3CWUA

Crystal structure of an alka host/guest complex 2'-fluoro-2'-deoxy-1,n6-ethenoadenine:thymine base pair
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cwuA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cwuA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cwuA01
1EBMA 4E9EA 2NOEA 3N5NX 2NOZA 3F0ZA 4EJZA 2NOFA 2OFIA 1LMZA 2NOIA 2XHIA 4E9GA 2OFKA 1DIZA 1LWWA 2H56A 1N3AA 1PU7A 4YPRA 1P59A 4EVVA 5DPKA 1HU0A 3S6IA 1NKUA 1FN7A 1PU8A 3IH7A 3KTUA 2YG9A 4OFHA 1WEIA 4B22A 3CWTA 4B21A 3N0UA 4E9HA 1NGNA 1KQJA 1MUNA 1VRLA 1RRSA 4UOBA 2YG8A 4PIIA 2NOBA 1KG7A 1YQMA 3I0WA 1KG2A 4EW4A 5CHZA 4YOQA 1KO9A 4B24A 3CWSA 3CW7A 1YQKA 1ORPA 1MUYA 4E9FA 3D4VA 4OFAA 5AN4A 1XQPA 3F10A 2JHJA 4UNFA 4AIAA 1MUDA 1N3CA 3I0XA 1RRQA 4AI4A 1KG3A 1M3HA 3CVTA 3OGDA 5KN9A 4EW0A 3KNTA 5KN8A 3FHGA 3CWUA 3OH6A 1XQOA 1M3QA 1P7MA 1PVSA 1LWVA 1KG5A 2NOHA 2ABKA 2JHNA 4EJYA 2NOLA 2JG6A 4OFEA 1N39A 1WEFA 1LWYA 3G0QA 1KEAA 1YQRA 1ORNA 4AI5A 2I5WA 1PU6A 1MPGA 1WEGA 1KG6A 4YPHA 4EA5A 1KG4A 4HSBA 3CWAA 4EA4A 3FHFA 3CVSA 3IHOA 3OH9A 4B23A 1YQLA 1XG7A 3FSPA 4DK9A
chains in the Genus database with same CATH superfamily
2NOEA 1KYUA 3RSMA 2IV9A 2W03A 2O3OA 2QR1A 2OFIA 1P5GX 4EAGA 4ROEB 1LWWA 1KFIA 2H56A 1PU7A 4MRQA 2QRCA 2MJ7A 1PCZA 3L2UA 1P59A 3OSMA 1YTFA 2YG9A 1PZDA 4BE2A 1QNBA 1TBAB 4C7PA 3KRMA 3N0UA 3DPTA 3RPJA 3R2XC 2NVMA 4ROCB 3PDKA 1VRLA 3OYMA 4PIIA 1JDYA 4EAKA 1YQMA 2H4LX 1KG2A 4YOQA 4B24A 1VKLA 1YTBA 1PCJX 3OLPA 1JFIC 4ZTJA 3NNQA 1QTSA 1UL7A 1QN4A 1KYFA 3CVTA 1QTPA 2D0BA 2QREA 1RM1A 5HSHA 3OCIA 3T4NA 4WXAA 3VN5A 1B9KA 3ENOC 2Z8UA 1PVSA 2LAEA 2NOHA 2ABKA 4EJYA 3I3WA 2HL8A 4Q11A 4OFEA 1WEFA 2Y8LA 1KEAA 3OYDA 4EALA 3EAYA 1QNAA 4HSBA 5IYDP 3FSPA 4RODB 4BDYA 2NOZA 3F0ZA 2NWVA 1QN3A 3TDHA 2G30A 2EHBD 2XHIA 2OFKA 3OYCA 1DIZA 5JN5A 3NA5A 2FKMX 1AISA 3OC3C 5DPKA 4BE0A 3KTUA 1UT4A 3EIKA 5FRNA 1WEIA 3HS9A 3H1ZA 2HKPA 1C4GA 1K2YX 2D0AA 1KQJA 1MUNA 2NOBA 1QNEA 3OYLA 3I0WA 1R4XA 1KO9A 5KL0A 1C47A 3D7QA 1J3MA 4EAJA 3CWSA 3CW7A 1YQKA 1MUYA 4I8OA 4OFAA 4E7KA 3F10A 3N89A 2JHJA 1C9BB 4E7HA 4IKFA 1V5SA 4DULA 