3CVSA

Crystal structure of an alka host/guest complex 8oxoguanine:adenine base pair
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 89
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cvsA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cvsA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cvsA01
2JHJA 2OFIA 1XQPA 3F0ZA 2OFKA 1P59A 4EW0A 1LWVA 4AIAA 4AI5A 4UNFA 1HU0A 2H56A 1N3AA 3CWAA 4EA4A 2JG6A 4E9GA 4EVVA 1KG2A 1LWYA 2NOFA 1M3HA 1DIZA 2NOHA 1KG7A 2NOZA 2NOBA 5AN4A 1KQJA 1PU8A 2ABKA 1LMZA 3IHOA 4E9HA 3CVSA 4B23A 1NKUA 1MPGA 3D4VA 1YQLA 1PU6A 4EJZA 1MUYA 1RRQA 4PIIA 1N39A 5DPKA 5KN8A 3FHGA 1PU7A 5KN9A 3FHFA 4EA5A 1ORPA 3KTUA 4E9FA 4EJYA 2YG8A 2NOLA 4E9EA 3IH7A 1FN7A 4OFHA 2YG9A 1N3CA 4UOBA 1MUDA 2I5WA 1M3QA 1NGNA 3KNTA 1VRLA 1WEIA 3N0UA 4YPRA 1KG4A 1P7MA 3CWTA 1WEFA 1YQRA 1ORNA 3S6IA 1KG3A 1YQKA 4AI4A 1XG7A 3CVTA 3I0XA 4DK9A 1WEGA 1YQMA 1KO9A 4YPHA 3G0QA 4OFEA 1KEAA 1RRSA 5CHZA 2NOIA 1KG5A 1LWWA 3OH6A 4B21A 3FSPA 3I0WA 2NOEA 3CW7A 1EBMA 4YOQA 2XHIA 2JHNA 3OH9A 4HSBA 4EW4A 4OFAA 3F10A 1KG6A 4B24A 3OGDA 1PVSA 3CWUA 3N5NX 1XQOA 1MUNA 4B22A 3CWSA
chains in the Genus database with same CATH superfamily
3S3NA 4RODB 1P59A 1VOLB 1UL7A 2FKMX 1HU0A 2H56A 4EA4A 4DULA 3TE5A 1KG2A 1M3HA 5FRNA 1K35A 2NOZA 3IHOA 1NKUA 1MPGA 4TPSA 3DPTA 5JN5A 4IKFA 1MUYA 3OYAA 2VJ0A 3FHGA 1JDYA 2NWVA 4B0AA 3H1ZA 4WX8A 1ORPA 3KTUA 1VKLA 2V8QA 1KFQA 1FN7A 1QN5A 4UOBA 3EIKA 2I5WA 1M3QA 1KYFA 3OYIA 3NNQA 3OYHA 3N0UA 2QR1A 3LCNA 3CWTA 3OYKA 1ORNA 2O3OA 1AISA 4AI4A 3VN5A 3OS1A 3I0XA 4DK9A 2JOIA 2Y8LA 4I8OA 2Z0FA 3OYDA 2DKAA 2NVMA 4OFEA 1KEAA 1TBAB 2D0BA 3NA5A 3EAYA 2JHNA 2HZSA 3ENCA 3OYNA 3D7QA 4B24A 3OGDA 2D0AA 4EALA 2FGTA 3CWSA 2OFIA 2OFKA 2YA3A 4EW0A 1K2YX 3S3OA 1VTLE 1QTPA 4AI5A 3KRMA 2V75A 3OYEA 4D7RA 4E7HA 3S3MA 1KFIA 4HJHA 3I3WA 2OOXA 2JG6A 3N89A 4EVVA 4E7LA 2LAEA 1M5Q1 1KG7A 3L2QA 1KY6A 2ZFDB 3PDKA 1LMZA 3D4VA 1TGHA 1PU6A 1NGMA 5IYBP 5KN8A 1PZDA 5FRMA 4BDZA 1P5GX 3HS9A 1MP9A 2HL8A 5F9CA 1E42A 2EHBD 3OYBA 2DKDA 4E9FA 4BE2A 2DKCA 4E9EA 1QN9A 4ZTJA 5FROA 2H4LX 4OFHA 1XSZA 5JMVD 1MUDA 