3CWUA

Crystal structure of an alka host/guest complex 2'-fluoro-2'-deoxy-1,n6-ethenoadenine:thymine base pair
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cwuA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cwuA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cwuA01
3S6IA 3CVTA 4EA4A 1PU6A 2YG8A 2XHIA 1KO9A 1MUDA 1ORNA 3D4VA 3N5NX 1LWWA 3KNTA 1LMZA 5KN8A 1NKUA 4EJZA 1MUNA 1MUYA 4OFHA 1PVSA 1YQRA 1KG3A 1WEIA 3CWTA 1EBMA 1KG6A 3I0XA 3CW7A 3CWUA 1NGNA 1LWVA 3IHOA 2I5WA 3CWSA 4E9FA 1HU0A 2NOHA 3F0ZA 3OH9A 4E9EA 3N0UA 4OFAA 3I0WA 2NOLA 1KQJA 4B21A 4E9HA 3KTUA 4YPHA 4E9GA 4DK9A 4UNFA 1M3QA 2ABKA 1N3AA 4YOQA 4B22A 2NOIA 1MPGA 4AI5A 1N3CA 4EA5A 5DPKA 4PIIA 2JHJA 1YQKA 4AIAA 1FN7A 3G0QA 2JHNA 4AI4A 3CVSA 1M3HA 1KG7A 2NOFA 4YPRA 5KN9A 4EVVA 1KG4A 2NOEA 1WEFA 2YG9A 1DIZA 1KG5A 1KG2A 1P59A 1KEAA 5CHZA 4OFEA 4B23A 3OH6A 3F10A 3FHGA 1WEGA 3FSPA 4B24A 1VRLA 1ORPA 3CWAA 2JG6A 3FHFA 3IH7A 1RRSA 1LWYA 2OFIA 1P7MA 1XQPA 4EJYA 2H56A 3OGDA 1RRQA 1PU7A 1YQLA 4EW0A 1XG7A 2NOBA 4EW4A 2OFKA 5AN4A 1N39A 1PU8A 2NOZA 1XQOA 4HSBA 1YQMA 4UOBA
chains in the Genus database with same CATH superfamily
4E7JA 1QN4A 2IV9A 3ENOC 2YG8A 2XHIA 3OYBA 4ZTFA 1CDWA 1VTOA 3OYJA 1UT7A 4E7LA 3OYGA 3ENCA 1YTBA 1VOKA 3OYFA 1KG3A 3CWTA 1PZDA 3OSEA 1Q9UA 1KG6A 3I0XA 3BKQX 2I5WA 3CWSA 4E9FA 4BACA 2JPSA 4RODB 1J3MA 3OY9A 3L2WA 3KRMA 4EAKA 3L2QA 5KL0A 3OS0A 3KTUA 1C47A 4E9GA 4BE2A 1KY6A 4YOQA 1QTPA 2V9JA 2DKDA 2Z0FA 4EA5A 1TBAB 4BDYA 1FN7A 3G0QA 2Z8UA 3C04A 4E7HA 2NOFA 3HS9A 2QLVA 1YTFA 2H5AX 2PWWA 5KN9A 1KG5A 1C9BB 2D0AA 5CHZA 3TE5A 2MZ8A 2W04A 3OS2A 4B24A 3NA5A 4PY5A 3CWAA 1NH2A 1V5SA 3EAYA 3I3WA 3OSMA 3OYCA 4WX8A 4WXAA 2OFKA 5AN4A 1N39A 1PU8A 2NOZA 5FRNA 3L2VA 4UOBA 2IV8A 4BDZA 1KO9A 3OYAA 1MUDA 4HJHA 3OYHA 2Y8QA 2D0CA 3KNTA 1LMZA 5KN8A 2LAEA 4EJZA 1MUNA 1PVSA 4ROCB 3N89A 1YQRA 2QR1A 1W80A 1UT4A 4EAIA 1K35A 2MJ7A 1WJWA 1NGNA 1P5DX 2OOXA 3L2UA 1QNBA 1U84A 2JPIA 3F0ZA 3OH9A 2YH5A 1RM1A 4OFAA 3I0WA 2NOLA 4MRQA 3SNSA 5IYDP 4BE0A 4YPHA 4DK9A 1QNCA 4UNFA 1M3QA 2W03A 1N3AA 5HSHA 1MPGA 4B0AA 3EIKA 1T6AA 