3OYMA

Crystal structure of the pfv n224h mutant intasome bound to manganese
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oymA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oymA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oymA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oymA03
2XY8A 4CJWA 4PWDA 2IC3A 1JLAA 1HRHA 3SUOA 4J2EA 4KRFA 3OB9A 3TAMA 2RO0A 3MP6A 3U3GA 2X78A 2X4XA 3ZCMA 3VA3A 1RBVA 3QEPA 2XY7A 4KTWA 4M3YA 2R57A 1UA0A 4Q0BA 2G3RA 4CHZA 1SL2A 4LSLA 4B9UA 4DG1A 1JXBA 1KSPA 2EQUA 3MP1A 3SPZA 1TKZA 4BD3A 4FVMA 1BIZA 2HHXA 3QERA 4QW2A 3SJJA 4OKJA 5CZ2A 1JL1A 4XIUA 3ZSQA 3L2VA 4BWMA 4M3UA 1NK4A 4RW6A 2DFEA 1C0UA 3RRHA 4FZZA 4AHVA 4DTXA 4F4KA 1HYZA 3P8HA 1TVRA 4ELUA 4FJIA 4E19A 3LGLA 2Z1GA 3NH0A 3NNQA 4KPYA 3I0SA 2P1JA 2X35A 5HBMA 4FM0A 1WSEA 4HUFA 3K5LA 2EQKA 5D3GA 1JLFA 4QQDA 4M3RA 3RMBA 3TARA 1RDBA 3C95A 2F8SA 3MAQA 1RTDA 4NS5A 1U48A 1SL1A 3QJ6A 4DSIA 3QETA 3K5OA 1RT3A 1NJYA 1UOCA 4CF8A 3KK3A 3PX4A 4DQSA 5HRNA 2ATQA 4F3TA 2HHTA 4DQIA 2R58A 4B9WA 1RBUA 4BDPA 3AA4A 2HHUA 4BACA 1ASWA 1TK0A 3DLHA 2G8WA 4CIFA 2HHWA 1JL2A 4C5EA 2RJCA 1DLOA 2HVIA 3OY9A 4IUTA 1EXQA 3O3HA 3LPTA 1CXQA 3D45A 4RG8A 1IO2A 1D5AA 2M0OA 2RKIA 1S6QA 3SZ2A 4FJXA 4CK1A 2X4WA 3HP9A 4I9LA 4AHSA 2G8VA 3OMGA 3SI6A 4AHTA 3QIIA 5C0MA 3SQ1A 4FLWA 2OZMA 3V9UA 1RTHA 3HVRA 3KK1A 3LAKA 4FJ9A 4KB0A 1Q8IA 4W5RA 2Y1JA 4DLEA 1SUQA 1L3VA 4KAZA 1QQCA 2IG0A 4C8LA 2BKDN 5KGXA 2LRQA 3NGYA 4LY7A 4O0IA 4KTQA 1S1WA 4H8KA 3NHGA 2G8FA 4KI6A 2RJEA 1C0MA 3F70A 1VSMA 2HQEA 2DIQA 3DYAA 1N6QA 4ID5A 4CJEA 4J2DA 1VSDA 1KLMA 2WOMA 1C1CA 3EY1A 3MXJA 1NJWA 2IGIA 3FEOA 2QKKA 5CYMA 1T7PA 4E89A 4B9VA 3LX7A 4CGDA 3HK2A 1SKWA 1RT6A 1JXEA 4CEOA 4Q5WA 3KUFA 4W5QA 1F21A 3ZT2A 1YT3A 1ASVA 3VQQA 2BIVA 2HHSA 4KHSA 4Z4FA 2B6AA 3FFIA 4CESA 3SPYA 4N4HA 1VSHA 3T19A 4CFDA 1NK0A 4FJ8A 3HXMA 1RT7A 1JLBA 1HNIA 4E1MA 4CHOA 4FJKA 1C0TA 4FYDA 2G8KA 3DLGA 3TR8A 3DLKA 1RCHA 4DSLA 4CECA 2M16A 3H08A 4DSEA 3SUNA 4N5SA 2HNZA 4LSNA 3VQAA 3WNGA 4I9QA 4KFBA 4FXDA 4FJMA 4IG0A 1T8EA 4FCYA 2NLUA 1IKWA 2IS3A 4ZTJA 2E6LA 1ZBHA 3OYLA 3V1RA 1FXXA 2LTOA 4M3WA 4CEQA 3D0PA 4ID1A 4DFPA 4Q5VA 4KREA 1LWFA 4DF8A 3ZSYA 4OVAA 4PLIA 3WNFA 4DTMA 3ZT0A 3MP8A 3OYCA 2HVHA 3HM9A 2EQJA 1X9WA 1LAVA 4O4GA 2F8TA 3AO5A 5SWMA 2KW4A 2RJDA 3ASMA 4E7LA 4MQ3A 3LLRA 3WNEA 1QE1A 2B5JA 3S3MA 2B4JA 4CGFA 2RI5A 1EKEA 2KZMA 2O4XB 3MEAA 1JLCA 1T03A 4EP5A 1X9SA 3PO5A 2L8DA 3NF7A 1KVBA 1X9MA 1RNHA 4DTRA 4LD0A 1H3ZA 3C94A 1JKHA 1TAQA 3RR8A 1J9AA 3PNWC 5J2NA 4O55A 3TANA 4W5NA 3NDKA 3KLEA 2VG5A 1JLEA 1FKPA 2JZ2A 3OVNA 1VRUA 2FBXA 4CERA 3SCXA 4RW7A 4QQ6A 1DTTA 4GW6A 2QKBA 3OS1A 2GF7A 3NTIA 3CQ8A 3OYNA 4I7FA 3KJVA 1CXUA 4CHYA 5FRNA 3RMDA 2IDOA 4JRPA 2DAQA 1KFDA 3P1GA 1WJSA 3L2UA 4HTUA 4N41A 4DQPA 4CEEA 4CJKA 2QXFA 3B6OA 1KFSA 1RT4A 3DLRA 3E01A 3DI6A 4DS5A 4O0JA 1L3SA 5FROA 5CIUA 1RDDA 4PL6A 2W42A 3RTVA 3ZT4A 1WAJA 1C1BA 4PQUA 1J53A 3DB4A 1Y97A 3LAMA 4FM1A 3AVJA 3MEDA 3JYTA 2PZSA 1KLNA 1VSJA 3OYKA 2WACA 3C6UA 4E0DA 1X1PA 2RHUA 2FC0A 2KZZA 3S6WA 2X6NA 1XNIA 4FLTA 2RN2A 1HQEA 1BIUA 4KI4A 4M41A 2ZE2A 2BDPA 2KQ2A 4DMNA 2LDMA 1O1WA 1TKXA 1LWCA 3SQ2A 4DTJA 3OYFA 2X6SA 5HRSA 4CEBA 4JRQA 3TI0A 4L8RB 1ITGA 1RDCA 5HRPA 3MO8A 2HHQA 2O4XA 1TKDA 3PY8A 5KE2A 2K3YA 1GOCA 3THVA 3ZSXA 3NCIA 1RI0A 4JS5A 4CIEA 2HNYA 4FJLA 3V9SA 4E7IA 4EZ6A 3K58A 4AILC 1NKEA 2JTFA 3IS9A 4DTPA 3QNOA 3QKJA 1NKBA 3QBYA 2FBTA 3NGZA 2YRVA 4HUEA 2F96A 4C5GA 3SNNA 1HMVA 2IOCA 1YTAA 3SV4A 2O4GA 3AA3A 4DU1A 2RHYA 3I8DA 3META 2Q3SA 2OPRA 4CFCA 5J2QA 3ZSWA 1LAWA 2HW3A 4N4GA 3CFPA 1U45A 2EX3A 1FK9A 1VSEA 3TWHA 3NF6A 3HPGA 1S1VA 1HYVA 2Z1JA 5KH6A 4UQGA 4IFYA 3OS0A 3MEEA 3VQCA 4DSKA 3LP1A 2XDPA 4CIGA 3SUPA 3U6FA 3V9ZA 2P5GA 1G15A 1I39A 4HUGA 3L3UA 3T1AA 1NJZA 3OYAA 2G8IA 4IBNA 3DMJA 3EZ5A 3ULDA 1B9DA 4ZHRA 4JS4A 1ZBLA 1OI1A 3DOLA 2YV0X 5DK5A 1WGSA 2KFZA 2D0CA 4J2AA 1W0HA 1WSHA 2QK9A 4OLAA 3NF9A 1CZ9A 3RMAA 4IKFA 4CHQA 3MXMA 1BI4B 3TAFA 1WSFA 4Z4IA 1XC9A 3ITHA 4R5PA 3ZSVA 4KHUA 3P8DA 4E7JA 1G5VA 3DLEA 4E3SA 3PFSA 2EHGA 2YNIA 2RHXA 2PYLA 3PUFA 3AVCA 2P5OA 1BL3A 2OZSA 3AO1A 4DFKA 3MEVA 2XHBA 3AVBA 2DFFA 3AVLA 1KHCA 3LWMA 2D5RA 1QSSA 2CKKA 3AVIA 1TV6A 4DU4A 3IRXA 1S9EA 2ZD1A 4CFAA 1VK0A 3QNNA 4CJ4A 3PMTA 3AVGA 3VQ5A 2G8UA 4KHNA 2AJQA 4GMJB 4W5OA 4FL6A 5HP1A 5C24A 4Z4EA 4BE0A 4HVJA 5IN1A 3M8SA 4FJ5A 1L3TA 4AHUA 4ELTA 2MWPA 3K5NA 1LW2A 3SUQA 1B92A 3O4QA 2OYQA 5E41A 5J39A 4N4IA 3M9QA 3BDLA 4K8XA 2OA8A 3MXIA 2OPQA 5D6YA 4KB1A 1IKXA 3OYEA 5HRRA 5DMRA 1VSFA 2EKOA 3E9GA 4CEFA 3K2PA 4PY5A 4RW4A 2VWJA 3QO9A 1MU2A 3ZEHA 4E1NA 3CEYA 4FZXC 3NH1A 5KRTA 1JLGA 3WNHA 3VQ9A 3SV3A 4DFJA 4CK3A 4F3OA 3AVKA 1RBSA 2D0AA 4CJUA 1GOBA 3OYHA 2BE2A 4UC4A 3RMCA 4NCAA 4TSXA 4LH4A 3UIQA 3V4IA 3AVMA 3V1QA 3VA0A 1XHZA 4ELVA 2DTUA 1BHLA 4FW1A 3KD5E 1ZBUA 1NOYA 4BWJA 4B9NA 3AVNA 4CGIA 4OGCA 3OYIA 4CRIA 1RT2A 4CF0A 4O5BA 3QEIA 4B9LA 5FDLA 3F9KA 2RHIA 3LALA 4FJJA 1BI4A 1SKSA 4FLXA 4M42A 3PMIA 1SV5A 4CGJA 4Y1CA 4IUPA 1BISA 3CM5A 1IKVA 1Q9YA 2D0BA 2YNFA 3TABA 4JLHA 4FW2A 1KCFA 1Q9XA 4MFBA 