3OYMA

Crystal structure of the pfv n224h mutant intasome bound to manganese
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oymA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oymA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oymA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oymA03
3T19A 4EDUA 3OYAA 2X4XA 4H8KA 3PX0A 3PMTA 2QKBA 3EY1A 1OYXA 3OYCA 4AHRA 3U3YA 4RG8A 4KB1A 2XY8A 4CHOA 4HUEA 3OYMA 3KK2A 4M3RA 3SV3A 3K5OA 4M42A 1ASWA 1WAFA 1H3ZA 2HHWA 1YTAA 5T7BA 2IG0A 4OLAA 4DU1A 3MEGA 4C8KA 3LP1A 3LP2A 3NF7A 1B9FA 4PLIA 1RDAA 2YRVA 5D6XA 4ZHRA 3I8DA 5JS1A 1BGXT 3DLRA 5CZ1A 4CJVA 3KIOA 1NJYA 1IKVA 3FFIA 3MO8A 5E41A 4DFMA 2RJDA 2O4GA 3OYDA 3L2VA 3AA4A 4FK4A 1EETA 3RMCA 4Z02A 3LALA 4BE0A 4N5SA 3NGZA 3E9FA 3LP0A 3WNEA 4B9XA 1RBVA 4N56A 2ETJA 4A4HA 4FLWA 3V1OA 1WSHA 4CJLA 4ZTFA 3OYBA 1ZBHA 5C0MA 2LVMA 4IBNA 5SWMA 5J2PA 3PFSA 1GOBA 1QQCA 1WGSA 4IUQA 1T03A 4RW6A 4BACA 3HM9A 2R5MA 4DSFA 5CY4A 3NTKA 4CJRA 4HUGA 2RJEA 1SSFA 1UAXA 3HVTA 3F73A 2FBTA 4DU3A 1TK5A 2W42A 1UA1A 3SI6A 3C95A 1VSFA 3QJ6A 4W5RA 4IFVA 2GFUA 2P0KA 4C8NA 5KE2A 1U4BA 2HHTA 4PLLA 4E1MA 3DMJA 4RW7A 1ITGA 4FLXA 3A2FA 4CERA 4F2RA 1U49A 1WJSA 4CK3A 2HHXA 1NK4A 3ZSQA 4CJQA 4L8RB 4CJUA 3L3VA 2FBXA 4FJ5A 4FYDA 1L3VA 3RTVA 4FM1A 4I9QA 5HLFA 4FK2A 1RT4A 4B9TA 1Z26A 4KKOA 4XIUA 3AA2A 1F21A 3LLRA 1JL2A 4FLTA 1UOCA 1NJXA 4QOZB 4B8CA 3QEPA 4M45A 4CGIA 4E7IA 1TGOA 3SQ1A 3RWUA 2B8AA 3PX4A 3OS2A 1ZBIA 4JRPA 3QERA 3QNNA 1HYZA 4KO0A 4KV8A 4O0JA 1VSEA 4M3XA 3DM2A 4FK0A 3OVNA 4KTZA 2L89A 1TK0A 5KCHA 1S9EA 4IG3A 3V9SA 3ZT2A 2QXFA 1U04A 4RG2A 4OVAA 3SZ2A 5K14A 1S1VA 1WSEA 4Q0BA 4GW6A 4W5TA 1WSFA 1VRTA 3V9ZA 3ZSZA 1RT3A 3PUFA 4OGEA 1KSPA 3PX6A 4OGCA 2KZZA 1L3SA 4DF8A 2A1RA 3AVJA 3CG7A 2R7YA 3UT1A 1KFSA 4LH5A 2R57A 3P1GA 3ASKA 2RJCA 4B9WA 2XHBA 1TKXA 4CIEA 2FHDA 1BIZA 2OPPA 2GUIA 4O5BA 3LYIA 3U6FA 4KTWA 4FJXA 3KLHA 5EU7A 3TANA 3TAPA 1JLQA 1WSGA 4F3TA 3OS0A 3EZ5A 5D3GA 4E1NA 3M8RA 3CFPA 4E3SA 4QCLA 3QEVA 1NK7A 3ALYA 3TWHA 1TAUA 5I3UA 4DQIA 1MU2A 4A4EA 3QINA 1U47A 1REVA 3K59A 1DTTA 1VSMA 4Z4FA 2F5KA 4WE1A 2YV0X 3CEYA 4QQGA 4BWMA 2O4XB 1LAWA 3V9XA 2Q3SA 3RR8A 3FC3A 5KCOA 1KHCA 3SCXA 3D0PA 2LTOA 1NOYA 3DLGA 4Y1CA 4FJ7A 3K2PA 3OYNA 1VSKA 4AHSA 4E19A 4CJWA 3LANA 2YNFA 4H4OA 5KI6A 3OY9A 4FZZA 4M3ZA 1IH7A 2D0CA 5FDLA 2CKKA 3KLGA 3SQ0A 4BDPA 3AO4A 2GF7A 1JLGA 4CJSA 4JRQA 4DTRA 2VWJA 4O44A 4CHPA 4DTXA 3QEWA 4DTNA 1D9DA 4OPJA 3DYAA 3OMCA 3DRRA 3K58A 4M3UA 1NKCA 4IKFA 3M8SA 3ZSWA 1NK8A 1NKEA 4ICLA 4FZXC 1WJRA 3F70A 1LV5A 4FXDA 4DSEA 1Q8IA 3V1QA 2OA8A 1KLMA 3AA5X 1TAQA 4QVZA 4KHWA 3B6PA 2HQEA 3AVCA 2VG7A 2WONA 4G1QA 3L2QA 4B3OA 4N76A 4KHUA 1DLOA 4E7KA 4CE9A 2PYLA 1IG9A 2VWKA 5J2MA 3C6UA 4FJ8A 1TVRA 4NS5A 1I3AA 3CFOA 2YHBA 3JYTA 2X74A 3CM5A 4FLZA 2PZSA 3DOKA 1LW0A 2MWOA 5J2NA 1S9GA 3OMGA 2GFAA 4KB0A 5C42A 4E7JA 3LGFA 3ZT4A 4W5QA 4NCAA 4B8AB 3HT3A 1TKZA 3SQ2A 3L42A 1KFDA 2DIGA 4CHQA 4LSLA 4KTQA 2K3YA 3KKRA 3O3HA 1JXEA 3ZT3A 1NK6A 4LY7A 3RR7A 3SPYA 4BE2A 3OS1A 4DQSA 4HCBA 4F4KA 2HHSA 2D5RA 3QO9A 3VQ9A 3H8ZA 3PO4A 3NTHA 1K6YA 2G8FA 2B4JA 4CEFA 3H08A 3S9HA 5J2QA 4FJJA 2E6MA 2EQMA 3NDKA 3ME9A 4CEDA 4Q5VA 1ASVA 5D6YA 1KCFA 3AO1A 4TSXA 3DLMA 3DOLA 3K5MA 1XC9A 1LWFA 4N4IA 2IGIA 3LPTA 1RTIA 4B9MA 5I42A 3S3OA 3LAKA 4NCBA 3FDRA 3ZT1A 5IAYA 1NKBA 2RHZA 4CFDA 3MXMA 1TV6A 3CQ8A 3NAEA 1I39A 1KTQA 3OQ5A 2GBZA 4AH9A 3HPOA 4ELUA 1Q9YA 3HO1A 3ZT0A 4DTMA 3KK1A 5HROA 3SV4A 3HYFA 1RILA 1C0TA 3ISNC 1TL3A 1YVUA 3U3GA 4FJHA 2LDMA 1EXQA 1CXUA 1SUQA 3HXMA 4DSLA 2D0AA 2BIVA 1QSLA 5CYMA 3TAMA 3LP3A 3ZEHA 2HNYA 4B9VA 2G8UA 1VK0A 1QSYA 1EP4A 3DB4A 3NTIA 2RKIA 1TK8A 3KD1E 4PWDA 4FJIA 4QQDA 3BGRA 3HK2A 2OZMA 3AVGA 1JLAA 3NHGA 5FROA 1HMVA 2DFHA 4DSJA 2EX3A 1VSIA 2P51A 4OPKA 4FW2A 4M3WA 2I5JA 3V4IA 4F3OA 2YKNA 5C24A 4IUTA 1BQNA 2QQRA 2HHUA 3RRGA 3VN5A 1T05A 1RBRA 3QIPA 2JZ2A 4FL6A 3VQ4A 1T7PA 1Q9XA 2F96A 2X6SA 2BDPA 2QQSA 4NCGA 2OZSA 3QESA 4C5GA 2RHUA 3UWNA 3WNGA 4HUFA 3AA3A 3CYMA 3G10A 3VQ8A 2NLUA 4O0IA 4ELVA 5C25A 4CEZA 1TKDA 1FKPA 4RW8A 2G8VA 2BE2A 4KFBA 5C6SA 2YHAA 3MXJA 3F9KA 1W9HA 4Y1DA 2IS3A 1HNVA 2G3RA 2P5GA 2X6NA 5FRMA 4FZYA 3ULDA 3M8PA 5KRTA 2EQJA 4E0DA 4KPYA 1HNIA 3VQAA 4KHYA 4BD3A 1XHZA 3AO3A 4CEEA 3PMIA 3NCIA 1L5UA 2X4YA 4II1A 2IAJA 1HJRA 4KRFA 4OKJA 2IDOA 1HQUA 4Z4IA 2EFIA 2JLEA 4C5EA 2XY6A 4BE1A 3NE6A 3MAQA 4ELTA 3ZCMA 3HPHA 2A1SA 2EKOA 3AVHA 1D5AA 3UIQA 3NBPA 4FCYA 2E4LA 4DS5A 1J9AA 3L2RA 1RDCA 2HHQA 2HVHA 4B9LA 1TKTA 3PV8A 1ZBLA 3VQ6A 4B9SA 1IO2A 2Y1IA 2R58A 2R5AA 4CF0A 4M3TA 1BISA 1GOCA 3NGIA 4DQQA 3VQEA 3RMDA 2G8IA 4W5OA 4RW9A 2AJQA 4YNQA 4FJLA 3O8VA 3QIOA 1CLQA 4IG0A 4QQ6A 1UWBA 4N4HA 3SQ4A 1GOAA 5HBMA 4Z4CA 3MEVA 3KD5E 4K8ZA 4KI6A 3META 1L3UA 1RT6A 4DSIA 1RT2A 4AHTA 2E6NA 1A5VA 3DLKA 2EQUA 4R5PA 3T3FA 4DWIA 4LSNA 3P5JA 2VG5A 2G8WA 4LD6A 3KLEA 1J53A 2Z1JA 2HQXA 1LWCA 1BI4B 5JS2A 4CJEA 4L59A 1RBSA 4CJPA 5HRPA 4IDKA 2LRQA 4F2SA 1X9MA 1ZBFA 2XDPA 4CESA 4M3YA 3B6OA 5M9OA 1X1PA 1WN7A 3L8BA 3CFRA 3L2UA 4HVJA 4FLYA 4F8RA 1HQEA 2YNIA 4C8OA 3SUOA 1U45A 2EQKA 1VSDA 