3OYMA

Crystal structure of the pfv n224h mutant intasome bound to manganese
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oymA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oymA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oymA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oymA03
3QETA 3NDKA 1KVBA 3AVFA 2OZSA 4C5HA 1TL1A 5CYQA 4DFJA 5KRSA 4GY5A 1EKEA 4HVJA 5J26A 1MHNA 3ASKA 3TI0A 5D6WA 3MXMA 4FJ9A 1NJYA 2G8VA 1JL1A 4FJLA 3KD1E 3DYAA 4B9WA 1RDAA 4QAGA 5FRMA 3ZT3A 3DMJA 3L2VA 3L3UA 4WE1A 1RT2A 3DB3A 4CFCA 4DS5A 3QIPA 4CIEA 3NF7A 4J2AA 4NS5A 3QESA 3V1QA 1UWBA 1NKEA 1C0MA 2PZSA 3P1GA 4DTJA 5KH6A 4Y1DA 1G15A 3TABA 1WNSA 5KGWA 2D9TA 1RT4A 3RRHA 4C8KA 2Y1JA 4Q5WA 2G8IA 4IDKA 2MWOA 1X1PA 2ZQBA 4K8XA 4FJKA 4OLAA 2X35A 4OLBA 4H4OA 1IH7A 2BGGA 3M9QA 4IUTA 5HRSA 2PY5A 3DLEA 1HYZA 3HVRA 3DRPA 4CJQA 1BQNA 1NJXA 1N27A 2P5OA 4A4EA 1CLQA 1S1XA 3OB9A 3VA0A 4CJLA 4DQQA 1WJQA 4DU3A 4FJXA 2BIVA 1NKBA 1LWFA 5J2NA 1IKWA 4FXDA 4IUUA 1MU2A 1VSJA 3G10A 3ME9A 4KPYA 2YNGA 4O5BA 4QOZB 2F96A 1Z25A 3AVBA 4DTMA 3HPHA 3OJUA 1RTJA 4BE1A 3SUQA 3M8RA 3HM9A 4F2RA 3LGLA 1WAJA 4CGFA 4N4IA 2LDMA 4DWIA 4FL6A 4FM0A 1WSGA 2M0OA 1RTDA 3PMIA 3L8BA 1KRPA 3QINA 3C6TA 3OYEA 1N6QA 3I0SA 3P8DA 1KSPA 1SKWA 4A4GA 1IO2A 1TK5A 1WGSA 2RHIA 2B4JA 2BANA 4RW8A 4II1A 1LAVA 1HMVA 2HHTA 3LALA 1WSEA 1TAQA 5HRRA 1JLCA 3AO1A 4CIGA 1CZBA 3SQ4A 3OYFA 3OVNA 2MWPA 3AO3A 1JL2A 2QQRA 4AHCA 2D0BA 3V1RA 1H3ZA 2LVMA 1BI4B 1S6PA 4X34A 3WNGA 2X74A 1S1VA 1GOAA 4CIFA 3TWHA 1VSKA 3KLGA 4DSFA 1LAWA 3LAKA 3VQQA 1BCOA 3DRSA 4IUQA 4QQGA 1OZ2A 4FLUA 4W5NA 1C0UA 1U4BA 4L59A 1LV5A 4B9VA 3F70A 4H8KA 4R5PA 4AHUA 4EP5A 2HHQA 3VQ4A 1U48A 4W5OA 1KLNA 3IAYA 4NCBA 3VQ8A 1QTMA 3S6WA 4DTXA 3AA2A 3P83D 5J2MA 5CYMA 2LTOA 2VG5A 3OYBA 4M3YA 1ZBIA 1T05A 4PA1A 4NYFA 4OKEA 3RMDA 3KLIA 3LGFA 1KVAA 4A4HA 3PX0A 2X6SA 3QEVA 1T03A 2R5MA 3V9SA 4DTPA 3T1AA 1WSHA 4DQIA 4QQ6A 3OYLA 4ID1A 4YNQA 1KCFA 2EHGA 4JS4A 3CQ8A 1IKXA 2Z1GA 4GMJB 3NBPA 3S3MA 4OKKA 4CJPA 2O4XA 3CYMA 3VA3A 4KV8A 3PO4A 4ELTA 3ZT2A 4E7KA 1VSIA 3MAQA 3NH1A 4FLZA 4KHSA 4B9LA 2QKBA 2RKIA 1WN7A 1RDCA 3O8VA 1Q8IA 3V1OA 4IKFA 4FLYA 1S5JA 3DI6A 1DTQA 1TGOA 2P5GA 2XK0A 4CHQA 3CFRA 3V9WA 3PV8A 4BDYA 5J39A 4IFYA 3MXIA 4IFVA 4FYDA 4FU6A 1UOCA 3MEEA 4F3TA 4FK2A 1IKVA 4DLGA 4NYNA 3RMBA 4W5RA 3P8HA 4FM1A 1NOZA 1RTIA 1EX4A 4Z4IA 1JLQA 4CECA 4OGCA 4EDUA 4CEEA 4N4HA 4HCZA 4E1NA 1NK5A 2XRIA 3ZSXA 3ZSOA 3QEPA 2DFEA 1RT6A 3LP0A 4B9XA 4CJRA 3L3VA 1X9MA 2B6AA 3L2RA 1XNIA 1ASUA 4FW2A 1HNVA 2RN2A 3C94A 2RHZA 4HUFA 2EKOA 3LWLA 2GBZA 3HT3A 5KTQA 3CEYA 1SL0A 4CRIA 1ZBFA 2HB5A 4JRPA 1J5OA 3NGYA 1LW2A 3KTQA 4XIUA 1TKTA 3CG7A 4FJ8A 2QKKA 3KUFA 3I8DA 3PX6A 1Y97A 4BWJA 4Z4EA 1BIUA 2DIGA 4CJ5A 3AVJA 5J2QA 3NGIA 1BGXT 3EZ5A 3QEXA 2RHYA 3LLRA 1Q9YA 5JS1A 1S1WA 4BDZA 4OVLA 4O0JA 4Z4FA 4DG1A 1QQCA 3QO9A 1SKRA 4N47A 2KZZA 3MXJA 3VQAA 1RCHA 4FZYA 3RR8A 4HHTA 2X4YA 2YHAA 4OPJA 3OS2A 4CF1A 2P51A 4CK3A 4CF9A 3VQ9A 1FKPA 3NGZA 3M8SA 1NJZA 3HP6A 4KI4A 3KKRA 3VQBA 3RWUA 2W42A 2X4WA 1NK0A 3ZT0A 1F21A 3TAFA 3OJSA 4C5GA 2HQEA 2OPQA 3L2WA 1WJRA 3RR7A 3AO2A 5D6XA 4N5SA 3HK2A 1HRHA 3OQ5A 1B9FA 3OMCA 3QEIA 4DF4A 2Z1IA 3QKJA 3KK1A 5C24A 1X9SA 5SZTA 3TARA 3V9ZA 3OYNA 5HROA 5T7BA 1LW0A 4MFBA 4CGIA 4F3OA 2K3XA 2GF7A 3SQ0A 4IG0A 2EQMA 4CESA 1UAXA 4FVMA 1SL1A 3IRXA 1RBSA 3S9HA 1RT7A 2HQXA 1D9DA 1SL2A 3MEVA 2YRVA 1XI1A 2DTUA 2KTQA 2ETJA 4AHVA 2G8KA 1RILA 4J2BA 3B6PA 1NK8A 4Z0UA 2QQSA 2O4GA 5C25A 4FJ7A 4ICLA 4M41A 1WLJA 2VG7A 4DSLA 1HQEA 3VQ5A 4FLVA 3AVHA 5J2PA 3A2FA 3SZ2A 2OPRA 4FW1A 4BWMA 2I5JA 4CEOA 3E9FA 3SUOA 3K58A 3SV4A 3PY8A 1UA1A 2DIQA 1JLEA 2Z1JA 3MEGA 2D5RA 3ZSQA 2B5JA 1Z26A 3TAQA 1D9FA 2JGUA 1U47A 4K8ZA 3HPOA 3QERA 4MQ3A 4HUGA 4EP4A 1LWEA 3MP6A 3NCIA 3C4SA 4C8MA 2RI3A 5E41A 4HUEA 4DS4A 1S6QA 3UT1A 1W9HA 3SV3A 5JS2A 1R0AA 3M8QA 5CZ2A 1X9WA 3ZT4A 4CJSA 5C0MA 3RMCA 1C1CA 5HBMA 3LZJA 2IG0A 1VSEA 3VQEA 2LRQA 1RT3A 4C8NA 1SSFA 3KLEA 2OZMA 2HNDA 3SD4A 4FJ5A 1XWLA 2X78A 4FZXC 3OS1A 3LANA 3AVKA 1BI4A 4PWDA 4G1QA 3TR8A 4E19A 1ZBUA 1YTUA 4CJEA 4IUVA 4CEFA 1C1BA 5CIUA 5HP1A 2RI5A 4PQUA 1TKXA 4KTQA 4FLWA 3CM5A 2BE2A 4CGDA 2YKNA 1JKHA 5KRTA 3MP8A 3V6DA 1D5AA 4KKOA 1BQMA 4B9NA 1YTAA 4I2QA 2QK9A 2DY4A 1JLGA 4FJHA 2HHVA 2G8WA 3TAPA 3DLBA 4KB1A 4DQSA 5KCOA 3IG1A 2RHXA 3I0RA 3HO1A 4M3WA 5FDLA 1K6YA 1KFDA 2NLUA 4O55A 2OA8A 2BDPA 2FBTA 3TAGA 4BDPA 3U3YA 4AHTA 4PLIA 4CJ4A 1VSFA 1NK7A 4BE2A 1RBTA 2X6NA 2WOMA 4CHZA 4FLXA 3V4IA 5I42A 2XO7A 1A5VA 5C6SA 5K14A 1TL3A 2CKKA 5SWMA 4M3XA 1GOCA 3V81A 3AVAA 4DFPA 1DLOA 3HXMA 2GFAA 3K57A 4CF0A 1KVCA 1XHXA 4JRQA 2YNIA 4CJ3A 4M3RA 3NNQA 3QBYA 4OPKA 4CCHA 5HRNA 3HJFA 3META 3RTVA 1KFSA 4CHPA 3L2QA 3H08A 3FFIA 4Z4CA 1NJWA 2DAQA 2JTFA 2F8TA 5KCHA 3B6OA 4B8AB 4PLLA 1CZ9A 4O0IA 1FK9A 3TAEA 1W0HA 3LDSA 1D8YA 4IG3A 1WSIA 2O4XB 3NFAA 4C8LA 4E7JA 3ULDA 3PX4A 1B9DA 2HVIA 3DB4A 4FCYA 1HYSA 2F5KA 3VQPA 3DM2A 3LP3A 4TSXA 1RT5A 1HJRA 3D45A 1RBVA 4DSIA 4DSJA 2XY7A 4J2DA 3K5MA 1RI0A 2OPPA 3NH0A 2XY8A 3VQCA 2RJCA 4DU1A 1CXQA 5DK5A 1EETA 2IGIA 4M3TA 