4QQGA 2X74A 3LGFA 1NK7A 3FLGA 3DRSA 4C8MA 3HSTB 4KO0A 2R5MA 1BQNA 4NYFA 4CGGA 2L3RA 2RJFA 3HPHA 5HROA 3OMCA 3M8PA 3LDSA 3F73A 3ZSZA 1GOAA 4I2PA 1VRTA 4B3OA 2A1RA 4OLBA 4OJRA 1QSLA 3KIOA 5KE3A 3L8BA 4FM2A 3RR7A 4DTUA 4N76A 2RPIA 2ZQBA 3HO1A 2QQSA 4CEZA 3CFOA 3OYJA 4Z02A 1RTJA 3DM2A 3NF8A 1RT5A 1LW0A 4CEDA 3VQPA 2FBVA 2GUIA 3VQDA 4CK2A 1U49A 2YKMA 3NH2A 2YNHA 1A5XA 4CF2A 2DIGA 3KK2A 3KD1E 4EP4A 2F5KA 1QSYA 1SL0A 4QOZB 3UWNA 3O3GA 1Z26A 3K57A 5EU7A 4F8RA 4E7KA 4FLYA 5D6XA 3HL8A 5I42A 3L2QA 3EAEA 4DU3A 2E5QA 4CHNA 3U3YA 2K3XA 4B08A 2VYTA 1K6YA 2PYJA 4DLGA 1RTIA 4Z4GA 2HMIA 3VQEA 3ZT3A 2KTQA 4IDKA 3VN5A 5CZ1A 1QTMA 1C6VA 4IURA 1OZ3A 1A5VA 4HHTA 3KLGA 5FRMA 4DQQA 3OQ5A 1CLQA 1OZ2A 4M45A 1TGOA 3M8QA 3P5JA 3DB3A 3H6ZA 1WSGA 3HPOA 1KVAA 2GBZA 3JSMA 4H4MA 2A1SA 4DSFA 5KGWA 1WLJA 1EP4A 3VQ4A 4DTSA 5J26A 2MWOA 4IUQA 3BGRA 1D8YA 1RBRA 2Y1IA 2YHBA 4CJQA 3G0ZA 1BQMA 3AVFA 3PX0A 4WE1A 4C8OA 1IH7A 4CJTA 4Z4CA 2KFNA 1HPZA 3PX6A 1WN7A 4O44A 5KTQA 4CE9A 2HHVA 2E4LA 3LH0A 4FJHA 3G10A 2P0KA 5IAYA 4EDUA 3DOKA 1MHNA 2YHAA 3V6DA 2BUDA 3KLHA 5C6SA 1OYXA 3LP0A 3VQ6A 1RT1A 1TAUA 5JS2A 4GY5A 3OS2A 3AO2A 4KKOA 3ZT1A 2R5AA 1BGXT 4QVZA 1NOZA 2Z1HA 2IAJA 4IG3A 4N56A 3LANA 4NYNA 4Z0UA 3S3OA 4B9XA 3T3FA 3OYMA 3TAGA 4FJNA 4B9MA 4FJ7A 4OPKA 4CF9A 3OYDA 1J5OA 2E6NA 1UAXA 4CGHA 4A4FA 2WONA 4LH5A 3PO4A 3CM6A 3TAPA 1TL3A 2XK0A 3S9HA 4CCHA 4C8NA 3P83D 1IKYA 5I3UA 2X4YA 4A4GA 3DRRA 3QINA 4FU6A 3LZJA 1R0AA 4BDZA 3SD4A 3C4SA 4IUVA 2YNGA 3AO3A 4DTNA 4IFVA 2DY4A 3IAYA 3DLMA 4F2SA 3SQ4A 3QESA 3QEWA 4L59A 1VSLA 4OGEA 4G1QA 3ALYA 5K14A 5SZTA 1N27A 1WJRA 3LP3A 4PA1A 2B8AA 2LSNA 2GV9A 3MEUA 2ETJA 5M9OA 1TKTA 4BE2A 4E7HA 4Y1DA 4CJ3A 3DRPA 4M3XA 3RWUA 4KHQA 2BANA 1J54A 3VQ8A 2EQMA 3NBPA 5J1EA 2VG6A 3HT3A 1D9DA 3I0RA 4KHYA 4HCCA 4KV8A 1LV5A 3LZIA 5KCOA 1B9FA 1WAFA 4FLVA 3KLFA 3MECA 1QHTA 2HB5A 5T7BA 2JGUA 3AVHA 3B6PA 5KCHA 1NK8A 1RILA 3MEWA 3V9WA 1TK5A 1UWBA 1WNSA 4GVMA 2NUBA 4OKKA 1S1XA 4J2BA 4B9TA 4FK0A 2EFIA 4CF1A 2I5JA 5J2MA 3SQ0A 3FDRA 4BE1A 3NGIA 4K8ZA 5HLFA 2R7YA 3IG1A 4FK4A 2L89A 3L2RA 3M8RA 3C6TA 1EX4A 3K5MA 3ZSOA 1L3UA 3AA2A 1WSJA 1HYSA 2VWKA 3KKRA 4B8AB 4AH9A 3V81A 1XWLA 5KRSA 3AVAA 3H8ZA 3NTKA 4NCBA 4CJSA 2BGGA 4DTOA 3L2WA 3OJSA 2XRIA 4Z4HA 2QQRA 2JLEA 3OA6A 3KLIA 4OPJA 4OKEA 2PQWA 4RW8A 4RG2A 4CJRA 2ITGA 4RW9A 2P51A 1KTQA 3TAQA 3TAEA 4NZGA 3VQ7A 1ZBIA 4DSJA 5KI6A 4CHPA 5C42A 4DWIA 3HVTA 1IG9A 3ZSRA 1NK6A 1C1AA 4NCGA 3HJFA 1U4BA 4H4OA 3OJUA 3BDPA 1WSIA 3A2FA 1SSFA 5JS1A 3SYZA 4FLUA 3S3NA 2FBYA 1RBTA 5CYQA 4DS4A 3CYMA 4AHRA 4QCLA 1CZBA 3NE6A 3UT1A 3KKSA 2D9TA 1LWEA 1D9FA 4F2RA 3QEVA 5D6WA 4I2QA 2RI2A 4FZYA 4DQRA 4BDYA 1S1TA 4YFUA 1Z25A 4YNQA 1BCOA 2RHZA 4C5IA 1VSIA 3NAEA 3L42A 2YKNA 4OVLA 3AO4A 1NK5A 4CFBA 4AHCA 1KVCA 1RDAA 1N5YA 3VQBA 4KHWA 3V9XA 3LP2A 3OYBA 3QIOA 2M1HA 4CEAA 1NKCA 3ASKA 1HQUA 2XY5A 1U47A 1NK9A 5J2PA 4M3ZA 2RF2A 1I3AA 1W9HA 1YVUA 2HNDA 4II1A 1VSKA 4A4HA 3V1OA 3O3FA 3O4NA 4CJPA 2HQXA 1T05A 1HJRA 3KTQA 2PY5A 4A4EA 3MEGA 1TL1A 2G8HA 2GFAA 2DFHA 1SKRA 4ICLA 1XHXA 4B8CA 1KRPA 4EZ9A 3GOXA 4PUOA 3AA5X 3L3VA 1U04A 4KTZA 4DFMA 1ZYQA 4FLZA 3LPUA 1WJQA 1EETA 1S6PA 1YTUA 4IUUA 2LCCA 4FJGA 4W5TA 4PLLA 2GFUA 1A5WA 2VG7A 3ISNC 3FC3A 3ME9A 1S1UA 1S9GA 3HP6A 1REVA 4CJVA 3NFAA 3Q1JA 3NTHA 4C8KA 2OPSA 1UA1A 4M3TA 4HCZA 5C25A 2RI3A 1JLQA 4B9SA 3LYIA 1FKOA 4ZTFA 4CJFA 3QIPA 2Z1IA 1HNVA 3QLHA 3OYGA 2XY6A 1S5JA 3QEXA 3RRGA 2O4IA 1XI1A 4LD6A 3LWLA 2LVMA 1DTQA 3HYFA 4CJLA 3E9FA 3PV8A 1TK8A 4C5HA 1BCMA 2OPPA 4CJ5A 3K59A 5CY4A 4DF4A 4N47A 1ASUA 2XO7A 3EYZA 3CG7A 4FK2A 4HCBA 3AV9A 1QS4A 3DLBA 1NJXA 3O8VA 2E6MA 1L5UA 4X34A 4QAGA 3CFRA 1ZBFA 2FHDA
chains in the Genus database with same CATH superfamily
1PRLC 1HRHA 3RYPA 3LAJA 3OB9A 1T2KA 3TAMA 2K5IA 1M90R 4J00A 5GAOq 1IN7A 2M87A 1KD1C 2X78A 2X4XA 4KMFA 1GT0C 5M3MJ 1Y96A 3QEPA 2QEXN 2R57A 5FKMA 2GXAA 1JXBA 1KSPA 4HYEA 2BUPA 1I6HJ 4UUTA 2BVMA 5ILUA 1JT6A 5LHGA 3MKYB 3MP1A 4D0PA 2A6TA 3SPZA 1KD1O 3RKYA 5K5RA 5EZGA 3ABTA 4CZGA 2KMTA 1QVGS 4C8QD 2R92J 4BS9A 4KT5C 3QERA 3DKWA 1JUSA 1PG5B 2FF6A 2HYJA 1FYNA 5CZ2A 4CBWA 1ULYA 2KRSA 4CC7A 2B0LA 3CF5F 1H88C 4J9EA 3HOUJ 3L2VA 4DZJA 1IBKK 2XB5A 1P7IA 5GAN5 5AIQA 4F4KA 3E9PA 1PUFA 3P8HA 1DPRA 4J01A 1SHGA 3KE2A 4DA4A 4OP0A 3SDBA 1YYVA 2DW4A 3E3VA 1K7AA 2FG0A 2VPLA 4ELUA 3F3XA 1H8AC 2CZ6B 4QSHA 2LNHB 3WT0A 4FYYB 1WUAA 2FBHA 3GW2A 5EEGA 2D6FA 2ZNYA 3BP8A 3B6AA 3BWGA 2X35A 3CXCP 2O88A 3MX5A 4N4NB 5FJ8J 3CMET 2HVQA 1BC7C 4FM0A 1WSEA 3EPZA 1SFKA 2NVUB 2NXNB 8ATCB 1JLFA 1WYXA 4CCKA 1GLCG 1IB8A 2ZFUA 2NZTA 1Q82R 5IP6A 1BR1A 1HD3A 1U48A 3JRBA 3QJ6A 1O7FA 3LQRA 2B9SA 2C06A 5HCKA 4XMYA 4J7IA 1XTDA 5GMKm 1TQIA 4XNFA 4CF8A 2YT6A 2J5PA 2ZKZA 3CMEI 3MWPA 2E71A 3GTQJ 3I4NJ 1OVQA 4GFBA 3O6WA 4BJ6C 4F3TA 2R58A 4B9WA 1JBMA 1MIJA 2IS4A 1RI9A 4QT7A 3JSCA 4BACA 2HBWA 1TQMA 3H1CA 2G8WA 1WJEA 1JKQC 1I1GA 1QWEA 3WXIA 5EGOB 1YRNA 1OR7C 2HVIA 1O7LA 1SG5A 4IUTA 1EXQA 1XNQK 1YQAA 3VF4A 3KPHA 1N8RO 4XH1A 2IIRA 1FPQA 4GYIA 4RG8A 1D5AA 2DDAA 1G2HA 2M0OA 1WBDA 4DR6K 1WI9A 4PSWA 2RKIA 1S6QA 