1N6QA 3JSMA 4H4MA 3V81A 3ITHA 1C6VA 3RMBA 1BL3A 2HNDA 4HHTA 1RDDA 3DI6A 3OA6A 3PY8A 2ZD1A 2OYQA 1X9WA 3EAEA 2P5OA 3TAEA 3SPZA 3PO5A 5CZ2A 3RRHA 4HCCA 4HCZA 5DK5A 4CEBA 2LCCA 3IAYA 4CEAA 2O4XA 1BI4A 2D0BA 1N5YA 4I9LA 4CK2A 4QW2A 4C5IA 2HVIA 4MFBA 4PY5A 4NYNA 3OJSA 1NK9A 4KHNA 4FJMA 3KUFA 4CIFA 3KLFA 4FW1A 2BGGA 2O4IA 1XNIA 4C5HA 4CGGA 2IC3A 3V1RA 3P8DA 3I0SA 4DLEA 4IURA 2ITGA 5SZTA 1ASUA 1C0MA 1L3TA 4Z4GA 2Z1GA 4N47A 1NOZA 2HNZA 1BHLA 1W0HA 2F8SA 3K5LA 1FK9A 1C1BA 4OLBA 1A5WA 1D9FA 3QETA 3Q1JA 4DG1A 4DF4A 3AVKA 1J5OA 3C6TA 3NF6A 2YKMA 3ZSRA 1C0UA 2D9TA 3L3UA 4JS5A 3OYEA 3DRSA 3TI0A 3OYIA 3FLGA 5J1EA 2QK9A 4CHYA 3OB9A 1RBUA 1D8YA 1WAJA 3OYLA 4KI4A 1FKOA 3SJJA 1A5XA 2KTQA 2BKDN 3LDSA 2X78A 4PQUA 3NH2A 4J2AA 1IKWA 1VSHA 4GMJB 3TR8A 5J26A 4QAGA 3NF9A 2KZMA 1S1TA 4CEOA 1OZ2A 4OKEA 3NF8A 3T1AA 1EKEA 4A4GA 3VQ5A 3V9UA 4AHUA 4PL6A 1WLJA 1S1XA 4FM0A 4GVMA 1OZ3A 2GV9A 3SUNA 4O4GA 1YTUA 2RHYA 2HB5A 4EZ9A 3I0RA 2HHVA 4I2QA 2RI2A 3BDPA 4Z4EA 1U48A 2M0OA 1NJWA 5HRNA 3AVAA 1BCOA 3QLHA 4E7LA 2X4WA 1KVBA 4CJ5A 3IS9A 2WOMA 4DU4A 4DMNA 3QBYA 1QTMA 1MHNA 3E9GA 4M41A 1SKRA 3VQCA 1DTQA 2YNGA 4CFAA 1YT3A 4J2EA 4CHNA 1JLEA 1N27A 4N41A 2XK0A 3ASMA 4FJGA 3TAQA 5HRSA 4FJNA 2F8TA 1C1CA 1NJZA 2PYJA 4KREA 2DFFA 1BQMA 3HL8A 3QNOA 4KHSA 2Y1JA 4DQPA 3WNFA 3MEWA 2RI3A 4CFBA 3AVLA 4B08A 2OPQA 4BDYA 3LH0A 4J2BA 4FJKA 3PNWC 2LSNA 1S1UA 4MQ3A 2BUDA 3P8HA 4PUOA 4EP4A 1RTHA 4CGJA 3AO5A 1RCHA 2FBYA 4JLHA 1KVAA 4W5NA 3LZIA 1JL1A 1WSJA 3H6ZA 2FC0A 3DLEA 4CGFA 1HPZA 4DTPA 3ZSVA 1T8EA 4X34A 2NUBA 4CJ4A 3AO2A 5IN1A 1RBTA 1LAVA 1Y97A 3TAFA 4UQGA 1XHXA 1LW2A 1XWLA 1XI1A 1Z25A 2KFZA 4NYFA 4CF1A 1VSJA 3HVRA 3NH0A 4C8LA 4CEQA 3NFAA 1X9SA 3K57A 4N4GA 2JGUA 3GOXA 3DRPA 3L2WA 2VG6A 4BWJA 3QKJA 4K8XA 1S1WA 4CECA 1WSIA 4E7HA 3S3NA 3P83D 1NK5A 4DTSA 3OJUA 3MEUA 1SL2A 3HP9A 3D45A 1S6PA 1G5VA 4DTUA 3S6WA 1RT5A 1HRHA 5FRNA 4OVLA 2RJFA 3MEEA 2Z1HA 2RF2A 3OYHA 4Q5WA 4FVMA 1RTDA 1LWEA 3M9QA 4EZ6A 3KJVA 4FM2A 3LZJA 3MEAA 3KTQA 3VA0A 3HP6A 2OPRA 2WACA 4CFCA 5D6WA 3KK3A 5KTQA 4CGDA 3O4NA 3SD4A 3OYFA 4J2DA 4IUUA 1JXBA 5HP1A 2JTFA 4LH4A 1HYSA 1IKYA 2KW4A 3MEDA 4ID5A 3CM6A 2L8DA 4C8MA 4CF8A 1CZ9A 2XY7A 5DMRA 1RT1A 3QEIA 3MXIA 1R0AA 4CIGA 3G0ZA 3OYGA 3SNNA 1VSLA 2XO7A 4AILC 1KRPA 4DTJA 3LX7A 3THVA 3DLBA 1QE1A 2QKKA 2VYTA 4CGHA 2B6AA 2DTUA 2L3RA 3ZSYA 3VQDA 3VQ7A 1EX4A 3KLIA 1ZYQA 2DY4A 3MECA 4B9NA 1RT7A 3NGYA 2G8KA 2HW3A 1BCMA 1JKHA 1BIUA 4AHCA 4DQRA 4DS4A 4OKKA 1SV5A 5J39A 4DLGA 4DSKA 4CJTA 3ZSOA 1HYVA 3AVBA 4FLVA 2X35A 3AVFA 2DFEA 4CJKA 2RHIA 5KGWA 4E89A 2KFNA 2FBVA 5KH6A 1WJQA 3AVIA 4IUVA 2ZE2A 4JS4A 1SKSA 1UA0A 4DFPA 2RN2A 1CXQA 3SUQA 2PQWA 5HRRA 2G8HA 4GY5A 2RI5A 3ZSXA 1S6QA 1VRUA 4HTUA 2MWPA 2XY5A 2M16A 3M8QA 1RDBA 3LGLA 4CF2A 3O3GA 2ATQA 3OYJA 5CYQA 4B9UA 2BANA 1J54A 3KKSA 4RW4A 1B9DA 2M1HA 4IFYA 4CJ3A 2PY5A 1ZBUA 2ZQBA 3NH1A 4CF9A 3C94A 3S3MA 3MP6A 3HJFA 4EP5A 1CZBA 3LAMA 3WNHA 3SYZA 1O1WA 3AVMA 3VA3A 4DTOA 5CIUA 1IKXA 2RO0A 4Z0UA 3V9WA 4AHVA 1NK0A 4FU6A 3VQQA 3K5NA 4ID1A 1OI1A 2K3XA 4Z4HA 4CJFA 4A4FA 4LD0A 4BDZA 1FXXA 3NNQA 2E5QA 3LWLA 1KLNA 3AVNA 2Z1IA 3HSTB 3V6DA 3FEOA 4OJRA 2P1JA 3TARA 4DFKA 4UC4A 4I2PA 4DFJA 1RTJA 1C1AA 3RMAA 2E6LA 4O55A 2RHXA 4CK1A 4FLUA 1RNHA 1QSSA 4CCHA 4PA1A 4KAZA 3TABA 1G15A 2B5JA 4FJ9A 4CRIA 3O4QA 3VQPA 2XRIA 1QHTA 1JLCA 3AV9A 3OYKA 3EYZA 5KGXA 1B92A 3IG1A 1SL0A 2YNHA 1JLBA 3SUPA 2EHGA 4NZGA 3E01A 2KQ2A 2DIQA 1QS4A 1WNSA 3BDLA 3C4SA 3IRXA 1SKWA 3QEXA 3VQBA 4IUPA 3MP8A 5KE3A 3HPGA 2DAQA 1TL1A 5KRSA 2OPSA 1S5JA 2RPIA 3LWMA 1JLFA 1KVCA 3TAGA 3MP1A 4CHZA 4ZTJA 4KHQA 3DB3A 3O3FA 3LPUA 2IOCA 1RI0A 4YFUA 3DLHA 3QIIA 4I7FA 1SL1A 2HMIA
chains in the Genus database with same CATH superfamily
2M87A 4A0XA 3S1QJ 4CCMA 3T19A 3Q7BA 3OYAA 2A5YB 3LAPA 2D0QB 2COBA 3PX0A 2ME6A 5GANh 2KRCA 3PMTA 4BB7A 1LWYA 4HQEA 2IPOB 4I99C 2L3PA 4AVPA 3GO5A 2ISZA 3OYCA 1AWJA 3FXKA 4OMQA 1IHVA 2HQAA 3OYMA 1LMZA 1WBDA 2HYFA 1JE8A 2V9VA 3RZOJ 2ID6A 3SV3A 2ZSIB 2CDTA 1F1BB 2HHWA 1VQPI 1XG1A 1YTAA 3BG3A 3C7JA 3IWFA 3MEGA 1NJIU 3R1XA 4A12A 3LP2A 1MUZA 1B9FA 2M8GX 2D8JA 1RETA 3CCQT 2VUBA 5IT3A 4ZHRA 1R00A 4F91B 4D8KA 3TSPA 1YRNA 3WT0A 1VQ4N 4MDAA 3F6OA 1NPRA 1YI2T 3DLRA 5CZ1A 4CJVA 2Q97A 1FIPA 4JAXA 1NJYA 3JSOA 3DBRB 3FFIA 4DR4K 3SYTA 4YOQA 5LJ3e 1LDJA 4BH9A 1T6CA 1K8AR 3AA4A 3M0TA 3ZOBA 2GEMA 4XAXB 4JKCA 1V4SA 4LK0F 1YJWN 1K4TA 3LQRA 2LQKA 3LP0A 4DUYK 2R7FA 2GA2A 3OW2M 1ULYA 3WNEA 4RMNA 1GUUA 4J9GA 1X4PA 1SFEA 2E2JJ 2LC4A 2JQ7A 4FLWA 4XSZF 1W70A 3C2HA 5J8FA 2DMUA 3JCMd 4FPAA 4Y52J 4OMOA 4C3JJ 4KNYA 3QMLA 5FGMA 1QVFM 4V2GA 2LVMA 5JI6A 3N4PA 3D5RC 4I01A 5SWMA 1X9JA 1FSEA 4IUQA 3OW2S 1YQLA 1U5TC 3JCMP 4HTLA 2R5MA 2O8KA 1M1KC 3GZNB 1RUNA 4KBOA 4O8KA 4HUGA 1ZKGA 5DCMB 1UHCA 1OFCX 4Y91A 1UAXA 4HV5A 4JI3K 2FBTA 1XCBA 1VYVA 3WUHA 1VSFA 4W5RA 3FHFA 2R93J 3VWBA 1WRJA 4LD5A 1WX6A 3IUCA 2Q2EB 4C8NA 2CV2A 1HOMA 1TUGB 4LFUA 3RYPA 2V26A 3LSKA 1D1CA 1HYOA 3KK7A 4E1MA 1KC8C 4CERA 4F2RA 4CYDA 3V7RA 3WHBA 2DW4A 1N78A 1S6LA 5BRFA 3S1MJ 3ECHA 2MGQA 2HHXA 1ZC6A 1RIOH 3ZSQA 4L8RB 5AQZA 