4ZHRA 3SYZA 1ITGA 3ZSVA 1UA0A 4CJKA 2EX3A 4YFUA 4CF2A 5IN1A 3SUNA 2IOCA 3LH0A 4AHRA 2A1RA 3BDPA 3OYJA 3TAMA 1BL3A 4F2SA 4N76A 1C1AA 3HYFA 3FLGA 3WNFA 3VQDA 3SUPA 3DLGA 4LH4A 4CGJA 1ZBLA 1N5YA 1JLAA 3QNOA 1KLMA 4F8RA 3NHGA 2FC0A 1EP4A 3O3HA 2GV9A 2F8SA 1FKOA 2RI2A 3VQ6A 2E5QA 3ZSRA 4DFKA 1BIZA 1BISA 2IC3A 1FXXA 2E4LA 4KHUA 3LWMA 3AA4A 4UQGA 3AVIA 4LD6A 1DTTA 3DOKA 4PY5A 3DLKA 1S1UA 4PUOA 2XDPA 4KHQA 3KK2A 3THVA 2G8HA 3PO5A 1O1WA 1QSSA 2L89A 4Z4GA 3QJ6A 2G8FA 3FC3A 2O4IA 4M3ZA 2HW3A 1S1TA 4BACA 3K59A 3QIIA 3AVNA 3K5NA 4DSEA 3KJVA 1C0TA 1EXQA 3H6ZA 1U45A 3OYAA 3OA6A 4Z4HA 1REVA 1U04A 3F73A 4FK0A 4N4GA 3D0PA 2D0AA 2PYJA 4A4FA 3O4NA 3E9GA 3DLRA 2G3RA 4DMNA 3DRRA 4FLTA 4RW9A 1OZ3A 3ZSYA 4CFAA 2FHDA 5KI6A 3L2UA 1HPZA 2BKDN 3U6FA 3OYGA 3AVLA 2Y1IA 2ITGA 4RW4A 4UC4A 5KGXA 3V9UA 4ZTFA 4DTUA 4QQDA 2VYTA 2FBXA 4E89A 1LWCA 3KK3A 3UWNA 1ZBHA 5M9OA 4CEZA 1VSHA 2YV0X 1SV5A 1CXUA 1RBUA 4KFBA 2DFHA 3OMGA 1HQUA 3OY9A 3ZSWA 4CFDA 4J2EA 1VSMA 4KO0A 2R58A 4JLHA 4Q5VA 4KHNA 3DLHA 4QW2A 4CK2A 4FK4A 3L42A 2YNFA 4E3SA 4PL6A 2WACA 3SQ2A 3FDRA 3WNHA 3ITHA 4ELUA 1VK0A 3U3GA 4I2PA 1NK4A 4W5TA 2YKMA 4DU4A 1S9GA 4I7FA 1WSJA 3HVTA 4DTRA 3HSTB 3ZSZA 4LD0A 1JXBA 1NKCA 4CHNA 3SCXA 5DMRA 5D3GA 3FEOA 3QEWA 1IKYA 5HLFA 3T3FA 4E1MA 3IS9A 1L3TA 3VN5A 2E6MA 4OGEA 3OYIA 1NK9A 4HTUA 2EQUA 3ALYA 1S9EA 2R57A 4C5IA 2HMIA 3AVMA 2P1JA 3SNNA 3F9KA 3KIOA 4LSLA 4CJUA 3O4QA 4KI6A 2L3RA 2X4XA 2RHUA 1RTHA 1RBRA 4RW7A 3CFOA 2EQKA 2LCCA 2ZD1A 1U49A 3ISNC 4CEDA 2HVHA 1WSFA 3MO8A 1TVRA 4B3OA 4LSNA 1NK6A 3OYDA 3M8PA 3JYTA 4RG2A 2OPSA 1RNHA 4QCLA 4CHYA 2NUBA 3NTIA 2EFIA 4M45A 4B9UA 3P5JA 2KZMA 2RJEA 2IS3A 2GFUA 3LPTA 5KE2A 3LPUA 3LP2A 5HRPA 4DF8A 2RPIA 2PQWA 1KTQA 1YT3A 4C5EA 3OYKA 4O4GA 4CJWA 2RJFA 3V9XA 2RJDA 1TK8A 2BUDA 1I39A 1L3VA 2EQJA 5CZ1A 1RT1A 1TKDA 3S3OA 4KB0A 1QHTA 3T19A 5D6YA 3G0ZA 1JXEA 3NF6A 2RF2A 4CE9A 3MEDA 1VRUA 4I9LA 3C6UA 4DQPA 2PYLA 4KHYA 3OYHA 4RW6A 4FJNA 1XC9A 4HCBA 1A5WA 2KFZA 4FJIA 2ATQA 3TANA 3ASMA 4C8OA 2IDOA 3KKSA 4CJFA 1L3SA 2HHSA 4AILC 1J9AA 2IAJA 2HNYA 3Q1JA 2E6NA 4CJVA 4NCGA 3HPGA 3LAMA 4B9SA 1BHLA 3PFSA 1NOYA 3PMTA 4OKJA 3NTHA 4EZ9A 3AO4A 3EYZA 3KD5E 1ASVA 2P0KA 4E7HA 1ZYQA 3EAEA 1I3AA 4IBNA 2OYQA 4OJRA 4AH9A 4IURA 1VSLA 2HHWA 4B9MA 3DLMA 2WONA 4Q0BA 4KAZA 4KREA 3S3NA 4E7IA 4CK1A 4ID5A 4NCAA 1A5XA 2L8DA 2XHBA 3K5LA 2YHBA 3EY1A 3NH2A 3PNWC 4FJMA 3SPZA 4JS5A 2G8UA 4Z02A 4GVMA 1HYVA 2R5AA 1C6VA 5CY4A 1RDBA 3MEAA 3DOLA 4KRFA 3MEUA 3K2PA 3BGRA 2B8AA 3E01A 2AJQA 3WNEA 3MP1A 3MEWA 3UIQA 1JLFA 4ZTJA 1QSLA 4FM2A 3RMAA 3SI6A 4DSKA 2A1SA 3K5OA 1JLBA 1HNIA 3C95A 2FBVA 2HHXA 4DTOA 1QE1A 3PUFA 3AO5A 3JSMA 1ASWA 4AHSA 2VWJA 2HNZA 4KHWA 2KFNA 4BD3A 1TAUA 5J1EA 3NAEA 2E6LA 4E0DA 2Z1HA 4CFBA 3NF9A 2Q3SA 1TV6A 4HCCA 1VRTA 2YNHA 3SJJA 1RDDA 2LSNA 4KTZA 1KHCA 2JZ2A 4N41A 1QS4A 3AVCA 4CJTA 4IUPA 2RO0A 3RRGA 5KE3A 1G5VA 4B8CA 4M42A 5EU7A 4CERA 3MECA 4B9TA 2JLEA 4BE0A 4LY7A 4B08A 1B92A 1L3UA 4CEQA 1Q9XA 2KW4A 4ELVA 3BDLA 1GOBA 4FJJA 3AV9A 1VSDA 3O3FA 4N56A 2XY5A 5I3UA 3OYMA 4DTSA 2DFFA 3SQ1A 3AVGA 4DLEA 3AA3A 4OVAA 4DQRA 3NTKA 4CGGA 4KTWA 3QIOA 4LH5A 1TKZA 3QLHA 4FJGA 3KLHA 3LYIA 3ZCMA 3VQ7A 3HP9A 2KQ2A 1OI1A 3CM6A 3OYCA 1WJSA 4CEAA 3GOXA 1BCMA 2K3YA 3HL8A 5FROA 5FRNA 3O3GA 5IAYA 1IG9A 2VWKA 4DFMA 3LP1A 4CF8A 1YVUA 2VG6A 3KLFA 3LZIA 5C42A 2QXFA 3SPYA 1L5UA 4E7LA 1J53A 2R7YA 4NZGA 3NE6A 1XHZA 1OYXA 4H4MA 1T7PA 4DTNA 3ZT1A 4Y1CA 1J54A 2FBYA 4CEBA 4CHOA 1T8EA 4W5QA 3AA5X 4CGHA 4L8RB 1QSYA 3CFPA 3NF8A 4EZ6A 4O44A 2GUIA 2XY6A 4RG8A 4I9QA 2M1HA 3H8ZA 2ZE2A 3QNNA 4QVZA 4F4KA 4FZZA 4GW6A 3LX7A 4M3UA 3OS0A 1SKSA 3ZEHA 1SUQA 1WAFA 2D0CA 1TK0A 2HHUA 2M16A
chains in the Genus database with same CATH superfamily
5L3CA 1S7EA 3VJPA 3HRSA 4DEXA 4O5FA 4IHXA 1PDNC 2A05A 4BUGA 5CYQA 4XKCA 4BQAA 3V7CA 3TEDA 1Z6RA 3EG0A 4ESRA 2WV0A 3HHHA 2NOJB 4FIBA 5K1YA 3TI0A 4BUPA 2VYPA 4ATOA 1LJ9A 3TTFA 1FOKA 2G8VA 5L3DA 3C7JA 3KD1E 1JB0E 3DYAA 1FN7A 4B9WA 1KYZA 1TWCJ 4JDSA 4G7HF 3L2VA 4ELZC 1ZRCA 1IB8A 1ETVA 4CFCA 3FHGA 5LGUA 4ENMA 1I3QJ 4QLCU 1OQKA 2YR2A 2P9UB 3QZ9B 3JCMf 1T39A 2M34A 4NS5A 3IC7A 1RNLA 1MIJA 4EHTA 2LLKA 1SHGA 5D6EA 3EHRA 3P1GA 2VQHA 3CCRA 4XK4A 3FKIJ 2CQKA 2HS5A 1K8KA 1UMQA 4I0AA 2PVDB 1WNSA 1VQ6N 1IN8A 2MWOA 1X1PA 2QCOA 2ZQBA 2Q31A 2FF6A 3CCMN 4NXNK 3CJ7A 4K8XA 2E3IA 2CP7A 4OLBA 5GANf 1FEXA 2LX7A 2W41A 2B86A 2R92J 2BGGA 2ZXIA 3M9QA 1LPQA 2HNIA 2BUPA 3DLEA 1HYZA 2FJ1A 2VI6A 3H3VK 1N27A 4A4EA 3OB9A 4CJLA 4DQQA 4FJXA 1ABQA 1FYLA 1EA3A 1PU6A 5GAEP 1RUWA 4X62K 2YJEA 4CCKA 1M27C 1EJ9A 4BRGA 1RL2A 2K6DA 4PNOA 2V52B 3WXKA 4FXDA 2VQCA 3S1MJ 3CCVQ 1MU2A 5GAOl 2VGMA 1GLDG 1VSJA 1IUYA 4KPYA 3HTRA 1NGCA 4O5BA 1Z25A 1PUFB 5FU6C 4DTMA 3H0IA 4IHTA 3KHYA 3OJUA 2OU2A 3LAPA 4BL0B 3GWZA 3L2ZA 3D4VA 3B02A 3SUQA 4DBHA 1HW2A 4HVWA 3U4LA 2D0QB 3I59B 2H27A 2LDMA 4DWIA 2HMPA 3DLAA 4ORZA 2HL3A 1P4AA 2AQEA 2M0OA 3L8BA 1NG2A 3GOIA 1I1SA 1OISA 3L4IA 2XGDA 3LM2A 2ZWHA 4F7UA 1N6QA 2D8JA 4UUSA 1HW5A 1KSPA 3BJOA 4XKVA 1Y0UA 1IO2A 2QBYA 1ZGAA 3S32A 3VRYA 2DA7A 3OSGA 2XGCA 2FX0A 3UKUB 3FK7A 