3L2RA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2rA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2rA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2rA03
3T19A 2IDOA 1G5VA 3QJ6A 3V9SA 3OY9A 1N6QA 4FCYA 2OPRA 2EQJA 1C6VA 5I42A 4CIGA 4E7LA 3QO9A 1XI1A 3L2WA 1BQNA 1XHZA 2HVIA 3L2VA 1TKTA 3AVMA 3HSTB 4EZ6A 2LCCA 1FKPA 3NTKA 1KLMA 4C8MA 4CJVA 5KI6A 5SZTA 3V9WA 4B9MA 5KTQA 1VRUA 5C6SA 1IKXA 4DTNA 2VG5A 4OGCA 2XY7A 4CEZA 4E7HA 5K14A 4I2PA 1KRPA 3DOLA 4ZHRA 3AO1A 4EZ9A 3OJSA 1VSFA 4CHOA 2L8DA 4E1NA 1BGXT 3AVLA 3MEUA 1SL0A 3LH0A 3VQPA 2YNGA 3VQBA 4FZXC 4QW2A 4N41A 3HYFA 3HPGA 2G8KA 2HNDA 4B9XA 3V81A 3TAMA 3OB9A 2JLEA 2P1JA 4DSJA 5HRRA 4RG2A 2YHBA 1Q8IA 2A1SA 2R7YA 4CESA 3EZ5A 1VRTA 2IC3A 3G0ZA 2XY5A 1W9HA 4ZTFA 3CYMA 1X9MA 3I8DA 2D0CA 3OYCA 2RHYA 3FEOA 3ZT2A 3TANA 3V9UA 3QETA 3QNOA 3RMAA 3AVNA 4FJXA 2RJDA 3BGRA 3L42A 1VSLA 3G10A 3LLRA 3OJUA 2EQUA 2RO0A 3OYLA 3ME9A 1CXUA 5FROA 2OZSA 3DLKA 2RI3A 1JL1A 3OS2A 4C5IA 4AHCA 4FL6A 1NK9A 2RN2A 5CYQA 1C1AA 4X34A 4CJ3A 3K2PA 4W5TA 3KJVA 3ZCMA 2D0AA 5D6WA 3C94A 4M3UA 3FLGA 4M3WA 4OLAA 3SUQA 3H8ZA 3OYBA 3QEIA 5C24A 1HJRA 3EYZA 1U04A 3T3FA 5FDLA 1WLJA 1TK5A 2WONA 3AA4A 2EX3A 3LANA 3PY8A 3BDLA 1HPZA 3C95A 1I39A 1LW0A 4OJRA 1NJZA 4KO0A 3HVTA 2HVHA 4BDZA 3AA2A 1KTQA 2RHXA 1IG9A 2YNIA 4IG0A 3VQCA 4C5HA 4FJ7A 3KLEA 4K8XA 1RI0A 4F8RA 4CGGA 1ASUA 2FBTA 2YKNA 3RMDA 3VA3A 1NK4A 4IUUA 3K5LA 2HHWA 2EQKA 4EP5A 3KIOA 1GOAA 4FLVA 1S9GA 4B8AB 2IOCA 2JZ2A 1IKWA 4O0IA 3L2UA 4CRIA 4B08A 4OPJA 2B4JA 4IUTA 3KTQA 2OPSA 3DLMA 1JLGA 4OKJA 1HQEA 2FHDA 5CZ2A 2NLUA 1CXQA 4DTXA 1NK5A 3PO4A 3EAEA 5J2NA 2XK0A 3OYKA 1HYSA 4PL6A 2RKIA 3RMCA 4FK2A 3C6TA 4FVMA 3KK2A 4CGJA 4ELVA 1D5AA 4FK0A 4CEOA 5DMRA 1O1WA 5DK5A 3I0SA 2RHUA 4Z4HA 3OYNA 2RJFA 5D6YA 4CGFA 1U47A 2GUIA 4DWIA 