3OYMA

Crystal structure of the pfv n224h mutant intasome bound to manganese
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oymA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oymA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oymA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oymA03
3BGRA 3HT3A 3OYBA 1TKXA 1TGOA 3NAEA 3HP9A 3P8HA 2EKOA 4CFDA 5I42A 1X9MA 4RG2A 4IG3A 1BCMA 1VSMA 2R7YA 1NK8A 1JLCA 2G8UA 4KI4A 4ICLA 2KFNA 3C94A 4KAZA 4OLAA 2XK0A 3DRRA 4DS4A 5HBMA 3RMCA 4CECA 1LAWA 3NH1A 3A2FA 4C8MA 2FBTA 4FLZA 3M8SA 4L8RB 2FC0A 1WSJA 3NFAA 1ZBLA 1SKSA 4KB0A 1TKZA 2OPPA 3D45A 4XIUA 3VA0A 2RN2A 4CHNA 4FJLA 4KRFA 3KIOA 1NKBA 1TV6A 4DTMA 1Q9XA 3V9SA 3V9ZA 1REVA 3NHGA 4DF8A 4C8KA 4J2DA 1XNIA 5HRRA 3NDKA 3ZT1A 2L8DA 3QEXA 3VN5A 3CFOA 3H6ZA 4CIEA 3NBPA 4N56A 2XY5A 2HQEA 4M45A 4BE2A 3OYLA 2HHWA 1ZBIA 1J5OA 1HYVA 4GVMA 2KZZA 2X78A 4GW6A 5SWMA 1N6QA 3KKRA 4B9MA 1HQEA 3AA2A 4FK0A 2DY4A 2Z1IA 2ZQBA 1G5VA 3RTVA 3T3FA 4F4KA 4B8AB 4FJNA 2CKKA 4IUPA 3AVCA 1NK5A 3SQ2A 3FDRA 2KZMA 5CYMA 3S3NA 3LP2A 3VQ6A 4CK3A 2HHSA 4CEAA 3SPZA 2HB5A 1KVCA 4CK2A 5HLFA 4DSJA 1EETA 4CGDA 4CCHA 3HVRA 4IKFA 1C6VA 3OJSA 3SV4A 4CJVA 1JXBA 1D9DA 1KTQA 4E89A 3U3GA 3H8ZA 3DRSA 1HNVA 3RMDA 3PO5A 3PNWC 4DFMA 4FZYA 1VSEA 1UA0A 3LGLA 1WN7A 5E41A 5D6YA 3AVHA 2YRVA 3CG7A 4M3ZA 3VQDA 3OYKA 3O3GA 3NGIA 5KH6A 4TSXA 4NYFA 1KSPA 2G8IA 3B6PA 4N4IA 3HL8A 1CXQA 3IG1A 3UIQA 3LPUA 3TARA 1BIUA 1T05A 4WE1A 3TAGA 4NS5A 5IAYA 3ULDA 3AVJA 1EKEA 4AH9A 2B6AA 4H4MA 1QTMA 4QW2A 4BE1A 1RBRA 3OS1A 3DOLA 4CIGA 3NE6A 3QINA 3NGYA 3MEUA 4EDUA 3K5MA 3KK1A 3OYHA 1NJWA 4DTOA 4M3WA 1RDBA 1F21A 3IS9A 3P5JA 3HPGA 3LYIA 2PYLA 4FJHA 1YVUA 3OS0A 3TAPA 4PL6A 1JLBA 1RT5A 1OYXA 3ASKA 1RT2A 3VQAA 1D9FA 4KPYA 3RMBA 3TR8A 1WJQA 3DB4A 3LANA 1NOYA 4CJRA 4FJ8A 4F3TA 1KLMA 3NF8A 2D9TA 2G8VA 1KFDA 1W9HA 1HNIA 4CFCA 1YTAA 4KHWA 1BQMA 5HRNA 1FK9A 3QIIA 1ZBHA 3LX7A 2QK9A 4B3OA 3KD1E 2DFEA 4CJPA 1NJXA 4KREA 1IH7A 4FM0A 3HSTB 1TKDA 3MP6A 1RTDA 3UT1A 3CFRA 4BACA 4AHCA 3VQQA 1U04A 4YFUA 1X9SA 4ELUA 1BISA 5KGWA 3AVFA 2R5MA 4IFYA 1SKWA 4OLBA 2BIVA 3ZSVA 1S1UA 4CF9A 4IUUA 2G8WA 2RHZA 2PYJA 4W5TA 4ELTA 3L42A 4CRIA 2WOMA 2YHBA 1RDCA 3HPHA 4CJUA 4FLYA 3TAEA 3OYMA 3PO4A 4IUQA 4DTXA 1D5AA 4BDZA 4OJRA 4LD0A 3LP0A 4R5PA 3VQPA 3HPOA 4N4GA 4CF1A 1KLNA 5J39A 1SV5A 3AVNA 4FM1A 4DQQA 1J54A 1X1PA 3CEYA 1I3AA 2HHTA 1C0MA 5KRSA 1U49A 3M9QA 1NK0A 3T1AA 4OGCA 3ZSXA 2LSNA 2P5OA 1HJRA 2Z1JA 2I5JA 3L2UA 3LGFA 5KCHA 1O1WA 3FEOA 2WONA 2YV0X 4Z4CA 2XO7A 5HRPA 4O4GA 4KHYA 3NTHA 1Q9YA 5KI6A 3M8PA 4Q0BA 3MECA 2P5GA 2A1RA 4KFBA 3RWUA 4DU4A 3LDSA 3QEVA 1LWFA 4FL6A 2D5RA 2E6NA 2BE2A 3RRHA 3TANA 3AO5A 2KW4A 4G1QA 4JS4A 2R57A 1FXXA 4Z4EA 2ETJA 2IC3A 3FFIA 3TAQA 3OYEA 4NCAA 2RF2A 1FKPA 1VSLA 1S6QA 4B9WA 4GMJB 3VQ5A 2D0CA 4HUEA 3B6OA 4B9XA 1L3TA 1BGXT 2KQ2A 3H08A 4DQIA 4FJ9A 2RJEA 1KCFA 3AVLA 1WAJA 4E1MA 1UA1A 2O4IA 2BUDA 5CYQA 4DTJA 4QQ6A 2YKNA 5J2QA 2G8FA 4KHSA 1DLOA 3AVGA 3SQ4A 2PY5A 4QAGA 2Y1JA 2M16A 3TAMA 4II1A 4LD6A 3F9KA 4BWMA 3U6FA 4N4HA 2YNIA 3KLHA 4FLVA 2RI3A 2X35A 2RPIA 2OPSA 4CEZA 5C0MA 1LW2A 1NK4A 3RR7A 5DK5A 2E4LA 4O44A 4CK1A 4CEEA 4EP4A 1VSDA 3AA3A 3E01A 3OMGA 5HRSA 4CJTA 3NH0A 1RT1A 3O3FA 3ZEHA 4BD3A 4FLXA 1OZ2A 3PX0A 2OA8A 3SUQA 1XC9A 3LPTA 4N41A 4N76A 4Y1DA 4OKEA 3SCXA 3DM2A 2LDMA 3OYFA 2RI2A 2B4JA 3MEDA 3OVNA 4CJWA 3MEVA 2YNGA 4CF2A 3HXMA 3S6WA 3VQEA 1QSLA 4KHNA 1BCOA 2RKIA 3NTIA 4M3YA 3NF9A 4FLTA 3NNQA 3ZT2A 3QETA 4BWJA 1NK6A 4DFKA 3MEWA 4DSLA 1WJRA 1B9DA 4CERA 1HRHA 4CFAA 4EP5A 2PQWA 3ISNC 1VSJA 3T19A 4CGHA 2Y1IA 5HP1A 4M3RA 1JL2A 4OPJA 1NK9A 1TL1A 2QKBA 2X74A 3SV3A 1BI4B 1HYZA 4CJ3A 2GF7A 1W0HA 3HVTA 4DU1A 4DSFA 3OYNA 2L89A 3C6TA 3V9UA 1WSGA 4B9LA 2HNYA 3NF7A 2EQUA 5J26A 1JLEA 4HCZA 3KLIA 3QLHA 2Q3SA 3PX4A 4CEQA 4RW4A 1NKEA 2GUIA 1QSYA 4C8LA 2RHIA 4E7LA 3DLGA 1VSIA 3TWHA 1NJYA 2O4XB 3D0PA 3VA3A 4Z0UA 3K59A 1RBSA 1FKOA 4E3SA 3SI6A 5D6WA 5KE2A 2IOCA 3KTQA 4Q5WA 1EX4A 5CY4A 3E9FA 1QS4A 3WNEA 4ZHRA 3NCIA 3QESA 2XY7A 3S3MA 3DI6A 4AHVA 2O4GA 1L3SA 1IO2A 4UQGA 3META 3S3OA 2LTOA 3AO3A 3KD5E 4KHUA 3KK2A 3OA6A 5J2NA 3QO9A 4KI6A 2HQXA 3AA5X 3MO8A 3AA4A 3SUNA 1ASUA 4CF0A 4BDYA 2EQJA 2EQMA 2OZSA 3OS2A 2IAJA 1I39A 3OY9A 1JLFA 3L2VA 4PA1A 4Y1CA 2XY8A 3DRPA 3ZT4A 4DTRA 1NK7A 1NJZA 3AVIA 1ASWA 2L3RA 1LV5A 4E7IA 1L3VA 4FJMA 4DFPA 3F70A 1LAVA 1WSFA 4DF4A 1C1BA 4QQDA 1NOZA 3BDLA 5J2PA 2EHGA 3K57A 4LSLA 4C5GA 1SL1A 2WACA 1JKHA 2OPRA 4E0DA 3KLGA 1RNHA 1SUQA 1XWLA 2NUBA 3SD4A 1GOAA 4AHSA 3ME9A 3TI0A 4BDPA 1HYSA 1Z26A 4Z4IA 3AO2A 4I2QA 3K58A 4O55A 3OMCA 2XY6A 1SL2A 4DWIA 2EFIA 4HVJA 1KVBA 4FYDA 4IDKA 5KCOA 4B9VA 2VG6A 5I3UA 5FDLA 2JTFA 3OYJA 3O4QA 2GFUA 3V9WA 5K14A 3I0SA 3ZSWA 4FLUA 3AO4A 2HVHA 1UAXA 4EZ9A 3VQ4A 3DB3A 4DFJA 2P51A 3NF6A 4ELVA 2R5AA 4LH5A 3SJJA 3MEGA 4O5BA 3ZT0A 3OYCA 1D8YA 5FROA 2IG0A 4FJGA 2M0OA 2E6LA 4KTQA 2X4YA 3P83D 3EY1A 2HHXA 2HHQA 4L59A 2DFHA 4B9UA 5KTQA 2QXFA 4CJ5A 2RHXA 3OJUA 3PX6A 1QE1A 3JSMA 3AVKA 1ITGA 3WNHA 3MXIA 4NZGA 1SSFA 5M9OA 1VRTA 4CFBA 2F8SA 4E7KA 4PQUA 1TAQA 5JS1A 