2A5XA 2QGFB 2M9UA 3BUZB 2WB1N 4LD9K 5HRRA 3VWBA 3OYFA 3WQUA 1XN7A 1JL2A 3DPUA 4AHCA 3CCUT 1IN5A 5ICFA 1WZOA 2LVMA 4ILHA 2P7CB 1YFNA 2HYGD 2KQRA 2OTLN 3TDZC 5A0LA 3CHWA 4HX7A 4X34A 5DCMB 1FBUA 2X74A 4CIFA 2JQ7A 3UATA 3JCMQ 1FOWA 3KCCA 3KLGA 4DSFA 5BQTA 1XOVA 1LAWA 3FMRA 4GLMA 2Y30A 1BCOA 1HU0A 4GBQA 4MDAA 3E2UA 4QQGA 1OZ2A 4JRIA 2RQTA 4BR0A 1UGSB 3F70A 3M4OJ 2HDDA 4RTUA 3VQ4A 2B7EA 3M3YJ 3H41A 4JI3K 2RV8A 1TYQA 1KLNA 2Z5UA 1JJ2P 3VQ8A 3S6WA 3R0AA 5CYMA 2LTOA 2E7XA 3ABKH 4HG2A 3OYBA 4M3YA 2Q2EA 2R7SA 2PUOB 1NGAA 4PA1A 4NYFA 4B1VA 2JMAA 2DFIA 5IP7J 4B48A 4K43A 4A4HA 4H0TB 1BM9A 1T03A 3GLLA 3V9SA 2A42A 2FRHA 1OYYA 5LJ5f 4QQ6A 3GTKJ 3QZ5B 4PKCC 5DY9A 4YNQA 2M7AA 4HQEA 4BRFA 4DA4A 2EHGA 3CMYA 1LWWA 2XASA 1GLNA 1IKXA 2B9SA 4GMJB 1FSEA 1VQ5A 1B3QA 4OKKA 4CJPA 3JCMX 1WPKA 1ULYA 3VA3A 4KV8A 4Y15A 4G12A 1NM7A 3PO4A 4XRMA 3SDGA 1VSIA 3CIPA 3MAQA 5GAMj 3BDDA 4FLZA 5EJCA 2DMTA 3PIOL 1YJWN 1XQOA 1OCRH 1E4GT 2NS0A 5AT1B 3O8VA 3L4QA 1Q8IA 2GBQA 2RM4A 1XQPA 5GPAA 1T0HA 5AFUA 3H6EA 4U87A 3KYLA 2ISZA 1BJAA 3L00A 4FLYA 3CJRB 1DTQA 1QKWA 5L3GA 3PJRA 1TGOA 2P5GA 4KH0B 3MVPA 5ICGA 2J06A 4GO1A 2K02A 4A3GJ 3CCEA 4FSVA 2W4SA 5CVIA 2HOAA 1MSFC 2QASA 4FK2A 1IKVA 3CC2A 2CP3A 1XMQK 1M2OA 4LFBK 3NVKA 4NLCA 3RMBA 3BQYA 3P8HA 1NOZA 3S93A 1RTIA 2JWLA 4AQYK 1FY7A 5KAFC 3CD6Q 2Y0MA 3ECHA 1TH7A 4YFXF 1FWZA 1SPKA 2W03A 2KE9A 1N9RA 1PCXA 2DFEA 2D0NA 2KDSA 4B9XA 1VTNC 4CJRA 2CW8A 4J6WA 1NJIC 1UAAA 3GNFB 5CAIA 5JMVA 5A2QE 3L2RA 1VQPT 3ZQQA 1HNVA 2RK2A 4X1EA 1B9NA 2V8JA 1UJYA 1NPPA 4LIVA 3VYRB 3LWLA 4XLFA 2GBZA 4AT1B 3JRFA 1YFHA 1G59A 2ZSHB 2MG4A 1SL0A 3G6EQ 2XB5A 1ZBFA 2A7YA 1XGNA 2OTJT 2QA4T 1OR7A 5LGTA 1IREB 3EFOA 2BXZA 3A02A 1TNTA 3KTQA 2LQNA 2ZXWH 2ZXHA 4CSWA 4PKHA 1KFZA 1XSDA 1I1JA 2X6WA 2RQVA 2NLXA 2MLKA 4M7AA 4XQ3A 3WQTA 1NGIA 4XLNF 4C92G 1A0NB 4CXFA 5GMKj 2VQLA 1QWEA 1TSFA 4OO1J 1TS9A 3K7AJ 2ENMA 3NVMA 5AQXA 3G4SI 3NGIA 2K9NA 3QEXA 3HFOA 1VI0A 3E6BA 5DD8A 3LLRA 3WGHA 4D8DA 3F72A 5JS1A 3EUHA 1S1WA 3EEQA 2P4WA 4OVLA 1M1GA 2KQWA 2R7XA 1JCGA 4DG1A 2A6AA 4Z4FA 4N47A 4OIPF 5CE3A 3K2ZA 4A3DJ 1ZLMA 4CYCA 2BHZA 5FFZA 2D2WA 1AKHA 3J8AA 1I6HJ 4AG1C 4BVPA 3O9SA 4GYIA 3OS2A 4CF1A 2DL7A 1YITQ 2P51A 4H0XB 4KH1B 4FO0A 3SEQA 4A3KJ 3HRTA 3L1AA 2GQVA 1FKPA 2XPVA 5E8GA 1B34B 4H5WA 4JRKA 1J5EK 4HEA2 2MIOA 2L3QA 3VQBA 2KKZA 3GNGA 2DW4A 2V1NA 1UGRB 3FB9A 2XU8A 2KRFA 3GVAA 2X6YA 1HA8A 1F21A 4M7AG 2VV5A 3OJSA 2E60A 1LMZA 3AO2A 3D6RA 1ORPA 2O8EB 1N25A 1IHWA 5CQYA 4EJZA 3FMQA 1XC5A 4ILJA 3RVCA 5DM7L 1ZA2B 2FPDA 2P9UA 4JI8K 1VF9A 5DCFA 3VUZA 1N8RC 1RR8C 4DF4A 2PN6A 4CZCA 3J7ZI 5GAOn 1MBJA 5H1SQ 3CJAA 1M5Q1 3AG2H 5C24A 2QEXA 3TDUC 4C8QB 3BJAA 1W5TA 4DYCA 2DDAA 3ZEUB 1B1BA 2F4MB 1LW0A 3BC8A 3KP2A 3GZ5A 2LF8A 2O9SA 4CGIA 5GAN8 4A63B 2K3XA 4HNUA 3SQ0A 2EQMA 4IIOA 3A0BC 3CLQA 4FVMA 4DBFA 1Z9ZA 2HHHK 1R6RA 3MDQA 2QSHX 5DD4A 2O01E 2HQXA 2K3FA 1I8FA 4B23A 2GTDA 3G71T 3MEVA 3C2GA 3P9IA 2YRVA 2YHYA 2EPDA 4L3QA 1IV6A 2CT3A 2ETJA 4CVNE 2ITMA 1KC8R 5KQ8A 3R61A 4AHVA 3QPSA 1YHQT 4HX8A 2G8KA 4J2BA 3E9LA 2JPSA 5LHIA 1U8BA 1ON2A 4KNYA 4J9CA 4JJNK 2QKMB 2C6YA 1W97L 4ICLA 3GFLA 5A2QO 1WLJA 3TEEA 5IXBA 3O8HA 3S8PA 1PUFA 3GF2A 1Y07A 2ZFWA 3SXYA 4FLVA 2JTVA 3AVHA 5J2PA 1PRLC 2XIDA 2AT1B 4XM3A 4XRSA 3CCUA 3K70D 3CC4Q 2DMNA 3E9FA 3SUOA 4M78E 5IT9E 2W1OA 4JZ3A 3I71A 2DIQA 2FXUA 5HS8A 2QQ8A 3MEGA 4BRMA 3R6OA 3ZSQA 4M77A 4HVUA 2B5JA 3ZQGA 3JCMJ 2GOMA 3CQTA 4K8ZA 2O7OA 3ZMVA 1OR7C 4WFNL 2HGCA 2VT3A 2ECCA 1B72B 2DTIA 3QERA 4MQ3A 3M0QA 4HX4A 4M75F 3THYB 1CQTA 1X3MA 2CUJA 5E41A 4MIMA 1Q81U 1YJNT 3CCLQ 4M7AC 2YHXA 4R55A 3UT1A 3SV3A 3TSWA 2KPMA 3WG9A 3J81E 2DJZA 3LSKA 2L2PA 2ZGWA 1NLOC 3SHWA 5C0MA 1NGEA 3NMZC 3WTTC 2LNVA 3JV3A 4NHJA 2K9GA 3JB9F 1N34K 3AL0B 4WWCA 5LJ3g 3CCST 3VQEA 4V2SA 5GAN4 4MZTA 2FMLA 2VUMJ 3DXMA 2O8BB 2RN8A 3HIFA 1ZREA 1PU7A 3OS1A 2Z33A 3K1PA 4PWDA 3KEYA 4FTHA 3BOQA 3K9TA 1GV2A 4KIBA 3Q7BA 3JRZA 3QUIA 5DCMA 3CI5A 1YTUA 3LDQA 1R77A 2O8DA 4LK1F 4UV8A 1CGPA 1K76A 2RI5A 1N75A 4KTQA 2DPPB 4CZIA 5DYMA 2ZNYA 3LSTA 3QQAA 2J6OA 5C0YA 3ENHA 4KUIA 3GPLA 3V4GA 2KJBA 1GFDA 4LG3A 4BQOA 3V6DA 1D5AA 4KKOA 1POGA 4EJYA 4BRCA 5I21A 4I2QA 3EG1A 2DY4A 1OCPA 2DL3A 4FPAA 4FJHA 4CZZA 3DLBA 4KB1A 1OH6A 2PU9B 2YDLA 1MMNA 5CKBA 3F8CA 1K6YA 2W04A 3JSOA 2NLUA 1K79A 2BY1A 4B09A 3RYRA 1D8JA 1MW7A 4A5NA 3H9NA 4BDPA 3FXOA 5F0CA 4CJ4A 2P9SB 3SWNB 1UB9A 1ZLKA 4FWSA 4EJOA 1JO8A 1ONVA 3CJQB 3CCMT 4ISGA 2JW4A 3VU3C 2ACJA 5I9EB 1VQNQ 2XO7A 3DU5A 1RPWA 1TL3A 1PWTA 1BA1A 2FD5A 2KIMA 4M3XA 1SC7A 4JEPA 2NOEA 3LA2A 3Q0VA 4B4CA 3V8KA 4JK8A 1D0XA 1PYVA 2DPDA 2I5UA 2Q0OA 4CZHA 1MJ9A 4RA2A 2YNIA 4GKJK 1UDLA 1X01A 4CCHA 3META 3VYSB 3RSNA 2K57A 4S04A 1R1VA 5LHHA 3T9NA 3JB9J 1NJWA 2PVGB 3L2CA 2GM4A 5B5EC 2C0OA 1BR1A 2F8TA 2OJ2A 2DXTA 3NWTA 1N78A 3CVSA 3TAEA 3KFWX 5GAN3 4XH4A 4LC9B 2OTJA 1KC8C 3LDSA 2QA4A 4IG3A 4L5IA 1HPMA 1OCTC 2CP6A 1B9DA 1MD0A 5IT9O 1HYSA 1JHFA 4HA8A 4LDXA 4YTLA 2HZTA 4M75D 1UEBA 3E3VA 4X0GA 3FHZA 3QSUA 3DM2A 1N5ZA 4EMKB 3LP3A 4C23A 3TSPA 3JB9I 2DXUA 2IGOA 2XY7A 2LY2A 2ABKA 1NM1A 3GCMA 3I5RA 