4NZGA 2D0BA 2QRDA 3D7QA 4AIAA 1M3HA 2V75A 4YPRA 1QN5A 2ZFDB 1KG4A 1TGHA 1MP9A 1DIZA 2FKFA 3DPUA 3R2XC 2O3OA 2G30A 1P59A 1KEAA 4B23A 3OH6A 3F10A 3FHGA 3FSPA 1KYDA 1VRLA 3HS8A 1QN8A 1ORPA 2V8QA 3FHFA 2OFIA 1P7MA 4EJYA 1QNEA 1YQLA 4EW0A 2QRCA 1NVPA 1XG7A 5EPCA 4EW4A 1KFIA 1YQMA 5BMNA 2DKAA 3CVTA 1QN7A 1QTSA 2HL8A 4Q11A 1QN3A 4IL8A 1QN6A 1VOLB 3D4VA 1P5GX 4IKFA 3N5NX 1LWWA 3OYEA 2FKMX 1PCZA 1NKUA 1MUYA 2FGTA 1KFQA 1B9KA 4ROEB 3OYIA 1LWVA 1TUOA 3IHOA 4I8OA 4ZTJA 1HU0A 4TPSA 4E9EA 1E42A 1KQJA 1XSZA 1C4GA 2Y8LA 2R5XA 1QNAA 3DPTA 1UL7A 5FROA 3OLPA 1AISA 5DPKA 3S3NA 2JHJA 1PCMX 4AI4A 3CVSA 3OYMA 2H4LX 1VKLA 2NOEA 1R4XA 3OSTA 4E7IA 3PMGA 4EAJA 3OYKA 1RRSA 1LWYA 3S3OA 3S3MA 1TBPA 2H56A 1RRQA 1PU7A 1JFIC 2NWVA 3H1ZA 3VW4A 3ULXA 3S6IA 3OYDA 4BJUA 4EA4A 1KYUA 1PU6A 1PCJX 3RPJA 5IYCP 3L2RA 1ORNA 3RSMA 3UW2A 4EAGA 2JOIA 4OFHA 4WZSD 2NVMA 2EHBD 4D7RA 1EUVA 1D3UA 1WEIA 1NGMA 4QG5A 1KYFA 1EBMA 4DULA 4CFFA 4E7KA 3CW7A 3CWUA 3OYLA 2F7LA 2NOHA 3N0UA 2DKCA 3TDHA 3OCIA 3ASMA 5BMPA 4B21A 4E9HA 3LCNA 2HZMA 4D7QA 2V92A 2ABKA 3PDKA 2HL9A 2HZSA 4B22A 5JMVD 5JN5A 3VN5A 2NOIA 1N3CA 4AI5A 5F9CA 1KY7A 1WQAA 4PIIA 1VTLE 1YQKA 2JHNA 1KG7A 3T4NA 2HKPA 4C7PA 2VJ0A 4EVVA 1WEFA 2YG9A 5FRMA 3OS1A 5IYBP 1KG2A 3OC3C 2QREA 4OFEA 2FUVA 1WEGA 3OYNA 4EALA 1K2YX 2JG6A 3IH7A 1XQPA 1QN9A 1LXTA 3OGDA 2OOYA 2NOBA 4BE1A 2YA3A 2NLVA 3NNQA 1JDYA 1XQOA 4HSBA 1M5Q1
chains in the Genus database with same CATH topology
3S6IA 3CVTA 4EA4A 1PU6A 2YG8A 2XHIA 1KO9A 1MUDA 1ORNA 3D4VA 3N5NX 1LWWA 3KNTA 1LMZA 5KN8A 1NKUA 4EJZA 1MUNA 1MUYA 4OFHA 1PVSA 1YQRA 1KG3A 1WEIA 3CWTA 1EBMA 1KG6A 3I0XA 3CW7A 3CWUA 1NGNA 1LWVA 3IHOA 2I5WA 3CWSA 4E9FA 1HU0A 2NOHA 3F0ZA 3OH9A 4E9EA 3N0UA 4OFAA 3I0WA 2NOLA 1KQJA 4B21A 4E9HA 3KTUA 4YPHA 4E9GA 4DK9A 4UNFA 1M3QA 2ABKA 1N3AA 4YOQA 4B22A 2NOIA 1MPGA 4AI5A 1N3CA 4EA5A 5DPKA 4PIIA 2JHJA 1YQKA 4AIAA 1FN7A 3G0QA 2JHNA 4AI4A 3CVSA 1M3HA 1KG7A 2NOFA 4YPRA 5KN9A 4EVVA 1KG4A 2NOEA 1WEFA 2YG9A 1DIZA 1KG5A 1KG2A 1P59A 1KEAA 5CHZA 4OFEA 4B23A 3OH6A 3F10A 3FHGA 1WEGA 3FSPA 4B24A 1VRLA 1ORPA 3CWAA 2JG6A 