3L2RA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
b'AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2rA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2rA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2rA03
3QNNA 4DSKA 4NYFA 3OYEA 1WJSA 4CK3A 4XIUA 4F2RA 3VQDA 3U3GA 3QJ6A 4II1A 4Z0UA 4CHNA 4YFUA 5C0MA 1ZBIA 3NF7A 3OJSA 2Z1GA 1T7PA 1ZYQA 2GF7A 4WE1A 4F3TA 4FCYA 1VSJA 4GMJB 5HRNA 1QSSA 3EY1A 2HHTA 5J26A 4M3WA 2FBYA 1C6VA 3AV9A 4CEZA 1S6QA 2OPPA 2RJEA 5D6XA 2I5JA 3LZIA 4DWIA 3V9WA 1NKCA 2IGIA 3SUOA 3FDRA 3K58A 3FC3A 2KQ2A 3SV3A 1DLOA 4CK2A 4L59A 1N5YA 2ZQBA 3DRPA 4CESA 4ZHRA 3O4QA 4DQPA 1HRHA 1XHXA 4W5OA 4B9UA 4NCGA 1IKYA 4GY5A 2YNIA 4CJQA 1HYVA 1ZBFA 4C5EA 3AVIA 3F70A 1FXXA 2D0CA 2Z1IA 1BCMA 1J53A 3LAMA 4BE1A 2ZE2A 3AVNA 5KCOA 3DMJA 1JLAA 3DM2A 3TI0A 4F4KA 2O4GA 1RBTA 2L89A 4DSEA 1T03A 5HBMA 1IKXA 4KRFA 4QW2A 5I42A 3QEIA 4IBNA 3OVNA 1I3AA 1OI1A 1ASVA 5KH6A 1QSLA 3VQ4A 4CF8A 4OLBA 4CE9A 4LD6A 1KSPA 2KFZA 3AVLA 4E7HA 1FK9A 2RN2A 4C8NA 2JZ2A 1ZBHA 5KRSA 3HPOA 2BE2A 3ZT3A 3ULDA 1A5XA 3TAEA 1YTAA 4Y1DA 3CEYA 3VQQA 4CEEA 2F8SA 1WLJA 2P1JA 3PV8A 4EZ6A 1S1WA 3HXMA 3QERA 2LSNA 4KHUA 3ASMA 2QQSA 1VSMA 3ZSQA 4CEFA 3AO1A 2RF2A 4B9TA 4H8KA 1J54A 1L3UA 3O3GA 4LH5A 1RT7A 1QE1A 2K3YA 1LWEA 3MEWA 4NCAA 2WONA 1GOAA 4Z4FA 1RT3A 2KZMA 1UAXA 3HP6A 2IG0A 4N41A 1IKWA 3VQBA 4CHQA 3NH1A 1J5OA 4L8RB 3C6TA 1YVUA 4KB1A 2EX3A 2QXFA 1O1WA 3SNNA 1JXEA 2X6SA 1S9EA 3BDLA 3ZSZA 2PY5A 1KCFA 2HNYA 4FVMA 2HHXA 4DTSA 3CM5A 4PLLA 1WAFA 1JKHA 3AVCA 4M3TA 3F9KA 2A1RA 3UIQA 4B8AB 3G10A 3KK1A 1JLGA 1CZ9A 1LAWA 3CYMA 3HVRA 4J2DA 4G1QA 2KFNA 2ETJA 2YKNA 4KFBA 4A4GA 3QINA 2XK0A 4M42A 3AA4A 1RDAA 4DQQA 5T7BA 3NTHA 1JLFA 1IO2A 2L8DA 4Q5WA 1S1VA 2QKKA 2VYTA 4DSLA 1RBUA 4DG1A 1X1PA 1S5JA 2KTQA 2ZD1A 2X35A 4CJ4A 1NK5A 1RBRA 4FK4A 2OPRA 4HVJA 4CFBA 3OY9A 3PUFA 3NDKA 4DTOA 3P83D 1OZ2A 3LANA 4B08A 3AVMA 4ELTA 4A4FA 1RDBA 3TAMA 2EHGA 3O3FA 2YRVA 3OYBA 5J2NA 4NCBA 1BGXT 1OYXA 4O0JA 3PO4A 2FC0A 3KKSA 5JS2A 1HQUA 4PLIA 1RT1A 3PX6A 3NBPA 3AO5A 3HP9A 1RI0A 4BDYA 3M8SA 2M1HA 3F73A 3O8VA 1TL3A 3PO5A 2PQWA 1NK6A 3O4NA 4O5BA 2R5MA 1VSDA 3WNFA 2HNZA 4BE2A 2HW3A 2DY4A 2BANA 4KTZA 4OGEA 3MEDA 3DLBA 4DSIA 3OYNA 4FLXA 1L5UA 4KHSA 3VQ6A 4DS5A 1U48A 3AVJA 3L2WA 1UA1A 4DTPA 5HLFA 4QQDA 3VQCA 4CGJA 3KLEA 4FLYA 3L2UA 4ID5A 1TGOA 3OS2A 3QIPA 3IS9A 1HNIA 4DU1A 4FLVA 4Q5VA 4MQ3A 3LP1A 2BGGA 2CKKA 3META 4B9SA 4HUEA 1WSGA 2G8IA 3NGYA 3OYIA 5I3UA 4CJLA 3MP1A 2IDOA 4EDUA 1SL0A 1RDCA 4DQRA 3RMCA 2HVIA 4M3XA 3NH2A 3RRHA 1WSEA 4CK1A 4OKJA 2M16A 1U47A 3LGFA 3QEXA 1ASUA 2RHZA 3U6FA 1B9DA 2GBZA 4E7IA 1D9DA 1TVRA 1KVBA 3AA2A 4OPKA 3PNWC 2RHXA 4Y1CA 3LWMA 3V81A 1G5VA 1JL2A 1EKEA 1TKDA 2M0OA 3QESA 3LP0A 3MXIA 4N56A 2X4XA 2Q3SA 4CERA 4DTMA 1X9WA 3ZT2A 4E7LA 3OYFA 1DTTA 1W9HA 4C5GA 3HL8A 2XY7A 4FM2A 2HVHA 3VQ5A 1Q9YA 4LY7A 2RKIA 2GV9A 4ELUA 4QQ6A 4UC4A 4CHPA 3BDPA 3ASKA 4DTNA 3I0SA 3L8BA 2XY6A 1CXQA 4H4MA 1VSIA 3ME9A 1WSHA 3RMAA 4HTUA 2RI5A 4CGIA 3SQ2A 1Z25A 4FJ7A 1BQMA 4N47A 5FRMA 3LDSA 1XI1A 2AJQA 4BDPA 1A5WA 1S9GA 1W0HA 1WJRA 1TAUA 5FROA 1QQCA 4A4HA 4BACA 3ZSXA 1EXQA 4A4EA 4DF8A 4FJ8A 4R5PA 3L2RA 3S6WA 5JS1A 4O44A 4DF4A 4IG3A 4PL6A 3QEPA 4IUVA 2KW4A 1RT6A 3HJFA 1C0MA 2P5GA 4BDZA 4CJFA 3NNQA 2HQEA 3C94A 4CF0A 3TAQA 2MWPA 3RWUA 3AVKA 3LZJA 3NHGA 4RW7A 5HRSA 3VN5A 3SPZA 3NTIA 2XRIA 1VK0A 2O4IA 3KIOA 4QQGA 4DFMA 1SUQA 4CIGA 4CJKA 1KLMA 1U45A 4H4OA 4DFKA 2YNFA 2RJFA 3ZT1A 2K3XA 4RW9A 4OPJA 4FM0A 1EP4A 1L3VA 3HO1A 4KAZA 3DLKA 4FXDA 2HHQA 4FL6A 1NOYA 3BGRA 4Q0BA 1L3SA 3HVTA 1J9AA 3MXJA 4QOZB 4FJ5A 3TAGA 1IG9A 3TR8A 1Z26A 3VQ9A 2HB5A 1TK8A 3LLRA 1C1BA 3KLIA 3THVA 4DTXA 1CLQA 5HRRA 3MXMA 5KCHA 1VSFA 3OA6A 3T3FA 4PY5A 3G0ZA 3K57A 4IUUA 1VSKA 2R5AA 4CGHA 1XNIA 5CZ1A 1RT4A 1RDDA 5C24A 3DOLA 4Z4EA 4M3UA 3B6PA 1RTDA 1TV6A 4KKOA 1UOCA 3EYZA 4X34A 3KKRA 4B9VA 2YHBA 2JGUA 4IDKA 4AH9A 1NK8A 3NCIA 4CHYA 1NK0A 2OZSA 3ZCMA 5CYQA 4B3OA 4CEOA 2BKDN 2L3RA 2IS3A 5EU7A 3U3YA 3L2QA 5DK5A 3AO3A 3AVGA 4CJEA 3RRGA 1VSEA 3AVAA 5J2PA 5J2QA 3CQ8A 4LH4A 4E3SA 5SZTA 3E01A 1KVAA 4DQIA 4FW1A 3DRRA 1NK7A 4FJIA 4I9LA 3SCXA 4FM1A 2E6LA 4CJ5A 2ATQA 5KE3A 2R57A 2DAQA 3QKJA 3VQEA 1RT5A 1H3ZA 2EQKA 4BWJA 3OYAA 4ID1A 1SKWA 1ASWA 2VWJA 3MP8A 2F96A 4QCLA 1KFDA 4PUOA 1SL1A 2ITGA 4HUFA 3TABA 4KO0A 2HQXA 5M9OA 3OMCA 3PX4A 4DTUA 1K6YA 1B9FA 3AA3A 2OZMA 4E89A 1KFSA 3OS0A 3KD1E 4C8LA 2RO0A 3L2VA 3TAFA 3AA5X 4RW4A 1F21A 5K14A 3GOXA 4KI4A 3MEVA 3A2FA 4AILC 3KJVA 2RJCA 3DLEA 3DI6A 4LSNA 1XHZA 3OYHA 3DYAA 3MECA 2RI3A 1WSIA 2YKMA 1C1AA 1NJXA 3PY8A 4O4GA 3QLHA 4CJ3A 4FK0A 1FKPA 4E7KA 4C5IA 1RBVA 1JLEA 1TKZA 3KUFA 4HUGA 4O0IA 3RMBA 5C42A 4Z4IA 1BI4A 3IG1A 3T1AA 4ELVA 4KHQA 3HM9A 2PZSA 2BUDA 4CF2A 1TK0A 3V6DA 3DLRA 4QAGA 3NTKA 3OYJA 3LP2A 4FLZA 1U49A 3SD4A 2D0AA 4NS5A 3HPHA 2JLEA 2HHWA 2O4XA 1KLNA 2DIQA 5KTQA 1BI4B 2EQJA 2XDPA 4AHTA 4CIEA 1SV5A 3C6UA 1IKVA 1KVCA 3OS1A 3TWHA 3V9XA 3VA3A 4EP5A 1DTQA 1D5AA 3OYKA 1HMVA 3OYDA 4DSJA 1IH7A 1TAQA 4J2EA 2O4XB 3M8PA 3TAPA 2VG7A 1LWFA 4CEAA 2G8KA 3K5MA 4FLTA 