1MUDA 2JPSA 1N3CA 2NLVA 3ULXA 3OGDA 4EW0A 1WJWA 2R5XA 1KY7A 3OH6A 3DPUA 1LWVA 1KG5A 3OYKA 2JG6A 2V92A 1N39A 1LWYA 3G0QA 4E7IA 1TBPA 3VW4A 1M5Q1 1YQRA 3S3NA 2I5WA 1MPGA 4YPHA 3OY9A 3PMGA 3FHFA 1U84A 3C04A 3OH9A 3IHOA 3CVSA 4B23A 1YQLA 2DKCA 1W80A 1XG7A 4WZSD 5FRMA 1EBMA 3L2VA 4E9EA 1WQAA 1K35A 1D3UA 4EJZA 2V8QA 3ENCA 1VOKA 2HZMA 3HS8A 4E7JA 2NOFA 2NOIA 4E9GA 2OOYA 2JOIA 2MZ8A 4YPRA 1QN7A 1HU0A 3S6IA 5JMVD 1PU8A 3IH7A 3SNSA 1PCMX 3OYBA 4OFHA 1VTOA 2Z0FA 2JPIA 1MP9A 4B22A 3CWTA 2V9JA 4B21A 3OYHA 3S3OA 4UOBA 4D7QA 1KG7A 2VJ0A 4EW4A 1TUOA 2QLVA 3OS2A 1ORPA 4E9FA 2ZFDB 4NZGA 2PWWA 5AN4A 2YH5A 1XQPA 4UNFA 4B0AA 3I0XA 1KG3A 4E7LA 5F9CA 3TE5A 4BDZA 5KN8A 3CWUA 1EUVA 2W04A 1M3QA 5IYCP 4HJHA 3OYFA 5EPCA 3UW2A 3OYJA 2JHNA 1QNCA 1QN6A 1QN5A 2DKAA 1WEGA 3BKQX 2IV8A 3OYNA 1NH2A 2HL9A 4DK9A 3N5NX 2FUVA 2H5AX 4BACA 2FGTA 4CFFA 2D0CA 1LMZA 4EVVA 1P5DX 1NKUA 1FN7A 1UT7A 1QN9A 1KY6A 3OYEA 1Q9UA 4ZTFA 3OSEA 3L2WA 1TGHA 4IL8A 4E9HA 1NGNA 4D7RA 1RRSA 5BMPA 2YG8A 4EAIA 1NGMA 5IYBP 5CHZA 2DKDA 3D4VA 1QN8A 4AIAA 2QRDA 1RRQA 4AI4A 2F7LA 1M3HA 2OOXA 3OYIA 3L2RA 5KN9A 1E42A 4WX8A 3KNTA 1CDWA 2Y8QA 3FHGA 3OS0A 3ASMA 4QG5A 1XQOA 1P7MA 1T6AA 2NOLA 2V75A 1VTLE 1KYDA 2HZSA 4BE1A 5BMNA 1NVPA 3L2QA 1ORNA 4AI5A 2YA3A 1PU6A 1LXTA 5FROA 1KG6A 4EA5A 1KG4A 2FKFA 3OYAA 4PY5A 1VOLB 3S3MA 3CWAA 1KFQA 1XSZA 4EA4A 3OSTA 3OS1A 3OYGA 4TPSA 4BJUA 3LCNA 1N3AA
chains in the Genus database with same CATH topology
1EBMA 4E9EA 2NOEA 3N5NX 2NOZA 3F0ZA 4EJZA 2NOFA 2OFIA 1LMZA 2NOIA 2XHIA 4E9GA 2OFKA 1DIZA 1LWWA 2H56A 1N3AA 1PU7A 4YPRA 1P59A 4EVVA 5DPKA 1HU0A 3S6IA 1NKUA 1FN7A 1PU8A 3IH7A 3KTUA 2YG9A 4OFHA 1WEIA 4B22A 3CWTA 4B21A 3N0UA 4E9HA 1NGNA 1KQJA 1MUNA 1VRLA 1RRSA 4UOBA 2YG8A 4PIIA 2NOBA 1KG7A 1YQMA 3I0WA 1KG2A 4EW4A 5CHZA 4YOQA 1KO9A 4B24A 3CWSA 3CW7A 1YQKA 1ORPA 1MUYA 4E9FA 3D4VA 4OFAA 5AN4A 1XQPA 3F10A 2JHJA 4UNFA 4AIAA 1MUDA 1N3CA 3I0XA 1RRQA 4AI4A 1KG3A 1M3HA 3CVTA 3OGDA 5KN9A 4EW0A 3KNTA 5KN8A 3FHGA 3CWUA 3OH6A 1XQOA 1M3QA 1P7MA 1PVSA 1LWVA 1KG5A 2NOHA 2ABKA 2JHNA 4EJYA 2NOLA 2JG6A 4OFEA 1N39A 1WEFA 1LWYA 