3FHFA 3IH7A 1RRSA 1LWYA 2OFIA 1P7MA 1XQPA 4EJYA 2H56A 3OGDA 1RRQA 1PU7A 1YQLA 4EW0A 1XG7A 2NOBA 4EW4A 2OFKA 5AN4A 1N39A 1PU8A 2NOZA 1XQOA 4HSBA 1YQMA 4UOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6I A;  3CVT A;  4EA4 A;  1PU6 A;  2YG8 A;  2XHI A;  1KO9 A;  1MUD A;  1ORN A;  3D4V A;  3N5N X;  1LWW A;  3KNT A;  1LMZ A;  5KN8 A;  1NKU A;  4EJZ A;  1MUN A;  1MUY A;  4OFH A;  1PVS A;  1YQR A;  1KG3 A;  1WEI A;  3CWT A;  1EBM A;  1KG6 A;  3I0X A;  3CW7 A;  3CWU A;  1NGN A;  1LWV A;  3IHO A;  2I5W A;  3CWS A;  4E9F A;  1HU0 A;  2NOH A;  3F0Z A;  3OH9 A;  4E9E A;  3N0U A;  4OFA A;  3I0W A;  2NOL A;  1KQJ A;  4B21 A;  4E9H A;  3KTU A;  4YPH A;  4E9G A;  4DK9 A;  4UNF A;  1M3Q A;  2ABK A;  1N3A A;  4YOQ A;  4B22 A;  2NOI A;  1MPG A;  4AI5 A;  1N3C A;  4EA5 A;  5DPK A;  4PII A;  2JHJ A;  1YQK A;  4AIA A;  1FN7 A;  3G0Q A;  2JHN A;  4AI4 A;  3CVS A;  1M3H A;  1KG7 A;  2NOF A;  4YPR A;  5KN9 A;  4EVV A;  1KG4 A;  2NOE A;  1WEF A;  2YG9 A;  1DIZ A;  1KG5 A;  1KG2 A;  1P59 A;  1KEA A;  5CHZ A;  4OFE A;  4B23 A;  3OH6 A;  3F10 A;  3FHG A;  1WEG A;  3FSP A;  4B24 A;  1VRL A;  1ORP A;  3CWA A;  2JG6 A;  3FHF A;  3IH7 A;  1RRS A;  1LWY A;  2OFI A;  1P7M A;  1XQP A;  4EJY A;  2H56 A;  3OGD A;  1RRQ A;  1PU7 A;  1YQL A;  4EW0 A;  1XG7 A;  2NOB A;  4EW4 A;  2OFK A;  5AN4 A;  1N39 A;  1PU8 A;  2NOZ A;  1XQO A;  4HSB A;  1YQM A;  4UOB A; 
#chains in the Genus database with same CATH topology
 4E7J A;  1QN4 A;  2IV9 A;  3ENO C;  2YG8 A;  2XHI A;  3OYB A;  4ZTF A;  1CDW A;  1VTO A;  3OYJ A;  1UT7 A;  4E7L A;  3OYG A;  3ENC A;  1YTB A;  1VOK A;  3OYF A;  1KG3 A;  3CWT A;  1PZD A;  3OSE A;  1Q9U A;  1KG6 A;  3I0X A;  3BKQ X;  2I5W A;  3CWS A;  4E9F A;  4BAC A;  2JPS A;  4ROD B;  1J3M A;  3OY9 A;  3L2W A;  3KRM A;  4EAK A;  3L2Q A;  5KL0 A;  3OS0 A;  3KTU A;  1C47 A;  4E9G A;  4BE2 A;  1KY6 A;  4YOQ A;  1QTP A;  2V9J A;  2DKD A;  2Z0F A;  4EA5 A;  1TBA B;  4BDY A;  1FN7 A;  3G0Q A;  2Z8U A;  3C04 A;  4E7H A;  2NOF A;  3HS9 A;  2QLV A;  1YTF A;  2H5A X;  2PWW A;  5KN9 A;  1KG5 A;  