1NK9A 3B6OA 1BQNA 3OMGA 2JTFA 2MWOA 4CGDA 5FRNA 3MAQA 3S3NA 3NF9A 1TL1A 2LTOA 3NH0A 4FJHA 5KGXA 2WOMA 2DIGA 5KI6A 1SKRA 4EZ9A 4FJJA 4LSLA 4AHSA 4DMNA 2DTUA 1X9MA 1SL2A 2P5OA 4CJWA 3QETA 3LALA 4AHCA 4DLGA 4E1MA 2A1SA 2HHUA 1N27A 4DS4A 4JS5A 3ZT4A 2DFEA 1HNVA 3OQ5A 1U4BA 3HSTB 3SPYA 3H8ZA 3Q1JA 3L42A 1RBSA 3LPTA 4N4HA 4MFBA 2F5KA 4DFJA 1TKTA 3WNGA 3AO4A 3OYCA 4F8RA 1N6QA 4B9MA 4ICLA 4YNQA 3K59A 4M41A 3LPUA 1JLBA 5HRPA 2X74A 2EKOA 4FU6A 3D45A 4AHVA 1LAVA 4OGCA 1YT3A 1C1CA 4OKEA 1S6PA 2G8FA 2LDMA 1REVA 3DLMA 4JLHA 1EX4A 3QNOA 4M3YA 5C6SA 1QS4A 2E4LA 5CYMA 3SUNA 4E7JA 1MHNA 4J2AA 3V9UA 4QVZA 4KB0A 1RTJA 3OYGA 4W5RA 2D5RA 4OJRA 4FYDA 4HCBA 2OYQA 1C0TA 3M8QA 2P0KA 4DSFA 4FZXC 1NKBA 1LV5A 3D0PA 3VQ8A 4KREA 1Y97A 4RG2A 3AVHA 1QSYA 5FDLA 4N76A 4IUTA 3QO9A 3VQPA 3ZT0A 1WJQA 1OZ3A 1QHTA 2HNDA 2IAJA 3CFRA 2OPQA 2OA8A 1SKSA 3S9HA 1NOZA 3DLGA 3EAEA 3HK2A 5KRTA 3NGZA 4AHRA 2NLUA 3RR7A 3EZ5A 4NYNA 3V1OA 3NF6A 1HPZA 3QIIA 2RHUA 1GOCA 2XY8A 3SJJA 1S1XA 3SUQA 2NUBA 4ZTFA 1B92A 3WNEA 3K5LA 2G3RA 4HCCA 4E19A 3VQAA 2E5QA 4E0DA 3KLHA 4CEQA 4CJRA 4IURA 3MEGA 2DFFA 3S3OA 2WACA 5CY4A 4CCHA 1R0AA 2GFUA 4JRPA 3OYLA 3OYMA 2FBVA 2IOCA 3RR8A 3TARA 5J2MA 4CGGA 3RTVA 3E9FA 3S3MA 3V1QA 2Z1JA 4OVLA 4FK2A 1ITGA 1KHCA 1WNSA 1VSHA 1C0UA 1LW0A 1NJYA 1D9FA 4CJPA 4KHYA 2D9TA 1NK4A 2XO7A 3NFAA 1MU2A 4IKFA 4TSXA 3AO2A 4CJTA 4ZTJA 1I39A 3IAYA 4E1NA 1RNHA 5SWMA 3V9SA 1WSFA 3O3HA 2YNGA 3DB4A 3ISNC 4FLWA 4F3OA 5E41A 1VRUA 1RILA 2X4YA 2GFAA 1YTUA 4Z02A 3AVFA 2B4JA 2YV0X 1BL3A 2FBTA 3PMIA 2DFHA 3LAKA 3AVBA 3TANA 4UQGA 3PMTA 4DTRA 4BE0A 1JLCA 2W42A 1Q8IA 4KI6A 1JXBA 1BISA 4CFAA 2G8HA 4I2QA 4F2SA 3LYIA 1GOBA 1CXUA 4CF9A 3E9GA 3DB3A 4B9LA 2X6NA 3I8DA 4OVAA 1RCHA 3ZSYA 3FEOA 4DU3A 2G8WA 1WGSA 4FW2A 3SZ2A 3LWLA 3NGIA 3OB9A 3HT3A 3MEUA 2VWKA 3JSMA 4FJLA 4IUPA 2X4WA 4LD0A 3CFOA 4HCZA 3FFIA 4CHOA 1SSFA 4C8MA 4FJNA 3UT1A 3NF8A 4BWMA 3JYTA 4Z4GA 4FLUA 4I7FA 3WNHA 5IN1A 4IUQA 3DLHA 1TK5A 2G8UA 4W5TA 2HMIA 3ZSVA 2E6MA 4W5QA 1JL1A 4RW6A 4HHTA 3ITHA 3KK2A 1T05A 3P8HA 3K5NA 3V1RA 1BIUA 4M3RA 4CHZA 1XC9A 4KTWA 3T19A 4CJUA 3P5JA 3SUPA 4K8XA 1TKXA 1NKEA 3HPGA 5J39A 3K2PA 4B9WA 4I2PA 3P1GA 2XHBA 3L3VA 4DLEA 4CF1A 2YHAA 3SQ4A 1RT2A 2GUIA 4AHUA 2FHDA 1T8EA 3LH0A 4KHWA 2HHSA 4CGFA 1Q9XA 4GW6A 1S1TA 3K5OA 3ZEHA 2RHYA 1BHLA 4M45A 2EQUA 1L3TA 1VRTA 4DFPA 5C25A 3CG7A 2RI2A 1WN7A 3ZSWA 1FKOA 4IFYA 1UA0A 4CECA 1HQEA 3KLFA 3L3UA 3PFSA 1A5VA 2VG5A 2R7YA 4KTQA 3MEAA 3IRXA 4I9QA 5D3GA 4B9XA 3KLGA 2B5JA 4CIFA 1WAJA 1D8YA 4NZGA 4CJSA 1KRPA 3SYZA 2G8VA 2F8TA 2RPIA 3V4IA 2FBXA 4KPYA 2EQMA 4CFDA 1LW2A 3KTQA 1RTIA 2HHVA 3CFPA 4Z4CA 2QK9A 4FJMA 2RHIA 2PYLA 2P51A 1RTHA 4Z4HA 3UWNA 1KTQA 4N4IA 3DRSA 4DU4A 4W5NA 5KGWA 4JRQA 2Y1IA 2X78A 4GVMA 1HYSA 3V9ZA 4FJGA 4FZZA 3VA0A 4IFVA 4IG0A 5D6WA 2XY5A 3P8DA 2R58A 4C8OA 4BD3A 4RW8A 4FJ9A 3HYFA 2KZZA 2LCCA 3QEWA 3MP6A 4DTJA 4K8ZA 5KE2A 4C8KA 4O55A 4CEBA 3MO8A 3C95A 4JS4A 4CRIA 1CZBA 1XWLA 1HJRA 2D0BA 2Z1HA 1LWCA 1JLQA 4EP4A 2QQRA 1BCOA 1WSJA 2E6NA 5HROA 3SQ1A 2BDPA 2QKBA 4PQUA 1G15A 3SV4A 2YNHA 3ZSRA 4PA1A 4CEDA 2RJDA 3LX7A 3C4SA 3QIOA 3VQ7A 3MEEA 5IAYA 2B6AA 3OJUA 3SQ0A 3I0RA 4N5SA 1ZBLA 3NAEA 1S1UA 3KD5E 3KK3A 4M3ZA 4FZYA 2B8AA 4B8CA 3M9QA 4C5HA 1BIZA 4KV8A 1EETA 3M8RA 3QBYA 1NJWA 5DMRA 3RMDA 2OPSA 4J2BA 4FJXA 3PX0A 4OLAA 4KHNA 5CZ2A 4PWDA 4FJKA 5J1EA 5D6YA 3CM6A 2BIVA 5HP1A 1QTMA 4B9NA 1VSLA 2EFIA 3SI6A 2IC3A 2LVMA 2PYJA 3QEVA 3FLGA 3DOKA 3LP3A 2Y1JA 2VG6A 2LRQA 1HYZA 4CFCA 4CJVA 3H6ZA 3NE6A 3H08A 4N4GA 5CIUA 4DQSA 3LGLA 1UWBA 1ZBUA 4OKKA 1U04A 3ALYA 1NJZA 1X9SA 3ZSOA 4RG8A
chains in the Genus database with same CATH superfamily
1M3AA 3QNNA 4DSKA 3VUZA 1MPGA 2OZ6A 1WJSA 4GBQA 2CQ7A 1QCOA 2JMWA 2YHXA 2Y2ZA 1PWTA 3U3GA 2LVSA 4Z0UA 4CHNA 4L9TA 2NVYJ 1CGPA 3OJSA 1WJCA 2BEOA 3OSSC 3JXUA 1KO9A 1KG4A 3CJ1A 1QZ6A 3UF4A 3R6MA 2HGCA 1BKBA 3WG7H 3JCMg 2DTOA 1X4OA 4LIUA 5EDNA 1MMGA 3T5XA 3LL3A 1Q95G 4M3WA 3HC7A 2P84A 3P8BB 2JUGA 3AV9A 1S6QA 2A0FB 1BBZA 3KZBA 2GUPA 4A6DA 3LWHA 3ZQIA 1NKCA 4GO1A 4J6XA 1BO5O 4DV1K 3DXJF 4A93J 2IW5A 2DJNA 4OMPA 1D5VA 5FB2A 2YR2A 4JI3K 2ABLA 1I5ZA 1ZH5A 1N5YA 2ZQBA 2HDWA 4ZHRA 2E5KA 2X3WD 1R1VA 1HRHA 2LDUA 4JI5K 2JWLA 3N05A 4W5OA 2M34A 1J09A 4LGWA 1ACIA 3CC7N 1WHMA 1K8AU 1HYVA 3A1PA 1PSEA 2BE7D 4C5EA 2OFKA 2FRYA 3F70A 3J80E 1IO6A 2QWQA 1X2NA 3E97A 1B9MA 1P92A 1ATNA 2P9SA 2D0CA 4DW6A 2QM1A 1TC3C 3RESA 4BQOA 1HX1A 3ZQFA 2ASMA 1A6IA 4UVAA 3QRFF 2LQ8A 1TUUA 1W5CC 1MW7A 2I2LA 3AVNA 3WVDB 4M7AE 2JHNA 1A36A 5GJVB 3ZBDA 4F4KA 1S8NA 1E7OA 2O4GA 1VQPQ 1OR7C 2ZSHB 4DSEA 2ESWA 2HQAA 1MMAA 4JI0K 1JJ8C 3I8BA 3M8EA 3GWZA 2DEUA 3D5SC 4IIOA 3E5UA 2WBNA 3IP4B 1OKJA 3RKYA 3JS6A 4M7YA 2X48A 1YJNA 1M8VA 4XOPA 3CO7C 3D7SB 3ZFJA 2HZTA 5LBQA 2YHYA 3FRNA 2WC2A 2H6BA 1YITA 1FK9A 2OA4A 2JZ2A 4X6AJ 4XSZF 3GTLJ 3TAEA 2X4HA 3LSTA 4A3MJ 1B3QA 2OTJQ 1M3QA 2F8SA 2YX6A 2XMFA 4BXXJ 3DEUA 5FFXA 3PV8A 3WXJA 3BY6A 2NVUB 4V19K 2QSGX 2ENMA 2VT2A 3VRYA 2V9KA 1WQWA 3SJMA 3Q5FA 3ULEB 1K9MC 1K9MO 3TP0A 2DYRH 1VQ4N 1YHQQ 1YJWI 3O3GA 1QE1A 1KONA 1YIJQ 