3G0QA 1KEAA 1YQRA 1ORNA 4AI5A 2I5WA 1PU6A 1MPGA 1WEGA 1KG6A 4YPHA 4EA5A 1KG4A 4HSBA 3CWAA 4EA4A 3FHFA 3CVSA 3IHOA 3OH9A 4B23A 1YQLA 1XG7A 3FSPA 4DK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EBM A;  4E9E A;  2NOE A;  3N5N X;  2NOZ A;  3F0Z A;  4EJZ A;  2NOF A;  2OFI A;  1LMZ A;  2NOI A;  2XHI A;  4E9G A;  2OFK A;  1DIZ A;  1LWW A;  2H56 A;  1N3A A;  1PU7 A;  4YPR A;  1P59 A;  4EVV A;  5DPK A;  1HU0 A;  3S6I A;  1NKU A;  1FN7 A;  1PU8 A;  3IH7 A;  3KTU A;  2YG9 A;  4OFH A;  1WEI A;  4B22 A;  3CWT A;  4B21 A;  3N0U A;  4E9H A;  1NGN A;  1KQJ A;  1MUN A;  1VRL A;  1RRS A;  4UOB A;  2YG8 A;  4PII A;  2NOB A;  1KG7 A;  1YQM A;  3I0W A;  1KG2 A;  4EW4 A;  5CHZ A;  4YOQ A;  1KO9 A;  4B24 A;  3CWS A;  3CW7 A;  1YQK A;  1ORP A;  1MUY A;  4E9F A;  3D4V A;  4OFA A;  5AN4 A;  1XQP A;  3F10 A;  2JHJ A;  4UNF A;  4AIA A;  1MUD A;  1N3C A;  3I0X A;  1RRQ A;  4AI4 A;  1KG3 A;  1M3H A;  3CVT A;  3OGD A;  5KN9 A;  4EW0 A;  3KNT A;  5KN8 A;  3FHG A;  3CWU A;  3OH6 A;  1XQO A;  1M3Q A;  1P7M A;  1PVS A;  1LWV A;  1KG5 A;  2NOH A;  2ABK A;  2JHN A;  4EJY A;  2NOL A;  2JG6 A;  4OFE A;  1N39 A;  1WEF A;  1LWY A;  3G0Q A;  1KEA A;  1YQR A;  1ORN A;  4AI5 A;  2I5W A;  1PU6 A;  1MPG A;  1WEG A;  1KG6 A;  4YPH A;  4EA5 A;  1KG4 A;  4HSB A;  3CWA A;  4EA4 A;  3FHF A;  3CVS A;  3IHO A;  3OH9 A;  4B23 A;  1YQL A;  1XG7 A;  3FSP A;  4DK9 A; 
#chains in the Genus database with same CATH topology
 2NOE A;  1KYU A;  3RSM A;  2IV9 A;  2W03 A;  2O3O A;  2QR1 A;  2OFI A;  1P5G X;  4EAG A;  4ROE B;  1LWW A;  1KFI A;  2H56 A;  1PU7 A;  4MRQ A;  2QRC A;  2MJ7 A;  1PCZ A;  3L2U A;  1P59 A;  3OSM A;  1YTF A;  2YG9 A;  1PZD A;  4BE2 A;  1QNB A;  1TBA B;  4C7P A;  3KRM A;  3N0U A;  3DPT A;  3RPJ A;  3R2X C;  2NVM A;  4ROC B;  3PDK A;  1VRL A;  3OYM A;  4PII A;  1JDY A;  4EAK A;  1YQM A;  2H4L X;  1KG2 A;  4YOQ A;  4B24 A;  1VKL A;  1YTB A;  1PCJ X;  3OLP A;  1JFI C;  4ZTJ A;  3NNQ A;  1QTS A;  1UL7 A;  1QN4 A;  1KYF A;  3CVT A;  1QTP A;  2D0B A;  2QRE A;  1RM1 A;  5HSH A;  3OCI A;  3T4N A;  