3L2RA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2rA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2rA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2rA03
3LWLA 3RRHA 4CK2A 3BDPA 4HCCA 4HCZA 1GOBA 2IS3A 4DQRA 1CXUA 3BGRA 1LV5A 2IAJA 4JLHA 2F8TA 3VQBA 3CEYA 1NK0A 4CIGA 3FFIA 3LP3A 1QE1A 4NCBA 1UA1A 4E19A 1B92A 1S5JA 4FJXA 1TKXA 1GOAA 1VSMA 4HUEA 3SQ2A 3NTHA 3KKSA 4IG0A 3IS9A 4B08A 3V81A 3MO8A 1TKTA 2VWJA 3AVHA 4E7IA 4O55A 4DTXA 1VSKA 4G1QA 5CYMA 2DIGA 4QQ6A 4W5TA 3AO4A 4A4EA 1Q9YA 3AVIA 2YHBA 4BE0A 3SI6A 3MEUA 3QESA 4KB0A 3CG7A 1SL2A 4ID5A 1D5AA 3SQ4A 1Z26A 4CEBA 4ZTJA 2XO7A 3O3GA 1N27A 3IG1A 3ZSVA 1BIZA 4DG1A 2JGUA 1BISA 1BIUA 4RG8A 3OA6A 1VSJA 4DTUA 2G8WA 1CXQA 4EZ9A 4I2QA 1HJRA 3P8HA 3RWUA 1WAJA 2HVIA 3LWMA 1WSIA 2D9TA 3HSTB 3C4SA 3ZSWA 4HUGA 3QNOA 3AVAA 1WN7A 4J2EA 1YVUA 4Y1DA 3VQ6A 4UQGA 3RR8A 1XC9A 1A5VA 4QOZB 3SD4A 1Y97A 4CF9A 1ZBLA 1VSLA 1TKZA 2DFFA 3RMBA 4BDZA 2RJEA 3VQEA 4QAGA 1L3SA 3DLKA 3NF9A 4Z4HA 1VK0A 1HNVA 3K5OA 2W42A 2RI5A 2B5JA 1UWBA 3V1RA 3LYIA 1HQUA 1NK8A 4KHSA 3L2QA 5HRRA 4AH9A 1HYZA 1WJSA 3KLGA 1OZ3A 2JTFA 4DS5A 3THVA 2ATQA 4BACA 3M8QA 3I8DA 3QIPA 4CE9A 4CIFA 4MQ3A 3MXMA 3AA3A 1RBSA 2BUDA 3S9HA 5D6WA 4CIEA 4N76A 3O3HA 2K3XA 2PYLA 2HHVA 4BDPA 4KHNA 4DF8A 2WACA 2O4GA 3TAEA 1A5XA 3CYMA 4M3TA 5FRNA 2FBYA 4B8CA 1BI4A 5J2PA 4OLBA 1BCOA 4CJWA 1UOCA 1RCHA 3NBPA 3KUFA 1KRPA 1SSFA 1ASUA 4DQQA 2HHTA 1U4BA 4CESA 4ID1A 4BWMA 3PO5A 1QSYA 4DSFA 3AA4A 1GOCA 4H8KA 3RMAA 1RT7A 4BE2A 3FEOA 1QS4A 4KHYA 5C42A 1NJWA 3SUNA 4E89A 2QKKA 2XDPA 2RJDA 4KO0A 4AHRA 5D6XA 3QETA 3L2VA 5FRMA 3L2UA 3HPHA 2EHGA 1H3ZA 4UC4A 1JXBA 4CGIA 2I5JA 4C8NA 3AVJA 4KTZA 2DTUA 1S1WA 4C8OA 3OVNA 4C8LA 2BKDN 3MAQA 3ZT2A 3DLGA 1HYSA 1JLQA 3AVNA 2HNDA 5KGWA 3MEAA 2FBVA 4FLYA 4CEFA 1VSFA 4OGCA 3NHGA 1U47A 4CHYA 1JL1A 4F3TA 4BD3A 3I0RA 1ZBFA 3DOKA 1RT5A 4CJEA 3QKJA 4FU6A 3D45A 2VG7A 5KGXA 4CF0A 4LSNA 3OB9A 4FJGA 4CJPA 4DLEA 4LSLA 4M3ZA 4CECA 3M9QA 2ITGA 4F8RA 3K59A 1KLNA 2D0BA 1ZBHA 1Q9XA 3NAEA 1I3AA 2PZSA 3EAEA 4DU4A 4AHSA 4HCBA 4BWJA 4CEQA 1RDDA 4DTRA 4DWIA 2KZZA 3KK2A 4E7JA 2FC0A 4KKOA 1HRHA 2GFUA 4CGHA 1T8EA 4FZZA 4ELUA 4O5BA 4Y1CA 3QEPA 1S1UA 4OPJA 1ZYQA 2L3RA 2PY5A 2VYTA 2EKOA 3HL8A 1NJXA 4LH4A 4N4IA 4YFUA 4WE1A 3DMJA 4CFBA 1LW2A 2YNHA 2O4XB 2K3YA 1RBVA 3KIOA 2RHIA 3KLEA 3LPTA 1U48A 1HPZA 4AHVA 4B9XA 2OPPA 4DFMA 4OVAA 4DSKA 2HNYA 3TABA 3CFPA 1KFSA 3OYNA 2E4LA 2XY7A 1QSSA 1S1TA 3IRXA 3H8ZA 1G5VA 3M8RA 1O1WA 2IOCA 4CJ4A 3HPOA 3U6FA 2RPIA 1T7PA 4BDYA 3OS1A 3P83D 4OJRA 1SKWA 4W5OA 4F3OA 2RO0A 2B6AA 3ZSXA 5KTQA 2YRVA 3UT1A 4JS4A 3ASMA 3VN5A 1TK8A 4DU1A 3AVMA 1REVA 3KTQA 3O8VA 2P0KA 1U04A 3CFOA 4X34A 1XHZA 3DB4A 4EDUA 1QSLA 3DB3A 3RMDA 1MHNA 1IKYA 2L89A 2ZQBA 4O0IA 1KHCA 4CJSA 2EQJA 1RDAA 4E0DA 4C5EA 3ZSZA 3ULDA 1FKOA 3LALA 1C0UA 4EP4A 4KFBA 3FDRA 3V4IA 4FJHA 4AHUA 2AJQA 2MWOA 4B3OA 1WSJA 2RHZA 2HNZA 4IUUA 2A1SA 1YTUA 2F5KA 4E7KA 1DTQA 4ZHRA 1TK0A 2G3RA 3ISNC 2DIQA 3ZT3A 2EQKA 2YNFA 2OPRA 1K6YA 3QEXA 5J2MA 3DLMA 3C94A 3LLRA 5T7BA 2RKIA 1U49A 4M3UA 2X4YA 3SCXA 4PL6A 2E6LA 5KRSA 2PQWA 5KI6A 1BQNA 4YNQA 5FDLA 2LDMA 3OYKA 4IKFA 4RW9A 3HVTA 2GFAA 1IG9A 2X6SA 3VQCA 4IFVA 4FM0A 4DSJA 4N56A 4Z4IA 5KE3A 4CEAA 1WSFA 4OLAA 4FZXC 1SKRA 2QK9A 1RI0A 4IURA 4KAZA 4N5SA 2R5MA 3V9XA 3FC3A 5HRNA 4OKKA 4RW4A 2P5OA 4FYDA 3MEDA 3SNNA 5D3GA 1EKEA 2FBTA 4DTJA 2LVMA 4GMJB 4M42A 5HROA 3LPUA 1SV5A 4CFDA 3P1GA 4O0JA 3CM6A 4CFAA 4Q0BA 5K14A 4ZTFA 3VQQA 4FW1A 4C8MA 3QEWA 3JSMA 4PY5A 2KZMA 2HHUA 1J54A 3DOLA 3ASKA 3EZ5A 4OVLA 3VQAA 4MFBA 4CFCA 3NH1A 2HQEA 3PV8A 1J53A 1S6QA 2XY5A 3L3UA 1JLBA 3F9KA 2LSNA 1G15A 4EP5A 3T1AA 3VQDA 2LRQA 1RTHA 3KK1A 3O4QA 3QIIA 3TANA 1RT3A 4LY7A 3LGFA 3IAYA 2Z1GA 1TVRA 1NK5A 1WSEA 4KTWA 2D0AA 2ETJA 3AVBA 1XNIA 1VRTA 2M16A 5KRTA 4FK4A 3HM9A 5IN1A 2GF7A 1L5UA 3OYMA 1JXEA 4HUFA 4AILC 4FLUA 2O4XA 1WJQA 3WNHA 4FCYA 2Z1HA 1IKWA 2XY8A 3V9WA 4N47A 3AO2A 3VQ7A 3VQ8A 2G8VA 5KCHA 2EQMA 1JLCA 4CHPA 1TKDA 3ZSRA 2HW3A 1B9DA 5DMRA 4CCHA 3VA0A 3MXJA 1JLEA 3NH0A 3OMGA 2CKKA 1RNHA 3AA2A 3K5NA 2EQUA 3RRGA 4RG2A 4DTSA 4CJTA 4LD0A 4H4MA 3VQ9A 4CRIA 1NK7A 3OYIA 2D0CA 1RDCA 1HQEA 3HYFA 5CYQA 1EP4A 4HVJA 1S9GA 4A4GA 1LW0A 4IUTA 3V1QA 3QO9A 3L2RA 3S3MA 4A4FA 2G8HA 3LZIA 1D8YA 4KTQA 1W9HA 3P5JA 4IG3A 4DFPA 5HRPA 4FL6A 2DY4A 3TARA 2YKNA 3AVCA 1D9DA 3AVKA 3K58A 1TK5A 2RHYA 4FJJA 4E7LA 2XRIA 4DFKA 4TSXA 3DI6A 3U3YA 3L42A 4KI4A 4FJ5A 3PFSA 1LAVA 4EZ6A 2RHUA 3TR8A 2G8FA 3QNNA 3TI0A 1NKBA 1KSPA 4DSEA 3AVFA 3EYZA 4E7HA 4I9QA 3LAKA 1I39A 1CZBA 1RTDA 2Y1IA 3TAMA 4IDKA 1LAWA 3O4NA 4CJUA 3HPGA 4B9WA 2G8KA 4KI6A 2KFZA 3SUQA 4LD6A 3TAQA 4FJNA 4Q5WA 4NZGA 1S1XA 4DTOA 2X35A 3E9GA 2Q3SA 1BL3A 2O4IA 2LTOA 4M3RA 5J2NA 4F4KA 1VSDA 5EU7A 1RBUA 2D5RA 1OYXA 2P5GA 3ME9A 4CJLA 4J2BA 4CHZA 1U45A 2X4WA 3H08A 2X4XA 4NYFA 2IGIA 3L3VA 3T3FA 4AHTA 1JLAA 4CJ3A 4AHCA 1XWLA 3EY1A 4QQGA 3AVLA 4M3YA 4JRPA 2HMIA 1A5WA 4B9NA 2QKBA 3LX7A 5KE2A 1SL0A 2OPQA 4FLZA 3META 3NGZA 1VSHA 4DLGA 1SUQA 2XY6A 3Q1JA 3V9SA 1BGXT 3L8BA 3NGYA 4PA1A 4CGFA 3HK2A 4KREA 