4PKHA 4FJ5A 3N4MA 4RTXA 4DBRA 4A69C 5EC7A 5CYVA 1UB4A 1I27A 3EG1A 4FWPA 1PC0A 4KULA 5DCMA 2L9SA 3O8HA 4XIUA 3BTIA 1XC5A 1F21A 1TXQA 3LLRA 1JL2A 3GTOJ 3KHYA 3HKZA 2ZPEB 1UOCA 2YHWA 2QWNA 4QOZB 1H88C 3HUGB 1VQ7Q 1FP1D 3QEPA 1UDLA 3JCMc 4M45A 3TREA 2Q2EA 1MGQA 5GAGJ 3I71A 1YAGA 2ZF5O 4L6V5 3E19A 5TKWA 5J40A 2K9GA 3OS2A 1ZHFA 3CESA 1OCCH 3QERA 2PTKA 4A93J 2YHYA 4JKEA 4ZDLA 5AQNA 2O9SA 4FK0A 1Q81U 1VQNI 4KTZA 2L89A 2IGNA 2COZA 1LFBA 3ERED 2XHIA 2KRFA 3P9KA 1FJLA 1S3XA 4RG2A 1LFPA 5AQHA 4LLLA 2YPRA 3A1YA 1BA0A 2K5LA 2NRRA 1UGRB 3GW2A 2BW3A 2LRDA 3VS1A 4GW6A 1YJ9A 4PJOB 2P0WA 4DOWA 3HUGA 1RT3A 4H0TB 5AQQA 1I5OB 1J0RA 5TGTA 2VGMA 2KZZA 1DJ7B 2EIJH 3DKXA 3JW4A 3AVJA 3LMMA 1JXSA 1YIJQ 3MN6A 2MSYA 2ED0A 3HBLA 6PAXA 1KJWA 1GT0C 1QHAA 2A08A 4XKWA 4XLPF 2QQAA 2K57A 1MMDA 4RTYA 4B9WA 2XHBA 2ZXJA 4RM3A 1ZLKA 3ZQLA 3EH1A 5TKYA 3DFGA 2DL5A 1U6ZA 2Y90A 2IXSA 5JR3A 1WZOA 2LMJA 2LY1A 1M1FA 4O5BA 3LYIA 3JCMe 2JTEA 3TANA 3WTTC 4PJOA 1XNRK 4QS7A 3GDQA 3EZ5A 1JJ2P 1HNZK 2F4MB 1MWMA 3M8RA 3CFPA 4ENJA 3QEVA 3QUIA 2WV0A 2LTPA 1M27C 3W0LA 3I0XA 5I11A 1TAUA 1YLFA 5I3UA 4DQIA 1NG6A 3CMYA 2MIOA 2EGEA 3SZTA 1M2OA 2DRMA 1NZ9A 2EJRA 1V54H 1XGOA 1HA8A 1OJLA 1HKSA 4CZEA 1Z7UA 2F5KA 4FQGA 2PEXA 4WE1A 2FNPA 5GAN6 4RTWA 1NEBA 1U06A 4B1WB 5F0HA 2O4XB 1F1ZA 1NEGA 2WBNA 1KHCA 2EGCA 3A0HC 1IGQA 2HDWA 4BR7A 2MPXC 4CXFA 3K2PA 3OYNA 1VSKA 2M7BA 3PNYA 2MYSA 3H5RA 2D0NA 4JX5A 4YRVA 3U8XA 5CKEA 4CJWA 3TO7A 3JB9J 4D0PA 2DYIA 1VQ5N 3LANA 1E3MA 2ZPFB 2W24A 4LF5K 4FHTA 2A6AA 1HW5A 1ATNA 4FZZA 2UUCK 1UELB 4XU0A 2O7OA 2P9IA 2IBDA 3MX5A 4BDPA 1ARKA 3KLGA 1WKMA 2XGCA 2X1CA 5ED4A 2LJ1A 1U6GA 4C92F 3GOIA 1ETWA 4X6AJ 3PSFA 4O44A 4XK8E 1ETOA 2QEXQ 3Q0UA 1D9DA 2EV6A 4OPJA 4MTEA 4JX6A 1VQ6Q 2LNHB 3OSSC 4OF1A 5C2DA 3HI0A 1JUPA 4M3FA 4M4ZA 3BP8A 1HDDC 4FZXC 3ZLJA 3M7GA 2WC2A 1Q8IA 2TCTA 2JVGA 1KLMA 2ZJRL 2OAWA 3CWAA 4B1ZA 4QVZA 3QU6A 4L0YB 3AVCA 3O9RA 4BJ5C 3S14J 2P7VB 4G1QA 2IGOA 2JJ7A 4NL3A 1DLOA 4E7KA 4CE9A 5LRSA 3CD6Q 2P9LB 2VQLA 2HF3A 3BZ6A 5J2MA 1D8JA 4E1JA 1TVRA 1I3AA 1HW2A 4NS5A 2E1CA 3G4SQ 2L02A 3A5NC 3VSLA 5TJJA 2DA4A 2FOKA 3M53A 5AR0A 2CH4W 3TDZC 1FZPB 5BPMA 1MMGA 4OIOF 2PZSA 1KQSS 1RAAB 3H3NO 1T2KA 3Q9VA 3QYHB 3A02A 1ATSA 4N0BA 1KD1C 2LSOA 3HM8A 5KN8A 2QTXA 3CCLI 4B8AB 4GRIA 2HDDA 2HWVA 1O3QA 2LT4A 2DTIA 1KG1A 2CUEA 1WBBA 3L42A 2AP1A 5IT9Z 4WQ4C 5LJ5d 1ZR2A 1ZLMA 4LF4K 4CHQA 2J05A 3A8HB 4BRIA 3F72A 3ZT3A 2O5RA 2MD0A 1QPIA 4QVDA 4FO0A 2PBDA 2W6KA 3CMAN 3RR7A 2QCOA 3CLQA 3P7NA 1I4K1 1HKBA 3QJYA 1Z6RA 2F5CA 5DM7F 3TEDA 3KLOA 2IGMA 2A3SA 2WFBA 1J9IA 3CO6C 3LSIA 3ZMDA 5AQKA 1N39A 1OV3A 3GF5A 4LK1F 2V6EA 4E4HA 2DVEA 2W7NA 2B4JA 1KAZA 3S9HA 2NVUB 5J2QA 4FJJA 4D7MA 3JSCA 2E6MA 1T56A 4B43A 4KDPA 1M3BA 2EQMA 4G94A 2XAUA 3ME9A 3G6ET 3I4NJ 2M0YA 3TVTA 1JXMA 1N36K 5FKLA 4EATA 3IC7A 1KCFA 3AO1A 1M8VA 3K5MA 1XC9A 2DE0X 1FYLA 1XMOK 2QBYB 4RAYA 2UXXA 4C9YA 3CC7A 4B9MA 4M3BA 8AT1B 5CVJA 5I42A 3S3OA 1D0XA 4NCBA 3IRRA 4BG8A 5IAYA 2GAUA 3C12A 3SJHA 1XMAA 3THKA 3J7ZO 5IOZA 5J47A 4AFSC 1I6HJ 1TV6A 3E5UA 1V1CA 3OV8A 4XOTA 3OWTA 2JHNA 1IREB 1BOTO 1WHJA 2NOEA 4C2UA 3H9JA 3TMOA 4XH5A 2O8BB 1OISA 3W2WA 4HX7A 1C0TA 4ZYDA 1YJWA 3ISNC 2ZXWH 1YVUA 4EHTA 4F9OA 3L1PA 3D5SC 3K4CA 4A5NA 3CXCP 2QM3A 3ZGKA 3TAMA 1KQSA 3ZEHA 1B9MA 2QBYA 2G8UA 2XRNA 3CPEA 4WYBA 1DU0A 3F5TA 1PD1A 3DB4A 1NGIA 2L9RA 3WTWC 3HM5A 3SDBA 2RKIA 3CCJN 3M3YJ 3KD1E 2QYZA 5E8GA 3OOUA 4KIBA 5AQRA 4ZZDA 4N0AC 2O8DB 1MBEA 3NHGA 3DQVC 5FROA 1QZYA 1WYXA 2VCPA 5GAGP 2P51A 2O8BA 3ROUA 4A5AA 1VHXA 2YKNA 4PJLA 3HRMA 2Y9ZA 4CZLA 1H1VA 3TOAA 4BRGA 3VN5A 1R1TA 1RBRA 4GV9A 3PIOA 3KFVA 2BDPA 4JI2K 1GL5A 3RPUD 3BJAA 1K73R 4ILJA 3R61A 1NM7A 3PO2J 4YOWA 4OX9K 4I02A 3RIRA 1OH5A 4HBLA 5DM7R 1VQOA 2L2OA 2JSCA 2DTOA 1A5JA 3LQQA 1WXBA 1TKDA 4KGVB 2F5VA 2W40A 1X75C 2G8VA 1TUUA 1VQLA 1MSEC 3ABKH 4R55A 3WE3A 4H0OA 4YPHA 1EWRA 1X3ZB 4DQ8A 4JX4A 2YHAA 3UE5A 1W9HA 4V19S 3TP0A 1WDXA 2IS3A 1E3HA 2ZJPF 2H8RA 3VF6A 3BW1A 1UE9A 5FRMA 1QP2A 5GANf 3ULDA 2KY9A 1RZ4A 1FTTA 1MIJA 1FYNA 2LJ3A 3FRNA 3D6RA 2EQJA 3FXQA 3R0AA 2LKXA 1GBQA 1VQ5T 4HT8A 2B7EA 2DOFA 2CQQA 4A54A 1QWEA 2LYCA 1XHZA 3O1WA 4FOEA 2DMQA 2L2PA 2E1ZA 1K73U 5J3LA 1JRIA 5GAMd 2IAJA 3AAPA 2VXEA 1HJRA 4OKJA 3E7LA 2CYYA 4Z4IA 5M1PA 2W57A 2JLEA 1RI9A 1JHFA 2V7FA 3IWZA 1OCRH 5BQTA 3JRDA 3MAQA 5ILVA 2QDYB 3LA7A 1LDKB 5GIPA 5FPDA 2HMAA 3CCVN 5HS9A 3CC2A 5BRDA 3JTGA 4YEJA 1QVGM 3UIQA 2LG4A 2E4LA 1LEAA 5L8RE 1AT1B 4GV6A 2F69A 2HVHA 3AG3H 3VS5A 3PV8A 3CJNA 1ZBLA 5FKNA 1MJAA 3CMET 3MAJA 4LLNA 4CF0A 4RWTA 4H0VB 1CKAA 3RMDA 3BDUA 4X64K 4XSXF 3I55A 1BG3A 3VS6A 2E3IA 4X1EA 3DTEA 1OOTA 3LW5E 4IG0A 1FYKA 3F8NA 4UOBA 1UWBA 4ORZA 4BQLA 1FT9A 5HBMA 4Z4CA 3KE2A 1SD5A 1R1VA 3KD5E 3UB5A 5LJ3h 4DSIA 1RT2A 5GAN3 2E6NA 1K9MC 3WQUA 2AS5F 3FZMA 2DI3A 3MCZA 1W2BS 3DLKA 4P5OA 3D7EO 4R5PA 2NUPB 1U5TB 3CUQC 4DWIA 4EA4A 3HTRA 1UB9A 1YJNA 3QPLA 3ZMZA 3KLEA 2UXNA 3H36A 3LA2A 2BXYA 2JPSA 2D6FA 2ASPA 5CKFA 3CCEQ 2ZPGB 2PAVA 4F2SA 2J5OA 4KT0E 3T0YA 1SD7A 2HBWA 1ZBFA 2FQ3A 2F2VA 2HEQA 4CCLA 3CCMT 1HJDA 3K2AA 1X1PA 1IRXA 