2WADA 2XY8A 2LCLA 1KG2A 1BG3A 1CXQA 3COAC 4ZHRA 2CZ7B 3JR9A 2YX6A 1ON1A 1QHHD 3EFSA 5ICCA 2W48A 4CJKA 3AKZA 3O08A 3G6EI 1W1WE 3J81O 1QCNA 2IIRA 4OU0A 5IN1A 1WH5A 1HC8A 3S1RJ 3LH0A 3EGUA 1VQ7Q 1J5YA 4C3HJ 4WXHA 3RI4A 2AA4A 1XB4A 3TAMA 3RSEA 2RNGA 2KGTA 4F2SA 1BOAA 2VODA 1O9SA 1HF0A 1WI3A 3VQDA 2MF2A 3DLGA 4LH4A 1D8KA 4EMHA 3CF5F 2HBMA 2A40A 4J9GA 2JA5J 4QTRA 1I27A 4F8RA 2XAHA 3NHGA 1BIAA 2H1KA 3VODA 1UHFA 4UOBA 1FKOA 1ZXOA 2HAXA 4O3MA 3A8LB 4HQMA 4ZYHA 3I56Q 4BQLA 4OMOA 5LEJA 5BPNA 3OMYA 4ENNA 2IC3A 2IGMA 2E4LA 1NLPC 3HKZA 3H3ZA 2LH9A 2JPCA 4UQGA 2MC3A 3AVIA 1GDTA 3DLLA 4AM3A 3DOKA 3LSJA 3EGDB 6AT1B 3SEZA 4A3LJ 1U9NA 2LNHB 4GGGA 3M0PA 1YITI 4KHQA 2ZCFB 2G8HA 2OX7A 5M5YJ 3PO5A 1QSSA 2L89A 3JTGA 2XUBA 1AEYA 2QLZA 4D5CA 1SAZA 3FC3A 1W4SA 2O4IA 3PNYA 5AFUH 4YPHA 4L5JA 4DSEA 1B34A 3FBIB 4L5EA 1C0TA 3OYAA 3I54A 3HGYA 1V76A 4EFHA 1U06A 1U04A 4FK0A 1A36A 2NRXA 1BBZA 4X66K 1SFKA 3FZFA 3H35A 4UVBA 3O4NA 2OF7A 3DLRA 2Q0UA 2ZO4A 2G3RA 3G71A 3HOXJ 2JSPA 1YJWT 4DNCA 2Z9OA 1A31A 4QS8A 3GX4X 3ZSYA 4CFAA 2L9RA 3PIPF 5D4RA 1HPZA 2BKDN 5C12A 3OYGA 4IRGA 1SKUB 3AVLA 2ITGA 3D5SC 4RW4A 5KGXA 2MABA 1YHQA 1LFPA 5TRDA 4AYBA 4QQDA 4HNTA 2VYTA 2FBXA 1XCVA 4BC2A 1LWCA 3GW2A 3FDYA 4LLNA 3JRHA 4ZN1A 2LRDA 3R60A 3HOUJ 3IDHA 1K1ZA 1CXUA 5C10A 3DBHB 3WTYC 5TKYA 4BNCA 2DFHA 1NWKA 2FNPA 2COWA 4M9ZA 3OY9A 2M9HA 3CBPA 4KGXB 3WODF 4XSXF 2R58A 4JLHA 1KIKA 3EHQA 5BOXA 4FK4A 3ASOH 4ABZA 3L42A 1QPIA 1VQKQ 5GAN6 1KG7A 5B8HA 3FDRA 3WNHA 3OSVA 2RVCA 3U3GA 4BC3A 2XG8D 4I7FA 1U5TB 4YOQA 4XU2A 3LQRA 1E3OC 4DTRA 3VS0A 4OPHA 3HSTB 3ZSZA 3IRQA 1JXBA 1E2XA 4ZDLA 3CW7A 4Y7NJ 3MPUB 2R7FA 2VL8A 3SHFA 5DMRA 3QEWA 1XX5A 4XTYA 4KHPK 4A6DA 3QDFA 1MPGA 3CC4I 5KN9A 2LSOA 3CCSA 3U21A 1L3TA 4JI1K 1NJIU 2HKQB 4OGEA 3OYIA 5GAMg 4MZPA 4C8QG 3ALYA 2DBMA 1Z21A 2HMIA 3THWB 3KIOA 4HDVA 3A8YA 3BZ6A 2ASOA 2HDCA 4KI6A 2R7TA 4D0PA 3CCJT 3E19A 2RHKA 4OAZA 2MFZA 3TO6A 1RTHA 1IDYA 1RBRA 2HU9A 4R79A 3H3NO 4G6QA 2DK3A 1B72A 2D1HA 1V5GA 2LCCA 2DRKA 1WSFA 1LE8B 4LSNA 1NK6A 1JRIA 2X4HA 1B6AA 1LVKA 2ABLA 1OH7A 4M3FA 5HNHA 3QOEA 4JAXA 4QCLA 1G99A 4CHYA 2NUBA 2ZPFB 5LMNK 2YUNA 4J9DA 4IEIA 4M45A 4P5OA 3Q9VA 1MDUB 1YIOA 4DJAA 5JI6A 1YJ9N 2FSKA 2RJEA 2XB0X 4R8HA 3ABMH 5HRPA 3LP2A 1S72I 3P9CA 5DUIA 1W7PB 2EZHA 1ODDA 3VEOA 1PSEA 1XGSA 2HVQA 1TWGJ 2RJFA 5A0DA 4MO4A 2EQJA 1QZYA 1RT1A 4UVCA 4A0ZA 4FWOA 2XKPA 2DXIA 2RQUA 2Y9YA 2EFOA 2CO5A 1K6OA 3T19A 3HUGA 4E1JA 3G0ZA 1WBBA 5BPDA 2NVQJ 2K27A 2YHTA 4B9QA 1WB9A 1RI7A 4KHYA 4FJNA 2FBHA 1A5WA 4RMNA 1GBQA 3EFRA 2JS2A 4MO7A 1KG5A 3UF4A 3HB9A 1IN6A 2YI1A 5HS9A 3A8GB 3K2AA 2HHSA 1J9AA 4JYKA 3FJ5A 2HNYA 4GY2B 3WXMB 3PGGA 3G1OA 2HSEB 1BHLA 3AY9A 4F7UF 3PFSA 1NOYA 1BWFO 3NTHA 2MD5A 3ZX3A 3K4KA 2OQGA 2HXOA 3K10A 1ASVA 2LQKA 2P0KA 1ZYQA 1DDNA 3EAEA 2L7MP 5MLCQ 3PSIA 4YFKF 5FFXA 1KXPA 3SWNA 1VQ8N 1YF5L 4JKGA 5FWCA 3GTMJ 1HUXA 1WHMA 4KREA 3CPFA 1HSJA 2J4RA 3S3NA 4E7IA 4OAYA 3VYHB 4ID5A 2PG4A 4NCAA 1STZA 3H46O 4BI3A 4C8QC 3PNTA 5AQLA 2O9VA 3NH2A 3LCNA 2QTXA 3SPZA 4P96A 1M1EB 1OX9A 1T0FA 2V1RA 1RAIB 4KH6A 2IA0A 4JK1X 3GTPJ 2BTFA 2H8RA 3W2VA 4JV5K 4PJMA 3UPUA 2CQXA 2BE7D 2R5AA 4HNVA 4ZZDA 1M3QA 2F2XA 4KGVB 3MEAA 1GXQA 4KIGA 2GWJA 4BRNA 2IVNA 2AJQA 3WNEA 1SHFA 3JCMc 3WTXC 3GL1A 1JLFA 4ZTJA 1PM3A 2KIQA 2RQRA 4DSKA 2A1SA 3K5OA 2O5RA 2FBVA 4CI6A 1QE1A 4XSZF 2X1CA 4MMKA 1D4XA 3AO5A 2BVMA 2DODA 4O6JA 4A93J 3I55Q 1ASWA 4AHSA 2VWJA 1FYKA 2DZ9A 3DKXA 4PCQA 5M1FA 1N36K 2KFNA 4BD3A 1ETXA 3G4ST 3NAEA 4FASD 2LBFB 2E1YA 4LF7K 2NOBA 2EWSA 3F5TA 3KVGA 2ESHA 4BS9A 2Z1HA 1NBWA 3GLXA 4FWKA 3SJJA 4DQ8A 5FD5A 3DFGA 2CQQA 1KHCA 2NUTA 1LWVA 1QS4A 1T3SA 4BY6B 4XTZA 1ZGJA 4M74A 2A61A 2RO0A 3MWTA 1OPKA 2YPRA 3EL2A 5KK1A 5KE3A 4BG8A 1G5VA 4M42A 1VNDA 4B08A 4M6XA 2ZJPL 4QIWN 4F93B 1D1AA 2OPTA 2KYBA 1NG9A 3UB5A 1RDUA 1X1CA 1GOBA 1O3TA 4FJJA 1P2FA 1M1KR 3O3FA 2IA1A 1M8MA 1CSKA 3K1NA 4V2FA 1YP5A 4K2EA 1YS7A 1JU5C 1BB9A 2DFFA 3AL0C 3SQ1A 4CBUA 3HZJA 1LEAA 2RMOA 1ZRDA 2JA6J 1UGPB 4DQRA 4HYEA 3NTKA 5J3BA 4CGGA 1HSQA 1BI2A 3ERMA 1TKZA 2GCXA 2I7PA 2O2OA 2V1UA 4KT0E 4ISEA 2JVHA 5EEAA 2CH4A 4BAYA 3THXA 3HP9A 1ETOA 2M5WA 4MHGA 1OI1A 1ABOA 5DV5A 2J7IA 3MMYB 3CM6A 2Q2RA 4KITB 4NL3A 1EH6A 4CEAA 5ED4A 3EGDA 4RGSA 2P0WA 2LC2A 5GADP 3P8BB 1WI9A 2M87A 4AM6A 2L7FP 5IAYA 2IRFG 4J9FA 2N8GA 1ERDA 1HXDA 1YVUA 1U2WA 4Y3OA 2XF7A 4PUSA 2GA1A 4N0BA 4XU1A 4M7DA 2NNNA 3SPYA 1L5UA 2V6EA 2MA3A 4PJNA 1GLBG 4XAXB 1OYXA 2QWRA 5H2FC 4DTNA 5F1XA 2JA2A 3CCVT 4H4KC 3SWNC 1SD4A 5L8RE 1JEGA 4CEBA 1T8EA 4CICA 4W5QA 3AA5X 4L8RB 3CFPA 3BR1A 1IXSB 2GX9A 3I4NJ 5AYFA 3E9PA 4EZ6A 3SZGA 4A3IJ 2PZ1A 2R7QA 5LJ3d 4ITVA 4UVAA 2KT8A 3DKWA 2CGPA 2E6ZA 3FXJA 1A6IA 4QVZA 3RPQA 4CCOA 4B6MA 2RE2A 4QPQA 2WWYA 4K11A 4GW6A 3N05A 3UR3C 2CUFA 4YELA 4BYYA 1D09B 3JCMb 3ABUA 1TK0A 1X2MA 2L9VA 3A5LC 5D5UB 5FJ8J 1UCRA 3J81K 3QETA 3AVFA 1U84A 4C5HA 3JCMe 4DFJA 5IHNA 2LFBA 4IZZA 3K4LA 1ZLJA 4B1YB 3W6VA 3DTKA 4JKEA 1MHNA 3MQ0A 2PBDA 3CCJA 3ASKA 3CCQQ 2QK0A 1NJYA 1IF1A 3KEOA 1KC8U 1SD7A 1MBGA 3PQJA 2HTSA 4PKGA 4ILGB 3J7YP 3O9UA 4WE1A 4IEEA 3HFNA 