1TAUA 3SUOA 3VQPA 4N4HA 1JLGA 2DFHA 1FXXA 4PWDA 3NF8A 2Y1JA 4O4GA 1B9FA 3OYDA 4HTUA 3LANA 3MECA 2L8DA 3AO3A 1QQCA 4Z4GA 4CGGA 4GW6A 3SPZA 3DRSA 2HHQA 2PYJA 3I0SA 4NCAA 4KV8A 3LP1A 4O44A 5SZTA 4Z4EA 1WGSA 3C6TA 4OKEA 4F2SA 4RW8A 4CEEA 2BANA 2OZMA 3OYGA 5J1EA 1S6PA 4RW6A 4KHWA 4OGEA 3LGLA 4FLTA 1RT2A 3NGIA 2HHSA 4K8XA 4FLWA 4NYNA 1RT4A 4CJFA 2FHDA 3H6ZA 4I7FA 2RF2A 2FBXA 1ASWA 1NK9A 3ZT4A 3PX6A 1NOZA 3OY9A 4L59A 4FJ8A 1C1BA 3K5MA 3SUPA 3SQ0A 4B9UA 3RTVA 3MEVA 2HQXA 2Z1IA 4FM1A 2VG6A 3VA3A 2MWPA 4FLXA 3K5LA 4DU3A 3AO5A 3OYJA 1KTQA 3MXIA 2XK0A 3OYEA 1KCFA 4DQSA 1RTJA 1JKHA 4CJVA 1UA0A 4CK1A 3SV4A 4RW7A 5J39A 3LDSA 4Z0UA 4FJKA 3MEWA 2F96A 1XI1A 1NKEA 1NKCA 4Q5VA 1KVCA 2X78A 3S6WA 1CLQA 1TL3A 4XIUA 3SZ2A 1KVAA 1WLJA 5KH6A 4CEOA 1ZBIA 4J2AA 2RI2A 4M45A 2BE2A 3MEGA 3SYZA 3OMCA 2KTQA 3AO1A 3C6UA 4DMNA 4W5QA 3LZJA 1LWCA 4W5NA 2KW4A 3O3FA 2P51A 1HMVA 1RBTA 1W0HA 3OQ5A 3WNGA 3LP2A 4I9LA 4FLVA 3RR7A 2HB5A 4LH5A 4B9MA 1VSEA 2OZSA 4OKJA 4NCGA 1LWFA 2GV9A 4A4HA 4K8ZA 4KRFA 3KD5E 1S9EA 3OS0A 1HYVA 4L8RB 4W5RA 4CHQA 1C1CA 4OPKA 4B9VA 4DFJA 3QIOA 4C5IA 2NLUA 3OYHA 3E9FA 4ELTA 4E1NA 1BCMA 1KLMA 2QQRA 1C6VA 3PY8A 3NF6A 3QINA 1YTAA 4M3WA 5C0MA 4CEDA 4F2RA 3KLFA 1R0AA 4CF1A 2HHWA 2X6NA 4FW2A 1RDBA 4DS4A 2A1RA 2IC3A 4CGDA 4PUOA 4BE1A 5HBMA 3WNEA 1EETA 2DAQA 1WAFA 2M0OA 4Z4CA 2ZE2A 5CY4A 3TAFA 3HO1A 4DSLA 1T03A 2IDOA 2WOMA 3BDLA 3K2PA 4C5GA 1RILA 4CHOA 1XHXA 4IUVA 4IUPA 4ELVA 5CIUA 2GUIA 1RTIA 3QEVA 1MU2A 3OYAA 5CZ2A 2R58A 1BQMA 3HXMA 3JYTA 3QERA 2G8IA 3NTIA 4C5HA 4N41A 3PX4A 2YNGA 4N4GA 3SV3A 3OYCA 3DRRA 1HNIA 2BDPA 3OS2A 5IAYA 3KK3A 4DTNA 3NDKA 2M1HA 3OJSA 5HLFA 2YNIA 2KFNA 4CGJA 2NUBA 1FKPA 4IUQA 3ZCMA 4NS5A 1DLOA 1WJRA 3ZSQA 4ICLA 1RBRA 3LAMA 3CFRA 4DTPA 5I3UA 1J5OA 3B6OA 3M8PA 4KHQA 3F70A 1CZ9A 2E6NA 1X1PA 3S3OA 3PO4A 3ZSYA 1NJYA 1DTTA 3WNFA 3P8DA 3PNWC 4B9LA 1WSHA 1Q8IA 3FLGA 2Z1JA 3DRPA 4Z4FA 3KLIA 1X9WA 4DQPA 4FJ7A 4GVMA 3SJJA 2DFEA 3AV9A 4PLIA 4CF8A 2QQSA 2WONA 1IKXA 4IFYA 2VG5A 1TAQA 1EXQA 4JRQA 2F8SA 2EX3A 2YKMA 3ZEHA 1FK9A 4FJLA 2HHXA 1WNSA 2OA8A 3NF7A 4B9TA 1IH7A 4FK0A 4CJ5A 2OPSA 4R5PA 3DLHA 3OYLA 1C0TA 5CZ1A 1L3VA 1UAXA 1OI1A 3ALYA 5C6SA 4DTMA 5C25A 4QVZA 5SWMA 1TGOA 3DLEA 3OYFA 3NTKA 1Z25A 4CK3A 1X9SA 4FJ9A 4CJQA 3D0PA 4FM2A 1KFDA 1OZ2A 4QQDA 4GY5A 4I2PA 1C1AA 1WSGA 3PX0A 4DF4A 2VWKA 1ASVA 4PLLA 4FK2A 3LP0A 3CM5A 3UWNA 3QJ6A 2XHBA 1TL1A 4JS5A 1NK4A 2EFIA 2R5AA 4B8AB 3KLHA 4FJMA 3G0ZA 4FZYA 3MP8A 3HVRA 4KHUA 3TAGA 2YV0X 4M3XA 1YT3A 4J2DA 2E5QA 3HT3A 2B8AA 1IKVA 3ZSOA 5J2QA 3SPYA 1SKSA 3TWHA 2BIVA 1NJZA 1LWEA 2BGGA 3MP6A 3TAPA 1ZBUA 1QHTA 3KKRA 3AVGA 3NNQA 1N6QA 1EX4A 3PMIA 4CF2A 3ITHA 2IG0A 3QEIA 5HRSA 5J26A 3V6DA 3QBYA 3OJUA 4QW2A 3UIQA 3U3GA 3KJVA 4DSIA 3RMCA 1BHLA 3DM2A 2JZ2A 3MEEA 3DYAA 3LH0A 1D9FA 3OYBA 2R57A 3L2WA 3A2FA 3PMTA 2ZD1A 3SQ1A 1N5YA 1JL2A 3ZT1A 5DK5A 3NE6A 2HVHA 4CEZA 5I42A 2RJCA 2LCCA 1ITGA 1L3TA 1RT1A 3V9UA 2RJFA 5FROA 5E41A 3HP9A 2JLEA 3V1OA 1IO2A 1QTMA 3GOXA 3HJFA 3KD1E 1C0MA 3C95A 3S3NA 3E01A 2P1JA 1JLFA 1J9AA 3DLBA 4CERA 3AA5X 3VQ5A 1L3UA 3VQ4A 4HHTA 1KVBA 5HP1A 1NOYA 3QLHA 3NFAA 3F73A 4CJRA 2QXFA 2YHAA 1BI4B 4DQIA 4CHNA 1NK6A 3M8SA 3G10A 4FJIA 2RI3A 3DLRA 5KCOA 3NCIA 4FVMA 4QCLA 3CQ8A 1S1VA 3B6PA 4B9SA 1VSIA 4E1MA 4PQUA 4Z02A 4H4OA 2E6MA 2R7YA 1RT6A 4II1A 5JS2A 3T19A 5M9OA 4IBNA 5JS1A 1TV6A 4E3SA 5C24A 1X9MA 3PUFA 3K57A 3NH2A 2B4JA 2RHXA 3HP6A 1F21A 2X74A 4M41A 2G8UA 1SL1A 4KPYA 3MP1A 1T05A 3ZT0A 2KQ2A 3V9ZA 2OYQA 1VRUA 5D6YA 4FXDA 4C8KA 2RN2A 2GBZA 4CJKA 4KB1A
chains in the Genus database with same CATH superfamily
4BY9C 3LWLA 2F2VA 4FX0A 4G6DA 3ID6A 1N9RA 4HCZA 1GOBA 1Q95G 2ZCFB 2DA9A 2O61A 3A98A 4F7ZA 2JUFA 5FLXE 3M6GA 3CMAT 4JLHA 4YPHA 3LP3A 1AU7A 3M0PA 1IBMK 1YIJQ 2MLKA 3DCFA 1E17A 3GZ6A 2YUSA 2QW9A 1S5JA 3JRDA 1TKXA 4CC7A 3NPFA 3NTHA 4XONA 2FMYA 2DT6A 1KYWA 3IRRA 1HKTA 4ILGB 3IS9A 4R0KA 4KFCA 3MO8A 2BVMA 4JI4K 3SBGA 4OFEA 4M63C 4G1QA 4EJVA 3I9V2 3SDGA 4B8XA 2ZFWA 5HNHA 3F23A 3BY7A 2LK2A 1XS9A 4WCIA 4A4EA 1ZARA 3PIPL 1LCKA 2YHBA 1MUYA 6PAXA 5FU7C 1SL2A 1D5AA 1ON2A 1Z26A 4CEBA 4ZTJA 2X3XD 2UV1A 2NNWA 3IG1A 4BR5A 2HTSA 1BIUA 1G3YA 1SVOA 4MO4A 4BI3A 4OMLA 4AU7A 2CRGA 3TTFA 3JCMW 2MF2A 1SKUB 4B1UB 1BOBA 1CXQA 4EZ9A 2A61A 4B3TK 2H3JA 3P8HA 3ZX3A 3RWUA 5E18F 4HT9A 4LGWA 1QCNA 2DJNA 3T5XA 2V8JA 2R93J 1P4XA 2XAHA 3DU5A 2Y9ZA 3HSTB 2JN0A 3ZSWA 3LFKA 1I81A 1DGWY 4CUGA 2YG9A 3ID8A 5CVVA 4EW4A 4J2EA 3QWYA 5AIQA 3VQ6A 1TC3C 5DCMA 4JBAA 1BB9A 2YJFA 5H6QA 3R6NA 1Y97A 2RQTA 1BI2A 3RMBA 4XMYA 4JYKA 1W36C 5F2RA 2RJEA 3LSIA 5BN8A 4EHTA 2VQHA 1RLQC 3SFMA 4QAGA 4CI6A 1L3SA 3JV3A 1MDUB 3VTHA 5IOYA 1YRNA 4BKXA 1UE9A 2W42A 4E47A 2LY1A 2H09A 3M5AA 2DL5A 3G6EI 3CXCS 1ILYA 4PFPA 2E1NA 5F1XA 2NRAC 1R0BG 5KN9A 5J1UA 4LLNA 3JCMh 5HRRA 1DDNA 2KZGA 2EYQA 4IZZA 2JTFA 3QPHA 1WHMA 3THVA 1RRQA 4BACA 4GYIA 1BU6O 3I8DA 1PU6A 4CE9A 4CD1A 4LLGF 4FOEA 4H5RA 3MXMA 2JJ9A 4CSWA 1GBRA 5E8IA 2V7FA 4CIEA 4N76A 3TREA 5CJ9A 2VOPA 2HBPA 1MV0B 3KETA 4GY2B 4I6MA 2PMZA 1ZXOA 3AAQA 1R4MB 2VKDA 2R7TA 