2O4GA 3MEDA 4FJHA 1BQMA 3KD5E 2BGGA 4MQ3A 1JLEA 2OPPA 5KH6A 4IUQA 4E19A 3CM5A 3SQ4A 4A4EA 4DTJA 4ELTA 1UA1A 1C1CA 3V9ZA 1NJXA 4A4GA 4AHTA 3DB3A 3AVAA 1ZBLA 3WNGA 1JLAA 4C8NA 4MFBA 1JLQA 2ZQBA 4FJNA 2WACA 4HCCA 3LAKA 2KZMA 3NH1A 1B9FA 1NK6A 3AA3A 1WSEA 4FM2A 3RRGA 4E7KA 4IFYA 3OYMA 1TV6A 3NHGA 2PYJA 2F5KA 3NF9A 4Z4GA 3P8HA 1RT4A 3NBPA 4BE1A 1L3UA 2XO7A 3KLHA 1ZBHA 4KI4A 4Q0BA 1EXQA 1WNSA 4CJWA 2R5MA 3OYJA 2RF2A 2XRIA 4OLBA 1BISA 4AILC 3QESA 1WJRA 2PQWA 1RT2A 1EETA 3SNNA 2O4IA 1CZ9A 4N76A 4B9NA 3RRHA 2NUBA 2DFEA 4PQUA 3SPZA 4FJLA 4OPKA 3OYFA 4F3OA 3VQAA 2WOMA 4I2QA 1Y97A 1SKRA 1KSPA 2HHQA 4O5BA 2R5AA 3IS9A 3O4QA 4E3SA 2GFUA 3UIQA 3SV3A 2E6NA 3A2FA 1U48A 3MEEA 2E6MA 3CFRA 1WAFA 3K5MA 4CF9A 1SL1A 2VG7A 4IBNA 3K58A 4DTSA 4AHUA 5T7BA 3KK1A 1L3VA 3ZT0A 3DRPA 4HUFA 3QEVA 3PX4A 1LWEA 4DTUA 4A4FA 2EKOA 1S1UA 3VQ7A 2GV9A 3HJFA 1WGSA 2P5GA 3E9FA 1YVUA 1LAWA 3WNHA 4KRFA 3OS1A 1Z26A 1DTQA 2IG0A 1D9DA 4FXDA 4B3OA 4FYDA 3O3GA 2QK9A 1S9EA 3KLFA 3AO2A 4CE9A 3IAYA 3DLBA 4F3TA 2BDPA 3CFPA 4JLHA 4AH9A 3H08A 4B9WA 4O0JA 2DFFA 4KKOA 3OYEA 3QBYA 3MXIA 3L3VA 3NF6A 3LP0A 4HHTA 1T03A 4N5SA 4JS4A 2YV0X 1RT7A 3E01A 4CJ5A 3NTHA 4CK1A 4PWDA 1T8EA 4I9QA 4FJ8A 1QSSA 4FM1A 4LD0A 2QQRA 4KHWA 4DSLA 4RW9A 3NNQA 4M41A 3PMIA 4YNQA 3SUOA 3ZT3A 4CJRA 4BACA 2QKKA 3OYDA 4OKKA 4BDYA 1NK8A 1ZYQA 2PY5A 3L8BA 4F4KA 1VSJA 5HRPA 4IURA 3ZSQA 3KLGA 4FLYA 1NJWA 1U45A 3MXMA 4KFBA 4UC4A 4FJJA 1MU2A 3TAEA 4OKEA 3IRXA 1S1XA 4LH5A 1KLNA 3LX7A 3P5JA 1NKEA 2O4XB 2HMIA 1T05A 1TL1A 3DRSA 3UWNA 1JL2A 1ASWA 4DLEA 3RR7A 3KUFA 2RI5A 1R0AA 4BD3A 2G8IA 1UA0A 1NOZA 4TSXA 1ZBIA 1TAUA 3TAFA 3NTIA 1ITGA 3SD4A 3S3NA 3LPTA 1FKOA 1TL3A 4RW6A 1QSLA 2D0BA 1TKDA 1SV5A 3ZEHA 3M9QA 3TAQA 2BANA 1RDAA 4M42A 3HPOA 1OZ2A 1YTAA 4CJQA 3D45A 2KQ2A 3DLGA 3D0PA 1TKXA 4QQ6A 