3L2RA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2rA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2rA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2rA03
1G15A 3MECA 3OJUA 1VSDA 1S9EA 3HPOA 2L3RA 1WLJA 5FDLA 3KIOA 4I9QA 4M41A 2HHWA 3ALYA 2ZD1A 2BGGA 4CESA 4AHCA 4O0JA 3V1RA 3RR8A 4B3OA 4E7LA 1IKVA 2E5QA 4O44A 4B9WA 3HM9A 1C6VA 3VQ6A 4B9TA 1N27A 3E01A 3QEIA 3MXIA 3RWUA 3ISNC 3NTHA 3P5JA 3DB4A 4Q0BA 1J53A 3L42A 5CZ1A 3LZIA 3RMAA 4DWIA 4QVZA 3PUFA 3KLFA 1NKBA 5D6YA 3KLHA 1ASWA 1T05A 3I0SA 2P5OA 5C42A 3V4IA 1KRPA 4N47A 4CF2A 2IDOA 3KTQA 1FXXA 4FJLA 4FLZA 3P8HA 2Q3SA 4ELUA 4LSLA 4LY7A 4DFMA 1ZYQA 4KFBA 4H4MA 4PWDA 4FLVA 3MEWA 3C95A 2CKKA 1VK0A 3OYNA 4CRIA 1QQCA 5KRTA 4FJKA 1FKOA 1QE1A 4IG0A 3DLGA 3OA6A 1RT2A 3VQPA 3L2WA 1D9FA 3TABA 4BWJA 1HYZA 4DSKA 2BUDA 3PFSA 3LP0A 2X78A 2R7YA 2HHTA 4NS5A 4HTUA 4CERA 3NAEA 4DS5A 4AHSA 3DI6A 1HJRA 3MEVA 1S1TA 1D8YA 1NK9A 4C5IA 4FCYA 4F2SA 3TAMA 4IDKA 1WSGA 1JL2A 4CGFA 2VYTA 2HNZA 1NOYA 2HHQA 4FJ8A 3WNEA 1WJSA 2FBXA 4CEFA 4IUTA 3MP6A 2HNYA 4E19A 3PX6A 4H8KA 4IUQA 4OVAA 3PX0A 4C5GA 4CJUA 2HQXA 1U45A 4CJFA 3M8SA 2Z1JA 4W5NA 3OS2A 5FRMA 1KFSA 4FJJA 3K59A 2IGIA 2G8KA 3OYDA 1B9FA 4DTSA 5C24A 1IO2A 4W5QA 2RPIA 4RG2A 2B8AA 2HHUA 2Y1IA 2M0OA 3D45A 1YTUA 4CFAA 3HT3A 3NFAA 3B6PA 3KUFA 1JXEA 3UWNA 4FZZA 1BI4B 4DTOA 2KZMA 3U3GA 3F73A 5J2QA 4AILC 2R5AA 1Q9XA 2EQUA 1S1XA 1MHNA 4UQGA 2D9TA 3K5NA 1CXQA 2KW4A 1HYSA 5KCHA 3EYZA 3RR7A 3MXJA 3LANA 4CJ5A 5DK5A 4KREA 2FBYA 2IS3A 4Z0UA 4FLWA 3QERA 1JLAA 1IH7A 2G8HA 3OMGA 3OYGA 1C1BA 4FW1A 1HQUA 3K2PA 4HHTA 3LX7A 2G8WA 3FEOA 1B92A 4CJEA 3CM5A 2K3XA 1BI4A 4AHUA 5J39A 3OYLA 3V9SA 1XHXA 5C25A 4B9SA 3OS0A 3NGYA 1N5YA 4CGHA 3PNWC 4FK2A 3S3MA 4M42A 3AA3A 3VQCA 4NZGA 4FJ9A 4DTXA 3TI0A 1U04A 4FJ7A 3LWMA 2X6NA 2YNGA 1WSEA 2YRVA 3KK1A 2EKOA 4L59A 3QLHA 2HNDA 1KVBA 2EQJA 4CEOA 1SKWA 3T1AA 1XNIA 2DFHA 4N5SA 1QSLA 2HW3A 4W5TA 4ICLA 4DU3A 3AVIA 1KFDA 3LPTA 2IOCA 3QKJA 1IKYA 1GOCA 4IUPA 4RG8A 3DMJA 3AVFA 4PUOA 4I2PA 1TKTA 3SYZA 4CF8A 2DY4A 4IG3A 3ZT4A 1RCHA 4NCGA 1SKSA 1RBTA 4DFKA 3MEDA 4LD0A 4EZ9A 1RT6A 1NJWA 5EU7A 4IKFA 2W42A 3ZT0A 1KVAA 2RI3A 3U6FA 1LWEA 3O8VA 2R5MA 4DU4A 5KRSA 3MEAA 3CFOA 4B9LA 5IAYA 4FLUA 4M3UA 3OMCA 3AA4A 4EP4A 2GUIA 1OZ3A 4EDUA 4KKOA 3O3GA 4QAGA 3META 3NCIA 4J2AA 3AO2A 4DLEA 2LTOA 1YVUA 2RHUA 2X4XA 1NK4A 4M3ZA 3HVTA 4KHYA 2OYQA 4HUFA 5KTQA 3UT1A 4DF8A 3NTKA 3MEUA 4M3TA 4FJGA 4JRPA 3DRSA 3TARA 3L2RA 1LW2A 3ASMA 4FYDA 3ZEHA 1S1UA 3TAFA 3OVNA 4C8KA 3VQ8A 4C8NA 1A5VA 1TKDA 3SD4A 1EKEA 1W0HA 2KTQA 4BACA 3DLHA 4CJSA 1KVCA 1KHCA 3LP3A 3L2UA 2L89A 3AO1A 3C6TA 1WGSA 1UAXA 3KD1E 1QHTA 1UA0A 3S3NA 3ZSWA 3V6DA 4F4KA 4LSNA 3OYEA 4FL6A 3I0RA 3RMDA 3RRGA 1JLGA 1RT4A 2ZE2A 4E0DA 1RBVA 4Q5VA 1NKCA 1X1PA 3HP9A 4FXDA 5J26A 4CJKA 3THVA 3ZCMA 3G0ZA 2A1RA 3PMTA 2YNHA 3OYIA 1VSKA 2D0CA 1RI0A 4BE1A 3SPZA 2OPQA 1ASUA 4K8XA 2BDPA 5D3GA 4KI4A 4DS4A 4CJVA 4O5BA 1U49A 2JZ2A 4DMNA 1VSIA 1VSLA 1RILA 2LDMA 4FU6A 1RT1A 3HJFA 4IBNA 1EXQA 4KPYA 4JS4A 2QXFA 1TK0A 1ASVA 4GVMA 4H4OA 1ITGA 3V1OA 4EP5A 1RDDA 4DFPA 4KB1A 1HPZA 4ID5A 5SZTA 4ELVA 2KZZA 4CJWA 2IC3A 3H6ZA 3MP1A 4QW2A 1U4BA 2HHSA 1T7PA 3ZT3A 1I3AA 3DYAA 3SJJA 5T7BA 2G8VA 4CHPA 5SWMA 3HPHA 3DLBA 4N41A 3Q1JA 4CCHA 3SPYA 4QQGA 2IG0A 2A1SA 3CEYA 3SQ0A 2WOMA 3S6WA 1HYVA 3LALA 3VQBA 4CJRA 1XWLA 3SUNA 3OYAA 4CJ3A 2QK9A 4A4HA 4RW7A 4CHNA 2G8IA 2MWOA 1JLCA 3LWLA 4A4GA 5J2PA 1YT3A 4Z4HA 1U48A 3QEPA 1J54A 4DQRA 2EHGA 4II1A 3AVJA 4CIEA 1BISA 4CFDA 4CHYA 3CM6A 4FVMA 3LAKA 1CLQA 3BGRA 4CECA 3AO5A 3PMIA 4CJQA 1X9WA 1KCFA 1SL1A 4FJXA 2HHXA 3QBYA 2G8FA 1T03A 4Q5WA 3AVLA 1JLFA 2E6MA 4FZXC 1Z26A 3AVGA 4FM1A 1WSJA 3NBPA 5C0MA 4QCLA 3ASKA 4Y1DA 3JSMA 3AVNA 2LSNA 4B8CA 3WNHA 3TAQA 2FBVA 3LGLA 4KTQA 2EX3A 2VG7A 4J2BA 1BCOA 1NOZA 1S9GA 3KD5E 3O3FA 4ID1A 3K57A 4OGEA 3QJ6A 2RHXA 3LLRA 1RDAA 1JLEA 1BIUA 3DRPA 2DFEA 4DSIA 3E9FA 4CF9A 4CHZA 3IAYA 2VWKA 3QNOA 4BDPA 4FM2A 3S3OA 3PX4A 1S6PA 2FBTA 4YFUA 1KTQA 3QINA 2DIGA 3VQ7A 4DSFA 2XY7A 4PY5A 3NHGA 1NK5A 3K5MA 3CFRA 3QIOA 3HO1A 1NKEA 4LH4A 1J9AA 2XY6A 3CFPA 3MP8A 4CF0A 5C6SA 3O4NA 3DLEA 5HROA 4ZTJA 2WACA 4AHTA 5DMRA 1C1AA 3MEEA 4F8RA 1O1WA 4OKJA 3HYFA 2GFUA 4E3SA 2O4IA 3VQ4A 4G1QA 4C8LA 4NYFA 2RI5A 1CZBA 4KV8A 4IFVA 4RW6A 2ETJA 1HNIA 1FKPA 4EZ6A 3MAQA 1NK6A 3KLGA 4CJPA 4FW2A 4RW9A 4DG1A 4DQSA 1YTAA 4N56A 4DLGA 4GW6A 5KE3A 3AVCA 4JS5A 3EY1A 3OYHA 1JKHA 4C5HA 1VRUA 4BDZA 3LAMA 3P1GA 3TAPA 5CYQA 4Z4FA 2VG6A 3V9WA 4XIUA 2Z1IA 3M8PA 2P5GA 3VQDA 1SL2A 2G3RA 4FJHA 3V9UA 3KK3A 1A5XA 4X34A 4C5EA 4FJMA 4KAZA 3M8QA 2ITGA 4CEQA 3V1QA 4IUVA 1RDCA 2YKNA 2LCCA 2EFIA 4DTNA 1X9MA 3VN5A 2RO0A 1W9HA 4CIFA 1JLBA 4FJIA 3ZT1A 4JLHA 1JL1A 4ZHRA 1LWFA 2JGUA 4QQ6A 1NJYA 3CG7A 2DFFA 1RT7A 3NH1A 4IURA 2P1JA 1NK0A 4UC4A 2KFNA 3HP6A 5HRNA 2NUBA 1S1WA 2FC0A 1ZBLA 4W5OA 1RBRA 3VQ9A 1OYXA 4DQIA 2F96A 2XO7A 3JYTA 2OZSA 5FROA 3SUOA 1QS4A 3LZJA 2PY5A 4KI6A 2E4LA 3NF8A 4M45A 3LPUA 1BL3A 1OI1A 4PLLA 5KH6A 2XY8A 1VSHA 1WSHA 1HNVA 4KTZA 1JLQA 2OZMA 4DQPA 4CEDA 1RT3A 3U3YA 3F70A 3PO5A 