4E19A 3KJVA 4CGGA 4CGIA 1CZBA 4CHYA 3KK3A 3V4IA 2LRQA 4JRPA 3NH2A 3HO1A 2ITGA 2IGIA 1TVRA 3EYZA 1LW0A 1IKXA 3LP3A 2HNDA 4AHUA 3LWMA 3RMAA 3G10A 1QHTA 4Z4HA 4KTWA 2D0BA 3V1QA 4N5SA 4J2AA 4C8OA 4DSEA 3OYIA 1Y97A 3DLKA 5SZTA 2VWJA 2HNZA 4QCLA 4CJLA 1RILA 3SUPA 2LVMA 4AHTA 1JXEA 4KV8A 2X4XA 2VWKA 4CE9A 4K8XA 3DLEA 2BGGA 1CLQA 3VQCA 3QJ6A 1RI0A 2P0KA 2F96A 1ZBUA 3V6DA 3AVBA 1WGSA 3PMTA 1S1XA 2YNHA 5IN1A 3V1RA 4DG1A 4B08A 4HCCA 4FXDA 2FBYA 4H8KA 4DLGA 4CJFA 2DIQA 2E6MA 2HHUA 5J2MA 1RDDA 2VG5A 3LP1A 4DSIA 4DTSA 1C1CA 4BE0A 2XHBA 1T03A 4Q5VA 1SKRA 1LWCA 1H3ZA 1RTIA 1WLJA 2GV9A 4CJKA 1XHXA 4CJEA 3ZSRA 4MQ3A 3I0RA 3MXMA 1U47A 4KHQA 3JYTA 1RBTA 4A4HA 1HPZA 2XRIA 1CZ9A 3AVAA 3HP6A 1KFSA 1JL1A 4CHZA 2KFZA 4YNQA 4IUVA 2AJQA 3NTKA 4UC4A 4FW1A 1A5VA 1UOCA 2EX3A 3VQ7A 1K6YA 3CM5A 4E7HA 3LALA 3Q1JA 3ASMA 3DOKA 4LSNA 4OKJA 3EZ5A 3QNOA 4CEOA 3L2WA 1S5JA 3V1OA 4CJQA 2B5JA 4DTNA 4DQPA 4F3OA 2A1SA 4J2EA 1J9AA 3I8DA 3RR8A 2DFFA 4RW9A 2RJDA 2NLUA 1RBUA 3FC3A 3ZSQA 4DLEA 4B9TA 3SPYA 3V81A 1WJSA 4CIFA 1S6PA 2D0AA 1RTHA 5EU7A 2FHDA 3PV8A 2RHUA 2JGUA 3AV9A 1BQNA 4ID5A 4I9LA 1BL3A 5KRTA 5FRMA 4O0IA 4F8RA 3HYFA 2OPQA 4M3XA 4GY5A 5T7BA 4RW7A 3DLHA 1JLGA 2MWPA 3K2PA 3LZJA 4HUFA 3PMIA 4CESA 1XI1A 1ZYQA 3LZIA 4JRQA 3DLRA 1C1AA 3ZT3A 1WSEA 3LWLA 3C95A 3VQ8A 4CEDA 5CZ1A 3SYZA 4FJIA 1WAFA 4FCYA 4IFVA 4DU3A 3QIPA 1TK0A 3WNGA 4HCBA 4M3TA 1MU2A 3P1GA 4KTZA 2QQRA 4ID1A 4MFBA 4C5IA 3HM9A 5C6SA 2G8KA 5D3GA 3KKSA 3AO1A 4FW2A 4I7FA 3KLEA 1DTTA 1T8EA 2HW3A 1T7PA 4DSKA 1NKCA 2IS3A 5KE3A 4Z4FA 3AVMA 3QEIA 3MEEA 4NCGA 3QEWA 1TL3A 2HVIA 2RO0A 4B9SA 4AILC 1OZ3A 3L2QA 2K3XA 3KLFA 1QQCA 4NCBA 3QBYA 1ASVA 1RT6A 1WSHA 3UWNA 1QSSA 4A4EA 4DTUA 3ZSOA 3O8VA 4J2BA 3QERA 4FK4A 1EXQA 1HMVA 2DTUA 3M8RA 2X6SA 4FZXC 1RT4A 4FJJA 4FJ7A 3HK2A 2OYQA 4JS5A 1L3UA 1TAUA 4Z4GA 2ZD1A 1JLAA 2GBZA 3OB9A 4B8CA 3K5LA 2LCCA 3EAEA 1RTJA 4IBNA 2RJFA 4RW6A 1VSHA 2HMIA 4QOZB 3CQ8A 1S1TA 1RDAA 2RHYA 1IKWA 3VQBA 3OYGA 3PFSA 2DAQA 3LAKA 2O4XA 3E9GA 1C0UA 3ZSYA 3V9XA 1XHZA 2QKKA 1L5UA 4FLWA 4FJKA 5C24A 4CEBA 4F2SA 3ZSZA 3K5NA 2BKDN 1U45A 1JLQA 2QQSA 4RG8A 3FLGA 4A4GA 4PWDA 2VYTA 2FBVA 3MEAA 3QIOA 3IAYA 2RJCA 2P1JA 4CHQA 2DIGA 2IDOA 1X9WA 2ZE2A 1VSKA 4CHPA 3CFPA 4ZTFA 2VG7A 3VQ9A 3DMJA 2FBXA 4RW8A 4DTPA 3DLMA 2JLEA 3TAFA 4N47A 4O0JA 4CEFA 1IG9A 3MP1A 2YKMA 3SQ1A 3SQ0A 1SL0A 4IUTA 1LWEA 4W5NA 5FRNA 2R58A 4OKKA 2RI5A 1ZBFA 4W5RA 3QEPA 1R0AA 2KTQA 4NYNA 4FJXA 4DS5A 1WSIA 4FU6A 3F73A 4FJ5A 2PZSA 3SZ2A 5CIUA 3L3UA 3U3YA 5HROA 4CJ4A 3K5OA 3CYMA 3L2RA 2E5QA 1Z25A 3M8QA 1DTQA 4HHTA 1S1VA 4LY7A 5D6XA 4CF8A 4FM2A 3TABA 4K8ZA 2F8TA 3HJFA 3DLBA 2F5KA 1J53A 3C4SA 2M1HA 3WNFA 1VSFA 4PLIA 3O3HA 4I9QA 3LLRA 4C5EA 1RT7A 1UWBA 1VK0A 4M42A 4LH4A 2MWOA 4W5QA 1IKVA 4QVZA 1VRUA 4PLLA 1WNSA 5CZ2A 2BDPA 2HHVA 3KUFA 1N5YA 4DQSA 4A4FA 4H4OA 2K3YA 4OVLA 3SUOA 2X6NA 4C8NA 3MP8A 2Z1HA 4X34A 4HUGA 1GOCA 1G15A 2YNFA 3NGZA 1TK5A 4IG0A 1S9GA 3OQ5A 1U4BA 1EP4A 5JS2A 2B8AA 1BHLA 1YTUA 1BIZA 3LAMA 4QQGA 1RBVA 4CGFA 4EZ6A 4F2RA 4CHOA 4JLHA 1OI1A 1YT3A 4OPKA 3RRGA 2G3RA 3THVA 3P8DA 2BANA 2YHAA 3PUFA 2ATQA 4ZTJA 1HQUA 1RCHA 1N27A 1GOBA 4KKOA 3ITHA 4CJSA 1KRPA 5C42A 4DMNA 4C5HA 1S9EA 4KO0A 4M41A 3L3VA 3ZCMA 1B92A 1BI4A 4DQRA 3C6UA 2XDPA 3S9HA 1KVAA 4E7JA 2X4WA 1RT3A 4AHRA 4CGJA 2G8HA 1Q8IA 4KB1A 4OGEA 4OVAA 5KGXA 1B9FA 2EQKA 2Z1GA 2JZ2A 1C0TA 5DMRA 3O4NA 4B9NA 4PY5A 3LH0A 2W42A 4PUOA 3MXJA 1S1WA 4W5OA 2OZMA 4Z02A 1A5XA 1U48A 1KHCA 3BDPA 3PY8A 1A5WA 4M3UA 2GFAA 3OYDA 1TKTA 3OYAA 3IRXA 3QKJA 4HTUA 3DYAA 1IKYA 3SNNA 1TK8A 1MHNA 3MAQA 3CM6A 3ALYA 4I2PA 4E1NA 3G0ZA 3QNNA 1CXUA 5J1EA 5C25A 4FK2A 4FZZA 4IURA 3L8BA 3GOXA 4FVMA
chains in the Genus database with same CATH superfamily
2QBYA 3J81E 3OYBA 2ROTA 4RG2A 3F2KA 1BIBA 1V4TA 1JUMA 1R00A 1QCOA 1HA8A 2VL8A 4CECA 1SZ2A 4FSVA 4L8RB 2JPSA 1M2VA 1JJ2P 4AF1A 3VA0A 2M87A 3LH5A 4K43A 3A0IX 2DMNA 2MFZA 1SFOJ 3KVGA 3UE5A 1SHFA 4Z6YA 5L3EA 1HXDA 1VQLQ 4B9MA 3W3DA 4RB1A 1YG2A 4JJCA 2ZQBA 1G5VA 2UXXA 2KYBA 2TDXA 4IUPA 1HJDA 2KZMA 2HB5A 4CK2A 4IO9L 1NGAA 2VQLA 1X6BA 3SJMA 3U3GA 2J4RA 3OYKA 1DPUA 2DPPB 1BC8C 3VODA 3TARA 4M7XA 4PJOD 1UJ0A 3QQAA 1RBRA 3BDUA 1Y71A 1KYWA 1D9FA 3ZN0A 3DBRB 4J9IA 5CKFA 1GUUA 2JA5J 3OYYA 4ANJA 3AGRA 4BROA 3SHWA 4BACA 5AQJA 2A6AA 1ZSGA 1YBYA 2G8WA 1SAZA 2YG9A 4Y91A 2VBXA 3PO4A 2IA2A 3O8HA 5D6EA 1Y1VJ 4R5PA 2X4HA 1SD5A 5A0DA 4HKEA 2DJNA 4KBMB 2KIQA 3HSFA 3O8MA 3M6GA 3HM8A 3G4ST 1TH7A 3O9UA 4KGXB 4KAZA 2H94A 4CZLA 1WIEA 3H08A 3ERMA 3JRGA 1TQMA 2OCEA 1KD1C 4AT1B 4KRTA 5AONA 4QAGA 3BW1A 4FLVA 4GBQA 2NZTA 4CEZA 2D4WA 4PFZA 1O9SA 1I27A 1V4SA 4CJTA 1MWMA 4KHNA 3CCJI 3CCQN 4LF9K 4MIMA 2GIZA 2DL3A 4DSLA 1OLTA 5GAHJ 1SHGA 4CGHA 2FE3A 1Z9CA 1W0TA 3SWNA 3CCST 1JL2A 3FZLA 4J9CA 3CWTA 4R8HA 5AQTA 4XLNF 3C1DA 3N05A 3CCUA 4UV9A 2ID6A 2CS7A 5CVVA 4U87A 4C0DC 2VV5A 4Z0UA 1VQNN 2QLZA 2IOCA 4CZHA 5F0CA 4AG1C 3SEQA 4XM3A 3DKXA 2O4GA 4BQLA 2IGOA 1RFQA 5AQRA 3H0DA 2C0OA 1MNMC 3OMYA 2YCHA 2RF0A 3GNFB 3SBTA 1UDLA 5GJVB 2XAGA 3HOSA 2BH1A 1Y0MA 3NVKA 4E1JA 4RLQA 2KT1A 4HX8A 5LJ5g 2VQFK 