3CVSA

Crystal structure of an alka host/guest complex 8oxoguanine:adenine base pair
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 89
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cvsA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cvsA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cvsA01
3S6IA 2NOIA 4UNFA 3FSPA 2NOZA 3N5NX 4E9GA 2NOBA 4EA4A 3OH6A 4B24A 3CWSA 3FHFA 1YQLA 4AI5A 4AI4A 1LWWA 5DPKA 3IHOA 1DIZA 1N3CA 2NOHA 4YPRA 3I0WA 1PU6A 4E9EA 5KN8A 3G0QA 3KTUA 1M3HA 1KG2A 1N3AA 1NGNA 2OFIA 1P7MA 4PIIA 1XG7A 4OFEA 2OFKA 1LWVA 2NOEA 1KO9A 1XQPA 3CWAA 2XHIA 4E9HA 1P59A 3CW7A 4EW4A 4B21A 1XQOA 1WEFA 4UOBA 1PVSA 5CHZA 1MUDA 3CVTA 1MUNA 1N39A 5AN4A 1PU7A 4EW0A 1RRSA 4EJZA 3I0XA 2I5WA 4E9FA 1ORNA 3FHGA 4DK9A 4AIAA 3CWTA 2JHJA 1M3QA 2ABKA 1YQRA 1PU8A 3OGDA 1YQMA 4HSBA 3F10A 1VRLA 5KN9A 4EJYA 4EVVA 1KG3A 3IH7A 2NOFA 2YG9A 1WEGA 2JHNA 4OFHA 1KG7A 4OFAA 3CWUA 1NKUA 1LWYA 1YQKA 3D4VA 2JG6A 4YOQA 2NOLA 1ORPA 1MUYA 3F0ZA 1KG4A 1HU0A 1LMZA 2YG8A 1KG6A 3CVSA 1WEIA 4B22A 3KNTA 4B23A 3OH9A 4EA5A 1MPGA 1KG5A 1RRQA 4YPHA 1EBMA 1FN7A 2H56A 1KEAA 3N0UA 1KQJA
chains in the Genus database with same CATH superfamily
2NOIA 4UNFA 2NOZA 4E9GA 1C9BB 4EA4A 3I3WA 2Y8QA 3OYEA 3OH6A 3FHFA 2V9JA 1P5DX 1DIZA 2NOHA 2MJ7A 1PU6A 5KN8A 3OSEA 2FKMX 3EIKA 2V92A 2OFIA 1P7MA 4E7JA 1Q9UA 1NGMA 3L2WA 2H5AX 3TE5A 2NOEA 1KO9A 2D0BA 3PMGA 1XQPA 1CDWA 1PCJX 1TBPA 5FROA 3CW7A 1QN5A 1VOKA 5FRNA 1P5GX 5CHZA 1QN3A 1QNAA 5F9CA 5AN4A 4ROCB 1QNCA 3I0XA 2QRDA 4ROEB 2HKPA 4D7RA 4E7HA 3CWTA 4BE1A 4IKFA 1D3UA 2LAEA 3OGDA 3RPJA 3F10A 1VRLA 1QTSA 3IH7A 3DPUA 2DKAA 1LXTA 1NVPA 3OYFA 1KG7A 4OFAA 3BKQX 3C04A 4WX8A 3EAYA 2Z8UA 1QN6A 1ORPA 1MUYA 5EPCA 3F0ZA 1KG4A 3S3NA 1HU0A 1LMZA 1KG6A 3OS2A 3KNTA 3LCNA 4EA5A 1KG5A 1AISA 1QN9A 1RRQA 4BACA 1KQJA 2NVMA 2H4LX 3N5NX 3DPTA 3OYJA 4B24A 1YQLA 1M5Q1 1JDYA 1YTFA 3OSTA 3IHOA 5BMPA 2HL9A 2NLVA 4E7IA 4E9EA 1MP9A 1QTPA 3KTUA 1PCZA 3ULXA 1VTLE 1KG2A 1NGNA 4WXAA 1KYFA 4PIIA 1TBAB 1C47A 5IYDP 3N89A 4OFEA 4BE0A 3L2RA 3L2UA 3OYGA 1KFQA 3OC3C 1KYDA 4E9HA 1UL7A 1QN7A 4EW4A 3SNSA 