1LWEA 3GFLA 3MEWA 1SZ2A 1HBXG 3S1NJ 1Y39A 5C0YA 1VQPT 2NRTA 1F9NA 5LJ5g 3U9DA 4K41A 4HOBA 5AQKA 4PSWA 3CD6I 4CHQA 3VQBA 4L8RB 5TRDA 1V29B 4ENJA 5JLFA 3EGDA 1TWGJ 4KB1A 4OMZA 1Q81U 4IZ9A 1L3LA 3R3LA 3TU5A 5EXWA 3A0HC 2DL5A 1O1WA 3P9CA 2QQ8A 5KVRA 3BDLA 4CCKA 1KCFA 2HNYA 4DTSA 3CM5A 1WAFA 1NGEA 1JKHA 2RGVA 1PVSA 4XK8E 3U9GA 1ZQ3P 5LGUA 1YYVA 2YCHA 3G10A 4ME7A 3KK1A 2P4TA 1JQQA 2RH2A 4UV8A 1WEIA 2YU9J 1JLGA 2OTLQ 1XG1A 2OTJT 1U0JA 4J2DA 4G1QA 2CW0F 2WSFE 1JE8A 4KFBA 3E2UA 4ESBA 5GAN3 4ZYDA 1YI2T 2XK0A 3CWAA 3HTSB 4KUDK 4M42A 2X6XA 3G4SI 1LOJA 2QQAA 4DQQA 3OSVA 3NTHA 2FSWA 3DQVC 3OIOA 2VYTA 4CVNE 3GTGJ 5DCMB 3TQ7P 5LY3A 3CCLT 1RBRA 1GLDG 1YIJT 2DT5A 2JUCA 2JVVA 3LQQA 2E1ZA 1LWWA 3OY9A 3I3LA 4RMOA 3H3UA 5LEJA 5GAOr 2HSEB 3L6QA 1VQ6I 5IT9K 4BY6C 5AFUH 2HMPA 4CDGA 3CWSA 3TAMA 3MJXA 3D5LA 4DV3K 3HUGB 3JRGA 1YAGA 4NCBA 3J7AP 4L0ZB 3I0XA 5IHNA 2E1HA 2XI9A 5JS2A 2EPDA 4EVVA 5H20A 1VNDA 4EHUA 3OL3A 3HP9A 4L5GA 3R0JA 1SFUA 1FSHA 2M1HA 2JA6J 4AFZC 3OR2C 2KRSA 2DOEA 2OTLT 3PO5A 2F1LA 3ENBA 4CZHA 2Q2EA 2IGMA 2K3PA 1W0TA 2NRZA 2ELJA 1I50J 4HF1A 3CCMQ 1VUBA 2CWEA 2BANA 4KTZA 1IB8A 2WWYA 4RTUA 1FOYA 1VQ4T 4NLCA 3QPTA 4ZN3A 1RLPC 4BYYA 3EG0A 5HS7A 3HZJA 2Y30A 2KIFA 3BWGA 2FQ4A 4OIOF 3AVJA 1FLIA 2J6FA 4PIIA 1UA1A 3HPWA 4AU7A 2FX0A 3VTIA 1JT0A 3R60A 2HKQB 1QGPA 4ID5A 3Q0VA 3S2WA 4KISA 2D0QB 2JVGA 2ISZA 2EZKA 4DBFA 2X6YA 4JJBA 1TL8A 2Z33A 4PSXA 4LF6K 4C2UA 1XN7A 3K9KA 4GY2B 2DPNA 5JR3A 1TT5B 2IA1A 3META 2HEOA 2E10A 4C8QG 2FL7A 2DD5A 1YG2A 3VGLA 2W03A 2DZCA 1ABOA 2H3GX 3CJCA 3K9TA 1VQ5I 1YX3A 1KGSA 1XMKA 5I3UA 1O9SA 2JA8J 2JVHA 2FB7A 4YDUC 4B1ZA 1GLCG 2V8KA 1SL0A 1RDCA 3BG3A 2HVIA 1MNDA 2CV0A 2EPFA 2JMCA 2KNBB 2XU8A 3RRHA 3M0PA 1KQ1A 4C92F 1AOYA 4ZGJB 1U47A 3LGFA 3CQTA 1IBKK 2WUSA 2VN2A 5D5WB 1B9DA 5AQHA 4AFQC 1YQRA 4BY6B 3AA2A 3FZKA 4BR9A 3V81A 3E1YA 3LDPA 3CWTA 3CIPA 4DNCA 5E3MA 4BRQA 3QESA 4N56A 3VEVA 2X4XA 4DTMA 4M75F 3J7AO 1XMAA 2QENA 1VQ8N 4E7LA 2QSHX 2V8IA 3WXIA 3OYFA 1DTTA 4QTRA 4H0YB 5CHZA 5FLXK 4IJNA 3HL8A 4M77D 5DUIA 4L9VA 3BEXA 2F4OB 2XY7A 2HVHA 2DXIA 1ZG3A 1R8OB 3JCUC 2RKIA 1W5SA 1JTXA 2KBTA 2GV9A 1VQ9A 4AYBN 3DWLA 5IPAA 2VQFK 4JI8K 2GM4A 2UXXA 4CHPA 2CGHA 3ASKA 4DTNA 3L8BA 2P0WA 4BUPA 2XY6A 3EUHA 1CXQA 5K5OA 2V1RA 3RZOJ 4QSHA 2EA2A 3ME9A 3RMAA 4M3GA 2A42A 1HXDA 1Z7UA 3EEQA 4FJ7A 5LMNK 3CCVN 4K0KK 3CUOA 3LDSA 2A3SA 2AJQA 1CF7B 3BQZA 1A5WA 1X2QA 5M1NA 2ED0A 5GIOA 4PJOF 3QG1A 2ZGZA 4II3A 5J1UA 4CYCA 2YDLA 4DR2K 2IRFG 4BACA 2COYA 3ZSXA 1EXQA 2RM4A 3K0LA 2YT6A 4CZEA 4A4EA 1SPKA 2DBMA 3C18A 5J1RA 4FJ8A 3D5RC 4Z89A 1GLNA 3S6WA 5JS1A 5FGMA 3J80Z 4HSBA 2Z16A 5JVGF 2LD5A 2NVTJ 2BUPA 1UEBA 2LJ3A 4BRNA 5TKWA 3HJFA 4I99C 1GBQA 3C2BA 3W2AA 1VQLA 1TYQA 3QP6A 1JUMA 1QVFP 4BVPA 1VQNQ 4RW7A 4MNUA 3A2KA 5EEHA 2A07F 3JB9J 3MPUB 4UNOA 1BJAA 1MSFC 3KIOA 2HR3A 3CCRN 2XGDA 4M75C 4DR4K 2JA2A 2K86A 4EJOA 4R0KA 2BOLA 3HZ6A 3ZT1A 2K3XA 1UG2A 3VGMA 1EP4A 1L3VA 1K76A 4A2UA 1ABQA 1K9MU 3I35A 7AT1B 3F0ZA 4KAZA 3MCZA 2RPNA 1FMVA 3CD6A 5GAN4 1NGBA 2EIMH 5AZJA 2HHQA 2RV8A 4WTOB 1J5YA 1W97L 3EKSA 3K9JA 2CGPA 2CGJA 3GUDA 2NNWA 4KGVB 3MXJA 2CYYA 5F1XA 1VZ0A 1X2KA 3MN7A 1VQ8T 4I0AA 2DE0X 3TAGA 1X27A 5EEAA 1WA7A 5LJ3d 1Z26A 3VQ9A 2DO7A 3MKDA 3E66A 1V4TA 2C0TA 4CW7B 2HAXA 4JHDA 1SF9A 2LBFB 1YCYA 3JCMW 2C06A 1M2VB 2NOEA 4PY5A 4C8QD 5DYMA 4IUUA 3I55N 1VSKA 3X28B 5E8IA 4P5OA 3DV8A 4JX6A 3FSPA 1VQNT 1CSKA 5KYUA 1IDZA 1P7IA 3FJPA 5EG0A 1I3QJ 2PG4A 4XU2A 3DTEA 4HT8A 4Z4EA 2LY2A 2UXBK 4M3UA 2P5VA 4JNEA 1NH3A 1RTDA 2IIRA 4RTZA 2QYOA 3ULRB 3CCVT 2UU9K 1XQPA 2RQWA 4IDKA 2OV7A 5KK1A 4AH9A 1NK8A 2HOTA 3BUZB 1Y71A 5CYQA 2PVGB 2BKDN 2L3RA 2IS3A 5EU7A 1RABB 1WNLA 4B3RK 4IX7A 3VU3C 2LSOA 4KICA 5DK5A 2HTJA 3AVGA 5KCMA 3A0BC 2QKMB 1IXSB 3QWLA 3AVAA 2EIJH 4D7MA 1XC5A 3CQ8A 5JVHL 2KRNA 4YOUA 3FFKB 1BW6A 1Z21A 4E3SA 5A0LA 1AKHA 1XMQK 2F2WA 2B9SA 4D1QA 4DQIA 2HXOA 4XKWA 3SAFA 3HJEA 5BR8K 1BK2A 1SRMA 2E6LA 2ATQA 2R57A 5HDGA 2XAQA 3CCUI 2ASPA 4M75B 1DPRA 2K57A 1Z6RA 1IF1A 3OYAA 1ZREA 4AVPA 3BZCA 1ASWA 2X6OA 2K79A 1KAZA 2F96A 1KFDA 1NGAA 1SL1A 4KT0E 3RSEB 3E19A 2ITGA 3X26B 4OIRF 2E7WA 2RKHA 3G1MA 5D5XB 1NG7A 1R4MB 3OOUA 3PX4A 4OB3B 1TUGB 3K69A 1G59A 4NLBA 2BTFA 1VQ7A 1OH6A 3OS0A 4LLGF 3PSIA 3KD1E 4C8LA 4OPHA 2RO0A 1K6OA 2H09A 4ZH4F 3J81O 3ULQB 2HS5A 3EQLF 3A2FA 3K4CA 2DF6A 3KJVA 5JFRA 3H45C 4F93B 3IH7A 3DLEA 1X3WB 2ESHA 2NNNA 3DI6A 4AIKA 4LSNA 1ATRA 5DD8A 3DYAA 1K4SA 1C1AA 3P9KA 1VQ5A 4M7DA 3HXLA 5M5YJ 2O8CB 1B4AA 1FKPA 3BE3A 3DBLB 2HTSA 1QCNA 2HD0A 1SHGA 4XRSA 5GADP 1ZQ1A 3GEZA 4HUGA 1P7MA 3EGXB 3F9MA 2XUBA 4C2TA 2DRKA 1YCSB 2ZZDA 3AG2H 3WTZA 3AGKA 1N77A 4KHQA 3GNGA 1ETVA 2MMPA 2O61A 3CC2A 2DXBA 2WAQN 3NTKA 3KP3A 3QU6A 4FLZA 1V4RA 2XB5A 3G1LA 2P9IA 4I0BA 1WIEA 1H9TA 2EIKH 5HDNA 2DIQA 3MMVA 3EFSA 3E7LA 3TOAA 2RQTA 3B6CA 4A5AA 3PLAA 3CC7I 3NWSA 2OI3A 4BC5A 2MH2A 1NG9A 3EFRA 3RI4A 1K73C 1K73O 3TWHA 1QVTA 4EP5A 1DTQA 2CQXA 1QMCA 3OYKA 1IV0A 2QXLA 4X62K 4K25A 4DBRA 1X69A 5E8GA 1T08B 2NUPA 2YX7A 4QLCU 1GV5A 2JA5J 4OIQF 3TAPA 2XF6A 1BB9A 2OU2A 2QQ9A 4BQQA 1PD0A 