4CHUA 1D1BA 2OFKA 3TBIA 1AVZC 5FDLA 3OYJA 4JHDB 1R4NB 1BK2A 4V2FA 4C92G 1UG0A 4RA2A 2QSGX 1YJNQ 4Z94A 2R5AA 4OMYA 3K70D 3ZT0A 5DD4A 5FROA 3LSMA 1R1UA 5M5YJ 4L59A 2BY3A 3V7RA 2QXFA 1WKMA 4O3MA 3QYBA 1TAQA 4QVDA 4CHYA 3U21A 4M7DC 1M1KC 1GLCG 1VQ7A 2ITGA 4Q48A 2IA0A 4DJAA 1NHAA 2VWKA 2CUEA 2V1XA 2BW3A 2BGGA 1CLQA 3G25A 3VQCA 4A62A 2BUPA 4FWOA 3V4GA 3CDHA 1WGSA 3UA6A 4JJDA 4L9TA 2RQVA 3DXMA 2W03A 4RAGA 1SKRA 4EJOA 5BPDA 3A4CA 2NOEA 2RKHA 4IUVA 1KG1A 1QZEA 2XU8A 1KG5A 4DV6K 4F3OA 3JAME 1MH4A 3MPUB 2DZ9A 3JR9A 5BPIA 4RW9A 4BJ6C 4WF9L 2MIOA 4LD9K 3DXKA 4M7AD 4M3XA 4OWRB 4JDSA 2JJ9A 3BF1A 4XLAA 4HCBA 1W5TA 4WQ5C 4G6TB 4GKKK 1BOTO 5JFRA 2JTMA 1X58A 2K85A 4FW2A 3A8MB 3EEQA 1KD1O 3A0HC 3JCMd 1IGQA 2LQWA 3QEIA 2MSYA 4NB5A 1KONA 1DJ7B 1FNNA 4BRHA 5IOZA 3F22A 4J2BA 2MF2A 1TW3A 2QW9A 4CC4B 2CG4A 1RUWA 1VQ9Q 5FW9A 1XG7A 4AFUC 3CCRA 1VQ6T 3HKZN 1QCFA 2KEAA 4D7NA 2QQSA 3E19A 2VYTA 3QIOA 4PJOB 1VSKA 2YRCA 3P8BB 4O0JA 4EA5A 3H41A 3VWBA 4MZPA 3K0SA 3JV3A 2RV8A 1ZKGA 1NKUA 2KIFA 3U3YA 2A6TA 5EY4A 4HHTA 4CF8A 1D5YA 5BNGA 4AFQC 3LFUA 2IVWA 2YX4A 4Z2YA 1M27C 4JLIA 3JB9H 3B6AA 2ZJPL 5C44J 1G15A 3NGZA 1XC3A 1BHLA 2BZ8A 1B34A 1PUFA 4FWNA 2KHOA 3TSQA 1Q1VA 2R7QA 1VTNC 3HOZJ 3WGGA 1P7JA 1BI4A 2FF6A 1X2QA 4DQ2A 3CC7I 2WBNA 1SMYF 4LD5A 1WJDA 2LCSA 3DEEA 5ADXA 3ZETB 2PNIA 4C3JJ 1TNSA 1K9MO 3L7WA 2G8HA 3OYAA 5D6FA 3BGRA 3HT3A 5IHNA 3NAEA 3HP9A 3L1PA 1NK8A 3OL4A 2HKQB 1W2BS 5HVQC 2HBJA 2FSKA 2QA4Q 2FA5A 2DBKA 4FSSA 1KU2A 3HB9A 2A6HF 5HS7A 1WEFA 2KT0A 1HKCA 1SKSA 2XVCA 2HZYA 4G9ZA 1JT6A 1UHCA 3M0RA 1A31A 2NS0A 1AZEA 2L8DA 4L3QA 1ZARA 1TXQA 1Q86R 1LDKB 1YJ9I 4GVMA 3CO6C 4FWQA 1IDYA 1KIKA 5GAN7 5IWAK 4F4KA 3CCLN 4BGDA 4EIKA 2H1KA 5CYMA 1YIOA 2QEXI 1BM9A 4EA4A 1R6RA 5GANj 1SRLA 4AM3A 5GAN5 1KQSS 5KCMA 2QEXQ 4Y3OA 4M77G 3O3GA 1NGGA 2QSHX 1CXQA 4IHWA 4CI6A 3LPUA 3I8BA 4GV3A 2LY9A 4G6QA 3LMMA 2QK0A 1UFFA 3CPWS 4B1XB 3HOTA 3NGYA 3KEQA 1OOTA 4AFSC 5JLFA 1UCRA 3P5JA 3GIBA 3J7AF 3ASKA 3TR8A 4K25A 5K1YA 3J7ZI 4IL6C 1KU3A 4EMHA 1RKTA 4UB6C 1X27A 4KH4A 4C92C 1U5TA 1K9MR 2Y0MA 4YFUA 4BI8B 3QPLA 1K61A 2RHZA 2QGGA 4O5VA 5F0FA 4C8QC 2YHBA 2A36A 2MLGA 1HW2A 2HYGD 4HOBA 3CEYA 4ENMA 2M8EA 1RABB 4G7ZF 2QTDA 4KULA 2HR3A 3KZBA 1HKBA 2L0KA 2E35A 3HSBA 5JI6A 4AG2C 4G1QA 2FRHA 1FXXA 2R57A 1KG4A 5GANg 2ETJA 3AAQA 3IKMA 1Q86O 1KK7A 1VSLA 1TT0A 3PSIA 1FJGK 1KCFA 2A7YA 4XAXB 2K2MA 1N3CA 1ETOA 2NRHA 2E7XA 1FBUA 3C7JA 3EE9A 4LD6A 5AR0A 3HHTB 3E6DA 3FZVA 2L5QA 3CW7A 1XTDA 2E4LA 4NL2A 4JX6A 3OMGA 4FLXA 1RT1A 2Y48A 4BRFA 3QICA 2WADA 3I55Q 1WJRA 2VE8A 1Q81O 4EP5A 3V8JA 1ETKA 5L3DA 1BU6O 2TCTA 5KQ8A 2JA6J 4JP0A 4OU0A 4JRKA 3UF4A 3DWLE 1STZA 5J26A 3QLHA 5D4SA 4KGZB 3R8EA 5GANf 4DYCA 2FVUA 4CCNA 1Z77A 2KAFA 4LXCA 1UJYA 4ZHRA 4IWVA 4AHVA 2V75A 4M77A 1OX9A 1SANA 4XTWA 1Y0NA 3OA6A 4IOCL 4BDYA 1D0XA 2QQ9A 1VQKI 4DTRA 1ASWA 1R8OB 4QVCA 5GMKh 4HV5A 4BY7J 1HYSA 4AHSA 2XAHA 4I2QA 2OI3A 2F4OB 3OMCA 4DWIA 4FO0A 1U6ZA 3RKYA 4LLGF 4B1VA 5KCOA 3J7AP 1VQ5T 4JJNK 1H88C 2ZGWA 3WE3A 2GFUA 1I3QJ 5K14A 3VS4A 2OTJQ 1OYWA 1RAGB 2EAYA 1GLFO 4YTLA 4IX7A 2R3SA 3VTIA 3GFLA 2HHQA 5H6QA 4IOCF 3COAC 3M0UA 1JJ2M 4FWRA 3WNHA 1VRTA 4LLLA 2ELKA 4H5WA 2LRQA 3Q7CA 4ZGJB 4OF1A 4BQOA 3K69A 3G10A 1T38A 3TP3A 4OFHA 2JUGA 2VWJA 4M71A 2K4YA 2DA2A 4CJLA 1RILA 1B59A 2X4XA 3JREA 2DXUA 3DKWA 2HAXA 2JHNA 1ZBUA 1IBLK 1XC5A 2QKLB 1VA7A 2OC6A 4BRGA 5AQWA 2DIQA 3G71T 1KU7A 2JW4A 2PVGB 2R7WA 3QDRB 1JU5C 4A4HA 4I7HA 1JGGA 4NLBA 3QMLA 3LALA 3EG3A 4KUMA 4CYDA 2OTJT 3VDXA 2HF4A 2GUPA 3S2HJ 3FRNA 5E8GA 5EXWA 4NL3A 3OW2M 3DXJF 3VEZA 3PIPA 1RL2A 5HK3A 2HSPA 4FPBA 5D5WB 2A5YB 4HDUA 1VQKT 2DA4A 3QUIA 4FJIA 2Q0RA 3HM9A 1VQ4Q 2XIDA 3D6RA 1AWJA 2OA4A 3S2DJ 1T8EA 3TO9A 3ASOH 4QWQA 4PUSA 4OIPF 5B8HA 4B9SA 1UHFA 2GZWA 4XONA 4NCBA 4J7IA 2DTUA 3I56T 3ZMTA 3EAEA 1VQ5N 2NOFA 4MQVA 2BKDN 3F21A 3N4QA 2HQ5A 1LJ9A 5JVGL 5HCKA 1M90R 2ZE2A 5DLOA 1YJ9T 2GWKA 1W1FA 5CVRA 1WXBA 2XB5A 2O8FB 1Z1DA 4BRIA 2VJ5A 1ZGJA 1K76A 1FTZA 1QGPA 2XF7A 5GIOA 3KNTA 1X69A 3L3UA 5BN9A 4HXJA 2XUBA 1K6OA 5DTDA 4FISA 1V55H 3P4IA 2Q97A 4XTZA 1W6XA 4ILJA 2V1UA 3G1OA 1QVGM 1X3WB 2BDPA 1VQ4T 5FU6B 2YHWA 2BHYA 3CXCS 4C8QD 1NGBA 3P9CA 4IG0A 2A5WA 1OCCH 1HNZK 4DBQA 1WHKA 2YHYA 1PWTA 2Z9OA 2H8WA 2VBZA 3VGKA 5ILVA 1S29A 2WTEA 3MMYB 2L3PA 4EJTA 2QEXN 1YRNA 1A5WA 4XL9A 1TKTA 1HF0A 4YOVA 3R1XA 1TK8A 2IIRA 2ISYA 1CXUA 4FZZA 3MJXA 4J7FA 4B4CA 3P8HA 2JK3A 1Q7YU 5FO5A 4CBWA 1YIJN 2AIRB 1LAWA 2CDTA 3A2FA 2OPTA 3RPQA 4HNVA 4YOTA 3HRUA 3CC2N 1XGNA 1GCQC 4ZYAA 1RZ4A 1PRLC 2P6TA 1MBKA 2HHWA 2X51A 5SWMA 2O8DA 3N4MA 3BE3A 4BXUA 3I58A 1YIJI 5GAMj 3H0IA 4TVRA 4JKGA 4F04B 5BREA 2A0FB 1KTQA 5CE3A 4A5NA 3CCRQ 2I5UA 1IN8A 2O8DB 3JRDA 1MD0A 1KSPA 3W2AA 3QG1A 3N97A 3QAHA 4DGWB 5BS6A 3BQYA 1KGSA 5JICA 3C0CA 2JM8A 2ISZA 3OS0A 3VQAA 3ZMZA 3DBHB 3QU3A 2EH3A 2OCCH 4CFCA 1ILYA 3IHOA 1MJ9A 3QIIA 1NPPA 5J3BA 1NJXA 3S32A 4RMOA 2YLBA 3NFCA 2X3XD 3AVFA 3CMEQ 4FPAA 1IREB 3FXJA 4FT8A 3OHRA 1BYMA 1YQRA 3MKZA 1OCTC 4IUQA 2AQFA 4RUGA 3H0FA 1WQWA 3VQPA 1G2HA 3ULQB 1K7AA 4A63B 1USTA 2HHTA 2PX9A 4FWLA 2F7TA 