3L8BA 2YNIA 4C8OA 3SUOA 1GLFO 4UV9A 1VQPQ 3I56A 1R5GA 4EJWA 3FF5A 2HNDA 3R6MA 1IBKK 1VQ4I 1GLEG 4X66K 3QICA 3DI6A 3WVEB 1RR8C 2ZD1A 5FWCA 1I0CA 2K3PA 3HFOA 2VVKA 2HPIA 2NVTJ 4AI5A 1U5TA 3ISPA 1YTYA 1N3AA 3JRBA 3QZ9B 5CPRB 4IHWA 4MLEA 2GTJA 2D0BA 5IXFA 1T0HA 4BHCA 3VS4A 1R58A 2KXCA 2QQ8A 1YJWI 2YU3A 2X4JA 2HVIA 4A59A 3RJPA 2QENA 2BTTA 3CCRT 1U78A 3AG1H 1FEXA 3I0WA 1V5EA 3S8PA 2E35A 5EGOA 4CD1A 3OJSA 3BDDA 4FTHA 3F0CA 3KUFA 4CIFA 1CGPA 3UATA 1P2FA 2R0QC 2EBIA 2H27A 1WEFA 1P59A 1WFXA 1H0MA 3EDPA 1XNIA 5GAMe 1NGBA 1NJIC 2H6CA 2X0LA 4FWQA 2ITGA 5JVGF 3WXIA 1JGGA 2XF7A 4E9EA 1L3TA 2K3BA 2Z1GA 2OZ6A 4N47A 3QOPA 3ZQQA 2F2WA 1BHLA 3K9TA 1ON1A 1VQ9T 1UHMA 3TDUC 3K5LA 1BKBA 3ZN0A 1C1BA 3OSVA 3QETA 4HSBA 4CCOA 2KYMA 3WXJA 3AVKA 2ASMA 1RUOA 4OB3B 2O88A 2I7PA 1PYVA 1YS7A 5DY9A 1T95A 2GA1A 4MZTA 1W2BA 5J1EA 4TVRA 3OB9A 1RBUA 1WAJA 1W4MA 2XPWA 4A6DA 4KI4A 2P5LC 3SJJA 1JTYA 5E84A 2KTQA 5KCMA 2HOTA 1M1GA 3KEQA 2JZYA 3CPWP 4J2AA 1LWVA 1IKWA 1VSHA 5IH2A 1PUFB 4GMJB 4WCGA 2NNYA 3NF9A 1S1TA 4CEOA 1ODDA 1OZ2A 4Z2YA 4FX4A 2LK2A 4OKEA 1IXDA 4Y4RA 3J7YP 3E9LA 4FM0A 3MDQA 4HWIA 3D2FA 1XC3A 5CHZA 3RKWA 1R6RA 2JVHA 3CMAA 3M1EA 4YPRA 2HHVA 2HZYA 1IC8A 4F7UG 4Z4EA 2HKXA 1X19A 2FF6A 2OAUA 1M3HA 1E4FT 5HRNA 2OI3A 3AVAA 4FWMA 3QLHA 2J6KA 4PIIA 3ZXSA 2X4WA 3TPQA 4PGHA 5DLQE 1QZ5A 4D5FA 1NH3A 1PUFA 3BTLA 1VQ7N 3VQCA 1IRGA 3JCMh 1ON2A 2KHOA 4N9IA 2EYYA 1JLEA 4YOXA 1DGWY 3LSMA 4FJGA 2D45A 2F8TA 4KREA 3QDRB 2HTSA 1BQMA 4BQZA 1YJ9T 4D5CA 3EE8A 5FU6C 2Q0OA 4G7OF 5AQGA 2AHQA 2NOIA 2EWNA 2R7DA 3AG4H 4C0ZA 4KGXB 2JM8A 3P8HA 3J7AP 2HQHA 2EB7A 4F55A 4AFQC 1RTHA 2WB1N 2FUG2 3AO5A 2ZPIB 2QWMA 1XOVA 4JLHA 3LZIA 1JL1A 2FC0A 2A41A 4E6KG 5BOXA 4VUBA 3ZSVA 3VEZA 3M07A 2NUBA 2V1QA 3AO2A 5IN1A 4HLXA 4JI4K 1Y97A 3GBGA 4JHDB 1Q81C 4G6TB 5KYNA 3C3WA 2GWKA 4A3BJ 4RGSA 4UQGA 5D4SA 4JP0A 1X2MA 2DT6A 1Z9QA 1XWLA 5CO7A 2KFZA 2CW8A 3J80E 4JK8A 2NOGA 4LB6B 5FLVA 2HMPA 3NH0A 3HXLA 2CUDA 4UUVA 1NM1A 1YYVA 2HYJA 2OCEA 1UGPB 3CCJA 2ESHA 3R8EA 4YFKF 3DRPA 2CT4A 4L9TA 5M1KA 1DEJA 3S15J 2DQRA 2NRHA 4BS9A 5GAOn 1NK5A 1Y56A 3JRGA 4DTSA 2WY8Q 5LD2C 2NVXJ 2PZ1A 1REPC 3D45A 4E6RA 4DTUA 2FO0A 3I58A 1M90R 4JHDA 5AQYA 1A36A 3J81K 2W82A 2RF0A 4NXMK 2RJFA 2Z1HA 2V1UA 5K5OA 4KICA 2HAXA 3OYHA 2LF8A 1RTDA 3M9QA 3KJVA 2DA5A 3LDQA 1M4ZA 2DK3A 2V8IA 1Y6IA 2M3AA 4UVCA 3LZJA 3KFWX 4L5GA 2H8HA 3HP6A 2F5DA 3AAFA 2C0TA 3U9ZA 1VQ5I 1TZLA 1IO6A 4XU2A 4CGDA 3RPUA 1RLQC 3O4NA 1G99A 2KKZA 4Y0WA 1HPMA 4KFCA 1USTA 1Y0NA 4B3MK 1B07A 1KU2A 1YQMA 2JTFA 4KUDK 4LH4A 1YW9A 3HPWA 4WQ5C 1TWAJ 4H5RA 4ENKA 2XY7A 1RFQA 5HLTA 1W7AA 4DBFA 5DMRA 1T44A 5K5RA 1XMQK 5L3BA 3FMQA 2QM1A 3QEIA 3L6QA 3RKYA 1NMNA 1TC3C 5GANg 3V42A 5EZHA 2ZGWA 5ICGA 4LD9K 2MFZA 1ZGAA 2XO7A 1KRPA 4DTJA 2VWFA 1DP7P 3DPTA 1OKRA 2GOXB 1W5SA 1MD0A 2KJBA 4W1UA 2QEXN 3H0FA 1FMVA 1JJ2M 1VQ6N 2PQ8A 3BY6A 2VGNA 3RBBB 1RL2A 3GMEA 1SMYF 1YITQ 2DO3A 4G7HF 2W00A 1W7PB 4WQ4A 3LDLA 1TYQA 2BVLA 2DMPA 2YUSA 2FF4A 2QWOA 4NC7A 4M7DD 2AQEA 4J9IA 1X3NA 4IXAA 3CJBA 3HOVJ 3WTYC 4ZJZA 1ZARA 2XF6A 2HZTA 1BCMA 3E1YA 1T6DA 5HDKA 3B8AX 3D4VA 3BCAA 1JJ2S 4DQRA 1TTHB 3HDDA 1NKUA 1R9TJ 1SV5A 3LM2A 1MNMC 2VIXA 5J39A 3RSNA 5F1JA 1JU5C 3TU5A 2RA2A 3PIOF 2Y4YA 3ZSOA 2X3XD 2KL4A 3CD6N 3BPVA 4RLQA 5JHUA 1KG5A 1PRMC 1SEMA 2R7QA 4FLVA 4EGYA 2X35A 3G4SN 2JPBA 2KHMA 4UUSB 1RDUA 1RDWX 4M7AG 2RHIA 5KGWA 3U1KA 4E89A 1Q86R 1D3BB 3PFIA 2V4JC 5KH6A 4C8QG 2GBQA 2JMAA 2I5WA 4IOXA 1SEUA 2VOPA 1W7PA 1GXPA 1SKSA 2UXCK 4U87A 4DFPA 2G7UA 5KVRA 1G83A 2G8HA 2L7ZA 2KMUA 2VONA 3I9V2 1H8KA 3CMAI 3ZSXA 1UCRA 3MN5A 3ER0A 1ZYRF 3N0UA 1Q7YO 3NARA 2M16A 3L9FA 4BVPA 4CD3A 4A4KA 5GAN8 4XTWA 2GZWA 1RDBA 4YY3K 4GXOA 2QUFA 3O3GA 3OH6A 1YQRA 1VFCA 3KWIA 2Q1NA 4BBRJ 2JM9A 1J54A 3O9QA 3KKSA 1MV3A 2F9WA 4RW4A 1X1AA 4CJ3A 4I76A 3O1BA 4UUSA 1DP3A 2EQRA 1JTXA 2L4MA 3VRZA 3CCQQ 2BE5F 3EGUA 1M1EB 1CZBA 3SZPA 4DOZA 2UUAK 1QHHD 3SYZA 2QXLA 1Q86U 1SAUA 3CDHA 1UTIA 4KIFA 3EFSA 2K2MA 1YI2Q 1C0GA 3CC7T 4K43A 1KO9A 3VQQA 4AQYK 5IXBA 4CJFA 2OPTA 3AG2H 4M6VA 3FISA 4LUDA 4EJUA 1WNLA 2G6FX 4J6YA 1SF9A 2IA1A 3TO6A 2QWLA 3V6DA 4N0AA 2AK5A 5KYYA 3J8AA 4QS9A 4ZDPA 2VI6A 3E6DA 4ZDOA 4KMFA 1P7IA 4Z89A 3M5RA 4GKKK 2PU9B 4EMSA 2CH0A 4YORA 1YIOA 4B8XA 1NGDA 3I4PA 4O55A 2RHXA 4JYKA 4CCHA 2W84A 1PCXA 1NE8A 1G15A 1VQMA 5EY4A 2NRAC 4DQ2A 3O4QA 3VQPA 4RUGA 2XRIA 4OINF 1TSFA 2BY0A 4E70A 3PE0A 1N75A 1ETXA 2FRYA 3PQJA 5LEKA 5KGXA 3KZBA 3D7SB 5LJ5h 2GNCA 1GLBG 2V6CA 1WH7A 2ZPHB 1KK7A 3CCJI 2DA9A 2WSEE 3CQZJ 1QS4A 2R7VA 4XNFA 3QZ5B 3ZYYX 1YIJT 3C4SA 1ZXOA 2EAYA 5I2MA 2YUOA 2YXYA 4HYEA 4UB6C 4K25A 4Z94A 5K5QA 2ROLA 4NB4A 2ZZDA 5KE3A 3HPGA 2DAQA 1TBXA 2JG6A 3ULRB 1S5JA 3TAGA 1SAZA 2XAJA 1VQ8Q 1MNEA 1J09A 3MP1A 4RTZA 1N34K 3H5NA 2IOCA 4OB1B 1VQOT 4RB3C 1MSFC 1GLCG 4IO9L 4YFUA 2DERA 2Y2ZA 5B5EC 5DM6L 1FN7A 3QIIA 1NGJA 1SL1A 4L3QA 2ZCFB 3VYSB 1VQLT 3VEOA 1OX8A 3P4IA 4B3SK 5KYUB 1R22A 1FMWA 5EG0B 4AG1C 2YDLA 3VGKA 3HRSA 5AQFA 1ZGWA 4AHRA 4HUEA 4CDGA 3KK2A 4WCIA 2FRWA 3K5OA 4M42A 2CQKA 1QQIA 3A1PA 1RRQA 3B02A 1YG2A 3BZKA 1H3ZA 3JRFA 2UU9K 