3CVSA

Crystal structure of an alka host/guest complex 8oxoguanine:adenine base pair
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 89
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cvsA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cvsA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cvsA01
3CWAA 1ORNA 1KG3A 1WEFA 1LWWA 1M3QA 2JHNA 4EW0A 4AIAA 5AN4A 1N3AA 4YPRA 3F0ZA 4E9FA 3IHOA 5KN9A 1XQPA 3FHGA 4E9GA 1KO9A 1PU6A 3CWUA 3CWTA 4EVVA 4YOQA 1PU7A 2NOEA 2OFKA 2XHIA 4YPHA 1ORPA 3IH7A 3CVTA 4DK9A 5CHZA 1N3CA 3F10A 4EA5A 1LWYA 4OFHA 1KG2A 1KQJA 1XQOA 4B21A 1MUNA 1KG6A 1P7MA 5KN8A 3CWSA 4EJZA 1EBMA 1KG7A 2NOBA 1PVSA 5DPKA 1YQMA 2NOZA 3S6IA 4AI5A 4E9HA 2NOHA 2H56A 3KNTA 3OH9A 3CVSA 2JG6A 3I0WA 2YG8A 2I5WA 1WEIA 4B22A 3KTUA 3FSPA 2NOLA 3OH6A 1YQKA 3N5NX 1RRSA 1HU0A 1VRLA 4OFEA 3N0UA 2YG9A 4B23A 1MPGA 1N39A 1LWVA 1KG5A 3I0XA 1KG4A 1NKUA 1YQLA 1YQRA 4UOBA 4EW4A 1DIZA 3CW7A 1MUYA 1MUDA 4UNFA 1NGNA 2JHJA 4EA4A 2NOIA 3D4VA 4EJYA 1FN7A 1M3HA 4B24A 3G0QA 1P59A 2OFIA 3FHFA 2ABKA 4E9EA 4OFAA 1PU8A 1RRQA 1LMZA 3OGDA 4AI4A 4PIIA 1KEAA 4HSBA 2NOFA 1WEGA 1XG7A
chains in the Genus database with same CATH superfamily
2OOXA 1YTBA 3LCNA 1N3AA 3IHOA 1XQPA 2ZFDB 1QTPA 2Z8UA 4EAJA 3OSEA 3OYFA 4BE0A 2OOYA 4D7QA 3S3OA 3OYNA 3L2QA 1WEGA 1TBPA 2V8QA 2QRCA 2OFKA 1J3MA 2D0BA 3OYGA 5CHZA 3L2WA 3PDKA 4EA5A 1LWYA 3DPUA 4IL8A 1XQOA 1P7MA 2YH5A 1YQMA 3OYMA 3VW4A 4AI5A 4BE2A 1D3UA 2H56A 3OLPA 3CVSA 3I0WA 2F7LA 4EAKA 3OYBA 3FSPA 1RRSA 1PZDA 1WQAA 4NZGA 4RODB 1P5GX 2YG9A 1NVPA 1MPGA 3OYCA 3I0XA 1KG4A 1KY6A 1YQRA 4UOBA 1K2YX 2W04A 4BE1A 2Z0FA 1M5Q1 3CW7A 4PY5A 2HZSA 2QR1A 3OS0A 1U84A 1TGHA 4EA4A 3D4VA 2G30A 3BKQX 1M3HA 5FROA 3OC3C 2OFIA 5JMVD 5BMPA 3FHFA 3OYDA 3NNQA 2W03A 2EHBD 1YTFA 1KG3A 3OSTA 5IYBP 1VTLE 1TBAB 1QN9A 1B9KA 3I3WA 5AN4A 4YPRA 4BDZA 3OYJA 1C47A 2DKCA 2QRDA 1QNAA 4WZSD 3CWTA 1KYUA 4YOQA 1PU7A 2NOEA 2XHIA 1ORPA 2R5XA 1PCJX 1KYFA 1KYDA 1KG6A 5KN8A 1EBMA 1KG7A 3S6IA 5FRMA 3S3MA 3KNTA 4BDYA 3OH9A 1JDYA 1JFIC 2JG6A 1KFQA 2HZMA 2YG8A 1WEIA 3TDHA 1QNEA 2NOLA 1YQKA 3OSMA 3L2UA 2FKFA 