2K3YA 4AHRA 3ZSOA 3AVMA 4PQUA 4CHQA 3QETA 2IAJA 3SUQA 3V9XA 4DQQA 1BQMA 3KK2A 2GFAA 2X4YA 4OGCA 3BDPA 4CEEA 1GOBA 2EQMA 3VQAA 4JRQA 1XHZA 1RTIA 4CIGA 4F3OA 2P51A 2GBZA 1KLMA 1ZBFA 4E89A 4OJRA 5CY4A 3ZSRA 1LAVA 1SSFA 3CQ8A 3TR8A 4DF4A 3TANA 3LYIA 4FJ5A 4B9NA 3AA2A 3UIQA 4CGDA 1SL0A 4HCBA 1BHLA 2GV9A 1TV6A 3HSTB 4YNQA 3I8DA 5KGXA 4IUUA 4N76A 4MFBA 4CF1A 3T19A 3K5LA 4OPKA 3MXMA 1ZBIA 3FDRA 3L2VA 3OYMA 4PLIA 3M9QA 2HVIA 3G10A 4OLBA 4IFYA 1QSSA 1F21A 4BE2A 3ME9A 4MQ3A 4B9XA 3L3UA 4KHWA 1C0TA 5JS1A 4QQDA 2BKDN 2OPPA 1HRHA 3SQ1A 4HCZA 1BQNA 2EQKA 1IG9A 2RHZA 5KE2A 3L3VA 3MO8A 3NTIA 2RKIA 2YHAA 3AO3A 3NDKA 2R57A 4KHUA 1EX4A 3L2QA 4CK2A 3H8ZA 4KB0A 4M3RA 3P8DA 4CJLA 3K58A 3D0PA 3HPGA 5HBMA 2DTUA 4N4GA 4OKEA 1DTTA 1Y97A 4KRFA 2LRQA 3ZSYA 2YHBA 4FM0A 4HVJA 1REVA 3M8RA 1SKRA 3LGFA 4E7JA 3ZT2A 1K6YA 4OVLA 4CHOA 3NE6A 4E7KA 5IN1A 2NLUA 3DLKA 4I7FA 3FC3A 3DLRA 4M3YA 5CIUA 1RBSA 1L3UA 2YNIA 1KSPA 1TAUA 3NH0A 3ZSZA 1VSEA 1C0MA 3SCXA 4A4FA 4KHNA 3ZSVA 2X74A 1R0AA 1ZBUA 3SUPA 1Q9YA 3HL8A 3OYCA 2RF2A 2D0AA 2WONA 3O4QA 3QEVA 5HLFA 3NGZA 1TK8A 1IKWA 1TAQA 1S6QA 3SV4A 3KKRA 5K14A 2ATQA 2MWPA 1NJXA 1L3TA 2RHYA 1FK9A 1UWBA 4BDYA 4FZYA 3IS9A 1RTHA 1ZBHA 3V81A 4LD6A 1JXBA 2BANA 4K8ZA 2X6SA 3VQEA 2B5JA 2DAQA 2M16A 4FLYA 3MEGA 4Y1CA 4NCAA 1LV5A 1C1CA 1NK8A 2E6NA 3K5OA 1J5OA 1RTJA 5J1EA 1HQEA 4DTRA 3T3FA 4C8MA 2XRIA 1L3SA 1LW0A 1NJZA 4FK4A 3QO9A 2XK0A 2PZSA 4GMJB 3V9ZA 4B9MA 3A2FA 4Z4EA 1KLNA 1A5WA 1LWCA 3SV3A 2RN2A 1WN7A 1GOAA 3OB9A 3CYMA 4DSJA 4I9LA 3AVHA 2HHVA 2HB5A 3NNQA 5I3UA 1Z25A 4B08A 3QEWA 4FK0A 2I5JA 4FLXA 1OZ2A 5HRRA 3PV8A 2FHDA 3OJSA 2F8SA 4KO0A 3IG1A 1C0UA 4CK1A 3DOLA 4E7HA 3SQ2A 3WNGA 5KGWA 3DM2A 4HUGA 3RTVA 4N4IA 5D6WA 4TSXA 4J2EA 4CGGA 2P0KA 4KTWA 1WJQA 2HQEA 5I42A 2HMIA 2PYLA 3E9GA 4F2RA 3PO4A 1WNSA 1TK5A 3LP2A 4OKKA 4N4HA 3OYJA 4AHVA 5CYMA 1NK7A 4DSLA 2OPRA 3L8BA 1SV5A 1CZ9A 1TVRA 2Y1JA 2G8UA 4HUEA 1VRTA 1VSJA 2QKBA 4F3TA 4DSEA 2XDPA 1WJRA 3AVAA 2D5RA 3OY9A 2RJEA 1H3ZA 1TL1A 3FFIA 2O4XB 2B6AA 4DFJA 3RMBA 3B6OA 3QESA 3S9HA 4FJNA 4CJ4A 4OLAA 4KHQA 2RJFA 3SI6A 3RMCA 3C4SA 4Z4CA 3NF9A 2AJQA 4BE0A 4W5RA 3AA5X 3VA0A 3QIIA 4E1MA 2O4GA 3RRHA 2X35A 1UA1A 3BDLA 3ZSXA 2KQ2A 2JLEA 2YV0X 4CEBA 3KLEA 2PYJA 3LDSA 3C6UA 3DLMA 4C8OA 3NF6A 1IKXA 1D9DA 2O4XA 5D6XA 3GOXA 4L8RB 3HXMA 4DTJA 4DTMA 1RNHA 3PY8A 4M3WA 1CXUA 1XI1A 4A4EA 1S5JA 2D0BA 5KI6A 4B8AB 2RI2A 4CFBA 1L5UA 2KFZA 5KCOA 4B9UA 4CGJA 2YKMA 3SQ4A 1BCMA 2M1HA 4B9VA 1RBUA 1HMVA 1DTQA 2BIVA 3F9KA 4AH9A 3ITHA 3OQ5A 4CFCA 3SNNA 4Z02A 3NH2A 4QOZB 3QIPA 4BWMA 4E7IA 1XC9A 1N6QA 4CEZA 2B4JA 3KKSA 2ZQBA 1SUQA 2RJCA 3P83D 4J2DA 1RT5A 2DIQA 2F5KA 3H08A 1G5VA 2F8TA 4DU1A 1BIZA 5HRPA 5E41A 3VA3A 1TKZA 1L3VA 4FLTA 4R5PA 1T8EA 3FLGA 3LP1A 3VQQA 2Z1GA 4O0IA 4KHSA 4GY5A 3KLIA 4ZTFA 4RW8A 4BD3A 3WNFA 2R58A 1RTDA 4O55A 3DOKA 1U47A 2VG5A 2OPSA 1WSFA 2HVHA 4CJTA 3OS1A 3OYKA 2JTFA 5HRSA 4Z4IA 2RJDA 4NYNA 3KJVA 1TL3A 1S1VA 2VWJA 2Z1HA 3HVRA 2L8DA 3HK2A 4RW4A 4Z4GA 3IRXA 4NCBA 1LAWA 4O4GA 2XHBA 3EAEA 4CEAA 5CZ2A 4WE1A 3VQ5A 4I2QA 4CGIA 4LH5A 1EETA 1B9DA 1TGOA 3TAEA 3C94A 5FRNA 3O3HA 4ELTA 4DTUA 2QQSA 3OYFA 4CK3A 2PQWA 1I39A 2RHIA 5M9OA 4M3XA 4CE9A 3NGIA 3SZ2A 2BE2A 3DB3A 3QEXA 1VSMA 3TWHA 2GF7A 3OYBA 1RDBA 1WAJA 2X4WA 1QSYA 4E1NA 1EP4A 3LH0A 1MU2A 2QKKA 3ZSQA 3ULDA 3AV9A 4DTPA 1TKXA 3AVBA 4PL6A 4PA1A 3QNNA 3DRRA 2E6LA 1VSFA 2YNFA 5HP1A 5J2NA 3TAGA 2QQRA 3NF7A 3AO4A 1WSIA 2LVMA 4HCCA 1WAFA 1UOCA 5JS2A 2XY5A 1Q8IA 3EZ5A 1X9SA 5J2MA 1BGXT 1QTMA 4OPJA 3AVKA 1D5AA 2OA8A 1DLOA
chains in the Genus database with same CATH superfamily
1G15A 3CETA 2DQRA 2P5VA 5LY3A 5M1FA 3F23A 1LFPA 3B6CA 5GANd 2QWLA 5IHNA 2NOJB 1LWYA 1BL0A 3QFUA 5JVGL 2V8JA 3ALYA 3SAFA 5L3FA 3C1DA 4WXHA 4HX8A 2EYWA 3DKMA 3EFRA 3ATVA 3K4BA 4KT0E 4B3OA 4E7LA 1IKVA 1R6RA 4JX5A 2E5QA 4B9WA 3HM9A 1C6VA 3F6OA 3VQ6A 4B9TA 1HYOA 3MXIA 5LL6S 3VERA 4N0BA 2H6BA 2W04A 3CERA 4AIHA 3LA3A 1UB4A 1X2KA 2L7MP 1GLJO 2FBIA 2WWYA 3RMAA 4H0PA 2DJNA 2DYBA 1NKBA 1E3OC 5D6YA 1F1BB 3VOVA 4D8KA 5FU6B 2D1VA 5TRDA 2Y90A 4FVUA 4FX0A 1IUYA 3NPFA 3I0SA 4ZGDB 3J81Z 3X25B 1WHLA 2LMDA 3RQ4A 2IDOA 1NG6A 1POGA 2M0YA 3WQTA 2K5LA 1BA0A 4Y92A 3MKZA 2BOLA 2WV1A 3RBBB 4YOWA 5L3CA 4ATOA 4ESRA 1ZYQA 3C95A 4NB4A 5DUKA 4OB2B 1HW1A 2H1LA 3KP5A 4MFDA 1D0ZA 4UB8C 1PNJA 1XQSC 5AN4A 3J8AA 1XUPO 1WI7A 2K2VA 4IFEA 4EMSA 3Q5FA 2J4RA 5DD8A 4X64K 3VYUB 1UAAA 5GMKj 4D9JA 3CCRT 3JB9G 3A02A 3CCUQ 1UELB 4CHUA 2K4JA 3VENA 2R7YA 3OR2C 1NHAA 4HTUA 4Q5SF 1NLPC 4H5WA 5BN9A 2F5DA 2NOEA 4IDKA 4UV8A 2UWMA 3PGGA 2EZIA 4CGFA 2VYTA 1LOJA 3ZEUB 1RLPC 2LTPA 1QQMA 1ENHA 5IP9J 2HHQA 2PG4A 1SVMA 2MH9A 2FBXA 2E5NA 5GAGJ 4XIDA 1BWFO 2W00A 3PX6A 3QICA 2VCPA 1RRQA 1E17A 3C18A 5DD4A 3PX0A 4CJUA 1SQKA 1U45A 4MTDA 1LKXA 2IVOA 1SAXA 2CU7A 4OFEA 1WDXA 3I55A 2AT1B 3M8SA 3VRZA 3RCOA 2QA4A 4FJJA 3VS7A 2ME0A 1QZZA 2HGCA 2EYQA 5ECAA 4DTSA 3DTKA 1ZUUA 5FWCA 2PUKB 2W84A 2CSIA 1IO2A 4I99C 4W5QA 3JB9D 1GV2A 1BDGA 2ESHA 2QTVA 2VC1A 2NRVA 4XR6A 3ZEUA 1VQ9A 2HXOA 4OU0A 2LJ3A 2HHUA 5TJJA 3B73A 3D45A 