1WQWA 4OLAA 1WEIA 2HOEA 4OO1J 3K6GA 3CUQB 5CR4A 4PLIA 3CXCM 1IN6A 1Y96A 2YRVA 3IRQA 4RBOA 2CGLA 2ISYA 3VJPA 4GNIA 3G2BA 1XDSA 4ON0A 2VKVA 5KYUA 2VASA 1MH4A 2QI2A 2XVCA 1H8AC 3MMVA 1VQ7A 5EG0A 3I64A 4PJMA 5E41A 2ZMEC 4DFMA 4XTYA 2XB0X 2RJDA 2O4GA 2F6CA 3L2VA 2H8WA 4Y92A 2B0LA 2BY2A 3CC2T 3LALA 2DYSH 1PJRA 4BE0A 3FK6A 4M77G 3NGZA 2XIDA 3E9FA 1KXPA 1HXDA 3CCVI 1MW7A 4MGRA 4M75G 2HHHK 2AXLA 1EIFA 1RBVA 3ZPLA 1KG3A 1J59A 2OTJN 3CUQA 1VIEA 4I2OA 2ETJA 3AY9A 2V1NA 1QKWA 3L0QA 3I55T 3V1OA 1WSHA 4CJLA 4ZTFA 4BNCA 3OYBA 1ZBHA 4IEEA 1DQUA 5C0MA 4ATOA 1ABOA 4Z8AA 4IBNA 5EJCA 4XICA 1B8IB 5K7HA 2JS2A 3WE2A 4BACA 3UDCA 2OJED 2JW4A 3G3ZA 4EFHA 1SSFA 2F9TA 3HVTA 2E2HJ 3F73A 2HEOA 4J8FA 3A8LB 2YR2A 4DU3A 3WGHA 2FZKB 3SI6A 4A2BA 4EJTA 2X9DA 4LJZF 1WHGA 1V4TA 3GCMA 3KLNA 1WFWA 4JKAA 2GFUA 2AZSA 3VS3A 4DJAA 2P0KA 5E3NA 2Z0WA 1U4BA 4XLFA 1Z9CA 1M3AA 1JT0A 4PLLA 3DMJA 1Y0UA 1ITGA 4FLXA 3JV3A 5IT9E 4IOAF 5I21A 5KYXB 2OTLN 1P6RA 1WJSA 5GAMh 4IVNA 3D5LA 4S05A 5H2FC 3E9OA 1B8IA 3HOYJ 4J7IA 4DR5K 2VQGA 4JQFA 4BR2A 4FYDA 3I56T 5GIOA 4B3TK 4LXCA 1M1KR 5BMZA 2G9WA 2QG9B 4I9QA 1RT4A 4M3GA 4FE7A 5F08A 5DEQA 3P38A 1WUAA 1QCNA 3M54A 3QYGB 2BE7D 3EGDB 2K5IA 3AGRA 2W4SA 3TOBA 4B8CA 3H3UA 3IAS2 4E7IA 2PVGB 5ILSA 2RNAA 5M3MJ 1GLJO 2H1KA 3RWUA 1W6XA 1VQPN 1PUEE 4PKCC 3FSPA 4ITVA 2XMFA 1KC8R 1QQJA 1JBMA 4JRPA 5HLGA 1HYZA 4KO0A 4O0JA 4H0PA 5ADXH 5KYXA 1IUFA 3MK6A 3OVNA 1Z67A 1KQ0A 2KXDA 2PMZN 3TQ7P 3VRYA 1GLAG 3ZT2A 2DPDA 2VBZA 3CBOA 1UEBA 2QXFA 5AQTA 1BJAA 4OVAA 3SZ2A 3WU0A 1W97L 3ZX0A 5GMKm 3MCPA 4W97A 1LQ1A 5K14A 5GADJ 1FBUA 1WSEA 2IVNA 4W5TA 4UUTA 3A8MB 5IHNA 1WSFA 3EGDA 2M0MA 5AYFA 4PNOA 3V9ZA 3ZSZA 4XONA 4J6WA 3CJTB 4F17A 3J7AY 2ZJPL 1L3SA 5D5XB 1VQ6A 2OJ2A 3CG7A 3CZ6A 2YSRA 4H5WA 4CZJA 2IS4A 3DBLB 4LH5A 2R57A 4RB0A 2Q0RA 1LUJB 1ZK8A 1H89C 5LGUA 2DF6A 3A5OC 3P1GA 1Y1VJ 1QVPA 4V2FA 3GFMA 5FU6B 3H0GJ 3LSTA 3OL3A 4EEFG 3WU2C 2P4WA 4EJZA 2QKMB 2CREA 1HNWK 3S2WA 4PK4A 2FHDA 4JJNK 1XGSA 5KAFC 1NYFA 4BRDA 1QQNA 2NAZA 3VEVA 1T0JA 4H03B 2YUPA 4XLNF 3QXEB 1SC7A 1LNXA 1IG7A 4DOVA 5FU7C 3M4OJ 1U8BA 5GANj 4M7AC 3SBGA 5EU7A 4C0DC 3TAPA 4F3TA 3OS0A 3CD6A 9ANTA 2K9SA 5D3GA 3EG3A 2XUBA 1XGMA 1NK7A 2EJ9A 3QBWA 3KPHA 1BR2A 2V8KA 3U9DA 4J9BA 1MU2A 3JR9A 2M02A 3QINA 3UNGC 4NOYA 1U47A 1REVA 2DJIA 1IRZA 1DTTA 1VSMA 4Z4FA 2CH4A 1AD5A 3ZQIA 3QG1A 4XQ3A 2LVSA 2GELA 1LAWA 2GOMA 3V9XA 1K6OA 3DKWA 1Z05A 4BXUA 2A0FB 4LF9K 5KCOA 2BY3A 5DPKA 1PNJA 1N6AA 4H5TA 2GIZA 1ZGJA 1JJ6C 4LF8K 3RQ4A 3G71A 1ONVA 3VUBA 3F2KA 3SZGA 5GMKh 3G6EQ 4YHHK 2LTOA 3DLGA 4Y1CA 3JXUA 2FEZA 4WXCA 1I3QJ 2MC3A 3V4GA 1VA7A 2DL4A 4H0YB 3CCST 3ATUA 4ISFA 1VQ7I 4BRNA 2ZB9A 1AWWA 2YG9A 3EKSA 5KYWB 4E19A 4A3DJ 3EHRA 4F7UE 2YNFA 2Z1DA 3GNGA 4H4OA 5KI6A 4M73A 3ZETA 3FB9A 5IYDJ 4M3ZA 4FETA 4FWSA 2P84A 4KH6A 1VNDA 3M58A 3AO4A 2GF7A 2XPUA 2Z33A 2CO5A 1M3CA 2L9NA 4EMKC 4DTXA 1FBSA 2ZC2A 3FZHA 1QNTA 4DTNA 2RAEA 2VKNA 3OMCA 1G2BA 4P55A 1XMKA 4LB5A 4XIDA 2HKNA 1P4WA 3GG4A 4U7DA 3T69A 2JA6J 4BRQA 1NK8A 2XAQA 3SFIA 1AOJA 3OIPA 1NKEA 3RPQA 2XGXA 2DXUA 1RKTA 1WJRA 3NAUA 3F70A 1B34B 1LV5A 2IW5A 5KYWA 2OA8A 2KJCA 3CPWM 3AA5X 4ABZA 4I6ZA 2D5VA 5EF6A 3OHRA 4OB2B 2VG7A 1YIJI 2GX9A 4B3OA 4KHUA 4AC0A 1SFUA 1GXIE 1CZAN 2CUJA 4D1QA 4JZ4A 4JKGB 5M5WJ 2DODA 3P9IA 1D0YA 4ZGDB 1IG9A 5HS7A 1BR1A 2EIMH 3C6UA 4FJ8A 2PJRB 3CFOA 4HVVA 4BUGA 1D3YA 3CW7A 3CPWS 3A0IX 1AHDP 4HW0A 2DYBA 4P9UA 4FLZA 4NXNK 1U2VB 2E1MC 4DV4K 5IPAA 1IN5A 4IO8A 4WQ5A 2F4VK 1PP7U 2NNNA 4KB0A 5AQMA 3EL2A 3RMQA 3EH2A 4PUSA 1MUNA 2XSJC 2HOSA 4IWVA 1ZN2A 1MDUB 1S8NA 1XS9A 3LL7A 1I1GA 3BROA 1AWCA 3IH7A 2VUMJ 1KQSP 2K3YA 4JKGA 1JXEA 1MDMB 1KEAA 3PL8A 2FBHA 2CGKA 4LG3A 1YWOA 2A3ZA 1HKTA 4DQSA 1LNWA 4HCBA 3E6CC 4D6WA 3BR2A 4OMFB 2D5RA 3VYUB 3EO3A 4RTTA 3QO9A 3VQ9A 3D2EB 1X2NA 3BWGA 1U2VA 5IP7J 3H8ZA 4M7AD 2EGAA 3NTHA 3CCET 1P9QC 2ZGYA 2XASA 4C8QD 1S72Q 1KD1R 1U5SA 3DP7A 4P9FA 2GLOA 3KTUA 2QA4T 2JN6A 2VC8A 2VJJA 2D1XA 3NDKA 1VRLA 3JREA 3G7ZA 1QZ6A 1SKUB 2Q2RA 2EZKA 2CP5A 2XF5A 2R7WA 4KGZB 3SEMA 2A37A 2E8AA 3BF3A 1V5GA 4TSXA 2SEMA 1EJ9A 3G1JA 5GAOm 5GINA 3S93A 1BUPA 1MDMA 4B24A 1V4RA 2Z9OA 4ZGEB 4WWCA 1ZLJA 3VU3C 1ZSZC 2QEXI 2CSIA 3FDRA 3A5MC 3ZT1A 5LGNA 1YHQA 2M2EA 4OIRF 3F8FA 1VQ6I 4JK1X 4DW6A 1O4XA 4CFDA 3MXMA 3CQ8A 3D2EA 4M77C 1RI7A 2GBZA 4M75C 1ENHA 2D1VA 4AH9A 3SJMA 3ZT0A 1BL0A 3KK1A 5HLIA 1YQKA 1SHGA 4MZMA 2P4TA 5GAOp 4NBQA 3R6SA 2E36A 1KD1U 3U3GA 3CMEQ 2F1LA 4BGDA 1IN8A 1I8FA 1EXQA 3HXMA 1YITN 5TRDA 4DSLA 2OTJA 2D0AA 1S1NA 2BOLA 2DO7A 5CYMA 4AFUC 1LPLA 2NVYJ 1ZH5A 4B9VA 2XRLA 3TSZA 3CD6I 4Y28E 4DBHA 3BJOA 3NTIA 1N25A 3G4SI 3FHZA 4MDXA 3DLLF 1U1TA 2JOYA 5GAEJ 5DDGA 4EMGA 1D5VA 3CQYA 4PWDA 4L5JA 4FJIA 2CYZB 1JUMA 3BPXA 1BBYA 2VLAA 4LGWA 3AVGA 1JLAA 4C2TA 1FBQA 4UY8I 3OYYA 1HMVA 2EX3A 1JB0E 4WCEL 5LJ5f 2I5JA 5DTDA 5E26A 3V4IA 1WA7A 1ZG5A 4QSHA 4IUTA 5C24A 2VC1A 2HHUA 4M7AE 2DL3A 3CJ1A 3VOEA 4FL6A 3VQ4A 1FX7A 2OZUA 2X6SA 4L9VA 4C8QE 1W5CC 4M78B 4A62A 4B22A 5F0CA 3DU6A 4XH4A 4F92B 3AA3A 3QRFF 5BRHA 4E7SA 2NLUA 2PFUA 4O0IA 1GFCA 4ELVA 3CCMQ 3MFKA 