3CWSA

Crystal structure of an alka host/guest complex 2'-fluoro-2'-deoxyinosine:thymine base pair
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cwsA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cwsA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cwsA01
1VRLA 4AI5A 1ORPA 3N5NX 4EJYA 1KG2A 1MUDA 2NOIA 3OH9A 3N0UA 1LWVA 3CW7A 1MPGA 3FHFA 1MUYA 4OFHA 4EA5A 1KG4A 4EA4A 3CWSA 2JHJA 1P59A 1WEGA 4PIIA 3CVTA 5CHZA 1LWWA 3FHGA 4EJZA 1ORNA 1MUNA 4B21A 1RRQA 2NOEA 2NOHA 4E9EA 3I0XA 5AN4A 1NKUA 4B23A 1N3AA 4EVVA 1KG7A 3KTUA 1N3CA 4OFAA 1WEIA 3IHOA 4E9FA 1KQJA 1PU8A 3FSPA 5KN9A 2XHIA 2NOZA 1N39A 4DK9A 1KG3A 2I5WA 1YQRA 1PU6A 1KG5A 1HU0A 2OFIA 5DPKA 4OFEA 3OGDA 4E9GA 2ABKA 1KO9A 3CWAA 4B24A 1PU7A 2H56A 4HSBA 3KNTA 3I0WA 3D4VA 2NOLA 3CWUA 1M3HA 1WEFA 1YQKA 4E9HA 1YQLA 4UNFA 4EW4A 3OH6A 3IH7A 1LMZA 2JHNA 1M3QA 3G0QA 4B22A 4AIAA 1FN7A 3F0ZA 1XQOA 1DIZA 3CWTA 1KEAA 1LWYA 2OFKA 2NOBA 1NGNA 1P7MA 1YQMA 5KN8A 1KG6A 1PVSA 2JG6A 4YOQA 2YG8A 4UOBA 4AI4A 4EW0A 2NOFA 3S6IA 1RRSA 3CVSA 4YPHA 1EBMA 4YPRA 3F10A 1XG7A 2YG9A 1XQPA
chains in the Genus database with same CATH superfamily
1VRLA 4AI5A 3N5NX 4HJHA 3ENOC 3CW7A 1K2YX 2DKAA 2Y8QA 1MUYA 4OFHA 1QTPA 5FROA 3CWSA 4NZGA 2IV8A 4EJZA 1RRQA 3EAYA 3PDKA 2NOHA 5AN4A 4BDZA 1VTOA 4B23A 4CFFA 2V92A 3KTUA 2LAEA 3L2RA 4E7KA 4EAKA 3TE5A 1WEIA 4E9FA 1MP9A 1PU8A 1JFIC 2YA3A 1QNEA 2XHIA 1KYUA 3ENCA 1KG3A 3OYNA 5DPKA 3OGDA 3OYIA 3T4NA 1W80A 1K35A 1QNCA 2H56A 3VW4A 4E7HA 1QTSA 2HZMA 3I0WA 3D4VA 3VN5A 1M3HA 1M5Q1 1VOKA 4BE2A 1KYFA 3OH6A 3IH7A 2HL9A 3F0ZA 1QN5A 2FKFA 3UW2A 3L2WA 2OFKA 1NGNA 1PCJX 5KN8A 3S3OA 2JG6A 3OLPA 1PCZA 1KY6A 3HS8A 4EW0A 3RPJA 4EAJA 2NOFA 2D0AA 3CVSA 4IKFA 3OYCA 4YPRA 4DULA 1KYDA 1NH2A 2YG9A 1XQPA 3D7QA 2QRDA 2QRCA 2OOYA 1MUDA 3OH9A 3NNQA 4BDYA 1MPGA 3FHFA 5JN5A 3ASMA 1WQAA 3PMGA 3OY9A 2JHJA 1Q9UA 3CVTA 3OYEA 1ORNA 4B21A 1RM1A 4PY5A 4E9EA 4B0AA 4ROCB 1NKUA 1R4XA 1C9BB 2QLVA 5IYDP 1KQJA 1UT7A 2O3OA 2H4LX 3L2VA 1KFIA 2NOZA 1UT4A 1U84A 3OSTA 1QN7A 2FKMX 1HU0A 4E7LA 1CDWA 3SNSA 2ABKA 1QN8A 1V5SA 2JOIA 2JPIA 3KNTA 