4NZGA 1QNCA 1P5DX 1NGNA 1KYDA 3BKQX 3KNTA 3OYFA 1YTBA 1P7MA 4C7PA 3R2XC 1YQRA 1YQKA 1KY7A 4BJUA 2V9JA 2NOIA 1KG5A 1LWWA 3OSTA 1V5SA 1C9BB 1EBMA 4WZSD 4YOQA 3OLPA 3L2WA 2XHIA 2QREA 4OFAA 5KL0A 4MRQA 3F10A 1KG6A 2H5AX 4Q11A 5HSHA 1WJWA 1XQPA 1TUOA 3DPUA 5BMNA 4AIAA 4EAGA 1JFIC 3ENOC 4PY5A 2V92A 2JPIA 3CWAA 1LWYA 1DIZA 3TDHA 1PCZA 1VTOA 1WQAA 1PU8A 2ABKA 1KYUA 4B23A 4E7JA 4E7IA 1YQLA 2QRCA 4EJZA 1B9KA 4PIIA 1PCJX 5DPKA 4ROCB 5IYDP 1QN6A 4EAJA 1PU7A 5KN9A 3ASMA 4EA5A 2NLVA 4WXAA 3OYJA 4EJYA 2MJ7A 3OC3C 4D7QA 3L2RA 1N3CA 1QN8A 1QNBA 1VRLA 3L2UA 2QLVA 2Z8UA 1YTFA 1VOKA 3S6IA 3HS8A 1KG3A 1XG7A 2R5XA 1WEGA 2JPSA 1QN7A 1PCMX 2IV8A 4YPHA 2W03A 3PMGA 3G0QA 1QN4A 2MZ8A 1RRSA 2HL9A 4B21A 3CW7A 3I0WA 4CFFA 4ROEB 1RM1A 3OY9A 4EAKA 1U84A 1Q9UA 3OYCA 4EW4A 3OSMA 1QTSA 1PVSA 2FUVA 1XQOA 1C47A 3ULXA 2JHJA 2OOYA 3F0ZA 3UW2A 1LWVA 1NVPA 4ZTFA 4UNFA 1N3AA 2HKPA 4BE0A 2IV9A 4E9GA 2W04A 2NOFA 2G30A 1R4XA 3SNSA 3L2VA 5IYCP 2YH5A 3OS0A 2NOHA 1QN3A 2QRDA 4IL8A 2NOBA 1LXTA 5AN4A 1KQJA 4E7KA 1TBPA 3T4NA 4E9HA 3CVSA 3OSEA 1RRQA 3OYGA 1N39A 3OYLA 4QG5A 4EAIA 3FHFA 1C4GA 1D3UA 2YG8A 2NOLA 1QNAA 3IH7A 1CDWA 3RPJA 1NH2A 2YG9A 1WEIA 5BMPA 1UT4A 4YPRA 1KG4A 1EUVA 1QNEA 1WEFA 2F7LA 2PWWA 3CVTA 1W80A 3OS2A 1YQMA 2FKFA 1KO9A 1J3MA 5CHZA 3OH6A 5EPCA 3FSPA 2NOEA 2D0CA 1UT7A 1T6AA 3OH9A 4HSBA 3OYMA 3C04A 4BDYA 4BE1A 3CWUA 4BACA 3N5NX 3OCIA 2Y8QA 3VW4A 1MUNA 2HZMA 4B22A 3RSMA
chains in the Genus database with same CATH topology
2JHJA 2OFIA 1XQPA 3F0ZA 2OFKA 1P59A 4EW0A 1LWVA 4AIAA 4AI5A 4UNFA 1HU0A 2H56A 1N3AA 3CWAA 4EA4A 2JG6A 4E9GA 4EVVA 1KG2A 1LWYA 2NOFA 1M3HA 1DIZA 2NOHA 1KG7A 2NOZA 2NOBA 5AN4A 1KQJA 1PU8A 2ABKA 1LMZA 3IHOA 4E9HA 3CVSA 4B23A 1NKUA 1MPGA 3D4VA 1YQLA 1PU6A 4EJZA 1MUYA 1RRQA 4PIIA 1N39A 5DPKA 5KN8A 3FHGA 1PU7A 5KN9A 3FHFA 4EA5A 1ORPA 3KTUA 4E9FA 4EJYA 2YG8A 2NOLA 4E9EA 3IH7A 1FN7A 4OFHA 2YG9A 1N3CA 4UOBA 1MUDA 2I5WA 1M3QA 1NGNA 3KNTA 1VRLA 1WEIA 3N0UA 4YPRA 1KG4A 1P7MA 3CWTA 1WEFA 1YQRA 1ORNA 3S6IA 1KG3A 1YQKA 4AI4A 1XG7A 3CVTA 3I0XA 4DK9A 1WEGA 1YQMA 1KO9A 4YPHA 3G0QA 4OFEA 1KEAA 1RRSA 