3OS2A 3RPJA 4E7LA 1LWVA 3T4NA 1MP9A 1KG5A 1YQLA 2Y8QA 3OYEA 1Q9UA 1VTOA 2PWWA 1DIZA 1UT7A 4UNFA 1NGNA 2IV9A 5IYCP 2QLVA 4E7KA 3S3NA 2MZ8A 4D7RA 3VN5A 3OYAA 1P59A 2JPIA 3R2XC 5BMNA 4E9EA 3L2VA 1QN8A 1RRQA 1WJWA 3H1ZA 4PIIA 4HSBA 4I8OA 4QG5A 1NH2A 1PCZA 1ORNA 1LWWA 1M3QA 2JHNA 2H5AX 2HKPA 2IV8A 1VOLB 5IYDP 1QTSA 2VJ0A 5KN9A 4B0AA 3SNSA 4MRQA 1KO9A 2NWVA 3L2RA 4TPSA 1R4XA 3TE5A 4ZTFA 4YPHA 3CVTA 3F10A 1T6AA 2D0AA 1KQJA 4B21A 4ZTJA 2V75A 3CWSA 4EJZA 2NOBA 1PVSA 1UL7A 3ULXA 4E9HA 2DKAA 2FUVA 2H4LX 4Q11A 1QNBA 3KTUA 2FKMX 3N5NX 4EAGA 4OFEA 4E7JA 1QN7A 1N39A 1KY7A 1PCMX 1V5SA 3NA5A 3OYKA 2NLVA 1QNCA 3C04A 1QN3A 1MUYA 3RSMA 2JHJA 1KFIA 2NOIA 1FN7A 1NGMA 1QN5A 3EAYA 4OFAA 1VKLA 4BJUA 3ENOC 3ENCA 1XSZA 3HS9A 1C9BB 1QN4A 2D0CA 1XG7A 3CWAA 4WXAA 1QN6A 1WEFA 2HL9A 5HSHA 2V9JA 4EW0A 5JN5A 4AIAA 3D7QA 1UT4A 4C7PA 2YA3A 3F0ZA 4E9FA 3OYLA 5EPCA 3FHGA 4E9GA 1W80A 1LXTA 1PU6A 2JOIA 3CWUA 3EIKA 4ROEB 4EVVA 3OCIA 1CDWA 3PMGA 2DKDA 3IH7A 2HL8A 4DK9A 1N3CA 4OFHA 3DPTA 1KG2A 4WX8A 1MUNA 4HJHA 5DPKA 2QREA 2NOZA 3UW2A 3OS1A 4ROCB 2NOHA 1C4GA 2FGTA 3N89A 4DULA 3OYIA 4BACA 4IKFA 2I5WA 2O3OA 4B22A 3KRMA 4EALA 3OH6A 1HU0A 2LAEA 1VRLA 1E42A 4CFFA 3N0UA 4E7HA 2JPSA 4B23A 2NVMA 1NKUA 1EUVA 4EW4A 1TUOA 5FRNA 5F9CA 1RM1A 3ASMA 1P5DX 1MUDA 1K35A 2V92A 4EJYA 4EAIA 3OYHA 4B24A 1VOKA 2MJ7A 2Y8LA 3HS8A 3G0QA 3OY9A 2ABKA 1AISA 1PU8A 1LMZA 3OGDA 4AI4A 1KEAA 2NOFA 5KL0A 4E7IA
chains in the Genus database with same CATH topology
3CWAA 1ORNA 1KG3A 1WEFA 1LWWA 1M3QA 2JHNA 4EW0A 4AIAA 5AN4A 1N3AA 4YPRA 3F0ZA 4E9FA 3IHOA 5KN9A 1XQPA 3FHGA 4E9GA 1KO9A 1PU6A 3CWUA 3CWTA 4EVVA 4YOQA 1PU7A 2NOEA 2OFKA 2XHIA 4YPHA 1ORPA 3IH7A 3CVTA 4DK9A 5CHZA 1N3CA 3F10A 4EA5A 1LWYA 4OFHA 1KG2A 1KQJA 1XQOA 4B21A 1MUNA 1KG6A 1P7MA 5KN8A 3CWSA 4EJZA 1EBMA 1KG7A 2NOBA 1PVSA 5DPKA 1YQMA 2NOZA 3S6IA 4AI5A 4E9HA 2NOHA 2H56A 3KNTA 3OH9A 3CVSA 2JG6A 3I0WA 2YG8A 2I5WA 1WEIA 4B22A 3KTUA 3FSPA 2NOLA 3OH6A 1YQKA 3N5NX 1RRSA 1HU0A 1VRLA 4OFEA 3N0UA 2YG9A 4B23A 1MPGA 1N39A 1LWVA 1KG5A 3I0XA 1KG4A 1NKUA 1YQLA 1YQRA 4UOBA 4EW4A 1DIZA 3CW7A 1MUYA 