4BBSJ 2L9NA 2L7KA 2JTFA 2ZBKA 1X6OA 5I21A 3Q7CA 2DBBA 4MGRA 4ZYAA 1TL1A 1KZHA 2LTOA 4LN2A 3NH0A 1WJBA 5IYBJ 2WOMA 4XONA 2DIGA 1YUWA 3CCQN 3V4GA 4DMNA 2DTUA 1XGNA 1SL2A 2DJQA 3V8LA 1C0GA 1TSFA 4WF2A 3M3YJ 4JPBW 4CZMA 3THWA 1GLLO 1KD1C 5JVGL 4DLGA 3L4IA 4Y7NJ 4RB0A 4BKXA 3VEOA 1Y6IA 5A0GA 4KT5C 4L0YB 2DFEA 3U23A 4PJLA 1HNVA 1VQON 1HPMA 2KIUA 4CYDA 3SDGA 3FXRA 2K4JA 3H8ZA 1KQ9A 3LPTA 1NGDA 5IWAK 1KEAA 4E1JA 1AOJA 1T8IA 2PFUA 1TKTA 2DD4A 2HBPA 1HU0A 1ZLJA 3OYCA 3HRTA 2CG4A 4A0ZA 4YNQA 5J40A 2LRDA 1UHMA 1WX6A 4NXMK 3LPUA 4JLIA 1JLBA 1RRQA 2RN7A 4XTWA 3CC4Q 4FWKA 2F2VA 4FU6A 4XAXB 4MMKA 3LNQA 3D45A 2RREA 4ZYHA 4AHVA 1RUOA 1S7EA 4UNFA 4OGCA 3TEEA 2JSCA 1ZSZA 4OKEA 1S6PA 1BN5A 1QWEA 4QS7A 1F36A 4KIGA 2KSSA 5DUKA 4HZFA 4EMHA 3GF5A 1T0FC 5D7UA 5C6SA 5CYMA 4KBMB 2DTRA 4J2AA 3RJPA 3CUQC 4JKHA 3V9UA 2KQRA 5HS9A 4OFAA 1QVFS 1KG6A 1RTJA 2LQWA 4YIRX 1P4XA 5LFAA 3JTHA 1DT9A 2K4YA 4OJRA 2O9VA 4HCBA 2OYQA 2QGUA 4DSFA 3VF6A 2NS8A 3CCEQ 3D2FA 2V7FA 3D0PA 3LMMA 2JT4A 5AQYA 4DQ2A 4LDVA 1QKXA 1QSYA 1KU7A 2EBIA 5FDLA 2DDAA 3BTJA 3VQPA 3HI0A 3C1DA 1OZ3A 2EW3A 4N0AA 4F14A 1PC0A 3QPSA 2IAJA 1RLQC 4A2AA 5DM6F 1GV2A 4RTYA 2OPQA 1OH5A 4UB8C 1SKSA 3K2ZA 2NYXA 2DL7A 3CJQB 5DM7L 4MEYF 3HK2A 4PUSA 3NGZA 1IGUA 2HZYA 4A5BA 4AHRA 2LX7A 3RR7A 3EZ5A 5ILSA 3K4BA 1VFCA 3IC7A 4Z8AA 1OCRH 3ZN1A 3QIIA 1U78A 3VYSB 2DVJA 2K2MA 1GLEG 3CCQT 3G6EI 2O7OA 2LZ6B 1DDNA 3RQIA 1GXPA 3VTHA 1N3AA 1B92A 2V4JC 1YFNA 3UKUB 1JTYA 1BR1A 3WNEA 3FHGA 2G3RA 4FOIA 2HHHK 4HCCA 2DDBA 1T56A 4BC2A 1DKGD 4KH4A 4PKIA 4YHHK 2O6GE 3PQKA 3FHFA 3VS7A 2HF4A 3MWPA 1FT9A 1VQOT 3I58A 2LLKA 1M1KC 1M1KO 2KRHA 4IURA 4IQJA 5CY4A 3I5RA 4KDPA 1NGNA 2LMDA 1QVGA 1FBUA 2AQFA 4NNJA 3GDQA 3CCSN 2A3LA 2ELHA 3OYLA 3KEQA 1F43A 2IOCA 4D9JA 3TARA 5J2MA 3ZX2A 4XU3A 2ZXIA 2VUMJ 3CCYA 2E65A 1LE8B 3S3MA 1IRZA 3V1QA 4FK2A 2A6TA 3I9QA 3CCUA 3CMAQ 3T7ZA 2XAHA 2EB7A 1D0ZA 1NYGA 2DK8A 3S41A 5KQ8A 4C1NI 3PO3J 1D9FA 3BPVA 1MGQA 4FE4A 5E1WA 2DQLA 1FP2A 4UUVA 2QW9A 2CP2A 2CV1A 2W85A 3KFWX 2D0NA 4CCMA 2D6FA 1T3VA 2W7NA 4IKFA 4BR0A 3CUQB 3HB9A 4ZTJA 4WQ4A 3O1WA 3JB9F 2QAZA 4S05A 5SWMA 1UTIA 4CUGA 3HFOA 4A61A 4A3KJ 1WSFA 1Q82C 3O3HA 5A2QO 3GTKJ 2A68F 3NRVA 4Q4ZF 1XB4A 4BXFA 2JOYA 1IG8A 1U2WA 2ZJRF 1B59A 2YV0X 3VS5A 3Q0WA 2P9SB 3CXCA 2EINH 5C12A 4UQGA 4L9JA 3S16J 1LDKB 3H5AA 4G6QA 4DTRA 1U5TC 2OJED 2FNPA 2K85A 4X1VA 4IIMA 3RDVA 4LIVA 4CFAA 4B24A 4F2SA 2PEXA 4V2SA 3SZPA 5E3OA 4XICA 2M4GA 5IT9Z 2JTMA 1E17A 4PL7A 3DPTA 1GOBA 1QZ5A 2H1KA 1RCHA 1BC8C 2JN0A 4ABZA 4M77E 4Y3OA 4IRHA 2JZYA 1W2BA 2QI2A 5LJ5j 2YHTA 3HKSA 3KPHA 4XIDA 1T39A 3EG9A 2BE9B 4FJLA 4IUPA 1YRNB 4LD0A 1HSQA 2R7VA 3EO3A 3FFIA 5GANe 4CHOA 1A35A 2K7AA 5GMKe 5JHUA 1ORKA 4JAXA 3EG1A 1TW2A 4D6WA 4C8MA 5AZIB 2ZJPF 2OANA 3NF8A 3DBHB 4JKGA 3JYTA 3PNVA 5BQTA 3O5ZA 2E2OA 1VQMQ 4BB7A 2Q31A 3SK3A 3VYGA 4FLUA 2JXBA 5E17F 3CMEQ 3DLHA 1TK5A 2VQCA 1DUXC 4MQVA 2FNAA 4CH7A 2QEXQ 3ZSVA 3SAGA 1K73U 1V4SA 2A28A 2ZCFB 3EH1A 1JL1A 4RLQA 4X65K 2AS5F 5CO7A 1T05A 3P8HA 1O7LA 3V1RA 1XDUA 2E5NA 3QMLA 3CCVI 3VS3A 1S6LA 1Y96B 3HTVA 1SD6A 2OZUA 5FLVA 1XTAA 3U9ZA 5LHIA 2KEAA 5ILVA 2JUFA 3SUPA 1WPKA 4K8XA 1PKSA 1TKXA 2XB0X 4LD9K 4LB6B 3GP8A 3HPGA 4LDYA 5J39A 1LFBA 3P1GA 2HYJA 4DLEA 4CF1A 1ZLKA 2YHAA 5F0XA 1MDUB 3X25B 4FSVA 3SQ4A 1UJ0A 2CH4W 2P0PA 1WHJA 4AHUA 1JXOA 2FHDA 1T8EA 1XNRK 3REAB 4KHWA 5TJJA 2WTEA 5C2FA 3HOVJ 4F7UE 1KD1U 3ZEHA 2HKOA 2RHYA 4LMYA 4A5NA 1GT0C 4DFPA 2P7VB 1VQMT 1U5TB 1WN7A 2F5FA 4LK0F 4IFYA 3FK7A 2MK5A 5CR2A 4CECA 3CCRI 5FLMJ 3TSZA 5LGNA 3CVTA 3CF2A 3KEOA 1QBJA 1B72B 1VQ4A 5AQJA 1W7AA 2FXUA 5F1JA 3HRGA 2FMYA 2DA9A 1ETKA 3ELKA 3IRXA 1QPMA 3ZQHA 1ZR2A 2DK3A 2J7IA 1Q1VA 3E3VA 5GTIC 4JI2K 4U0VA 1O3SA 3ERMA 4X1EA 5FLXZ 4NZGA 3F22A 3URGA 5HDKA 1GUUA 2M9HA 2CSQA 3LSIA 2G8VA 3WEEB 4BGAA 4B21A 2DJIA 3SBTA 2F8TA 2XRNA 3VJPA 2FSNA 4C8QE 4BL0B 1J6ZA 1LW2A 4OMMA 3KTQA 1RTIA 3C0CA 4NC8A 2HHVA 2NWMA 2EJFA 2BHYA 1OYYA 1RTHA 4Z4HA 4C92G 1KTQA 2X1EA 4BRDA 1U6ZA 4JRQA 5KGWA 4B44A 3C3WA 4GVMA 1HYSA 5DM6L 3V9ZA 3BG6A 1IHWA 3VA0A 5JI6A 3ZR8X 3I55I 4IFVA 1FOKA 5LJ3j 2XY5A 2NOBA 1QP3A 3P8DA 1YF5L 2IPOB 4A6EA 3BJOA 4RW8A 3M3ZA 4M75G 2ZGYA 4IRIA 3MP6A 1BUPA 1S22A 2VQHA 1I4K1 1EZZB 4O55A 5IHIA 4PGGA 1I6HJ 2C0OA 3X24B 1DP3A 3NQOA 2H1LA 2DA1A 3A01B 1GFCA 1U5SA 2NLXA 3DAWA 2EK5A 4JS4A 1HJRA 5CKTA 1RADB 2DPPB 2D0BA 1LWCA 1JLQA 3O9QA 2EILH 5HOOA 1WSJA 1RFQA 4ZDLA 3ZMZA 1H641 2QWNA 4BC3A 1HDDC 5IP7J 1XNQK 1LJ9A 3MK6A 3SV4A 4BHCA 2YNHA 3ZSRA 1N34K 1U1SA 2JNGA 2AXTC 4PFPA 4CEDA 2RJDA 3DTIA 2EGAA 3C4SA 1P2FA 5LD2C 3VQ7A 3MEEA 5IAYA 3A5MC 5FPNA 4KH5A 1EWQA 1M1KU 1X3UA 5JLWA 3GFMA 5KN8A 2G6FX 5GAMh 4HBLA 4AIHA 1CQTA 4M9XA 1ONVA 2B8AA 4B8CA 1BIZA 4MDWA 3MZYA 2F2EA 4KV8A 3TKYA 4EJUA 1EETA 3H3OB 1RUNA 1XDSA 4KH0B 3IH3A 1R5GA 4JD2A 3QBYA 4B3AA 4J2BA 3N5NX 4FJXA 4XTVA 4MO7A 4WFNL 2HL3A 2W48A 1BJZA 4W97A 5FFZA 4C3JJ 2X3XD 3CM6A 2Q0UA 1EH6A 1VSLA 1YNZA 1QQJA 2HBKA 2YRDA 3SI6A 1T6SA 2PYJA 3QP5A 3QEVA 3FLGA 3JRFA 4C2MJ 2Y1JA 4CFCA 2K7LA 1S72I 2IGKA 5HK0A 4GXOA 2PJRA 1WQ2A 3L00A 1IRXA 