2Y1IA 5I22A 2ZJPL 2KYBA 3ZFJA 3MEXA 2HYGD 4C92F 2FYKA 3LL3A 2CW0F 1LFBA 1HSTA 5GAN2 1W0UA 3F72A 5KPRA 2ELKA 3PL8A 4WXCA 1P92A 2LP0A 3K10A 4BHBA 3JRCA 4JKBA 2KZMA 3DU5A 2R5AA 1YIOA 3CF5L 3DKYA 2FMLA 2OBPA 2R7UA 1TUDA 1S1XA 3QOEA 2DBBA 2OV7A 2XKOC 3K5NA 3I56T 2KW4A 5FKOA 1V5FA 2EYYA 3BZ6A 2JVGA 4XQ3A 2CP7A 3EYZA 1YX5A 3RR7A 2XVCA 2ZGYA 2O8BB 1XTAA 1PKSA 3N97A 2FBYA 3TGNA 1GT0C 3VS3A 3VW4A 2IS3A 2COWA 3EZWA 2DEUA 1WNLA 2XSJC 4AG2C 3M1EA 1JLAA 1YHQI 1YJWQ 3WTSC 1Z21A 3OMGA 1C1BA 2HL5C 3LMMA 2XGEA 4Y28E 2IPOB 3LX7A 5F1XA 1B92A 3WTUC 1YI2T 2ZCWA 4AHUA 2CV2A 1HLVA 4B9SA 3OS0A 3ULEB 3CCEN 1N5YA 4G6DA 3MMYB 2BTTA 2MSYA 4XTUA 3AAPA 3L7WA 1MV0B 1MGQA 3I0WA 3GUDA 4NZGA 4YELA 4PJOG 4FJ9A 4DTXA 2O8BA 4JBAA 3TI0A 2GZWA 4WQ4C 3T5XA 3LWMA 2HQNA 4TVRA 2ZGWA 2ZXWH 2D8JA 1SHGA 2L2OA 4EATA 1WSEA 5ILUA 1PP7U 3PIPL 4FT4A 3QLHA 2HNDA 1VQ8N 2A3ZA 5IT9Z 4CC7A 3CCMQ 1XOVA 2V1XA 3HHHA 4EJOA 4ABZA 3CCSQ 2YWWA 3CLQA 1UJ8A 2LNVA 1KFDA 1M1GA 3QKJA 1JE8A 4MNUA 1IKYA 1GOCA 3ULEA 3DMJA 2JSCA 4I2PA 1TKTA 3O08A 2YT6A 4BRGA 2X9DA 4II3A 2IIRA 4NCGA 3VPZA 1SAUA 3ZN1A 2D5VA 2PVDB 3THYB 4QS7A 2XRNA 3O1WA 1NJWA 4MMLA 3ZT0A 4DCHA 3EUHA 5EDNA 1RETA 2V7ZA 4EIKA 4LF6K 3I0TA 2RI3A 3O8VA 1VQNT 2EFWA 2LNBA 5CHZA 3CFOA 1K1ZA 1Q95G 3HOWJ 1WPKA 2DA2A 3OS5A 1WI9A 1NMDA 3EL2A 2X6YA 1NJIO 1ETXA 4MQVA 3OMCA 4EP4A 5CHIA 3J7AP 4B3MK 4JI2K 3O5BA 1I1SA 5HK3A 1Y0MA 1YVUA 1NGFA 1KAXA 5GAMj 2KRSA 1LDJA 1YWOA 4M3ZA 2V7YA 3CVTA 3HVTA 5KTQA 3ZQHA 5M5YJ 3NTKA 3THYA 4AIKA 4M77C 1ZLJA 1WZ2A 3P7NA 1BIBA 1R59O 4M3TA 2OTLN 1YCSB 1D0YA 1PG5B 3FZMA 4HOBA 1TUGB 2X3XD 3L2RA 4XL9A 1UUEA 4LLNA 1TZLA 2V1RA 3ZEHA 3TAFA 2BE5F 3DEWA 4XU0A 3MZYA 1K9MO 3VQ8A 4C8NA 1A5VA 2KTQA 5DUIA 4CJSA 3QMLA 2VBYA 1T38A 1KHCA 2XD0A 3KP6A 4BC2A 3DBHB 1WGSA 1IN7A 4OINF 2Z99A 1UA0A 3BOQA 2DA5A 4C0DB 3V6DA 2HSTA 1ZELA 2FPFA 1MSFC 4FL6A 3CCJI 3RRGA 1JLGA 2DPUA 2P6SA 4U0YA 4XTYA 4CI0C 5BRDA 2VT2A 1X1PA 3HP9A 4OP0A 2E5LK 4PZJA 1MKMA 5J26A 1PJRA 4JK7A 1PSFA 3JCMg 2HZYA 2W0ZA 1MMAA 1ETKA 2VL8A 3CO7C 3BF1A 3OYIA 1SHFA 2R5ZB 3GTJJ 3E0JB 1B9NA 2DETA 4BNCA 4XBFA 1DJ7B 3SPZA 2IAIA 5EXWA 4K8XA 1TYQB 2BDPA 5D3GA 2FPEA 2W6KA 3LA2A 5FFXA 3WE2A 1WJ5A 4C1NI 1LQ1A 4LFCK 4CJVA 1JU5C 3G4SA 5HVQC 2JNGA 1VQ7I 4O5BA 2JZ2A 2QWWA 3CMYA 1VSIA 1P8ZA 1J6ZA 2LDMA 4FU6A 1PD0A 2OAWA 2RREA 4OIRF 1RT1A 2A68F 3F8BA 2A61A 1SG5A 2Y31A 3O9RA 4IBNA 4B3XA 2CZ1B 1Y56A 3IAS2 1QVTA 2JWLA 1VIEA 3CP8A 4KPYA 4JS4A 2Q1ZB 3S14J 1TK0A 1U3EM 4H0EA 2R5ZA 5IT9K 1KD1C 2KGTA 3VRYA 3JRZA 2K9NA 3G1OA 4L5GA 1XCVA 4ID5A 2E3IA 3J7YJ 1QWEA 5CYVA 1X2NA 3K4LA 2PZ1A 1I07A 2BXYA 4KRTA 2GCXA 2JVVA 3ZT3A 3M4OJ 1WUAA 4BUPA 2KT0A 2XDBA 4IF4A 3SJJA 1TQMA 1R4MB 1CKBA 2G8VA 1SSHA 1Q82O 5AIQA 4N41A 3SPYA 2J6OA 4DZJA 1RFQA 1PUEE 1ZG1A 4HNUA 4C0ZA 1GHCA 3S6WA 3I55T 2XICA 1EV7A 3VQBA 5LJ5g 1Q1HA 5LRSA 5EX5A 1VQOA 3JCMe 1MJ9A 2DRKA 2QA4T 4CJ3A 4IIMA 4A4HA 3SAHA 2IS2A 2UXCK 4JAXA 1R7JA 4LMYA 1WX6A 2PTKA 4A4GA 2NVQJ 5J2PA 3H36A 1VQ5I 1YT3A 1Q1VA 4YHHK 1U48A 1PVEA 4G6QA 1VQ9T 2EHGA 4II1A 1QVPA 3BR2A 2O6GE 3VYTB 3Q0UA 3HPWA 1OYIA 4D7MA 3MK6A 4Q4ZF 1K73O 4J00A 5GAN6 1JUMA 3LAKA 2PUOB 4CECA 3AO5A 3PMIA 2CYYA 3ASNH 2KRNA 1X9WA 1WKMA 1KCFA 2R7ZJ 3L0QA 1W97L 2Q36A 2VJ4A 2E64A 4RTFD 4R8HA 4M73A 4WCIA 4DNCA 3FXLA 3BR1A 5GAOq 2ADUA 1XMQK 3AVGA 4FM1A 3ERMA 8AT1B 1NWKA 3D5LA 4Y1DA 5MLCQ 3CC2A 2NNYA 3GOIA 3I4PA 1RPWA 4RAFA 2DXBA 4EHUA 1NNEA 4OFHA 2EX3A 4DA4A 3DBRB 4UVAA 2MIOA 5BR9A 1DIZA 4IQ4A 1NGHA 4J2BA 3DKXA 1BCOA 1NOZA 1TP4A 1XTDA 3O3FA 1J09A 1YS6A 2BZTA 1VYTA 4M75C 1VQNQ 3F10A 5CR2A 4ID1A 3QJ6A 2FF3B 1RDAA 3O9SA 2LY9A 5D4SA 3J81O 4HCKA 1BIUA 3CDLA 1N6AA 3SWNC 2YJFA 3IAYA 2QKMB 4M6YA 4M4ZA 5KPZA 4FM2A 3T8RA 4B22A 2V1UA 5LJ5e 2FBTA 4YFUA 2EJRA 1KTQA 3QINA 1QVGP 3NHGA 3NMZC 4Y4RA 3K5MA 1NK5A 3WE3A 3QIOA 2DEQA 1FNNA 5GAEP 1EZZB 3BW1A 1U6ZA 3HB9A 2EIMH 3OW2S 4IO9F 3PNYA 2XY6A 4BREA 1I94K 4CF0A 1NTCA 4C1NK 4RMNA 3DLEA 3O4NA 3ZLJA 2IS4A 3CD6N 2LX9A 3JCMd 4DB3A 1C1AA 5AQMA 3HYFA 2GFUA 2AXTC 4E3SA 1C0GA 2JMCA 4C8LA 4NLBA 2EILH 2L3QA 1TW3A 2CH4A 5H1SQ 1M1KO 2STWA 5F64A 4BJTA 1AOJA 4EZ6A 1NK6A 2VVKA 3N5NX 3U23A 3KLGA 4YDUC 1YYVA 4XTZA 3VU3C 4FW2A 4RW9A 1YTAA 4GW6A 4JS5A 3X26B 1SMTA 4PIIA 2JQ7A 3D7EO 1WEIA 1IN8A 5M1OA 3VSLA 2NXNB 4IEIA 2CH0A 1V4SA 4BQNA 5CYQA 3TAPA 2VG6A 4KUIA 4PUSA 2RQUA 2EV6A 1YO5C 1IF1A 3OH6A 5BPLA 4C8QE 1Q7YO 1YITN 4CCJA 4LF9K 1J0RA 2RHKA 3M8PA 1U1SA 4KGVB 5FLXE 1VQ6I 4B3AA 2JRMA 4OWRB 2ZPGB 3R8EA 2NUPB 3V9UA 1QVFM 1P4XA 1A5XA 3FK6A 2HOEA 4X34A 4BC5A 3VEVA 2HEOA 2Y69H 3V1QA 2LR8A 2D1XA 4YOYA 4XK8E 1AHJB 2QM1A 1W9HA 5AYFA 2E1YA 1JHFA 2KP6A 2L9NA 4QWQA 1W1FA 1SEMA 3IH4A 4JZ3A 1JL1A 4ZHRA 3KZZA 2XKPA 4YORA 1NJYA 2LK2A 2DFFA 2CQ7A 2EAYA 3NH1A 3H9NA 3L1PA 2D0OA 1NK0A 3RDIA 4M7DC 3GFJA 2XUBA 3WU1B 5LJ5d 3SHFA 4LN2A 3DV8A 4IJAA 3MCZA 5E1ZB 2YUQA 2NUBA 2ZMEC 4WF2A 1R36A 2W24A 2HEQA 4W5OA 4DR1K 5J8CA 2X6OA 3H9GA 4H0TB 1DPRA 5B3SH 1X1CA 2C0TA 2E4LA 1Z77A 2GTOA 2LC2A 2B86A 3H92A 2L02A 2GXBA 2FMYA 4M45A 1ZQ3P 4M9XA 3A5OC 5BPIA 4JKEA 2KSSA 4PCQA 1SAZA 3OSGA 5IP7J 