4BY7J 1AKHA 2RKHA 4CK1A 3HI0A 1TYQA 4RMOA 3FXMA 3ZN1A 3K70C 3C2BA 4FT8A 3VYHB 1WZ2A 2R5YB 5C0MA 1VQ6A 1U84A 4NOYA 4A3BJ 2AA4A 5IXBA 4NLBA 4NQWA 1WHHA 4KB0A 3KLOA 1SUQA 2D5VA 5LJVA 2IG0A 2UV1A 2LNVA 5HNHA 2LRQA 1MA9B 1N9SA 2M7AA 1LKXA 1BUPA 1S1WA 3UKUB 1V4RA 4J9HA 5FU6C 2A0FB 1GVDA 2ZXHA 2EFWA 2L2OA 1T6SA 3S15J 2KQWA 2QWWA 3LMMA 3I55A 2HSEB 2BW3B 1S72T 4J2DA 2ELHA 3MK6A 2CQNA 1UGPB 1KLMA 2MBFA 2ZMEA 3EY1A 2XDVA 1J6ZA 5IHNA 2P6TA 2ME0A 3V4GA 2QKKA 1Z21A 2XRNA 3CLQA 3J80E 1W2BM 3LX7A 5TGTA 2E34A 1W0UA 1SKWA 2FA5A 3IH2A 2NRRA 3PQJA 3KUFA 1S72I 4EGZA 4A69C 4RCCA 4ZYAA 4LF7K 1F21A 3S17J 2M8GX 1X6OA 1LDKB 1YT3A 1MGTA 4AVZA 3O9RA 2PJRB 3CCSA 1ASVA 3VQQA 3JCMh 4G8XA 2BIVA 1YJNN 3A8YA 3AG4H 5E3NA 3NWSA 3ABLH 1GV5A 3Q9SA 1TBXA 1LOJA 3FFIA 3C6HA 2KDZA 5GMKe 2CSOA 2Q0RA 1Z77A 4AVPA 1N3CA 3KZZA 4XN3A 2RN8A 4LK1F 3OYYA 3HUGA 4DSLA 1VQ9N 4CECA 3JAMZ 3AL0C 4JD2B 1YX5A 3SUNA 2HNZA 2O61A 5LJ3g 4KFBA 2E2PA 2LCLA 1MDMA 1AVZC 2WSEE 2KY9A 2F5DA 2AS5F 1IKWA 2IS3A 4N0AA 4KN7X 3MZYA 4ZTJA 1QZEA 5F0FA 2YG8A 5GAGJ 4B1RA 2NOGA 1W7AA 1VQ4T 4OMMA 4A3CJ 2HZTA 1B1BA 4CYCB 1TC3C 3D0PA 4ID1A 4KREA 4Q5VA 1FSHA 1LWFA 4DTMA 3VEOA 3OYCA 4DB3A 2QW9A 2WA0A 3WU1B 3A0HC 2KI7A 1QVFA 1ZXOA 1WHLA 3FIWA 1AOJA 2K57A 3AO5A 4OOIA 1VQ4I 3ZQLA 2P81A 1QZ5A 3M57A 4MQ3A 2Q8KA 1VQLT 1MUDA 1QE1A 2F6CA 1YW7A 3BT9A 3JRFA 2RI5A 4B1VA 1EKEA 1TTYA 2KZMA 5IOZA 4CZKA 3SBTA 3MEAA 4FQGA 5CQEA 3GTJJ 2Y75A 4LF6K 1QBJA 4BJ5C 3S93A 4S0HB 2ZJQL 4EP5A 1ZQ1A 5BN9A 3G2BA 5K7ZA 1LNXA 2BXYA 2JS2A 4U88A 1VYUA 5J3LA 1MUNA 3CCUQ 1GCQA 4KITB 1X9MA 3K9JA 1VQLI 4DTRA 2DYSH 3GNFB 1ZTRA 1H3ZA 3RR8A 4IXCA 1J9AA 3LWIA 2O8EA 4C8QF 4UB6C 5TISC 2OTLT 4EJWA 3H3ZA 5C3EJ 3RUXA 4OWRB 1KQ8A 1JLEA 1G8XA 2CGPA 2W25A 1FOWA 3M4GA 1VRUA 2FBXA 4M78F 4CERA 3HRSA 1ZLJA 3SCXA 4RW7A 2HDWA 2YS9A 1DTTA 1GHCA 2AT1B 3NTIA 3GTOJ 1QVTA 4OAYA 2OTLI 2KNBB 1GUUA 1V5FA 4PKGA 2FLOA 1BM9A 5BNGA 2BOLA 2E1NA 3F8BA 4FWQA 2IDOA 2DAQA 2O0YA 3P1GA 3OTOK 3BZ6A 2HOEA 2PTKA 2H8RA 4J8FA 4HTUA 3RQIA 3QBXA 3T69A 1JJ2S 4CJKA 3CJ1A 1KFSA 3G1MA 5KAIC 4H0VB 4HSTA 5AJ3K 3DLRA 1GRIA 3GP8A 2HBMA 3E01A 3VS5A 1KJWA 1VNDA 3VU3C 3A02A 4Z88A 2VI6A 5FROA 2LC2A 1U9OA 5CIUA 4PL6A 1MNEA 1HQCA 3MVPA 2W42A 3WHCA 4EMKA 2Z1DA 1C1BA 2RV8A 3GZNB 3DB4A 5FU7C 1ORNA 1Y97A 2F4MB 1IHWA 3HFOA 3LAMA 4FM1A 4EJOA 3AVJA 4CCOA 4K0KK 1VSJA 3OYKA 5FLVA 2Q1ZB 2O6GE 4BBRJ 1YCYA 2FC0A 2P9IB 4FLTA 1HW2A 3CBOA 1BIUA 2GGRA 3VPRA 5JR3A 2BDPA 2DXBA 2KQ2A 3PJRA 2P4TA 2LQWA 1XN7A 4ASNA 3T1BA 1IV6A 2FBIA 4AM3A 2ZXWH 3M53A 5CO7A 2FYKA 4JNEA 1O3QA 1YCSB 1R0BG 1LWCA 4J6XA 3SQ2A 1NNEA 3R9PA 2M9HA 2X6SA 2RQTA 4RAGA 4XR6A 1NK2P 3EYYA 1WEFA 3CZ6A 3BY5A 5FW9A 2NUTA 2X1DA 1Q1VA 5HRPA 3DTEA 3OS5A 2WY7Q 3H45C 4M7AE 5BOXA 4CVNE 4OB3B 3QYEA 3A01A 2A7YA 3K4LA 3T5XA 5CKHA 1Z91A 1QWFA 1GXIE 3HOZJ 3JRGA 2NUZA 3S14J 2CWEA 3V9SA 5HLHA 1CZAN 3VYTB 1B8IA 1UELB 4DTPA 5JICA 2E10A 3J80O 1KG4A 2VOOA 1BK2A 3E1YA 1I8FA 2W82A 3NGZA 5BPIA 4HUEA 3UDCA 5CCAA 1PSEA 2QG9B 5KYWB 3QWXX 4EA4A 4C5GA 3M9AA 2CP5A 1O75A 3E6BA 3HL2A 1LJ9A 3THYA 3GWZA 1JUPA 1KG7A 5FB2A 4CCLA 3AA3A 3S41A 1AWWA 4K42A 5HDKA 4EHTA 4KJZA 4ZYGA 3META 4ZGJB 3NVKA 5ICFA 2E41A 3CLOA 3ZSWA 4BREA 1I07A 1LAWA 1A04A 5FD5A 4N4GA 4OIQF 3CFPA 1U45A 1MD0A 1NYGA 2EX3A 5I9EB 4NC8A 1AZEA 1OPLA 1RADB 1VSEA 1YW9A 1M8MA 3HPGA 1S1VA 4UXNA 1SAXA 2Z1JA 3IV5A 3IDHA 3GTLJ 2ZPEB 4IFYA 1NBWA 2JQ7A 5FPMA 3OS0A 3MEEA 3CCJQ 4CZHA 3P9CA 4ZZDA 4ZC3A 2OV7A 1AZGB 4BRNA 2M5WA 1J7KA 3CD6Q 3TOAA 4EFHA 2P5GA 3BTLA 4HUGA 3T1AA 3A8OB 2E20A 1NJZA 5FLMJ 1QQNA 3OYAA 2G8IA 2YUOA 1OPCA 3ZOBA 2VQLA 3DMJA 2HTSA 2L54A 1VQ7N 2VLAA 3H0GJ 3EZ5A 4WFAL 1VQ9T 4IJAA 3PGGA 4EIKA 2HMAA 2K4JA 2JM9A 1RAFB 2EYYA 3RKXA 1Z6RA 3QODA 1IV0A 3ZCOA 4K11A 3EFSA 4ENJA 1WGSA 2JPBA 2D0CA 2XAJA 3B6CA 1Y0MA 4XRSG 1WSHA 3R61A 4CC4B 4M7DE 2R7TA 2KKZA 3W3CA 3BG6A 3QDFA 4UB8C 3CC7Q 3SWNA 1VQ9I 4LD9K 4RCBA 4HNVA 3C2GA 3D5SC 3TAFA 1WH7A 1HPMA 4Z4IA 1XC9A 2NNWA 1G5VA 3JB9D 2DMUA 3Q0WA 2EHGA 4IL6C 2K3BA 3RNJA 1LWWA 2RHXA 1JI8A 2PYLA 4RBOA 4L5JA 5JLWA 1HNWK 1OISA 5GP9A 1BL3A 3AO1A 2XIDA 2VKVA 1E3OC 3RTRA 2PFBA 2DPDA 2EV5A 5AQZA 4M7AB 1KHCA 4B1ZA 1XSXA 3I54A 3V7SA 3CCQQ 3FHZA 1U9NA 3DBLB 3AVIA 1YTYA 3KVGA 1M27C 2ZF5O 1S9EA 4WQ4C 2FOKA 3O2PE 4RAYA 3SZTA 2NRWA 4WXCA 1TWFJ 3QNNA 4CCMA 4IRGA 4CJ4A 5I2SA 3CC2Q 2KRHA 4FETA 1KQSM 1NLVA 4C3HJ 5GJWB 3F5TA 5GADP 4YFKF 4FL6A 1XC5A 5J4VA 4JDSA 1Q86O 4BE0A 4YOQA 1LEBA 4HVJA 3LQQA 5L8RE 5IN1A 4LLLA 2EFOA 3M8SA 2ZGZA 3BG3A 3JCUC 3KHYA 4A2UA 3K5NA 1TQPA 5HLTA 1NGJA 1RAGB 2XF5A 1N34K 3BDLA 3GBGA 3H35A 5D6YA 2IEKA 2P9NB 1FOYA 2WB1A 4PUSA 5DMRA 1UTIA 2C0OA 3OV8A 2XGXA 1XS9A 3G4SN 3ELKA 3N4PA 3F8NA 2JW4A 4FSVA 4PY5A 2VWJA 1V5EA 4KBMB 4DEYA 3TDUC 4MGRA 4XU1A 1IGNA 4E1NA 4IEJA 3CEYA 2QDYB 1MZBA 1R1VA 4KUDK 4II3A 4BRKA 3UE5A 3A5LC 4CJUA 1GOBA 1WXTA 3V8JA 2DPUA 2F2VA 3RMCA 1OJLA 1YFNA 3F0CA 4CC2A 1YI2A 4BC5A 3V4IA 5CJ9A 2MC3A 4DBQA 4YY3K 2A28A 4M7AC 3BW1A 3M8FA 2QENA 1ABOA 3CW7A 4OPAA 4BWJA 3AVNA 2GX9A 4CD1A 1ZG3A 4O5BA 2WV1A 4B9LA 4AWXB 5FDLA 1VQNN 3F9KA 3VWBA 2QTVA 4M7DB 