5GAGJ 3WUHA 3GBGA 2R7FA 3K1PA 4A5BA 3FEOA 5BR9A 2YV0X 1FIPA 5HRPA 5KI6A 4Q0BA 1B72B 4XSXF 4KFBA 1XS9A 3R60A 3PSFA 2GNCA 2COMA 2R92J 4R79A 2K02A 2SRCA 1UEBA 5J4VA 2A28A 3B6OA 3WGHA 4DQIA 1KHIA 1WAJA 3JCMf 3OL3A 1VQ9N 2FO0A 3D7SB 2DT5A 1X2KA 2P0PA 4I6ZA 1SC7A 3IH2A 4UVCA 1XGOA 2DLLA 4RAZA 5C0MA 2HQNA 2KSSA 3VGLA 2HL3A 5FPDA 2CH5A 3SUQA 1XC9A 5ILUA 2BGCA 3K4BA 4IEIA 2B4JA 5CHZA 3S6WA 2P9SA 3CCMI 1DGKN 4CFAA 1ZRDA 2EPDA 2QAZA 2E5ZA 3E1YA 3A1YA 1IRFA 3VS2A 4XMYA 3CCVT 2GUIA 1NEGA 1ZXOA 1Z3YA 1Y7XA 2E36A 1Y8RB 2G7HA 5HS8A 2LBFB 1WJFA 3UDCA 2LTOA 4XRMA 2EZIA 2P9NA 3QO9A 4CZMA 4AFZC 3BG6A 3VOEA 3OSSC 5MLCQ 2WBMA 2F4IA 3DU6A 5DYMA 2NUBA 1VYTA 1G8XA 1NMDA 3H6EA 4C23A 4C92D 3UR3C 3M4YA 3DXMB 3NWTA 5JVGF 4ISGA 2DJQA 2JTFA 3CMEA 4WXCA 3I0SA 2K4JA 5DM7R 4L5GA 4BQQA 4BXXJ 4IXCA 3VYGA 3D1NI 1YI2I 4DFJA 3T1HK 3ZP5A 4O5BA 2IG0A 4KTQA 4BUGA 3P83D 5GTIC 2OV7A 3M4GA 2RHXA 3PX6A 1VQ5A 3KP7A 3L0QA 5CR2A 4A2BA 4B1UB 1IKXA 2FXAA 3RMAA 4FE4A 4GO1A 1H1VA 2DN0A 4DSEA 3VS3A 5SZTA 1UHSA 2EA4A 4KV8A 3HTVA 2QF7A 4P5OA 4HT9A 5EEHA 2H8HA 4BR5A 2A07F 4M7DF 4FQGA 4XSZF 1TUYA 3C0BA 4LFBK 1R0BG 4DBFA 4EEFG 1T8IA 4FT4A 2VXDA 4FSXA 1LFBA 4UUTA 4HF1A 1BR4A 4C8QG 2QWLA 3PO3J 1K8AO 3L2WA 3M0PA 4BGAA 4UXNA 2DFFA 2NLUA 3G1LA 1SAUA 2FB7A 4BR4A 1QVTA 4PJOG 3QPSA 3H3ZA 3VRYA 4BR9A 3PMIA 4JRQA 3LSKA 2P7VB 2WAQA 1DP3A 5CZ1A 2E19A 2D1XA 4M7AE 2G8KA 1NJIC 3F0CA 4C2TA 3KKSA 4JKCA 5KYNA 1QLYA 3H0HA 4AILC 1QQCA 1WSHA 4WXDA 1QSSA 2DF6A 4DZPA 1M3HA 2X6SA 4KJZA 3SAHA 1VQ9T 3GLLA 2GBZA 1F36A 2RHYA 2JPCA 3ZSYA 1VQ6Q 2L0AA 4CEBA 4A3LJ 3RMSA 3R0JA 1P59A 1TWGJ 4M6XA 3VQ9A 2G7UA 2VXEA 3SQ1A 2KI7A 1K8AU 4GXOA 2EYYA 1CZAN 3ECHA 2E5QA 1BR1A 2Q1ZB 3FXQA 3O3HA 3MFKA 1O75A 5BOXA 4P9UA 1LE8A 4XKBA 4C8NA 2VT2A 3MZ8A 3IRRA 4ENKA 2VYPA 2ZFUA 2Y9ZA 4PGHA 2PUOB 4QQGA 2L4AA 5AZIB 3LFKA 3X2QH 3LCNA 1RT3A 2H3JA 3I0WA 3W3CA 1HOMA 4JZ3A 5KYYA 3EYYA 1Z9QA 2JZ2A 3M57A 1W70A 1U6GA 2VBYA 1BDGA 1A5XA 1W36C 2BV6A 3SNNA 2HU9A 2LR8A 3CM6A 4I2PA 4BC2A 1DT9A 3SEMA 3E0JB 4KI4A 3VF6A 4ICLA 5CKDA 2J06A 2KISA 3BDDA 2AZSA 2UUZA 1GXIE 2ZGZA 1WBBA 2LLKA 1MJBA 2LKXA 4OMFB 2OZUA 2O8KA 1IAWA 3ZQGA 4J9FA 3OYLA 5EJCA 3KKRA 5ILSA 2BVLA 4MLHA 1QQJA 2DTIA 5IT3A 2KLOA 3T0YA 3SQ2A 3K4MA 1HJOA 3BQZA 4Y4RA 3HVRA 4FWMA 2WAEA 1LPLA 3HEFA 3CF5L 2XF5A 1DGRM 3CCRT 1T3LA 3RMDA 3PO5A 1UA0A 2M1BA 3DEWA 1ZELA 2EKHA 3VQDA 5D8KB 5KH6A 4DOVA 3R0AA 1S1NA 4LGWA 3CD6A 2E34A 1HPMA 3ULDA 2VQEK 1PNJA 1VRLA 1NGCA 3HRMA 4C92A 4OMLA 1E7OA 1JI8A 3WODF 1VQ7T 4BY6C 4UNFA 2EYXA 3MKYB 3DP7A 2MH9A 1TOVA 1HLVA 2DETA 4CH7A 3KD1E 4F91B 2E1MB 3LL3A 4DKWA 5D7UA 3JRFA 1V5EA 5ERIA 2LX9A 3CLQA 5AZIA 3O9TA 1X9SA 3FM5A 1TU0B 1J59A 1VQPN 4W5TA 1R5ID 3IKTA 4DK9A 3CC7Q 4BDZA 1KLNA 5FD6A 1WH7A 3W6JB 2Z33A 1HJRA 3G71A 2D8JA 2XO7A 4Z4CA 1Q9YA 2XGDA 2P5LC 4DU4A 5JMVA 3TCJA 1O7LA 2L2OA 2IC3A 3OYEA 3DTEA 3CCJT 1JKOC 4CYCA 3G7ZA 3AVLA 3MCZA 1FZPB 4E1MA 1IV6A 2KL4A 1T56A 1OR7A 3KP2A 4ORZA 1B6AA 1QA6A 4DTJA 1HKTA 3I56N 2XDBA 3JCMg 1MMDA 2EV5A 4G94A 4NC8A 5FLXE 2IPQX 2EBPA 3G71N 2DA7A 1W7AA 1NLOC 3R9PA 3VS0A 2WB1N 3PX0A 3REAB 3DFGA 4PK4A 1MSFC 4BRCA 2IGKA 5HLHA 3CUQA 5J8CA 2P0QA 1G4DA 3MEWA 2WY7Q 1NK9A 3WU2C 2VE9A 3GFJA 4CZCA 1RETA 3NF7A 4XTXA 3DXKB 1WZ2A 1YW7A 2ETHA 3G71I 5KE2A 2DTZA 4CZJA 1TYQB 3K7AJ 2V51B 4B3MK 3FZFA 4IZ9A 3META 5EG0B 3O80A 2CUJA 1KD1U 1WFXA 1OMIA 5KN9A 5KYWB 3HFOA 2EQMA 3ULRB 2LH9A 2M34A 2XPUA 3JB9J 3NMUA 2P5VA 3FHNA 4Q47A 4FWKA 3TI0A 3FR0A 3AO2A 2Z1DA 5K7ZA 4J19A 2DA1A 5KHDA 2KMTA 2V7YA 3ZQQA 1PCXA 1UAXA 4CCJA 1RAAB 3CF5F 4ELVA 1D4XA 3RUXA 1KG7A 1YS7A 4OFAA 1JTYA 3ECOA 5KTQA 3EFRA 3RCOA 2PMUA 3KETA 3JSOA 2XAJA 3LWFA 1JE8A 1WHGA 1AZGB 3LP3A 2QA4N 4MFEA 1RDWX 2D0BA 3HBTA 5IT9O 5LJ5e 4XTYA 3E66A 4CE9A 3CJBA 1ETVA 4CD3A 2EQIA 3LQRA 2CP0A 1RI0A 2P0KA 1FWZA 2JRMA 2VIXA 5LLQA 1ZSZA 3GE1A 3GBQA 1POGA 4UUVA 1V4RA 1HUXA 3ZSRA 4MDWA 4BR2A 1YHQI 3VYSB 4FW1A 2EX3A 2CP6A 2A61A 2ZFWA 1MDMA 2ITMA 2K9MA 4B9QA 1BW5A 3OS5A 3FMQA 1FN7A 3SK3A 1M3BA 3HBLA 3VS7A 5FKNA 2JNGA 2MMPA 1ITYA 3EFOB 2KKOA 2XPVA 2CZ7B 3AG1H 3NAUA 3O1WA 1ZYQA 2H3GX 4H5RA 3FJ5A 1WAFA 2UXNA 2QWMA 3ABKH 4DV2K 3MCPA 2STTA 1I5LA 1W2BM 4Z4FA 3QODA 4XH5A 1KQSM 2XIGA 5DDGA 3KLFA 4CCOA 2AHQA 3RMQA 2IW5A 5LRSA 3M8RA 4FJ7A 1EZZB 4CZGA 1WH5A 2B7EA 1S1TA 3MX5A 4FZYA 4NNJA 5CQGA 2W10A 3VKIA 4O6JA 4L0ZB 3TOBA 4GFBA 1U45A 4U0WA 4J83A 2RHKA 5E1WA 4PWDA 4A3FJ 3TEDA 2P9UA 4DEYA 4ZTFA 4Q4ZF 2P9UB 4F92B 1H3HA 1YO5C 1YJ9Q 2QKMB 4FJXA 4YDUA 4M3EA 4PZJA 4Y7NJ 1FP1D 2F5TX 4M63C 2NWMA 3JXUA 1DTQA 2DL4A 1VSFA 1R71A 4AWXB 2NUZA 1LEBA 1VK0A 1NG2A 2COBA 3EETA 4PLLA 1M9SA 4L6V5 2NVYJ 1N5YA 5L3FA 1X3NA 3MAJA 4BI4A 1QKXA 2P84A 3MWTA 5M3FJ 1RBVA 4S05A 4KT0E 2BE9B 1JCFA 4B3TK 3MVPA 4ZYGA 3AAFA 2ATQA 5C15A 1GOBA 3FHFA 1IJWC 2IVOA 3C6UA 2F2EA 4CGJA 4OGEA 2HD0A 4RB2C 5KGXA 1ZHIA 3M9AA 5FLXO 1IB8A 2OZMA 1RRSA 3OYDA 3RVCA 1MHNA 4J9EA 1CF7B 4IZZA 2C0IA 2M0MA 2VKDA 1HKSA 4CYCB 1WYXA 1C6VX 2DLPA 2ZXWH 1JGSA 1VZ0A 2CUDA 2G8UA 1VSMA 1JLCA 1J7KA 4DS4A 1IN7A 1KAXA 4JK8A 4B21A 4HLXA 1FYKA 2OPPA 3QSUA 3MN6A 3SDZA 3KIOA 