1UJ0A 2R7ZJ 5D8KB 1I5LA 2WACA 1Q86R 3TAEA 2X3WD 3KK7A 1DP7P 1A5XA 2O6GE 4FWSA 1HQCA 2H1KA 5FRNA 2E1MB 4BH9A 5FLXK 5J2PA 5GAOm 4BR2A 1KJWA 2QASA 3ZMVA 1VQOT 3JCMP 5ICFA 3IHOA 4DQQA 3RMQA 5F0CA 3OIQA 4LJZF 1QSYA 3EG9A 5K5QA 4C8QA 3I56A 4YDUA 4FTHA 4C8QD 1Q81O 1XMKA 2YSRA 1QS4A 5C42A 2DA1A 3SUNA 2L7MP 3K4KA 3CO6C 3I55I 5AT1B 3BCAA 4L9JA 2ZPEB 5GAMd 5KQ8A 2RJDA 3BE3A 2RK2A 2W48A 3RKYA 3LQRA 1M3HA 1BU1A 1WJFA 3KEYA 3VRZA 3CD6N 3L2VA 4HKEA 1DGKN 1VQPI 2OQRA 4NXNK 4UC4A 5GAEP 3FXOA 4JZ3A 2OAUA 2JVHA 4MIMA 3ZQIA 4ENMA 2A7YA 2I5JA 1D4XA 3NGPA 3AVJA 4KTZA 1DEJA 3U4LA 1HDPA 4C8LA 1NKUA 5LGNA 2GA1A 4FPAA 3DLGA 5LLQA 1D1CA 1JLQA 3AVNA 3M5RA 1P9QC 3OBWA 3MEAA 4D1QA 4M3BA 1UGSB 5D5XB 2YPRA 1RRJA 2IW5A 1U47A 2VE8A 1Y0NA 5FD5A 2KXDA 4BD3A 3I0RA 2RN7A 4P55A 5GAMf 3S32A 5KCMA 2DMQA 2MG4A 4KNYA 4PJLA 1R23A 4MO7A 3CJ9A 3T8RA 2Y0SA 4MTEA 3W2WA 2X1EA 1I5OB 2H27A 3D45A 3VWBA 4A3DJ 1ZBJA 7AT1B 2XPUA 5KQDA 1CKAA 1PUEE 4WQ5A 5FB2A 1MD0A 4I7HA 4C2UA 4LSNA 5M1KA 1UEBA 1IUFA 2A6HF 3CCRN 4FJGA 4AFQC 3LA7A 4LSLA 3QICA 4XSZF 2ZAEA 1XSVA 3CJQB 4AMCA 1OH8A 3M9QA 2CS3A 1ETKA 3MAJA 1EQYA 1WJCA 3NAEA 3RNJA 3H3UA 4JAXA 4RGRA 5DV5A 5DUKA 2WAQN 2B86A 1TWBA 3L4IA 4YIFA 2WUSA 3GTQJ 5AONA 1YP5A 2LCLA 2KZZA 3G4SI 2GIZA 4E7JA 2P6SA 4RTZA 2EJFA 2FC0A 3HOYJ 4LDXA 2E4HA 1ETXA 4FE4A 3T69A 1HRHA 4CGHA 2W57A 3CUOA 1YQAA 4BHCA 5EGOB 1W1WE 2DX1A 1FTTA 4CZHA 3EKUA 1TBXA 1I0CA 1ZYQA 2L3RA 3MX2A 2PY5A 2O9SA 3ERED 2M30A 1JT6A 3IMXA 2ROTA 4E9FA 5F0XA 2VBXA 2OX7A 4B6MA 3MCPA 3E9OA 1W0UA 1NJXA 3NWSA 2G7HA 2DT7B 4LH4A 3O9QA 4KHPK 2BHZA 3WUHA 4ANJA 3GMEA 1E7OA 2VT3A 4FISA 2VJIA 1N9SA 1IG7A 2YNHA 2X1DA 1VAZA 2O4XB 1OR7A 1NM1A 3LPTA 5A2QK 2K4BA 1Q7YO 1XNRK 4ENNA 1GHCA 1SRLA 1LPLA 2FOKA 3GTKJ 3CFPA 4JYAK 1UELB 3FHFA 2BY0A 1VQ5A 1S1TA 5ILVA 3COAC 3HGYA 3H8ZA 1A6IA 5LHHA 3A0BC 1O1WA 4DV4K 2CV2A 4CJ4A 3HPOA 2I5WA 3PFIA 3CCEN 1JI8A 2RPIA 4CCKA 4BDYA 8AT1B 2HSPA 2M02A 3VRYA 4ISEA 4W5OA 3ZSXA 5GMKj 3W2AA 2YRVA 3CCQA 3I56Q 3UT1A 3KFVA 1EFNA 2O8FB 2P5LC 1BC8C 3WXJA 1HW2A 4QVCA 4M4ZA 1BDGA 4IHVA 4JI8K 5B8HA 1J3TA 3J7YJ 1REVA 2PLYA 3O8VA 1BIBA 4BI8B 1S72T 3CFOA 3QPTA 3D0SA 4OIQF 3DJCA 1YJWI 1Q1HA 4JEPA 4LC9B 3OS5A 2DJIA 4BU2A 3RERA 5HLHA 2E2OA 2M0MA 2ZQBA 3V8LA 3FXUA 1X3UA 4CJSA 3FHGA 1WOQA 5GAHJ 1OYIA 1VFCA 3VMFB 2FA5A 1SZ2A 2H3GX 2MOXA 1FYMA 3I58A 3HUGB 4UY8I 2DQRA 3NMUA 3KP3A 2YJEA 2XKOA 5FKLA 2LNHB 3BY6A 2ZJPL 2HEOA 2F5KA 1DTQA 3NFCA 4L5IA 3FXMA 4CCJA 3BPVA 2DIQA 2IPQX 5HDGA 2YNFA 4M9SA 2OPRA 1K6YA 2HYGD 3MWPA 5HY6A 3LL7A 3N4QA 2PFBA 1OISA 4XM3A 1RAHB 2RKIA 1M3CA 4DR5K 4M3UA 2CW0F 4DR7K 3O6BB 1KQ8A 5D5VB 2M9UA 1BL0A 2EAYA 2DD5A 4ZYDA 4R55A 1TUGB 4YNQA 1T0FA 3GTOJ 1Z9ZA 3BR0A 4BR7A 1JGSA 3M0QA 3HVTA 3DPUA 2GFAA 1WLPB 1IG9A 2X6SA 3VQCA 3CVSA 5M3FJ 4IFVA 3FRNA 2R7SA 3U9GA 1HXDA 3LSJA 3BG9A 1APLC 2VQEK 2MH9A 2HL3A 2EGCA 1AWXA 2VC8A 4N5SA 1D8JA 1OKJA 5DLOA 1TTHB 4YFXF 5HRNA 1VRLA 1KIKA 3MEDA 2FBTA 2XAQA 4C8QG 3H46O 4I2OA 2E10A 4RS8A 2E5KA 3BR3A 1Z7LA 1Z7UA 2GUPA 4O0JA 5K14A 3VQQA 4FW1A 4C8MA 2VQFK 2EILH 4PHTX 1T56A 3R2XC 3HJEA 1LWWA 2HDDA 3SMPA 2GTDA 5CHZA 4JUVA 4Y4RA 2CUZA 3I35A 4J9IA 1HNXK 1UG2A 3UR3C 2IAIA 3BG5A 3HTRA 4BY6C 4PJ0C 1H1VA 3F9KA 4LB5A 4FYVB 3EGXB 4JJCA 4A59A 2COZA 1JO8A 4BJ6C 5IPAA 1JRIA 1VHXA 2GCXA 1IHWA 4JRKA 5FPMA 3KK1A 5EGOA 3E66A 3JCMQ 3JB9H 3LGFA 1NM7A 4FM4B 2O03A 4N9HA 2Z1GA 3IC7A 2RE2A 3RTRA 2KHMA 2QWOA 1B07A 3J8AA 3WTZA 4MMLA 3M7GA 2JPCA 5AQIA 3EGDB 4FK4A 3HM9A 4RDUA 1B8IB 2YRDA 5LMNK 5LFAA 3N5BB 3ZR8X 1O3TA 3EL2A 5IN1A 1MMDA 3QHSA 3A8YA 4FLUA 3DWLA 2O4XA 2ISZA 1SHGA 3KEOA 2JK3A 1WJQA 4BUGA 4FCYA 1NGCA 2Z1HA 3CCQQ 4N47A 1KU3A 3VQ7A 4RLFA 3K70D 4VUBA 1HUXA 1YHQA 3U23A 4BC3A 2EQMA 3F0CA 3S14J 3UDCA 5GJVB 3CWUA 4E1JA 5HS7A 1RUWA 3ZSRA 4A5NA 3EDPA 2LR8A 2ZB9A 1NGJA 5CKFA 2ZJRL 2A69F 4D8DA 4J6WA 4UB6C 1SAZA 4C3IJ 2QWNA 4BC5A 2DT5A 3CCJQ 5IT9K 2KRNA 1KU2A 4OMMA 2O8EB 2BXYA 4L18B 3CC7Q 2O9LA 3MCZA 5AQTA 3RRGA 2BTFA 3VEOA 4U87A 2MC4A 4LD0A 3CDIA 4HDVA 2FJ1A 4YELA 4ZYAA 5BPLA 3M1CA 1NK7A 3OYIA 5KYUB 4NC6A 2D0CA 1RDCA 1KU7A 4HVJA 3CD6I 4JK7A 2JQ7A 2O8FA 2Y4XA 3QYGB 4A4FA 2G8HA 4W1UA 3J7ZO 3URGA 3FM3A 2EYYA 1FIAA 1W9HA 2GELA 5HRPA 1SPKA 4DUZK 2KT1A 4DJAA 4KJZA 5DY9A 3AVCA 3WVDB 2H56A 2LC4A 2QYZA 4ILJA 4ELYC 5BREA 3K58A 1TK5A 1KG7A 3FZFA 4LFCK 1HNZK 4E7LA 2XRIA 5GTHC 2CZ0B 3GIBA 3U3YA 3SJHA 2PVDB 4RA2A 3PFSA 2L0AA 3ZMUA 3HUGA 1Y1VJ 2QM3A 1JU5C 2K5IA 3CETA 2G8FA 3VSKA 4BHBA 4AG1C 4EATA 1NKBA 4H0YB 4C8QC 2HS5A 4ZDPA 4YDUC 2PJRB 3LAKA 1CZBA 5GIOA 2P0WA 4JKCA 3GO5A 4HG2A 3HPGA 4RAFA 4E9GA 1JKPC 4KUIA 3CCRI 3HYIA 3BROA 3SUQA 3TAQA 2PFUA 5JVGL 2HHHK 3L00A 3L1PA 1WI9A 1SHFA 4DTOA 2PU9B 3E9GA 3U2RA 2JMAA 5JMVA 2K85A 1WBDA 2E36A 1FYNA 1BUPA 5FKOA 1OYXA 3EETA 2CGPA 1IB8A 4XRMA 3RBBB 3SJMA 4CHZA 2X4WA 4A63B 2KBTA 2C0TA 1DU6A 4DBQA 2V1RA 2M8GX 2YLCA 3MX5A 3FGUA 3T3FA 1MWMA 5E1WA 3SB2A 3DTKA 2CS7A 2QSFX 4IHYA 4A5BA 3EUHC 4QQGA 3L0QA 3AVLA 1LEAA 4UY8O 2HMAA 4BC2A 3H3VK 1OJLA 2XDDA 4JX6A 4FLZA 5D4SA 5ICEA 1WFWA 2K86A 1QP3A 3VKIA 1SUQA 2XY6A 1M1GA 1BGXT 