1MUDA 4UNFA 1NGNA 2JHJA 4EA4A 2NOIA 3D4VA 4EJYA 1FN7A 1M3HA 4B24A 3G0QA 1P59A 2OFIA 3FHFA 2ABKA 4E9EA 4OFAA 1PU8A 1RRQA 1LMZA 3OGDA 4AI4A 4PIIA 1KEAA 4HSBA 2NOFA 1WEGA 1XG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWA A;  1ORN A;  1KG3 A;  1WEF A;  1LWW A;  1M3Q A;  2JHN A;  4EW0 A;  4AIA A;  5AN4 A;  1N3A A;  4YPR A;  3F0Z A;  4E9F A;  3IHO A;  5KN9 A;  1XQP A;  3FHG A;  4E9G A;  1KO9 A;  1PU6 A;  3CWU A;  3CWT A;  4EVV A;  4YOQ A;  1PU7 A;  2NOE A;  2OFK A;  2XHI A;  4YPH A;  1ORP A;  3IH7 A;  3CVT A;  4DK9 A;  5CHZ A;  1N3C A;  3F10 A;  4EA5 A;  1LWY A;  4OFH A;  1KG2 A;  1KQJ A;  1XQO A;  4B21 A;  1MUN A;  1KG6 A;  1P7M A;  5KN8 A;  3CWS A;  4EJZ A;  1EBM A;  1KG7 A;  2NOB A;  1PVS A;  5DPK A;  1YQM A;  2NOZ A;  3S6I A;  4AI5 A;  4E9H A;  2NOH A;  2H56 A;  3KNT A;  3OH9 A;  3CVS A;  2JG6 A;  3I0W A;  2YG8 A;  2I5W A;  1WEI A;  4B22 A;  3KTU A;  3FSP A;  2NOL A;  3OH6 A;  1YQK A;  3N5N X;  1RRS A;  1HU0 A;  1VRL A;  4OFE A;  3N0U A;  2YG9 A;  4B23 A;  1MPG A;  1N39 A;  1LWV A;  1KG5 A;  3I0X A;  1KG4 A;  1NKU A;  1YQL A;  1YQR A;  4UOB A;  4EW4 A;  1DIZ A;  3CW7 A;  1MUY A;  1MUD A;  4UNF A;  1NGN A;  2JHJ A;  4EA4 A;  2NOI A;  3D4V A;  4EJY A;  1FN7 A;  1M3H A;  4B24 A;  3G0Q A;  1P59 A;  2OFI A;  3FHF A;  2ABK A;  4E9E A;  4OFA A;  1PU8 A;  1RRQ A;  1LMZ A;  3OGD A;  4AI4 A;  4PII A;  1KEA A;  4HSB A;  2NOF A;  1WEG A;  1XG7 A; 
#chains in the Genus database with same CATH topology
 2OOX A;  1YTB A;  3LCN A;  1N3A A;  3IHO A;  1XQP A;  2ZFD B;  1QTP A;  2Z8U A;  4EAJ A;  3OSE A;  3OYF A;  4BE0 A;  2OOY A;  4D7Q A;  3S3O A;  3OYN A;  3L2Q A;  1WEG A;  1TBP A;  2V8Q A;  2QRC A;  2OFK A;  1J3M A;  2D0B A;  3OYG A;  5CHZ A;  3L2W A;  3PDK A;  4EA5 A;  1LWY A;  3DPU A;  4IL8 A;  1XQO A;  1P7M A;  2YH5 A;  1YQM A;  3OYM A;  3VW4 A;  4AI5 A;  4BE2 A;  1D3U A;  2H56 A;  3OLP A;  3CVS A;  3I0W A;  2F7L A;  4EAK A;  3OYB A;  3FSP A;  1RRS A;  1PZD A;  1WQA A;  4NZG A;  4ROD B;  1P5G X;  2YG9 A;  1NVP A;  1MPG A;  3OYC A;  3I0X A;  1KG4 A;  1KY6 A;  1YQR A;  4UOB A;  