1OCPA 2CUFA 2BY2A 1MWKA 4CIEA 2EILH 2A3LA 1IC8A 4AIAA 5K7FA 3LSIA 2KK4A 4B8AB 3CCQT 4YOWA 3E97A 5HL7L 5HLFA 1SPKA 2C6YA 4K2EA 4LE9A 2QWPA 4YORA 1BIAA 5J1RA 1VQ5Q 3F6VA 1MGQA 4FWSA 3HGGA 4KHPK 1YLFA 1HDDC 1FPQA 4OFEA 1XOVA 1S3JA 4OX9K 3CJ7A 4QIWN 5IP6A 2CGHA 4HYEA 1VQ7Q 5EEGA 3U23A 5AQIA 3OTOK 1JLBA 3C7NA 3RMBA 4C3HJ 3C7NB 2RNJA 1VQ4N 1ZHFA 4C9YA 4M75G 4CCKA 4S0HB 1TUDA 3HHHA 2M5WA 1X6OA 1V54H 4XQFA 1FMVA 3FSPA 4OLBA 1KSWA 4MZMA 5AT1B 4WQ4A 1T0HA 4JI7K 3FKIJ 4IO9F 4CRIA 5DCMB 3DV8A 4CJUA 4LG0A 3HOYJ 3VOVA 3IMXA 2MG4A 3C18A 4DTXA 4EHTA 4RB3C 3ZQLA 4X1EA 3QP5A 4ESRA 3L2UA 3LGFA 2Z99A 1E4FT 2P9KA 1WLPB 2AQEA 1P90A 1TWBA 2YT6A 4D9JA 2K5IA 3CERA 4UNOA 1OH6A 5GPCA 3ROUA 2DA5A 4JS4A 4LDVA 3KWIA 4XRSG 4MNUA 1HCRA 1L3TA 2AJQA 3GTGJ 1SFXA 2A37A 4EJYA 3D5SC 2YKNA 1U5TC 2H3EB 1YFHA 2QDYB 4LF6K 4BWMA 2DT7B 3SMSA 3VU3C 3RR7A 5DK5A 1R1VA 4CK1A 5AQMA 3E01A 5HLGA 4PJ0C 1LPQA 1NG6A 1ACIA 4N41A 1ZC6A 3DM2A 3A2KA 1SKUB 5LJ5j 2FD5A 1OPCA 2K5LA 2XROA 4EVVA 3NTIA 4FETA 3NNQA 3QETA 1LOJA 3N5NX 4DU1A 1OVYA 2L89A 3I4MJ 4CZKA 4B9LA 1WSGA 5GAMd 2RB6A 4C8QF 1IGUA 2M45A 3I3LA 1P4AA 2Z16A 1FJLA 4XLFA 2KRCA 3KTQA 4Q5WA 4XU3A 4BBSJ 3WNEA 2WV1A 3QBXA 1VQON 5JVHL 3KK2A 3CJTB 2CSQA 2JA7J 2HQXA 3SUNA 1Z3XA 1QP2A 5DM7F 3G6EQ 3H92A 4J6XA 4FWPA 4PNOA 4XH4A 2E1OA 4E7IA 2E3HA 2I7PA 5JR3A 3F70A 2FLOA 2GXBA 4DF4A 1D3BA 4BR0A 3ELKA 3GO5A 1OULA 1EO1A 4PKGA 1U9NA 4O55A 3TW7A 2QSFX 1V76A 1Z6RA 5E26A 3G6EA 1YW9A 2D0NA 2XGEA 1M1EB 2RC4A 2L3DA 2X4YA 2P81A 2BVMA 3HOXJ 4F16A 1WEGA 1DKGD 2E2QA 3L09A 3JSMA 3CJCA 1SSFA 1OQKA 3THKA 4E7KA 1FMWA 1WI9A 3RERA 1GDTA 1S9HA 4YFNF 3BUZB 1I0CA 2HNDA 4PJOC 3A1PA 1Y97A 4K42A 1F1BB 3WEEA 2VPRA 1UHMA 3DLEA 2NOGA 3BF3A 2K2VA 2OTLA 3F10A 1YQAA 1RDDA 2VG5A 1IBKK 1RKWA 4AD9A 4BKXA 1N9RA 1O57A 2WSCE 4F9OA 2UYTA 3NTKA 2I2LA 2YJFA 5LHIA 2ZCWA 5CJ9A 4ISEA 1J9AA 3PO2J 4DLEA 3CC7T 4RGSA 2NVXJ 4CZZA 2M8GX 2QDLA 4FYXB 3EFSA 3BZCA 2WC9A 4BH9A 4ESFA 4AMCA 3F8BA 3GZ6A 5IT9Z 2OPQA 1XPXA 3K2PA 5HDKA 2PU9B 4QOZB 3F8MA 1TK0A 3PUBA 4MFBA 5C4XJ 1T6CA 4ID1A 2XHKA 3CC7A 3EUKL 3OIOA 2YUPA 4DEXA 3KLEA 3CVSA 2JUFA 3EGDB 1GXQA 3MEEA 5LL6Z 3VEVA 3CVTA 1GCQA 3EG1A 3HYIA 2K3XA 3U9ZA 1FYNA 4YEJA 4BRLA 4WQ5A 1Y0UA 3CQ8A 4FJKA 1DU0A 2XG8D 2AKLA 3HTSB 3IAYA 2P1JA 1X9WA 4BC3A 3KCCA 5H20A 2PQ8A 3VEXA 5FLXZ 3O6BB 3K70C 5FRNA 1R0AA 4YG2F 3CJRB 2X85A 3F73A 2P9NB 4FJ5A 4EMKC 4XIDA 2FZKB 1JTXA 4K8ZA 3VV0A 5CPRB 4AYBN 2OJ2A 5EX5A 1E6HA 4WQ4C 1PG5B 1U5SA 1ON1A 5AQVA 2JWLA 2L3QA 3IAS2 1MA9B 2R7RA 2WWYA 2ZMEA 4HUGA 1S9GA 3ASNH 1AHDP 2ZPFB 2P9LB 4YOYA 3AG3H 3SMPA 2O3FA 1WPYA 1YCYA 4B43A 4BREA 3HL2A 2KPMA 4JNEA 3H46O 1YT3A 2LDUA 4C8QB 5EF6A 2GTDA 2CQKA 1RCHA 4N76A 3ITHA 1NNEA 3E5UA 1B92A 1KVAA 1LWYA 4IEJA 1NK3P 2EJ9A 4F14A 5GMKj 3PNTA 2PVDB 4J5YA 3A8LB 1YI2T 2GFAA 1KD1R 1YJNT 1IKYA 3DTIA 2HBMA 5ICGA 1ATRA 3M07A 2BY1A 1W2BA 4IURA 3MXMA 4HW0A 4BHBA 1RRQA 2MLKA 2BYVE 4EJVA 4IG3A 2DO7A 2L9NA 4FX0A 4RTVA 3D45A 4C2MJ 1NH3A 2NOLA 4RTXA 2I5WA 2AZVA 3FJPA 2FEZA 1NGHA 3V9SA 4C8KA 3KK7A 2AT1B 3VN5A 3CD6I 1WHJA 4AIJA 5KK1A 3DKMA 1GLLO 1YHQN 5IHKA 5LD2C 5F0HA 3RTVA 4C92E 4EQQA 3M0QA 2HPIA 2YU9J 3IUCA 2HDAA 3D5RC 3ZMDA 2JQ7A 2WAFA 4CJVA 4DFMA 1W5SA 3CCMN 2HXIA 1N8RO 2YRVA 4J00A 3NGIA 2RQUA 4B48A 1M3CA 3B6PA 2OBPA 4CCLA 4OP0A 1KAYA 5IXFA 5D5XB 3K5MA 4M7AC 3I55I 4GLMA 1MH3A 2IIMA 2HNHA 4JX5A 2AA4A 4CJRA 1FYMA 4CBUA 2R7VA 1XMQK 4OO1J 3LX7A 1SQKA 4JKGB 1KQSA 2IT0A 3ABUA 4BAYA 4AHCA 1FSEA 4IIOA 4JLGA 1BISA 4LITA 2CQXA 1KEAA 2VC8A 2NAZA 2MPXC 2RE2A 1Z67A 2CO5A 2DE0X 4B3SK 3M9QA 1YP5A 2PFBA 5KCHA 2IBDA 2IRFG 3MECA 4M75E 5AZJA 5F6FA 1S3XA 3TTCA 4JV5K 2CQ7A 2KRMA 5LGUA 4FJ9A 5CCAA 2HL5C 4IO8A 5AFUH 5J2QA 2VKVA 5JHUA 5LJ3f 1YN8A 3O5ZA 2OQRA 1VQ9A 1KQSP 5A2QE 3FXKA 2Q0UA 2QYZA 4CEEA 2DJZA 4BD3A 1CGPA 3SCXA 1X01A 3OYFA 1TC3C 4A61A 2CV2A 3HXMA 1BCOA 2LKPA 5LL6S 2PUKB 1YITA 1F1ZA 1VSJA 1MMGA 2E71A 5EZGA 2EZLA 1HYZA 5GMKl 2AHJB 3ZOBA 2CP2A 1N78A 2Q3SA 2AKKA 2HTSA 1APLC 2O4XB 1S72N 4E3SA 1A5JA 2M9HA 5CY4A 3E9FA 1T6DA 2MC4A 2KVQG 4EM0B 1ZH5A 1HD3A 2A41A 2DJIA 4MEXF 3AA4A 1KG3A 2OZSA 1VQ8I 1NK7A 2L3SA 4FJMA 2HKOA 2N8GA 4NC7A 4QQDA 5J2PA 2QGUA 3K9TA 3U9DA 3IH3A 1IV8A 2OPRA 4FYYB 1J09A 1O3RA 5L8RE 1B4AA 5DD8A 4XNFA 2Q2EA 1VQ8Q 1UECA 1BA0A 3VJPA 4GNIA 2LFBA 5KAFC 4LB5A 3V9WA 4B47A 4AC0A 2ZF5O 4EZ9A 2PZ1A 3SJJA 2XMFA 2E6LA 4HQMA 3CCQQ 1I1SA 1EA3A 1X43A 4E9HA 1LDDA 1ITGA 3MXIA 5CVUA 4HEA2 3EG9A 1X4PA 4XRFA 3CCJN 1VQOQ 3RSEB 2HDDA 5KYWA 3VTHA 3V1QA 4XICA 4NDLA 4MGRA 1I81A 2E2JJ 4F55A 1I6XA 3R6SA 2OF7A 2HBLA 1ORNA 1R5GA 4PJOE 2YNHA 3QZ9B 2K7LA 4IQ4A 1KXPA 4BQZA 2FBYA 1U5TB 3ZQHA 3MN7A 1DDNA 2QA4A 1T3SA 2FPFA 4M7DE 2VKHA 3CCLQ 1RTIA 4DR5K 2KGTA 3HP6A 2ME0A 4A3MJ 3CM5A 4E7HA 2VB6A 4CW7B 4AI5A 4PJOA 1SG5A 3RJPA 4V2GA 3CPWP 1VQLT 2H6CA 1RR7A 2MOXA 3VF2A 2CH4A 4KFCA 4ASNA 2VUBA 2FSNA 2FHDA 2RHUA 5GP9A 2ZO4A 2VQGA 3M1FA 1VFCA 2ZM6K 4GY5A 3TQNA 3EHQA 2KBTA 1WRJA 5GANd 4CGZA 2NRVA 5DCMA 2EYZA 3LWLA 4CEDA 2NNNA 4BJ5C 4A12A 5C6SA 3IP4B 3RKQA 5LJ3j 3VESA 4E9GA 3T1BA 2ZCFB 1T7PA 2IS3A 2BE5F 4P1WA 