5IYDJ 1ETXA 2WSEE 5CKBA 4IO8A 1UDLA 4IZZA 3LGLA 1UWBA 3S1MJ 2MBFA 1Q82U 2Z3YA 2J5OA 4YTLA 1H0MA 3RQ4A 1OV3A 1R1UA 2QGGA 3ZSOA 1J0RA 1D8KA 4IXAA 4PKGA 2E6ZA 4M9SA 2QCOA 3I56I 4J9BA 4L5EA 4XKBA 1ZBIA 1NU0A 1NLVA 2VJJA 1QU3A 3FLCO 2CO5A 3HOZJ 2Z1GA 1T7PA 3BTIA 2E7XA 4FCYA 2LC4A 3JCMf 2YG8A 3LDNA 1IG7A 4X64K 5HRNA 1NJIR 1QSSA 2MOXA 3OH6A 3ZQ7A 3ESWB 1EIFA 2HHTA 4M7DF 1XQSC 2DYSH 1CKBA 5HODA 1N78A 3PNYA 5D6XA 1ON1A 5F0HA 3KNTA 2V7YA 4DWIA 4DR6K 3V9WA 2A05A 3VS2A 2IGIA 1FPQA 1VQ8A 1WEGA 5GANh 1KAXA 2E88A 1VYUA 2BHZA 2DNUA 1G2BA 5GMKh 2EZLA 2DTZA 2R7TA 2F4IA 1NLPC 3SV3A 1DLOA 2UXDK 4CK2A 2M30A 2ESNA 4CESA 2LY1A 4CZLA 3O4QA 1Y0NA 3BG9A 4AYBA 4ISGA 4C92D 2QWWA 1I5OB 4HTLA 1RGIA 1ZBFA 4RB1A 3DTKA 3OGDA 1EH8A 1RAGB 3L2CA 3BY7A 3G71T 4HX4A 3LSMA 3O5BA 1BCMA 2COZA 1B34B 3QHSA 1YJNQ 1J53A 4FX0A 3WGIA 4BE1A 4M75D 2V1DA 1ZSGA 2ZE2A 2DL8A 4H5WA 2UUBK 5KCOA 3CCVA 3U1KA 3DMJA 5J8CA 1YWOA 1NE8A 1YITQ 3LSJA 1PYVA 4H0EA 5FPEA 1RBTA 4KT6A 5AZJB 4MLOA 2VKEA 4JN4A 4IO9F 4DEXA 3LSHA 2P5LC 2E4HA 1MIJA 1DIZA 3QEIA 3H9QA 5LL6Z 2MC3A 2GWRA 1ASVA 5KH6A 5GMKm 3ISPA 2X6WA 3VQ4A 2R7RA 1D0XA 4LJZF 4OLBA 3EUKL 4I98B 4JX4A 4LD6A 4B1RA 1TXQA 4YFKF 4F3QA 1Y57A 4HX7A 2RN2A 2EQIA 4LDWA 3ULEA 3HPOA 3O6WA 1SRLA 3GYHX 3RMQA 4NXNK 1F1ZA 3KXTA 1A5XA 3B73A 2GQIA 4XR6A 1KAYA 2A5YB 3S1RJ 4PJOD 3O4WA 4LC9B 3PUBA 1JKQC 1W0UA 3CCRA 2P1JA 3H6EA 4EZ6A 3HXMA 1WZ2A 4O6JA 2M87A 4CZCA 2O5RA 3ASMA 4ESJA 2QQSA 3L9FA 3ZSQA 2EJ9A 4CEFA 3M4OJ 2K9GA 1FTZA 5BRFA 4YOVA 2P5KA 4H8KA 3WTYC 3C6AA 5J6XA 1WDXA 2K3YA 3ENOA 4HSRA 3T9NA 3IDHA 2BGCA 5CVVA 4Z4FA 1RT3A 3F8FA 1UAXA 2EGEA 1RETA 1Y07A 3C6TA 3GVAA 4RB3C 1HW5A 3F6OA 5GAMg 4F9OA 2QXFA 2E3IA 2HF3A 2OF7A 3SNNA 2X6SA 3FMSA 2QZ8A 5GAN7 2KT0A 1O57A 2R92J 4FVMA 2HHXA 1P59A 4HVVA 4PLLA 2EFNA 1ZG1A 3AVCA 4M3TA 1PKTA 5EY4A 3UIQA 1P4WA 2FEIA 2XICA 3E6CC 2KRCA 4FPAA 3I55A 1OR7A 2DKGA 3JSCA 2NAZA 3CPFA 4GFBA 4JKBA 1IJJA 1RPWA 3HVRA 3MCPA 2YKNA 3BTCA 2P9KB 4AI5A 4C0ZA 1LCUA 4WCEL 4ELZC 4Y13A 3VYHB 2B63J 4HPQA 3A8YA 2E36A 1JLFA 2WAEA 2IS4A 2QKKA 1DU0A 4EEFG 1XS9A 4AFSC 1RBUA 1X1PA 1GCQC 1GCPA 3HUGA 3ZLJA 3DXKB 3GG4A 2X35A 4CJ4A 1NK5A 3T1YK 3E9PA 3VB2A 1MGTA 2OPRA 4L3QA 4HVJA 1UGQB 4CFBA 3K70C 1YQMA 3NDKA 4FWMA 2P9LB 4C0FA 1XD7A 3LANA 3UNGC 3WTXC 1AZEA 1RDBA 2NRAC 2W4SA 2L0KA 2V1NA 4M71A 2RE2A 4OFHA 5J2NA 3CBPA 3IKMA 2BYVE 3CCSI 3M0SA 1BGXT 4J6YA 4PDKA 1QVGP 4BNCA 4A3CJ 3QPLA 3R0AA 3WE2A 4PLIA 1RT1A 3GBTA 3ABMH 3SEZA 3BY5A 2E70A 3GX4X 1RI0A 4EMKA 2GQVA 4BDYA 4YOQA 2QDLA 3F73A 3VEPA 4J7IA 5CVUA 4RAFA 3O8VA 3DXMB 3M7GA 1OEBA 2Y4YA 2PQWA 4GV6A 3JRAA 3J80O 1WZOA 5KAFC 3TW7A 3WNFA 2UUCK 2STTA 4BE2A 2HW3A 2DY4A 3A02A 4PZJA 3C7NA 1ZBSA 4XU1A 2ZSIB 4V2GA 1AWCA 2NUTA 9ANTA 1HF0A 4M7AC 3OYNA 4FLXA 1L5UA 1YHQI 3VQ6A 4KHSA 4DS5A 4YEJA 3CC4N 1U48A 1Z9ZA 1JGSA 4XOTA 1I27A 1RAIB 4U7DA 2NYSA 3DEWA 3FJ5A 3AL0C 3IS9A 3IHUA 1BI0A 4EMGA 1HNIA 3AGRA 2A7YA 2UUAK 4YFXF 1HCRA 4M3BA 4FLVA 2PMHA 2RNJA 5EF6A 2R7QA 1NK2P 3AKZA 2P9UB 2K5LA 1H9GA 1BWFO 3LP1A 1X3NA 2VJ5A 2BGGA 5I2MA 3CP8A 2XIDA 4N0AC 2XV4S 4HUEA 4JYAK 1QKWA 1RDWX 1R00A 3BZKA 3BQYA 4BAYA 3CWUA 1Z3YA 5AYFA 5J8FA 5C4XJ 2GNCA 1EQYA 3H46O 4CJLA 4DR3K 3R61A 3MP1A 3JRIA 4EDUA 5FW9A 2ZO4A 1RDUA 2KFDA 4FX4A 3QWYA 4FT4A 1RC9A 4A3FJ 4C3IJ 4DQRA 3LWFA 1PU6A 4EA4A 2WAQA 4RCBA 3NH2A 3THWB 2YJEA 3QEXA 1YJ9Q 1ASUA 1EV7A 2VBYA 1VQ9Q 1TVRA 5E1XA 3O8MA 1KVBA 1VI0A 5K7HA 4CC4B 2CS7A 3PNWC 4Y1CA 2QWPA 1G5VA 1IUYA 4QVCA 4IQ4A 3NVMA 4H4KC 1YQLA 1KU9A 1FIPA 2Q3SA 3CP2A 3ZT2A 4UUTA 5IT3A 1KC8R 4CZGA 4DV5K 1SVMA 4UVCA 4FVUA 5LJVA 5C3EJ 2KKOA 2UXCK 2A3ZA 4D5CA 3D6RA 4FWSA 1X58A 1KFZA 1YJWN 1RNLA 4C0DC 2QK0A 3VPRA 1PG5B 4PJ0C 2O3FA 4DK9A 3TU4K 3OA9A 1CF7A 4ELUA 2XG8D 3JCMJ 1UG0A 3I33A 1HLVA 3AHUA 2UXNA 3I0SA 2RNAA 1Z67A 4BGBA 4IO9L 4H4MA 3TO9A 3CCQA 2JK3A 3WXMB 1WHGA 2X1CA 1WSHA 4M7AB 3OW2A 4HTUA 4Y52J 1QHGA 4HAMA 3CCMI 2XDDA 3R9PA 4CGIA 3SQ2A 2DRMA 2JWKA 1VAZA 5FRMA 3JTGA 4F04B 1S3XA 4BDPA 1W0HA 5F0FA 5KPRA 5HLHA 4DKWA 1TAUA 1VQLQ 5AQPA 1Q86U 1VQOA 3AL0B 3GBGA 1IUFA 4HXJA 2V26A 5KPTA 2J4RA 4YDUA 3L2RA 1FN7A 1GXIE 4DF4A 4KNYA 1X43A 3M53A 5ED4A 2P0QA 4GCVA 1IREB 4ZGDB 2QBYB 2P5GA 3JB9G 2G0EA 4BY1J 2HQEA 1X3ZB 4JKEA 4RMNA 5F04A 1HQCA 1K8KB 3TAQA 4HVWA 3QXEB 5DDGA 2RF0A 3RWUA 3CD6Q 5HRSA 1TUYA 1ENHA 5CQGA 4OB2B 4OO1J 1YS7A 3NTIA 2NS7A 2O4IA 1VQ6N 4MFEA 5GPAA 2F2XA 4QQGA 2COMA 3V7CA 1SUQA 1JJ6C 4CJKA 1U45A 1M90O 4H4OA 1E3PA 1QZEA 4B1UB 4DFKA 4RW9A 2Y0MA 2R7DA 3RBBB 2LR8A 4FM0A 5J4VA 4H5VA 3I4PA 4IHTA 1QWFA 3CDHA 2FVUA 5FU6C 2LBFA 1UHSA 1M2VA 3TEDA 4LDUA 4FL6A 1NOYA 1AD5A 3BGRA 1V1CA 1TT0A 2NOJB 2PN6A 2JN6A 1L3SA 2O8DB 2FPFA 1J9AA 1OYIA 3AFHA 2K2VA 4FJ5A 3F3XA 1FBQA 4BQLA 4KMUX 2O8XA 2AZVA 3FZFA 4HRIA 2KZVA 5AQQA 3H92A 3IKTA 3LLRA 4C0DB 4DTXA 1YJWT 2VWFA 5HRRA 5EYRA 3MXMA 3UB5A 2STWA 5KCHA 2M4KA 2QWMA 3CMMA 1NGCA 2CP5A 1YQKA 4A57A 4AM6A 1A6QA 1MMNA 3WUHA 1XNIA 3CD6T 5J47A 5CZ1A 1RT4A 1N6AA 3K1NA 1M2OA 4MDAA 3O2PE 1I6XA 4X9CA 4H0XB 3ZPLA 3I64A 1UCRA 3DOLA 4S0HB 3PGGA 2MF2A 1TV6A 4WCIA 2LT4A 1JJ2P 1ZRDA 