3CUQC 2HKXA 3NGYA 4YTLA 2QQBA 5B3SH 3E19A 4MDWA 1XG1A 2ME6A 1IC8A 3Q3SA 4IRHA 2F5DA 4XTUA 1QVFS 2M4KA 2MH2A 5J3LA 2DOEA 2FLOA 1TAUA 4R56A 3SUOA 3IH7A 5CQEA 4N4HA 4A6EA 1E6HA 4CCMA 1WJBA 2JVGA 4N4NB 4ZDOA 5CKEA 4BRIA 4XH5A 3EGXA 1WZOA 4BY7J 2L8DA 1RL2A 1QQCA 4GW6A 2IGOA 2GBYA 2BEOA 1QPIA 3DRSA 2NVYJ 4KA4A 4NLBA 2PYJA 3LSRA 1RUOA 3DXKB 3HRSA 4BHPA 4M78F 3ZFJA 5SZTA 5AR0A 4ESJA 4Z4EA 3BR1A 3A5ZB 3CCEI 3DKMA 4GV6A 4G12A 4OKEA 1RETA 3LSMA 4J5YA 2HSTA 3EGDA 3TCJA 5J1EA 5TKWA 1QWFA 1Y64A 2DA5A 4KHWA 1B8IA 2RNGA 2XSJC 2FL7A 2HHSA 1BW5A 1PD1A 3B02A 2XDBA 4FLWA 1C0WA 4NYNA 1U1TA 2YWWA 4CJFA 3LW5E 1I07A 1Y57A 3SHWA 4LFBK 2FHDA 3CMEN 2XPWA 1HW5A 4FL9A 2RF2A 3T0YA 1XGMA 3FF5A 5LMUK 3C3WA 2DODA 1N6AA 2WAEA 1OR7C 4BVPA 2QA4A 1IGQA 1QRYA 3I3LA 5GJWB 1NOZA 1VOMA 4HVWA 1C0FA 1NK2P 4EA4A 3Q7CA 4CXFA 3CCUT 5CHIA 4B9UA 1A6QA 3J81E 2HQXA 2Z1IA 1AT1B 2O8EA 2R7UA 1NEGA 2LQKA 3GTPJ 1AWJA 2R7QA 2CSIA 5EZGA 5TISC 4JKHA 5KYUA 1LVAA 4BROA 3AL0C 2KNBB 3OYEA 1W5CC 4BRFA 4IQ4A 2NOZA 4LF9K 1T2KA 1JKHA 1XJWB 1D3YA 2ED0A 4JKEA 1NGHA 4A3CJ 4CJVA 4WQ4A 1J6ZA 4NB4A 2MA3A 2OBPA 3VYHB 2D1VA 5J39A 2K79A 1OCZH 2F96A 4MDBA 4AM3A 2P5VA 2X78A 2JUCA 3FMSA 4CO8A 2IVWA 3WQUA 1W97L 2K9GA 2E1MC 1GT0C 4JP0A 1FP1D 4M3EA 3LWFA 3HXLA 1ZN2A 1S8NA 4OOIA 1MUZA 4M45A 5E26A 1M2VB 2BE2A 3SYZA 3OMCA 3C6UA 4ASNA 5CKBA 4BQZA 1FBQA 4IFEA 4W5NA 4ZGJB 3NVKA 1HMVA 2PJRA 5B1AH 2HMPA 1RBTA 1OCOH 2ELHA 2QBYB 2KMTA 3O9RA 4A61A 2BE5F 3CPWM 4FLVA 1BBZA 5AQVA 3CC4T 4UUVA 1BA0A 1Z77A 5DD4A 4MLOA 2L02A 4OINF 5EDNA 4FT2A 4KDPA 1HYOA 2GV9A 2HVSA 1ERDA 3R8EA 1SD7A 3WTWC 3ZEUB 1IV6A 1F9NA 3OR1C 4KIFA 2EPFA 4A0YA 1S9EA 2YI1A 4L0ZB 3FB9A 3U1KA 1C1CA 4KIGA 5KYYB 2IS4A 1UB9A 1BCMA 5EYRA 2V52B 2WSCE 4ZYEA 2HF3A 2L2PA 2A6AA 5AFUH 3C2BA 3GTLJ 1PSFA 4Y28E 5ICCA 4PFZA 2F2WA 5C0MA 5GMKi 5GAMg 3VGMA 3QYEA 4IO8A 1JKOC 4CF1A 2HHWA 1RDBA 3MKLA 4E70A 1WI3A 3R61A 4N4OB 3WNEA 4M6VA 2I0NA 4H0EA 1WAFA 5J1YA 2CFXA 4YIIA 4ETSA 2AT1B 5IHKA 1X3ZB 4FWNA 3S1MJ 2R5ZB 1VQ7T 3TAFA 3HO1A 3GDQA 4C8QE 3VJPA 4RGXA 5GANe 4XEIA 2V6EA 1K9AA 1LNWA 1BO5O 3E6CC 1XHXA 3QSUA 4ELVA 2NYSA 1YNZA 1TH7A 3CF2A 2LVSA 4DR2K 1MU2A 5AIPA 1WCMJ 3NQOA 5CZ2A 3LWHA 2QGFB 5FU6B 1VZ0A 4X65K 3TDUC 3J81K 2G8IA 1IRZA 1VQ8A 3PX4A 3E7LA 3ABUA 3DTIA 2I2LA 1MBEA 3C2HA 4PKIA 3SV3A 1XSXA 3KYCB 3KK3A 4DTNA 3OJSA 5JLXA 3GFLA 2HKOA 2DK8A 3DXKA 4RMOA 4CZCA 4DV1K 2HZTA 1N5ZA 3DTEA 4CA0A 1X2QA 2XD0A 2WC2A 1WJEA 1RAGB 3LAMA 4IOAF 4EM1A 1YJ9T 4BRMA 1YOVB 2E7WA 4JKFA 3MEXA 3PO4A 3ZSYA 1LWVA 4A6DA 1DTTA 4BRLA 4CZMA 4M7DB 2AHJB 4OB1B 3TL4X 2Q2RA 3L6QA 1E2XA 2VIXA 2IVOA 2LJ0A 4IIOA 4U67L 5D7UA 4V19K 3AAPA 3KLIA 2V8KA 4LDUA 3G71N 2JTVA 1X9WA 3K70C 3ZPLA 1T3VA 1KQ0A 3KZYA 1GCQA 1U3EM 4EIKA 3ZRGA 1K0XA 2NS7A 2XKPA 2QQ8A 1OQKA 2XB0X 2QQSA 1NLPC 4IQJA 5LL6Z 4LF4K 1N33K 1XQHA 4K0KK 1EXQA 3M1FA 2YKMA 2QKMB 1VQNT 1NBEB 1NGGA 2OA8A 1TWFJ 2QWQA 3CCLT 2VL8A 2YLBA 1O75A 3SZPA 3Q9SA 4AUXA 2JRTA 4OIRF 5CZ1A 4BG9A 4AM7A 1E3PA 1UAXA 2COWA 5C6SA 3IQLA 5C25A 5SWMA 3GWZA 4NO7A 2RNJA 3NTKA 1AEYA 4CC2A 2F69A 1Z25A 4LUDA 3QZ9B 5KPRA 3D0PA 1Z9QA 1S3XA 1N8RU 3R6MA 4XKBA 5AQQA 4BJTA 4QQDA 1JJ2P 2VCPA 3JB9G 2MGQA 4EMKB 1C1AA 2YSQA 4DF4A 5GMKm 2VWKA 4YFNF 5E1XA 4FK2A 4EMHA 1M2VA 3UWNA 3H3ZA 1ZTRA 2HFHA 1CZAN 4BL0B 3FZMA 3EQLF 4XN0A 4JS5A 2QBYA 5MLCQ 4PJMA 1O13A 1MH4A 1BI1A 3C18A 1T3SA 5LHGA 3G0ZA 4OMZA 4P5OA 3JW4A 1MZBA 1IN8A 3CCRT 3ZETB 3CP8A 4CC4B 2PQ8A 1YT3A 1NG9A 4J2DA 1YJNT 1Y56A 1IKVA 4KGVB 5J2QA 3ZEUA 2BIVA 3MP6A 2FYKA 4XU2A 3SWNB 1XG7A 2EJRA 1P90A 4A3FJ 2JTMA 5KYYA 2GOMA 4QPOA 4FT4A 2W04A 1W7PD 1X19A 3HKZN 3BP8A 5FKKA 1XMXA 1EX4A 4CJ7A 4EEFG 2LSOA 2OTJN 3PMIA 3FR0A 1SFKA 2A08A 2JT4A 2AQFA 5LJWA 4IEEA 1TQIA 3GYHX 3PTAA 4ZJZA 2VONA 3AKZA 3V6DA 4NL2A 3QBYA 5AFUA 3UIQA 3OIOA 2P7VB 1QA6A 2HI3A 1ZELA 1VQ8Q 1I3QJ 4BG8A 2ESWA 1FWZA 1UGRB 2NUTA 2R5ZA 2LP5A 1AZGB 1QWEA 4N0AA 1LJOA 2JZ2A 2HBLA 2V7YA 1JKRC 1VYUA 3THXB 2DXBA 3JTGA 3LH0A 2MLGA 1K61A 2CQXA 3EHRA 2EIKH 3EGUA 3QDRB 2GNCA 5GAN5 4J6YA 3CJ1A 3CCVT 2ZD1A 4BY1J 3ZT1A 2RQPA 3K2AA 1ZA1B 5AQKA 1PNJA 3JR9A 1T6DA 2HVHA 3CMEI 4CEZA 2F5VA 2V51B 2VQGA 3CC2A 2E65A 2DEUA 5D5UB 2RJCA 1U2WA 4IVNA 4XLEA 2EFPA 2V9PA 3LM9A 3V9UA 2RJFA 2ZM6K 4F91B 5E41A 2ZJ2A 3V1OA 2E1YA 3CXCM 4HNTA 3FXJA 1Z3YA 1QLYA 5GAMj 2EFNA 3KD1E 1C0MA 3AFHA 2PMUA 4H0OA 1PC0A 2DPNA 3MCAB 1LE8B 3QODA 3BLYA 1J9AA 3DLBA 1WFXA 3AA5X 1ETWA 4ZZDA 1S9HA 3LSKA 1VNDA 3KEQA 2XAGA 1YIJT 3VQ4A 1IREB 1K73U 1R59O 1JUSA 3Q0UA 2IGNA 1NOYA 2DAOA 1VQLN 1WHGA 4DV0K 1OCCH 4M7AB 3JRHA 1IZ1A 1B4AA 4M7DA 2BUPA 1MJ9A 2MYSA 2LMDA 1RR8C 3M3YJ 4M7DD 3M8SA 3M4GA 5K7HA 2ZF5O 2BV6A 1A0NB 4QCLA 2CP7A 4WK8F 3CQ8A 1WQWA 1I1GA 4PQUA 4Z02A 1SVMA 1RT6A 1P7JA 1UZCA 3F2KA 4ZC3A 4PKCC 2AIRB 2COBA 4FYWB 4E3SA 5C24A 4O6JA 1K8KB 3HM8A 2DLLA 5J3BA 1YW9A 3K57A 3VTIA 4JHDB 1EZZB 2VV5A 4EGYA 1F21A 2G8UA 3HEFA 4KPYA 4IIMA 5CKTA 3MN9A 2E70A 1V54H 1FOWA 3ZT0A 2CO5A 1M1KU 2KQ2A 2OYQA 1RESA 4C8KA 2X4HA 1N8RC 2GBZA 1BJAA 3L2CA 1WH5A 2ELJA 1TU0B 3H9QA 5AYFA 4CK2A 4DR4K 5AZJB 4DNCA 2IS3A 4DQRA 