2HKPA 2NOLA 2W03A 3DPTA 3OYAA 2QR1A 4E9HA 2D0CA 3I3WA 2V8QA 3OYDA 1EUVA 3BKQX 4ZTJA 1D3UA 3OC3C 3RSMA 1KFQA 3LCNA 1FN7A 4D7QA 1YTFA 1XQOA 4WX8A 1KEAA 4IL8A 1QN4A 2YG8A 4UOBA 4ZTFA 3S6IA 1RRSA 1KY7A 1PCMX 3F10A 3OS0A 3OYMA 1ORPA 4EJYA 3NA5A 2NOIA 3N0UA 1LWVA 1QNBA 2YH5A 3S3MA 3OSMA 1UL7A 1T6AA 4EA5A 1P59A 1WEGA 4EALA 1WJWA 4EAIA 1QN9A 2FGTA 1TUOA 1P5GX 1N3AA 1KG7A 1N3CA 5F9CA 3C04A 3IHOA 3FSPA 2Y8LA 1N39A 2MJ7A 2I5WA 3R2XC 2OFIA 2NWVA 4Q11A 1C4GA 4OFEA 2FUVA 1KO9A 3CWAA 4B24A 1J3MA 1QNAA 4WXAA 1P5DX 1YQKA 2Z8UA 4TPSA 1YQLA 3L2QA 1AISA 2EHBD 2JHNA 2DKCA 3OYKA 4EAGA 3G0QA 4B22A 1QN3A 4D7RA 3OYLA 4BE0A 3H1ZA 3OYFA 3CWTA 5IYCP 4BJUA 5FRNA 1TGHA 1P7MA 1KG6A 2NVMA 4YOQA 1NVPA 1YTBA 4BE1A 1EBMA 1LXTA 1XG7A 2Z0FA 3OYJA 5BMPA 1KG2A 3OSEA 2G30A 4RODB 3ULXA 3KRMA 1KG4A 4EA4A 1E42A 4MRQA 5BMNA 3HS9A 5JMVD 4PIIA 5CHZA 2V75A 3OYHA 1LWWA 3FHGA 1PZDA 1QN6A 2OOXA 5KL0A 1MUNA 2NOEA 3I0XA 2HL8A 4EVVA 1VKLA 4OFAA 5EPCA 2NLVA 4E7JA 1TBPA 5HSHA 5KN9A 2HZSA 1JDYA 4DK9A 4BACA 1YQRA 1PU6A 2V9JA 1KG5A 4E7IA 2F7LA 4E9GA 3OS2A 1VOLB 3OYBA 2IV9A 1PU7A 4HSBA 5FRMA 3OCIA 1XSZA 2PWWA 3L2UA 2D0BA 4QG5A 1C47A 3CWUA 3S3NA 1WEFA 3OYGA 4UNFA 1TBAB 4EW4A 2JPSA 5IYBP 1LMZA 1M3QA 2H5AX 1B9KA 3TDHA 4AIAA 4WZSD 3DPUA 2VJ0A 2DKDA 1DIZA 1LWYA 4ROEB 2R5XA 3N89A 2NOBA 1YQMA 3EIKA 1NGMA 1PVSA 4AI4A 2QREA 4C7PA 2ZFDB 2W04A 1VTLE 4YPHA 2MZ8A 4I8OA 3OS1A
chains in the Genus database with same CATH topology
1VRLA 4AI5A 1ORPA 3N5NX 4EJYA 1KG2A 1MUDA 2NOIA 3OH9A 3N0UA 1LWVA 3CW7A 1MPGA 3FHFA 1MUYA 4OFHA 4EA5A 1KG4A 4EA4A 3CWSA 2JHJA 1P59A 1WEGA 4PIIA 3CVTA 5CHZA 1LWWA 3FHGA 4EJZA 1ORNA 1MUNA 4B21A 1RRQA 2NOEA 2NOHA 4E9EA 3I0XA 5AN4A 1NKUA 4B23A 1N3AA 4EVVA 1KG7A 3KTUA 1N3CA 4OFAA 1WEIA 3IHOA 4E9FA 1KQJA 1PU8A 3FSPA 5KN9A 2XHIA 2NOZA 1N39A 4DK9A 1KG3A 2I5WA 1YQRA 1PU6A 1KG5A 1HU0A 2OFIA 5DPKA 4OFEA 3OGDA 4E9GA 2ABKA 1KO9A 3CWAA 4B24A 1PU7A 2H56A 4HSBA 3KNTA 3I0WA 3D4VA 2NOLA 3CWUA 1M3HA 1WEFA 1YQKA 4E9HA 1YQLA 4UNFA 4EW4A 3OH6A 3IH7A 1LMZA 2JHNA 1M3QA 3G0QA 4B22A 4AIAA 1FN7A 3F0ZA 1XQOA 1DIZA 3CWTA 1KEAA 1LWYA 2OFKA 