2V75A 1PVSA 2QLVA 3H1ZA 1N39A 1PU7A 4BDZA 1RRSA 2FKFA 2I5WA 5IYBP 1WQAA 4E9FA 3OYBA 1KFIA 2JHJA 1M3QA 2PWWA 3OYHA 3OYAA 2YA3A 4QG5A 2QR1A 3T4NA 1WJWA 1TUOA 2D0AA 4EVVA 2NOFA 1WEGA 2JHNA 4OFHA 1V5SA 1E42A 4E7KA 1YQKA 1TGHA 3D4VA 3OLPA 4B0AA 5JN5A 2EHBD 5BMNA 2JOIA 1QNEA 1MPGA 1PZDA 4RODB 4ZTFA 3N0UA 3HS9A 1J3MA 4EAJA 1NH2A 1LWWA 5DPKA 3OS0A 1N3CA 4PY5A 4YPRA 2IV9A 3G0QA 5JMVD 1VOLB 4BJUA 4C7PA 3D7QA 3OYMA 2OFKA 1LWVA 3UW2A 4ZTJA 3L2VA 4HJHA 2XHIA 3OY9A 1P59A 3OYDA 4EAGA 2D0CA 1MUNA 2OOXA 1RM1A 2V8QA 3R2XC 1ORNA 3FHGA 4IL8A 2MZ8A 2F7LA 4DK9A 2O3OA 2Y8LA 5IYCP 3OCIA 3OYIA 4E7LA 4Q11A 1B9KA 1YQRA 1QN4A 2DKDA 1XSZA 1YTBA 4HSBA 1R4XA 4EJYA 4NZGA 1KG3A 2Z0FA 2W03A 1K2YX 1T6AA 2QREA 3OYNA 3PDKA 3CWUA 1VTOA 2HZSA 4D7QA 5FRMA 2NOLA 1U84A 1KYUA 3KRMA 5KL0A 1PCMX 3NNQA 3CVSA 4B22A 4B23A 1EBMA 1FN7A 2VJ0A 4WZSD 3S6IA 1VKLA 3FSPA 2G30A 2NOBA 3OSMA 2OOYA 3CWSA 4EAKA 2IV8A 3ASMA 4AI5A 2W04A 4AI4A 2ZFDB 1EUVA 4BE2A 3I0WA 1M3HA 1N3AA 1KY7A 3ENCA 3NA5A 3HS8A 1XG7A 2FUVA 4DULA 2R5XA 1UT4A 3CWAA 4TPSA 4B21A 1XQOA 1WEFA 4I8OA 4MRQA 2JPIA 4UOBA 1MUDA 3CVTA 4EALA 3OYKA 2QRCA 4EW0A 4EJZA 3VW4A 1UT7A 3OS1A 1W80A 1JFIC 4AIAA 5HSHA 2FGTA 4CFFA 3OYLA 2ABKA 1PU8A 2NWVA 1YQMA 3RSMA 5KN9A 3ENOC 4EAIA 3S3MA 2YG9A 2DKCA 1KY6A 1QN8A 1NKUA 2JPSA 3OYCA 1LWYA 1QNBA 3TDHA 2JG6A 4YOQA 3L2QA 2YH5A 2HZMA 3VN5A 2YG8A 2HL8A 1WEIA 3OH9A 1K35A 4YPHA 3S3OA 2H56A 1KEAA 4BDYA 1C4GA
chains in the Genus database with same CATH topology
3S6IA 2NOIA 4UNFA 3FSPA 2NOZA 3N5NX 4E9GA 2NOBA 4EA4A 3OH6A 4B24A 3CWSA 3FHFA 1YQLA 4AI5A 4AI4A 1LWWA 5DPKA 3IHOA 1DIZA 1N3CA 2NOHA 4YPRA 3I0WA 1PU6A 4E9EA 5KN8A 3G0QA 3KTUA 1M3HA 1KG2A 1N3AA 1NGNA 2OFIA 1P7MA 4PIIA 1XG7A 4OFEA 2OFKA 1LWVA 2NOEA 1KO9A 1XQPA 3CWAA 2XHIA 4E9HA 1P59A 3CW7A 4EW4A 4B21A 1XQOA 1WEFA 4UOBA 1PVSA 5CHZA 1MUDA 3CVTA 1MUNA 1N39A 5AN4A 1PU7A 4EW0A 1RRSA 4EJZA 3I0XA 2I5WA 4E9FA 1ORNA 3FHGA 4DK9A 4AIAA 3CWTA 2JHJA 1M3QA 2ABKA 1YQRA 1PU8A 3OGDA 1YQMA 4HSBA 3F10A 1VRLA 5KN9A 4EJYA 4EVVA 1KG3A 3IH7A 2NOFA 2YG9A 1WEGA 2JHNA 4OFHA 1KG7A 4OFAA 3CWUA 1NKUA 1LWYA 1YQKA 