4OMYA 4RTYA 2A6TA 5GAN3 4EJUA 3VQBA 3LWIA 4MTDA 3WXLA 4EMKA 4NCBA 2KT8A 1U8BA 3EYIA 3K4CA 4OMQA 4A3JJ 3CMAN 2MBFA 4KULA 2E3HA 1VQMA 3SAFA 1GOAA 3SQ2A 2EBIA 1JXSA 3DWLE 4OIOF 2QTDA 1M27C 4P9UA 2A0FB 2K3FA 4O55A 4DYRA 4DW6A 2DIGA 2QDYB 4QQ6A 1NJIU 3CCJI 2HBKA 2IS2A 3AO4A 3ZETA 2AO9A 3CC7I 3M8EA 2DDBA 3AVIA 1H9TA 3SI6A 1S72Q 3MEUA 3QESA 3JRFA 2H3EB 5HCKA 4ID5A 3OWTA 4GCVA 3B73A 2EWNA 2FBKA 2XO7A 3OH9A 2LX9A 2LFBA 3SWNA 5L3BA 2YU3A 1M2OA 3DKYA 5LY3A 4HSRA 3PLAA 2JGUA 1BISA 1LFPA 1A31A 1F4KA 1PU8A 3MKYB 2HOEA 4KICA 1VSJA 5BPNA 4I2QA 3AARA 2ZWHA 2YRCA 3THYA 4PJOF 4FOIA 4GKKK 2CGLA 3LWMA 4J9HA 1WSIA 4WCGA 2KKOA 4AC0A 4Y3OA 3N05A 3QNOA 2EYXA 2OUMA 1S1NA 1RAAB 2P9KB 1ABOA 3FXQA 2Q8KA 1LJ9A 4HX4A 3JS6A 2RDPA 3RR8A 1KD1U 4OMOA 1X75C 3UA6A 1VQ4A 3SD4A 3HTUA 1ZBLA 4GO1A 1VSLA 2DFFA 2G9WA 5JR3A 5EF6A 3THXA 1UJYA 3M55A 1TNSA 1RAIB 4GGGA 4J83A 2DYRH 1WA7A 3K2ZA 3MZHA 1ZR2A 3WTXC 1UWBA 3LYIA 1WB9A 4ILHA 1USSA 2E35A 4FQGA 1YN8A 2M51A 4XU3A 2CUFA 1TLHB 1HYZA 1VTNC 1WJSA 5C0YA 3G71I 1D8KA 4ITVA 2XF5A 3WHBA 4E9HA 2QGUA 1K73C 3AA3A 3OW2S 4JQFA 3O8GA 1HA8A 4F52A 5CVIA 1H3HA 1LE8A 2VBYA 2VGMA 2KY9A 2QYOA 2K40A 4EMGA 1XN7A 2F5FA 4BDPA 4CGZA 1FTZA 4L9VA 3J80E 5GANd 5LD2C 2GM4A 1SC7A 3E0JB 4M3TA 1TG0A 4YOYA 4M7AA 2FBYA 1JTXA 4PGGA 2UU9K 1UOCA 2BZXA 3T1BA 3KUFA 4NUBA 3TP3A 4M7YA 1SSFA 2R7RA 3QDFA 1BWFO 2GAUA 4RB1A 4ID1A 1REPC 2L01A 3VS3A 2EYWA 3OOPA 3RMAA 3A5NC 1VQON 3ELKA 1KONA 3QP5A 2DN0A 4HSBA 1IZ6A 2XIDA 1Y0UA 1NJWA 3M56A 4C92F 4E89A 3BF3A 1ATRA 4OB2B 4OB3B 1M1KC 3HOXJ 1K8KA 3PT9A 4KIBA 1VQ9A 2JS0A 4KO0A 4AHRA 1GCQC 1WVRA 5GANf 4JHDA 4KYWA 2EHGA 1JXBA 4ATOA 3M3ZA 5KYNA 1BOTO 1HK9A 4HNUA 1VQMQ 2NUPB 4HWIA 1E3MA 4GBQA 3ZP5A 3G1JA 4C1NK 1TOVA 5IT3A 3HSCA 5C44J 2W82A 3MAQA 3ZT2A 4HV6A 4RB0A 3LFUA 5AZJA 2EZKA 3CLQA 4EW0A 3ABLH 2FBVA 5FU7B 4OGCA 3NHGA 1QQJA 2NVUB 4X66K 2RGVA 3DXMB 1JL1A 3SAHA 2LZ6B 2QCOA 3OIPA 5IXBA 1AVZC 1RT5A 1X9JA 2GBQA 4H0VB 3QKJA 4F7UB 1VQLA 4M7DG 4EIAA 4J9EA 4FU6A 3TQNA 3LA2A 2ABLA 5KGXA 2OCCH 2OTJI 5JVHL 1O7FA 2I7PA 3TSZA 3QOPA 3RCOA 4DA4A 1BYMA 5LJ3e 4LDVA 3CI5A 2EA4A 1TUUA 4CJPA 2GWRA 1OYWA 3UNGC 2A40A 4X6AJ 1GLDG 2F5CA 2J6FA 3R1XA 2V1NA 2QI2A 4A0XA 1M90O 1HKSA 4YEJA 2ATCB 1HJOA 1R1UA 2D0BA 4OF1A 5E79C 4M75F 4CHUA 2QENA 4I76A 2XASA 4DR1K 4YOUA 4BBRJ 5LJ5e 1YI2A 4PSWA 4IXAA 3I5SA 2X6WA 1RDDA 3I56T 4DTRA 1FYKA 4G94A 4DWIA 2XUBA 2RH2A 2F5TX 1ZLKA 4BRDA 1D1AA 2GFUA 3DU6A 1T8EA 4M3GA 4O5BA 4OPJA 1KD1C 2DI3A 2H8RA 3OL4A 2W85A 3KLNA 2Y4YA 2NRXA 1QQOA 1XNQK 2Z5UA 4BAYA 5CVUA 2P9KA 3J80K 2J06A 2D6FA 4CI0C 5AQYA 2F2EA 3A2KA 4WE1A 1MMSA 1Q82U 3TVTA 2O7OA 1R6RA 4LN2A 2Q0UA 4KISA 4KMUX 2CZ6B 2D8HA 3N4MA 2QTVA 2K3YA 1NE8A 2W0ZA 1IRGA 3EH2A 3KIOA 3UKRB 2RHIA 3JRGA 1XOVA 3HHTB 1HPZA 3TSPA 4AHVA 1U5SA 2W7NA 4JV5K 3A01B 2IS1A 2FZGB 4DSKA 1NMDA 2LNVA 3TABA 1YS6A 3JRZA 3WTTC 1AHJB 3OYNA 2E4LA 1SFOJ 2ZXIA 4BGDA 2IOCA 1W4SA 4DV2K 2JA5J 3UF4A 2DXCA 3U6FA 1T7PA 4OJRA 2VC1A 2RO0A 2B6AA 1ACMB 3M4OJ 3M57A 5KTQA 1OPCA 3BG6A 4NC8A 2ZGZA 3ASMA 1CGPA 1TK8A 2M87A 1ON1A 1N8RR 1BR1A 2A68F 3IP4B 5JVTA 4WFAL 2BBYA 1U04A 3CQZJ 2ENMA 3VEZA 4E7ZA 1TZLA 1SFXA 3DB4A 1YXQA 1K76A 1F43A 2WSEE 1EH8A 3O5ZA 2CQNA 2LREA 1JUMA 1V5GA 5LGUA 3K1MA 2UXBK 4CBWA 1MNDA 4M75D 3HSBA 2CV0A 1IKYA 4JK9A 5L3FA 1FMKA 1Y71A 3V7CA 1S72N 2QDLA 1Y6IA 2DQLA 1T39A 2BE7D 4IHXA 3UA7A 4CH7A 3U9ZA 4M77F 4M7DC 5M5YJ 1P7MA 1FMVA 1FKOA 3LALA 3PQKA 3I53A 2AZSA 3UATA 2XF7A 4KFBA 2A41A 3FDRA 4CD3A 4B1VA 1USTA 4FJHA 2M8EA 3F3XA 1KG4A 4IJAA 3CMAI 1DPRA 2CDTA 4M73A 1WSJA 2RHZA 3TGNA 2NUZA 1J9IA 4IUUA 4WF9L 1YTUA 2EGEA 4JK1X 3ISNC 3ZT3A 2LF7A 5ED4A 4R1HA 3KXTA 1HC8A 5J2MA 1MWKA 2NUPA 2PMHA 4DQ2A 2QVOA 4HVUA 2EFOA 2FX0A 3IH4A 5FJ8J 2UUCK 1NU0A 4C2TA 1X3MA 2X4YA 2FXAA 5KRSA 2PQWA 5KI6A 5HKCA 3SMSA 5FDLA 2LDMA 3DXMA 1KA8A 3PSFA 8ATCB 4M7AG 4DSJA 3RUXA 4F7UA 1GCPA 4S0HB 2CGHA 1WSFA 9ANTA 4V2GA 2J05A 3CCMA 3FHNA 1YI2Q 4OLAA 1LDJA 4FZXC 3OOUA 1WRJA 4OFAA 2FF6A 1SKRA 2QK9A 4KAZA 3CCQT 4EMKC 2R5MA 3TTCA 2GQQA 5ILSA 4CZIA 4FYDA 3H92A 2O8CB 3C1DA 1EKEA 3Q7BA 2LVMA 2H6BA 4GMJB 4HLXA 2RVCA 1QVFP 1TT0A 3LL3A 2WADA 1WI7A 1G2HA 4DKWA 3DV8A 4XRSA 1NLVA 1VQOA 5BNGA 1QMCA 4CC3A 3GFJA 4OP0A 3CCJT 1X58A 1B59A 4BYYA 3CC7T 2KZMA 2KE9A 3RMSA 3CBPA 1JJ6C 2PBIA 4NC7A 3T7ZA 1J2XA 2QWWA 4ORZA 4Q4ZF 4OVLA 2H6CA 1GVDA 2K7LA 3MN7A 1AZEA 2I5UA 2K5LA 2XGDA 3QYHB 1J53A 1S6QA 4FVUA 3L3UA 3QBWA 5M1NA 4YFKF 2RN8A 5K5OA 1Y8QB 3P7NA 3SWNC 4DHYA 3VQDA 1QVFM 1HKQA 1RKWA 3O4QA 2XSDC 1XQSC 1K73R 1T44A 4UV8A 3QIIA 1RT3A 1DQUA 5B66C 2ELKA 3HZ6A 1FEXA 3WTSC 2D2WA 3MD2A 1WSEA 3RKXA 3BJOA 4YG2F 1O3SA 2D0AA 4PNOA 1OH7A 4Z6YA 3ULEB 3WXMB 3AHUA 2UXCK 9ATCB 1VRTA 4NQWB 2FOWA 3IUOA 5AQSA 1UHMA 3QYFA 1K8AU 4AQYK 2WB1A 5AQHA 3WNHA 5CE3A 1Y39A 1M3BA 1U1SA 5AQRA 3UKRA 2ADUA 2VYPA 3AO2A 2GTOA 1RRSA 5GMKe 1V5EA 5BQTA 4LF7K 4M74A 1CSKA 3A01A 3GZ5A 1R22A 1PYVA 4JKGA 1IW7F 3VA0A 3DPTA 2F2XA 3MXJA 2ZCWA 1KQ9A 2KISA 2VXEA 3NH0A 1M1KR 3OMGA 2J4RA 2CKKA 3K5NA 3S41A 4U0YA 2LX7A 5HS9A 4XK4A 4CRIA 4DR3K 4QIWN 2WY8Q 1YWPA 