1SQKA 3GIBA 1AA7A 5GADP 1UJ0A 2OTLA 1E7OA 2NOZA 2XHKA 4JRKA 3A8YA 5TISC 4L9JA 5AONA 5CHIA 2FNAA 2QDLA 3JCMJ 4BXFA 1EFNA 1HNVA 2YLCA 2NVQJ 3GLLA 2P5GA 5H6QA 3JCMX 4DYRA 2CT3A 1LOJA 4FZYA 2DXBA 3E9PA 5E18F 3CCQN 3EPZA 3HSFA 4F52A 2IAIA 1R23A 2EFWA 3BR3A 5EDNA 4E0DA 2ZAEA 1PVSA 4KHYA 1YI2N 2K3FA 2LX9A 4A2UA 3AO3A 3TTFA 3PMIA 3CCRQ 3NCIA 1L5UA 3UKRB 1NLVA 1VQPA 1PSFA 4NQWA 1EA3A 1XUPO 5F1XA 3R3LA 1JGSA 4JDSA 1R0BG 2KE9A 1MKMA 2E88A 5M5XJ 3PNVA 2PMZA 4XRSA 3LAJA 1VYUA 1K8KA 3PVQA 3CJRB 4BE1A 3B6AA 3F8BA 4IQ4A 1K76A 3ZCMA 1WH5A 4RDUA 4RTFD 3VMFB 5FLXO 1VQ9Q 1UGVA 3Q7CA 2EKOA 1R4NB 3SDGA 3FK7A 1GLNA 3N5BB 4FCYA 4DS5A 2JJ9A 1J9AA 3WTUC 3CDLA 1NGEA 1DT9A 2A6EF 1GXQA 1J75A 1BK2A 4JKBA 2ZMEB 5KPRA 4Q47A 3FWEA 3S17J 2FMLA 1IO2A 2EILH 4BU2A 3UKRA 2R5AA 1BISA 2X6YA 4KUIA 4DQQA 1K83J 1QPMA 2AJQA 4FJLA 2I0NA 3HKSA 3NEUA 3C6AA 4EJOA 2BEOA 4AVZA 3IH4A 3GTJJ 1SFOJ 4KH5A 4HCKA 4K41A 2V9PA 4M75D 1GOAA 4JNEA 4C3HJ 2E19A 2H3EB 3GYHX 1I50J 2IEKA 2YSQA 3BR6A 5D4RA 2CU7A 2KLOA 1A5VA 1VQ8N 3GPLA 1FY7A 3HTUA 2Y0SN 2EQUA 4GYIA 1YWPA 2XKOC 2ZMEA 2Y69H 3P5JA 2VG5A 1BJZA 4HKEA 4JLIA 1DGRM 3CCUT 2G8WA 1J53A 3VYHB 2RK2A 1BB9A 2H3GX 3L00A 3ZR8X 4BBSJ 1RBSA 1TWFJ 4IDKA 2LRQA 2A61A 2ELHA 3QYEA 1ACIA 3RCOA 3A98A 4H5VA 3VESA 1WN7A 3L2UA 4M9XA 3JCMV 4FLYA 5CKHA 1ZRCA 4NHJA 1W2BP 2GM4A 2EQKA 1VSDA 1TW2A 5E8IA 4H4MA 5ADXA 3NRVA 2LX7A 1PHTA 1U8RA 3QB0A 1SANA 2IS6A 3PY8A 2OYQA 3EAEA 9ATCB 1K9MR 1WHMA 3TAEA 4XLAA 3VV0A 4NDLA 1YJ9Q 1MMNA 4HCCA 4X0GA 1BW5A 2Z99A 2EYWA 5DK5A 4JN4A 4MHGA 2LCCA 3IAYA 4CEAA 2Y4XA 4BHPA 3MKDA 3EETA 3OMYA 1QWFA 3MD2A 4IIOA 3UF4A 4AU7A 4PY5A 1LEBA 1OX9A 3CP8A 4AM3A 1MGTA 4KHNA 3HOTA 4WFNL 3KLFA 2BGGA 4NLBA 5LRRA 4CJ7A 4BAYA 4I98B 2GWRA 2EV5A 3S32A 3JRHA 3M9AA 2COYA 2R3SA 5B8HA 1EZZB 4M77E 3W6JB 1RAEB 1X58A 4IURA 2ENMA 5HL7L 2VBYA 1R36A 4M75E 5EEAA 4J9CA 2X51A 1C0MA 2O8CB 4Z4GA 4IIMA 1N32K 1NOZA 5LHGA 3I59B 1K9MU 1P8ZA 1W0HA 2VB6A 2F8SA 1D0ZA 3HG9A 2ITMA 4BC3A 1FK9A 3SMSA 2DA3A 1D9FA 4PFZA 4DG1A 4ZN3A 4OAYA 3J80K 1J5OA 4KHPK 2DMTA 3DWLE 4CI0C 4FWRA 3C6TA 3ZSRA 4BG9A 2NRTA 4L5IA 3L3UA 4JS5A 1XTDA 2XIGA 3LOCA 2H3JA 3OYIA 3K70D 1NG7A 3EFRA 5GAN4 2MF2A 2K7AA 4CHYA 2E65A 1L0OC 1NU0A 3CC4T 4IDHA 1NJIR 2AKKA 4XL9A 1WHHA 1TW3A 3F3XA 1A5XA 3OSFA 3PVLA 4DUZK 1E17A 4PQUA 2DA2A 3NH2A 2CUFA 2FLOA 2O8CA 2DPNA 5ICEA 4LLGF 3TR8A 1R8OB 1RR7A 4B4CA 1Q18A 4IHYA 1NMDA 4CICA 4XKBA 4HLYA 5JLHA 3ESWB 1KONA 4U0WA 3NF8A 1EKEA 2E41A 3CCEI 3VQ5A 5FU7B 5IHKA 5DD4A 4AHUA 2OV7A 3K0SA 1K79A 4C0DB 1OZ3A 2QA4I 4YOYA 3UA6A 4B47A 1N8RO 2DYRH 2M0CA 2RI2A 3EGXB 5DV5A 2GBYA 2CH5A 5J1YA 2FMYA 4AIAA 4MDWA 3UKUB 4CZFA 1NJWA 3WHCA 4FISA 3QDKA 4WFBL 4U67L 3N4QA 1N3CA 5C44J 4E7LA 3VS2A 3QWLA 3E9GA 4K42A 3NHNA 4CFAA 4ENNA 5E1WA 3Q0VA 3KP4A 4CHNA 3GLXA 5GANd 3KYLA 3HOSA 3ASMA 3CPFA 2L7MP 5GAEP 5HRSA 3JB9F 1C1CA 2QSGX 2PYJA 3MN7A 3AL0C 3R4KA 4S04A 2IRFG 1I81A 4M7AA 3ZQ7A 1TQMA 4PHTX 5F6FA 3AVLA 1ZELA 4ENMA 2OPQA 3LH0A 2KP6A 4XN0A 4FJKA 3JTHA 2TRTA 1S7EA 5IYBJ 1F9NA 3EGXA 3PNWC 2KIQA 4MQ3A 1O3RA 2BUDA 2MLKA 2P6SA 3JAMO 3UKUA 4PUOA 1KZHA 1J5YA 5DUIA 1HQCA 1UJYA 2DXCA 2BBYA 1X6OA 2E2IJ 5B66C 4XTUA 4B3RK 4EMKB 1MMSA 3RMSA 1RBTA 4S0HB 1LAVA 5LJ3j 3QYFA 1AWOA 1P4AA 3GFLA 1VAZA 1HSJA 3TAFA 3H45C 1UAAA 1VI0A 3Q0WA 1YITA 1Q1HA 2IVOA 1Z3XA 5F04A 5FKOA 4HT9A 3A03A 1HF0A 2HVQA 4NYFA 2FBIA 3GNFB 4HX8A 4C3IJ 2E1HA 1R59O 2WAQN 3NFAA 4IRHA 1X9SA 3K57A 3K4LA 4N4GA 2QWQA 3OIOA 1IXSB 3F9MA 2EWSA 4GYGA 4F16A 1PP8F 2HSEB 1JUSA 3WEEB 5IP6A 3SQNA 3X20B 4BWJA 4BC4A 3LSPA 3QKJA 4K8XA 3I5SA 4CECA 4E7HA 5AQPA 4EW4A 2K40A 4D8DA 1QVFP 4EMKA 1XJWB 2A42A 2EJGA 1VQ8T 5LJ5g 3NPFA 3WTSC 1RT5A 3SAHA 3GTMJ 2A3LA 1Q81R 4QT7A 2KGTA 2O8XA 3G71T 2CMPA 5BS6A 4OVLA 4GKJK 4B48A 3AT1B 4EAHD 3TCJA 3IH2A 1PM3A 3K4KA 2E1MB 3FBNB 3PTAA 4EA5A 4Q5WA 4FVMA 4XEIA 3CCLA 2E2QA 3SWNC 4UB8C 3MEAA 3VA0A 1WXUA 4HOBA 2ICWG 3K1MA 3CC7Q 2XD0A 5ELZA 2LP5A 4PL8A 5A0LA 4JI1K 2BW3B 1NGNA 3WEEA 2LNBA 1JXBA 1B9NA 1RC9A 5I22A 2RNJA 1W5TA 1HYSA 1TL8A 1N9SA 4C23A 3G6EN 4C92D 2FOWA 2KW4A 1Y71A 4C8MA 2HVSA 4IFEA 1ORNA 2IIRA 3Q3SA 3O8GA 3ENBA 1G59A 2DMOA 4OP0A 1PRLC 2ELKA 3MMYB 3CCQA 1OPKA 3VODA 3GEZA 1V76A 1QA6A 1R0AA 4QPOA 4CZGA 4JYAK 3OTOK 1KYWA 1YCSB 7AT1B 4KN7X 1WSUA 4AILC 5DUKA 3PUBA 2KQWA 2VJ5A 3THVA 4IHXA 3DLBA 1QE1A 5EEHA 4RGRA 1OEBA 2QKKA 2LDUA 4CGHA 3CJCA 2DPPB 3V7CA 2R4GA 4QPQA 2DTUA 5GANe 2L3RA 1ZQ3P 3H9GA 1SHFA 1EO1A 3KLIA 5LEJA 2PJPA 4JEPA 1NHAA 4Y17A 2P8TA 2RK1A 3E1SA 2Q36A 1R77A 4A57A 5GJWB 3PIPF 1BI3A 4A3LJ 1X3WB 4RA2A 2O03A 5CVIA 5IY5H 3CCYA 1L3LA 2QAZA 4M77B 2XAHA 1X2KA 4DS4A 3JRCA 1D4XA 4DLGA 2ECZA 4DGWB 3E97A 4KH1B 5HCKA 1ILYA 3CERA 1VQOQ 4C30A 3MWMA 3HOUJ 5GAHP 4BI3A 3TQNA 1SD4A 3DF8A 1EWQA 3SMPA 1VQLQ 2CSQA 2ZE2A 4NO7A 4ISEA 2RN2A 1CXQA 3SUQA 2PQWA 2L4AA 4BQOA 3KBGA 2AZVA 1Q82U 2WV1A 1EQYA 3P31A 1GLDG 4JKFA 5HDGA 1ZSZA 2IA2A 1PWTA 4AIDA 3NVMA 4HTUA 1UGSB 3BG6A 2P9IB 4OWRB 4DNCA 4CZIA 3DU5A 3X28B 3J7AF 4M77A 2Y0SA 4LDXA 3EZWA 1Y1WJ 3X25B 2J06A 4M75A 3E2UA 1FWZA 4DV7K 2CQ7A 1XGNA 2GXAA 1K8AO 4DV0K 4M78F 