3DB3A 1X2KA 4PJOB 3K0LA 4NNJA 5GANe 4EMKC 3QIPA 4CIEA 1JTYA 3BG6A 1MH3A 5EG0A 3QESA 1C0MA 2G7UA 4A62A 1X6BA 5KH6A 1DGRM 2Q0RA 1S1NA 2EQRA 3TP3A 4Y1DA 1VQPQ 1WDXA 1NJIO 2LP0A 4LDWA 3TABA 5KGWA 2D9TA 5C2DA 4C8KA 1K9MC 2E2OA 2G8IA 3THWA 4JI2K 4BI4A 1KQ2A 3ZMUA 2HYJA 3H9JA 1V55H 4WCGA 3V8JA 5JVGL 2YUPA 3JREA 3M3ZA 1TQIA 3QOPA 4KMFA 4OP0A 1FJGK 4JHDA 3ZMZA 1JI8A 5HRSA 1PG5B 2PY5A 4XN3A 3GBQA 3LWIA 1LFBA 3H9QA 3CTAA 1M1KC 1FBSA 1LE8A 3HKSA 1S1XA 2W24A 3TREA 1KQSM 2H6CA 4HRIA 1NKBA 4IOCL 1IKWA 5LJ3h 4IUUA 4FSXA 3HPWA 1LCUA 2IA2A 4IOAF 3G10A 3ME9A 1W7PA 4M7AE 4M75B 4XKWA 4QOZB 2F96A 3MN9A 3OA9A 1KD1R 1PD1A 2NOGA 2AK5A 3PFIA 4IO9L 1MNDA 3KZBA 1WAJA 4LLLA 3R3LA 4FT2A 1WJFA 3DCFA 4E9FA 3CWAA 4FM0A 1RTDA 1ZQ1A 1Z7LA 4BEHB 3BF1A 1OVYA 3KYDB 3QINA 3CMAN 1UGVA 1IN4A 2KIFA 4AVZA 3I0SA 1TG0A 1VQOQ 2CV0A 2DFUA 4X65K 1VYVA 3OW2P 2K5FA 2PJPA 4M77F 3S2WA 2B4JA 2DK5A 4RW8A 2HBKA 2EVRA 1T98A 3GTGJ 2HHTA 2BOLA 1WSEA 3VS6A 5LRSA 2DYRH 4D7MA 2COBA 1JLCA 3LSIA 5AJ3K 1CZBA 4N4NB 3SQ4A 2JJ7A 3CD6T 4AFZC 4ESBA 2EYZA 1EQYA 1P4WA 3AO3A 2ZMEA 4E7SA 2QQRA 1P8ZA 3V1RA 2EH3A 2NWMA 3SMSA 4DR1K 4D7NA 2VBXA 3HOWJ 2DA5A 3L6QA 1CKBA 1O13A 3BG7A 3OBWA 1S6PA 1X3UA 5CQGA 4M3BA 3AARA 3WNGA 2QXLA 5FPDA 3TWHA 3BDUA 2JHNA 2M51A 2M0MA 3HRMA 3G4SA 2ZBKA 1YIJQ 3VQQA 4H0EA 3O4WA 2EIFA 3CQYA 5J4VA 2DD4A 1XSXA 4ZDPA 4FLUA 2DQRA 1NHAA 5JR3A 2P4RA 4L59A 1LV5A 1OFCX 4A69C 5LJ5e 2UUBK 2Z16A 4EW4A 4OFAA 4R5PA 5BRHA 1X2NA 3O3KA 3PTAA 3GZ6A 4W5OA 3FXUA 4FM4B 2YSQA 3P83D 5J2MA 3R6MA 4NC6A 2COMA 3Q3SA 1T05A 1NGFA 3A4CA 1U5TC 2AKLA 3SAFA 4J6XA 4RUGA 3RMDA 3LGFA 2WY7Q 1WJAA 3REOA 3PX0A 2RF0A 2HL5C 1C0FA 2H6BA 3H0FA 2VUBA 3SAGA 1RZ4A 2UZKA 5IXFA 2QENA 3T1AA 5EEHA 1APLC 4DQIA 2L3PA 1K73R 3MWMA 2QWPA 2ZJQF 1T3VA 3JXUA 3R1XA 4BQQA 2KFDA 4CW7B 2R7DA 2LBFA 2JVVA 2P9KB 3NBPA 3MX5A 3S3MA 4F52A 1NEBA 3PQKA 2O4XA 3FHFA 4B22A 5LEKA 1ORKA 5GAHP 2PLYA 3G0QA 5GTHC 3QYHB 4I2OA 1KO9A 2LP5A 3ZT2A 2VPLA 4E9EA 1YI2Q 2JN0A 4E7KA 1RAFB 4KHSA 2QKBA 4HLXA 1B07A 1YITT 2CGHA 4HSBA 1YJ9T 1M1FA 1TQPA 5HODA 4U0WA 2BZTA 1HK9A 3DI6A 1YJNQ 1JT0A 3MHXA 2O8FA 2FSNA 3HSBA 3V9WA 1ZTRA 3WUHA 4IFYA 1MDMB 2VASA 4XTVA 5EDNA 4FYDA 4DR6K 1UOCA 4F3TA 2DL5A 4YFNF 1IG7A 5M1KA 5FLXO 2LY9A 3KZIC 4FM1A 4KUDK 3W6KB 1EX4A 2ROLA 1JLQA 4CECA 4OGCA 2A68F 1QVUA 1RRQA 2JMCA 1JKQC 3I8BA 2DMPA 2HXIA 5AN4A 3QPHA 2KMTA 4CC3A 3CCVA 2D4WA 1YW9A 4C9YA 4U0VA 5CVUA 5LRRA 1IXRC 5D8KB 4M77D 1KD1C 2P9LB 2UYTA 3ULRB 5EXWA 3EKUA 3H1VX 3ZSXA 4C0GA 1KSWA 1WA7A 4U0YA 2L3SA 2D1KA 3L3VA 4J83A 1X9MA 4UY8O 2STWA 4MGRA 1XNIA 1ASUA 5GAMd 4BRHA 1PU8A 3RTRA 3ZETB 2RHZA 4FOEA 4YRVA 1C0WA 1WQ7A 3HT3A 1QVFP 1WJCA 2EINH 1VQ8T 3CEYA 5F6FA 1O75A 4CRIA 4HAMA 1OULA 2HB5A 4HT9A 2XI9A 1LW2A 1QZEA 2XPUA 2KISA 2DYIA 2Y9ZA 1VQ6Q 4IOXA 1TKTA 2KY9A 2JUGA 5FKNA 2HOTA 2QGGA 4A54A 4B1UB 5ADXA 1WHJA 4FJ8A 2QWLA 3CCMQ 3JRGA 1R71A 2F2VA 3DPLC 5GMKl 3CPWP 4QWQA 1NK3P 1Y97A 4OMNA 1ITYA 3GTQJ 1WKMA 1QPMA 2CSIA 1XPXA 4CJ5A 3AVJA 1UFFA 1AWXA 2YRCA 3PT9A 2K7AA 1XQHA 2VJIA 4IQJA 2YUOA 3SFIA 3QP5A 1R00A 4OIQF 3TPQA 2X4JA 1B7TA 2E20A 1GVJA 1UHSA 2KZZA 5EVZA 3CC7N 3MXJA 3TQNA 4MLOA 1B8IB 2X4YA 4HSTA 4L0YB 3SBTA 2E1HA 3E6DA 2CZ6B 3WG7H 2W10A 2YWWA 5GAOm 3VS7A 3G1JA 5M3FJ 2PQ8A 2V7YA 1ZR2A 2ZM6K 4MLHA 2NOHA 3GBTA 3WVEB 3KETA 1ZN2A 2DCEA 3CCLT 2DL4A 2YCHA 1YE9A 3DLLF 3NGZA 3M8SA 2XSJC 1IGUA 2EYQA 3W3CA 3O1BA 3RKYA 3ZP5A 2QG9B 4KI4A 2A08A 3KKRA 2A5WA 4L9VA 3BF3A 3O8GA 2AXTC 3CVTA 4ZNXA 3U9GA 1EWRA 1NH3A 2DN0A 3TAFA 1X27A 4C5GA 1KC8O 3CMEN 1WJRA 3RR7A 2QSGX 1BYMA 3ID8A 1IHVA 3L0QA 4FYVB 4CZEA 3FXQA 1S3JA 3G1LA 2BYVE 5AQQA 4MNUA 2M0CA 3A8MB 1HRHA 1K73C 3OQ5A 2LT4A 4U67L 1VQMN 4PJOA 2DD5A 3U1KA 4LDUA 5B66C 4C0DB 1QNTA 2DETA 3OMCA 2BY2A 1BI3A 2Z1IA 1DEJA 1VQPI 4TV7A 3CJBA 1HCRA 1X6GA 5J6XA 5E20A 4BY6C 5GAMh 3T69A 4FQGA 1X9SA 1XQSC 4BHCA 5JLWA 1R23A 2EIKH 1IXCA 2MLGA 2OTJI 2QA4I 4FYWB 3M57A 4YOTA 3BPVA 4F3OA 4YIFA 3QYEA 5IYDJ 2GF7A 3RIRA 1OX8A 3H5NA 1VQ4N 4IG0A 1IRFA 2GWKA 3ID6A 4D9JA 3FXMA 2UXXA 2LZ6B 3S9HA 2OTLQ 4HW0A 1WHLA 4EJVA 4CA0A 3FF5A 4IJNA 2ASMA 3NAUA 1ESVA 5CR2A 2GXBA 2F1LA 4IPAA 1HR0K 5FD6A 2DTUA 2KTQA 4OB1B 1WZ2A 3C6HA 1SS6A 4YDUA 4PGGA 3ZX2A 3WXIA 1M3AA 2LYCA 3PFYA 1VQLN 4BREA 2LR8A 4YHHK 2Z2SB 4XBFA 1VQNT 2XRNA 2EJFA 1NK8A 2EA2A 3BQZA 5AQOA 2IVPA 1QKXA 5LJ5g 5DUKA 5CR4A 3C0CA 4JI7K 2E5KA 4DSLA 1NTCA 5BRDA 1HQEA 1NE8A 2VJ4A 3I33A 1AZGB 3VQ5A 3K70C 1ZSZA 3CD6A 3S14J 3A2FA 4PZJA 5H6RA 3S6IA 4CEOA 4FX4A 2I5JA 4BWMA 3TW7A 1MBKA 3SEMA 3M54A 2DEUA 3ER0A 3J7AP 3A1PA 2D5RA 2R4GA 1Z26A 2P9PB 1D9FA 2JGUA 3DKYA 2K4YA 5BPIA 4DIQA 3IKTA 1T95A 4HUGA 3UKGA 2V8IA 2BZ8A 3T5XA 3C4SA 3MJXA 2RI3A 2H1LA 4HUEA 3NPFA 2Z1DA 3G6EA 2A0FB 4V19K 5AQWA 3BR6A 2HCKA 4FWPA 2K79A 2MI6A 1W9HA 4OOIA 1GLEG 1R0AA 5CZ2A 1YJWQ 2CQ7A 4J7IA 4RTYA 1ZRFA 5GMKh 5FLMJ 2LKXA 2JWKA 2LRQA 3HRGA 1R4NB 1ATNA 1V4RA 1SSFA 3UKRA 2OZMA 4M75G 1Z67A 3SD4A 1VYUA 3ONQA 3BY5A 4FZXC 4C0FA 3AVKA 1WQWA 4UUVA 1RR7A 5L23A 1XNRK 2XAFA 2RGVA 2XRLA 4F7UB 3MKYB 5M1QA 3R2XC 2R7OA 4KULA 5HP1A 4CZFA 1TKXA 4FLWA 3AAQA 