2B7EA 3HYFA 3GUDA 3EYYA 1ZG3A 5CYQA 3TEDA 2JWLA 2KAFA 4IUTA 2XHIA 2PUOB 2E1OA 2FRWA 3HBTA 4OWRB 4KTQA 3P5JA 1XSDA 3B6AA 4DFPA 1UHSA 4FL6A 3CCSA 3H3OB 4UXNA 3AVKA 4JPBW 4L6V5 4RLQA 1BA1A 4FJJA 1Y8RB 4DFKA 5LHIA 1RABB 3DI6A 2VWBA 1MUDA 4DV3K 4LFUA 3JCMX 1FPQA 2VE9A 4UVAA 1NJIR 3TR8A 1GLBG 3CQTA 3VEWA 1GV2A 1KSPA 4DSEA 3AVFA 3V8KA 1RTDA 3R6OA 4D7NA 3JRAA 2JW4A 4Q48A 2F9WA 3TAMA 4IDKA 4WXHA 4PL7A 2G8KA 2ZMEB 3MZ8A 5DM6F 1PSEA 1ZX6A 4ABZA 2KFZA 1QVFA 2WTEA 3EUKL 3D7EO 1WPYA 2DTZA 1BM9A 4NZGA 1S1XA 4XU1A 3CCMQ 3L4QA 3CPFA 2E41A 2HDAA 2K27A 3CJAA 2FG0A 3VPZA 1BL3A 4O5VA 2PTKA 1YHQT 4U0VA 4NB5A 5CLSA 1H641 3ZX2A 4B3AA 2K3PA 4IDHA 4J2BA 5F6FA 4BGBA 2HVRA 4J9DA 3BC8A 2Z2SB 3F6VA 4RB2C 1K4TA 3W0LA 2OTLQ 2NOGA 3RIRA 4PZJA 3O9TA 3KTUA 1QQMA 1R49A 1JLAA 2NRHA 1KD1R 3F8NA 4BY6B 1UHFA 4ENJA 5EX5A 2KK4A 4RAZA 1PVEA 2L5QA 4JDSA 1MMGA 5BPMA 4M3YA 2XAFA 2GA2A 2QAZA 1A5WA 4M7DE 1VQNQ 5C10A 2EA2A 2ECZA 2A3LA 1FYLA 2O8CA 5KE2A 1SL0A 2OPQA 3META 4XKCA 2ZC2A 1OCRH 2M7AA 4IEJA 4E4HA 4J9FA 2FPFA 3OSVA 1K9MC 1ARKA 5H2FC 4N9IA 1RAFB 4DLGA 3HKSA 3CBMA 3Q1JA 3V9SA 2CH0A 4KMFA 2XU8A 3HOZJ 4RTVA 3RSEB 1ZK8A 4J6XA 1Q18A 2Z9OA 1VQ6A 5E3NA 5IH2A 2KEAA 3WU1B 4JI5K 4XORA 3TMOA 2AS5F 4KREA 4A3EJ 3BJ6A 2DFHA 1MDMB 3NF8A 2UWMA 4O4GA 1M1EB 3V7SA 4N0BA 3FISA 1DPUA 2NOEA 3RQ4A 5L3GA 3SPZA 1JHHA 2Y9YA 4AD9A 4F17A 3AG4H 2LG4A 1JGGA 1YITA 1R5ID 5LJ3d 3LP1A 4O44A 3M59A 1EH7A 2IIRA 3I71A 3ULEA 3C6TA 2NYXA 2KT0A 3QFPA 2JTEA 1OMIA 3HSEA 4RW8A 1X4OA 4F7UG 1C0GA 4HEA2 4NQWA 2DEQA 4IO9F 3SZGA 1S6PA 1H88C 2M1BA 3ZXSA 1GLNA 3NGIA 4KH6A 2OAWA 3LAPA 4B43A 1SS6A 2QQ9A 3A03A 3WU0A 2Y75A 4O5FA 5LJ5d 4Q47A 1N25A 5J4VA 5CKHA 4FWRA 2QM1A 2X1CA 1X2KA 3HDDA 4I7FA 1S7EA 1PJRA 3S6IA 3ABKH 4G9YA 2KFDA 4XRSG 3H41A 2HU9A 2LBFB 1S72I 1NK9A 1ZQ1A 2V7ZA 4MDAA 4AI5A 2KR3A 3MMVA 4FJ8A 5LJ3f 1KXPA 3K5MA 5L3EA 5FLXZ 3SUPA 2DM1A 3SQ0A 2NVTJ 1XX5A 1F1BB 4G7OF 3MEVA 3CCSQ 1H0MA 4LITA 2A5YB 5AQGA 2WTUA 2LMJA 3K5LA 2X6OA 1KG5A 1UMQA 3E5UA 3CCUN 3S16J 2X48A 3SZTA 4EMSA 4XTXA 2VQCA 2XK0A 1RNLA 2EJ9A 1KCFA 4DQSA 2PVGB 5FPNA 3WVEB 2VKVA 4R8HA 2KXCA 1MBGA 1ZAOA 5IP7J 2AQEA 1FSHA 3UE5A 1QNTA 2KI7A 3LDPA 4CK1A 3SV4A 4K43A 1QHHD 4LMYA 2JM8A 5I11A 3LDSA 1IAWA 1VQKQ 4FJKA 5LL6S 3TBIA 4MLEA 5EZHA 3CCVQ 3REBB 4B09A 1EO1A 3VS2A 3ZN0A 1ZSGA 5FFZA 2Z99A 4A2UA 1TL3A 4E7SA 2KDSA 2O5RA 2BGCA 1KVAA 5FW9A 4M75C 2X6YA 5KH6A 4CEOA 1ZG5A 4BRAA 2H8WA 1RUNA 3C65A 2HQNA 4XU0A 4A3BJ 2XV4S 1MSEC 4GNIA 1ZQ3P 2CFOA 3MEGA 2Q1ZB 3LZJA 2P9NB 3VOEA 2KRHA 3OR2C 2KW4A 2M45A 4J9GA 4NDLA 1BKBA 2M34A 3MJXA 2J5OA 3WNGA 3LP2A 1KGSA 1SQKA 4I9LA 3PNYA 2ZMEA 2ZGWA 2OZSA 4PKHA 1YO5C 3WEEB 3JAMK 1LWFA 2HPMA 3J7AO 2E2NA 3VF6A 4A4HA 2F9TA 3T8TA 2AXLA 4RBOA 2OQGA 4KRFA 3CC4N 3G6EA 3GOIA 1K78B 1UB4A 1HYVA 3CUQB 1JJ2S 2JMCA 2QA4T 4B9VA 2CREA 4MO5A 3CVTA 2I10A 4G6TB 1Z1DA 1YQLA 4E1NA 2P7CB 4HOBA 3NF6A 3GTMJ 1ACIA 3DAWA 4MNUA 3N97A 4M3WA 5GINA 3I9QA 1MGQA 2QWLA 1YE9A 2XPVA 3IHUA 1M4ZA 3VB2A 5DTDA 1D1BA 4FW2A 4DS4A 1Q82R 4BRGA 3V4GA 4L9TA 1IGNA 4QS8A 4BE1A 2QEXQ 5A0DA 4M7AE 3X2QH 3PIOF 5GADJ 5TKYA 4J8OA 1OH5A 1U78A 2UZKA 3VS6A 3LA3A 3IL2A 1H9GA 3ZGKA 3MN6A 3BTJA 2ZE2A 2RB6A 5JI6A 2ZNZA 3EG2A 3OBYA 1K83J 4OPAA 1T03A 1YTYA 5DDGA 3RSEA 2J7IA 1NNEA 1YITQ 2VODA 2VXZA 2WOMA 1VQ7N 5IHIA 1WKMA 5CIUA 3SDZA 2GUIA 1Z3XA 3FMRA 1O3QA 2HD0A 5FWCA 3OYAA 1YYVA 4F92B 2L54A 3A5LC 3I0XA 1MDMA 2ZJQF 2DILA 3I55A 1U9NA 1W6XA 4KH0B 2B63J 4C5HA 3F8CA 2YCHA 1X6BA 3AAFA 4N41A 1ZHIA 2D0QB 1RI7A 1HKCA 2BDPA 2IJLA 2RD1A 5IAYA 1J7KA 1U5TB 1EWRA 5A2QZ 1VQPA 4B48A 2YNIA 2KFNA 3K1NA 1YX3A 2HPIA 3LDLA 4IUQA 3IFRA 4NS5A 3ZSQA 4DTPA 1VYTA 4MMKA 4XOPA 2EJGA 3AL0B 3L09A 3BFMA 1X1PA 3S3OA 4LE9A 1EJ9A 2K9LA 3OSSC 1RPWA 3P8DA 1KG6A 1YJ9N 3X20B 1WSHA 1Q8IA 1SMTA 3CQYA 3FLGA 1NJIO 2FD5A 3DRPA 4KBMB 1WJDA 2X51A 3H0FA 2D1XA 3ECOA 4Z4FA 2LBFA 1V4TA 2OJ2A 3SFIA 1KAYA 3WG7H 2LD5A 5BR9A 4FSSA 1BI3A 4UV9A 2KYBA 4UVCA 5GAN4 3HG9A 2OTLN 2WONA 1T95A 1QHAA 3DBRB 3HIFA 2VG5A 3WQTA 2EX3A 4IRGA 2E3IA 1RDUA 5IWAK 5BR8K 4FJLA 2G0EA 1WNSA 1ODDA 3PIOA 4KRTA 4B9TA 1P59A 4FK0A 5A2QE 3VF2A 1PWTA 1B7TA 4CJ5A 2OPSA 1VQNN 3BT9A 3JCMe 4R5PA 4EM0B 3EHQA 1C0TA 1L3VA 3CCLN 4HVVA 1OI1A 4DTMA 2AZVA 3G4SA 2K3BA 2CUJA 5LJ5h 3RSNA 3S8PA 4ESBA 2PJPA 1X9SA 1Y07A 2JVVA 2HBWA 1XC5A 1VQ8T 1KFDA 3C6AA 4RAGA 4GY5A 1JCGA 4I2PA 2O8DA 3M0SA 4RTXA 1QZEA 4KH5A 2YHXA 4PLLA 4XQFA 3G6EQ 4A3LJ 2E12A 5AJ3K 3IV5A 4LIVA 2CP3A 2P9NA 1KC8O 3PNVA 2XHBA 5D6EA 3FJPA 5LRRA 1HKBA 2VXFA 1TL1A 3WXKA 4CYCB 2JWTA 5D5WB 2RHKA 2R5AA 4B8AB 2L7KA 4AG2C 3BZCA 3EUHA 1R77A 4JJDA 4FHTA 2M5WA 5A0LA 1XDSA 4FZYA 4CYDA 3FX3A 2JA7J 1WHHA 2XVCA 3T1HK 4KHUA 3WEEA 2COMA 2YV0X 4M3XA 1N78A 3WTYC 3T9NA 2B8AA 4MFEA 3ZSOA 2KIUA 1ZGJA 1U2VB 5GTIC 1SKSA 1IHVA 2BGGA 1K78A 3CUQA 4X62K 1ZBUA 1YJNN 1R71A 5M3MJ 3KKRA 3NNQA 1Q81C 5AQFA 4IJNA 4OPHA 2JS2A 2RC4A 2MSYA 1QPMA 1GL5A 3MVPA 1Y1WJ 1B34B 1YWOA 1HJDA 4CF2A 4W97A 3VS7A 4J7FA 2IG0A 1SAXA 1HSTA 2IEKA 4LD9K 5HRSA 4YHHK 3DKWA 1K8AR 3TSQA 3P9IA 4RTFD 1WH7A 3D2FB 4IOXA 3H5RA 4FSVA 3RMCA 