5CHZA 2NOIA 1KG5A 1LWWA 3OH6A 4B21A 3FSPA 3I0WA 2NOEA 3CW7A 1EBMA 4YOQA 2XHIA 2JHNA 3OH9A 4HSBA 4EW4A 4OFAA 3F10A 1KG6A 4B24A 3OGDA 1PVSA 3CWUA 3N5NX 1XQOA 1MUNA 4B22A 3CWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHJ A;  2OFI A;  1XQP A;  3F0Z A;  2OFK A;  1P59 A;  4EW0 A;  1LWV A;  4AIA A;  4AI5 A;  4UNF A;  1HU0 A;  2H56 A;  1N3A A;  3CWA A;  4EA4 A;  2JG6 A;  4E9G A;  4EVV A;  1KG2 A;  1LWY A;  2NOF A;  1M3H A;  1DIZ A;  2NOH A;  1KG7 A;  2NOZ A;  2NOB A;  5AN4 A;  1KQJ A;  1PU8 A;  2ABK A;  1LMZ A;  3IHO A;  4E9H A;  3CVS A;  4B23 A;  1NKU A;  1MPG A;  3D4V A;  1YQL A;  1PU6 A;  4EJZ A;  1MUY A;  1RRQ A;  4PII A;  1N39 A;  5DPK A;  5KN8 A;  3FHG A;  1PU7 A;  5KN9 A;  3FHF A;  4EA5 A;  1ORP A;  3KTU A;  4E9F A;  4EJY A;  2YG8 A;  2NOL A;  4E9E A;  3IH7 A;  1FN7 A;  4OFH A;  2YG9 A;  1N3C A;  4UOB A;  1MUD A;  2I5W A;  1M3Q A;  1NGN A;  3KNT A;  1VRL A;  1WEI A;  3N0U A;  4YPR A;  1KG4 A;  1P7M A;  3CWT A;  1WEF A;  1YQR A;  1ORN A;  3S6I A;  1KG3 A;  1YQK A;  4AI4 A;  1XG7 A;  3CVT A;  3I0X A;  4DK9 A;  1WEG A;  1YQM A;  1KO9 A;  4YPH A;  3G0Q A;  4OFE A;  1KEA A;  1RRS A;  5CHZ A;  2NOI A;  1KG5 A;  1LWW A;  3OH6 A;  4B21 A;  3FSP A;  3I0W A;  2NOE A;  3CW7 A;  1EBM A;  4YOQ A;  2XHI A;  2JHN A;  3OH9 A;  4HSB A;  4EW4 A;  4OFA A;  3F10 A;  1KG6 A;  4B24 A;  3OGD A;  1PVS A;  3CWU A;  3N5N X;  1XQO A;  1MUN A;  4B22 A;  3CWS A; 
#chains in the Genus database with same CATH topology
 3S3N A;  4ROD B;  1P59 A;  1VOL B;  1UL7 A;  2FKM X;  1HU0 A;  2H56 A;  4EA4 A;  4DUL A;  3TE5 A;  1KG2 A;  1M3H A;  5FRN A;  1K35 A;  2NOZ A;  3IHO A;  1NKU A;  1MPG A;  4TPS A;  3DPT A;  5JN5 A;  4IKF A;  1MUY A;  3OYA A;  2VJ0 A;  3FHG A;  1JDY A;  2NWV A;  4B0A A;  3H1Z A;  4WX8 A;  1ORP A;  3KTU A;  1VKL A;  2V8Q A;  1KFQ A;  1FN7 A;  1QN5 A;  4UOB A;  3EIK A;  2I5W A;  1M3Q A;  1KYF A;  3OYI A;  3NNQ A;  3OYH A;  3N0U A;  2QR1 A;  3LCN A;  3CWT A;  3OYK A;  1ORN A;  2O3O A;  1AIS A;  4AI4 A;  3VN5 A;  3OS1 A;  3I0X A;  4DK9 A;  2JOI A;  2Y8L A;  4I8O A;  2Z0F A;  3OYD A;  