4WXA A;  3VN5 A;  1B9K A;  3ENO C;  2Z8U A;  1PVS A;  2LAE A;  2NOH A;  2ABK A;  4EJY A;  3I3W A;  2HL8 A;  4Q11 A;  4OFE A;  1WEF A;  2Y8L A;  1KEA A;  3OYD A;  4EAL A;  3EAY A;  1QNA A;  4HSB A;  5IYD P;  3FSP A;  4ROD B;  4BDY A;  2NOZ A;  3F0Z A;  2NWV A;  1QN3 A;  3TDH A;  2G30 A;  2EHB D;  2XHI A;  2OFK A;  3OYC A;  1DIZ A;  5JN5 A;  3NA5 A;  2FKM X;  1AIS A;  3OC3 C;  5DPK A;  4BE0 A;  3KTU A;  1UT4 A;  3EIK A;  5FRN A;  1WEI A;  3HS9 A;  3H1Z A;  2HKP A;  1C4G A;  1K2Y X;  2D0A A;  1KQJ A;  1MUN A;  2NOB A;  1QNE A;  3OYL A;  3I0W A;  1R4X A;  1KO9 A;  5KL0 A;  1C47 A;  3D7Q A;  1J3M A;  4EAJ A;  3CWS A;  3CW7 A;  1YQK A;  1MUY A;  4I8O A;  4OFA A;  4E7K A;  3F10 A;  3N89 A;  2JHJ A;  1C9B B;  4E7H A;  4IKF A;  1V5S A;  4DUL A;  1MUD A;  2JPS A;  1N3C A;  2NLV A;  3ULX A;  3OGD A;  4EW0 A;  1WJW A;  2R5X A;  1KY7 A;  3OH6 A;  3DPU A;  1LWV A;  1KG5 A;  3OYK A;  2JG6 A;  2V92 A;  1N39 A;  1LWY A;  3G0Q A;  4E7I A;  1TBP A;  3VW4 A;  1M5Q 1;  1YQR A;  3S3N A;  2I5W A;  1MPG A;  4YPH A;  3OY9 A;  3PMG A;  3FHF A;  1U84 A;  3C04 A;  3OH9 A;  3IHO A;  3CVS A;  4B23 A;  1YQL A;  2DKC A;  1W80 A;  1XG7 A;  4WZS D;  5FRM A;  1EBM A;  3L2V A;  4E9E A;  1WQA A;  1K35 A;  1D3U A;  4EJZ A;  2V8Q A;  3ENC A;  1VOK A;  2HZM A;  3HS8 A;  4E7J A;  2NOF A;  2NOI A;  4E9G A;  2OOY A;  2JOI A;  2MZ8 A;  4YPR A;  1QN7 A;  1HU0 A;  3S6I A;  5JMV D;  1PU8 A;  3IH7 A;  3SNS A;  1PCM X;  3OYB A;  4OFH A;  1VTO A;  2Z0F A;  2JPI A;  1MP9 A;  4B22 A;  3CWT A;  2V9J A;  4B21 A;  3OYH A;  3S3O A;  4UOB A;  4D7Q A;  1KG7 A;  2VJ0 A;  4EW4 A;  1TUO A;  2QLV A;  3OS2 A;  1ORP A;  4E9F A;  2ZFD B;  4NZG A;  2PWW A;  5AN4 A;  2YH5 A;  1XQP A;  4UNF A;  4B0A A;  3I0X A;  1KG3 A;  4E7L A;  5F9C A;  3TE5 A;  4BDZ A;  5KN8 A;  3CWU A;  1EUV A;  2W04 A;  1M3Q A;  5IYC P;  4HJH A;  3OYF A;  5EPC A;  3UW2 A;  3OYJ A;  2JHN A;  1QNC A;  1QN6 A;  1QN5 A;  2DKA A;  1WEG A;  3BKQ X;  2IV8 A;  3OYN A;  1NH2 A;  2HL9 A;  4DK9 A;  3N5N X;  2FUV A;  2H5A X;  4BAC A;  2FGT A;  4CFF A;  2D0C A;  1LMZ A;  