1IBLK 2P9UB 1RR7A 1YJWA 2HQAA 2KLAA 3WHCA 1IJWC 2JWKA 1BHLA 4XLAA 3G7ZA 2G6FX 1VQPQ 2JXBA 3ULQB 1KK7A 1N75A 2MK5A 1D9FA 3OYBA 2R57A 3C2GA 3SFZA 2DK5A 2HTJA 4AIKA 2W24A 1KYZA 4IZ9A 1N5YA 1ETVA 4MZPA 3J7ZI 3OW2P 3K0LA 1LOJA 2YXYA 3DEEA 4IOCF 1VQKN 1X43A 5I42A 2VVKA 2EBPA 3ZQCA 3CCVN 1PVSA 5ERIA 3ML6A 4CZFA 1L3TA 3VPRA 1RT1A 3HP9A 3HTSB 1KG2A 1IO2A 3LH5A 5HDNA 1U5TA 3L7WA 4EGZA 3A8MB 3WTVC 3G73A 3S3NA 1EA3A 4RCBA 2M3AA 2R7OA 4CERA 3VQ5A 4NL3A 5M1FA 1EIFA 3CCUI 1L3UA 2FXUA 1F1ZA 2KYMA 3K9JA 5IP6A 3PO2J 3OW2M 1KVBA 3KZIC 5IT9Z 1K6OA 1R1TA 3QLHA 1NYFA 3MKDA 4H4KC 3F73A 2VC0A 1DP3A 4F7UE 4DQIA 4CHNA 1YIJN 2BY3A 3BG7A 2HAXA 2HOTA 3WGIA 4FJIA 2E64A 2DO3A 2XRLA 3MHXA 3NCIA 4FVMA 2VPRA 2MPXC 1S1VA 4B9SA 2P9LB 5AN4A 4DBFA 4B44A 2STWA 1PM3A 4E1MA 1VUBA 2OCEA 4AT1B 4B4CA 3G4SQ 1QP2A 5M9OA 3T19A 4EAHD 4IBNA 2JNGA 3FIWA 1T8IA 4A5AA 1X9MA 3PUFA 3P4IA 3LSPA 2DL4A 2E2HJ 2CT3A 2RHXA 2X74A 4M41A 2V9KA 2VLAA 4AFSC 1SL1A 1FT9A 4K41A 3MP1A 2QEXN 2DOFA 2RNAA 4D8KA 4JLIA 1XMQK 1MMNA 1ESVA 1PP8F 4KGZB 2IVNA 3GXOA 5D6YA 4ZGDB 2NXNB 2RN2A 3SHFA 2QZ8A 3ATUA 2RK1A 4D0PA 3NWTA 4DV7K 4HNVA 5IT9E 1XCVA 1Q7YC 1FBSA 3R4KA 2BZTA 5M1PA 1FX7A 2QQAA 3KP7A 3CC4I 2ECBA 2EZLA 1CXUA 3BGRA 1LV5A 3Q5FA 1Q82O 1X3WB 2F8TA 2XIGA 4FPBA 5FFXA 4H5NA 4CIGA 3FFIA 1P6RA 3BCBA 1D0XA 1T38A 3JCMJ 1QVTA 4EJTA 3E5QA 4FJXA 3ABTA 1VSMA 4HUEA 1Z6RA 2HGCA 3KKSA 4IG0A 3KWIA 4B08A 1OULA 5CK9A 1TYQB 2VWJA 1V1CA 4CYCA 1UJ8A 2EH3A 2LJ1A 3AVHA 4E7IA 2HSEB 4DTXA 2DO7A 1MGTA 3VODA 2A05A 3ENOA 1Q9YA 3F10A 2NVXJ 5DM6L 5GAMh 2ZMEC 5FLXO 3CG7A 5BRHA 1GXQA 2AHQA 3IWFA 1U2VA 5GAEJ 4B1RA 3ZBDA 4BXUA 2KSSA 2ETHA 2KMUA 2K5CA 1YF5L 1G3WA 1NWKA 4MEXF 1VQ7I 3ZSVA 4IRIA 1BIZA 3GE1A 1YJWQ 3OW2A 5CO7A 3FBNB 1G3SA 3GBGA 1XB4A 1HF0A 4RG8A 2A28A 4DTUA 4BI4A 2YS9A 3ER0A 1B34A 1VF9A 1QO0D 4L9NA 2E2QA 3HL2A 1ZRCA 4WXDA 3CWAA 2HKNA 3C4SA 3CD6A 3CDLA 3O1WA 1ZUUA 1X1CA 3IAS2 1ULYA 1M3QA 4JI1K 3MWTA 3U1DA 2MD5A 4WTOB 2YHYA 3D2FA 3OGDA 1YVUA 3O80A 3U8XA 4Y1DA 4UQGA 1ZGAA 2P9UA 1YQMA 4QOZB 1M8VA 2MD0A 3S2DJ 1JQQA 3VQEA 5L8RE 3WG9A 1UHCA 6AT1B 1ORKA 1KQSS 1TWAJ 3DLKA 3NF9A 4Z4HA 1Q86O 1VK0A 1FW6A 2PN6A 5M1OA 2FPEA 2RI5A 2B5JA 3V1RA 1YJ9I 1YW8A 2IVMA 1VQ5Q 3ZLJA 2K9QA 3ZMZA 1I50J 1VQMT 4CCNA 4K2EA 3AG3H 4AH9A 1QVGP 1LQ1A 3KLGA 4DS5A 2ATQA 3GZNB 5IY5H 5EG2A 5KVRA 4CIFA 3CCRA 1WWXA 4MQ3A 3D1NI 2VBZA 1RBSA 2BUDA 3RDVA 3PJRA 1OVYA 1XDUA 2NLXA 2OTLI 3S9HA 3K1PA 4II3A 5D6WA 3L9FA 3TO7A 2R0QC 2HBJA 1SD5A 2ITMA 5GAGJ 2K3XA 2O31A 2PYLA 2V79A 4DYCA 1ZLMA 3GCMA 3D5LA 4KHNA 1IG8A 5D8LB 2VJ5A 2O4GA 4EVVA 1VQNI 2WAQA 4DBRA 2FUG2 4B8CA 2MC3A 5AQZA 4CJWA 2J6KA 4TVRA 3CCLI 3NBPA 4EJYA 1QZZA 2D5VA 2LJ3A 3QWLA 5E3MA 3VF4A 1YCSB 1KRPA 2W4SA 4Z8AA 1S22A 3VSLA 2IA0A 1V76A 4BWMA 3PO5A 2LDUA 1ETOA 3VEXA 1RFQA 2P9LA 3AA4A 2VGNA 1GOCA 4H8KA 3CJBA 2DBMA 4XICA 4XLFA 4GKJK 4HTLA 4KHYA 2EQIA 3GL1A 4DOZA 1T6CA 2OAZA 5LJ3g 2XDPA 4C2MJ 1B72B 5D6XA 3OSGA 1NLOC 1XC3A 4BXFA 5FRMA 3L2UA 4DQ8A 3HPHA 4LD5A 4ENKA 5DYMA 5M1QA 4PSXA 3KLOA 4FYXB 2V1DA 4S04A 1I6HJ 1MJAA 3CZ6A 3EZWA 4C8NA 2CW7A 2DTUA 2BZ8A 3CJNA 1S1WA 3BQYA 4C8OA 3B6CA 5LJ5g 1OX8A 3D5RC 2BKDN 3O2PE 2HNDA 4I0BA 5A2QO 5KGWA 4X1EA 3SEQA 4FLYA 4CEFA 4RM2A 4M78B 3GVAA 1KAXA 2HWVA 1E6GA 4F3TA 2ZPFB 3GPLA 3MFKA 2DTOA 1M5Q1 1YJNI 3BW1A 2L7ZA 2ASMA 2L4AA 1K8AO 2JUGA 2NOBA 4CJEA 1E0EA 2HCKA 4E6KG 4NLCA 4M6XA 4U7DA 3AGKA 5DM7L 3CCEA 3M0RA 2FBHA 2H1LA 3OB9A 5IYCJ 1EF4A 2DRKA 2WV1A 2QUFA 3I4MJ 4ZN3A 1TYQA 2Y69H 2DVEA 4M3ZA 2PEXA 3ISPA 4I6ZA 2PMZN 4F8RA 3K59A 4RTTA 2GWKA 3JCMd 4AM6A 1ZBHA 4BR4A 1Q9XA 2NS8A 5FPEA 5BN9A 3CD6Q 4B47A 2H8HA 5EEHA 1ZKGA 1WEFA 2DOAA 4DU4A 3TU5A 2I8DA 2EVRA 4WWCA 2E19A 2EIMH 1NG6A 1H89C 2QXLA 1K1ZA 4KKOA 1YG2A 4PKGA 1LB2A 2DA7A 2YUNA 1GLFO 3DXJF 1JE8A 2NOJB 3I56N 1SVLA 1VQKI 4ELUA 3QEPA 5IHNA 2MCNA 3CCVI 2LP0A 4DYQA 4HYEA 1JCFA 5GAOn 1RZ4A 2EINH 4CZLA 3JCMf 4CICA 2LT1A 2CZ1B 2IXSA 3N0UA 2CSQA 3HL8A 3J81Z 3F22A 3VYRB 4DR6K 2E71A 3PIOL 5I2MA 5HNFA 4N4IA 1HCRA 4YFUA 3E3VA 1MA9B 3PQJA 3DMJA 2XICA 4CFBA 2YU9J 3LNQA 1LW2A 1ETYA 4FWMA 1O4XA 1RBVA 1YHQQ 3BR5A 5D4RA 3KLEA 3QU3A 2MABA 3W6JB 2BYVE 1YIJI 2CG4A 3VEYA 2OPPA 1D0YA 4I01A 2FZCB 3QQAA 4RGSA 2HNYA 1ZBSA 3U9DA 1AD5A 1YLFA 2VT2A 1KFSA 3GF2A 2XY7A 2Y0SN 1SG5A 3HFOA 2HQRA 4EA5A 3JRCA 1JKQC 1FZPB 4CW7B 2XGCA 3OS1A 3ATVA 3P83D 2CP5A 4QWQA 2MMPA 2A5XA 3M8FA 2VUMJ 4F3OA 1IV8A 1EWQA 1M8MA 4JS4A 1UDLA 1I94K 5C3EJ 2IRFG 1U5TC 4X1VA 3UKUA 4AI4A 3QUIA 1YBYA 2FSKA 4HPQA 3AVMA 2JA8J 4PJNA 2LYCA 3KTQA 2ID6A 2QEXI 2P0KA 1YI2T 3M0UA 4IHTA 3VGLA 2P9PB 3P9KA 3D4VA 1WGXA 1QSLA 3DB3A 3GEZA 3ABMH 2KRCA 2O88A 1MHNA 3KP2A 3HOSA 1AWWA 3QB0A 3ASNH 4ZH4F 2FF4A 1GBQA 3HRUA 1KHCA 1PKSA 3M0TA 2OZUA 1RDAA 1M30A 4E0DA 4C5EA 4MZMA 2VWFA 4EP4A 2GOXB 3EPZA 3V4IA 2FU4A 3VS4A 1QBJA 2MWOA 1B72A 2HNZA 2K9MA 2DA2A 4FASD 3O3KA 2R7FA 1TK0A 3C6HA 2IGKA 4V2FA 1Z67A 5LJVA 2EQKA 2ZXWH 4WCEL 4R79A 3CCEQ 2DCEA 3LLRA 1QCOA 4XOTA 3C7NB 4H5TA 4M3FA 4P1WA 1A5JA 3SCXA 4PL6A 4A3MJ 1OLTA 5HDKA 2DYIA 2BTTA 3QG1A 3QRFF 1ONVA 4M78A 3JB9J 1KG3A 