1HNXK 4M42A 3JCMQ 3PMIA 3QU3A 2E1YA 4NHJA 4NL3A 3CM5A 1XMQK 4J9GA 1Q9YA 3BR6A 1OCOH 2I2LA 3TABA 1DU0A 4A2AA 1FMWA 4JLHA 1KCFA 4H03B 4HNUA 2R93J 1K8AU 1E6HA 4FWPA 3QO3A 1NG9A 2IT0A 4C92A 2O7OA 3D6RA 2RJFA 3HPHA 3JRDA 5DTDA 3MKWB 3M8PA 4EMGA 1HDPA 2KIFA 1LOTB 4JI8K 4LDUA 3O9QA 5CHIA 5FO5A 2DF6A 4J9CA 4I2PA 2A1RA 5KPZA 1NGFA 2K4YA 2PAVA 2F4IA 1V4TA 3UB5A 1UJYA 2LZ6B 4J7FA 1VQON 1P59A 4CDGA 2RNAA 1F9NA 2Q0UA 1VQ8Q 1YITT 1AU7A 4EQQA 3M55A 2VJIA 4RTTA 2G7UA 4N76A 1X3WB 2RPIA 2XF6A 2QQSA 2HHHK 3JB9J 3LDQA 4OMNA 5CVUA 2QEXQ 4E7ZA 5GAEJ 4CEZA 4EAHD 3CFOA 3R1XA 3BTJA 1O3SA 3G25A 1MBEA 3AT1B 3L6QA 1K8AC 1A31A 4LLGF 4LOCA 1B34A 1RPWA 3JRIA 3VQPA 3W3DA 1LCUA 1G3YA 4BR5A 3FM3A 1YITI 4HSBA 1U49A 2N8GA 3FB9A 3NH2A 2DODA 4ZJZA 3DBHB 1IAWA 2XGEA 3GTKJ 1W7PA 3PTAA 2VJ5A 3GUDA 1UEBA 3CQYA 4PNOA 5CVRA 5GANh 2RQWA 4M7AG 4OO1J 1X1BA 5AR0A 1K8AO 2HKOA 3DTKA 4ESRA 5I42A 3KZBA 3ASOH 3D0SA 2MCNA 5A0DA 2PN6A 3OR2C 2SEMA 3E5XA 4CD3A 3U3YA 3C6AA 3BROA 4RGUA 2VYTA 2F5TX 1YRNB 4HTLA 4XONA 2YRDA 4Z4GA 1KAZA 1HYOA 3LA3A 3ENOA 2RNGA 1TW3A 2XAUA 1RDWX 3NVMA 3DJCA 1G4DA 4EEFG 1MMAA 3ENBA 2ROTA 3KLGA 3L9FA 4A5MA 1D0YA 1W2BS 5AQPA 1AKHB 1GLEG 2NOIA 1VQKA 4LITA 3H6ZA 1TYQB 4GVEA 1KVAA 1J0RA 4BQAA 3QRFF 1W7PD 5TJJA 4H4MA 3A98A 5KGWA 2YPRA 5J26A 2MWOA 4IUQA 3ESWB 1ZUUA 2QA4Q 3BGRA 1VQ7I 2F5EA 1D8YA 2QUFA 2WV0A 2AHJB 2P5LC 2YHBA 4CJQA 3CXCA 3PX0A 4GV9A 1WHGA 4WE1A 1IH7A 1OV3A 1G2BA 4LD5A 1LMZA 3DQVC 5B1BH 3HIFA 4O44A 4CE9A 1MJAA 2CP0A 2HHVA 2HCKA 3DLAA 3MMVA 4FJHA 2TRTA 3G10A 2P0KA 5GAHP 2TDXA 3DOKA 3MPUB 5GAOl 2BY3A 2AKLA 3IFRA 3KLHA 1UJ8A 2EAYA 3LNQA 1KQJA 1K73O 5LEKA 4ZN1A 2XAHA 1TL8A 1RT1A 2RQRA 2O9VA 4GY5A 3AO2A 4KKOA 5AYFA 1OQYA 4KHPK 1BGXT 2M34A 1VQ6N 5ADXA 4FT2A 1TUDA 4PJOE 3WGHA 2KJBA 3RKQA 4M74A 4YIFA 4LK0F 2DXCA 1JTYA 2K6DA 2LJ1A 4K2EA 2A37A 5D5XB 1ZYRF 3O9SA 4Z0UA 2Y69H 3OYMA 1DP3A 1XMAA 3CCRA 4B9MA 2ID3A 2UXXA 4OPKA 5BPLA 4JI4K 1J5OA 5M1OA 4M73A 2IS6A 3GF5A 3O5BA 2QF7A 3KEQA 3OMYA 2E36A 2M02A 4CZMA 4M6YA 2M4GA 2Y0SA 4EMSA 1CGPA 2WONA 4LH5A 1DEJA 4RGXA 3WGIA 1YIJA 1D4XA 1TL3A 3I55N 3S9HA 2QKLB 4MMKA 2P9KA 4A3FJ 1IKYA 2HL3A 4L5IA 2LT1A 3RZOJ 1WJBA 8AT1B 2OC6A 4A4GA 4PL7A 3P31A 3I5SA 2R7VA 3M56A 2IRFG 4CI0C 2YNGA 3U2RA 3MN6A 3JRZA 3I5RA 4MO4A 4DTNA 3G4ST 2A61A 2Z9OA 1YJWT 5J6XA 3VB2A 4JI5K 2GXBA 3FMSA 3N4QA 2E2QA 4L59A 1NMNA 4OGEA 5CHZA 1DGWY 2LY2A 3CCSN 1WJRA 2JTVA 2QWMA 3A1PA 3HHTB 2GV9A 2CW7A 2HI3A 2L3SA 1B6AA 1YJNQ 3G4SI 1WB9A 1L3LA 3BLYA 1R4MB 5M9OA 3Q3SA 2VWFA 4BUGA 2DTIA 3DKYA 4Y1DA 1X4PA 1MH3A 2EA4A 4M3XA 2BXZA 4WK8F 5CKDA 2BANA 4DUYK 5GANg 1W6XA 1HU0A 3EH2A 2ZMEC 2VG6A 3A8MB 2V8KA 3PUBA 4KV8A 1LV5A 3LZIA 4U0VA 4XTYA 1R36A 2UZKA 2YG9A 3L2ZA 4FLVA 2VASA 4XLEA 1N9RA 2GM4A 4DV7K 4I76A 5L3EA 1VQNT 4XOPA 1OH6A 3AVHA 2CP6A 3VFZA 4QS7A 3WODF 3B6PA 4XLAA 2NVTJ 2EYXA 1RILA 3MEWA 3V9WA 1QCFA 5D7UA 4IRIA 2RM4A 1UWBA 2H94A 3RERA 3C7JA 1JO8A 4FISA 1NG7A 1J2XA 5BR9A 1KAXA 1WKMA 4GVMA 2CQXA 2EV6A 3QB0A 1VUBA 1OQKA 1SD4A 1I5LA 5FWBA 4FK0A 2QWRA 3ZX2A 4QLCU 1VQNI 1ZKGA 1U2VA 3UA7A 5GAMh 1QVFS 1K0SA 4E2FB 3M54A 2J05A 1FYKA 3G71T 4HCKA 4FK4A 2KZVA 3F21A 1EA3A 2L89A 2D1VA 5EYRA 1ORKA 1EX4A 3K5MA 1M4ZA 1E17A 3QDRB 4B3SK 1HYSA 5E20A 5EJCA 1X2KA 3EO3A 1I81A 3NQOA 1K8KB 3H8ZA 2R7QA 4PJOB 3G71I 2IAIA 4NCBA 2BGGA 3L2WA 1Q95G 2FXAA 3LDPA 4N0AC 3KFWX 2JUFA 1LPQA 3KLIA 3B8AX 5CLSA 4FX0A 4M4ZA 4OPJA 2PQWA 2FRHA 5L3FA 4NC6A 4RW8A 2ITGA 3RVCA 2DXIA 3PIPL 1D1CA 2P51A 3T1YK 2STWA 3FGUA 2CMPA 4PJJA 3CJCA 2D0OA 1T38A 1E3MA 2HNHA 2DL8A 4DSJA 5C42A 1FP1D 2FF4A 1FN7A 2RREA 4BH9A 4QKUA 1IG9A 1U5TB 3ZSRA 1C1AA 3HJFA 1U4BA 4L0YB 1Q81R 4H4OA 5LJWA 3T0YA 3VEVA 3KLNA 4HLYA 5FKLA 1OFCX 1WSIA 1B07A 4B23A 1ZA2B 3S3NA 5AQFA 2YI1A 4AHRA 3EETA 1CZBA 3NE6A 3UT1A 3J7ZO 1UUEA 1M30A 5J40A 3QICA 1T8IA 2YX6A 1GCQC 3CCJA 2ATCB 4G7ZF 2MI6A 1Z25A 2XI9A 3J81E 4A2BA 1VSIA 5JMVA 3MJXA 1XMOK 3RQ4A 3F6OA 5BREA 5D4SA 3WXLA 3VQBA 2HQNA 4RAZA 1N36K 2FL7A 2EFPA 3LL7A 3SHFA 3C3WA 3J81K 4XAXB 3GXOA 5DD4A 3LA7A 2M1HA 2QWLA 2NUTB 4PJ0C 3KX2A 4RM3A 2XY5A 5J2PA 1W9HA 1YVUA 4ZH4F 4B3RK 4F17A 4CGZA 4B43A 3V1OA 3O4NA 2K40A 1JJ6C 2BV6A 3CC7A 1Y6IA 4GGGA 3NGPA 5LRRA 3W2WA 1R5ID 3S6IA 1T05A 5IYDJ 4I6MB 4ESBA 2F4VK 3LSRA 3LWHA 1B8IB 1R8OB 4BXXJ 3VF6A 3KTQA 3UR3C 2E19A 2D8JA 1YS7A 3K4NA 1OKRA 3DXJF 1SKRA 2E1MB 2MYSA 2CUJA 1ETQA 3S32A 2DZCA 4UNFA 4BEHB 2HXOA 2IVWA 2A68F 4NXNK 2H1LA 2LQ8A 4KTZA 1IJWC 3LSGA 4EMKC 2XASA 4X9CA 3LPUA 1RAAB 2CW0F 4DEXA 1K78A 3G6EQ 2HAXA 1EETA 1LB2A 4P55A 5LJ5h 3RESA 4RLFA 4PLLA 3ISNC 3CC2A 3HSBA 4KISA 2XAFA 4Z8AA 5BN8A 4JZ3A 5CQYA 3NFAA 3KP4A 1FW6A 3GL1A 3Q1JA 3NTHA 1RR8C 3EGDB 3CCMA 2OPSA 1UA1A 2MH9A 5C25A 4KIFA 1GLBG 1ILYA 2EB7A 2QSHX 1Q1HA 2Z33A 1EQYA 1ENHA 1V54H 1IGUA 4C1NI 3QWLA 1D8JA 2LX9A 3RRGA 2VQHA 2K3FA 4LD6A 3FF5A 2MSYA 2Z3YA 1DTQA 1WZOA 1A0NB 4RUGA 1BCMA 1VIEA 4KRTA 1LVKA 3VYRB 2E60A 1S5LC 1USTA 1X2QA 3EYZA 4BU2A 3CG7A 5LL6Z 4L5EA 2H3JA 4EJTA 2K9SA 3QBWA 3DLBA 1NGIA 3I8BA 3O8VA 2X9HA 3A8GB 3I55I 5AQKA 1KQSS 2GA2A 1N6AA 2OAWA 3CFRA 4AFSC 4DBRA 2K3PA 2W04A 