  2OFK A;  2YG8 A;  5CHZ A;  2ABK A;  1XG7 A;  3FHF A;  4EA4 A;  2JHJ A;  4OFE A;  1N3C A;  1M3H A;  2YG9 A;  1MUD A;  1KG6 A;  3I0X A;  1VRL A;  4B24 A;  1N3A A;  3CVT A;  4B21 A;  1XQO A;  4YOQ A;  2NOZ A;  4EW0 A;  1P59 A;  4E9E A;  2NOL A;  3IH7 A;  4PII A;  3CWU A;  4E9H A;  4AIA A;  3S6I A;  1ORN A;  1KQJ A;  1PU7 A;  3OH9 A;  3FSP A;  1KG3 A;  4AI4 A;  1KG7 A;  4EVV A;  4B22 A;  1MUN A;  1WEI A;  1DIZ A;  1NKU A;  2OFI A;  2JHN A;  4OFH A;  4B23 A;  1M3Q A;  2H56 A;  1N39 A;  1PVS A;  3KTU A;  2XHI A;  3CVS A;  1RRS A;  4EJZ A;  1XQP A;  1YQK A;  1LWV A;  4E9F A;  1PU6 A;  1YQL A;  4YPH A;  5KN8 A;  3CWS A;  3N5N X;  1RRQ A;  2NOI A;  3KNT A;  1YQR A;  4HSB A;  4UNF A;  1EBM A;  3N0U A;  2NOH A;  1LWW A;  3G0Q A;  1KO9 A;  1HU0 A;  4UOB A;  3CWA A;  1NGN A;  2NOF A;  1ORP A;  4EW4 A;  3I0W A;  1KG5 A;  1MUY A;  4AI5 A;  3F10 A;  3F0Z A;  3IHO A;  1LWY A;  3D4V A;  1YQM A;  4E9G A; 
#chains in the Genus database with same CATH topology
 2H4L X;  1JDY A;  2JG6 A;  3S3M A;  3NA5 A;  4EA5 A;  3SNS A;  1T6A A;  2DKC A;  1P7M A;  2HL9 A;  3OYH A;  5EPC A;  3OH6 A;  4OFA A;  2HKP A;  1QN9 A;  5DPK A;  2YH5 A;  1MP9 A;  3T4N A;  3I3W A;  1J3M A;  2V75 A;  2D0C A;  2OOX A;  3H1Z A;  1LXT A;  4C7P A;  1N3C A;  2QLV A;  3OS2 A;  1MUD A;  3D7Q A;  1KG6 A;  1KFI A;  5IYD P;  2D0B A;  1C4G A;  1QN6 A;  4BJU A;  3R2X C;  1M5Q 1;  2HZM A;  3L2W A;  3OYN A;  3IH7 A;  1ORN A;  2V9J A;  5FRM A;  1KQJ A;  1PU7 A;  3BKQ X;  3FSP A;  4B22 A;  1WEI A;  1NKU A;  4D7Q A;  2OFI A;  2JHN A;  2HZS A;  3OYE A;  1K35 A;  1B9K A;  1M3Q A;  1YTF A;  4BE0 A;  3KTU A;  1VOK A;  2R5X A;  1YQK A;  3N89 A;  3ULX A;  1CDW A;  1PU6 A;  2V8Q A;  5IYB P;  1RRQ A;  1KYU A;  3L2R A;  1YQR A;  2F7L A;  4UNF A;  3ASM A;  1EBM A;  1R4X A;  2HL8 A;  1HU0 A;  1NGN A;  2FUV A;  3OYA A;  4NZG A;  3EAY A;  4BDY A;  1AIS A;  4EAJ A;  4WXA A;  1QNA A;  4E7J A;  1WEG A;  2NOB A;  1U84 A;  3PMG A;  1NH2 A;  1KG2 A;  2NOE A;  3CWT A;  5HSH A;  2I5W A;  4ZTF A;  3L2U A;  3VW4 A;  1KEA A;  1VOL B;  4ZTJ A;  1C47 A;  2OFK A;  1QN8 A;  2YG8 A;  2NWV A;  5CHZ A;  2IV9 A;  2ABK A;  1XG7 A;  4EA4 A;  1VKL A;  2OOY A;  1M3H A;  4BDZ A;  3I0X A;  1VRL A;  4D7R A;  1NVP A;  3RPJ A;  4B24 A;  4ROD B;  2FKM X;  1QN3 A;  4B21 A;  4YOQ A;  2NOZ A;  1QNE A;  4E9E A;  2IV8 A;  3S6I A;  3OH9 A;  1C9B B;  1KY6 A;  1XSZ A;  2DKA A;  4IL8 A;  2W03 A;  1DIZ A;  1D3U A;  4EAG A;  3OYI A;  1VTO A;  3L2V A;  5FRN A;  1QTS A;  3KRM A;  4WX8 A;  3RSM A;  1XQP A;  1E42 A;  2PWW A;  1YQL A;  3N5N X;  4IKF A;  2V92 A;  5JN5 A;  3OS0 A;  1QNB A;  3OST A;  1LWW A;  2DKD A;  4Q11 A;  2QR1 A;  1MUY A;  5F9C A;  3EIK A;  2NLV A;  3HS8 A;  3F10 A;  3F0Z A;  1LWY A;  3D4V A;  2Z0F A;  1EUV A;  2FGT A;  2EHB D;  3DPU A;  3FHG A;  4E7H A;  2JPI A;  3CW7 A;  3OGD A;  1LMZ A;  3ENC A;  1MPG A;  5AN4 A;  3C04 