2M1HA 4IFYA 4ELZC 2K85A 1ZBUA 3NH1A 1J6ZA 4CF9A 3C94A 3S3MA 4MO4A 3AFHA 4G6QA 4RB2C 1DU6A 1O1WA 2ABKA 4LC9B 3DWLA 3VA3A 2RO0A 4YDUC 1NK0A 1S72N 4NC8A 2K3XA 4Z4HA 3SDZA 1E3PA 1QQOA 4LD0A 3M5AA 3E3VA 4BDZA 3NNQA 4JUVA 1SSHA 2E5QA 3LWLA 1XB4A 5E3LA 3AVNA 3CC2Q 2Z1IA 1KYZA 3FEOA 3DEUA 1NGAA 2F7TA 3KP5A 4TV7A 2XHCA 1IB8A 2P1JA 2MD5A 2L54A 4EM0B 4OFHA 2NUZA 3CIPA 4Q5SF 1TWBA 4XM3A 4UC4A 2IS2A 3QOEA 2FRHA 1C1AA 3U4LA 4CK1A 4FLUA 1UFFA 4N9HA 1GCPA 1D09B 2ZSHB 5L3DA 3I55Q 4MTDA 1Q1VA 4KAZA 1VQKT 2E5NA 1HU0A 1YITI 2HTJA 1KQ9A 2EKHA 3HRTA 2PVDB 4CRIA 2CQNA 4EVIA 5FW9A 4DCHA 3HSEA 4X62K 1ZQ1A 3OYKA 1XX5A 2IVWA 1AU7A 1Y8RB 1RADB 1KQSM 1PU8A 2ZJQF 3CMEN 3GWZA 2YNHA 3DXMA 3SUPA 4NZGA 2NYSA 4EVVA 3C6HA 2KQ2A 1MUDA 4E9GA 3HSRA 2H1LA 1YUWA 3FIWA 4G8XA 1SKWA 3QEXA 3VQBA 2KMTA 2O31A 1BA1A 4M9SA 1YJNQ 4BHBA 1JQQA 1TL1A 4JI0K 4RTUA 5GAOq 3LWMA 1JLFA 3F23A 1USSA 1KVCA 5E17F 2ECBA 1IF1A 1HK9A 1MV0B 2BZ8A 2CJJA 3LSHA 2ESWA 3HEFA 4KHQA 1OVYA 3T8TA 4MO7A 3DB3A 3O3FA 3LPUA 4AFZC 1OH8A 1NGGA 3DLHA 5E3OA 5IT9K 3BF1A 1SPKA 1X3MA 2HMIA 4IPAA 4F3QA 2HR3A 3OGDA 4J9HA 3I56Q 2DU9A 1Q7YC 4IRGA 1NPPA 2X4XA 2CFXA 4H8KA 4HPQA 3ZBDA 2GIVA 2QKBA 3EY1A 1WVRA 1C0FA 1OYXA 2E64A 4KB1A 3O9TA 2HU9A 4CHOA 2MG4A 4M3RA 3CCMN 1WJAA 1H9TA 1IZ6A 1I94K 1ASWA 4NNJA 3S1NJ 4OMMA 1WAFA 2MMPA 3F22A 4I6MA 5T7BA 3CCQI 4DU1A 1CF7B 1UG0A 1AZEA 3LP1A 1YI2I 1HKQA 4M3EA 1G6NA 2UYTA 2FZGB 1RDAA 1AKHB 3F10A 4M7DG 4FT4A 3KIOA 3ZX2A 2ACJA 2MCNA 4BI4A 2R92J 2L7KA 1JT6A 2FE3A 1WGXA 2MI6A 2V52B 5KNLA 4GV3A 3MO8A 2ZCWA 2Y48A 3FMRA 4I0BA 3IUOA 4EPCA 4BRCA 3R60A 3OYDA 3CCRN 2UV1A 3KETA 4FK4A 1VQ4A 1BO5O 4Z02A 2HS5A 4R79A 1K1ZA 4A63B 5EZGA 3FM5A 3HJEA 2WTUA 3J7YJ 1CF7A 4J9FA 1TNTA 2YS9A 4UXNA 3M4YA 2XKOA 4BY6B 1NG2A 4A4HA 1GBRA 3HGYA 3U1DA 4ZN1A 4OMPA 1AKHA 1P7JA 5FLXZ 1FYMA 1VQ9N 3VEWA 2FQ4A 4CBWA 3H35A 3BG5A 2WSCE 1O3SA 3O6WA 3GXOA 4OPHA 3RKQA 2NNWA 3PFSA 3PO3J 1A31A 1OPLA 1QQCA 4RW6A 2NUTB 1KU3A 3A0BC 1X6BA 5JVHL 1B72B 2YUNA 3CLOA 4DSFA 5CY4A 3NTKA 1ZUUA 2AKLA 3CQTA 2B9SA 1WJFA 2CZ6B 1M3QA 3I8BA 3ZMSA 4M6XA 3C95A 4YG2F 1VQ8I 5KN9A 3EUKL 5D6FA 1RESA 1LFUP 1OCZH 5KE2A 2GCXA 2HBPA 1CQTA 1IN7A 2O3FA 4P5NA 2XKPA 4RW7A 1R5HA 3URGA 1U49A 2NWMA 3VW4A 1ZUKA 3TSQA 2KIMA 2D1KA 1HLUA 4BEHB 1K7AA 1NK4A 2X1DA 2NUTA 4CJQA 4CJUA 3HKZN 2COMA 1B72A 3E5QA 1MBFA 4AM7A 3RTVA 4FM1A 3REOA 4IHTA 3CCSQ 4R0KA 4FK2A 3DLLL 4KMUX 1JI8A 3A8GB 1T3LA 3PM1A 4KKOA 5CR2A 4FLTA 3QODA 1B3QA 5IHIA 2JA8J 4L18B 4IJAA 2W48A 1TGOA 2NYXA 1F4KA 1O9SA 3EQLF 1H92A 2DBKA 2N8GA 2DAOA 1OULA 2PBIA 2DA7A 4XTVA 2B8AA 3M0QA 4FSVA 1R71A 3PX4A 5BR8K 4FVUA 3JB9I 3I4MJ 1GHCA 4YOVA 4KV8A 3GX4X 1S72T 2JWKA 1VSEA 4QS8A 5KCHA 2NRZA 4BEHA 3IL2A 5JMVA 2QK0A 1YJ9N 3IAM2 4IL6C 2BXZA 5KPZA 2RQVA 1YX3A 2DILA 2ZFWA 2VKHA 1M8MA 5LJ5j 1VQNT 1UJ8A 3ABMH 3K69A 4RTVA 2MAMA 4Q0BA 1LB2A 1SRLA 1JO8A 3KZIC 5EOYA 1TT5B 1VRTA 4F93B 3ZL7C 3RQIA 1B4AA 5LLQA 3PUFA 3GFIA 1X1DA 4OGEA 1KSPA 3PX6A 4YFXF 4OGCA 1QCFA 1GFDA 2F5TX 2CSOA 4U7BA 2A1RA 3J7AO 2LOOA 3EKUA 3TKYA 3AL0B 4DIQA 3UT1A 2AO9A 1FOXA 2CH6A 3WODF 2M8EA 4FSXA 5GPAA 3DPLC 2ID3A 3VENA 1OMIA 3R9PA 4PGGA 3K10A 1LWWA 4Q4ZF 3GP8A 4PSXA 2FL7A 2F2EA 2OPPA 5AIPA 3M0UA 1N8RU 3U6FA 4IF4A 2JMWA 1W2BM 2R5ZB 5LL6S 4QVCA 1HD3A 2WTEA 2E60A 2F4IA 1JLQA 5LBQA 3J7ZI 2XG8D 1YOVB 1DGKN 1IBLK 4QCLA 4BR0A 1U2WA 4F7ZA 4R1HA 3SXYA 1W1WE 3ALYA 2G7HA 4OMZA 2VQHA 3K1NA 3AARA 4B21A 4XH1A 5F0XA 2RN7A 2M30A 2L3SA 2DDAA 4A61A 4A4EA 1OQYA 5F2RA 3VGMA 3I33A 3OH9A 5CVVA 3WG7H 3IFRA 3BJ6A 3LL3A 3KZZA 4KN4X 3DXKA 1NTCA 3CEYA 3ID6A 4IEIA 3K4JA 1ETYA 2Q3SA 3M6GA 1YW8A 3S6IA 1E0EA 2R5ZA 2QA4Q 1Y0MA 5E1XA 2P0PA 1JCFA 1NOYA 5FKMA 5EGOB 4XK4A 3QPSA 3W2VA 2JT4A 2KR3A 3H9QA 1H9GA 1S3JA 3H3ZA 4ZYEA 3JCMQ 4FE4A 4M74A 3QQAA 2BH1A 1TWCJ 2Z5UA 4XKVA 4LNPA 1SZ2A 1HNXK 4JPBW 1IH7A 3SHWA 4ZH4F 4MZPA 5FDLA 2EBPA 1G3SA 3N05A 2LT1A 3SQ0A 4FL9A 3ID8A 1FOKA 1ZBXA 3BOQA 3ML6A 4OB0B 1VQ5A 4DTRA 2VWJA 3QEWA 3BUZB 3CF5F 3DYAA 1OQKA 1K61A 4LDYA 3H92A 3THWA 3K58A 1IGNA 4M3UA 1NKCA 3M8SA 4FT2A 2R7XA 2FX0A 1F5TA 4ICLA 1PG5B 1YBYA 3MQ0A 4DA4A 3GBQA 2KVQG 1M2VB 3DTIA 4FXDA 2NOLA 4DHYA 3TSWA 2JTVA 3RSEB 3EUAA 2NOJB 1IJWC 1TAQA 3JAMZ 2M1BA 4JZ3A 2HQEA 4IOCL 1U0JA 2WONA 3L2QA 2PVOB 2K9MA 2HL5C 1K73O 2YLBA 4CC4B 1IGUA 1BU6O 3MWPA 2EFNA 3QWYA 1MBKA 1QGPA 3SWNA 2VWKA 1UGQB 3LWHA 2XV4S 2O8EA 2CWEA 4PJOF 4J7FA 1GLLO 2YHBA 3S1RJ 1ZBSA 2M9HA 3M59A 3CMEA 2Q8KA 2WAEA 2YJFA 3CM5A 5ERIA 3DOKA 3D2FB 5J2NA 2ETHA 4EMHA 1RAIB 3D1NI 3OMGA 3CJ9A 3O6BB 1K4US 1M2VA 4I09A 5C42A 3WTXC 2KK4A 3SBTA 3H41A 4M77F 2J5PA 3ZT4A 4NCAA 3RSEA 4J9DA 3HT3A 2QWRA 1TKZA 3SQ2A 2EYZA 1PVEA 3OL4A 4AM6A 1KFDA 4NB5A 4QLCU 3CCLT 4LSLA 4KTQA 3KKRA 3O3HA 1NK6A 1XNQK 4LY7A 5AIQA 4P1WA 4LOCA 3VDXA 2JNGA 2JVVA 4BE2A 3OS1A 1DDNA 2DZCA 2GUPA 2HHSA 3BR0A 2QTVA 2KKOA 4YTLA 3G6EI 1B6AA 4EIAA 5IP9J 2JS0A 1K6YA 2G8FA 2NRVA 4B23A 3CCMA 3H08A 3A4CA 2CS7A 1DPRA 2EINH 3KP3A 5JLXA 1D1BA 3RI4A 3HOWJ 4RB1A 2FSWA 3INZA 4LMYA 3CC7N 5J4VA 4EJYA 4CEDA 4EJVA 5LJVA 4M7DC 4CCKA 3M0RA 2LKSA 3DLMA 1E3OC 2GQVA 3CBPA 4N4IA 