2DKA A;  2NVM A;  4OFE A;  1KEA A;  1TBA B;  2D0B A;  3NA5 A;  3EAY A;  2JHN A;  2HZS A;  3ENC A;  3OYN A;  3D7Q A;  4B24 A;  3OGD A;  2D0A A;  4EAL A;  2FGT A;  3CWS A;  2OFI A;  2OFK A;  2YA3 A;  4EW0 A;  1K2Y X;  3S3O A;  1VTL E;  1QTP A;  4AI5 A;  3KRM A;  2V75 A;  3OYE A;  4D7R A;  4E7H A;  3S3M A;  1KFI A;  4HJH A;  3I3W A;  2OOX A;  2JG6 A;  3N89 A;  4EVV A;  4E7L A;  2LAE A;  1M5Q 1;  1KG7 A;  3L2Q A;  1KY6 A;  2ZFD B;  3PDK A;  1LMZ A;  3D4V A;  1TGH A;  1PU6 A;  1NGM A;  5IYB P;  5KN8 A;  1PZD A;  5FRM A;  4BDZ A;  1P5G X;  3HS9 A;  1MP9 A;  2HL8 A;  5F9C A;  1E42 A;  2EHB D;  3OYB A;  2DKD A;  4E9F A;  4BE2 A;  2DKC A;  4E9E A;  1QN9 A;  4ZTJ A;  5FRO A;  2H4L X;  4OFH A;  1XSZ A;  5JMV D;  1MUD A;  4NZG A;  1QNC A;  1P5D X;  1NGN A;  1KYD A;  3BKQ X;  3KNT A;  3OYF A;  1YTB A;  1P7M A;  4C7P A;  3R2X C;  1YQR A;  1YQK A;  1KY7 A;  4BJU A;  2V9J A;  2NOI A;  1KG5 A;  1LWW A;  3OST A;  1V5S A;  1C9B B;  1EBM A;  4WZS D;  4YOQ A;  3OLP A;  3L2W A;  2XHI A;  2QRE A;  4OFA A;  5KL0 A;  4MRQ A;  3F10 A;  1KG6 A;  2H5A X;  4Q11 A;  5HSH A;  1WJW A;  1XQP A;  1TUO A;  3DPU A;  5BMN A;  4AIA A;  4EAG A;  1JFI C;  3ENO C;  4PY5 A;  2V92 A;  2JPI A;  3CWA A;  1LWY A;  1DIZ A;  3TDH A;  1PCZ A;  1VTO A;  1WQA A;  1PU8 A;  2ABK A;  1KYU A;  4B23 A;  4E7J A;  4E7I A;  1YQL A;  2QRC A;  4EJZ A;  1B9K A;  4PII A;  1PCJ X;  5DPK A;  4ROC B;  5IYD P;  1QN6 A;  4EAJ A;  1PU7 A;  5KN9 A;  3ASM A;  4EA5 A;  2NLV A;  4WXA A;  3OYJ A;  4EJY A;  2MJ7 A;  3OC3 C;  4D7Q A;  3L2R A;  1N3C A;  1QN8 A;  1QNB A;  1VRL A;  3L2U A;  2QLV A;  2Z8U A;  1YTF A;  1VOK A;  3S6I A;  3HS8 A;  1KG3 A;  1XG7 A;  2R5X A;  1WEG A;  2JPS A;  1QN7 A;  1PCM X;  2IV8 A;  4YPH A;  2W03 A;  3PMG A;  3G0Q A;  1QN4 A;  2MZ8 A;  1RRS A;  2HL9 A;  4B21 A;  3CW7 A;  3I0W A;  4CFF A;  4ROE B;  1RM1 A;  3OY9 A;  4EAK A;  1U84 A;  1Q9U A;  3OYC A;  4EW4 A;  3OSM A;  1QTS A;  1PVS A;  2FUV A;  1XQO A;  1C47 A;  3ULX A;  2JHJ A;  2OOY A;  3F0Z A;  3UW2 A;  1LWV A;  1NVP A;  4ZTF A;  4UNF A;  1N3A A;  2HKP A;  