2NOBA 1NGNA 1P7MA 1YQMA 5KN8A 1KG6A 1PVSA 2JG6A 4YOQA 2YG8A 4UOBA 4AI4A 4EW0A 2NOFA 3S6IA 1RRSA 3CVSA 4YPHA 1EBMA 4YPRA 3F10A 1XG7A 2YG9A 1XQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRL A;  4AI5 A;  1ORP A;  3N5N X;  4EJY A;  1KG2 A;  1MUD A;  2NOI A;  3OH9 A;  3N0U A;  1LWV A;  3CW7 A;  1MPG A;  3FHF A;  1MUY A;  4OFH A;  4EA5 A;  1KG4 A;  4EA4 A;  3CWS A;  2JHJ A;  1P59 A;  1WEG A;  4PII A;  3CVT A;  5CHZ A;  1LWW A;  3FHG A;  4EJZ A;  1ORN A;  1MUN A;  4B21 A;  1RRQ A;  2NOE A;  2NOH A;  4E9E A;  3I0X A;  5AN4 A;  1NKU A;  4B23 A;  1N3A A;  4EVV A;  1KG7 A;  3KTU A;  1N3C A;  4OFA A;  1WEI A;  3IHO A;  4E9F A;  1KQJ A;  1PU8 A;  3FSP A;  5KN9 A;  2XHI A;  2NOZ A;  1N39 A;  4DK9 A;  1KG3 A;  2I5W A;  1YQR A;  1PU6 A;  1KG5 A;  1HU0 A;  2OFI A;  5DPK A;  4OFE A;  3OGD A;  4E9G A;  2ABK A;  1KO9 A;  3CWA A;  4B24 A;  1PU7 A;  2H56 A;  4HSB A;  3KNT A;  3I0W A;  3D4V A;  2NOL A;  3CWU A;  1M3H A;  1WEF A;  1YQK A;  4E9H A;  1YQL A;  4UNF A;  4EW4 A;  3OH6 A;  3IH7 A;  1LMZ A;  2JHN A;  1M3Q A;  3G0Q A;  4B22 A;  4AIA A;  1FN7 A;  3F0Z A;  1XQO A;  1DIZ A;  3CWT A;  1KEA A;  1LWY A;  2OFK A;  2NOB A;  1NGN A;  1P7M A;  1YQM A;  5KN8 A;  1KG6 A;  1PVS A;  2JG6 A;  4YOQ A;  2YG8 A;  4UOB A;  4AI4 A;  4EW0 A;  2NOF A;  3S6I A;  1RRS A;  3CVS A;  4YPH A;  1EBM A;  4YPR A;  3F10 A;  1XG7 A;  2YG9 A;  1XQP A; 
#chains in the Genus database with same CATH topology
 1VRL A;  4AI5 A;  3N5N X;  4HJH A;  3ENO C;  3CW7 A;  1K2Y X;  2DKA A;  2Y8Q A;  1MUY A;  4OFH A;  1QTP A;  5FRO A;  3CWS A;  4NZG A;  2IV8 A;  4EJZ A;  1RRQ A;  3EAY A;  3PDK A;  2NOH A;  5AN4 A;  4BDZ A;  1VTO A;  4B23 A;  4CFF A;  2V92 A;  3KTU A;  2LAE A;  3L2R A;  4E7K A;  4EAK A;  3TE5 A;  1WEI A;  4E9F A;  1MP9 A;  1PU8 A;  1JFI C;  2YA3 A;  1QNE A;  2XHI A;  1KYU A;  3ENC A;  1KG3 A;  3OYN A;  5DPK A;  3OGD A;  3OYI A;  3T4N A;  1W80 A;  1K35 A;  1QNC A;  2H56 A;  3VW4 A;  4E7H A;  1QTS A;  2HZM A;  3I0W A;  3D4V A;  3VN5 A;  1M3H A;  1M5Q 1;  1VOK A;  4BE2 A;  1KYF A;  3OH6 A;  3IH7 