3D4VA 2JG6A 4YOQA 2NOLA 1ORPA 1MUYA 3F0ZA 1KG4A 1HU0A 1LMZA 2YG8A 1KG6A 3CVSA 1WEIA 4B22A 3KNTA 4B23A 3OH9A 4EA5A 1MPGA 1KG5A 1RRQA 4YPHA 1EBMA 1FN7A 2H56A 1KEAA 3N0UA 1KQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6I A;  2NOI A;  4UNF A;  3FSP A;  2NOZ A;  3N5N X;  4E9G A;  2NOB A;  4EA4 A;  3OH6 A;  4B24 A;  3CWS A;  3FHF A;  1YQL A;  4AI5 A;  4AI4 A;  1LWW A;  5DPK A;  3IHO A;  1DIZ A;  1N3C A;  2NOH A;  4YPR A;  3I0W A;  1PU6 A;  4E9E A;  5KN8 A;  3G0Q A;  3KTU A;  1M3H A;  1KG2 A;  1N3A A;  1NGN A;  2OFI A;  1P7M A;  4PII A;  1XG7 A;  4OFE A;  2OFK A;  1LWV A;  2NOE A;  1KO9 A;  1XQP A;  3CWA A;  2XHI A;  4E9H A;  1P59 A;  3CW7 A;  4EW4 A;  4B21 A;  1XQO A;  1WEF A;  4UOB A;  1PVS A;  5CHZ A;  1MUD A;  3CVT A;  1MUN A;  1N39 A;  5AN4 A;  1PU7 A;  4EW0 A;  1RRS A;  4EJZ A;  3I0X A;  2I5W A;  4E9F A;  1ORN A;  3FHG A;  4DK9 A;  4AIA A;  3CWT A;  2JHJ A;  1M3Q A;  2ABK A;  1YQR A;  1PU8 A;  3OGD A;  1YQM A;  4HSB A;  3F10 A;  1VRL A;  5KN9 A;  4EJY A;  4EVV A;  1KG3 A;  3IH7 A;  2NOF A;  2YG9 A;  1WEG A;  2JHN A;  4OFH A;  1KG7 A;  4OFA A;  3CWU A;  1NKU A;  1LWY A;  1YQK A;  3D4V A;  2JG6 A;  4YOQ A;  2NOL A;  1ORP A;  1MUY A;  3F0Z A;  1KG4 A;  1HU0 A;  1LMZ A;  2YG8 A;  1KG6 A;  3CVS A;  1WEI A;  4B22 A;  3KNT A;  4B23 A;  3OH9 A;  4EA5 A;  1MPG A;  1KG5 A;  1RRQ A;  4YPH A;  1EBM A;  1FN7 A;  2H56 A;  1KEA A;  3N0U A;  1KQJ A; 
#chains in the Genus database with same CATH topology
 2NOI A;  4UNF A;  2NOZ A;  4E9G A;  1C9B B;  4EA4 A;  3I3W A;  2Y8Q A;  3OYE A;  3OH6 A;  3FHF A;  2V9J A;  1P5D X;  1DIZ A;  2NOH A;  2MJ7 A;  1PU6 A;  5KN8 A;  3OSE A;  2FKM X;  3EIK A;  2V92 A;  2OFI A;  1P7M A;  4E7J A;  1Q9U A;  1NGM A;  3L2W A;  2H5A X;  3TE5 A;  2NOE A;  1KO9 A;  2D0B A;  3PMG A;  1XQP A;  1CDW A;  1PCJ X;  1TBP A;  5FRO A;  3CW7 A;  1QN5 A;  1VOK A;  5FRN A;  1P5G X;  5CHZ A;  1QN3 A;  1QNA A;  5F9C A;  5AN4 A;  4ROC B;  1QNC A;  3I0X A;  2QRD A;  4ROE B;  2HKP A;  4D7R A;  4E7H A;  3CWT A;  4BE1 A;  4IKF A;  1D3U A;  2LAE A;  3OGD A;  3RPJ A;  3F10 A;  