2G9WA 2FSJA 2Y0SN 2BE2A 3RMQA 2ZCWA 2IJLA 3LFUA 1VQ7T 1NMNA 2VCPA 1VQ9N 2UUCK 4C8QE 1FLIA 3UNGC 2GGRA 3FBNB 3C0BA 3O5ZA 3HI0A 3M1FA 4OMYA 4A3MJ 3LL3A 2ESWA 4B8XA 5J8CA 4DZPA 5GAN7 1P92A 3W6JB 5M1OA 1YITA 3IG1A 4AC0A 2KLOA 3HO1A 5HLHA 3F22A 1YJ9A 4B21A 4LF8K 1J0RA 4O55A 1GV5A 4QS9A 1TW2A 2FBTA 1WOQA 2K9LA 2D0OA 1UTIA 2HOSA 1BOBA 1VSFA 4F7ZA 1NK7A 1ZKGA 4Q4ZF 3TW6A 1Z3YA 2WOMA 2Y90A 4DGWB 3I56T 4B3SK 1AWOA 1XCBA 1IGNA 4Q5SF 4X1VA 1W2BP 5C6SA 1HKTA 2P9KA 5SWMA 3DV8A 4JPBW 3FXRA 2CYYA 1YI2I 4DFPA 5CKHA 1GL5A 3KP4A 1DLOA 2PEXA 5J47A 3JCMW 3G73A 1TYQB 4CJ3A 3TMOA 3VKIA 3QBYA 3QFUA 1SVLA 2Y31A 1MMGA 2UU9K 3RTVA 1S8NA 1T2KA 4CHPA 3QPTA 2EPFA 2HVRA 2Q2EB 2F6CA 1YJNI 2CYZB 4Z4CA 3X25B 2M4GA 2MH2A 4WXDA 3MKDA 1M1KU 5KCHA 2F2WA 4MDXA 1NLVA 4S0HB 2PMHA 4FWNA 3FZLA 1CZ9A 3KK7A 3CCSI 4AD9A 4I6MB 3GFJA 4M3EA 1S72N 1XGMA 5AQHA 4IF4A 4XTUA 2VOPA 1D8YA 2QWOA 4BY7J 1WSIA 2A69F 1FP1D 3NEUA 4YIRX 4ZDOA 3MN6A 5KYWB 3ULDA 4M75C 2XDDA 2LT1A 3SBGA 3H3UA 3BROA 3CMAT 5IP9J 4BXXJ 3EE8A 5LJ3f 4TSXA 1RT5A 1K78A 3D45A 1RBVA 3RDVA 4P55A 2P9LA 3VF2A 4J2DA 3K5MA 3OW2S 4ME7A 4DV7K 2ZJRF 2ROTA 2VC8A 2OQRA 4E6RA 2OPPA 2IVOA 4LF6K 4DV2K 5JLFA 3VQCA 3SMPA 3TO9A 2RJCA 3WEEB 4DU1A 1EETA 2Q1ZB 2IGIA 4M3TA 3A98A 4NQWA 3CC4A 2FBKA 2YX4A 3SYZA 1ITGA 3ZMSA 1UA0A 1E6GA 2H8HA 4ANJA 2DT5A 1B4AA 2KT0A 2ZZDA 5E79C 1VQKT 3M4GA 2CUZA 4ON0A 1YXQA 4MQ9F 3BDPA 2BE9B 4GDFA 1OCZH 1RLQC 1BL3A 4AIKA 1VQ6I 5KYUA 2DBKA 4N76A 2BH1A 2ZPIB 4HOBA 3HYFA 2V6CA 3DTEA 4C92F 4CC7A 2KZGA 3SUPA 3CCMI 1ZBJA 4CGJA 1ZBLA 3CCLA 1WPYA 1R5ID 1YCYA 4NB5A 1CKAA 2BTTA 2L02A 2FC0A 1EP4A 4I76A 2JJ9A 5BREA 3VQ6A 4I98B 4F92B 1DPRA 5GAN5 4R1HA 3ZSRA 3CPEA 4DFKA 2LJ0A 3VYTB 2ZPGB 3ZQLA 5KYYB 3AFHA 3OL4A 4KHUA 3M8FA 2VVKA 2PAVA 2FXAA 1ZSGA 4B47A 2I10A 4ESFA 3HTUA 3CP2A 1ZX6A 4LD6A 4WTOB 4PSXA 2MW8A 1XMKA 1S1UA 4B43A 2CS7A 1KQJA 1RRSA 4LLGF 3D2FA 2VE8A 1O3SA 2XKOA 3VPZA 3CLOA 5J8FA 3O6WA 3CCRN 4MFDA 4BACA 3K59A 3QIIA 3K5NA 1TC3C 3KTUA 3SAHA 3LSRA 2OZUA 1EXQA 3A0IX 3BY7A 3CETA 3D0PA 1DGKN 2D0AA 2HQ5A 4MDBA 4ZN3A 1Y6IA 2I5WA 4M7DF 4EVIA 4E47A 4DMNA 4G8XA 4FE7A 4H03B 2FE3A 2YU9J 1FIPA 2FHDA 1LWYA 1JCFA 4KYWA 3J7AO 2Y1IA 2VXZA 3HOVJ 1Y7XA 1JXMA 4DHYA 3V9UA 1KU3A 4FSSA 4ZTFA 4DTUA 3P7NA 1VQNA 5FB2A 3HBTA 3K6GA 5E3LA 1QVGP 4HVVA 1QVFM 3UWNA 1ZBHA 5M9OA 3NHNA 5JLHA 3ABTA 3M55A 4JYAK 1K0SA 4XQFA 4L18B 2OCCH 1RBUA 2DOEA 3MMVA 2RQQA 3BT9A 1L0OC 2Y4YA 4XEIA 4CFDA 3BJ6A 1NYGA 5KVRA 2OTLI 2WC2A 3FISA 4IHWA 1BDGA 4Q5VA 4IXCA 2HPIA 3CDLA 3FK6A 3BR0A 1J59A 2ED0A 5KAIC 4PL6A 3CPWM 2CUDA 1HX1A 4D1QA 1Q7YC 3TOAA 1WIEA 2DZCA 2WC9A 3ITHA 1VK0A 1OU8A 1T3LA 2YKMA 2ZAEA 1S9GA 4LG0B 5BR8K 1WSJA 2RKHA 4JQFA 3HVTA 2PNIA 1VYTA 4ZH4F 3VETA 2VT2A 5ADXH 4C2UA 2XC7A 3QPLA 3RYPA 4LFUA 1H8KA 2HEOA 3OIOA 2HNHA 3PM1A 5J1RA 3FEOA 5D3GA 1IKYA 1KD1U 2E2IJ 3T3FA 2KKOA 1U1SA 4EM1A 1QVFS 4E1MA 1RLPC 3LQQA 1G4DA 5DM7R 3AAPA 4HTUA 5M5XJ 3NARA 2CSOA 4C5IA 1MMDA 4A57A 1ZUUA 3AVMA 3RUXA 2DRMA 2BVLA 4LSLA 2GQIA 3MEXA 4KN7X 1EIFA 2DE0X 4OIOF 1T33A 2RHUA 2CV1A 3BG9A 2P9PA 2BXYA 3U9DA 2KMUA 4IRIA 1XSVA 2NVTJ 4I99C 2EQKA 3KE2A 1U49A 3CPWS 3MO8A 1TVRA 2X85A 1OMIA 5HLIA 1X2QA 1MZBA 4AFUC 1VQ7A 4RG2A 2CGJA 1YJWI 2CJJA 5DS9A 1K8AR 3VGLA 3EG2A 3I55T 2O61A 3HSRA 4KJZA 3TU5A 2DTHA 4YOVA 2Y2ZA 2KZMA 1B9MA 3CC7T 4LUEA 3GYHX 3LPTA 1PP7U 2RPIA 1W0UA 1KK7A 2QVOA 1NJIR 4CJWA 5BMZA 3V9XA 5CK9A 4YPRA 2RJDA 4JX6A 4M77B 1BW5A 5CZ1A 2KLAA 2NVYJ 1X1DA 1QHTA 4DV3K 2GIZA 2M4KA 3ZRGA 1JXEA 4V2GA 1SMTA 4XRFA 4XN0A 3NF6A 3DEWA 3AT1B 3I56A 2CS3A 1LCKA 1NYFA 3OYHA 4RW6A 4EA5A 4M7DD 3VPRA 4HCBA 4FJIA 3ISPA 3VW4A 4KT6A 2XKOC 1D0YA 3HBLA 1QU3A 3TANA 4Z94A 1T44A 4L9NA 2JM9A 1XG7A 2VWBA 4UY8I 1VQ5N 4L9JA 3KKSA 1Y1WJ 1HDDC 2QTVA 1L3SA 2O88A 4C1NK 3N5NX 2V9KA 3OHRA 3FFKB 1UB4A 2W84A 4H0VB 4DCHA 3F10A 2W85A 1HKSA 3LSPA 3DXMB 1JJ8C 2D1VA 2E2HJ 3VYUB 1HKGA 2ZXJA 5JICA 1I5ZA 4KDPA 3PMTA 4EZ9A 1JJ2A 4PIIA 2Q8KA 4JBAA 1NKUA 3JCMV 4E7HA 2XHIA 5LMUK 3HL2A 1AHJB 1S7AA 1K73U 1R36A 1P7MA 4LUDA 3CERA 1VSLA 4U7DA 3MFKA 2K9MA 2NNYA 1KG3A 2O8DB 1M9SA 1Z0XA 4C0DC 1JTXA 1VQ4T 1I4K1 1FYMA 2OI3A 1GHCA 1ETQA 3CCEN 4DZJA 5AQNA 1A5XA 2E34A 4LF5K 3D2EA 4WQ4A 3CC2N 4F7UG 3EETA 1R59O 3K5LA 4BY9C 2L01A 3EY1A 3CCJI 3VOVA 4DYQA 4FJMA 2X0LA 1X6OA 4I6ZA 4WFBL 1D1CA 1K9MO 4M3DA 1YRNB 5EEGA 5JFRA 2P0PA 4ASNA 4Z02A 1IRZA 5CVRA 1OLTA 1Y8RB 1VQLT 1RDWX 2HQNA 1IO6A 4WFAL 3VS1A 5GAMf 2XDBA 2O31A 2QI2A 2V9PA 3S2DJ 2E2NA 2A36A 3OTOK 3BLYA 3JB9H 5IYCJ 2OJED 3MD2A 4FT8A 2GTOA 2P8TA 1YG2A 3MEWA 1M1KO 3JRIA 4CZJA 4A5MA 4GFBA 4YEJA 4KFCA 1W1FA 3H36A 3CF5L 2WBNA 3SI6A 5TKWA 1VQKA 1JLBA 4KMUX 5I2MA 4I6MA 3TKYA 3VTHA 2VE9A 4DTOA 1BU1A 1N8RR 1U2VB 3F8BA 1GFCA 3JSMA 5D5VB 5IHIA 2F5CA 4BQNA 2HNZA 2XAQA 2MYSA 4KHWA 5KYWA 1TAUA 1V54H 5LL6Z 2QGUA 4FL9A 5J1EA 3PVQA 1E17A 3FWEA 4BGBA 2XGXA 1TV6A 2PUKB 5EX5A 2X6XA 3IKMA 1RDDA 2LSNA 1QBJA 2JZ2A 2WAQN 4AUXA 4N41A 1R0CB 4CJTA 1W7AA 4UB6C 3M9AA 3UA6A 2NRZA 4IUPA 1RESA 2R5ZA 1OQYA 2Q97A 3RRGA 2YX7A 3K0SA 3WEEA 4B8CA 2ZB9A 2HSPA 5EU7A 4B9TA 5DDGA 3KWIA 4KH4A 4BE0A 3BFMA 