1UOCA 3KKRA 1OCPA 2JHJA 4BJTA 2YHBA 5E79C 3QDKA 1JT6A 2DI3A 2FRHA 3NCIA 3HRUA 1FY7A 1W7PA 1QZYA 4CHYA 4H5RA 1NK0A 3A03A 4ELYC 1YE9A 1UG1A 5H6QA 1NGJA 3PJRA 1Z1DA 2HSPA 4N9IA 3FXOA 3QU3A 4WXHA 3AO3A 2A5WA 3JAMK 2HDAA 4YOXA 2R0QC 2RQVA 2NZTA 3WTSC 1M3HA 3CCSA 4FPBA 3G4ST 3IV5A 3A5ZB 3OSGA 1WJFA 3E1SA 4LD5A 5L3GA 4YOWA 5SZTA 1MMDA 3RSEA 3EFOA 8ATCB 1G3YA 4JK1X 3QQAA 5KN9A 3HSBA 1IRFA 4FJIA 4FM1A 1GXQA 2MABA 1VQ7Q 2W40A 2DAQA 2HBMA 4G7ZF 1FYLA 4HF0A 2V6EA 1RT5A 1VQ6T 4A3LJ 1OU9A 1I5LA 3MQ0A 1E0EA 4NBQA 2L54A 1HUXA 3JRHA 5DY9A 4HVUA 3CF5F 2EKHA 2O8EA 2XDVA 4PUOA 5BN9A 1QVGS 5CHIA 4IPAA 1QLYA 1LNWA 2EWNA 4JKAA 5FU6B 2ASOA 4DZJA 5M9OA 4OAZA 3OMCA 1K6YA 3HHGA 1YWPA 1S9HA 2ZXWH 4XTZA 1B9FA 3H1QA 2R5YA 2OZMA 4JKGB 2K27A 1MD0A 4E6RA 1AA7A 3L2VA 4BGDA 4D8KA 1ZELA 4GGGA 1N32K 3GFIA 1JXSA 3GOXA 1E3MA 3VMFB 2AQEA 2I7NA 4ILGB 4AILC 4B3SK 2RJCA 4JK9A 2COWA 2W1OA 2FF3B 3EYIA 3CC2Q 1IZ1A 1JKPC 3MECA 2RI3A 2YKMA 3JB9D 3SHWA 2DPUA 3C12A 4AD9A 3JCMX 3K1PA 2H6CA 5CQYA 4ILJA 2ME0A 3ID8A 1XSVA 1IJWC 4BU2A 5ADXA 3PFIA 4RDUA 3TL4X 1JLEA 4O0IA 1FP1D 4B6MA 3RMBA 1PVEA 5C42A 4J9EA 2XD0A 4Z4IA 2HMAA 4LXCA 3IG1A 3DU6A 3OWTA 4ELVA 3HM9A 2PZSA 3LDOA 1Y0MA 3H0HA 4F91B 2EV5A 4C92E 4XH1A 1HNWK 3GZ5A 3V6DA 3DLRA 2FXAA 1O3QA 1JO8A 3GTPJ 4QAGA 3Q0UA 4BBRJ 4BRIA 4FETA 3LP2A 3DP7A 3A8HB 1U49A 2Y0SN 1QVFA 2D0AA 5DLOA 1FMWA 1EF4A 4P9UA 4HNVA 1IAWA 5GAN2 1E3HA 4EIKA 1VQ5T 2QA4Q 4QS9A 4NB4A 1HK9A 4J00A 4KHPK 1QVGM 5B1BH 4M75E 2VONA 5M1KA 2LQNA 3C6UA 2BY3A 1KVCA 1T38A 1RACB 3V9XA 1T98A 2L0AA 1FSEA 2YLBA 1HMVA 2L9SA 1OULA 2EVRA 4DSJA 1TQIA 1TH7A 1ZN2A 1YP5A 2O4XB 1MA9B 2G8KA 3K5MA 4E7SA 5IYCJ 4LFAK 5ILUA 3GZ6A 1BQNA 1GHCA 2MWOA 3TPQA 4U67L 5AONA 2DXUA 5FRNA 3S3NA 4O3MA 3A8GB 4JV5K 4L6V5 2VYPA 4FJHA 4R1HA 2DA3A 1SKRA 4EZ9A 4FJJA 3S2DJ 5DEQA 1X9MA 2P5OA 4B3XA 4CJWA 1LDJA 1PP7U 4PJOE 5AT1B 1JBMA 4QKUA 1USTA 5CE3A 4WQ5C 2DT6A 4MO4A 1M1FA 2VXEA 4DS4A 1W4SA 3ZYYX 2DN0A 3ABTA 5IY5H 4RTFD 4JZ3A 1U4BA 2DODA 4DR7K 2VQLA 1GLBG 2L7ZA 3F2KA 3BROA 2R7WA 2CH4A 3SPYA 4ESRA 3HHTB 3I5UA 1LVAA 1ZA1B 3O1BA 2F4VK 3HGGA 3KLNA 1BC7C 4CI6A 3WNGA 2D0OA 1MZBA 1N6QA 2Q2RA 4ICLA 3K59A 4M41A 4DR1K 1MJAA 3KEYA 3LW5E 4KIFA 3H41A 5HRPA 2X74A 5BPLA 4RAZA 4JKFA 2EKOA 3HOSA 1W2BM 4M6XA 2CUJA 4G6TB 4M73A 4M74A 3KYLA 2DTHA 1BW5A 1SFKA 1YT3A 5A2QK 1C1CA 2J6OA 2JMAA 4M72A 1JRIA 5HS8A 2LDMA 5ECAA 3ML6A 1EX4A 3LM9A 2VQGA 1QS4A 2E4LA 4E7JA 1MHNA 1TOVA 2GGRA 3WU0A 1MDMA 2OD5A 4XSXF 4QVZA 1SAZA 2VXFA 2XAJA 5AQIA 4U0YA 4KB0A 2R7OA 2Q1ZB 1H88C 2GXBA 3OYGA 4W5RA 2WC9A 3B6AA 1EFNA 3OH9A 3CJBA 1Z6TA 2K9QA 4FYDA 4MDBA 2KDZA 3M8QA 2P0KA 1LV5A 2SEMA 4OMLA 1ESVA 3N97A 3VODA 4N9HA 1MWKA 3VQ8A 4KREA 3HSFA 4RBOA 4AC0A 1Y97A 4XRSG 3A8LB 2JS0A 3FF5A 4X0GA 3K4KA 1IN6A 2ZGWA 5AQMA 4JD2B 1PUEE 4BHBA 1UHCA 4JJDA 2HU9A 3UKUA 3BCAA 2PU9B 1R58A 3EAEA 2HVQA 2L2OA 1B1BA 1FW6A 3H3VK 1QW1A 1SEUA 4DYCA 3MN2A 5DM7R 3V1OA 3NF6A 1U9NA 4MDXA 5DD4A 2O8BA 2RHUA 4H0PA 4OMQA 3WTUC 3VSKA 2ICWG 1S1XA 3QOEA 2CDTA 4DV6K 1T95A 3QZ9B 3DCFA 4AUXA 2E5LK 2PJRB 4M4ZA 4GLKA 1AWXA 3K5LA 2DL4A 2F5TX 4HV6A 2E2QA 2L7MP 2R5ZB 3VQAA 4XN0A 3LSKA 4GNIA 1LE8A 2AO9A 3KLHA 5D5VB 1Y8QB 3I54A 1OU8A 2OCEA 2EYXA 2DFFA 2WACA 2E1YA 2WB1N 4H0VB 1JJ2S 2LF7A 1R0AA 2GFUA 3G71A 4B43A 3NWTA 4J83A 1T0FA 3OYMA 1H8KA 3SZTA 3RR8A 3CF5L 2MI6A 3CUQA 4A3IJ 2MC4A 3RTVA 3E9FA 2MD5A 1KHCA 2EGCA 4FQGA 5FKKA 3CC4I 4WXCA 1MBKA 5EEGA 1LB2A 1YN8A 2D9TA 1WSUA 5AQVA 3WODF 3CW7A 3T1BA 4TSXA 1OX9A 2JW4A 4UB6C 3JAME 4CJTA 5AQRA 3IAYA 4E1NA 4LLNA 1EJ9A 5EC7A 4HLXA 3Q3SA 2E34A 2YNGA 3DB4A 3ISNC 3V8JA 5FLXO 1WXTA 3REOA 5E41A 1VRUA 5F27A 3J8AA 1ZBXA 2GFAA 1YTUA 3CCUT 3AVFA 3FZVA 4XLFA 1PCXA 3FXMA 5AQXA 1I8FA 2EZHA 2FBTA 2DFHA 3CCEI 4O5FA 2F5CA 1YBYA 1QCFA 4M3EA 1V5FA 4ON0A 3TANA 3B02A 4J9HA 2ZC2A 2VGMA 3BPXA 1OCZH 3KCCA 3V42A 1FJGK 1AZGB 1B9NA 4KI6A 4KN4X 2V6CA 3O8GA 4NHJA 3RERA 1IN5A 1JCFA 3GOIA 1BYMA 2BE5F 4BR2A 1YRNA 4EV0A 3N4MA 3BCBA 4RLFA 2KHOA 1KYZA 4M7AG 3SFMA 2XGXA 3AY9A 3LOCA 2XC7A 2P7CB 4CF9A 1D8JA 3HSRA 3DB3A 1JJ2M 2ZPIB 2X6NA 1N36K 1VF9A 2DMNA 4OVAA 1OPCA 1WHUA 4UVBA 2BY2A 4A3GJ 5AZIA 2ZXJA 4HYEA 2DM1A 1IW7F 2HDDA 3SZ2A 2PLYA 5BMZA 4ITVA 3CPEA 3OV8A 4LLLA 4TV7A 3OB9A 3HT3A 1YI2Q 3JSMA 4BQAA 4QVDA 4J01A 2GCXA 2XIGA 2ZJ2A 4EPCA 3SEQA 5K1YA 2YHWA 2FJ1A 2YXYA 4RS8A 2A5XA 4I7HA 4M7XA 1SSFA 1XGMA 1F1BB 4FJNA 3CCLQ 1V55H 1WH7A 1KXPA 5HLIA 1UGSB 1PUFB 4EMKC 1Y96A 2WFBA 4M7DD 3RYRA 4A4KA 1XUPO 3D7EO 2HMIA 2VI6A 5IXBA 1JKRC 3UDCA 4RW6A 4DBQA 4JKCA 3LH5A 3KK2A 4HT9A 2O2OA 2GZWA 4Z6YA 3KK7A 4U7BA 3KFVA 3CMAI 3OW2P 4M3RA 1CKAA 2DEQA 1UJ8A 3KZYA 5CYVA 1PDNC 2DTIA 4CJUA 3CC7T 4YPRA 4MQ9F 2W57A 3SWNC 1H89C 2B7EA 3T1HK 2Z5UA 4A3EJ 1U5TA 1SANA 3JCMd 3L3VA 5GADJ 2I5UA 4XKVA 1RT2A 2GUIA 2CGKA 1VQ4Q 1ZG5A 2NRRA 3LH0A 2ZXHA 1QPIA 4XTUA 5AFUA 3HEFA 1Q9XA 1KJWA 1B72A 4GW6A 4TVRA 3BOQA 3K5OA 2EQUA 2LNHB 4V2FA 3KYDB 2XGCA 5C25A 1M1GA 2LK2A 1PJRA 2GTDA 1TQPA 3DJCA 3G6EN 1UA0A 4D5FA 1UB4A 4RKUE 1HQEA 3L3UA 3WEEA 4C3HJ 3EKUA 3VFZA 2NOHA 2D1XA 1SAUA 4E9FA 4WYBA 2VG5A 2R7YA 4KTQA 