1VRL A;  1QTS A;  3IH7 A;  3DPU A;  2DKA A;  1LXT A;  1NVP A;  3OYF A;  1KG7 A;  4OFA A;  3BKQ X;  3C04 A;  4WX8 A;  3EAY A;  2Z8U A;  1QN6 A;  1ORP A;  1MUY A;  5EPC A;  3F0Z A;  1KG4 A;  3S3N A;  1HU0 A;  1LMZ A;  1KG6 A;  3OS2 A;  3KNT A;  3LCN A;  4EA5 A;  1KG5 A;  1AIS A;  1QN9 A;  1RRQ A;  4BAC A;  1KQJ A;  2NVM A;  2H4L X;  3N5N X;  3DPT A;  3OYJ A;  4B24 A;  1YQL A;  1M5Q 1;  1JDY A;  1YTF A;  3OST A;  3IHO A;  5BMP A;  2HL9 A;  2NLV A;  4E7I A;  4E9E A;  1MP9 A;  1QTP A;  3KTU A;  1PCZ A;  3ULX A;  1VTL E;  1KG2 A;  1NGN A;  4WXA A;  1KYF A;  4PII A;  1TBA B;  1C47 A;  5IYD P;  3N89 A;  4OFE A;  4BE0 A;  3L2R A;  3L2U A;  3OYG A;  1KFQ A;  3OC3 C;  1KYD A;  4E9H A;  1UL7 A;  1QN7 A;  4EW4 A;  3SNS A;  2V75 A;  1PVS A;  2QLV A;  3H1Z A;  1N39 A;  1PU7 A;  4BDZ A;  1RRS A;  2FKF A;  2I5W A;  5IYB P;  1WQA A;  4E9F A;  3OYB A;  1KFI A;  2JHJ A;  1M3Q A;  2PWW A;  3OYH A;  3OYA A;  2YA3 A;  4QG5 A;  2QR1 A;  3T4N A;  1WJW A;  1TUO A;  2D0A A;  4EVV A;  2NOF A;  1WEG A;  2JHN A;  4OFH A;  1V5S A;  1E42 A;  4E7K A;  1YQK A;  1TGH A;  3D4V A;  3OLP A;  4B0A A;  5JN5 A;  2EHB D;  5BMN A;  2JOI A;  1QNE A;  1MPG A;  1PZD A;  4ROD B;  4ZTF A;  3N0U A;  3HS9 A;  1J3M A;  4EAJ A;  1NH2 A;  1LWW A;  5DPK A;  3OS0 A;  1N3C A;  4PY5 A;  4YPR A;  2IV9 A;  3G0Q A;  5JMV D;  1VOL B;  4BJU A;  4C7P A;  3D7Q A;  3OYM A;  2OFK A;  1LWV A;  3UW2 A;  4ZTJ A;  3L2V A;  4HJH A;  2XHI A;  3OY9 A;  1P59 A;  3OYD A;  4EAG A;  2D0C A;  1MUN A;  2OOX A;  1RM1 A;  2V8Q A;  3R2X C;  1ORN A;  3FHG A;  4IL8 A;  2MZ8 A;  2F7L A;  4DK9 A;  2O3O A;  2Y8L A;  5IYC P;  3OCI A;  3OYI A;  4E7L A;  4Q11 A;  1B9K A;  1YQR A;  1QN4 A;  2DKD A;  1XSZ A;  1YTB A;  4HSB A;  1R4X A;  4EJY A;  4NZG A;  1KG3 A;  2Z0F A;  2W03 A;  1K2Y X;  1T6A A;  2QRE A;  3OYN A;  3PDK A;  3CWU A;  1VTO A;  2HZS A;  4D7Q A;  5FRM A;  2NOL A;  1U84 A;  1KYU A;  3KRM A;  5KL0 A;  1PCM X;  3NNQ A;  3CVS A;  4B22 A;  4B23 A;  1EBM A;  1FN7 A;  2VJ0 A;  4WZS D;  3S6I A;  1VKL A;  3FSP A;  2G30 A;  2NOB A;  3OSM A;  2OOY A;  