A;  2HL9 A;  3F0Z A;  1QN5 A;  2FKF A;  3UW2 A;  3L2W A;  2OFK A;  1NGN A;  1PCJ X;  5KN8 A;  3S3O A;  2JG6 A;  3OLP A;  1PCZ A;  1KY6 A;  3HS8 A;  4EW0 A;  3RPJ A;  4EAJ A;  2NOF A;  2D0A A;  3CVS A;  4IKF A;  3OYC A;  4YPR A;  4DUL A;  1KYD A;  1NH2 A;  2YG9 A;  1XQP A;  3D7Q A;  2QRD A;  2QRC A;  2OOY A;  1MUD A;  3OH9 A;  3NNQ A;  4BDY A;  1MPG A;  3FHF A;  5JN5 A;  3ASM A;  1WQA A;  3PMG A;  3OY9 A;  2JHJ A;  1Q9U A;  3CVT A;  3OYE A;  1ORN A;  4B21 A;  1RM1 A;  4PY5 A;  4E9E A;  4B0A A;  4ROC B;  1NKU A;  1R4X A;  1C9B B;  2QLV A;  5IYD P;  1KQJ A;  1UT7 A;  2O3O A;  2H4L X;  3L2V A;  1KFI A;  2NOZ A;  1UT4 A;  1U84 A;  3OST A;  1QN7 A;  2FKM X;  1HU0 A;  4E7L A;  1CDW A;  3SNS A;  2ABK A;  1QN8 A;  1V5S A;  2JOI A;  2JPI A;  3KNT A;  2HKP A;  2NOL A;  2W03 A;  3DPT A;  3OYA A;  2QR1 A;  4E9H A;  2D0C A;  3I3W A;  2V8Q A;  3OYD A;  1EUV A;  3BKQ X;  4ZTJ A;  1D3U A;  3OC3 C;  3RSM A;  1KFQ A;  3LCN A;  1FN7 A;  4D7Q A;  1YTF A;  1XQO A;  4WX8 A;  1KEA A;  4IL8 A;  1QN4 A;  2YG8 A;  4UOB A;  4ZTF A;  3S6I A;  1RRS A;  1KY7 A;  1PCM X;  3F10 A;  3OS0 A;  3OYM A;  1ORP A;  4EJY A;  3NA5 A;  2NOI A;  3N0U A;  1LWV A;  1QNB A;  2YH5 A;  3S3M A;  3OSM A;  1UL7 A;  1T6A A;  4EA5 A;  1P59 A;  1WEG A;  4EAL A;  1WJW A;  4EAI A;  1QN9 A;  2FGT A;  1TUO A;  1P5G X;  1N3A A;  1KG7 A;  1N3C A;  5F9C A;  3C04 A;  3IHO A;  3FSP A;  2Y8L A;  1N39 A;  2MJ7 A;  2I5W A;  3R2X C;  2OFI A;  2NWV A;  4Q11 A;  1C4G A;  4OFE A;  2FUV A;  1KO9 A;  3CWA A;  4B24 A;  1J3M A;  1QNA A;  4WXA A;  1P5D X;  1YQK A;  2Z8U A;  4TPS A;  1YQL A;  3L2Q A;  1AIS A;  2EHB D;  2JHN A;  2DKC A;  3OYK A;  4EAG A;  3G0Q A;  4B22 A;  1QN3 A;  4D7R A;  3OYL A;  4BE0 A;  3H1Z A;  3OYF A;  3CWT A;  5IYC P;  4BJU A;  5FRN A;  1TGH A;  1P7M A;  1KG6 A;  2NVM A;  4YOQ A;  1NVP A;  1YTB A;  4BE1 A;  1EBM A;  1LXT A;  1XG7 A;  2Z0F A;  3OYJ A;  5BMP A;  1KG2 A;  3OSE A;  2G30 A;  4ROD B;  3ULX A;  3KRM A;  1KG4 A;  4EA4 A;  1E42 A;  4MRQ A;  5BMN A;  3HS9 A;  5JMV D;  4PII A;  5CHZ A;  2V75 A;  3OYH A;  