4EVV A;  1P5D X;  1NKU A;  1FN7 A;  1UT7 A;  1QN9 A;  1KY6 A;  3OYE A;  1Q9U A;  4ZTF A;  3OSE A;  3L2W A;  1TGH A;  4IL8 A;  4E9H A;  1NGN A;  4D7R A;  1RRS A;  5BMP A;  2YG8 A;  4EAI A;  1NGM A;  5IYB P;  5CHZ A;  2DKD A;  3D4V A;  1QN8 A;  4AIA A;  2QRD A;  1RRQ A;  4AI4 A;  2F7L A;  1M3H A;  2OOX A;  3OYI A;  3L2R A;  5KN9 A;  1E42 A;  4WX8 A;  3KNT A;  1CDW A;  2Y8Q A;  3FHG A;  3OS0 A;  3ASM A;  4QG5 A;  1XQO A;  1P7M A;  1T6A A;  2NOL A;  2V75 A;  1VTL E;  1KYD A;  2HZS A;  4BE1 A;  5BMN A;  1NVP A;  3L2Q A;  1ORN A;  4AI5 A;  2YA3 A;  1PU6 A;  1LXT A;  5FRO A;  1KG6 A;  4EA5 A;  1KG4 A;  2FKF A;  3OYA A;  4PY5 A;  1VOL B;  3S3M A;  3CWA A;  1KFQ A;  1XSZ A;  4EA4 A;  3OST A;  3OS1 A;  3OYG A;  4TPS A;  4BJU A;  3LCN A;  1N3A A; 
#chains in the Genus database with same CATH homology
 1EBM A;  4E9E A;  2NOE A;  3N5N X;  2NOZ A;  3F0Z A;  4EJZ A;  2NOF A;  2OFI A;  1LMZ A;  2NOI A;  2XHI A;  4E9G A;  2OFK A;  1DIZ A;  1LWW A;  2H56 A;  1N3A A;  1PU7 A;  4YPR A;  1P59 A;  4EVV A;  5DPK A;  1HU0 A;  3S6I A;  1NKU A;  1FN7 A;  1PU8 A;  3IH7 A;  3KTU A;  2YG9 A;  4OFH A;  1WEI A;  4B22 A;  3CWT A;  4B21 A;  3N0U A;  4E9H A;  1NGN A;  1KQJ A;  1MUN A;  1VRL A;  1RRS A;  4UOB A;  2YG8 A;  4PII A;  2NOB A;  1KG7 A;  1YQM A;  3I0W A;  1KG2 A;  4EW4 A;  5CHZ A;  4YOQ A;  1KO9 A;  4B24 A;  3CWS A;  3CW7 A;  1YQK A;  1ORP A;  1MUY A;  4E9F A;  3D4V A;  4OFA A;  5AN4 A;  1XQP A;  3F10 A;  2JHJ A;  4UNF A;  4AIA A;  1MUD A;  1N3C A;  3I0X A;  1RRQ A;  4AI4 A;  1KG3 A;  1M3H A;  3CVT A;  3OGD A;  5KN9 A;  4EW0 A;  3KNT A;  5KN8 A;  3FHG A;  3CWU A;  3OH6 A;  1XQO A;  1M3Q A;  1P7M A;  1PVS A;  1LWV A;  1KG5 A;  2NOH A;  2ABK A;  2JHN A;  4EJY A;  2NOL A;  2JG6 A;  4OFE A;  1N39 A;  1WEF A;  1LWY A;  3G0Q A;  1KEA A;  1YQR A;  1ORN A;  4AI5 A;  2I5W A;  1PU6 A;  1MPG A;  1WEG A;  1KG6 A;  4YPH A;  4EA5 A;  1KG4 A;  4HSB A;  3CWA A;  4EA4 A;  3FHF A;  3CVS A;  3IHO A;  3OH9 A;  4B23 A;  1YQL A;  1XG7 A;  3FSP A;  4DK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...