4CZLA 3CCET 4PWDA 2IC3A 4IEIA 1SC7A 4PHTX 4J2EA 1BA5A 5KQ8A 2EILH 3ZQIA 1IREB 2Y0MA 4OF1A 3U3GA 2MA3A 2ELJA 3HOYJ 3MWTA 1QKXA 3P9KA 1U1SA 4F16A 2HL5C 4KTWA 4KFCA 2KVQG 1Y0NA 3QP6A 1K9MR 3R2XC 2PVGB 5IYBJ 3CPEA 2P9LB 2OTJA 5AZJA 2H27A 4DQ2A 2HU9A 1S7AA 3JRHA 2EV0A 4C92E 5FD6A 3RR6A 1V29B 2W03A 2D0QB 2DA3A 2F69A 4YPRA 6AT1B 2E2OA 1HKSA 3VS7A 1VQ7Q 1TKZA 2JSCA 3I0TA 1LFUP 2HVSA 2Y9YA 4BD3A 4DBHA 3WU2C 4FVMA 1BIZA 5FPDA 4AIKA 4B9QA 1ERDA 4QW2A 1T0JA 3DP7A 4LG0A 3CDIA 2DYIA 3W6VA 3CCYA 5KYUA 4XIUA 3D5RC 3IMXA 2CGJA 4BWMA 3OW2A 4KGXB 1C0UA 2KIMA 4DTXA 4G7OF 4DYCA 3TW6A 4G9ZA 5DLQE 3E1SA 1PU8A 1R4NB 1FYMA 1GBQA 1MJ9A 3MCPA 4FJIA 4WCEL 2AHQA 3U23A 1I94K 1W5TA 2DA4A 2P1JA 4P5NA 4LMYA 1Z9QA 3SXYA 1S3JA 4Y3OA 3FXOA 4PJNA 2KJCA 2A6AA 3MFKA 3RMBA 3TARA 3SAGA 3FJ5A 3C95A 3WXJA 1WEIA 1RUOA 2F8SA 3MAQA 1OH5A 3HTUA 1LCKA 3GCMA 2CT4A 1GLLO 3TO9A 2EIMH 1Y39A 3K5OA 2HD0A 1WVRA 1VQ8A 4Y33A 5CVJA 2ZO4A 3ZBDA 4MMLA 5D8LB 2D0PA 3DBRB 2W7NA 4DQSA 5HRNA 4FOIA 4JK9A 3SWNC 4DQIA 1FEXA 1RBUA 2DMPA 1PUEE 3AA4A 4IQJA 3MWMA 2ZJPL 4RTWA 3L2CA 3DLHA 4GCVA 5GMKh 1X43A 5E8IA 2E65A 5M1FA 2ITMA 3NMZC 2Q31A 2XD0A 1VI0A 2VB6A 4ZYDA 3D2FA 5LJ5g 4LC9B 3LPTA 1IO6A 3H0FA 4JI0K 5CKEA 4M77A 3BE3A 3J81O 1IO2A 4Z89A 2MLKA 3ERED 2WB1N 1O57A 3WTXC 1Z3YA 1SEMA 2BZ8A 1HW5A 4BRDA 3H9QA 2PQ8A 2X48A 4HVUA 2KRCA 3SHWA 3WQUA 5DM6L 4I9LA 1Q82O 4EGYA 3LDLA 3G4SQ 4HAMA 4CXFA 4FLWA 1VQPA 1Z6TA 3V9UA 4H5RA 1Z05A 1JCFA 1RTHA 2VKEA 3THWB 3LAKA 1AHJB 4D9JA 2KPMA 4ON0A 1L3VA 4BRHA 3RKWA 3C12A 3M59A 3E7LA 3JB9G 3NGYA 4LY7A 4KTQA 3NHGA 4F93B 4JZ4A 1YI2N 2G8FA 2RJEA 1C0MA 3F70A 4C92B 1VSMA 1D0XA 3DYAA 3LA2A 2NOFA 4AFUC 2KSSA 2B63J 1J3TA 4E7SA 1PP8F 5HK0A 1VSDA 3THXA 3D7EO 1C1CA 3TMOA 4M77D 1BKBA 5BMZA 2XPWA 2IGIA 1HJDA 1HSTA 4MEYF 4E89A 2F1LA 2RHKA 2KXCA 3ONQA 4L0ZB 4CGDA 1JXEA 4CEOA 1NPPA 1GL5A 5KYXA 1OH7A 2EIFA 4W5QA 5KPRA 2CSIA 4RTUA 2PNIA 3PIOA 4CC3A 3ZT2A 1S7OA 3WTVC 3GE1A 3BG9A 2KLAA 1DGKN 1A35A 2PMUA 4B3XA 2HQHA 3ZMSA 4BKXA 3P39A 3CERA 1HKCA 1F36A 1KG1A 4Z4FA 4M3GA 2B6AA 3ZYYX 3HKZA 1V76A 7AT1B 4M3EA 2IBDA 3ZXSA 3SPYA 3G1LA 3EUHA 1NK0A 4H0XB 4FJ8A 3V42A 2XDBA 1RT7A 3E5UA 3H9GA 3X2QH 1C0TA 4FYDA 3IL2A 3TR8A 2YHYA 3DLKA 1RCHA 1U5SA 2M16A 3H08A 4DSEA 2LKPA 1FYLA 4RGSA 4HX4A 5LHIA 2FSWA 3WNGA 2W00A 4I9QA 3CCLT 2GWJA 1VQOQ 1TWAJ 4FCYA 4BQNA 3TEEA 2UYTA 1WHMA 4HVWA 1M8VA 4C9YA 1LPLA 4YRVA 2VUBA 4EJZA 1F5TA 4M78B 4U7DA 4PGHA 3L4IA 2LMJA 3WTUC 2W6LA 4C92C 2ZPIB 2IVPA 2WWYA 2X0LA 3TU4K 4JI2K 2W4SA 2IPOB 3HG9A 4B3TK 2Z5UA 4AI4A 3B02A 4WCIA 1OEBA 1X9WA 3TCJA 4O4GA 2WY8Q 2CREA 2F8TA 1XD7A 2DK5A 2CGLA 2R5YA 2KW4A 2RJDA 3LLRA 1JCGA 1E0EA 4C1NK 3WQTA 1LDDA 2D2WA 2PVDB 1YHQT 2EGCA 3CJNA 1O4XA 2LKXA 3HBLA 3VEYA 1T03A 5I11A 4LLNA 4OFEA 3HRGA 3UA6A 4D5FA 3UKUA 2L8DA 3NF7A 1KVBA 4J9FA 3L1PA 2HPMA 1ZBJA 1FBUA 3C94A 5JHUA 2CGHA 2BW3A 1YHQI 2JG6A 3DXKB 2NOBA 4O55A 1SANA 1R5HA 2HOTA 3NDKA 2VG5A 4A4KA 3J8AA 3QMLA 1FKPA 1KQ9A 1VQKN 2YCHA 2LC4A 2ZJRL 4ZN3A 3IWFA 2P9SB 4QQ6A 2QWNA 5BRFA 4ILGB 1TT5B 1MJBA 3SJHA 3D2EA 3CQ8A 3AGRA 2DMQA 3OYNA 4LE9A 1CXUA 4XK4A 3CXCS 4X65K 3DLLL 1T56A 3TTFA 2W10A 2O8DB 2PJRA 2VXDA 5CR2A 2HQ5A 3RMDA 1H9GA 2NS7A 3I56A 4JRPA 5I22A 1KFDA 3J7AP 2Y30A 3U9DA 3L2UA 1JHHA 2LQKA 1HLUA 2VONA 4DQPA 3OBYA 2HSTA 3IHUA 4GKJK 2P6SA 1D3BB 3EFOB 2HFHA 2NOHA 3U8XA 2PEXA 2UUZA 4E70A 3DI6A 1NEGA 2X1EA 4JI6K 4C92G 3A5NC 2JA2A 2RF0A 4IOAL 4JD2A 3TP0A 3LSHA 2FBKA 5ILVA 4XLHA 4GYGA 3ZQCA 1J53A 1KD1R 1YJ9A 4EVVA 2AIRB 2CYYA 4DOVA 3I59B 3JYTA 1X4OA 1VQ6Q 5GADJ 2DDBA 4HV5A 3CPWP 3C6UA 5K7HA 3BR2A 3C7NA 5C4JJ 4PFZA 2BH1A 3CCRN 1OCZH 2KZZA 3S6WA 2V79A 2JXBA 2KZGA 3EL2A 4CYCA 2R7XA 2RN2A 1RACB 4HF0A 2ZE2A 2COWA 3IRQA 2LDMA 4ZYHA 1KZHA 4AM6A 2Y0SN 3GMEA 1YIJN 1HSJA 1O1WA 4X0GA 2IVMA 1GV2A 1TKXA 1P92A 3I55Q 4DTJA 4P96A 3PIPF 5HRSA 1HKGA 4JRQA 1ITGA 1LUJB 2BHZA 2MF2A 4HW0A 1TKDA 3J80Z 2ED1A 3THVA 4XK8E 2JMAA 3ZSXA 3S1NJ 1I4K1 2DQLA 3FXLA 4FJLA 3GOIA 2RC4A 4E7IA 1SD6A 3K58A 4Y4RA 1Q7YU 4DIQA 3CCSQ 3K4JA 3T9NA 3TL4X 1Y0UA 5EX5A 3S2WA 4CYDA 2VC1A 1JJ2A 3PQKA 3TGNA 5C12A 5ELZA 5CKBA 5C44J 5JVHL 4M77F 3QHSA 1HSQA 1U3OA 1U2WA 1VTNC 2OI3A 1T08B 1HMVA 1PP7U 1N8RR 4X64K 3ZMVA 3EQLF 3SV4A 5DCMB 4F7UE 4BRCA 2O4GA 1T3SA 3KYDB 4NB4A 4OIPF 3VRZA 5C10A 1YI2I 5J2QA 2YDLA 1BYMA 4XU0A 4ZDOA 5FKKA 2PZ1A 2CRGA 1X6GA 2M51A 4A5BA 1N3AA 4JX5A 2CV1A 2VL8A 5A2QE 1Q7YC 3VQCA 1LJOA 4DSKA 1Y57A 3BPXA 4JYKA 2XDPA 3LP1A 4CIGA 2DAOA 4DK9A 2L9NA 5GMKl 2HF3A 2DU9A 4L9VA 3K6GA 1I0CA 5JLHA 4EV0A 4HDVA 1M1KU 1RAHB 3QU6A 3EG2A 4LDYA 2O03A 2K2MA 1GXPA 2XHIA 4IBNA 5JLFA 1FT9A 2I10A 1WI3A 2TCTA 2NRVA 2B86A 4JK8A 1B9DA 4M71A 5GINA 4ATOA 4JS4A 3M1EA 2FSNA 2VJ4A 4NNJA 5DK5A 4CHUA 2KFZA 1TWCJ 1RIOH 1TSFA 3SYTA 4I09A 2XC7A 2FEIA 3VUZA 4OLAA 2EFQA 3NF9A 3RMAA 1E3PA 3HJEA 2XB0X 1XSDA 3W6KB 3QOEA 4Q47A 4XTUA 1WSFA 2A3ZA 1KHIA 2NVXJ 1WPYA 4E7JA 3HOSA 1UAAA 4E3SA 1IG7A 2YNIA 3JCMX 1V3FA 3PUFA 3TO7A 4JJNK 2P5OA 4OPHA 1M1KC 3M8JA 4F52A 4YORA 4DFKA 3SFZA 2CZ0B 1B59A 3CMAA 4B8XA 4O8UA 3AVBA 2XKOA 3HSFA 2LYCA 3RSNA 4PIIA 3LWMA 