A;  5KN9 A;  3S3N A;  1KYD A;  3OSM A;  1PZD A;  1P5G X;  2Y8L A;  1WJW A;  3DPT A;  2NVM A;  5BMP A;  5IYC P;  2D0A A;  4PY5 A;  1N3A A;  4ROE B;  1XQO A;  4WZS D;  1P59 A;  4PII A;  3CWU A;  1KY7 A;  4HJH A;  2ZFD B;  4B0A A;  2JPS A;  1QNC A;  1KYF A;  3OYB A;  4E7K A;  1MUN A;  1NGM A;  4OFH A;  4BE2 A;  2Y8Q A;  1TUO A;  4EAI A;  1Q9U A;  2G30 A;  2XHI A;  2FKF A;  1RRS A;  3S3O A;  3OLP A;  4BAC A;  3OYL A;  4EJZ A;  4EAL A;  4E9F A;  1P5D X;  1QN4 A;  4YPH A;  5KN8 A;  4MRQ A;  1W80 A;  4CFF A;  2QRE A;  3KNT A;  1QN7 A;  3NNQ A;  3VN5 A;  1KFQ A;  2NOH A;  3G0Q A;  4UOB A;  1UL7 A;  2NOF A;  1ORP A;  4EW4 A;  3I0W A;  1TBA B;  3TDH A;  3HS9 A;  4QG5 A;  3IHO A;  2MJ7 A;  2YA3 A;  3OYF A;  1YQM A;  1VTL E;  4E9G A;  1PU8 A;  1WEF A;  1WQA A;  4YPR A;  4DUL A;  1TBP A;  2W04 A;  4TPS A;  1KG4 A;  2MZ8 A;  2VJ0 A;  1FN7 A;  1PCM X;  4EJY A;  2H5A X;  4E7I A;  2LAE A;  4DK9 A;  1PCJ X;  3FHF A;  3LCN A;  2Z8U A;  2JHJ A;  4OFE A;  1PCZ A;  2YG9 A;  1UT7 A;  3OYG A;  3OS1 A;  4ROC B;  3CVT A;  3PDK A;  3OY9 A;  4EW0 A;  4I8O A;  5KL0 A;  2NOL A;  4E7L A;  4E9H A;  4AIA A;  3OYK A;  1JFI C;  3ENO C;  1K2Y X;  1KG3 A;  4AI4 A;  1KG7 A;  3OYM A;  4EVV A;  1QN5 A;  3OSE A;  5BMN A;  2JOI A;  4B23 A;  2H56 A;  1N39 A;  1PVS A;  3CVS A;  2QRC A;  3OCI A;  3UW2 A;  3OYJ A;  1LWV A;  3L2Q A;  4BE1 A;  3CWS A;  2O3O A;  2NOI A;  4HSB A;  1UT4 A;  1V5S A;  3N0U A;  3OYD A;  1YTB A;  1KO9 A;  3CWA A;  2QRD A;  3OYC A;  1RM1 A;  3OC3 C;  5FRO A;  3TE5 A;  5JMV D;  1KG5 A;  4AI5 A;  1QTP A;  1TGH A;  4EAK A; 
#chains in the Genus database with same CATH homology
 1PU8 A;  1WEF A;  4YPR A;  2JG6 A;  1WEG A;  4EA5 A;  3FHG A;  2NOB A;  1KG4 A;  1P7M A;  3CW7 A;  3OGD A;  1FN7 A;  1LMZ A;  1MPG A;  1KG2 A;  3OH6 A;  2NOE A;  3CWT A;  4OFA A;  5AN4 A;  5KN9 A;  2I5W A;  4EJY A;  5DPK A;  1KEA A;  4DK9 A;  2OFK A;  2YG8 A;  5CHZ A;  2ABK A;  1XG7 A;  3FHF A;  4EA4 A;  2JHJ A;  4OFE A;  1N3C A;  1M3H A;  2YG9 A;  1MUD A;  1KG6 A;  3I0X A;  1VRL A;  4B24 A;  1N3A A;  3CVT A;  4B21 A;  1XQO A;  4YOQ A;  2NOZ A;  4EW0 A;  1P59 A;  4E9E A;  2NOL A;  3IH7 A;  4PII A;  3CWU A;  4E9H A;  4AIA A;  3S6I A;  1ORN A;  1KQJ A;  1PU7 A;  3OH9 A;  3FSP A;  1KG3 A;  4AI4 A;  1KG7 A;  4EVV A;  4B22 A;  1MUN A;  1WEI A;  1DIZ A;  1NKU A;  2OFI A;  2JHN A;  4OFH A;  4B23 A;  1M3Q A;  2H56 A;  1N39 A;  1PVS A;  3KTU A;  2XHI A;  3CVS A;  1RRS A;  4EJZ A;  1XQP A;  1YQK A;  1LWV A;  4E9F A;  1PU6 A;  1YQL A;  4YPH A;  5KN8 A;  3CWS A;  3N5N X;  1RRQ A;  2NOI A;  3KNT A;  1YQR A;  4HSB A;  4UNF A;  1EBM A;  3N0U A;  2NOH A;  1LWW A;  3G0Q A;  1KO9 A;  1HU0 A;  4UOB A;  3CWA A;  1NGN A;  2NOF A;  1ORP A;  4EW4 A;  3I0W A;  1KG5 A;  1MUY A;  4AI5 A;  3F10 A;  3F0Z A;  3IHO A;  1LWY A;  3D4V A;  1YQM A;  4E9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...