1K2Y X;  2W04 A;  4BE1 A;  2Z0F A;  1M5Q 1;  3CW7 A;  4PY5 A;  2HZS A;  2QR1 A;  3OS0 A;  1U84 A;  1TGH A;  4EA4 A;  3D4V A;  2G30 A;  3BKQ X;  1M3H A;  5FRO A;  3OC3 C;  2OFI A;  5JMV D;  5BMP A;  3FHF A;  3OYD A;  3NNQ A;  2W03 A;  2EHB D;  1YTF A;  1KG3 A;  3OST A;  5IYB P;  1VTL E;  1TBA B;  1QN9 A;  1B9K A;  3I3W A;  5AN4 A;  4YPR A;  4BDZ A;  3OYJ A;  1C47 A;  2DKC A;  2QRD A;  1QNA A;  4WZS D;  3CWT A;  1KYU A;  4YOQ A;  1PU7 A;  2NOE A;  2XHI A;  1ORP A;  2R5X A;  1PCJ X;  1KYF A;  1KYD A;  1KG6 A;  5KN8 A;  1EBM A;  1KG7 A;  3S6I A;  5FRM A;  3S3M A;  3KNT A;  4BDY A;  3OH9 A;  1JDY A;  1JFI C;  2JG6 A;  1KFQ A;  2HZM A;  2YG8 A;  1WEI A;  3TDH A;  1QNE A;  2NOL A;  1YQK A;  3OSM A;  3L2U A;  2FKF A;  3OS2 A;  3RPJ A;  4E7L A;  1LWV A;  3T4N A;  1MP9 A;  1KG5 A;  1YQL A;  2Y8Q A;  3OYE A;  1Q9U A;  1VTO A;  2PWW A;  1DIZ A;  1UT7 A;  4UNF A;  1NGN A;  2IV9 A;  5IYC P;  2QLV A;  4E7K A;  3S3N A;  2MZ8 A;  4D7R A;  3VN5 A;  3OYA A;  1P59 A;  2JPI A;  3R2X C;  5BMN A;  4E9E A;  3L2V A;  1QN8 A;  1RRQ A;  1WJW A;  3H1Z A;  4PII A;  4HSB A;  4I8O A;  4QG5 A;  1NH2 A;  1PCZ A;  1ORN A;  1LWW A;  1M3Q A;  2JHN A;  2H5A X;  2HKP A;  2IV8 A;  1VOL B;  5IYD P;  1QTS A;  2VJ0 A;  5KN9 A;  4B0A A;  3SNS A;  4MRQ A;  1KO9 A;  2NWV A;  3L2R A;  4TPS A;  1R4X A;  3TE5 A;  4ZTF A;  4YPH A;  3CVT A;  3F10 A;  1T6A A;  2D0A A;  1KQJ A;  4B21 A;  4ZTJ A;  2V75 A;  3CWS A;  4EJZ A;  2NOB A;  1PVS A;  1UL7 A;  3ULX A;  4E9H A;  2DKA A;  2FUV A;  2H4L X;  4Q11 A;  1QNB A;  3KTU A;  2FKM X;  3N5N X;  4EAG A;  4OFE A;  4E7J A;  1QN7 A;  1N39 A;  1KY7 A;  1PCM X;  1V5S A;  3NA5 A;  3OYK A;  2NLV A;  1QNC A;  3C04 A;  1QN3 A;  1MUY A;  3RSM A;  2JHJ A;  1KFI A;  2NOI A;  1FN7 A;  1NGM A;  1QN5 A;  3EAY A;  4OFA A;  1VKL A;  4BJU A;  3ENO C;  3ENC A;  1XSZ A;  3HS9 A;  1C9B B;  1QN4 A;  2D0C A;  1XG7 A;  3CWA A;  4WXA A;  1QN6 A;  1WEF A;  2HL9 A;  5HSH A;  2V9J A;  4EW0 A;  5JN5 A;  4AIA A;  3D7Q A;  1UT4 A;  4C7P A;  2YA3 A;  3F0Z A;  4E9F A;  3OYL A;  5EPC A;  3FHG A;  4E9G A;  