1MH3A 3P9KA 1LJOA 1S72T 4WXDA 4ILHA 4M77G 2CUFA 2XAUA 2GWRA 3EO3A 4OIQF 3GG4A 1PC0A 1OR7C 3I55Q 5TISC 1QQJA 3SUQA 3V9XA 3G4ST 3KK2A 3GIBA 5BQTA 2QA4Q 5L23A 4BU2A 1UGVA 1RR8C 1GV5A 2OI3A 2Z9OA 2JA5J 5AFUH 3K1NA 5IT9O 5AQRA 1VQ9Q 3WODF 2XPWA 4FYXB 3FKJA 4BY6B 2DNUA 2X4JA 3MD2A 2DRMA 4J9HA 4DF4A 1IN6A 2W25A 4B9NA 4F7UE 1S3XA 3EHQA 3DJCA 2DBMA 3FXRA 1TV6A 2GV9A 3CUQB 2IP2A 3WGIA 1YW7A 2DK8A 2F2VA 5J47A 2L7KA 2XPUA 2QWQA 4MFBA 3UA7A 1RGIA 4CF1A 3KX2A 4A62A 3T19A 3E5QA 3LSGA 3K5LA 2XSDC 4PJOB 4M77D 3IWFA 4QTRA 3CCUI 3OYMA 4PLIA 5GAN3 4UXNA 3M9QA 3BLYA 1PRLC 1NK3P 3TU5A 3F5TA 3NQOA 3I9V2 2R5YB 1RRSA 2ELHA 3CCQN 3CPFA 3DPTA 1X3UA 3VEPA 1LCKA 3L3UA 1BOAA 5JS1A 2VI6A 4H5TA 4QQDA 2OPPA 2E5ZA 1YFNA 5GAOm 2HI3A 2F69A 3FSPA 4FWMA 4RMOA 1IG9A 3CUQA 2COZA 3NTIA 3HRGA 1S5LC 2YHAA 4IWVA 2W1OA 5K7HA 2HFHA 4CK2A 4KB0A 2RQQA 2VGMA 4PJOA 2V9KA 4WX9A 1ZLKA 1O7FA 4OB3B 3L00A 4DBQA 5ERIA 3SZGA 2YHBA 1W7AA 1A6IA 3Q7BA 4LK0F 2R5YA 3BT9A 4N0AA 1REVA 2GIZA 3LGFA 4E7JA 1I81A 3NE6A 4LDVA 4E7KA 5EEHA 5IN1A 4JKFA 4XLEA 2EIJH 3CCVN 1AA7A 2BE9B 3DLRA 2J6FA 1OV3A 2PFUA 4IRHA 1FLIA 3TP0A 1W5SA 5CVVA 1RKWA 1REPC 1SFXA 3CC2T 4M74A 3FISA 2EBPA 4FO0A 1OPLA 4XRFA 1VSEA 4UB6C 3CBMA 2OFKA 2QQ8A 4KHNA 2XG8D 2J6KA 3VF4A 2A5WA 5IXFA 4DR4K 4NC6A 2K86A 3M3YJ 2MAMA 3JRIA 1ZARA 2LJ1A 2HQAA 3VS1A 4ELYC 3OYCA 4OPHA 3N4PA 4HLYA 4OB0B 2D0AA 4MLOA 4FM4B 3OOPA 2KEAA 5HLFA 4MEYF 1W0TA 3NGZA 5CAIA 2QF7A 1IKWA 1XSVA 3KP4A 4UNFA 3HRTA 1S6QA 3T69A 2VQLA 1YJWI 3JS6A 2FA5A 1L3TA 3JB9J 5LRRA 3IRQA 4JI3K 1XPXA 1HNXK 4ITVA 2RQWA 1MJBA 5CKFA 4WYBA 4H0OA 5KCMA 5DLQE 4IXAA 2HPIA 5GAN5 2D8HA 2WUSA 2G6FX 2NNWA 3DEEA 3F3XA 2PBDA 4Y1CA 2OU2A 2YX4A 2DA9A 3A8HB 1C1CA 5D8LB 4EA4A 1W6XA 1J5OA 1AHDP 1SKUB 4C8MA 2XRIA 1LW0A 2ZPHB 5EC7A 4M75G 2F5TX 2XK0A 4GMJB 3V9ZA 4PFZA 2DMNA 2V6EA 3CCMI 4Z4EA 4AFZC 1KLNA 1LWCA 2UXBK 2IGNA 2X1CA 1QQIA 4CD3A 1NG2A 3CCSI 4A5MA 4I9LA 3AVHA 3HKSA 2YX7A 4K11A 2ZGZA 2COMA 2M45A 1GXQA 1Z25A 4B08A 4FSSA 4FK0A 4BY9C 3RUXA 1A36A 5GAGP 3OJSA 2EA4A 1XGSA 3DOLA 5LJ5j 2C0IA 2DW4A 5DCMB 5L3BA 2Q0UA 3WXLA 3BROA 4N4IA 1G3SA 4TSXA 4J2EA 3S1MJ 4WFNL 2P0KA 3MFKA 3DU6A 2K02A 1WJQA 5I42A 3M5RA 3BTCA 4QIWN 2P0QA 1DGKN 2PYLA 4HQEA 1TUCA 2HDWA 1TK5A 3DXMB 1I0CA 2EWNA 3G4SQ 1JHHA 2EVRA 3F8CA 2QBYB 3CJNA 4JLIA 1W70A 5IHIA 3MHXA 3CMAT 1VQKT 4JI7K 2E88A 2HBKA 2G8UA 1VRTA 1VQMN 2QGFB 3O6WA 4M75D 4F3TA 4DSEA 1WJRA 3SDBA 3OY9A 3Q9SA 2HF4A 1LDKB 1STZA 2L2PA 4E4HA 5DCMA 3E6BA 3RDVA 1D0XA 3FFIA 4DFJA 2JSPA 3H45C 2OJ2A 2P9IB 3EG9B 2K40A 3VDXA 3QESA 4OMYA 3GW2A 3TSUA 3J7AO 4PFOA 3LQRA 3DXMA 4A2BA 1EO1A 3SI6A 1JO8A 3C4SA 4IHWA 2QBYA 1JT6A 4GYGA 3NGPA 2QI2A 2VQHA 3VFZA 3I5RA 1MNEA 2W41A 3VA0A 2Q97A 4B8XA 1RZ4A 2V75A 2X35A 3LDOA 1G99A 2YV0X 2CDTA 4L18B 3CWSA 3JAMZ 2PYJA 2VWFA 3C6UA 3TPQA 2R7XA 4G7ZF 3OWTA 1B34B 1VQOQ 4J9GA 1IKXA 2P9IA 4R56A 4Q47A 3EG9A 2D1KA 3HXMA 4PL7A 4DTMA 2DPDA 4DV7K 1XG7A 2HOAA 4RWTA 1CXUA 4IRGA 2D0BA 5GMKi 2V1NA 4K2EA 2M9UA 5KI6A 1VQ4N 1HKQA 4EV0A 2JM9A 1WEFA 5L3EA 4FT2A 5KCOA 4B9UA 1I6HJ 2NOLA 3SQ4A 2E19A 3TEEA 4XU3A 3F9KA 1FJLA 2QWOA 2RNJA 1UHSA 1B34A 4E47A 4CFCA 1ZREA 3SNNA 3HEFA 2RF0A 1YJ9N 4JPBW 1JJ2S 3AGRA 3AAFA 5E84A 1AT1B 3CCEA 4QPQA 4E7IA 3HHGA 1BBZA 4KISA 1SD5A 5FFZA 3H0DA 2W82A 2B4JA 2XI9A 4LB6B 3GO5A 3TP3A 3G1JA 3CC2Q 3P83D 1RT5A 2DIQA 4M71A 2OZ6A 1BIZA 5K7FA 1UCRA 5E41A 4F52A 2YRCA 2EIKH 3DLLA 3GYHX 1X3WB 2XHIA 2ZF5O 3LAJA 3VQQA 4KHSA 4GY5A 1VQ8A 5GPAA 1ETQA 4QKUA 5JI6A 1ON1A 4J5YA 3EEQA 1N8RC 2Y48A 3DOKA 5FLXK 4KFCA 2RA2A 4DQ2A 4M7XA 4CJTA 2WSEE 3OYKA 2VODA 2DDBA 4JJBA 2RJDA 4NYNA 3CDHA 4G9YA 1IUFA 2VWJA 4XKBA 3EN9A 3WHCA 1QO0D 2L8DA 4QVDA 3HVRA 1N3AA 5DS9A 2FL7A 4NCBA 4DKWA 1W2BS 3B6AA 4O4GA 3MZ8A 4YIFA 2XHBA 4CEAA 5CZ2A 2EW3A 1UGSB 4I2QA 1BA1A 2NS0A 2IPQX 1SS6A 4CGIA 5E8GA 4CBUA 2KR3A 4UHTA 4OIPF 2HVQA 5KAFC 2R3SA 3O8GA 4LLGF 5BREA 3OYFA 4ENMA 2QK0A 1AOYA 1EIFA 2GM4A 1APLC 1I39A 2YCHA 5M9OA 1MH4A 3S1RJ 1XMKA 4OAYA 2RDPA 2VE8A 1VQLA 4K42A 5DM6L 1B9MA 1VYVA 1QPMA 2LYCA 3DB3A 2E1ZA 3QEXA 1VSMA 1BU6O 2KRMA 3LCNA 1XQHA 3CJ7A 4M3BA 4XRMA 4BQAA 3CMEN 3QWLA 3EYYA 2O8KA 1T3VA 1JCFA 2WC9A 3F22A 4YEJA 1WAJA 3BG9A 2P7CB 4PKIA 1EP4A 4RCBA 2OTLA 4M3DA 1TL8A 1NEGA 1IB8A 1WGXA 1GFDA 3AV9A 4E7ZA 4OF1A 2W6LA 1VSFA 3K70C 2DILA 1K0SA 1BK2A 3RR6A 3TSPA 1WH5A 4IOCL 2QQRA 4DYCA 5C44J 1K83J 4A54A 2NOFA 5HS9A 1GCQC 3NF7A 2KFDA 4CC4B 3JCMQ 4YOUA 1VQNI 1AKHB 3K6GA 2ETHA 1PDNC 2MC4A 4DZPA 3V7RA 3AVKA 2DJQA 4J9FA 4J7IA 4PKGA 3OJUA 3KEOA 2LQKA 2W03A 4DBRA 1S9EA 4JKHA 3FHNA 1RAHB 2L3RA 1MWMA 3CJ9A 4B44A 5FDLA 4I9QA 1TWGJ 3CO6C 4IZ9A 2R4GA 2B7EA 1SFKA 9ANTA 4M77B 2ZD1A 4M78F 1PU8A 1RAIB 4HAMA 3VGKA 1UG0A 3S8PA 2KHOA 3V1RA 1ZHIA 1T98A 3RR8A 1G6NA 1OCPA 3S1NJ 4O44A 4DUZK 1JGGA 1S7EA 1M3BA 1NG9A 3EHRA 1VYUA 3J7YP 1P7IA 4C23A 3ISNC 2CWEA 3NTHA 1AKHA 1KFZA 3DB4A 1AWCA 1IG8A 1TWFJ 4DYRA 1QKXA 4NC8A 3L42A 3JB9H 2YSRA 1BM9A 3A01B 1PHTA 3LWHA 2NLXA 3GTQJ 4I98B 3LZIA 2EK5A 2ISYA 3TL4X 1NYGA 4QVZA 3KLFA 4I6ZA 2GGRA 3KLHA 3HM8A 5KN8A 2HBPA 2O2OA 4DHYA 2FQ3A 