1C9B B;  2D0A A;  5CHZ A;  3TE5 A;  2MZ8 A;  2W04 A;  3OS2 A;  4B24 A;  3NA5 A;  4PY5 A;  3CWA A;  1NH2 A;  1V5S A;  3EAY A;  3I3W A;  3OSM A;  3OYC A;  4WX8 A;  4WXA A;  2OFK A;  5AN4 A;  1N39 A;  1PU8 A;  2NOZ A;  5FRN A;  3L2V A;  4UOB A;  2IV8 A;  4BDZ A;  1KO9 A;  3OYA A;  1MUD A;  4HJH A;  3OYH A;  2Y8Q A;  2D0C A;  3KNT A;  1LMZ A;  5KN8 A;  2LAE A;  4EJZ A;  1MUN A;  1PVS A;  4ROC B;  3N89 A;  1YQR A;  2QR1 A;  1W80 A;  1UT4 A;  4EAI A;  1K35 A;  2MJ7 A;  1WJW A;  1NGN A;  1P5D X;  2OOX A;  3L2U A;  1QNB A;  1U84 A;  2JPI A;  3F0Z A;  3OH9 A;  2YH5 A;  1RM1 A;  4OFA A;  3I0W A;  2NOL A;  4MRQ A;  3SNS A;  5IYD P;  4BE0 A;  4YPH A;  4DK9 A;  1QNC A;  4UNF A;  1M3Q A;  2W03 A;  1N3A A;  5HSH A;  1MPG A;  4B0A A;  3EIK A;  1T6A A;  4NZG A;  2D0B A;  2QRD A;  3D7Q A;  4AIA A;  1M3H A;  2V75 A;  4YPR A;  1QN5 A;  2ZFD B;  1KG4 A;  1TGH A;  1MP9 A;  1DIZ A;  2FKF A;  3DPU A;  3R2X C;  2O3O A;  2G30 A;  1P59 A;  1KEA A;  4B23 A;  3OH6 A;  3F10 A;  3FHG A;  3FSP A;  1KYD A;  1VRL A;  3HS8 A;  1QN8 A;  1ORP A;  2V8Q A;  3FHF A;  2OFI A;  1P7M A;  4EJY A;  1QNE A;  1YQL A;  4EW0 A;  2QRC A;  1NVP A;  1XG7 A;  5EPC A;  4EW4 A;  1KFI A;  1YQM A;  5BMN A;  2DKA A;  3CVT A;  1QN7 A;  1QTS A;  2HL8 A;  4Q11 A;  1QN3 A;  4IL8 A;  1QN6 A;  1VOL B;  3D4V A;  1P5G X;  4IKF A;  3N5N X;  1LWW A;  3OYE A;  2FKM X;  1PCZ A;  1NKU A;  1MUY A;  2FGT A;  1KFQ A;  1B9K A;  4ROE B;  3OYI A;  1LWV A;  1TUO A;  3IHO A;  4I8O A;  4ZTJ A;  1HU0 A;  4TPS A;  4E9E A;  1E42 A;  1KQJ A;  1XSZ A;  1C4G A;  2Y8L A;  2R5X A;  1QNA A;  3DPT A;  1UL7 A;  5FRO A;  3OLP A;  1AIS A;  5DPK A;  3S3N A;  2JHJ A;  1PCM X;  4AI4 A;  3CVS A;  3OYM A;  2H4L X;  1VKL A;  2NOE A;  1R4X A;  3OST A;  4E7I A;  3PMG A;  4EAJ A;  3OYK A;  1RRS A;  1LWY A;  3S3O A;  3S3M A;  1TBP A;  2H56 A;  1RRQ A;  1PU7 A;  1JFI C;  2NWV A;  3H1Z A;  3VW4 A;  3ULX A;  3S6I A;  3OYD A;  4BJU A;  4EA4 A;  1KYU A;  1PU6 A;  1PCJ X;  3RPJ A;  5IYC P;  3L2R A;  1ORN A;  3RSM A;  3UW2 A;  4EAG A;  2JOI A;  4OFH A;  4WZS D;  2NVM A;  