3MEAA 1BOTO 4BS9A 1BU6O 3VUBA 4B9XA 1BR2A 1B8IB 1EBMA 1WAJA 4F92B 2ME6A 3ZQQA 5GMKl 3CCJN 1M90R 3FZHA 4EM1A 1VOMA 1YVNA 2RPIA 3V4IA 2FSKA 3ZGKA 3SMSA 3HG9A 4KPYA 3J7AF 3Q9SA 1ETWA 2GELA 1YJ9N 3AARA 5L3EA 2ROLA 3ABKH 1WI3A 2RHIA 1IZ6A 3GTMJ 2P51A 2I8DA 5DLQE 3H35A 4FASD 2CW7A 2ZB9A 1STZA 1UHFA 2H56A 4EMKB 2X0LA 2KXDA 4DU4A 4W5NA 2Y1IA 3WTTC 1Q7YC 1Q7YO 5CKHA 1UJYA 4FZZA 2HEQA 4ESFA 3CBOA 3BP8A 2QTXA 2DMTA 1M3BA 1V5GA 3CMEI 3A01A 4XM3A 4C8OA 2QEXI 3LA3A 4FYXB 4FJ9A 1Y8RB 5KNLA 3C7NB 3HYFA 3QEWA 2XSJC 2NUTB 1WH5A 4K8ZA 4Q47A 2FPDA 3AAPA 2OBPA 3PT9A 2J05A 3F23A 3JCMe 1XMXA 1N25A 1MBEA 3SWNB 4DB3A 1OH8A 2DAOA 1HNXK 1PSFA 4E70A 4M77C 4CRIA 2Z1HA 1G3WA 5HROA 3THYB 3BJAA 2JTVA 1N39A 4MEXF 2WSCE 1PD1A 3TSUA 1VIFA 1BR4A 1G15A 3G1OA 5LJ5d 1T0JA 2A37A 3S15J 4ORZA 1WHKA 3OIQA 2AA4A 4PA1A 1RUWA 3EN9A 5ICGA 1RR8C 3B8AX 2VOPA 2RN8A 3WGHA 3F72A 3QYBA 1RZ4A 2CH5A 5GAHP 2PUOB 2O8KA 3G6ET 2DA5A 4JK7A 3P39A 2DXTA 4RTXA 2ISYA 4U0WA 4FZYA 5BPDA 1W36D 3IMXA 4JQFA 2KT8A 5AQFA 2CUZA 1LCKA 1F5TA 2ZMEC 1ZTRA 2AKKA 3CC4A 1M27C 5GAEP 2M2EA 3RMDA 4FISA 2OPSA 2D0PA 4IOAF 3MVPA 1OKRA 4GVEA 4A69C 2OAUA 5J1EA 2IEKA 3CCJT 1IV8A 1Y1VJ 2KVQG 4AT1B 3O8HA 5HP1A 5AN4A 3VF4A 2KIMA 1BM9A 2AHJB 3LP3A 2VG6A 1HYZA 1UHWA 4CJVA 3H6ZA 4OB1B 1I81A 3H9GA 3H08A 1GVJA 4NC6A 1WOQA 2OAZA 3NPFA 4AMCA 2ITMA 2YUOA 1KYWA 1ZHFA 4PGHA 1KG2A 1M1EB 4CBWA 1U8RA 1LNXA 5HNFA 3JV3A 1TQMA 1X9SA 1ETOA 2YUPA 4E4HA 4PJJA 3HOXJ 3OHRA 4PFZA 4CK3A 4F2RA 3VQDA 3CJRB 1KK7A 1TWAJ 2BXZA 5TISC 3I0TA 3M4YA 1VQ8Q 4GKJK 3NF7A 3RYPA 1Y56A 2BH1A 5E3LA 4WE1A 3H0DA 4F3TA 5J4YA 4CZZA 2YPRA 3JAMZ 4XNFA 1TZLA 3KP4A 2WTUA 1BIAA 2L7FP 1V54H 2D4WA 2HQNA 1A31A 4M77B 3EYYA 1C6VA 4CEZA 4AQYK 2OPPA 2RJEA 2LYCA 5LJ5e 4JK8A 3JCMV 3DPLC 3LZIA 3PTAA 1ZGWA 4DOZA 3S17J 5JLHA 1SS6A 3SUOA 3FDRA 4C8QC 3D1NI 5LMUK 1RIOH 3FC3A 2G7UA 3K58A 4JUVA 1B34A 2KDSA 4LF9K 1YJWA 3CCVQ 2GXGA 1KG3A 1BU1A 2VKVA 3IHOA 1G99A 1XTDA 1XHXA 4D0PA 5ICCA 4B9UA 1IKYA 3G3ZA 4GY5A 2V75A 2YNIA 4FT8A 4M78A 4CJQA 2HKNA 5IHKA 4ZJZA 5FKLA 2GA2A 3RMSA 3NEUA 3E5XA 3DEEA 1ZC6A 2RVCA 2ZMEB 3LAMA 3IUCA 1A0NB 3IRQA 2IXSA 1BA0A 4IDHA 1JLAA 3DM2A 3TI0A 3ZMDA 1OMIA 3RPQA 2A36A 3EHRA 3DWLE 4ISFA 3K1MA 1TNSA 3VWBA 5HBMA 3HM8A 3RTRA 2FPEA 1WFWA 5I42A 4FTHA 1ZGAA 4IBNA 3OVNA 1Y1WJ 2QM3A 3CCRQ 4E9HA 1QSLA 2RK1A 2VB6A 4QPOA 1LPLA 4CF8A 3G4SA 2HOAA 4JI1K 4JZ4A 1IHVA 1P90A 2KYBA 3OW2S 3ZOBA 2PI0A 2KFZA 2NVXJ 3FDYA 3J80K 4E7HA 2V52B 4F7UB 5KRSA 4I6MB 3PIOA 1VRLA 2BE2A 3VESA 3ZT3A 5JMVA 1NHAA 3VGKA 5TGTA 4B1YB 1YTAA 2MPXC 2E1MC 1R9TJ 1POGA 1BA1A 4CEEA 1VQ6A 1KQ2A 2YWWA 2CUBA 1WLJA 5FO5A 3VEZA 3VERA 1S1WA 2KISA 3QERA 3PIPA 2LSNA 2M0MA 2PVDB 3SMPA 3F0CA 1NYFA 4XTYA 3AO1A 4FWNA 2Q8KA 2JQ7A 1WBDA 1KA8A 5I22A 1K8AO 1L3UA 1W7PB 1ZARA 1RT7A 2FLOA 3J7ZO 3F6VA 3KP2A 1N9SA 2ECBA 1I1SA 4NCAA 2WONA 3GLXA 1WUAA 3WQTA 1WBBA 3O3KA 1GOAA 2V51B 2D8HA 4N41A 1IKWA 1J5OA 3JW4A 1YVUA 2XAGA 5GAMf 2M7BA 4YOYA 1PM3A 2NUZA 2JM9A 3PQJA 1UFMA 4C8QB 2L3SA 2D1VA 4A54A 2YU3A 3CCRT 4G94A 3JCMQ 1JXEA 1Z3XA 3ZSZA 2K9SA 2P9KA 2WADA 3EFOB 3CQZJ 5IT9E 2A1RA 4B8AB 2K5IA 2QA4N 4CBUA 2MG4A 3VEWA 5DPKA 1NWKA 3VEXA 4B8XA 5LJ3e 3DXKA 1CZ9A 1LAWA 2EV0A 5EVZA 2W6KA 1WJAA 2Q36A 2KFNA 1G3SA 3OW2M 2O8EB 1QQMA 4A4GA 4RTVA 2P9LA 2EFQA 1S7OA 1YJNI 3AA4A 3JR9A 2W00A 2EYYA 4GV3A 5T7BA 1S72N 2E3HA 2ED1A 3CPWP 1IO2A 2L8DA 2ACJA 2KR3A 2X1DA 4WK8F 4DSLA 4Y17A 2R5YB 2KTQA 1ON2A 3G7ZA 4FK4A 3RR6A 2WBMA 1AWWA 3W0LA 1N75A 3I55T 1E6HA 4DTOA 4HWIA 1QA6A 3CETA 1NJIC 1NJIO 4B08A 4AWXB 3I56N 4ELTA 4JRIA 3DXMA 4A4FA 2EHGA 3SAHA 3O3FA 1HNZK 3OYBA 4HQEA 1VQKN 2YSQA 2FQ3A 2LNVA 3PO4A 1Z9CA 5K7FA 1HQUA 4GYIA 3UKRA 3LSPA 3PX6A 5A2QZ 2XHCA 2E1MB 3VV0A 3VOEA 3NBPA 1NEGA 3AO5A 5FKMA 3MX5A 4YELA 1Q81O 3KZZA 2M0YA 1U3EM 1KHIA 2Z2SB 1RL2A 1ACMB 3O4NA 4FYWB 4O5BA 2KY9A 4AVZA 3HTRA 1LOTB 3ROUA 5GANf 2JG6A 2HNZA 2EFOA 2BZ8A 1K1ZA 4OGEA 3MEDA 3K4LA 3DLBA 1WLPB 2HQRA 2GWKA 4DSIA 2FA5A 3OSFA 4BQNA 2ZFWA 2P9UA 4KRTA 1ATSA 4BI3A 4O8KA 4FHTA 3L2WA 2BZTA 5BPNA 2SRCA 3AG3H 1T33A 5GTHC 3QDRB 3D2EB 4CGJA 4FM4B 1TGOA 1IN7A 3PVLA 1HLUA 1BOBA 3OS2A 2IAIA 3QIPA 2EAYA 3J7YP 1WXBA 5GAGP 3N4QA 4DU1A 5L3FA 4XL9A 4Q5VA 4MQ3A 1WWXA 1ITYA 1BI2A 4JRKA 2IVNA 2EYQA 2LQKA 1GCQA 2CKKA 1J3TA 1WSGA 2HWVA 2O0YA 3NGYA 1UFFA 1NTCA 3OYIA 5FLXE 2FO0A 4R56A 2XAUA 2GQQA 2V9VA 1LWYA 3U2RA 1K61A 1E2XA 4ISEA 2BY1A 3HSCA 2AXLA 2DX1A 2IDOA 5EOYA 2H27A 5AR0A 4AG1C 5C44J 4KH1B 4XEIA 3EETA 3QSUA 5EGOB 3KP5A 1S72T 2CZ7B 3QICA 3JSPA 4M3XA 1KG7A 1XQOA 2Y0SA 1KQSP 1D1BA 2ZNYA 4M7DE 5LJ5h 2GBZA 4E7IA 1QHHD 5FWCA 4NQWB 3MCAB 4OPKA 5F1RA 3M8JA 3LWMA 1JL2A 1M5Q1 1EKEA 4RAGA 1O13A 3QYFA 5FU7C 2WAFA 1TKDA 2M0OA 3I56T 3LP0A 3MXIA 3TBIA 2R3SA 1X9WA 2MLGA 3CCQQ 4RGXA 5IOYA 5FD6A 1HKBA 5GAN8 4E7ZA 4C5GA 2V8JA 2A6EF 1SFXA 3VPZA 4FM2A 2GXAA 3VQ5A 3WGGA 4M7AA 1R4NB 1J2XA 1GRIA 4OF1A 2H8HA 4II2A 3VSLA 5AQZA 1S3JA 1SFOJ 3I71A 4QQ6A 4UC4A 3W3CA 3TW6A 2HCKA 1VQOQ 4I01A 3O6BB 4XK4A 4J8OA 3OL4A 2RI5A 1MDMB 4Y91A 4OIPF 1JXMA 5DV5A 4N47A 1FWZA 3P7NA 1XI1A 1E4FT 2K3FA 2HDCA 