3AG4H 3V4IA 4YTLA 4M77A 3A0HC 4N47A 3SB2A 4EHTA 5H20A 3DFGA 2VE9A 2CQKA 1K4US 3QPHA 3PIOL 3IUCA 3SJMA 4FLVA 2B0LA 2A7YA 2A3LA 2EQRA 4FWPA 3OYNA 4EMGA 3I0XA 3A01A 3SXYA 1NGAA 3D2EB 3COAC 1LNWA 3JTHA 4IG0A 4LDWA 2E2HJ 4YOVA 3EH1A 3L2WA 1XDUA 2ZPEB 4BWJA 1OPCA 5K1YA 1HYZA 4BGBA 2EZLA 4XM3A 4JD2B 2X78A 1Q86C 1IDZA 2HHTA 2NRHA 3NAEA 3ZGKA 2VWBA 1TTHB 4DGWB 3G6EN 4C92G 4LFUA 1YW8A 4GV3A 4GVEA 1HJRA 5D5UB 1S1TA 3O9UA 2VLAA 4M6VA 5KYNA 1VUBA 1EH7A 3I4NJ 4C5IA 1NK9A 2E7WA 1ETWA 2P9PB 4RCCA 4HSRA 2WFBA 3TAMA 1TWAJ 1QZEA 5DM6F 1BI1A 2PMHA 1E3MA 3RNJA 4KDPA 2IS6A 3W6VA 1NOYA 5L3GA 1XD7A 1IRFA 2BY3A 1HKCA 4H5NA 1ZSZB 4E19A 4MDAA 4JJDA 3D2EA 4H8KA 3HBTA 3LDQA 4AG1C 1RC9A 4M9SA 4BS9A 3M0SA 4WCEL 4JD2A 2MK5A 3OS2A 2DYIA 2MOXA 2YUNA 1KZHA 4A3GJ 3S2DJ 2M30A 5ILSA 4OMOA 2IGIA 2G8KA 3BF3A 5DEQA 1IBMK 4BXFA 4L5IA 2VXZA 2P9PA 1BBYA 4RG2A 1IV0A 2B8AA 1XS9A 1OEBA 3W6JB 4BBSJ 2RGVA 1YTUA 2WTUA 1WQ2A 3EETA 3I55I 3VS6A 1ZSZA 3V42A 5FWBA 1W1WE 3AHUA 3NFAA 3KUFA 1FOXA 1HX1A 1NGGA 2QA4I 2PFBA 4RBOA 5J2QA 2HQRA 2PVGB 3IAM2 1Q9XA 1GLBG 4FWLA 2MA3A 3G6EI 3QWYA 3QZ9B 4UQGA 4BQLA 3HHTB 1Y1VJ 5KCHA 1OCRH 2RV8A 1LNXA 2VONA 3ATUA 3CCET 3MXJA 2R7FA 3ISPA 5DK5A 2CUJA 2DBKA 2ID6A 3PLAA 4FLWA 3HRUA 4ME7A 2KI7A 3QERA 2L01A 5EEGA 1YF5L 3R0AA 3OYGA 1T0FA 5DYMA 1ZTRA 3K2PA 4HHTA 2K9QA 3ZQCA 4CJEA 1YN8A 2HVSA 3EGDB 1U8RA 1VQ8T 4EPCA 3OYLA 3PO2J 2X6XA 3CD6A 4CGHA 4BJ6C 1S7AA 3PNWC 3WXIA 3M57A 5GAOr 4PJMA 3CC7N 3CCLN 3PIOF 1YP5A 5HY6A 3AA3A 3FM3A 2IIMA 1WJDA 3M4YA 2L0AA 2Q1NA 3BR5A 4A53A 4M75B 4RKUE 1BC7C 2ASPA 2XF6A 1U04A 1DQUA 2CS7A 2H8WA 4YRVA 2WAQN 2NVTJ 3O80A 5FPNA 5AQNA 2V6CA 3V8KA 4L59A 3V7CA 3GZNB 4XLPF 3TTFA 4EJTA 2CP3A 2RQRA 5KYUB 1SKWA 2M9HA 4ILGB 1XNIA 4I0AA 2DFHA 4N5SA 2VASA 3QHSA 2HF3A 4ICLA 2P9UB 3EGDA 4A4KA 1B4AA 4A93J 4DU3A 2VQGA 2JHJA 4AU7A 2P0PA 3LPTA 2IOCA 2XB0X 4KIBA 1RR7A 4H0XB 4RG8A 1YITA 1IRXA 3KHYA 2L0KA 4IG3A 3QPLA 3PVQA 1ZSGA 1RCHA 5JR3A 2FX0A 3LDNA 1IG7A 2OPTA 3HFNA 4A2AA 4EZ9A 4M75A 2PQ8A 3GFLA 1UG2A 5M1KA 4GYIA 3H9JA 1BOTO 5LJ3h 3HOZJ 1KVAA 3U6FA 3U2RA 2GTJA 4XSXF 4DU4A 3MQ0A 4EA5A 1M8MA 1JKRC 3AKZA 3VEXA 4RGSA 1VQ7T 3MEAA 1HNWK 3DWLA 3RTRA 2VT3A 5KYUA 1KGSA 2HKQB 4L5JA 5IAYA 4K43A 1X2MA 1K4SA 1S3JA 3JAMO 2NOGA 5C10A 3MDQA 4XSZF 2P9UA 4PKCC 4BXUA 4EDUA 1YAGA 3LSIA 1P9QC 3HGGA 3OSSC 3CPWA 3NCIA 2LTOA 4IIOA 2E2IJ 2O3FA 2OYQA 4QLCU 1WEGA 1TTYA 4HUFA 2XU8A 2QASA 1BI2A 5E8IA 2ACJA 5LJ3f 3UT1A 1YIJN 4A3LJ 4DF8A 5M1NA 2VKDA 1WBDA 5J4VA 2LJ0A 3DRSA 3VTIA 4KH6A 1ZK8A 5FKMA 4XLNF 1SVOA 1KU7A 5F0HA 2D6FA 4BY1J 2PJPA 2FSKA 2NVXJ 2AK5A 2R7QA 1TKDA 3SD4A 1EKEA 4EFHA 3BDUA 1QHAA 5AQFA 4JI8K 2ASOA 3I54A 3LP3A 1I5LA 4JEPA 2FU4A 1QVGA 2JTMA 2W7NA 3S6IA 4AT1B 4E6KG 3W3DA 4IHYA 4RTZA 3QDFA 3S3NA 2QCOA 1V76A 3ZSWA 5B5EC 4F4KA 2HKXA 4LSNA 3PSFA 4C8QC 5HOOA 2M4GA 1KQSS 3S2WA 3A8GB 1AZGB 2QENA 2VN2A 2MFZA 3FGUA 5EG2A 2M02A 4LDUA 2YHYA 3BP8A 1RT4A 2ZE2A 3C2HA 1U3OA 4LD5A 4FTHA 2LOOA 4GLMA 1RESA 4G94A 2F1LA 3B02A 1ZR2A 1HKTA 2A1RA 4ISGA 3VKIA 2CFOA 9ATCB 3ZQGA 1XC5A 1P4WA 1RI0A 2A05A 4RGUA 5IPAA 4KT5C 1JB0E 2LX7A 3UPUA 4DV6K 4JDSA 1HKGA 1RUOA 4KI4A 1JTXA 2CUEA 4DS4A 3PQJA 1WFXA 1YIJI 1Q81C 3ER0A 2OAUA 2FBKA 3HJEA 4DMNA 5JFRA 4F93B 4BUGA 2NUZA 4LG0B 4AF1A 2PMUA 2X51A 1H8KA 5EF6A 4RAYA 2XRLA 4AM7A 5LHGA 5CE3A 5J6XA 4PSWA 3M7GA 2DA3A 1HKBA 4NL3A 3BCAA 2M5WA 2RQVA 3KYLA 3CMMA 3H46O 5JLHA 1U5SA 1ASVA 3ZMZA 4GVMA 3G4SI 5K5RA 4KUDK 3CCQA 4I0BA 4HX7A 2BE7D 1RDDA 1AWJA 3A2KA 4DFPA 4ELVA 2KZZA 5GAMh 2BHYA 4RTYA 4DR2K 1PU7A 1M3QA 3MP1A 1U4BA 1T7PA 1UJ0A 3CCEQ 1I3AA 1V55H 1DUXC 1KU3A 1NJIR 4LG0A 4AQYK 3HPHA 4FWKA 1G4DA 1R23A 2E1MC 1OR7A 2O03A 4A3CJ 2A1SA 5D5VB 3SQ0A 3EPZA 1Y57A 2WOMA 1OJLA 2A69F 1D1CA 1NM1A 2HWVA 3GNGA 1BR1A 3VS5A 2P5KA 2QK9A 5GAMf 1VQ8Q 4CHNA 5BPMA 5AT1B 2MWOA 5AQOA 4J83A 1JLCA 4DK9A 3E97A 2R0QC 5FU7B 1GLNA 2DYRH 4M7AF 4Z4HA 3VS4A 1OH8A 4C2TA 1YG2A 4OX9K 2STTA 3CCVA 4NOYA 1BISA 2JA7J 1QMCA 2ESWA 4DV4K 5F08A 2OANA 4KIGA 2A36A 3CM6A 1K8AC 1TH7A 2KJBA 1VQOI 1SRLA 3FMQA 1JGSA 4N9IA 1ZN2A 2FSJA 4CJQA 1H9GA 2WB1N 1LMZA 3I35A 2QDYB 4KMUX 4FIBA 3BJOA 1BA5A 1BJZA 4KN4X 3HOTA 1J7KA 1HU0A 4JRKA 4M9ZA 2HHXA 2KY9A 3FXMA 4W1UA 2K7AA 1A31A 3A8OB 4PJOE 2O5RA 2E6MA 2RKHA 3HZ6A 2WBMA 1VQ6T 1Z26A 2LQ8A 3A5LC 1WSJA 3NBPA 4FWRA 3TSWA 4ZN1A 3JSMA 3WNHA 3TAQA 3EUAA 2DD5A 3CCRN 2JPSA 2XGXA 3H3UA 5IH2A 3LSTA 4L3QA 4CYDA 3WTWC 1PUFB 3F9MA 1VQLQ 4XONA 2J7IA 5J3BA 1T6DA 3H3NO 5J40A 3KD5E 4LK1F 3K57A 4OGEA 2RHXA 3K69A 3LLRA 3UE5A 1Z91A 1ZKGA 1NZ9A 2OTLQ 1ONVA 1JJ6C 3E9OA 2XAFA 4DSIA 2LFBA 3J81E 4CHZA 1OYYA 3QO3A 3BZKA 1FBUA 3C2BA 2ISZA 1AWOA 4X62K 4BDPA 3CC2I 1N5ZA 4B6MA 3PX4A 1S6PA 4DSFA 2DIGA 3UF4A 2XY7A 4PY5A 3WTTC 3TCJA 2VJJA 2J05A 1U6GA 3CFRA 3DPUA 3MN5A 3FHGA 4WF9L 4I7HA 3MWTA 1NKEA 1KC8C 1EH8A 1OH5A 4O5FA 4K0KK 2QQ9A 2XGDA 3MP8A 1QVFS 1JUSA 1XNRK 4H03B 1FN7A 1PUFA 3H5AA 2V9PA 4E2FB 4ZTJA 5DMRA 4BR0A 2O4IA 4G1QA 3JTGA 4E9EA 3BCBA 5EVZA 3FRNA 1YITT 3PFYA 5LJVA 3WTYC 4AC0A 2X9HA 1YOVB 3SDZA 4J9CA 2RN8A 1WHHA 1X3ZB 3HSFA 3WTXC 4KGXB 