1YF5L 2CH4A 2RDPA 2CKKA 2BY2A 2FQ3A 3IRXA 4FX4A 3CCJN 3K69A 3I35A 5E3OA 4FTHA 1UG1A 2QYOA 3AVGA 4C3IJ 4H0OA 3K1NA 4EM2A 5ECAA 2G8UA 4O3MA 4GMJB 1ETWA 5C15A 5C24A 1R7JA 3HM5A 1F43A 5KYWA 3AKZA 4Z4EA 3TSZA 2RA2A 2K9LA 4JEPA 3D1NI 1NE8A 1KGSA 4UY8I 1L3TA 4AHUA 3H3NO 2MWPA 1MSEC 2CSQA 1W4SA 2V1QA 1NH3A 3CESA 1P8ZA 4F7UB 4K8XA 3MHXA 2F5VA 5DS9A 2DTZA 1N25A 1VA7A 4FWRA 4KB1A 2K5CA 5A0GA 3CMYA 1QZZA 2XHCA 3QZ5B 2FRYA 3TU5A 3K2PA 1X3ZB 3CC7N 4NL2A 3LSJA 5K1YA 3ZEHA 3FXUA 4I98B 3BR5A 1HKBA 4FZXC 2DPPB 2KDSA 4L9JA 2ZCFB 3VQ9A 1FMKA 3SV3A 5GAHJ 3F22A 1YE9A 3J7AF 4F3OA 4DNCA 2D0AA 1WA7A 3HZ6A 2BE2A 1P2FA 1O3TA 5E26A 2L7KA 3KK7A 4NCAA 4TSXA 4LH4A 2KYBA 4G12A 3LOCA 3AVMA 2CH5A 3O5ZA 4A0ZA 2OA4A 4YFXF 1BHLA 4OMPA 3OSFA 2KK4A 4FW1A 3RBBB 1SZ2A 4ZNXA 5GAOr 4C0DB 1ZBUA 1NOYA 3ZL7C 1MDUB 3CC2N 4X66K 4LUDA 4CGIA 2DJIA 2JWTA 5M5WJ 4CRIA 4MNUA 1GLAG 3CCUT 2VOPA 3CMEA 1OKJA 1RT2A 4K43A 3BF1A 3CCMN 5LEJA 4FJJA 4FLXA 5AIPA 3ECHA 1FC3A 2DMOA 4CGJA 5ERIA 1YNZA 3RYRA 1YIJT 3CCVQ 3CCUI 2CZ1B 3TSPA 4CZFA 5IY5H 2ZJPF 4QQGA 2X74A 5HVQC 2DO7A 3FLGA 4C8MA 4BRLA 3HSTB 3OR1C 1BQNA 5IP9J 2JRMA 3BOQA 4LUEA 3FZVA 5I2MA 3F73A 3MKLA 2D0NA 3ZSZA 3JCMe 1YIJI 1YAGA 2H1KA 1MBJA 4GLMA 1E4FT 4GXOA 1GOAA 3ZN0A 1YWPA 2Y9ZA 5AQIA 2EZLA 1X6BA 3V8LA 1I50J 5BPNA 4LG0B 1R00A 4OLBA 3QOPA 4KYWA 4MLHA 3LH5A 5KYUB 4OJRA 1UHWA 1QSLA 3KIOA 4F7ZA 5KE3A 1JHFA 3T8TA 1VOMA 3REAB 1M2OA 4PJMA 3TEDA 3HO1A 4CH7A 4LG3A 2Y31A 1H9TA 2CW8A 2IVNA 2O8KA 4IHTA 2O5RA 2OTJN 4CO8A 2CS3A 5I21A 3MN7A 3DM2A 1LW0A 4CEDA 2P9NA 4H0EA 1OCRH 5A2QO 2GUIA 4FASD 2YKMA 1MUYA 3GIBA 2QAZA 3KK2A 3KD1E 4EP4A 4M7AD 1SL0A 4QOZB 1RNLA 3H3VK 3UWNA 2HDDA 1SD7A 2VT3A 4E7KA 1IZ1A 5JHFA 5D6XA 4B6MA 3ZMTA 3JCMf 3L2QA 4DU3A 3E6DA 2IJLA 2R7ZJ 5AQRA 1K1ZA 4Y0WA 4XM3A 3FXJA 4CHNA 1IG8A 5GAN7 4V19K 4IVNA 3TP3A 2K3XA 1TU0B 4JKDA 3M0UA 2VXFA 3G0QA 2L02A 1BOBA 2PYJA 4DLGA 1NZ9A 4F04B 4ANJA 2OJ2A 1HKTA 1RTIA 1YWOA 2GUPA 4C2TA 3EFRA 1KG2A 3D2FB 4JKGB 3ZT3A 2KTQA 4AMCA 2VV5A 3B73A 1QTMA 1C6VA 1OZ3A 1RFQA 5KQDA 4HHTA 2R7SA 3CQTA 4EA5A 4DQQA 3OQ5A 1CLQA 4IRHA 1OZ2A 1PKTA 1TGOA 1B4AA 1IV8A 3P5JA 1RESA 1RR7A 3HPOA 2R7DA 4M7DA 1VQ8N 4ZDLA 2VXEA 2M0YA 5KNLA 1NTCA 3JSMA 2A1SA 2NRAC 1WLJA 3VQ4A 2BE9B 1K76A 2PI0A 4BI8B 2Y1IA 3HM8A 4ENMA 2MOXA 1UHFA 4KULA 2PMZA 2NVYJ 2Y48A 2VE8A 2XPVA 2E2JJ 4Z4CA 2MPXC 1T3LA 2VBWA 1HPZA 2EPFA 1YOVB 1WN7A 5KTQA 1NK3P 3TO6A 3JCMd 2X3XD 2E4LA 3X20B 3LH0A 3GPLA 2Y90A 5IAYA 1MBFA 2GWKA 3SK3A 4NC7A 1U6ZA 2L2PA 1NYFA 2BUDA 4PKHA 1FIPA 2H8HA 4HX8A 3THXB 3F8CA 2KDOA 1N8RU 2LD5A 2KIQA 5IYCJ 2HEQA 2OPTA 4A3KJ 1XQPA 1TAUA 4ETSA 4ITVA 2LF7A 4XH4A 1HF0A 2CS7A 2R5AA 4CUGA 3EHQA 2FZCB 4MDXA 1VQPN 2E1CA 3CCJT 2FMLA 1Z7LA 5LJ3h 1Y1VJ 4XTWA 2EA2A 2DOAA 5KYXB 4AFZC 4M7DD 3CD6T 1YX3A 5L3GA 4FJNA 4FJ7A 3JTGA 1QZYA 4JKEA 5LGUA 1G3TA 1VQLA 3MKDA 1M1EB 1REPC 4Y92A 1T0FC 1XTAA 4FSXA 2HEOA 3CBMA 3CCJI 3S1QJ 4JQFA 3PO4A 4M77C 3LM2A 2NRXA 1YI2Q 4CCHA 3CD6I 4N9HA 2ZFWA 3VGMA 5I3UA 2X4YA 3DRRA 3QINA 2BYVE 1W2BA 3AFHA 2DBBA 4PGGA 2OF7A 2DEUA 3LZJA 3WVDB 3GTGJ 2VN2A 2UWMA 4IUVA 3EUKL 3AO3A 4FOEA 1N8RC 3EG1A 5K5QA 2QA4N 1D1BA 4IFVA 3CC7T 2OTLA 4YOXA 2NYXA 5FGMA 3BTIA 2HYGD 1XCBA 5DUKA 4F2SA 3ZQGA 2X3WD 3UKRB 1QQIA 3BZCA 1ZC6A 3O4WA 1TUUA 2ASOA 2GTJA 2F2EA 1OCTC 1HA8A 4G1QA 2JK3A 2LVSA 5SZTA 3LP3A 3M5RA 5GIPA 3DLLF 1BI2A 2JPSA 4P5OA 3GYHX 2LX7A 2ETJA 3BTCA 3CC7I 4BROA 1Q86R 1TKTA 3JS6A 4BE2A 1KG6A 2HYFA 2V7ZA 1TW2A 4WF2A 5LLQA 3CCQT 3DRPA 3DXMB 4J5YA 4V19S 3VSLA 1JCEA 1J54A 2EIJH 5AQWA 2ECCA 4BGBA 2GOMA 4LN2A 3HT3A 1D9DA 3I0RA 3CPFA 4HCCA 1MMGA 2QBYB 3CC2T 1B9FA 3AHUA 4I0AA 3TW7A 3MAJA 2L4AA 3X28B 3MECA 1GLJO 1IDYA 2WUSA 3CCQI 4PK4A 4BAYA 2VPRA 1APLC 3REBB 1NK8A 3W2VA 1TK5A 1Z67A 2HVRA 5EG2A 1T6CA 2OCCH 2BE7D 2RK1A 3CC2I 1WNSA 4OKKA 2B7EA 2EJRA 4CF1A 3GBTA 1ESVA 5EY4A 3A4CA 3CCMI 4FWMA 1IJJA 3V7CA 5F1RA 4NO7A 2IGOA 3EUHC 4HKEA 4A59A 3GF2A 3O1BA 1J9IA 5AN4A 3L2RA 4ORZA 2E2NA 3AG2H 3SAHA 1J5EK 4AM7A 1W70A 3ZSOA 1N32K 2IGKA 4M77G 1D0ZA 1WSJA 1OYYA 4B8AB 2P7CB 2CQ7A 2OJED 2FNAA 4RB1A 2DLPA 2FZKB 1BOTO 3D2EB 1IZ6A 4MFEA 2EIKH 4OAZA 4CJSA 4DTOA 4BJTA 2XRIA 2EKHA 4B1XB 5AFUA 2CUFA 3ABMH 2P4RA 4OKEA 3UPUA 2D8HA 4XN0A 4X9DA 4RG2A 2RPNA 3ABUA 1EF4A 4CJRA 2XRLA 4A93J 1QVGM 2OTJT 3CI5A 2F5FA 3ZR8X 5HS8A 2QVOA 3TAQA 2D4WA 3K9KA 4CW7B 3TAEA 2KHOA 5AQNA 1JB0E 4M7AF 1FTZA 1ZBIA 1QPIA 4MDBA 4CHPA 4DWIA 3HTVA 2RAEA 4BG8A 4EJYA 3MX2A 3I33A 3S1MJ 3N05A 3Q5FA 1NK6A 1VQKQ 4MDAA 2V75A 2CUEA 4RKUE 3OJUA 2OTJI 3BDPA 1W36D 5AQQA 1IW7F 5JS1A 4QTRA 1QP2A 2FBYA 5CYQA 4Y15A 1Y71A 3RMQA 2D9TA 3C7NB 3VPZA 2A3SA 1D9FA 3QEVA 2ELKA 5D6WA 3I56N 4I2QA 4OU0A 1KEAA 1MGQA 1ZGAA 2RI2A 2P9UB 4BDYA 1S1TA 4M75A 3FHFA 3CC4Q 1C0WA 2RHZA 1WH5A 5CQGA 2JS0A 3NAEA 4M72A 3L42A 4B3MK 3IAS2 2O9LA 2FD5A 2CV0A 2L3QA 1W0TA 4AIDA 2OUMA 1H0MA 4XQ3A 1PDNC 5GAOp 2UXCK 2DL4A 3IH7A 5E79C 3PT9A 1XDSA 5F0XA 4PCQA 3U9GA 2M45A 4FWKA 4Z2YA 2XMFA 2L0AA 2QGFB 3TTDA 4UV9A 4EM1A 1YJ9N 4E47A 5LBQA 1HQUA 2ZC2A 3A5ZB 1U47A 1VQ8T 4AD9A 1NK9A 2DE0X 3W2AA 2QGGA 1I3AA 4E1JA 1EH7A 1VSKA 