4LY7A 4IWVA 4HXJA 2COZA 4CEQA 2DVEA 4CC2A 2I2LA 1TWHJ 3CCQT 1VAZA 2QQAA 5AQVA 4EMSA 4BG9A 3AV9A 3GXOA 4J9EA 2XY5A 4F17A 2E4HA 4XORA 1W7PD 1XMAA 1K8AC 4DTSA 3F9MA 5LFAA 1MNMC 2CZ0B 2EKHA 2A41A 1Z3XA 1BU6O 1W2BM 3I9V2 2W25A 1HBXG 3C3WA 3Q9SA 2GA2A 2DA4A 5M3MJ 2DAOA 4OVAA 3AA3A 3RZOJ 3PIPL 3TOBA 2RH2A 3KLHA 4B3MK 1F4KA 1VQ9T 4B1WB 1DP7P 2A3LA 2HWVA 2AIRB 3O2PE 5KCMA 1IDZA 4CO8A 4N4OB 5HVQC 4DQ2A 5KYYA 3OYCA 2P81A 5GAN2 1BO5O 1QQNA 3GIBA 1WJ5A 2P5LC 2DKGA 2JVGA 1BCMA 5H20A 3KYCB 3HL8A 1D5YA 4XLPF 3LDPA 3FMSA 3RSEB 4LFAK 3O3GA 5GAHJ 3LW5E 3DXKB 5D7UA 4M63C 3LP1A 2IEKA 2FLOA 4I0BA 1MA9B 5J3LA 4PJ0C 2X3XD 2LQ8A 2OAUA 3LZIA 2KL4A 1Y0MA 5C42A 1UZCA 2QEXN 4NZGA 3IV5A 1XHZA 4WQ5A 1W2BS 1T7PA 2QWNA 2LJ3A 3TCJA 2HVSA 3ZT1A 4BGDA 2PMZA 3C6AA 2OUMA 2FBYA 1AWJA 4E2FB 4CGHA 4OINF 1USSA 2KYMA 3DF8A 5F64A 5KPRA 1SAXA 1QSYA 3NF8A 2JTEA 2XAUA 2KHOA 2CH6A 2J6FA 3A0HC 2GUIA 3EKSA 2BE5F 1NNEA 1QZ6A 5GJWB 5DLQE 2M1HA 1PKSA 2ISYA 4DUZK 2ZE2A 3QNNA 1YYVA 3OYYA 3CUQB 4F4KA 5AQFA 2QSFX 3LX7A 3OS5A 1SKSA 3J7AY 1AA7A 1YJ9Q 1WAFA 2JK3A 4WF9L 4FWQA 1TOVA 1VQOT 4EQQA 1K4SA 1XDSA 3HSEA 2EFWA 4NL2A 3NDKA 1KVBA 3Q7CA 1R7JA 3VSKA 1TL1A 1X43A 3HRUA 1F9NA 3CZ6A 3FX3A 1N3CA 1K83J 5F1RA 1V29B 1QHAA 5KRSA 4ZYDA 3N97A 4JK7A 3CCUN 1Y96B 4MQVA 1EKEA 4HVJA 2XROA 2R93J 4FJ9A 1JL1A 4FJLA 5F04A 2VKDA 2JN6A 1RDAA 4QAGA 2EJGA 4JZ4A 3CDHA 2CRGA 3ZT3A 4LG0A 2KXDA 4J6YA 3QU3A 2QYOA 1MGQA 3F3XA 3BG3A 4DS5A 1FMWA 4AF1A 5DPKA 3I55A 3NF7A 1TQMA 4KBMB 4GV9A 5C4JJ 2TCTA 3CQXA 3V1QA 1KD1O 2LQWA 1BKBA 2TDXA 3CXCP 1YIJT 2PZSA 3H1QA 1YQRA 3BPXA 4RAYA 2FA5A 3SLCA 2JHJA 1IJWC 3HSCA 2DF6A 2E1MB 2DBBA 3GUDA 3HOTA 4PJOF 5AONA 4ZJZA 4DR4K 3VMFB 2HFHA 1RT4A 1TXQA 3O1WA 3E7LA 3RRHA 2HKXA 1Z9QA 1VQ8Q 4AIHA 4RAFA 3DU6A 3AG4H 3BW1A 4OFEA 2X35A 4H4OA 2X51A 5DLOA 1DU6A 1N33K 2WTEA 3CCVI 4NC8A 2NRTA 2NUPA 4IUTA 3HVRA 3DRPA 3O6BB 4CJQA 3LDOA 2P5OA 1CLQA 1L3LA 1SZ2A 3JW4A 2LY1A 2Y69H 1BBYA 2K7LA 1JCEA 3RNJA 4F91B 4UNOA 4IO8A 4LF4K 3LSGA 4XU0A 1AWCA 3P39A 5DEQA 5C44J 2DOAA 2DEQA 1R0BG 1GRIA 4A61A 1K0XA 1RAEB 1QVGM 3KNTA 3NMUA 4A53A 2A28A 1R9TJ 4XLHA 1E7OA 1ACIA 5HK0A 2VB6A 1RC9A 3HPHA 3VENA 1YI2T 4A3EJ 2VKNA 4BE1A 5AQIA 1E4FT 3HM9A 2BEOA 4F2RA 4CGFA 2NXNB 3HDDA 4N4IA 2VJ5A 2KBTA 2GELA 2NYSA 3C2HA 3EYYA 3QO3A 1WSGA 5HKCA 4JKBA 3P8DA 4KUMA 2QM3A 4DOZA 4H5NA 1SKWA 2M30A 5AQRA 4A4GA 1WGSA 1U9OA 4WQ5C 1Q1VA 3TO7A 3C65A 1LAVA 3JCUC 1QO0D 1HMVA 1TT5B 3LALA 1TAQA 1T38A 2VKVA 3I4MJ 3EUHC 3AO1A 4PL7A 1EFNA 2ASPA 3OVNA 2MWPA 3HUGB 3L09A 1QVGS 3VGMA 2K5CA 4XRSG 1ZBSA 1K73O 3F6OA 3WT0A 2K9QA 2NVXJ 4M77G 1XMXA 4AIJA 4H5RA 4RGUA 2E5NA 2JRTA 4BJTA 1SSHA 1C0GA 1EH8A 3EH1A 2H09A 3LDNA 1I50J 1GOAA 2KNBB 1VSKA 2OTJN 2QA4N 3LAKA 3K4JA 4OFHA 4K25A 4IUQA 1YRNA 3R6NA 1MJBA 4M3GA 2XDVA 1U4BA 5FGMA 3IRRA 2V1XA 2E41A 4H8KA 2E1NA 4GRIA 3H45C 2HHQA 1U48A 2MOXA 4A12A 2LK2A 5CLSA 1VQ6T 4DTXA 3AA2A 2A6HF 4JKGB 2G0EA 2VG5A 4VUBA 1EH7A 4YOXA 4UUTA 4MEXF 1ZBIA 5CYVA 3I58A 3B6CA 4PJOD 4OKEA 4F9OA 1Q18A 5D5XB 4FVUA 2R7RA 1KVAA 3CCQA 3QEVA 1ZELA 1R49A 2FPFA 4OB0B 5KYXA 4EA4A 1U2VA 4J9IA 3I5UA 1YW8A 1QQJA 5FPNA 4OF1A 2YHWA 4GCVA 3OYLA 4ID1A 4O8UA 1W5CC 1KGSA 3ENBA 4JS4A 3EQLF 1QLYA 1ETWA 3B8AX 4RM3A 4DB3A 1GLLO 2F5VA 3VS4A 8AT1B 2FF3B 1SRLA 1RI9A 3MCPA 3CP8A 3DPTA 1Z77A 2DL8A 1RETA 3TQ7P 4ZC3A 4EV0A 4M75E 4ELTA 4G94A 1TUUA 4KBOA 1NPRA 3VS3A 3NH1A 2V75A 3LDLA 5CQEA 2W82A 1VQPA 2EFPA 1WN7A 1YBYA 1YTYA 2A6TA 2CW0F 3V1OA 3QB0A 1VHXA 3I35A 1MBEA 3OIQA 5BR9A 1P6RA 2V7FA 2WV1A 3VEVA 9ATCB 2W40A 1FJLA 4CCNA 1ATSA 4CHQA 3HKZN 2LKPA 2CZ1B 3CFRA 3CD6I 5J39A 5K7ZA 3JRCA 3MXIA 4IFVA 4D8KA 4FU6A 2XPWA 2JZYA 4B3AA 4Z89A 2CH5A 2EFNA 4N9HA 2GNCA 4K42A 1FOXA 4BRAA 2O0YA 2OBPA 4EEFG 2NRAC 5HNFA 2NUTB 4EDUA 2DMOA 1IRGA 4CEEA 1O3QA 4M77C 4CZKA 3QG1A 1H9TA 1UHMA 3REAB 4B3RK 1WH7A 4XR6A 3I0WA 1I0CA 3VOEA 2ELHA 1IG8A 3ATVA 3JB9D 1S5LC 4YY3K 2IS1A 3PIOA 3ZSOA 4C92B 1RT6A 2JMWA 3LP0A 3IWFA 5IWAK 3HC7A 3IQLA 1S6LA 2UXNA 3M8EA 4LFCK 3G71N 5LD2C 5GAOq 4IIMA 4X6AJ 2RN2A 3C94A 4XKBA 2OTLT 3FRNA 5F0FA 4HDUA 4HUFA 1NZ9A 2EKOA 1Q86R 3DXKA 4M73A 4JKHA 3GMEA 3MZ8A 5K7FA 1YHQN 3C12A 1ILYA 3ZQHA 4AYBN 3A5NC 3RDIA 4JRPA 3BWGA 4I01A 5E26A 2LVSA 2KROA 3OH6A 1VQOA 3LWFA 4GV3A 3ZX0A 1IZ6A 3CC2T 3THXB 1GCPA 2DTRA 2D6FA 4JN4A 2A37A 4LXCA 2ICWG 1HKCA 1PVEA 1WJDA 4AM7A 4PJLA 3N4PA 4BRDA 4BBSJ 3KUFA 3I8DA 3PX6A 4BWJA 4Z4EA 2CP0A 1Q81C 1BIUA 3X20B 4LB5A 3K69A 1BGXT 3EZ5A 3O5BA 3ZN0A 1Q9YA 2D45A 1KAYA 4BDZA 1DT9A 1QQCA 2OA4A 3CUQA 5BN8A 3OL3A 1O4XA 1YJ9I 1SKRA 3MKWB 3OIPA 4M7DB 3VQAA 1RCHA 1QRYA 2CWEA 4JNEA 4Y0WA 4HHTA 1MMAA 2G6FX 3EH2A 2YHAA 1YIJA 3M0TA 1RAAB 2JPBA 1MUYA 2L7KA 5KPZA 3VQ9A 4YG2F 5HL7L 1WJBA 3NGPA 3CCSN 2EK5A 3HP6A 1VFCA 4G7ZF 3DXJF 4MFEA 4P9FA 2GAUA 3RWUA 1Y96A 4KN4X 1NK0A 1J75A 2RDPA 3ZT0A 1KQSP 5C15A 2OPQA 5I22A 4QSHA 3WTUC 4IDHA 4BH9A 1R5HA 5GMKi 4IOAL 5FKKA 5HCKA 3CMAQ 2AXLA 1ETYA 3O9QA 1QQIA 1HD3A 1KU2A 3J80K 1O57A 2QDYB 1GUUA 4LNPA 2P9IA 4DEYA 1DPUA 1MMSA 1T08B 4LJZF 1U0JA 4NXMK 3N4MA 1SFOJ 3QKJA 2W6LA 1JT6A 1P7JA 3KK1A 2GXAA 2J5PA 