1VQMQ 2IGIA 3KP7A 2CFOA 3LPTA 5HVQC 1EF4A 4RMOA 3THYB 5D6EA 2HNHA 1OLTA 3M57A 1IJJA 3HSCA 2ED1A 3TP3A 3NGPA 2KZVA 2P9SB 2E7WA 2RHZA 1GDTA 4DYQA 2F48A 1QMCA 1I39A 1KTQA 3OQ5A 1AZGB 3JRZA 2LC2A 3SK3A 1ORKA 1X4OA 2XGEA 3L2ZA 3HPOA 4CYCB 3CCRA 1Q9YA 3HO1A 2HKQB 2UWMA 5HROA 3SV4A 2VQCA 1POGA 3TBIA 1ZREA 2GXGA 1TL3A 2A40A 3A5ZB 1I6XA 3DLAA 3WVDB 4FYYB 2LDMA 1SUQA 3W3CA 3K0LA 3CETA 2DRKA 3CJQB 4BY9C 1QSLA 1EH8A 3GVAA 1NNEA 2FSJA 2HNYA 2XAGA 3E6BA 4UV8A 1VK0A 1SS6A 1QSYA 1EP4A 3THYA 1VQ9A 2DBMA 3H0IA 1YIJN 5MLCQ 3PSIA 1QW1A 4H5NA 1K8AU 1TK8A 3UPUA 2VXFA 2P9SA 4QQDA 3I0TA 4RCBA 3HK2A 2FZCB 3AAQA 1QVFS 2OZMA 2DVJA 1O7LA 3ZCOA 4OMYA 3KXTA 3IHUA 4U0VA 4CYCA 1PKSA 2MOXA 4YDUA 1VSIA 5EXWA 4DSJA 4FW2A 4HRIA 4F3OA 3KCCA 4IHSA 4LFAK 2HGCA 4A3MJ 3FZFA 3PT9A 2LJ0A 2EW3A 1VQON 3RRGA 2AQFA 1T05A 1D8KA 5L3EA 3CCUQ 2P9KB 1T7PA 2F96A 5GMKj 2QQSA 2OZSA 4A5BA 2DA6A 4CUGA 5IOYA 1WEGA 3QESA 4DV6K 1VQLN 1WPYA 3WNGA 4UNFA 3B73A 3CYMA 3Q9SA 2JK3A 4YFNF 4R56A 3FFKB 2DMNA 4JK7A 1KU9A 5CQGA 3G25A 2VE8A 3NMZC 5DCFA 2M51A 4BUPA 4JRIA 4CEZA 1IRFA 1FKPA 4RW8A 3I9QA 1NK2P 2BE2A 4E9FA 4KFBA 2E70A 2RQRA 2MA3A 2ZJ2A 3S16J 4UVBA 3MXJA 4K0KK 3F9KA 5JLWA 2XICA 1S72I 2X6NA 2V1RA 3O08A 1RNLA 2KT8A 2CS3A 3M8PA 2ASOA 4JI7K 2P9KA 1I1JA 5I2SA 5HNFA 5GJVB 1TYQB 1Q82C 3T7ZA 4ZNXA 3FKJA 2JUGA 3VQAA 1MNDA 4G7ZF 4BD3A 1WHLA 1K78B 2LMDA 2OC6A 2HDCA 2CZ7B 1APLC 3SFZA 2OD5A 4KRFA 3G1MA 3QSUA 4LUEA 2OF7A 3VYRB 4AT1B 3HC7A 4KT5C 2WWYA 3CC2N 2ZPBB 3Q5FA 4FPBA 1UUEA 2BZYA 2XY6A 3NE6A 5CQYA 1KQJA 1XTAA 1TOVA 3OW2A 2ZKZA 1G4DA 4AUXA 5GAOr 3CMEI 2V51B 4IEJA 5F0FA 3I55N 1RDCA 2HHQA 4B9LA 4XTXA 2K9NA 2C06A 1TKTA 1FOYA 1BWFO 5L23A 1K78A 1ACMB 1QVFA 4R8HA 2XC7A 1KG7A 3VQ6A 4B9SA 2X48A 3VB2A 3CCVA 2R58A 5M5YJ 2JUCA 4ESFA 4M3TA 3M0SA 3RNJA 1GOCA 1JCGA 1WOQA 3VQEA 2O01E 4GVEA 2G8IA 3DV8A 4RW9A 3MKZA 4YNQA 3P9CA 3O8VA 2BUPA 2DM1A 2WADA 5FB2A 1PKTA 4XBFA 1O13A 3HBTA 1MZBA 3CC4Q 4D9JA 1WJDA 3QIOA 1CLQA 5D5UB 3CDIA 3P39A 4N4HA 2PMUA 5CVUA 4OPAA 3FJPA 1X01A 5AQIA 3MEVA 5AJ3K 1YJNN 4K8ZA 3META 1L3UA 2JRTA 1RT6A 1BBZA 4AHTA 3R0JA 3N97A 1OVQA 1KSWA 3BY5A 5LY3A 4FWKA 3J81O 5JICA 3PIPL 4LD6A 1QRYA 4J8OA 1RRSA 2RQQA 3CCMI 2E6ZA 4CJEA 1IDYA 4CJPA 4PKIA 5H20A 3I56N 3EG9B 3RKXA 2XDPA 5KYYB 3LDPA 4M3YA 5EYRA 3B6OA 1O57A 5M9OA 4XLHA 2SRCA 1U45A 2R7SA 1Y64A 3QFUA 3V81A 3ITHA 1C6VA 4ZZLA 3RMBA 3ZQHA 4ESRA 1X27A 4EV0A 4LDVA 2GXBA 1RDDA 3HRGA 2P5OA 5KK1A 2D1HA 4KYWA 5CZ2A 2KFDA 3RESA 4JI6K 1J2XA 3WTVC 2JA7J 2W03A 1VQ4T 2FXUA 5LJWA 4JJCA 3H46O 3ENOA 2BGCA 2EIKH 1R1UA 3CCRI 1WJEA 2HXOA 3F8CA 2O4XA 4M7DE 1QVTA 4BVOA 4I9LA 4CK2A 1WHKA 1X43A 4FWOA 1GVJA 1HSQA 1JCEA 4H4KC 4C5IA 3M1CA 1M9SA 1KAYA 4MFBA 3EG9A 1Z1DA 3HHTB 4NYNA 4DV2K 3PGGA 1YJWT 3KP2A 4IO9F 4FW1A 1K4SA 3FZLA 3P8BB 5E3MA 2HCKA 2O4IA 4BR5A 1I1SA 5DM6F 1Z77A 2BZXA 1IAWA 5HODA 2D4WA 2IC3A 3V1RA 1VQ9I 5H6RA 3FZKA 4DLEA 1V29B 2KDOA 2CP6A 1U84A 3NQOA 3VEXA 2HNZA 2RV8A 3OSGA 5A2QO 2X3WD 3EN9A 1AOYA 1A5WA 1M90O 5AQWA 1FNNA 5AN4A 1ZX6A 1KFZA 1YW7A 2OQRA 4DF4A 2YKMA 4ZGJB 2D9TA 4X9DA 1AEYA 3OYEA 2DA1A 1U9NA 5DLOA 2QWPA 5AFUH 5C4JJ 2MK5A 5KHDA 2YX6A 5M1OA 2E1OA 2QK9A 2K5CA 4Y15A 3GTGJ 1BI1A 4DEYA 1N77A 2VJIA 3CWSA 3NWTA 4G6DA 1NWKA 3G71Q 2R5YB 2QQ9A 3ZMTA 4XQFA 1KG4A 4QAGA 4GDFA 1A0NB 4IQJA 2KZMA 4DB3A 1Y96B 2P9LA 5LFAA 4FT8A 3BE3A 2BVMA 3ZEUB 2DJQA 2Y30A 3T1AA 4KRTA 2ZJQL 1A6IA 1G2HA 1Y8QB 2DPUA 4PL6A 2LLKA 3ULEB 5HLHA 1MJ9A 1OR7C 2VBXA 2GV9A 2DFIA 3C18A 1PU7A 5LJ3f 1YTUA 3QDFA 2HB5A 5KQDA 1DUXC 2HBLA 4HSRA 4I2QA 4II2A 3BDPA 2DXTA 4XMYA 4AD9A 2IVPA 2CGHA 2DX1A 4BL0B 2M0OA 3MHXA 2YG8A 1XQSC 3CCSN 2YI1A 2P4RA 1EH7A 3DBHB 3QP6A 4MFEA 1BCOA 1NGFA 4PJJA 2ZXIA 2QGUA 1KVBA 4ZYAA 4DU4A 5GAN2 8ATCB 1RABB 4XU1A 3VS7A 1MHNA 3UA7A 2R5YA 1DTQA 4H0EA 1YJ9I 4J2EA 2L3QA 3O4WA 4B1XB 1KIKA 1N27A 1S22A 1M30A 1XG7A 1STZA 3ZEUA 1NJZA 2A05A 4O6JA 2GTOA 2W41A 2O6GE 3W2AA 2PI0A 5L3CA 3WNFA 3C1DA 4JOMA 1ESVA 3ULEA 3MEWA 2RI3A 1LDDA 4CFBA 2PMHA 3MZ8A 1B7TA 4B08A 3S2DJ 4CW7B 2M4GA 4BDYA 2R7RA 5FLMJ 2X4HA 2UUBK 2VT3A 1WJ5A 2QTDA 2CGJA 3A01B 1WHUA 3UKGA 4MDBA 1V5FA 4HEA2 1J3TA 2LSNA 1Q86O 1RRJA 5DM7L 4EP4A 2WC9A 4CGJA 4PKGA 4B6MA 2OQGA 3AGKA 1YNZA 3H6ZA 1KA8A 3DLEA 4CGFA 4HA8A 3O5ZA 4FIBA 1HPZA 1RGIA 5HOOA 4DTPA 2F4OB 4IX7A 1KGSA 1T8EA 4HDVA 1OYIA 2WB1A 1XSDA 2AIRB 2O8FB 1X3UA 2KSSA 3GUDA 2P7CB 1J5EK 4MEYF 5E20A 1LW2A 1XI1A 4IXCA 1VSJA 1NLPC 3HTVA 3HVRA 4C8LA 3T5XA 2RGVA 2OFKA 1BI0A 1WJCA 3HFNA 3A01A 1QU3A 1YIJA 2JGUA 4HX4A 1JHHA 4OIPF 1SD6A 3GOXA 3L2WA 2ELJA 1GVDA 4J19A 2E71A 3HB9A 2VG6A 4WXDA 4A3IJ 3R6OA 3JB9G 1WSIA 1YJNT 2CG4A 3L09A 3HP9A 3CJ7A 1G5VA 3KYCB 4HG2A 3S6WA 1HRHA 2ZNYA 2O8FA 1SVOA 2P6TA 5D5WB 2WSFE 2DL8A 2HPMA 4KUMA 3IHOA 1XSVA 5K7ZA 2IIMA 2ZM6K 1LCKA 2O8DA 4GBQA 4FM2A 3FXMA 1N8RC 3VPRA 5LJ5e 2WY7Q 2QASA 1YN8A 4CZKA 2WACA 3M3ZA 5D6WA 3CCEN 4XU3A 5KTQA 1Y39A 2VYPA 2V75A 3OYFA 2UUZA 4IUUA 1YHQQ 2D8HA 5HP1A 2QA4N 2VPRA 4C0FA 3HOZJ 1W1FA 1NK3P 2HSTA 2J7IA 4ID5A 3CM6A 2L8DA 4PL7A 1CZ9A 2EVRA 3HHGA 2JHJA 5LGTA 3TO9A 3U21A 4B9QA 5D8LB 2KZGA 2H6BA 3MXIA