1LWW A;  3FHG A;  1PZD A;  1QN6 A;  2OOX A;  5KL0 A;  1MUN A;  2NOE A;  3I0X A;  2HL8 A;  4EVV A;  1VKL A;  4OFA A;  5EPC A;  2NLV A;  4E7J A;  1TBP A;  5HSH A;  5KN9 A;  2HZS A;  1JDY A;  4DK9 A;  4BAC A;  1YQR A;  1PU6 A;  2V9J A;  1KG5 A;  4E7I A;  2F7L A;  4E9G A;  3OS2 A;  1VOL B;  3OYB A;  2IV9 A;  1PU7 A;  4HSB A;  5FRM A;  3OCI A;  1XSZ A;  2PWW A;  3L2U A;  2D0B A;  4QG5 A;  1C47 A;  3CWU A;  3S3N A;  1WEF A;  3OYG A;  4UNF A;  1TBA B;  4EW4 A;  2JPS A;  5IYB P;  1LMZ A;  1M3Q A;  2H5A X;  1B9K A;  3TDH A;  4AIA A;  4WZS D;  3DPU A;  2VJ0 A;  2DKD A;  1DIZ A;  1LWY A;  4ROE B;  2R5X A;  3N89 A;  2NOB A;  1YQM A;  3EIK A;  1NGM A;  1PVS A;  4AI4 A;  2QRE A;  4C7P A;  2ZFD B;  2W04 A;  1VTL E;  4YPH A;  2MZ8 A;  4I8O A;  3OS1 A; 
#chains in the Genus database with same CATH homology
 1VRL A;  4AI5 A;  1ORP A;  3N5N X;  4EJY A;  1KG2 A;  1MUD A;  2NOI A;  3OH9 A;  3N0U A;  1LWV A;  3CW7 A;  1MPG A;  3FHF A;  1MUY A;  4OFH A;  4EA5 A;  1KG4 A;  4EA4 A;  3CWS A;  2JHJ A;  1P59 A;  1WEG A;  4PII A;  3CVT A;  5CHZ A;  1LWW A;  3FHG A;  4EJZ A;  1ORN A;  1MUN A;  4B21 A;  1RRQ A;  2NOE A;  2NOH A;  4E9E A;  3I0X A;  5AN4 A;  1NKU A;  4B23 A;  1N3A A;  4EVV A;  1KG7 A;  3KTU A;  1N3C A;  4OFA A;  1WEI A;  3IHO A;  4E9F A;  1KQJ A;  1PU8 A;  3FSP A;  5KN9 A;  2XHI A;  2NOZ A;  1N39 A;  4DK9 A;  1KG3 A;  2I5W A;  1YQR A;  1PU6 A;  1KG5 A;  1HU0 A;  2OFI A;  5DPK A;  4OFE A;  3OGD A;  4E9G A;  2ABK A;  1KO9 A;  3CWA A;  4B24 A;  1PU7 A;  2H56 A;  4HSB A;  3KNT A;  3I0W A;  3D4V A;  2NOL A;  3CWU A;  1M3H A;  1WEF A;  1YQK A;  4E9H A;  1YQL A;  4UNF A;  4EW4 A;  3OH6 A;  3IH7 A;  1LMZ A;  2JHN A;  1M3Q A;  3G0Q A;  4B22 A;  4AIA A;  1FN7 A;  3F0Z A;  1XQO A;  1DIZ A;  3CWT A;  1KEA A;  1LWY A;  2OFK A;  2NOB A;  1NGN A;  1P7M A;  1YQM A;  5KN8 A;  1KG6 A;  1PVS A;  2JG6 A;  4YOQ A;  2YG8 A;  4UOB A;  4AI4 A;  4EW0 A;  2NOF A;  3S6I A;  1RRS A;  3CVS A;  4YPH A;  1EBM A;  4YPR A;  3F10 A;  1XG7 A;  2YG9 A;  1XQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...