1ABOA 3J80Z 3ZSOA 3WTWC 3IV5A 1CQTA 1FP2A 2H1LA 2XHIA 3LDNA 4B8CA 1BOAA 1LQ1A 4Z89A 1EWQA 4QS7A 4F3TA 2DAQA 4IRIA 2FSJA 3ZEUB 1FBSA 4YPHA 3JAMZ 2E5KA 4Y0WA 1K4US 1U2VA 4Y33A 2IDOA 1OVQA 4M75A 3S17J 4D8DA 2YKMA 3SQ0A 4IUTA 4FU6A 3F9MA 1VQOI 8ATCB 4M9ZA 2E2IJ 4FM2A 3ZETA 3C4SA 4HVVA 1YTYA 3T9NA 3KP5A 2EQRA 5IT9K 2DA6A 3ZQFA 3OW2A 4A2AA 3DTKA 1WNSA 1WFWA 3VPZA 2PBIA 5GAOl 1U4BA 2KROA 1EP4A 3KZIC 2HTJA 2DEQA 6PAXA 5GAOm 2P9KB 2ZBKA 3Q0UA 2JN6A 2G3RA 3I64A 3ZX3A 4ZTJA 1I94K 1XTAA 4KKOA 2DERA 2QKBA 4KH0B 4KO0A 1Q95G 1Y1WJ 3H9JA 4A57A 2VXFA 4M7DA 3QYEA 3AL0B 4F7ZA 2EQKA 1GVJA 4GYIA 1PVSA 4XLEA 5FLXK 4DQ8A 1UGVA 4HWIA 4ISFA 1U1SA 4HTUA 3QKJA 1TQPA 2Z0WA 2HDCA 5BMZA 4IDHA 3CF2A 3V7SA 1NYGA 4PFPA 1IZ1A 2H8RA 5HBMA 3RMCA 5E1ZB 1WSUA 4IQJA 2V1RA 1ZBLA 2CJJA 2GEMA 3VMFB 4BR7A 4CHNA 3A8GB 3URGA 4KRFA 2FZCB 3I55N 2EBIA 3V9ZA 3S93A 1QQMA 2L9RA 3H6ZA 1MNEA 2LMDA 3IDHA 1N6QA 1RDUA 3ATVA 3MK6A 1UAAA 5GAMh 1E3OC 3AVCA 4LNPA 3FMRA 3F8FA 4M73A 4M77F 1I07A 2DFUA 4YY3K 4IKFA 2J05A 1HSQA 3H8ZA 3DRSA 3RQ4A 3IHUA 1Y96A 1VIEA 4XRSA 3O8GA 4CI0C 3CG7A 4EFHA 2K9LA 4XN3A 4G12A 3OW2P 4QW2A 2DOFA 1GL5A 1PHTA 3KK1A 1I8FA 1ETYA 1YVUA 3TAPA 4HZFA 2UUCK 4KPYA 3H35A 3M56A 2G8VA 1W9HA 4D0PA 1KC8U 2V1QA 4AI4A 3PLAA 4EM1A 1HDPA 3MP6A 4CJ7A 3TTFA 4C1NI 1M4ZA 4M75B 3HIFA 4I6MB 1XGSA 3U1DA 4GLKA 3BR2A 1ATSA 2WOMA 1WHMA 1PKSA 2WV0A 3ZGKA 1B3QA 4CF1A 4FM1A 3BY7A 4I99C 2NRZA 3KPHA 1XCVA 4RTTA 4PL7A 2Z1JA 3REOA 2FOKA 4C0DB 4YIRX 3RWUA 4JI8K 1B9NA 2CZ1B 3IKVA 2D45A 4M7AB 3O4WA 2GAUA 2GGRA 1NGEA 1S6QA 7AT1B 4HUEA 1R49A 1AU7A 2RJEA 1TTYA 2Q36A 3SYTA 4QQ6A 2FX0A 1DLOA 3ENHA 2AO9A 2UWMA 5AQUA 2M16A 2HZDA 2K6DA 1TWAJ 2RPIA 3BJ6A 2FYKA 1PYVA 1RGIA 4EV0A 4XLCA 1BO5O 1Y56A 3OVNA 4CJWA 3DAWA 2W4SA 4HG2A 4FLTA 1NK6A 4H5NA 4NHJA 3TTDA 1MKMA 1W0HA 1OU8A 3SAGA 4MDAA 2E60A 1NG9A 4GKJK 3P31A 3TMOA 3AY9A 2F5VA 2ABKA 4M3BA 1MMAA 2E1NA 1G59A 3NCIA 3KHYA 4UQGA 1EH6A 3L2ZA 2JS2A 1OYYA 5GADP 3BTLA 4B1ZA 1D0ZA 2JXBA 3C6HA 4HSBA 4PFOA 3P39A 3KFWX 4DOZA 1WSFA 3W2VA 3JCMb 1Q86C 3EFOA 2LF7A 1XMOK 1S7OA 1F4KA 2E64A 3ULEA 2V1NA 2E3IA 1K4SA 1W7PD 2O2OA 2PLYA 2EZHA 2VASA 5GAMg 1QO0D 2DQLA 2M0OA 4L9JA 4ABZA 2M7AA 1SS6A 4PQUA 3C3WA 2NVQJ 1HLUA 4YIIA 4CGIA 2HWVA 4PJLA 9ANTA 4AHUA 2YUNA 4MMKA 3HSCA 4DIQA 4DV1K 3DLKA 4ELYC 2ZPBB 4AHTA 3QJ6A 4JI1K 3CPFA 2EGEA 3O3KA 2K40A 3R6OA 1U8BA 4ME7A 4I0AA 4CJFA 3BR0A 5IHIA 4YOQA 3EH2A 4IF4A 3ZCOA 4BE0A 1EQYA 1QQNA 1W1WE 4OB2B 2GV9A 2RMOA 3I0RA 3F23A 1ZSZC 2V8KA 1UGPB 2DBBA 4LDUA 1U3EM 3LA2A 1IXRC 3A01A 3ASMA 2VCPA 1D8JA 1FC3A 3M0SA 2VXZA 1YQKA 2LNHB 3JRCA 2RJDA 3GP8A 3QOPA 1N34K 5C0YA 4F8RA 4BC4A 5FRMA 2DILA 2V9VA 1AOYA 1Q82C 2VJJA 4ZDOA 2JVVA 3F72A 4FCYA 4IFVA 4KITB 4L9NA 1BBYA 3FF5A 2ADUA 4EW4A 1YJNA 1ONVA 1BJZA 4UV8A 4UOBA 2HVIA 3G4SN 2EV6A 3AG4H 3O8VA 3QZ5B 2HEQA 2QVOA 4JS5A 2ZD1A 1JLAA 5GIPA 3FHGA 4RTZA 2BXYA 1IKWA 3PFSA 4YRVA 5DEQA 1M2VB 2ZPGB 5C24A 4F2SA 4E7ZA 4EGZA 5LJVA 2A69F 2GX9A 2Z5UA 4FTHA 2DIGA 1MUDA 3DMJA 3DLMA 2DKGA 4N47A 3PIOF 4FYVB 4W5RA 3PFYA 4NYNA 3RYRA 2CGJA 1R58A 2QGFB 3A5NC 2BE7D 2FNPA 1YNZA 2EJRA 1T0FC 3CQXA 3CCVA 2DXTA 4AM7A 1JCEA 4IVNA 4H0OA 1E2XA 1VQ7N 1XSDA 4OINF 4QVZA 2R7UA 3CIPA 3LM9A 5C2DA 1DEJA 2HNIA 5JS2A 1DQUA 3CUQC 1WVRA 4WF2A 4ZN3A 2O8BB 3RI4A 1N27A 3TO6A 2JHJA 2ELJA 3J80K 4XLPF 4DQRA 3SZPA 4MHGA 2XDPA 2X4WA 3BTCA 2FRYA 4KB1A 4H03B 5DMRA 2JVGA 2W42A 1UZCA 3T7ZA 3RTRA 1KHCA 3PY8A 4X1VA 3I55A 3EKSA 3KEYA 4FK2A 4FVMA 1O3SA 2VOPA 5I42A 3O08A 4A3KJ 2R7YA 4F3QA 4BRKA 3QOEA 3DPUA 4CC3A 4JD2A 2Y90A 3U8XA 5GAHP 1W2BP 1WSJA 3EKUA 1H89C 1AD5A 3CCRI 2KRSA 3CMAT 4IHTA 1Q9XA 4X65K 4IOXA 1IRGA 1R7JA 4S04A 2UZKA 3CFOA 1TWFJ 2ZPIB 1LVAA 1N32K 4ZGDB 1HU0A 1HQEA 3AA2A 1OISA 2HYJA 3CPWA 5J3LA 3RSNA 4N0BA 5GMKi 4LG0B 2M3AA 1S5LC 2LRDA 3GLXA 5D6YA 3CCSI 2F2WA 5F0XA 4C0ZA 3BR6A 3Q3SA 4NS5A 4AH9A 3PM1A 1SFUA 2M30A 3NE6A 1N6AA 2R5ZA 3OYHA 1C0FA 2ZSHB 5KVRA 4A0YA 3I35A 2MC3A 1R0CB 2Z2SB 4RCCA 3PTAA 4MTEA 1VQ9I 1MUZA 1E3PA 5GMKm 4JKDA 1WI7A 3CC4T 2FF4A 5KQDA 4YHHK 2B63J 3TVTA 4A0ZA 1X2MA 3VEOA 1JJ2S 3CFRA 2O8EB 1NM1A 2OTJN 4I01A 1PSEA 2CREA 1SKWA 4M77D 3ZMUA 2BIVA 2ZXJA 4B09A 1MBGA 3WGIA 4ELTA 5KYYB 3HPHA 4BEHB 2QEXA 1I1JA 1QVGS 3AVNA 5CKBA 5KRSA 1U49A 5KYUA 1IUFA 4O4GA 1TNTA 2V8IA 2HSEB 2BY0A 1U78A 2F2VA 1G3YA 2MD0A 3FXLA 3Q0VA 3TSWA 3VQ5A 3JCMJ 2HHHK 5CQYA 5CQXA 3OSGA 3V8KA 1UA1A 4F52A 2AXTC 3K9JA 2O4IA 5CYQA 2DX1A 5IP9J 2JT4A 3QYHB 2PY5A 3FISA 1UGSB 2G0EA 1D5VA 1EV7A 1WB9A 4A0XA 3ESWB 1ZRCA 4BRNA 4XORA 1BA5A 2KNBB 3NH0A 1OZ2A 4MO7A 2LDMA 3MEVA 4KIGA 4WK8F 3ZT2A 3CCMA 1HR0K 4CERA 3ISNC 2Y1IA 2Z3YA 3BTJA 1BI4B 1IN6A 3R61A 1OH8A 2XGXA 1AEYA 2COYA 1IXCA 9ATCB 3PX4A 4CEQA 1ZBXA 5HK0A 3DLGA 1WJCA 1MZBA 1PUFB 1FKOA 2KHMA 2NRTA 5AYFA 4RGRA 3QESA 1MUNA 3S3MA 3UNGC 2LVSA 3WXJA 1M5Q1 3BWGA 3AA5X 2NUTB 1F9NA 4FK0A 4H0YB 4QS9A 3FXMA 1X6GA 3QO3A 5A2QO 5A0GA 1T2KA 4PGGA 3ZXSA 1S72A 4NOYA 3ME9A 4Z4IA 3K58A 1SL2A 3MN2A 1SEMA 1UB4A 2V26A 3RDIA 2EYWA 4ZYDA 4LK0F 2A42A 3I59B 3S41A 1RI7A 3VQ4A 1Z6TA 4KA4A 3MEXA 4MTDA 1QCNA 1TQIA 3JS6A 4GRIA 