3ZQIA 2AZVA 5SZTA 3TSZA 3OBYA 3OYNA 1FSHA 5HROA 2E88A 2JUFA 3D5LA 1VQ8I 4MFBA 1NGNA 4JI0K 2IVMA 2PVOB 3LH5A 1G3TA 1YI2A 1N9SA 1F36A 3QYGB 2FBIA 2Z3YA 3DWLA 1MJAA 1VOMA 1TWBA 2QAZA 4CESA 2Y48A 3ZPLA 4EMGA 1QVPA 3HM5A 1RBSA 4B44A 2EYWA 1FC3A 3ROUA 2QWMA 1D9DA 3RCOA 1K8AU 1YJNA 5IP6A 1RRJA 2A07F 3R6SA 2ZFUA 2CP2A 2LNBA 3GTLJ 5EG0B 3IL2A 1OEBA 2VC0A 1H89C 2UXCK 4X9DA 3M0UA 2CGLA 5E3OA 1RILA 2EB7A 3CJNA 2R5YB 2HEQA 2W6KA 3CBOA 3I9QA 2RK1A 3OSFA 2O4GA 5C25A 4FISA 4FJ7A 3M7GA 4A3CJ 3IH7A 4M41A 1ZK8A 2VG7A 1DKGD 3QFPA 4JD2A 3EO3A 1FBQA 2ZPHB 1IXDA 3FXLA 3SZ2A 3URGA 2QEXT 2L3DA 4W97A 4FW1A 1A04A 3QWYA 1YW7A 3SV4A 3PY8A 5E8IA 2HOEA 4JHDB 1EWQA 1UA1A 3LMMA 4YORA 2H3JA 4H0OA 3CCLI 2WUSA 2FZKB 5GANj 1BC7C 3TAQA 2ZKZA 2LJ1A 2NRRA 4EJUA 4D5FA 3HPOA 1VIFA 1Q86C 4BR5A 3W2WA 3GBGA 3V8LA 4D6WA 3M8JA 1EO1A 3MP6A 1HLVA 2EYYA 4C8MA 1DUXC 4M6VA 4JKFA 4NUBA 2XD0A 4ZZLA 3B6AA 4C30A 1YN8A 4DS4A 1QQMA 1DU0A 1H9GA 1WUAA 4BRPA 3M8QA 4RTTA 1X9WA 3EUAA 2NS7A 4EATA 2PBIA 3ZT4A 4CJSA 1RGIA 3GTOJ 3GF5A 3PE0A 4OMMA 3RKXA 1VQ6A 2ZJQL 3CXCM 3SZTA 3WTWC 1OKJA 1RT3A 4C8NA 3KLEA 3DKMA 3CCMA 2EA4A 4FJ5A 3MCAB 4CD1A 3N4QA 2X78A 2FOWA 3CUQC 4CGZA 5DM6F 4BR4A 4G1QA 3TR8A 2JT4A 4E19A 4UXNA 4LIUA 3F8MA 1ZBUA 1LJOA 2EBIA 2ECZA 2XSDC 4CJEA 2ID3A 4J9BA 2YRDA 1I6XA 1C1BA 5CIUA 4CZGA 1E0EA 1PP8F 4M72A 5CO7A 2FEIA 1JKHA 3ENOA 3VEYA 5KRTA 3MP8A 2PFUA 1BQMA 1YTAA 4R56A 2VXDA 2HHVA 3CBMA 2G8WA 4XONA 3TBIA 3M0SA 4AMCA 2XVCA 2ZMEB 3E0JB 5KCOA 4B24A 4FT4A 4OMZA 1I94K 1M90R 2VGNA 2RHXA 3QDKA 1WGXA 3I0RA 3DBLB 4G9YA 1VQNI 1Q7YO 2OA8A 2BDPA 5GAEJ 3P9KA 1N8RU 2WSFE 2KEAA 2TRTA 3CXCS 3U3YA 1YQMA 1RBTA 5E1WA 2IGKA 3JSPA 3I0TA 1A6QA 3AAFA 1WI7A 4KRTA 2CP5A 4CHZA 4JX5A 4DV1K 4EM2A 5HDKA 3UE5A 1OYIA 1LB2A 4WXCA 3V4IA 5I42A 5K14A 2JTMA 4EJWA 3FIFA 1GOCA 1WVRA 4J9HA 2FF4A 3V81A 1EV7A 4XOTA 2E1MC 3IAS2 3AVAA 4A6EA 2GFAA 3MK6A 3K57A 4AI5A 1KVCA 1NGJA 4IQ4A 2IT0A 3INZA 2QF7A 3NNQA 1N6AA 4OPKA 2L0AA 5HRNA 3H0GJ 3HJFA 2ZJ2A 2WB1A 1KFSA 4A3BJ 3QWXX 3U9ZA 2EBPA 5GMKm 1J9IA 3L2QA 3TP0A 3FFIA 4E70A 3OH9A 4JI5K 2DAQA 2EIJH 3QBXA 1IBLK 2F9WA 1S7OA 4UNFA 3OOUA 1DGWY 3M0RA 3B6OA 5LJ3e 5AZJB 1OU9A 4B8AB 4PLLA 1E3HA 3IKVA 4IX7A 2OTLA 1W0TA 1FK9A 3CC7Q 2DVJA 4K41A 2DMUA 1P90A 4Z2YA 1W0HA 5LJ5j 3LAJA 5GJVB 1JUPA 1TLHB 1ZUKA 2O4XB 1ZH5A 2FUG2 1Q82R 3NFAA 3EGXB 4E7JA 3PX4A 2HVIA 4DBQA 3DB4A 2KIUA 5IOYA 5E84A 3MN2A 4FCYA 2XAGA 2E35A 2FOKA 1UG0A 4A59A 3O8MA 1GLAG 1K9MR 3CJ9A 4AIAA 3VQPA 4PDKA 3GFMA 4AVPA 2EGCA 3BTIA 4DSIA 3LOCA 1P59A 3LL7A 3S1QJ 2CG4A 1ZAOA 4C92A 1VQ7I 3OR2C 1Z7UA 2EGAA 2I8DA 3NH0A 3CMEQ 2O8FB 3LNQA 1YWOA 5DK5A 5E1XA 2UWMA 4F7UE 3BEXA 5GTIC 1ACMB 3ZSVA 1N3AA 4CD3A 2M8GX 1UFMA 1VQMQ 1T6SA 3ASNH 4YFUA 4QVCA 3DLLL 3OWTA 1OCCH 2R7UA 4CF2A 3X2QH 2FO0A 3SUNA 4A4KA 3QXEB 3K4NA 2A1RA 2IPQX 1XC3A 1GCQA 3MX2A 2SEMA 2JXBA 4OB2B 5AQUA 4H0PA 3A01B 3N5BB 1JGGA 2DU9A 2DTOA 4FETA 1ZG3A 2KHMA 3I56I 1QA6A 1FMKA 1FYNA 5CKEA 2RC4A 1N5YA 4RDUA 2G7HA 3HGGA 4PFOA 1VQ4Q 5ICEA 1FTTA 1UE9A 3QNOA 4JKDA 1YJWA 3O3HA 5AQTA 1ORNA 4ENKA 2XMFA 2F8SA 4Z8AA 2KT1A 2E5QA 2WAQA 2GOXB 2DMQA 3CCJN 3M59A 3WE3A 4C2TA 1UUEA 1BIZA 1BISA 1FXXA 4ELYC 2HQHA 3P31A 4WCEL 1JXSA 4CDGA 2CUBA 2OC6A 3LWMA 4DR2K 4XH1A 4Y13A 1VQLQ 4NLBA 5GIPA 1FZPB 4XLAA 1DTTA 2KRSA 1ZA1B 3DLKA 2DILA 4PUOA 2XDPA 2VC1A 7AT1B 2KRCA 1T8IA 3KK2A 3THVA 2FSWA 1JUMA 1RABB 2X9DA 1KG1A 2NOZA 4CI0C 1O1WA 5I2SA 4Z4GA 4KT5C 4M71A 3FJPA 2HW3A 4M78F 3AVNA 2HPMA 3KJVA 1M90C 5AQYA 4J8FA 4N0AA 2PJRB 2W00A 1REVA 3F73A 3RKQA 4N4GA 4L9TA 5CQXA 2ZC2A 3CMAI 1FPQA 3QHSA 2O8CB 4BR7A 1T0FC 4BJ6C 1F1BB 4FLTA 1AHDP 2BBYA 1W5SA 4G6TB 2CFOA 5KI6A 3L2UA 4L5GA 5LL6S 1IRXA 1AWWA 1HW1A 1USTA 1LOJA 4E89A 1D3BB 2KVQG 1D1BA 3EDPA 3F8NA 1H1VA 1YNZA 4CEZA 2P9NB 2MD0A 1VSHA 5BPMA 2FRWA 1MKMA 4BVOA 1VQKI 4M7DG 2YV0X 1SV5A 5KN8A 5F2RA 4RWTA 1KQ8A 5K5RA 4HKEA 1KHIA 3M07A 4DR7K 2JT1A 5F08A 4J2EA 1VSMA 4PSWA 3MKZA 2IS2A 1ZARA 1G83A 3VS5A 3A1YA 1BIBA 5J40A 4FWRA 2YNFA 2WA0A 3GEZA 3MN7A 3VEXA 1MBFA 3HHTB 2AS5F 4M7XA 2PI0A 2WACA 1K8AO 2NVUB 3WE2A 4ELUA 3Q0UA 4P1WA 4I2PA 1X4OA 4W5TA 3H0DA 4DU4A 2X1EA 4G6DA 3X24B 2R3SA 1Q82C 3EZWA 1VQ9Q 4BXFA 4HPQA 2ZF5O 2DYBA 2R5YA 4ESJA 1AT1B 4FYYB 1NKCA 3DQVC 3CF2A 4JKCA 3ECOA 4C92C 4DW6A 2JM8A 2IS6A 1PRMC 5FWBA 3IS9A 2UV1A 2E6MA 1C6VX 2DJNA 1VA7A 3SNNA 2P1JA 1JKOC 1JBMA 3UA7A 4P9UA 3O4QA 1OPLA 2X4XA 1FTZA 4F14A 2E5ZA 4G7OF 3W3DA 1GCQC 1PVSA 2A3SA 4U7BA 3CFOA 5GIOA 4ISFA 3I59A 2VOOA 1BK2A 2ZD1A 3ISNC 1J6ZA 4CEDA 2HVHA 3I3LA 3A8HB 1OVQA 3OYDA 3M8PA 3G4SN 2PTKA 3JYTA 2OPSA 3OW2A 1RNHA 3NTIA 3TL4X 4B9UA 3P5JA 3ZXSA 3VYGA 2DK8A 4RAZA 4Q47A 1ZSZB 4RAGA 3X28B 3QMLA 3PL8A 5FU7B 2OZ6A 4C3IJ 4DF8A 1UHCA 3IH3A 3UKUA 1RADB 1YT3A 1TZLA 4C5EA 3OYKA 4YOYA 4O4GA 3F23A 2P84A 2VBWA 1M3HA 5E3NA 3RPUA 1TK8A 2WY8Q 2BUDA 2P5KA 1L3VA 2D0PA 2DYSH 1PHTA 1XUPO 1TKDA 5M1NA 4M78D 3S3OA 1LKXA 1RACB 4KB0A 4MDWA 1IN7A 1YWPA 4II3A 5D6YA 4CBWA 1REPC 4M7DC 1S72Q 4CE9A 3MEDA 1MGTA 1VRUA 3AG1H 2AHJB 3U1DA 1YLFA 2KFZA 3I0XA 3RMSA 3MWPA 2FVUA 2ATQA 1X3NA 2QW9A 1KQSS 2MGQA 2MC4A