3GG4A 4X1EA 3FM5A 4BHCA 5J8FA 2QEXT 1MMDA 1ZSZB 1K8AR 2FU4A 1G83A 3CCRQ 2QQ9A 3OIOA 2ASMA 1NJIC 4HDUA 1HJRA 4BR4A 4W97A 4MDWA 1XNRK 1ETYA 1VQ8I 1I5OB 1TL1A 4WTOB 4LFAK 4ICLA 4M7YA 1W4MA 1SFUA 5E1ZB 3HSEA 2KQRA 2JMWA 1M2VB 2MIOA 1YIJQ 3GOXA 3VESA 4EZ9A 2H3GX 4HQEA 2QEXI 2EINH 4CZJA 1TTHB 1U04A 2RD1A 3TSQA 1RETA 2IPQX 4Q5SF 1K8KA 3SDZA 1NJIO 4FLZA 2MK5A 2LY9A 1DQUA 1S6PA 4PJOA 5EEHA 1ABQA 2WBMA 2KIUA 2MG4A 2GFUA 4XL9A 5AZIB 2M4KA 3R0JA 1S9GA 3DPTA 4CJVA 2E7WA 4P9FA 3G1JA 3ULQB 4DOWA 2E64A 2QSGX 3H1VX 1Z9ZA 4ZYEA 1VRLA 2RI3A 5F04A 3VEZA 4ZTFA 2ZM6K 4B1UB 4E9GA 2WAQA 1VQPI 2V6CA 3M0TA 1S5JA 1X1AA 3G1OA 5F27A 1XPXA 1JE8A 3RPQA 3H6EA 1WI7A 4ILHA 3HOXJ 3QEXA 1U5TA 4XTXA 4NLCA 5E1WA 5K7FA 2LVMA 3LL3A 1UCRA 4UUVA 3KWGA 3THKA 4CJLA 2OPPA 4DF4A 4N47A 1ASUA 4EIAA 2Q2RA 3BF3A 2Q97A 3AV9A 4UUSA 4X1VA 1MWMA 3CJQB 2QA4T 3AY9A 1K73R 5BR8K 2E6MA 1ON1A 1LWYA 4DV0K 4HLXA 4KDPA 2ENMA 2CH0A 4PJOD 5GAN6 3VS2A 4D7NA 5C0YA 2SRCA 3LW5E 1U3EM 1JLAA 4G6QA 1ATNA 3SUOA 4KRFA 4YDUA 5FLXZ 2QA4I 4LXCA 2DJQA 3CWTA 5EEAA 2W24A 2XY7A 5ILSA 4LIUA 4M3YA 5AONA 5AQUA 2G3RA 2JN0A 4CHZA 2EZKA 3IH3A 3FZFA 3G6EN 2DLLA 1SFOJ 3P8BB 2H09A 4HT8A 3ZQFA 1KC8C 5IHKA 3QZ9B 2KFDA 2BBYA 3DPLC 1Y64A 1OX9A 3C1DA 3OSSC 3CPWM 3ATUA 1ZSGA 3ZETA 4JKBA 1RRJA 1AHDP 4TVRA 4I6MA 2CH4W 3SJJA 1NG2A 4OKJA 2YJEA 3Q9VA 1JL1A 3BUZB 1JUMA 2GQQA 1KC8O 2XIGA 2PG4A 3HDDA 3ZSQA 1JKOC 2EJ9A 1ORPA 3CJ7A 4JX4A 3HOTA 4FZZA 3RRHA 3CCVA 2RQQA 5J47A 4AHVA 1BI3A 1HYZA 4BEHA 2K4BA 2O01E 1TVRA 1NGDA 4DV1K 1S22A 3FZKA 1N33K 1XUPO 4BL0B 3LGLA 2UXBK 3VEWA 3NNQA 2JJ7A 1ZR4A 1VAZA 3JB9H 2AZSA 3GFIA 3CMAN 1T33A 3KZIC 3CJBA 4KH1B 5D3GA 4A5AA 4QQDA 4KICA 1RDBA 1ZARA 2QQBA 5AQHA 3VS4A 1RTDA 2HQRA 1SVMA 2V51B 2L9SA 4BQLA 2X51A 1KQSA 4D6WA 2KMUA 3EGDA 1SVLA 2JN6A 4Y28E 1ETVA 1UOCA 2VBYA 1YJNT 3KK3A 5E3LA 2JTEA 1QCNA 3PX4A 3TKYA 1FJLA 4DV5K 2JPCA 3LAPA 2ATQA 2HHTA 2A5XA 3CVSA 4BDPA 2EQRA 3COAC 2KKOA 1SSHA 2A07F 1WLPB 4YIRX 2HHUA 1ASWA 4YFNF 3Q0UA 1GBRA 3VV0A 4CIFA 1JL2A 1K83J 2RJCA 2DA2A 1DLOA 1UB9A 5TKWA 1P4AA 1YJNI 3LM9A 1LFPA 3BR0A 5HL7L 2IIMA 1Q86U 3O3HA 3JV3A 2HZYA 2M9UA 2NRHA 4YG2F 3WTWC 1YITA 3AAFA 2DX1A 3H92A 3BR1A 4JK1X 4M9ZA 3D45A 2HBLA 4LGWA 3ZMDA 2XGCA 1MBHA 1ZREA 4NBQA 5D5WB 2BZYA 4LFBK 3SZ2A 3EEQA 4EJVA 3HRUA 2X4WA 1ZQ3P 3DU6A 5GAEP 3HP9A 1W5SA 4AHSA 3I53A 4Y17A 3LDNA 2E3IA 5H20A 3KYCB 2J4RA 4WXDA 3KK1A 2DPNA 4CCJA 2LT4A 1TS9A 2GWRA 1Q8IA 4DLEA 4KAZA 4DQ8A 1QQCA 2P9LA 2M3AA 4R79A 2BKDN 2DK8A 5KGXA 4O0IA 4WX9A 4H8KA 2HWVA 4BY6B 1IDZA 4KI6A 1UE9A 2HQEA 3K1MA 3ER0A 3JRAA 1Q86C 2PBDA 3SJMA 4MO5A 4Q48A 3DCFA 2GQVA 2HDAA 2FZGB 2WOMA 3MXJA 3HOWJ 2EWNA 1NJWA 1NGBA 4FWOA 3CMEN 2ME6A 3A1YA 2KYMA 3WHBA 1PVEA 5M1NA 5CYMA 4LF4K 4F3QA 2EZHA 4RMNA 4XKVA 3EG3A 5HK3A 2KLOA 1XQOA 3ID6A 4HV6A 3CCMQ 5GANd 2Y2ZA 4AIAA 3VEPA 3CUQA 2V8IA 1WPKA 2GTOA 1X58A 1BBYA 1MNDA 3L4QA 4CJ7A 2HHSA 9ATCB 3N97A 3QPLA 3CQZJ 2W48A 1G3WA 1KG3A 2DL3A 1BB9A 2VKHA 4JV5K 4N4HA 3WXMB 4BVOA 1N39A 1EWQA 3HXMA 3RSEB 3F72A 5KYYB 4E1MA 3E5QA 3IHOA 2D1HA 1XJWB 3K2AA 3H0DA 1T98A 2G8KA 4U0WA 2LKSA 2COMA 2BTTA 5AQJA 1QP3A 4N5SA 4LSNA 3VQAA 3VUBA 4FXDA 2EBIA 4FJMA 4IG0A 1RABB 4RTXA 3QG1A 4DKWA 3HSCA 2E6LA 2DD4A 2JSPA 5EG0B 2ZPHB 3V1RA 2DI3A 3GNGA 1UDLA 2RVCA 1FXXA 2LTOA 4BY6C 1ZBXA 4MIMA 3FX3A 4M3WA 3PLAA 2LMDA 2YR2A 4CEQA 2ZNZA 2KT8A 1ODDA 2OTJQ 4WFBL 3ZSYA 1NGEA 2W41A 4PLIA 3WNFA 1R71A 3ZT0A 4Q4ZF 2HVHA 1S9HA 2EQJA 1X1DA 5FPNA 3MN5A 4XSZF 4MQ9F 3GLXA 3MCZA 1YLFA 4PJLA 4YIIA 2QKMB 2RQVA 5SWMA 2E4HA 4BR2A 5GAMe 4E7LA 1VQ5Q 4B47A 3THWA 2PX9A 3FRNA 3S3MA 4V2GA 4CGFA 5HDNA 4WF9L 3LSMA 2O4XB 3QPHA 4U0YA 1VYVA 1ETKA 4KUMA 1JLCA 1B72B 3FHGA 3EG9B 3VEXA 2RQUA 1D5VA 3PO5A 5E1XA 4D8DA 2W84A 4IOCL 1M3BA 1YJWA 3E6MA 4LD0A 2P7VB 3G6ET 1ATSA 4XBFA 2PUKB 2UUCK 3ERMA 2XKPA 3PFIA 4FE4A 5LHHA 1YN8A 1ZRFA 3PNWC 3S1RJ 5AT1B 5J2NA 2R7FA 3KLEA 4D1QA 3WEEB 1PU6A 4YELA 5DM7L 1ZN2A 1UZCA 3TREA 4ME7A 1LE8A 3F0ZA 2Z99A 4GW6A 2JNGA 2K9NA 4DR2K 1VIFA 3G6EI 3GDQA 4EJUA 5LL6S 1JGGA 3CP2A 3H9JA 5L3DA 2DA5A 3FXQA 3KJVA 2E6ZA 2F48A 2NOZA 3L00A 1NGAA 1LEAA 1P9QC 1YW8A 2WAEA 3S2DJ 4JI3K 1NM1A 5GAMf 1AA7A 2ZCWA 1XG7A 2PMZN 4HVVA 4EM0B 1WJSA 1DU6A 2X6WA 4FHTA 2LREA 2A6HF 1W97L 4CEEA 1DJ7B 3DEUA 1BR2A 3K4BA 2QXFA 3BY7A 1OOTA 4IO8A 3B6OA 5KPTA 1RT4A 1KQ0A 4JAXA 3HPWA 4C92D 3PE0A 4AG1C 5B3SH 4DHYA 4ESJA 1K79A 4O0JA 3KEOA 1I1SA 1PRMC 1S7EA 2ADUA 1RDDA 3RTVA 4M7DC 1WAJA 4PQUA 2FSKA 1Z9CA 1WFWA 2HKXA 4ZDPA 3WU0A 4C8QA 1Y56A 1EIFA 1K61A 3G71A 1K73U 5GPAA 4AFQC 1VQPQ 1KLNA 4MEXF 1TWHJ 4E0DA 1X1PA 2ED0A 5IWAK 4DOZA 4M78A 3K4MA 1XNIA 1VQLN 1RLPC 3K9TA 4M75E 4M41A 3O8HA 3RZDJ 4H5NA 2HKQB 3PM1A 2XROA 3SFMA 1VQ7T 4GRIA 1WEGA 1RAIB 4OMZA 2OZ6A 3P4IA 2OFKA 2FPEA 2A05A 4IHYA 1NMDA 3OYFA 1Z7UA 2JA5J 4CEBA 4OFHA 4XU3A 5GAMd 5AQYA 3TI0A 2GQIA 3CDHA 4A61A 2VCPA 4J6WA 2PVOB 4Y52J 3MO8A 4DUZK 1VQMQ 4H5WA 1T6DA 3QPSA 4JI7K 3PY8A 2OTLN 3HRMA 2FNPA 3J7YJ 3R6OA 2XF7A 3JB9F 3WGGA 3NCIA 1RI0A 3GFJA 1K73C 3INZA 4JS5A 4CIEA 2HNYA 1ZRDA 2X6XA 3CC4A 2R7WA 3DFGA 5JLXA 2CG4A 4ABZA 4J9IA 4AILC 