3FB9A 4DG1A 5JHUA 4N56A 4MZTA 4DLGA 5KE3A 2HD0A 1T0JA 1PKTA 1N75A 3EY1A 5LFAA 3OYHA 1JKHA 1N78A 2KT1A 4L9TA 1VRUA 1G3WA 4BDZA 2RQTA 2F4VK 3HOUJ 3OL4A 1J59A 1GRIA 3BZCA 4EMKC 1OPKA 2LQNA 4AM3A 2GWJA 2JHNA 1D4XA 2WAEA 4XIUA 1D5VA 2VQCA 3ZCOA 3I56N 4YFKF 5FLMJ 1MNDA 3E5XA 2RNGA 2P5GA 5CKDA 5HLGA 3BTIA 3Q3SA 2DA1A 1QZ5A 3PJRA 4I6MB 1SZ2A 3HUGB 1VQMA 3G71N 2VJ5A 2XB5A 1Z9QA 1GLAG 3ABKH 3UNGC 1WPYA 3F8FA 2JA2A 5J3LA 4C92B 4IUVA 1MIJA 1RDCA 3TQ7P 3TOBA 1ZBJA 1K73R 1X9MA 1KJWA 2QM3A 1MWKA 5E3NA 2KYMA 5E17F 2E1OA 1I5OB 1YI2N 1R5ID 3IP4B 4IOAF 2JGUA 2FO0A 3K9KA 1RT7A 2IXSA 3U21A 1MMGA 1YS7A 2ED1A 3KWGA 1N32K 1ULYA 2DMOA 1X3MA 4BRMA 4I6MA 2CO5A 3HUGA 1RBRA 3VQ9A 1OYXA 2L9VA 2F96A 1BR2A 4BI4A 3JYTA 1U2VB 1P6RA 5FROA 3SUOA 2PY5A 4E9GA 4C92A 1XSDA 2PEXA 1N33K 3M6GA 3BEXA 3IUOA 1C0WA 3CWUA 2W48A 1O3TA 1VSHA 2EJGA 3FXQA 4YOQA 3ZYYX 2L7FP 4DQPA 1M90C 5ICFA 5DDGA 1ZYRF 3JB9I 4CEDA 4FISA 1RT3A 3H3VK 3U3YA 2IVPA 2VIXA 4DOZA 4AHRA 1E2XA 3OA9A 1C6VX 3ZSOA 4M7DF 3IHOA 2ZFUA 4PQUA 4CHQA 1VQ4A 2G9WA 1ABQA 4V2SA 3QETA 3LQQA 1KU2A 1MMSA 2IAJA 4PJJA 4OMNA 1UECA 3SK3A 1ZGJA 5GANe 1U2VA 2GFAA 5LL6Z 3S41A 5D6EA 4F9OA 1KQ2A 2LSOA 2N8GA 1WXBA 1GOBA 2EQMA 4PKHA 4HNTA 4LOCA 3RVCA 3ULQB 1YJ9A 1RTIA 5IT9E 2AZVA 2F9WA 4A3JJ 1KLMA 3CI5A 1FMVA 1ERDA 2F5CA 4A0ZA 2IW5A 1LAVA 1SSFA 3CQ8A 2YI1A 2Y4YA 3LYIA 3LA7A 2GOXB 3CCQT 4FJ5A 4D5CA 4NNJA 5LGUA 4CGDA 1SL0A 4EAHD 4HCBA 1LJ9A 2HKNA 1EQYA 3NFCA 5FU6C 1N77A 2H3EB 3I8DA 4N76A 2V4JC 5E20A 3BR0A 3PE0A 2F2WA 2ROLA 3PUBA 2A5YB 3QQAA 2LH9A 3GTPJ 2A28A 1DU0A 3FDRA 2HDDA 3HSCA 2M0MA 3G10A 2ID3A 4C0GA 4IFYA 3G73A 1H8AC 4P1WA 1QSSA 2VPLA 4DR6K 3AFHA 3HTSB 4WWCA 3CD6Q 2V9VA 2VYPA 3HRSA 3C12A 1Z6RA 3L3VA 3MO8A 4R79A 2RKIA 2EFOA 3AO3A 4C8QD 5B66C 2NOIA 4FQGA 3L2QA 4MZMA 2DMPA 2RVCA 5DM7F 4A5BA 4BG9A 2F2XA 4RA2A 1NH3A 4N4GA 3PT9A 1R5GA 3T9NA 4F16A 4KRFA 1R22A 2DI3A 1RADB 2SRCA 3SMSA 1RUNA 4JV5K 4YIRX 3CCST 1SKRA 4OVLA 1BG3A 3BQZA 5ED4A 4CHOA 1UFFA 2COBA 1ZR4A 1ORNA 1W5TA 1HSJA 3CMEA 3O9QA 2QYOA 5CVUA 4NQWB 3DLKA 1NYFA 4I7FA 3FK7A 3RZOJ 3DLLL 1YITQ 4HV5A 4M3YA 1J9IA 1L3UA 5FW9A 3EUKL 3SFZA 2V79A 3CCYA 2KDZA 2X1DA 4BGAA 2EYZA 3RPUD 2BH1A 2P84A 2MGQA 3H6EA 3FKIJ 1KHIA 4FE7A 4X1VA 3Q7CA 5KQ8A 1UDLA 3OHRA 1R0AA 1VOMA 4FYVB 1NU0A 2QW9A 2VGNA 3SUPA 4AFQC 1FWZA 1VNDA 3BTLA 3HL8A 1JXSA 2D45A 1H89C 1ZRDA 2DL8A 4J19A 2A08A 2WONA 3O4QA 3QEVA 4CUGA 5KPTA 2KK4A 1TK8A 3CQTA 4X9CA 1TAQA 1V1CA 2LY2A 3HSEA 4NQWA 3K7AJ 4CZLA 2DPPB 3KKRA 2NRZA 4QSHA 2ATQA 2UXNA 2MWPA 1NJXA 1FK9A 2HNHA 4AWXB 1UWBA 2D0QB 2RH2A 2EA2A 1F4KA 1F9NA 1KG7A 4FZYA 4MIMA 2EKHA 3GLLA 2O8DB 3WTZA 1J3TA 3M59A 1ZBHA 4XN3A 1JXBA 3A8LB 1WLPB 3CJRB 1TOVA 3HZJA 2CGPA 3M4GA 2ED0A 2PMZA 1TT0A 3C2GA 2Q0RA 1KG4A 4P9FA 3MEGA 1Y1WJ 5FLVA 2BV6A 3EFOB 4AM6A 1JEGA 1LV5A 3GDQA 4HBLA 3D5RC 2B63J 5K5QA 1VA7A 2E6NA 4Y17A 1R1UA 4II2A 4EMHA 3K5OA 4DIQA 3C7NB 5J1EA 1KG6A 2NYSA 3IWZA 1F1ZA 3HOYJ 1HQEA 1YNZA 4DTRA 3T3FA 1L3SA 2PZSA 2WA0A 5GAHJ 3A2FA 4EJWA 2FF4A 4AMCA 1A5WA 2HCKA 4JOMA 4MFEA 3SHWA 3SV3A 2BUPA 4BI3A 3QB0A 2O8DA 4UY8O 2Z2SB 3JSOA 5HCKA 3CYMA 2PJRB 4DSJA 3ONQA 5JLXA 2MCNA 2P0WA 4ISEA 5J1RA 4BYYA 3QEWA 2YHXA 2I5JA 1B07A 3EUHC 5HRRA 3PV8A 2FHDA 3IG1A 4H4KC 1C0UA 1GCQA 3CP2A 3EFOA 2K5CA 1VQMT 3TTDA 3M8FA 4BJ5C 4HYEA 4ZN3A 3DM2A 2IA0A 1WRJA 3C7NA 2CSOA 2J5PA 3TDZC 4KTWA 5AFUA 2GWKA 4RTXA 3Q0WA 2XPVA 2ZJRF 3U9ZA 3H1VX 3GX4X 2PX9A 1QP2A 3LP2A 4OKKA 4BKXA 2DFIA 3G6EA 2EPDA 5BRFA 4F7ZA 3OYJA 2PJRA 2LF7A 1MBKA 4AHVA 1G8XA 5CKHA 1NPPA 3URGA 2CZ7B 2OPRA 1SV5A 4A63B 1ATRA 4CH7A 1VSJA 3MCPA 4Z8AA 3FZKA 3WU2C 2OAZA 4PFPA 4HG2A 3QOPA 3GZ5A 3HTRA 5DV5A 3AVAA 2D5RA 4UUTA 2G7HA 2RJEA 2A41A 2F2EA 2CQQA 1HQCA 2IJLA 5JVGF 1I1JA 2UXXA 1H3ZA 4GGGA 4B4CA 5GTIC 2BTFA 1NK2P 2DMTA 3GP8A 3CCQQ 1LCUA 3RYPA 3B6OA 2PLYA 4NLCA 5CQXA 3AG3H 1KQSA 4CJ4A 3HDDA 3D1NI 3OSVA 5E3LA 1IO6A 2R92J 2GIVA 2CQNA 1IBKK 1X1BA 4FASD 2P9NB 1YUWA 4MO4A 2ROTA 3QU6A 2EJFA 4Z4CA 2VB6A 2HU9A 2E60A 2AJQA 3KP2A 2K79A 4BE0A 1ZGAA 3AA5X 2R7SA 4U7BA 4E1MA 1UHMA 1KD1U 3OW2P 1PWTA 3P38A 3BDLA 3ZSXA 2KQ2A 2JLEA 3R6OA 1TQPA 4XMYA 4CEBA 3MN9A 2CJJA 2RPNA 5KAIC 3KFWX 1LFUP 2KHMA 2NOBA 2E3HA 4ZNXA 2KIFA 4JZ4A 1JI8A 4FT8A 1DKGD 3K0LA 4A12A 5D6XA 3E1SA 4L8RB 5F1JA 3UKGA 4FHTA 2HVRA 1I1GA 3ZXSA 1X1DA 1BN5A 3QJYA 2ECCA 3J81K 4FWSA 1M3AA 4JQFA 1XI1A 4ZDOA 4C0DC 4L6V5 3BE3A 2FEIA 2P9NA 3LSRA 2DE0X 3CCVQ 1MMNA 3HG9A 2QWPA 3DBLB 1PCXA 1U2WA 4CFBA 1L5UA 3CC4N 2KFZA 4CCLA 1XDSA 3G3ZA 2YS9A 4CGJA 2YKMA 3TO6A 4RAZA 2HTSA 3MKDA 2LY1A 3V8LA 4HEA2 1HMVA 3VJPA 1R0BG 2XAGA 4AH9A 3ITHA 2ZZDA 2YUSA 2L4MA 2YG8A 2CH6A 3NH2A 3SLCA 3QIPA 4NC7A 3G25A 3V4GA 3DAWA 2LF8A 1XC9A 2W10A 3PNTA 4CEZA 1HJDA 1G2BA 3FM5A 2CUDA 1IXCA 3CC7A 3CCLA 2JXBA 2RD1A 4J2DA 4RGXA 1LPLA 1NGCA 2QZ8A 3H08A 1G5VA 4KA4A 2QEXN 2F8TA 2M51A 2X6WA 5BRHA 2DOEA 2QDLA 4ZYDA 3VA3A 3MJXA 3CQYA 4FLTA 3A5MC 4A3IJ 2WAQA 2E2JJ 2B9SA 4KBOA 4JP0A 4M72A 1ODDA 1LOTB 1RDWX 5GANj 3O8HA 4O0IA 4ZTFA 3DKWA 2O01E 1MBEA 4RW8A 4BD3A 3WNFA 2GNCA 3CCEI 1I8FA 1RTDA 3R6MA 4O55A 5ICGA 