4HQEA 3AVKA 2F8SA 2J7IA 3PNVA 1L3LA 4CFBA 5E3LA 1Q7YC 2GELA 5I21A 2EINH 3V4IA 4JRPA 3NH2A 3FWEA 2EFQA 3ZBDA 2X1DA 2I8DA 3SEZA 2CP5A 3SWNC 4QCLA 2E88A 1TS9A 3RNJA 1MMSA 4AUXA 4BRPA 3RSEA 2P9IB 2GOXB 3G6ET 1S1XA 1LCKA 3V1RA 4HCCA 2ENMA 3VEPA 3S8PA 2K3FA 4ITVA 1X3ZB 2UXDK 3DLLA 3HC7A 2MYSA 2ECZA 4KHQA 4MLOA 2KRHA 3I4PA 3CC4N 3X26B 5E8IA 4JYAK 4M77C 4LFCK 2Y4YA 3V1OA 4CJQA 1LVKA 5I22A 1O13A 4ZZLA 2ELHA 2W25A 5ICFA 1GRIA 5IH2A 3PV8A 3RPUD 2D1VA 3HUGA 3CJAA 3T8RA 1XSVA 4HUFA 3DLRA 5HDGA 3ZT3A 1WSEA 3C95A 2DL5A 3FZHA 1WCMJ 4BJTA 3C2HA 4F7UG 4BY6B 4EGYA 3LDOA 3WXKA 2IA1A 3REBB 4C8QA 3F6OA 4BEHA 2UUBK 5E17F 1P2FA 1RIOH 3OSFA 3QBYA 3N5BB 5FGMA 2ZXIA 4NUBA 4U7DA 3QERA 3KWGA 4M4ZA 4XEIA 4DV4K 4V19K 3I9V2 2F1LA 4BXFA 1XHZA 2QKKA 3Q5FA 3K5NA 5BR8K 3WG7H 1P7MA 3FLGA 1X1AA 2XI9A 5M1FA 4RWTA 2LY1A 4CEFA 2KYMA 3TREA 2RN8A 1SL0A 2E2OA 2LP0A 4HX7A 1XGMA 3CQTA 1K1ZA 4B6MA 3PT9A 1UGRB 3E3VA 1FTTA 3TABA 3CCUT 3DLBA 3TU5A 3WQUA 3OBWA 5KYXA 2A40A 3CXCA 2F4MB 1J3TA 5LEJA 3VEYA 4W5QA 5K5QA 4H4OA 4CBXA 5C10A 4XN0A 1ODDA 1TK5A 1NEBA 2NUPA 3A03A 3JRHA 3RESA 5TKYA 4DR6K 3SB2A 1Q81R 4CGFA 2P9SB 4CHOA 1EBMA 3BY6A 5H2FC 2MH2A 1ETWA 2LBFA 3LDQA 2IP2A 1YX3A 4I09A 1SVLA 2K9NA 4P5NA 3S1MJ 3H9GA 4NXNK 2LJ0A 2Z1GA 3H45C 3KLOA 1IHWA 4H0VB 4PUOA 1HW5A 2XF6A 4BQAA 3MAQA 1W7PB 5J1EA 1NBWA 1UTIA 5FFXA 4M78C 3GOXA 1WXTA 2LCLA 3B73A 3K2AA 3ID8A 1G3TA 2NRAC 4HSTA 3M8JA 3LA3A 3GZ5A 2AXLA 2FBTA 4FLZA 2RN2A 3LAPA 2W00A 1M90U 1ORKA 2STWA 2UU9K 5FU6C 2ZAEA 1K78B 3NDKA 2QQ8A 3RYPA 2XY5A 2HVRA 3CBMA 2IGNA 1IG8A 2YJEA 3C6AA 3AGKA 3CMAA 1Z7UA 5HY6A 3G6EN 2FNAA 4RKUE 2R4GA 2R7SA 3D2EA 3OJSA 3EQLF 3ZX2A 3UA7A 1HNVA 2LG4A 2CUZA 3GBTA 1U8RA 4I02A 1QTMA 1ZUYA 3GNGA 2P5KA 1VQLN 4DZJA 1RAIB 3VETA 4EDUA 1S22A 4M3WA 4P96A 1IBMK 5M1KA 3LANA 3I56I 4KHWA 4UUSB 1KFZA 2E2HJ 2ZPHB 2MA3A 3M4OJ 3EGXB 4WCIA 5GAOr 3ID6A 1MBFA 1QHHD 1R9TJ 3KXTA 1X9JA 4IFYA 2JMCA 1WJBA 1S1UA 4FLYA 3TAEA 2X4JA 5AQYA 4EIAA 3OR1C 1VYVA 5L3CA 1ZG5A 4LD0A 4N4GA 1TUUA 1J54A 4KT5C 3L6QA 4J6YA 3ZSXA 4KUIA 4FJNA 4Y92A 4BB7A 5C3EJ 5M5WJ 2E6NA 4KGVB 3RQIA 5E3MA 3TANA 4Q5SF 3M1EA 2RAEA 3GTJJ 4JRIA 1FKPA 1W36D 2RNAA 5A0LA 1IHVA 5CKTA 3VEWA 3HGYA 2OTLI 4Y13A 3L4QA 3JB9D 2DYBA 4N4HA 3LW5E 2RI3A 2OPSA 4PKIA 4OMQA 5EYRA 3O3FA 4JAXA 1W97L 2RI2A 2B0LA 3PIPF 4M3YA 3ENBA 4BRDA 1R77A 3QDFA 5LJ3e 5F1XA 4DUZK 3ZYYX 2CQNA 5GANe 1M3QA 3H9QA 2V79A 3KLIA 4HCZA 1DU6A 3CCLI 1ZX6A 4RW4A 5LJWA 4L18B 5CAIA 3H1VX 3K59A 3SI6A 3ABLH 2DMOA 1QS4A 4KN4X 1LE8B 2DDAA 1JXOA 2QUFA 2DRKA 1GBQA 2YXYA 2V6CA 1Y57A 3LM2A 3ERED 3TQ7P 1VQOA 3K57A 4C5GA 2M2EA 2DO3A 4E0DA 1RNHA 4E47A 3HRSA 3AT1B 3P38A 1JXSA 1QWFA 3BLYA 4HVJA 1H9TA 2OX7A 4X9DA 3OOUA 1HNWK 3CCQI 4KN7X 2IXSA 4F93B 2VG6A 1YJ9A 5DM6F 4A93J 3AO4A 3VB2A 2J5PA 2P51A 2M51A 3WTVC 3IRQA 1IN5A 3EG9B 2DFHA 3AFHA 1Y39A 4BI3A 2D0OA 1NK2P 1QZZA 1QVFM 1HSTA 5M9OA 3PQJA 2LC4A 3HO1A 3QYGB 3K0LA 2E2NA 4E9EA 4Z4HA 4BBRJ 3OYIA 2HNZA 3EUAA 4BNCA 2JRTA 2E4HA 4GGGA 1YJWA 3H0GJ 1TSFA 3PMTA 1LKXA 4B08A 3M5AA 2HHUA 4L9VA 5J2MA 3KZYA 1MDUB 1GXPA 1JHFA 3UKRA 3JYTA 1RBTA 3JB9I 1CZ9A 2YUSA 2W48A 2NLXA 2NRXA 5LY3A 3W2WA 2VGNA 1A5VA 3K9KA 2L2PA 1DPRA 3DOKA 4JD2B 2BBYA 2A1SA 4D7MA 3GTPJ 1LEAA 2X1CA 4DV0K 1WJSA 4CIFA 1JJ2A 1TL8A 4ID5A 4O0IA 3D2FB 5KRTA 3HYFA 5GAMf 5ED4A 3DLHA 1JLGA 1CKBA 4G7OF 4HPQA 3LZIA 1C1AA 2LNBA 2K5CA 4M3TA 4RGUA 4KTZA 1VYUA 4I7FA 2HI3A 3EH1A 3K10A 2QXLA 4RTFD 1ZUKA 3IFRA 2ZC2A 5AQPA 3J80E 2VUMJ 2NOIA 1EXQA 5FWCA 5LEKA 2XKPA 3OB9A 5LRRA 1KO9A 2P4TA 2HMIA 2VJIA 1VQ6A 1RDAA 3CCLT 3LAKA 4FLWA 3LNQA 4BHCA 4FASD 2FBXA 2JLEA 3MP1A 1NJIO 1LWEA 4W5NA 3INZA 2IVNA 2EJFA 1P9QC 4H5TA 4DS5A 1JT0A 4A4KA 1J2XA 2VBWA 1Q18A 4GY2B 1E17A 3Q0WA 5D6XA 3HSEA 3TOAA 1E6GA 4U7BA 2FG0A 2LZ6B 1R23A 3ZRGA 4LDWA 1GVDA 2ICWG 3F5TA 4OVLA 5AQKA 2L4MA 2OTJA 3OR2C 2CFOA 3ISPA 3KE2A 3RR6A 1PSFA 3WTTC 4F2RA 1R22A 1Q82R 2HCKA 3ZN1A 1KRPA 3NEUA 4N4NB 1VQPT 3S9HA 1PVEA 4OLAA 3OWTA 4BVPA 2MAMA 4IHVA 2EGCA 2EGAA 4D8KA 1O3TA 3CWSA 2RK2A 5F2RA 1G83A 2IS4A 3DLLF 3DYAA 2D8HA 1YX5A 1XG1A 2HOAA 5B3SH 1RT6A 3A8OB 2EWSA 1L0OC 1BW6A 1SD4A 2EIMH 3QYFA 2P8TA 4EMKA 1XN7A 3PNYA 4KUDK 3KX2A 4KYWA 2HEOA 1NKBA 4MLEA 4JI0K 4LF7K 2J6OA 2E1MC 4BE2A 1VQMN 3VS1A 2KRNA 1T44A 1WA7A 3KYCB 3EO3A 5B1BH 2X78A 3GYHX 2P7CB 2Z1IA 3EGDA 1VQ6N 1U1TA 1Q7YR 3AKZA 1NK5A 5D5VB 3DJCA 3LP2A 3J7YP 1EETA 1VQPQ 1JXBA 5GMKe 5DY9A 3I33A 3G2BA 5BPNA 3PNWC 4A3JJ 1XD7A 3I59A 4QPOA 1ZLKA 3CCQA 4JPBW 3TAGA 4HF0A 1EKEA 4H4MA 4LMYA 1LCUA 3ABTA 4ZZDA 3MEUA 2JSCA 2PJRA 1B1BA 2QWQA 2LK2A 4GCVA 1IG7A 4JI4K 4DCHA 2X6XA 1WX6A 3JRAA 1U2VB 2FBIA 1YQMA 5FWBA 2DFEA 2DTOA 3K6GA 1TKDA 4BRAA 1RTDA 3PVLA 5L3GA 3DPTA 3BZ6A 5LFAA 3JRBA 2QBYB 3CBOA 1K9MU 1J5YA 4CF9A 5LJ3h 3W6VA 4MDXA 2NRWA 3WEEB 3D7EO 5EOYA 3HPOA 4DQQA 1FW6A 4H5VA 2R0QC 2OZ6A 3WTZA 4J9GA 1XQSC 2DYIA 3J8AA 4KDPA 3RRHA 3TEEA 2ZB9A 1I4K1 2CMPA 4B44A 4GVEA 4GMJB 3P9IA 4RTWA 4B9XA 2VJ4A 1YFNA 2YX6A 4A3GJ 1GFDA 4CZFA 4KHSA 1Q7YO 5EZHA 3CCUQ 2Y1JA 3FBIB 1PU7A 3UKRB 1VQ6I 2LKSA 5TKWA 4OMPA 3LPTA 4M74A 1ORPA 1UUEA 1BR2A 1VHXA 