2EHB D;  4D7R A;  1EUV A;  1D3U A;  1WEI A;  1NGM A;  4QG5 A;  1KYF A;  1EBM A;  4DUL A;  4CFF A;  4E7K A;  3CW7 A;  3CWU A;  3OYL A;  2F7L A;  2NOH A;  3N0U A;  2DKC A;  3TDH A;  3OCI A;  3ASM A;  5BMP A;  4B21 A;  4E9H A;  3LCN A;  2HZM A;  4D7Q A;  2V92 A;  2ABK A;  3PDK A;  2HL9 A;  2HZS A;  4B22 A;  5JMV D;  5JN5 A;  3VN5 A;  2NOI A;  1N3C A;  4AI5 A;  5F9C A;  1KY7 A;  1WQA A;  4PII A;  1VTL E;  1YQK A;  2JHN A;  1KG7 A;  3T4N A;  2HKP A;  4C7P A;  2VJ0 A;  4EVV A;  1WEF A;  2YG9 A;  5FRM A;  3OS1 A;  5IYB P;  1KG2 A;  3OC3 C;  2QRE A;  4OFE A;  2FUV A;  1WEG A;  3OYN A;  4EAL A;  1K2Y X;  2JG6 A;  3IH7 A;  1XQP A;  1QN9 A;  1LXT A;  3OGD A;  2OOY A;  2NOB A;  4BE1 A;  2YA3 A;  2NLV A;  3NNQ A;  1JDY A;  1XQO A;  4HSB A;  1M5Q 1; 
#chains in the Genus database with same CATH homology
 3S6I A;  3CVT A;  4EA4 A;  1PU6 A;  2YG8 A;  2XHI A;  1KO9 A;  1MUD A;  1ORN A;  3D4V A;  3N5N X;  1LWW A;  3KNT A;  1LMZ A;  5KN8 A;  1NKU A;  4EJZ A;  1MUN A;  1MUY A;  4OFH A;  1PVS A;  1YQR A;  1KG3 A;  1WEI A;  3CWT A;  1EBM A;  1KG6 A;  3I0X A;  3CW7 A;  3CWU A;  1NGN A;  1LWV A;  3IHO A;  2I5W A;  3CWS A;  4E9F A;  1HU0 A;  2NOH A;  3F0Z A;  3OH9 A;  4E9E A;  3N0U A;  4OFA A;  3I0W A;  2NOL A;  1KQJ A;  4B21 A;  4E9H A;  3KTU A;  4YPH A;  4E9G A;  4DK9 A;  4UNF A;  1M3Q A;  2ABK A;  1N3A A;  4YOQ A;  4B22 A;  2NOI A;  1MPG A;  4AI5 A;  1N3C A;  4EA5 A;  5DPK A;  4PII A;  2JHJ A;  1YQK A;  4AIA A;  1FN7 A;  3G0Q A;  2JHN A;  4AI4 A;  3CVS A;  1M3H A;  1KG7 A;  2NOF A;  4YPR A;  5KN9 A;  4EVV A;  1KG4 A;  2NOE A;  1WEF A;  2YG9 A;  1DIZ A;  1KG5 A;  1KG2 A;  1P59 A;  1KEA A;  5CHZ A;  4OFE A;  4B23 A;  3OH6 A;  3F10 A;  3FHG A;  1WEG A;  3FSP A;  4B24 A;  1VRL A;  1ORP A;  3CWA A;  2JG6 A;  3FHF A;  3IH7 A;  1RRS A;  1LWY A;  2OFI A;  1P7M A;  1XQP A;  4EJY A;  2H56 A;  3OGD A;  1RRQ A;  1PU7 A;  1YQL A;  4EW0 A;  1XG7 A;  2NOB A;  4EW4 A;  2OFK A;  5AN4 A;  1N39 A;  1PU8 A;  2NOZ A;  1XQO A;  4HSB A;  1YQM A;  4UOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...