1TUUA 3AL0C 1NE8A 4JK9A 1VQLN 2JUGA 1LVKA 4U0VA 1U47A 3ZQIA 2KPMA 2VG5A 1UEBA 1R9TJ 4GV9A 4PK4A 1JBMA 1J5EK 3OS1A 2ZJQL 4ZYGA 3H1QA 1IZ1A 3JXUA 2JTFA 5JICA 4Z4IA 2KLOA 4YY3K 2ZJPF 4LF5K 4EM2A 2FPDA 1S1VA 1VQ8I 1OU9A 1YXQA 3HK2A 2M0CA 2F5EA 4RW4A 2GBQA 3FLCO 1LAWA 3L2CA 2VPRA 3RESA 3CMET 4WE1A 3VQ5A 3CF5F 1ZRFA 1VQPN 2K9MA 2VOOA 1EETA 5DLOA 1TGOA 5D5WB 3O3HA 1WXTA 3C65A 4CDGA 3OIOA 4ELTA 4LUEA 3IRRA 1GLLO 5K5OA 1SANA 3KP3A 2RHIA 3RMQA 1ZHFA 3F0ZA 3CF2A 3P9CA 4M78G 3KETA 4NL2A 1OVQA 3FJ5A 4XK4A 4O8UA 2GF7A 3VEOA 4E9HA 4U88A 4B21A 1YIJA 2LMJA 2QGGA 1M27C 1KONA 3QP6A 2UU9K 4B3RK 3ZSQA 1YQMA 4M3GA 4XTWA 3ULDA 4DTPA 1TKXA 2VXEA 3AVBA 3JSPA 2MBFA 3WQUA 4PA1A 2KBTA 3JCMV 2JZYA 3TO7A 4M75E 3TAGA 1IN5A 3D0SA 1VQMQ 4G6TB 5KYXB 1C0FA 1VQLI 1YJNN 4BC3A 1UOCA 3DWLE 4BHCA 5JS2A 1Q8IA 1WCMJ 1WFWA 3GTOJ 1IXSB 3DP7A 3IC7A 3ENBA 2L54A 2E1NA 3M58A 1GDTA 2OTLI 1NEBA 4AYBA 4X65K 2BEOA 3PIPF 3MECA 3UA6A 1VSDA 4ZYAA 2AHQA 3QDKA 4MQ9F 2DT6A 2Q2RA 1IC8A 4M41A 2QSHX 1NKUA 3WHBA 1RI9A 1KD1R 1WHGA 1FYNA 3CHWA 3LAPA 2G7UA 4M78D 4XKVA 2K9GA 5FGMA 4O0JA 1YLFA 4RB0A 1XN7A 5F04A 5KYXA 4HPQA 5L8RE 4DUYK 1UGPB 1N27A 2CZ0B 1TYQA 4M7AC 2I5WA 1AWXA 3E01A 4FOEA 3ZX2A 2HDAA 3T0YA 1R8OB 3RWUA 3P5JA 3GE1A 1NJIC 3FXJA 4HSBA 1J53A 5CZ1A 1N9SA 3GEZA 2L9RA 5GAN7 1I4K1 3ZMVA 3MWPA 2IGMA 3M8EA 5AQYA 3EKUA 4D8DA 1ASWA 1O75A 1IN4A 3RKQA 1R71A 2P5OA 3GVAA 2IBDA 3KTQA 4A3DJ 2QWNA 1VQ4Q 1HJOA 3G1MA 2IS1A 2JTVA 4U7DA 1WJFA 4C2MJ 1LE8B 4LY7A 3G6ET 1K9MC 4H4MA 4KFBA 5LJ3g 3MEWA 2Y0SA 2XASA 3QSUA 4CRIA 1QQCA 3FZLA 5C2DA 4FJKA 2EQIA 1YJ9Q 1IAWA 2MYSA 4DV1K 4RDUA 2XIDA 3BWGA 1QE1A 4XLFA 3TO9A 2QAZA 3QBXA 3DLGA 3OA6A 1D9FA 5CQYA 4DSKA 3JCMX 2BUDA 3LWFA 3ZBDA 1WHMA 3LP0A 2L9SA 3F21A 2BZ8A 1E6GA 2DK3A 2DXUA 3QODA 5M1PA 2GQVA 2YLBA 3O3KA 4AHSA 3DI6A 3MEVA 2MD0A 5FD6A 5KN9A 3VTHA 4OMMA 4FCYA 4Z6YA 1E4GT 3NHNA 1TUYA 3CPWP 1LE8A 4CO8A 3HFOA 3CPWM 1MUNA 2BY2A 4D0PA 1QCOA 1BC8C 2RE2A 4PJNA 3WNEA 1WJSA 4CEFA 4XH5A 4IUTA 3MP6A 2HNYA 4XH4A 3UKUB 4CSWA 4IUQA 4OVAA 3PSIA 4GLKA 4BGDA 2O31A 2M4KA 5HL7L 3I59B 4Y15A 2NWMA 4XTVA 5A2QZ 3SMPA 3BR6A 3L4QA 2DCEA 3NVKA 4BRFA 4C3JJ 3PNVA 5J1UA 3K59A 2AO9A 2DM1A 5IXBA 2CFXA 2WB1A 4BRAA 3D2FB 5BOXA 2YRDA 5C24A 1XGOA 2GAUA 2RPIA 1QVGM 3ZX0A 1R00A 4CFAA 3HT3A 3IQLA 1BI3A 5LJ3e 4M3EA 3VB2A 4CZIA 2YPRA 4EJUA 3B6PA 3CCRA 4FZZA 1BI4B 5GIOA 2CP0A 3G0QA 4IHVA 4FSVA 3F73A 2FJ1A 3E6MA 1KG1A 3I59A 5BN8A 3EE9A 3K1PA 2EQUA 2NRWA 1GXPA 3FXUA 3CMEQ 3ZOBA 1R58A 2D9TA 1OX8A 1CXQA 4DBFA 4DV5K 4FL9A 4F04B 3CLOA 3CMAN 1Q82C 2OD5A 5LGNA 4CJ5A 3D2FA 2R7RA 3D4VA 2DT5A 3EKSA 3FBNB 3TREA 4Z0UA 4BY7J 1DGWY 4BH9A 2EPFA 3CCLT 4V2FA 4WQ5C 5AQJA 2LKXA 2JT4A 1JXOA 1WJAA 2G8HA 2MG4A 4FW1A 3ML6A 1NG7A 2ZSIB 1BKBA 2G8WA 3FEOA 2JA6J 1JRIA 1JKQC 2E6ZA 3IKTA 3LSPA 1E3HA 3CM5A 3UDCA 2K3XA 4OMLA 1BI4A 5J39A 1XHXA 5C25A 1QW1A 2W85A 4XOPA 4UOBA 4BY6C 3NGYA 2NVUB 4XICA 2V7FA 2EYXA 5GAMg 2OZUA 1SMYF 5BPNA 5H6RA 2DJIA 4FK2A 4MZPA 4M42A 4WCGA 3TDUC 3KLOA 2XF7A 5DPKA 1K73C 4MO5A 2EBIA 1X1AA 2DOFA 1Z9CA 2C6YA 3N4MA 3FBIB 3HM5A 2KROA 1Z1DA 4B23A 4FJ7A 1OLTA 5D4RA 1DP7P 5GINA 1B8IB 1S9HA 2YRVA 5GAOp 2EKOA 1KVBA 4CEOA 3CD6I 3QG1A 4PJOC 3X28B 4ZJZA 4L9VA 2CV1A 5A0DA 1P90A 1QSLA 2HW3A 4W5TA 2R93J 2E5KA 3AVIA 3LL7A 1IREB 2CT3A 3M0TA 4N0AC 2P9SB 4IUPA 3P31A 3T1YK 3THXB 5AQKA 3I56A 1FT9A 2WSCE 1OKJA 4CF8A 2NUPA 1OU8A 3ZT4A 1OKRA 4IO8A 2O8XA 3HI0A 1SKSA 1Y0NA 2LT4A 1AVZC 1RBTA 5LJ3d 4I2OA 1Z05A 3G71A 3MEDA 1WQ7A 3EQLF 1RT6A 4KYWA 3SFMA 3HL2A 3KEQA 3GL1A 1ZG5A 2ZNZA 5DY9A 1LWEA 1OCZH 1R5HA 1B8IA 1YIJT 1AWWA 5KRSA 1IRGA 4EVVA 4B9LA 2VKVA 1ON2A 1V4TA 4FLUA 1YITI 4M3UA 1YI2A 3K1MA 2K9LA 3LW5E 2GUIA 1OZ3A 3JAME 3QZ5B 2Z33A 4KKOA 3O3GA 3O1BA 4J2AA 2P9SA 3THXA 1TSFA 1TT5B 4NHJA 3VETA 1DGRM 1VFCA 2RHUA 1XMXA 2DTHA 3WU0A 2DVEA 2EB7A 2Y75A 3GF5A 5CLSA 5CVIA 1XGMA 3SJHA 1BOBA 4XLHA 1H3HA 2IA1A 5IHKA 4FJGA 1JJ2P 2O9SA 3G6EQ 3TARA 1M1KC 1RIOH 3ASMA 3FF5A 1YWPA 1RDUA 3OVNA 1MJAA 4C8KA 1RAEB 2E2QA 4RS8A 1NLOC 4BACA 3DLHA 3SEMA 3ZMTA 5AIPA 5M3FJ 3O8MA 3IH2A 2H27A 3L2UA 3VSKA 3VGMA 3AO1A 4E7SA 4YOTA 5E1XA 1UAXA 4EW0A 1QHTA 2ZXJA 2Z0WA 2H6CA 1D1BA 2EFPA 3KP7A 1R77A 1GFCA 1FEXA 1KG5A 4PDKA 1G2HA 1Q7YC 3I0RA 3K4JA 3AY9A 5E1WA 4CCMA 2ENMA 3ELKA 2ECBA 3C0BA 1NKCA 2IA2A 1OVYA 5ELZA 4PJ0C 4CI6A 4CVNE 5IT3A 3SYTA 2KAFA 3EG0A 3ZCMA 3G0ZA 2HBMA 2E1CA 4LJZF 2YJEA 2RNAA 4HVWA 4QT7A 1TBXA 4AUXA 1KEAA 4BE1A 4C92E 1VQOT 1ITYA 4BEHB 1ASUA 4CZGA 5KK1A 4B1UB 3RERA 1W2BP 1K6OA 2NS8A 2XF5A 1KU9A 2IT0A 2I5UA 2DA6A 3ENHA 1A6QA 4C8QF 4A57A 5C4XJ 1UMQA 3IMXA 2O8EB 1AD5A 2KXCA 1Z67A 1EXQA 4M7AG 4HXJA 2HMPA 2QXFA 1FX7A 2HMAA 4A69C 1HW2A 1UE9A 1R1VA 5GAMd 1J2XA 1ITGA 1Y71A 3V1OA 2E7XA 2KQWA 4BEHA 3BJ6A 4IDHA 1X43A 3M0UA 4KB1A 5SZTA 4BL0B 4A3EJ 2Y9ZA 4FOIA 4BI8B 4XORA 4PJLA 3H6ZA 2XV4S 2F4MB 2CW7A 2HHSA 2VUBA 3KE2A 2P4RA 1WB9A 2BGCA 1FBSA 3CXCS 5AQPA 1ETOA 2VUMJ 5LLQA 5T7BA 3NRVA 2LC4A 1JCEA 2ZO4A 3CC7Q 3CCLQ 8ATCB 2O8EA 4Z89A 3ZQLA 4HKEA 3CCQI 4IEEA 2R7DA 1KO9A 1IHWA 1HYVA 5AQIA 1F43A 1U78A 4A3BJ 4CJRA 