3H6EA 3FE1A 3HGGA 4M78D 1I5ZA 2D45A 1F36A 4AFUC 3OYKA 2VJJA 4IKFA 4RW9A 3QOEA 4QS9A 2L2OA 3K6GA 1KFZA 5HL7L 5IT9O 4CEAA 4LF5K 3H0GJ 2E1CA 1VQ5N 3I4NJ 4AF1A 1W2BP 1RI0A 4LOCA 1UCRA 4OKKA 1EV7A 1FC3A 1I6XA 4RW4A 1W7PB 5LJ3j 3CW7A 3A0IX 1SAUA 2VI6A 3SNNA 5D3GA 2ESNA 3I54A 2KHOA 1XTDA 1BBYA 1TWCJ 2IIMA 4M42A 2B0LA 4C8QF 5HROA 3CCQN 4BQAA 1QVPA 3LPUA 2ZXHA 3EO3A 1SV5A 4CFDA 2NWMA 3CM6A 4Q0BA 3DFGA 3QEWA 1U6GA 4PY5A 1I27A 1PRLC 4GYGA 3DOLA 3QPLA 4MFBA 3KYLA 3CCJN 1Q1VA 1PHTA 5LJ5j 3S2WA 3LDNA 3D5SC 1W2BM 3BWGA 3CC7N 3PV8A 2NUTB 1JLBA 1G15A 3GP8A 4EP5A 3BEXA 2DTHA 4OAYA 1UUEA 4QVDA 3DP7A 1DT9A 3TANA 3TTDA 3E5XA 1JUPA 2W6LA 5DM7R 2NOFA 3IAYA 3J7YP 4KTWA 2CQQA 3S1RJ 4Y91A 3ASOH 2O3FA 3AVBA 3E97A 5CPRB 3NARA 5HLIA 2M16A 5KRTA 3PE0A 3Q0VA 3OYMA 3MKZA 3CF5F 4EHUA 4C0GA 4HUFA 2GZWA 5GAHP 2MFZA 3UPUA 4UVBA 2XY8A 2QA4Q 3CESA 4KUDK 3W3DA 3QAHA 2DERA 4YOQA 1TKDA 1WUAA 4J8FA 3CCMT 1TQPA 5DMRA 3ULRB 2HQ5A 4CCHA 1V29B 4C0ZA 1JLEA 1D5VA 2P6TA 2VOOA 4IOCL 1XCBA 1GVJA 2WY7Q 2I7NA 2XGEA 5GAOl 2ME0A 2Y31A 3VQ9A 1KU9A 4GLKA 5IOZA 3PSIA 3IWZA 4BGAA 3FZLA 2EFWA 3S15J 3Q9VA 3TEEA 2OTLT 3TQ7P 1EP4A 1S9GA 4B3RK 3ZQGA 5I21A 5EXWA 2R3SA 3DKXA 1BIAA 1KG1A 1X01A 3QO9A 3L2RA 3S3MA 2Q0RA 4NOYA 2LF8A 4H5WA 2X6XA 4DCHA 1D8YA 3E6MA 4EJOA 3NHNA 5CQGA 1IV0A 1ZLJA 2P9PA 1V3FA 2DY4A 5AQOA 2JHNA 3ZL7C 3TARA 2YKNA 3KZZA 3HHGA 4DUYK 1LMZA 1TL8A 4TSXA 1S7OA 5J4YA 4NHJA 4KI4A 5EY4A 2Y48A 1LAVA 1P7IA 2XI9A 2BVLA 3BR6A 4BJ5C 4LFAK 2VN2A 4LK0F 3LCNA 1W2BA 3EYZA 4I9QA 2A5WA 1I39A 2Y1IA 1FOYA 3ZX0A 3O4NA 4CJUA 4HXJA 5F0HA 2F4OB 3BDDA 2E1HA 3X28B 2LY2A 4LD6A 1OYYA 3HOUJ 1ENHA 3VYUB 5LEKA 4Q5WA 3QMLA 4PUSA 3IRQA 4K42A 1UGPB 2W40A 1J09A 1PRMC 4M7XA 1QVUA 4IWVA 1AKHB 2UXXA 3F6OA 3C7NA 4Y13A 2LTOA 4M3RA 1FBUA 1VSDA 1YQRA 3CMEA 2D5RA 3ME9A 4CJLA 2YX4A 2ZZDA 2K57A 4HCKA 4BXXJ 1YHQN 4OMPA 1G4DA 3IDHA 3P39A 4MDXA 2EK5A 2Q1NA 1JJ2M 2VJ4A 4AHTA 4FWOA 4AHCA 1XWLA 1N3CA 4XH4A 3SQNA 1WZ2A 1GLAG 4PL8A 3I56I 2AKLA 5FD6A 4XTWA 4LNPA 2ID3A 4B24A 4LG0B 3DPLC 4HV5A 5H1SQ 1W7PA 2OC6A 3LX7A 4CZKA 3M07A 1P4AA 1YX5A 1QKXA 4U7BA 2EZIA 5K7FA 2ZPBB 3FZHA 1VSHA 1WXTA 2CUDA 1HR0K 3CJRB 2BY2A 4F93B 3JREA 5I22A 3THYB 3G1MA 3O5BA 3L8BA 2F48A 2ZNYA 2V4JC 3CCST 2HNHA 4ON0A 3GF5A 1D5YA 3VYTB 4OX9K 3IUCA 1NGNA 2VKNA 5CQYA 5GAGP 1X2MA 1Z0XA 3ZQHA 3HK2A 2KGTA 2RQRA 5IP9J 3K4BA 5E3LA 2L3SA 3VQPA 1JLGA 1FXXA 3WGHA 4LF6K 3KX2A 3H3NO 1G6NA 5IYBJ 4O8UA 5FGMA 1X1DA 3OTOK 3MECA 3VS0A 3AO3A 2EZHA 3IKTA 4CGGA 5KYWB 1YFHA 1WHLA 2HHQA 1RIOH 1VQKT 1CQTA 3NAUA 2X85A 4M78G 1HLUA 5HK0A 4KV8A 3F5TA 2GXGA 5L23A 5L3DA 1WGSA 2IBDA 4F2SA 3K9TA 4E9EA 2KQRA 2BANA 4RW6A 4OGEA 4ESRA 2KROA 3LGLA 1RT2A 4RWTA 4K8XA 2KJCA 3HC7A 3JCMb 2HF4A 3JCMc 1RT4A 1RACB 5KPTA 3WXIA 3CWTA 1PKTA 1H8AC 2CH6A 1JB0E 2CYZB 2QF7A 1O3RA 4G7ZF 1O9SA 1PDNC 3OA9A 1ZC6A 2FBXA 2W84A 4YOTA 1U06A 4HQMA 3ZT4A 3PX6A 3E1YA 3OY9A 3M53A 2UXDK 4EFHA 2XDVA 2ICWG 2EKHA 3BQZA 4FM1A 1SD4A 2VG6A 3VA3A 2O2OA 3TU4K 2MWPA 2K2VA 4FLXA 1XMOK 1OCTC 4DU3A 3CCJA 2YHTA 3EFOB 2JOYA 2RA2A 3CC7A 2DFIA 1WSUA 3MXIA 1JJ2A 4I09A 1P4WA 3DLLF 1RTJA 2VQLA 1NZ9A 5BPDA 1VQ6T 4MHGA 3FXKA 3H0IA 1UA0A 1OV3A 4RW7A 2B9SA 4ZNXA 2QEXT 4BC4A 4Z0UA 4PJOB 2GXAA 1Y96B 2Q2EB 5JHFA 3MEWA 5J6XA 1NKCA 2DA4A 5JFRA 3JRBA 1BR2A 4M9ZA 1KVCA 3O4WA 3BZ6A 4Q5VA 1ZGWA 2FEZA 5D6FA 4XIUA 1ITYA 3J81O 5F0FA 2CMPA 1HSJA 2K02A 1ZBIA 2FNPA 4J2AA 2RI2A 2CP2A 1YITT 3OHRA 4JOMA 4GVEA 3AO1A 4DMNA 4W5QA 4YY3K 3CMEQ 5GAN8 1LWCA 4UHTA 4MFDA 2STTA 4BB7A 3O3FA 4WFNL 4JI0K 2P51A 1BOAA 1VQ5I 4H0XB 1RI9A 3EFRA 2JA2A 3OQ5A 1L0OC 2Z1DA 3AG1H 1KO9A 4GDFA 3RR7A 4LH5A 1W1FA 2BE9B 2FZKB 3GLXA 1VSEA 1GLEG 4BEHB 3ERMA 4OKJA 3PFYA 3CCQI 1E4GT 3X24B 3A02A 3ZMDA 1AKHA 4FO0A 4K8ZA 2LOOA 4PCQA 1GLLO 1ZG1A 3KD5E 2M9HA 2RQWA 3VS1A 2M4GA 5FLMJ 2V8IA 4CHQA 3RKWA 2L3QA 2WWYA 3QIOA 4RB3C 3V7RA 4C5IA 4XIDA 3OYHA 3E9FA 2XG8D 2E1ZA 3G71A 1BN5A 1MPGA 2QA4N 1YTAA 4CEDA 4M78C 4OMNA 4XH1A 2X6NA 2A1RA 2RKHA 3BJAA 4CGDA 3THWB 4L0YB 2KIFA 1EETA 4BQOA 2NOHA 4LG0A 2EIFA 2Q36A 1N39A 2JN6A 4UOBA 3H1QA 4Z88A 2Z33A 3EKSA 3KPHA 4BVOA 1L3LA 4Z4CA 1R00A 2LRDA 2DPUA 3REOA 1D09B 3JTHA 5GAN7 3DLLA 3A8HB 1AWOA 4MGRA 1BW6A 3K2PA 2CQKA 4C5GA 4MLHA 4C92B 1FP2A 4FYYB 1LEBA 4XKWA 3E2UA 4IUVA 1TUCA 4JKBA 1POGA 1G83A 2DF6A 4IUPA 4RM3A 5DCFA 3J80Z 1YQKA 3CC2Q 5J1RA 1RTIA 3EH1A 1BQMA 1W4MA 3HXMA 3INZA 4Z89A 3VEPA 4B3XA 2DXUA 3NTIA 1FOXA 4OAZA 2YNGA 3A1YA 4N4GA 4IHWA 2HL5C 5KYWA 3A5OC 5CYVA 3OS2A 1T33A 3NDKA 3R3LA 2RQQA 2HOAA 2RAEA 5HLFA 1HBXG 4CGJA 2NUBA 5CVJA 2DL8A 3ZCMA 1DLOA 1RBRA 3CFRA 5I3UA 3JCMg 3ENHA 3ZOBA 3L1AA 2QWMA 1X2NA 3G6ET 1XGNA 3GBQA 3F70A 4I98B 2H94A 1CZ9A 2DDAA 1ZYRF 2EIJH 1M90U 4XRFA 1MBHA 2E6NA 4C0DC 1NJYA 4EJZA 2CGKA 2L4MA 1LVKA 3PNWC 1AOYA 4KN7X 2RQVA 4RTUA 4LDWA 5K1YA 4ELZC 3I8BA 3BTIA 4CZEA 1FNNA 2E60A 2OV7A 1NG2A 2ZXJA 4DOVA 2VPLA 4CZJA 3HKZA 2OTJA 1TNTA 1K4SA 4FJ7A 5E84A 4KT0E 5C2FA 4GVMA 1B6AA 3SJJA 2DFEA 4EM2A 4KITB 2X9DA 1GXIE 4C9YA 1WXBA 4PLIA 4M75B 4CF8A 2OU2A 4IFYA 5AQJA 4AWXB 1TAQA 2F8SA 1NGEA 3ZEHA 4BUPA