3CWS A;  4EAK A;  2IV8 A;  3ASM A;  4AI5 A;  2W04 A;  4AI4 A;  2ZFD B;  1EUV A;  4BE2 A;  3I0W A;  1M3H A;  1N3A A;  1KY7 A;  3ENC A;  3NA5 A;  3HS8 A;  1XG7 A;  2FUV A;  4DUL A;  2R5X A;  1UT4 A;  3CWA A;  4TPS A;  4B21 A;  1XQO A;  1WEF A;  4I8O A;  4MRQ A;  2JPI A;  4UOB A;  1MUD A;  3CVT A;  4EAL A;  3OYK A;  2QRC A;  4EW0 A;  4EJZ A;  3VW4 A;  1UT7 A;  3OS1 A;  1W80 A;  1JFI C;  4AIA A;  5HSH A;  2FGT A;  4CFF A;  3OYL A;  2ABK A;  1PU8 A;  2NWV A;  1YQM A;  3RSM A;  5KN9 A;  3ENO C;  4EAI A;  3S3M A;  2YG9 A;  2DKC A;  1KY6 A;  1QN8 A;  1NKU A;  2JPS A;  3OYC A;  1LWY A;  1QNB A;  3TDH A;  2JG6 A;  4YOQ A;  3L2Q A;  2YH5 A;  2HZM A;  3VN5 A;  2YG8 A;  2HL8 A;  1WEI A;  3OH9 A;  1K35 A;  4YPH A;  3S3O A;  2H56 A;  1KEA A;  4BDY A;  1C4G A; 
#chains in the Genus database with same CATH homology
 3S6I A;  2NOI A;  4UNF A;  3FSP A;  2NOZ A;  3N5N X;  4E9G A;  2NOB A;  4EA4 A;  3OH6 A;  4B24 A;  3CWS A;  3FHF A;  1YQL A;  4AI5 A;  4AI4 A;  1LWW A;  5DPK A;  3IHO A;  1DIZ A;  1N3C A;  2NOH A;  4YPR A;  3I0W A;  1PU6 A;  4E9E A;  5KN8 A;  3G0Q A;  3KTU A;  1M3H A;  1KG2 A;  1N3A A;  1NGN A;  2OFI A;  1P7M A;  4PII A;  1XG7 A;  4OFE A;  2OFK A;  1LWV A;  2NOE A;  1KO9 A;  1XQP A;  3CWA A;  2XHI A;  4E9H A;  1P59 A;  3CW7 A;  4EW4 A;  4B21 A;  1XQO A;  1WEF A;  4UOB A;  1PVS A;  5CHZ A;  1MUD A;  3CVT A;  1MUN A;  1N39 A;  5AN4 A;  1PU7 A;  4EW0 A;  1RRS A;  4EJZ A;  3I0X A;  2I5W A;  4E9F A;  1ORN A;  3FHG A;  4DK9 A;  4AIA A;  3CWT A;  2JHJ A;  1M3Q A;  2ABK A;  1YQR A;  1PU8 A;  3OGD A;  1YQM A;  4HSB A;  3F10 A;  1VRL A;  5KN9 A;  4EJY A;  4EVV A;  1KG3 A;  3IH7 A;  2NOF A;  2YG9 A;  1WEG A;  2JHN A;  4OFH A;  1KG7 A;  4OFA A;  3CWU A;  1NKU A;  1LWY A;  1YQK A;  3D4V A;  2JG6 A;  4YOQ A;  2NOL A;  1ORP A;  1MUY A;  3F0Z A;  1KG4 A;  1HU0 A;  1LMZ A;  2YG8 A;  1KG6 A;  3CVS A;  1WEI A;  4B22 A;  3KNT A;  4B23 A;  3OH9 A;  4EA5 A;  1MPG A;  1KG5 A;  1RRQ A;  4YPH A;  1EBM A;  1FN7 A;  2H56 A;  1KEA A;  3N0U A;  1KQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...