4JRIA 1PD0A 4BRQA 2NYSA 4LJZF 1K6OA 2JTFA 3IS9A 5ADXH 5LJ5e 2ZGYA 2CV2A 3A5OC 4M78D 3DXKA 3DU5A 1ZA1B 2YHTA 2EYQA 3QBYA 2EBPA 1LNWA 1NKBA 3JTHA 1M1FA 2YRVA 2XV4S 5TKYA 3VETA 2F96A 2QK0A 2K86A 2UUBK 2FF3B 1EJ9A 3SNNA 4AYBA 4BG9A 1IUYA 2P9SA 5IT9Z 2C6YA 1EV7A 2DMTA 3E97A 1YTAA 2IOCA 3F9MA 3FISA 4DU1A 3MD2A 1T95A 2RHYA 4GV6A 1KU2A 3JREA 5IPAA 2OPRA 4CFCA 2QWPA 3JCMc 3KP3A 2O8DA 5FU6B 4YHHK 1FY7A 1F1ZA 4IX7A 3GBQA 4M7DG 2CQQA 4JHDB 2ID6A 1E6GA 4MFDA 4D8KA 1T39A 1ZUYA 1U8RA 1PWTA 1YFHA 4BQQA 3NF6A 4IEEA 3EG0A 2KT1A 2ZJQF 1HYVA 3KCCA 3MN9A 3SMSA 4IO9L 1TOVA 3EGXB 4B48A 1MMNA 1D3BA 3EFOA 1GDTA 3CJ9A 2ZPGB 4DZPA 2DILA 1UGVA 2YX7A 3EN9A 5LJ5f 3D4VA 1NGHA 1KSWA 4BQZA 3M07A 1I5ZA 3RI4A 2VQEK 3I59A 2HOSA 4PKCC 3ULDA 2A42A 4DV4K 1NGCA 5EVZA 4RLQA 1XG1A 1MKMA 2UU9K 2RGVA 2PUOB 3I9QA 3LFKA 1OI1A 3DOLA 4C23A 2G0EA 2L4MA 1WHJA 2YV0X 1K4TA 4JKCA 5EF6A 2GIVA 1V4SA 3VYSB 4IIMA 1TNTA 3IKMA 4J2AA 3O9UA 1HC8A 3IKVA 3M8EA 2QK9A 3FLCO 4M75B 3AL0B 1TH7A 4BR0A 4CHQA 3MXMA 3FHNA 2J6OA 3BCAA 1QCOA 1BI4B 4R55A 3AARA 3LDOA 4M6VA 3VS3A 4RWTA 3QWYA 4MQVA 4A3JJ 1KK7A 4KHUA 1SAZA 1ZG1A 1W36C 2ZXIA 2HPIA 3IQLA 3FWEA 3PFSA 5LD2C 3A0IX 4FPBA 4PFOA 2DYBA 4JI1K 3EGUA 1S1NA 2DA7A 5DLOA 1X75C 3MEVA 2RQPA 1FJGK 1X3NA 1YG2A 2DFFA 2AXLA 4ELZC 3AVLA 1CKBA 2D5RA 1ACMB 1QSSA 5CQXA 1HUXA 4BRIA 3HZJA 3E2UA 5LJ5d 4DU4A 4BB7A 2L9RA 5AQXA 3FBNB 3H9NA 4CFAA 1LWVA 1VK0A 4H5VA 3I56Q 1KU9A 1QQJA 1U6GA 3PMTA 3DAWA 3VF2A 3VQ5A 5E84A 1FOXA 2H6CA 4UNOA 3CVTA 4KHNA 4W5OA 2ABKA 5DCFA 5HP1A 2EFNA 3WG9A 3R60A 4B1WB 2ZPFB 2GA1A 2V1XA 4FYVB 2YUSA 4A3LJ 1BA1A 4FJ5A 4FYXB 1A5JA 5AQTA 3CCEA 5DCMA 1P4XA 1P6RA 1VF9A 3SUQA 2COYA 1B92A 2CZ7B 1X9JA 3O4QA 2OYQA 3BG7A 1SRMA 4AI5A 2QZ8A 3J80K 5J39A 4N4IA 3M9QA 3ISPA 2WFBA 2V9KA 5HLIA 2OA8A 1IUFA 1VQOT 5EZHA 2HMPA 1BN5A 1YJ9Q 2YHWA 4HBLA 4M6XA 3O3KA 1VSFA 2EKOA 3FZMA 2E1HA 4QWQA 4CEFA 1X27A 3DPUA 2LNBA 4RW4A 1YQRA 4M75C 2VQFK 2MAMA 2CU7A 4MLEA 1VQOI 2MW8A 1RI7A 2JWLA 1NPRA 2XG8D 4C92F 3NEUA 3NH1A 5KRTA 1JLGA 5HY6A 3S8PA 1MWKA 1OLTA 1SEUA 4BRPA 4G6DA 4CK3A 3VTHA 1RBSA 1X3MA 5F2RA 3OYHA 1YIOA 2OAUA 2JMCA 4A0YA 4MLOA 2O2OA 4MHGA 3CPWS 3M3ZA 3ATVA 4UC4A 2XGDA 3NWTA 3X24B 2IA2A 3UIQA 3BJAA 1MH4A 4QVDA 3O08A 1XHZA 4ELVA 3GVAA 2DTUA 1PVSA 3KD5E 4UUSB 4JYAK 2M7BA 3K4KA 3G7ZA 4X6AJ 2ZB9A 4ZZLA 3UATA 2A6EF 1R22A 3LCNA 3VSKA 2HTJA 1TG0A 1SKUB 1HJOA 2P0QA 5DYMA 4G94A 1X2MA 3FZHA 3LALA 2O8BA 1SKSA 1QW1A 5FU7B 4IUPA 2ASPA 3WVEB 1IKVA 2O8FB 2WAQN 2YNFA 3HHGA 3J7AO 2O3FA 2K85A 3BJ6A 2JVVA 1Q9XA 4N0BA 3TQNA 4MFBA 2O9SA 3LGFA 1NK7A 2JRTA 3BC8A 2R5MA 4LDVA 4XICA 2L3RA 3QDKA 2ZWHA 3HKSA 4PJOC 2ACJA 1XMXA 2JVHA 5LGTA 2L7FP 1HOMA 4ENKA 3IUOA 1FTTA 4JJDA 3ZETB 1UB4A 2RB6A 1VRTA 2VE9A 2NRTA 3ULEA 3GEZA 4OMLA 4LFUA 2K9QA 4B09A 1D3YA 1D09B 2CP2A 5HLGA 2UUAK 2LH9A 2IGNA 3LFUA 5A2QZ 1RUNA 4FM2A 1D5YA 4E6RA 2C0IA 2LRDA 2HZDA 1QKWA 2ZQBA 1U5TC 4M75G 3QJYA 2I7PA 3ZX3A 2HQAA 4GLKA 2HOAA 5L3CA 4MTEA 4F7UA 2JT4A 4Z02A 2CFOA 5E3MA 5H6RA 1SVOA 1HX1A 1B3QA 1AT1B 3VQDA 4LF5K 3QSUA 1VQ6T 3PIOL 4LIVA 2YNHA 1A5XA 4CF2A 2DIGA 5LMUK 4WXHA 3DEWA 2F5KA 4L18B 1QSYA 3ZEUA 2MFZA 4O5FA 4RS8A 5JFRA 4RTFD 2ISYA 3O3GA 1QVFM 2DTRA 3K57A 5BPDA 3VOEA 5EU7A 1XSVA 1DUXC 4YDUC 3EAEA 1I6XA 2E5QA 1VQ6I 1SS6A 4KT0E 4OB0B 3CCVN 3SB2A 4ZGDB 4KH4A 3JCMg 3I55T 4B08A 3I5UA 2NUPA 2GELA 4FYWB 1TXQA 2QLZA 2VC0A 1K6YA 2W85A 2FB7A 1JXSA 2DVEA 1NG6A 3O8GA 3VQEA 3FFKB 4JKAA 1BA0A 3SQNA 5EOYA 3L1AA 4G6TB 4PDKA 1M90U 3FK6A 4VUBA 2VGMA 2HGCA 3A0BC 2DFUA 1AWOA 2YSRA 4KT6A 3CMAQ 4DW6A 3VOVA 1A6QA 5FRMA 1IN5A 3OL4A 3M8QA 3M6GA 5B1AH 3DB3A 2VGNA 1NGGA 3PO2J 3M4YA 4XLPF 1WSGA 4D5CA 4PJOG 2NOEA 2VBZA 3CCST 2P0PA 2EH3A 3IKTA 4YOWA 5F6FA 1RL2A 4DSFA 1GVJA 2E1MC 3FIFA 2EGAA 1EP4A 3VMFB 4AQYK 1KIKA 1FOKA 1KONA 4Z94A 2PFUA 2GXGA 1M3QA 1BQMA 4FIBA 1FNNA 2DVJA 4R0KA 3HYIA 2R5ZB 2CYZB 2J7IA 4C8OA 4EW0A 4XSXF 4CJTA 2LR8A 1JQQA 3CCSI 1DKGD 2M0MA 1XCVA 3CCLA 4KH5A 3F10A 2KFNA 3PX6A 3QUIA 1ETOA 3R6SA 1YITN 4UVBA 1ARKA 3E9LA 3N4MA 1QMCA 2LSOA 3TSUA 4BHPA 4PSXA 2YX4A 1MHNA 3O1WA 2YHAA 4DCHA 1M90C 4GDFA 3EE9A 3V6DA 1USSA 1Y07A 4XTVA 1S8NA 1OYXA 3W6JB 1VQ5A 1KA8A 3TOBA 3Q7CA 5BRDA 3LP0A 1YQLA 3K1PA 3QYGB 2P0WA 2W57A 1Q7YR 3OS2A 3ZT1A 1RGIA 5LMNK 4A53A 4M3BA 1ZGJA 3QYBA 4QVZA 2LTPA 2STTA 2I5WA 3VERA 4DJAA 2Z1HA 5BRHA 4IG3A 2DOFA 3LANA 1Q82U 4M3DA 5KCMA 1M90O 4NYNA 3S3OA 4B9XA 3T3FA 2XSJC 3CUQB 5KK1A 4BGDA 3KYLA 4XLCA 1BO5O 5J4YA 2E6NA 3TVTA 2UXNA 2XHKA 2AK5A 5J1UA 5C2DA 4CGHA 4A4FA 2CUZA 2L0KA 4E6KG 1YHQA 3CM6A 4IOCF 2DOEA 3JCMP 4LF9K 1XC3A 4TV7A 2EPDA 2KT0A 3J7ZI 5DM7R 4XH5A 3SD4A 1ZHFA 3OW2P 1RAEB 3RDVA 3HFNA 1C0FA 1EWRA 4C8QE 3CMEQ 2DY4A 3CJTB 3HOVJ 5DM7F 1JKRC 2LJ3A 1PC0A 1SD5A 4GNIA 3QESA 1VSLA 5LGNA 2WSFE 4CZCA 4M78E 1N77A 2EZIA 3ALYA 5K14A 4FWNA 1Q82C 4PA1A 2V52B 2B8AA 1M1KR 2DJZA 3DF8A 2LSNA 1WFXA 4JKGA 3OH6A 4F92B 4DR1K 4I99C 1NKUA 1PYVA 4E7HA 2HF4A 2OANA 5H6QA 2DT7B 5AQMA 3G73A 4CJ3A 1JKPC 1B9NA 4KIGA 2O8XA 4CZEA 3RWUA 5IH2A 3WTSC 4KNYA 1QHHD 1R0CB 2J6KA 4YOVA 2EQMA 3NBPA 4HWIA 5J1EA 1YBYA 1Y7XA 3DWLA