1PU8A 4BWJA 4BC5A 1PKTA 4E7SA 5GAN2 2NNYA 1GCPA 4JJBA 1Z05A 3THXA 1IRXA 3TWHA 1OR7C 2E41A 5KYXB 4A6DA 2P4WA 2OAZA 4IOAL 2DFIA 1EWRA 2XY7A 2DZCA 2D6FA 4D5CA 4KMUX 3MO8A 2PAVA 2EVRA 4B1RA 2NXNB 1JLFA 3CMYA 3BG3A 1LFUP 2DDBA 4D1QA 4DFPA 2DVJA 3AARA 4BUPA 2CSIA 1YYVA 2Y9YA 4BDPA 2ZJQL 3S2WA 2XY6A 2HOEA 2D5VA 1GT0C 2PI0A 1Y07A 3UKUB 4IHXA 5GAOq 3S1RJ 1VQMT 3KP3A 3VYHB 1TLHB 3H1CA 1RAFB 4H0EA 1YJ9N 4CJ5A 3CESA 2VWFA 1NGFA 2KXCA 4E19A 3KJVA 1CZBA 2YLCA 4G6DA 4IOAF 5TISC 1TVRA 3EYZA 1T33A 1GV5A 2K3BA 2IGMA 2RD1A 2KLAA 2ECCA 2VKNA 1HYOA 2C06A 3SUPA 3VUZA 4A3IJ 2LVMA 2YDLA 2FZGB 2F96A 1WJ5A 2HMAA 3E6MA 3V6DA 2P9LA 1S6LA 1U84A 4X6AJ 4DG1A 2JZYA 5TJJA 1JXMA 3WXIA 3LP1A 5M5XJ 5IYBJ 1C0WA 2XHBA 1MNDA 4I0BA 3CWUA 5BPMA 3DBLB 1U47A 1HPZA 3CMAQ 3AVAA 4YNQA 2L9VA 5CVIA 1V3FA 1B8IB 2R7DA 2NOBA 2DPNA 4LSNA 1KYZA 1X4OA 2KR3A 4GYGA 1MBHA 3FC3A 3JRIA 1OYIA 4B9TA 4M6VA 1ZLJA 2D0AA 4U0VA 1RTHA 1HNXK 2HKXA 2GM4A 1I5ZA 1SFKA 4NB4A 1S72T 1BL3A 3M5RA 2RQPA 5AQQA 3A5ZB 2NOHA 4CD1A 3EYIA 3LZJA 2AS5F 3H1QA 5DLQE 2GA2A 1IDZA 3F0ZA 2GCXA 5D3GA 1I1GA 3KFVA 1NKCA 3AVMA 1YITI 5HS9A 3QEWA 3X20B 3FHZA 1TL3A 5AIQA 2Y75A 1N33K 1DIZA 4DTUA 1H9GA 1HMVA 3BR5A 1J75A 3HK2A 3P9KA 4IBNA 3EGXA 1VSHA 3CC4Q 4B8XA 5GAN8 3VQBA 2O4XA 3E9GA 4C0GA 1C0UA 1VQPA 4RG8A 1FOKA 1Y64A 1WEIA 4CHQA 1M30A 5LJ5d 4DTPA 3B8AX 4RW8A 1IG9A 3MKLA 2E65A 2GA1A 3EUHA 2R58A 2RI5A 4IRHA 3QEPA 2DW4A 2QCOA 3CC2A 1FOWA 2LJ1A 1BL0A 3U1KA 2EFWA 4JKBA 2LOOA 4CJ4A 4OIOF 2JJ7A 1S1VA 3J81O 1TP4A 3HJFA 2SEMA 3GX4X 2JG6A 4PLIA 2BHZA 1EH7A 2KXDA 1RC9A 2QZ8A 3G1MA 1H8AC 1I6HJ 1MV3A 4NXMK 4ELZC 3H3NO 1RPWA 1YXQA 2YHXA 2JA8J 4OB3B 1D3YA 3JCMX 3LAMA 3M59A 4EZ6A 3TSZA 3CCYA 2I10A 3MKDA 2QA4I 1G3SA 3K4LA 4KB0A 1SMTA 3JAMK 1ARKA 1K73U 2PN6A 3FGUA 3EGUA 4L5IA 3O4NA 3QU6A 4RDUA 1ON2A 3IAM2 3GVAA 1YI2A 2W82A 5CKHA 3ALYA 3G0ZA 3QNNA 3V7CA 4HNUA 1QVFA 2P9PB 1BWFO 5LHHA 1BKBA 5C4JJ 1TG0A 2KFNA 1NGNA 1SRMA 3DRRA 1K0XA 2HXOA 4C8MA 1REPC 3KZZA 4ENNA 2J6FA 4PSXA 3OGDA 1OFCX 4FJLA 2ZZDA 4EMSA 1FSHA 4YDUC 2B9SA 1N25A 2X6YA 1REVA 3NHGA 4DF8A 4J2DA 4G8XA 3E9PA 1KC8C 2TRTA 2HQEA 4K11A 2CGLA 1JCGA 3PL8A 2O8CA 1WZOA 2KMUA 1QQIA 3S15J 2CKKA 3EL2A 4M77B 1BI0A 2NS7A 2HHSA 3FMSA 4RB0A 3CCEI 4BG9A 1KVCA 4N9HA 4J8OA 4N0AC 3TKYA 5DUIA 2E1CA 2COWA 1C6VA 5IY5H 3HKZA 4HV6A 5AFUA 2XV4S 1M8VA 2ED0A 1KAZA 1BIUA 1T05A 4BHPA 2VI6A 3TO7A 4DUYK 1HBXG 5M1OA 5J6XA 3IUOA 3DOLA 1NJWA 1RDBA 3IS9A 5LMUK 5L3BA 3HI0A 4E4HA 3JCMP 4I6MA 1RT5A 1OYXA 1RT2A 3RPUA 1NOYA 2HVQA 2CWEA 3PIOA 3CCEN 4P9FA 3HXLA 1HNIA 3M0TA 5JHFA 1XCBA 2ZSIB 4MQ9F 1N9SA 4C0FA 4W1UA 4BL0B 2M0YA 4VUBA 4IUUA 1ZRFA 2HYFA 5H1SQ 5DS9A 5IYDJ 1U3OA 5GAEJ 3OYMA 3JCMe 1W7PA 5CLSA 1BI1A 4BU2A 5HOOA 3CJ9A 3KP4A 5DUKA 3QHSA 3FBNB 4FOIA 1MSEC 3QEVA 5CK9A 4DBHA 1M3AA 2BE2A 1Z91A 3MHXA 2DPDA 3VSLA 2EFPA 2D0CA 2DRMA 1UB9A 2O01E 3LDLA 1WHHA 2KFDA 1MBJA 1AWXA 5AQFA 2WUSA 3AVGA 3CMEN 3LSGA 5GJWB 3R3LA 3KLHA 3MMVA 5FKKA 1JUSA 1Q86U 4O44A 1OCOH 4EP4A 1UFMA 1S8NA 4IJAA 2Q1NA 2R7ZJ 4WFNL 2YNGA 5CVJA 1YOVB 2OJED 5HODA 2RKIA 1T39A 3WTSC 3EUHC 3WXMB 4M3RA 4M78G 1TUGB 2XKOC 2Y30A 1NM7A 4B24A 4CJ3A 2MI6A 1XX5A 4RBOA 2EQUA 3CC7N 3JCUC 4KIFA 1QSYA 2I0NA 2LQNA 3L4IA 2VC1A 3L00A 3D0PA 3E5XA 1EX4A 1FOYA 2VOOA 2O7OA 5ELZA 3S3OA 3KD5E 3AO3A 1A6QA 1GFCA 1ASUA 5CHIA 2EW3A 2IAJA 2NYXA 2DI3A 2HQAA 3RDVA 1SL1A 4C2UA 2FQ3A 1SUQA 1XWLA 3SD4A 5HNFA 2AK5A 1TW2A 1Z26A 1UHWA 4J9DA 4B9VA 5HNHA 1YJNN 3O4QA 3J7AO 1JJ6C 2V9PA 1BJAA 3LOCA 4HBLA 3GG4A 2P0WA 1YJWI 4LH5A 6AT1B 1Y96B 4ON0A 5J1YA 2HHXA 4B22A 3EHRA 1RESA 2JWTA 3GCMA 4NZGA 4ESJA 5BRHA 2HSTA 1QHGA 4N5SA 3QWLA 4EM2A 3FFKB 2L7FP 4GV6A 2KT8A 3V42A 3HKSA 1AOJA 4DV5K 3BOQA 4AYBA 1BOBA 2LQKA 3VPRA 2PVOB 5JVTA 1R1TA 2K9SA 1O3QA 4FVUA 1ZREA 4EAHD 3JSCA 1K6YA 2ZJ2A 3Q1JA 5ADXH 4M75F 4JK1X 4LJZF 2FEIA 5LGNA 4EJZA 1LOTB 3G4SQ 2A3ZA 3ZSQA 2R7TA 4DR1K 4LIUA 1MV0B 5AQLA 1K73C 2YSQA 5EU7A 2FOWA 1WGXA 2DOEA 3R6MA 1R36A 2MWPA 1JJ8C 3J7YJ 1XMAA 4PL8A 1D8KA 3GTLJ 3E6BA 4JK9A 3FZMA 3IC7A 2VONA 1DTTA 4JKAA 4LF5K 1XSXA 4I2OA 2O03A 1J0RA 2CRGA 4XU2A 2RO0A 4CICA 2P6SA 4JOMA 2F9WA 3CWAA 1C0GA 4FK4A 1RUOA 4LUEA 4FJJA 2DTHA 3GFIA 1L3UA 2F48A 2FXUA 3K5LA 1XB4A 3MWPA 4FIBA 1L5UA 2VN2A 5KNLA 1W4MA 5EEAA 2DMTA 4EW0A 1QVFS 1QZ5A 4CHPA 2VG7A 1IV0A 2DXBA 3ZMSA 2IS1A 3JB9F 1T08B 1TWCJ 5IXBA 1GLDG 1MMNA 2W1OA 4B1WB 3WTUC 3MX2A 3JRZA 3WU0A 2JA2A 3G0QA 3A98A 5JLWA 3SFIA 1G99A 4MO4A 1YS6A 1NTCA 5FLMJ 1UWBA 2CH0A 1QNTA 4LH4A 1Q81C 1B34B 4DR2K 2XAUA 1N8RU 3KUFA 2E1HA 3ZR8X 3IWZA 1DUXC 1OH5A 3OQ5A 2GXAA 3CXCP 2O8CB 3NRVA 4M7YA 4JLHA 4FX4A 2X3WD 3O2PE 2NOZA 3P8DA 3PUFA 1ESVA 1F5TA 2LYCA 2DPUA 1S9EA 2D1KA 4DMNA 2KZZA 3DWLA 2EZKA 4E7JA 5GAN4 1B9FA 2ESWA 3CJNA 4IPAA 4Z02A 1U48A 3OIPA 3RKXA 3IWFA 3L8BA 4AIDA 1N39A 1BCMA 3UKUA 5IP7J 1IF1A 3TPQA 2IS2A 2PJRB 3SZGA 1NMNA 3T8TA 2QWOA 4WFBL 3HHGA 1TV6A 4DTMA 1IN4A 2DTRA 1EJ9A 5HRRA 1ULYA 5K7HA 4N56A 1ZR4A 1ZBIA 2UV1A 2XAFA 1S7EA 2DY4A 3FM3A 3TW6A 4BGBA 1VQ5I 4CK3A 4V19S 2H09A 4XKWA 1K0SA 4DBRA 1KU9A 3O9RA 3LGLA 1VQ7I 4M3ZA 1VQMA 2HS5A 4NBQA 3WVEB