1W80 A;  1LXT A;  1PU6 A;  2JOI A;  3CWU A;  3EIK A;  4ROE B;  4EVV A;  3OCI A;  1CDW A;  3PMG A;  2DKD A;  3IH7 A;  2HL8 A;  4DK9 A;  1N3C A;  4OFH A;  3DPT A;  1KG2 A;  4WX8 A;  1MUN A;  4HJH A;  5DPK A;  2QRE A;  2NOZ A;  3UW2 A;  3OS1 A;  4ROC B;  2NOH A;  1C4G A;  2FGT A;  3N89 A;  4DUL A;  3OYI A;  4BAC A;  4IKF A;  2I5W A;  2O3O A;  4B22 A;  3KRM A;  4EAL A;  3OH6 A;  1HU0 A;  2LAE A;  1VRL A;  1E42 A;  4CFF A;  3N0U A;  4E7H A;  2JPS A;  4B23 A;  2NVM A;  1NKU A;  1EUV A;  4EW4 A;  1TUO A;  5FRN A;  5F9C A;  1RM1 A;  3ASM A;  1P5D X;  1MUD A;  1K35 A;  2V92 A;  4EJY A;  4EAI A;  3OYH A;  4B24 A;  1VOK A;  2MJ7 A;  2Y8L A;  3HS8 A;  3G0Q A;  3OY9 A;  2ABK A;  1AIS A;  1PU8 A;  1LMZ A;  3OGD A;  4AI4 A;  1KEA A;  2NOF A;  5KL0 A;  4E7I A; 
#chains in the Genus database with same CATH homology
 3CWA A;  1ORN A;  1KG3 A;  1WEF A;  1LWW A;  1M3Q A;  2JHN A;  4EW0 A;  4AIA A;  5AN4 A;  1N3A A;  4YPR A;  3F0Z A;  4E9F A;  3IHO A;  5KN9 A;  1XQP A;  3FHG A;  4E9G A;  1KO9 A;  1PU6 A;  3CWU A;  3CWT A;  4EVV A;  4YOQ A;  1PU7 A;  2NOE A;  2OFK A;  2XHI A;  4YPH A;  1ORP A;  3IH7 A;  3CVT A;  4DK9 A;  5CHZ A;  1N3C A;  3F10 A;  4EA5 A;  1LWY A;  4OFH A;  1KG2 A;  1KQJ A;  1XQO A;  4B21 A;  1MUN A;  1KG6 A;  1P7M A;  5KN8 A;  3CWS A;  4EJZ A;  1EBM A;  1KG7 A;  2NOB A;  1PVS A;  5DPK A;  1YQM A;  2NOZ A;  3S6I A;  4AI5 A;  4E9H A;  2NOH A;  2H56 A;  3KNT A;  3OH9 A;  3CVS A;  2JG6 A;  3I0W A;  2YG8 A;  2I5W A;  1WEI A;  4B22 A;  3KTU A;  3FSP A;  2NOL A;  3OH6 A;  1YQK A;  3N5N X;  1RRS A;  1HU0 A;  1VRL A;  4OFE A;  3N0U A;  2YG9 A;  4B23 A;  1MPG A;  1N39 A;  1LWV A;  1KG5 A;  3I0X A;  1KG4 A;  1NKU A;  1YQL A;  1YQR A;  4UOB A;  4EW4 A;  1DIZ A;  3CW7 A;  1MUY A;  1MUD A;  4UNF A;  1NGN A;  2JHJ A;  4EA4 A;  2NOI A;  3D4V A;  4EJY A;  1FN7 A;  1M3H A;  4B24 A;  3G0Q A;  1P59 A;  2OFI A;  3FHF A;  2ABK A;  4E9E A;  4OFA A;  1PU8 A;  1RRQ A;  1LMZ A;  3OGD A;  4AI4 A;  4PII A;  1KEA A;  4HSB A;  2NOF A;  1WEG A;  1XG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...