4BE0 A;  2IV9 A;  4E9G A;  2W04 A;  2NOF A;  2G30 A;  1R4X A;  3SNS A;  3L2V A;  5IYC P;  2YH5 A;  3OS0 A;  2NOH A;  1QN3 A;  2QRD A;  4IL8 A;  2NOB A;  1LXT A;  5AN4 A;  1KQJ A;  4E7K A;  1TBP A;  3T4N A;  4E9H A;  3CVS A;  3OSE A;  1RRQ A;  3OYG A;  1N39 A;  3OYL A;  4QG5 A;  4EAI A;  3FHF A;  1C4G A;  1D3U A;  2YG8 A;  2NOL A;  1QNA A;  3IH7 A;  1CDW A;  3RPJ A;  1NH2 A;  2YG9 A;  1WEI A;  5BMP A;  1UT4 A;  4YPR A;  1KG4 A;  1EUV A;  1QNE A;  1WEF A;  2F7L A;  2PWW A;  3CVT A;  1W80 A;  3OS2 A;  1YQM A;  2FKF A;  1KO9 A;  1J3M A;  5CHZ A;  3OH6 A;  5EPC A;  3FSP A;  2NOE A;  2D0C A;  1UT7 A;  1T6A A;  3OH9 A;  4HSB A;  3OYM A;  3C04 A;  4BDY A;  4BE1 A;  3CWU A;  4BAC A;  3N5N X;  3OCI A;  2Y8Q A;  3VW4 A;  1MUN A;  2HZM A;  4B22 A;  3RSM A; 
#chains in the Genus database with same CATH homology
 2JHJ A;  2OFI A;  1XQP A;  3F0Z A;  2OFK A;  1P59 A;  4EW0 A;  1LWV A;  4AIA A;  4AI5 A;  4UNF A;  1HU0 A;  2H56 A;  1N3A A;  3CWA A;  4EA4 A;  2JG6 A;  4E9G A;  4EVV A;  1KG2 A;  1LWY A;  2NOF A;  1M3H A;  1DIZ A;  2NOH A;  1KG7 A;  2NOZ A;  2NOB A;  5AN4 A;  1KQJ A;  1PU8 A;  2ABK A;  1LMZ A;  3IHO A;  4E9H A;  3CVS A;  4B23 A;  1NKU A;  1MPG A;  3D4V A;  1YQL A;  1PU6 A;  4EJZ A;  1MUY A;  1RRQ A;  4PII A;  1N39 A;  5DPK A;  5KN8 A;  3FHG A;  1PU7 A;  5KN9 A;  3FHF A;  4EA5 A;  1ORP A;  3KTU A;  4E9F A;  4EJY A;  2YG8 A;  2NOL A;  4E9E A;  3IH7 A;  1FN7 A;  4OFH A;  2YG9 A;  1N3C A;  4UOB A;  1MUD A;  2I5W A;  1M3Q A;  1NGN A;  3KNT A;  1VRL A;  1WEI A;  3N0U A;  4YPR A;  1KG4 A;  1P7M A;  3CWT A;  1WEF A;  1YQR A;  1ORN A;  3S6I A;  1KG3 A;  1YQK A;  4AI4 A;  1XG7 A;  3CVT A;  3I0X A;  4DK9 A;  1WEG A;  1YQM A;  1KO9 A;  4YPH A;  3G0Q A;  4OFE A;  1KEA A;  1RRS A;  5CHZ A;  2NOI A;  1KG5 A;  1LWW A;  3OH6 A;  4B21 A;  3FSP A;  3I0W A;  2NOE A;  3CW7 A;  1EBM A;  4YOQ A;  2XHI A;  2JHN A;  3OH9 A;  4HSB A;  4EW4 A;  4OFA A;  3F10 A;  1KG6 A;  4B24 A;  3OGD A;  1PVS A;  3CWU A;  3N5N X;  1XQO A;  1MUN A;  4B22 A;  3CWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...