2W84A 4OWRB 3MN5A 3CZ6A 2XDBA 2QBYA 4M3DA 3QWXX 1K8KA 2DLPA 1TS9A 1SVLA 4OB0B 1P6RA 1KQ8A 4DF8A 4XTXA 4R5PA 4ZZDA 3PL8A 4O44A 2JT1A 3VENA 3LFUA 4IG3A 4UY8I 1UGPB 1F4KA 3QEPA 2QDYB 2YUQA 4IUVA 2KW4A 1RT6A 4CJFA 3NNQA 2ZPGB 1HA8A 3V7RA 2VL8A 4CF0A 2W41A 2MWPA 1VQPN 2ID6A 1ETYA 3AVKA 1XGOA 1FYNA 3LZJA 2EJGA 2Q0OA 5AIPA 2XRIA 2R7UA 4HX8A 2O8BB 3NFCA 2Y75A 2KPMA 3QZ5B 1R49A 3CVSA 3CCJI 2IBDA 3L2ZA 2O8DA 1KLMA 3PVQA 3BR1A 4ZN1A 3CERA 1G83A 1QVFM 2YNFA 2CP0A 1KU3A 1C6VX 1XOVA 1VHXA 3CO6C 3HO1A 1VYVA 1SFEA 1BIBA 1YJ9I 4YG2F 3DLKA 3RKQA 4HLYA 3O08A 4FXDA 1VQ9I 4HNTA 3VS0A 1TG0A 5FU7B 2OTJN 3SEMA 3SLCA 5KYYB 1N8RR 2E2JJ 1YI2N 2OUMA 4BI8B 2ZJQF 1U1TA 4JLGA 4B1XB 2HB5A 2JS2A 2WV1A 4FWLA 2IJLA 2KJCA 4ZNXA 2D5VA 1IDYA 2QWOA 2QASA 1CLQA 4IHXA 2MYSA 2CRGA 1YHQN 5LJ3h 2DZ9A 3CCLN 1VSFA 1LWVA 1Q7YR 1YIJN 3OA6A 2BW3B 3EH2A 2R5AA 4B48A 5B5EC 3HOUJ 3PE0A 3ZQGA 1RDDA 1ZLMA 4FSXA 3B6PA 4HEA2 1WPYA 4B3TK 1WB9A 4DUYK 2TDXA 2L3PA 3CCSQ 2HYFA 2LF8A 4IXCA 2YRCA 3JREA 3PSFA 3D4VA 4B9VA 2F7TA 1LPQA 4DIQA 2DVEA 2OZSA 4RGRA 5F08A 3ZCMA 3WQUA 4IEEA 4B3OA 4CEOA 3S6IA 2Z1DA 1VQLI 3RPUA 3U3YA 3SDBA 2I10A 2OTLN 2WB1A 1IGNA 1QQNA 4CJEA 3RRGA 3GTQJ 5J2PA 1NJIU 3CPWS 5J2QA 4C1NK 2D2WA 2MD0A 1NPPA 4OMNA 4A59A 2M45A 5F64A 3KBGA 1K4US 3E01A 4QS8A 5MLCQ 2RHKA 2DA4A 3FWEA 1MH3A 3HKZN 1KC8C 4FW1A 2YI1A 1KC8O 4R79A 1ERDA 2E1CA 2OFIA 3FXJA 4M9ZA 4CJ5A 2W25A 4XBFA 2COBA 3E6DA 3VQEA 3KX2A 4DZPA 3WU1B 3CC7A 4YPHA 1UELB 2QSFX 2EQKA 1H3ZA 3KZIC 1M9SA 1SKWA 2VWJA 4M77G 4QCLA 4F52A 3FGUA 3S1QJ 3CCST 1FC3A 4BROA 4LF8K 1DJ7B 2EBPA 2VBZA 4DTUA 2XPWA 2LCLA 1X4PA 3OOPA 3AA3A 1PP8F 3NVKA 3JRCA 2OC6A 4E89A 4I2OA 1KFSA 1IN8A 4A12A 3Q7BA 2K6DA 4AM3A 3CLQA 3MKLA 2NRHA 3LL7A 4O8UA 2KIQA 1MSEC 2BTTA 5K14A 5M5WJ 3FXUA 4BRFA 3MEVA 4M63C 2F48A 1WKMA 3M1EA 3F5TA 5AQWA 3CCMN 2V7ZA 2DA6A 4NL2A 3T0YA 1YHQT 1FMKA 1XHZA 3AG4H 3GMEA 1WSIA 1NJXA 1KSWA 3PY8A 4B4CA 5HY6A 4UUSB 2NS0A 1RESA 2DA2A 3E9OA 5LHGA 4WCGA 1OVQA 1SAXA 4FK0A 4HQMA 1U3OA 1LQ1A 1UGRB 3CPWM 4E7KA 3DKXA 5KYWB 3KUFA 2KAFA 5E1ZB 3CQYA 4B3MK 4DV4K 4C0GA 3ASNH 4A3BJ 3BW1A 1SD7A 4QT7A 3JCMb 2A41A 2FZGB 4BRLA 4DV7K 4CF2A 1TK0A 2CZ6B 1R71A 4YFNF 3WHBA 3C0BA 3OYJA 3BLYA 1HJDA 2HQ5A 1TLHB 4IEJA 3RSNA 2XPVA 3SD4A 2ZPBB 4RTTA 1O3RA 5E84A 5D4SA 2FMLA 5E18F 3G73A 2FYKA 2DMPA 2HHWA 2O4XA 4IRGA 1KLNA 4RGUA 3JCMc 2EV6A 1BI4B 3F10A 2EQJA 2XDPA 3BF3A 4F7UG 2BVLA 1N5ZA 1IKVA 2Q1NA 1O4XA 2X9HA 2ZF5O 1D5AA 1KQSS 3D0SA 4CXFA 4AFUC 1XMOK 3I59B 1MBGA 3TP3A 1IBMK 3DLLA 1ZUKA 5CKFA 1TAQA 4J2EA 2VC0A 2FF6A 5GAOm 5EX5A 3M8PA 4RGSA 4CEAA 3JB9H 1Z77A 1VQ7I 4FLTA 1HKSA 1NK9A 3B6OA 1ZUYA 2FBKA 3ECHA 4S04A 4YORA 4OMFB 4IOCF 4M78F 4DYRA 2X4JA 1W1FA 1D4XA 1ZGJA 3IQLA 5KGXA 1W6XA 4Q48A 4AM7A 4P1WA 4CGZA 4LSLA 2RQPA 2JPBA 5HK3A 2OPTA 4FYVB 1BG3A 3T69A 1EWRA 1KQ0A 5LJ3g 4NDLA 5C15A 4E1MA 3FXLA 2A1SA 1S1NA 1HW2A 2HHUA 2CUFA 4BY7J 2IVPA 1S7AA 4JS5A 3ZT4A 3M0RA 6AT1B 1YW9A 4JI7K 2XHIA 3OIPA 3HSTB 1JJ2A 3AAQA 3H0FA 3G6EA 4FSSA 1MUZA 3L42A 4N4HA 3CCMT 5CQXA 4MFBA 2MH9A 4DFJA 3CC2I 3M57A 3GW2A 3AO4A 1HD3A 4F8RA 3TSWA 2HI3A 4FOEA 1X1DA 2W82A 1P8ZA 1FYMA 3PIOF 3TTFA 1BI1A 4FIBA 3CCJA 2LKXA 1KQSM 2ECZA 4XLHA 4OMYA 3MMYB 3R6SA 3IL2A 2NOIA 1YO5C 4LK1F 2G8FA 4JLHA 3QNOA 3PIPF 1K8AR 2LJ1A 2MAMA 2ZJQL 4Y15A 1YJ9A 1JEGA 2NVQJ 1IV6A 4CC7A 3OR1C 3I4MJ 4P9FA 2RDPA 2BZYA 1T6CA 1VQNN 4OP0A 3K4NA 2QA4I 5BPMA 1YX5A 1N3CA 1C0TA 4ZGEB 5F2RA 2WY8Q 1NKBA 2GBQA 1T0HA 4M78C 1O7FA 2DW4A 1ORPA 4M6VA 1V5EA 3EE9A 3H0IA 3HHHA 4N76A 2ZJRL 1SD4A 1WJQA 3MZ8A 4GLMA 1IN4A 1QHTA 2QKLB 3CFRA 2YUSA 2RNGA 2OA8A 2XAFA 2R7SA 3FM3A 4WQ5A 3S9HA 3PM1A 1FYKA 3KVGA 4XORA 1H1VA 2R5ZA 1R23A 3F8CA 4CC3A 5K5QA 2NOFA 3ZETB 1X1CA 4XLEA 2J06A 3G71Q 4WFBL 1TWCJ 2UYTA 3BFMA 3REBB 4OPAA 3SUQA 4C92C 1UE9A 3VOVA 4ENKA 1VQKI 4B1WB 4LG0B 4E19A 2YUNA 2LKPA 2E5QA 2VJIA 1FZPB 3C7JA 3L09A 4CEQA 5GPCA 1OCTC 3K6GA 3S3OA 3QOPA 5GP9A 4AI4A 2W24A 1SEMA 5GAOq 4JRPA 5ELZA 4Y92A 2ZJPL 2HBWA 2V1XA 4B1VA 2DOFA 3TDUC 2LREA 3O9UA 1QZZA 2ID3A 3TGNA 1GLFO 4CGGA 3CDLA 2RMOA 1ITGA 1Q81R 1MV3A 2M7AA 1WNSA 4RUGA 2UWMA 1KC8U 2KRMA 1QO0D 3OS5A 2R4GA 1NJYA 6PAXA 1OOTA 4KHYA 1TWHJ 4R8HA 1W7PD 4C30A 5M1PA 2PFBA 1ILYA 1JHHA 2OAWA 4WWCA 3I53A 3AO2A 1D5YA 3E9LA 3V8KA 3KP7A 1D3BB 4P96A 4PJOC 4JKDA 2ETHA 4HSTA 3M58A 1D0YA 4F3OA 1RILA 4CSWA 4Z02A 4I09A 4M78B 2B4JA 2V1QA 1BL3A 2P6SA 3PMIA 5CVRA 3AVBA 4YIFA 4RB2C 3HRMA 1RAHB 3PMTA 2VUBA 1UGVA 3FKIJ 1XC3A 4IL6C 3LAPA 2W42A 3DKMA 5FPMA 2CREA 1FX7A 2P9NA 5DM7F 1JXBA 4MZPA 2G8HA 2N8GA 4I2QA 3CJAA 3UA7A 1APLC 1CXUA 3E9GA 4DQ8A 4B9LA 4BRMA 1BA5A 5AQTA 3I8DA 5GIPA 3F8BA 3ZSYA 3FEOA 2G8WA 3ZL7C 1HOMA 4FW2A 3LWLA 3NGIA 1PUFA 4C92B 5KYXB 3VRZA 3MEUA 2X85A 2VWKA 4Z94A 1RI7A 3HIFA 3L0QA 2FOKA 4ZYGA 3VS4A 4HCZA 3QUIA 3HBTA 5HLGA 3THXA 4MTEA 4HNUA 5M5XJ 2DLLA 1WI9A 3ONQA 3SFIA 3IUOA 5F6FA 5FJ8J 3S2HJ 4KUIA 5KYNA 3IFRA 4I7FA 2JRTA 1UMQA 1SMTA 4W5TA 2PAVA 4BVOA 2P81A 2E6MA 4W5QA 4IOCL 1K7AA 4ZDPA 4HHTA 3MN9A 1VYTA 4CO8A 3ITHA 3QDFA 4BEHB 2L9RA 1ZYRF 4YY3K 2CMPA 1U8BA 4M7AF 1BIUA 4NOYA <