1KQ1A 2FF6A 3W2WA 4IX7A 2MMPA 4BQOA 1QU3A 2G8IA 1O4XA 2HAXA 1XMOK 3LWLA 4YFNF 3MAJA 2CQXA 4PL8A 4M7AD 3BPVA 1FYMA 4K25A 3LM9A 3AVJA 2VV5A 1SD7A 4BRHA 3FR0A 3DEUA 4KULA 4J9IA 1H9TA 2UYTA 5AQVA 2DPNA 4M78B 4HW0A 1IV8A 4FVMA 2OCEA 3L1AA 2NAZA 1FMWA 2E2PA 1Y8RB 1O13A 2A6TA 3BGRA 3E5UA 2WAFA 4XRSG 2L3DA 1N8RU 4J7FA 2LBFB 4JNEA 3M54A 3LSHA 1SL1A 4Y91A 2E10A 2QUFA 4JKCA 2E34A 2G8FA 1T03A 2KZVA 1ZGWA 1TS9A 3R0JA 4Q5WA 4A2UA 1JLFA 3CCVI 4FZXC 4JX4A 3RYRA 3WT0A 3WTVC 1SC7A 4QCLA 3ASKA 4IQJA 3AVNA 5GMKm 4B8CA 5AQZA 5GAHP 1HK9A 2OC6A 1MBJA 2FBVA 4FWQA 3LGLA 1JUPA 3OIQA 2OQRA 1YHQN 4A5NA 4R1HA 4KTQA 2JT1A 3SEZA 1WHUA 4F7UF 4M78A 2GX9A 3MKYB 4DQ8A 2JPBA 2LCSA 3X24B 3IHUA 4HRIA 1YIJQ 2CUZA 2NOHA 3ABMH 3SFIA 3R3LA 2LBFA 2HSEB 2DFEA 3FXOA 2OX7A 1MUYA 2I0NA 3E9FA 3VESA 4BAYA 1U9NA 3TU4K 2VWKA 3QNOA 3OL3A 4EGZA 5EZHA 3S3OA 1OCOH 3VQ7A 3QWXX 1MA9B 4CXFA 4W97A 5E79C 1Z0XA 1PVSA 2K5IA 5LJ3j 3TVTA 3R4KA 3C6HA 3HO1A 1PD1A 5GTHC 2YXYA 1J9AA 2PI0A 2L7ZA 3W2AA 3WXKA 2E4HA 5C6SA 1DP3A 1ZA2B 2WACA 1CZAN 2EH3A 2DFUA 4OPAA 3MEEA 2K7LA 1H641 4ENKA 5CR4A 2BW3B 1P7JA 1HKSA 2RI5A 3ZQQA 3QUIA 3WGHA 4KV8A 1JTYA 2DXIA 3J7ZO 2WV0A 1FP1D 2CREA 5J1YA 2KKZA 1HNIA 1EF4A 1FKPA 3MAQA 2UZKA 1K0XA 1S6LA 4N9HA 1PRMC 4CJPA 2K6DA 4DQSA 2DOAA 3G7ZA 3G71T 4LXCA 4C5HA 2DODA 4X0GA 3ZMUA 3LAMA 2O8FB 2IGOA 1X01A 4L5EA 1FOWA 3Q9VA 4RB3C 1DU6A 4I01A 2LQWA 1PSEA 3MPUB 3U9DA 3T1HK 2QGUA 3O4WA 3WVEB 3R6SA 2Z1IA 3B8AX 2V51B 2BW3A 5A2QO 2G3RA 4UVCA 1UGRB 4FJHA 1HCRA 2K3BA 4VUBA 4OOIA 2PAVA 1X6BA 2HDCA 1T39A 2ITGA 4S05A 1CQTA 4C2UA 2YKNA 4LC9B 2EFIA 4P55A 2Q8KA 4DTNA 4M7DG 3M56A 1GLEG 2O8FA 3EYIA 4B09A 5D5XB 2QVOA 4GDFA 4AVZA 1LWFA 1IW7F 2CV0A 2V8IA 3MN2A 3CG7A 1I5ZA 3GLXA 1VQMI 4IURA 2P1JA 2E2NA 1YRNB 2P4TA 3WGGA 2FG0A 2KIMA 3VUBA 5GAOn 5M5XJ 4X9DA 1Y64A 5HRNA 3U1DA 2LG4A 4ORZA 2FC0A 1ZBLA 1K78B 1BIAA 4Y13A 1W36C 3QPTA 2Z16A 2XO7A 1TQIA 2D0NA 1IDYA 1SFEA 2OZSA 1KQ9A 4A3KJ 1OOTA 4RTWA 1UGQB 2YUOA 3CCJN 1KD1O 3NF8A 4RGRA 3LPUA 1OI1A 5AQWA 4PLLA 2EFQA 5KH6A 3CDIA 3X2QH 3ZL7C 2P9KB 2KRHA 4B9QA 3ULRB 2DA7A 4XLCA 1QQOA 1Q86U 4PJOD 2I7NA 1L0OC 3VS0A 4BRNA 4BR7A 3PO5A 2K3YA 1YRNA 4OMQA 4CC2A 1WJEA 1K8KB 1T6CA 4CJ7A 1S8NA 4UV9A 3WUHA 3OOUA 1T8IA 2LKSA 4IRIA 3AVMA 1QNTA 4M7DD 2FBHA 3DPLC 3N0UA 3CC4A 3DQVC 3A0BC 2HBWA 1JT0A 2KVQG 1K78A 1N8RR 2PN6A 3J7AY 4J9EA 1T2KA 3CPEA 2X4YA 3E2UA 1VQ7N 3QYGB 1MV3A 1HXDA 3VQAA 1BW6A 2EGEA 3FE1A 1GCPA 3QYBA 1XHZA 3M1FA 2DX1A 1OCCH 1WJCA 4CIGA 4B1WB 2HHHK 4L9JA 2GEMA 2KISA 1HSQA 3IV5A 2H3GX 2P9KA 2P51A 1X19A 3JRDA 2DK5A 2GBZA 3D7SB 1ZBFA 4E89A 2PU9B 1VQ4I 4OJRA 1T95A 5CY4A 4F17A 3PIOA 2XKOA 4CYCB 2NRRA 2NUTB 3E6CC 3CCRQ 1WZOA 3CTAA 3DXJF 1K8KA 3VYRB 3UIQA 5HLTA 1TXQA 2QEXA 1M2VB 1U5TC 1R0CB 3HSTB 1T56A 4BVPA 2F9TA 4YNQA 5KGXA 4IUUA 1JQQA 1YJ9I 5A0GA 5LD2C 1WHKA 1ESVA 5EEAA 3ZP5A 4CZEA 5LJWA 4A3MJ 3MXMA 4ZGJB 3KXTA 3L2VA 3O6BB 4LF7K 2MLKA 2Q0OA 2HVIA 4HLXA 2AXLA 1YQKA 1DEJA 3EFSA 4OLBA 2OUMA 3L2ZA 2H8HA 4OB1B 2O8CB 3ME9A 4MQ3A 1S72A 2ZPFB 4B9XA 2DZ9A 4KHWA 1C0TA 3CZ6A 4B24A 4IHTA 4CYCA 2NUTA 4LFAK 5IOZA 4HCZA 4I76A 4M6XA 1M2VA 3KVGA 2QLZA 4WQ4A 3ZETB 2E35A 5JVHL 1I6XA 3DF8A 1VQ5N 2R57A 5LBQA 2A3SA 1VQPA 3JAMK 2K9SA 3P8DA 1H1VA 3K58A 1CGPA 3EGUA 2HQ5A 4P5NA 4IO9L 2GUPA 2DTZA 1DTTA 4YPRA 1Z3YA 3OW2A 4ESJA 2CGKA 1KQSP 1O7LA 4V2GA 1KQSM 4BR4A 4FM0A 1OH6A 3ZQFA 1QGPA 2O8CA 3AL0B 2ZKZA 4HT9A 4QVCA 1X2QA 3ZT2A 4AIAA 1ZSZC 1F36A 4P96A 2ZSHB 1W7PD 4NB5A 2JK3A 3L4IA 1SFUA 1H0MA 3I56Q 1RBSA 3LH5A 3ZETA 5GAN8 3R2XC 2YX6A 4B43A 1KSPA 3LFKA 3NH0A 3P39A 1XQPA 4O5VA 2PVOB 3R9PA 3G71Q 3H3OB 2PMZN 3BY5A 2F48A 1YJNA 5AZJB 1YTYA 3CMEI 4ENNA 1ZBUA 4CZKA 2H56A 2YU9J 1P7MA 4IL6C 1T0FC 2BY0A 1WOQA 1YI2Q 2GLOA 1S7OA 2FZGB 5EY4A 3LFUA 2M2EA 3FIFA 2QTDA 2NRTA 5C4JJ 2DT7B 4KGZB 4IZZA 2UV1A 3ERED 3AGKA 3FZVA 2WADA 2O0YA 1HNZK 4C9YA 4BDYA 3W2VA 2OTJN 3IS9A 2SEMA 3E3VA 2ZPIB 1YBYA 3V81A 5HLHA 4O6JA 4LD6A 3QRFF 1H92A 1Z7UA 1FTZA 4K8ZA 2X6SA 4XH1A 3VQEA 5AZJA 2M1BA 5I2MA 2B5JA 3O2PE 5M1QA 2DAQA 2KKOA 3A1YA 3TOAA 3TW6A 2M16A 4FLYA 3H0FA 5H2FC 4MMKA 2P8TA 3RIRA 3L09A 3TTCA 3EE8A 4R0KA 3MN7A 1NK8A 2M7BA 1Q86R 4HQMA 1RTJA 3FXKA 4N4NB 1QRYA 1GVDA 4EM1A 1OCTC 3KZIC 3JREA 4MLHA 2O88A 3W6KB 2FNAA 1VZ0A 1HOMA 3QO9A 3AAQA 4B9MA 1HBXG 3ZN0A 4AI4A 3REBB 2ZXHA 2YU3A 1QQNA 2TDXA 3BUZB 4B1ZA 1FIPA 2EV5A 2K2MA 2HHVA 2DTOA 2HB5A 3NNQA 3SQNA 3BG6A 5HDKA 4FLXA 4KMFA 3BR3A 3PVLA 1OZ2A 1XQOA 1Z6TA 2V26A 2IGKA 4KO0A 1VQ6N 3H41A 5CKTA 1KG2A 2VKEA 1RNLA 4E7HA 3KBGA 4B1VA 1FMKA 5M3MJ 4M7AB 4FPAA 5KGWA 3ABLH 3RTVA 3DTEA 1G59A 5D6WA 4CGGA 3JCUC 2FB7A 1FYLA 4IOCF 1PU6A 2DTRA 2HMIA 4RLFA 1K76A 4HVUA 4KIFA 3HC7A 4G7OF 3E9GA 3JRBA 4F2RA 5KHDA 2OTJI 1P59A 3PO4A 2MABA 4BR2A 1WNSA 3OTOK 1OULA 4N4HA 4FX4A 1X3NA 4RLQA 2XAHA 2RB6A 1NK7A 4DSLA 3L8BA 1CZ9A 1TVRA 1ETYA 4HUEA 2QKBA 2D1HA 4LUDA 2BXZA 3HSRA 2XAQA 2KJCA 3WXMB 2OF7A 5CVJA 4M7AA 3SEQA 1TL1A 1JXMA 4K41A 1VI0A 1VHXA 1D8KA 1Q81U 4CZFA 2O4XB 2B6AA 3QAHA 1WBBA 1T3SA 2VC0A 2DYSH 3BDDA 1D5YA 3S17J 3RMBA 3KYDB 4NXNK 3I71A 4XTXA