1XNIA 4Y1CA 2Q3SA 3HP9A 1FK9A 3WNEA 3O4NA 3MEGA 3NH2A 3HXMA 2RJCA 3L3UA 4GMJB 4GVMA 4M3ZA 4DFKA 1J9AA 2P51A 3LYIA 4CF8A 5J39A 4C5EA 3NCIA 4B9SA 4QOZB 3CFOA 3SQ2A 3ZSWA 1VSDA 1WN7A 1Q9XA 3SQ1A 3THVA 2G8VA 1Q9YA 3PMTA 1N27A 1RTHA 4KB0A 1HYVA 3LZJA 2HHVA 2ZD1A 4DQSA 2GBZA 3OYAA 4E1MA 4B9LA 4J2AA 1VSHA 4BE2A 2KFNA 1NOYA 1B9DA 1BIUA 4CHZA 1HNVA 4CFDA 4GY5A 1JKHA 4JS5A 1TVRA 3DOKA 1SSFA 2L89A 1S1VA 1H3ZA 5CIUA 3OVNA 4CEBA 4W5QA 2A1RA 2FBVA 5J2MA 1K6YA 1XHXA 3QIIA 1N5YA 3M8PA 5CZ1A 4RW4A 2PYLA 4PUOA 3META 2OYQA 4CGHA 4H4MA 1KVAA 3QIPA 4HCBA 1RBUA 4BWMA 4KTQA 4DSEA 1X9WA 4II1A 1NKBA 2KZZA 1HYZA 4GW6A 5D6XA 5J2PA 4CJEA 4NYNA 3DB4A 4KPYA 1IKYA 1L3SA 2GF7A 2F8SA 4B8CA 4QAGA 4CIEA 4B9UA 2M1HA 3LDSA 3KK3A 3AVFA 2QQSA 1ZBUA 4KHSA 2LRQA 4CJLA 2HNZA 2ATQA 2X6NA 2HB5A 1WAJA 2CKKA 3BDPA 3AVCA 4N47A 1SUQA 2ZE2A 3FFIA 1WSHA 4CJKA 4Q5WA 1JLCA 1U4BA 3KD1E 4DFPA 5HRNA 3O8VA 3M8QA 2OPQA 4FZYA 1UAXA 3S9HA 3HM9A 3U6FA 4N4IA 3HL8A 4CJSA 4FJIA 2HHTA 1QTMA 4KREA 3S3OA 3AVBA 2K3YA 4J2DA 3HT3A 3DRRA 4NCBA 4DSFA 4NZGA 2F96A 3AO3A 4HVJA 1KHCA 2EHGA 3QLHA 4DTRA 1RT1A 4UQGA 3MEWA 3DLRA 3ISNC 4IUPA 1RTJA 3C6UA 4G1QA 3B6OA 5J2QA 4DS4A 4ID1A 4FJMA 4Z4IA 1T7PA 4I9LA 5FRMA 4C8OA 2HQEA 3QINA 5HROA 1LV5A 1GOBA 2X74A 5E41A 3LGLA 3ZSXA 4OGEA 1XWLA 4CEAA 4CK3A 4CEEA 3QEXA 1I3AA 2M16A 1UWBA 4DU1A 1KFSA 2JGUA 4CJPA 3ZSVA 2HHUA 4DSKA 3OMCA 3PUFA 4Y1DA 1IH7A 1JLFA 3JSMA 4LH4A 3DM2A 4KI6A 3Q1JA 1S1WA 1IO2A 4NCAA 1L3TA 1RT5A 3V9XA 4C8KA 1KVBA 4FLUA 4AHVA 3MAQA 3MP6A 3SJJA 4ZTJA 1EKEA 2QXFA 2G8UA 4L59A 1EP4A 4C8LA 3RWUA 1RBSA 2YNHA 4PY5A 3MXJA 1QS4A 2MWPA 4CFCA 1F21A 4PLLA 1JLBA 4CEDA 4NS5A 4N56A 2KTQA 4Q5VA 4KAZA 3VA0A 3LAMA 3P1GA 3VQ5A 3U3YA 3KKSA 1J53A 5IAYA 4CHNA 1A5XA 4B9TA 3LZIA 3AVIA 4R5PA 3F9KA 3PV8A 4O44A 2IS3A 3DLEA 2Y1JA 4M3XA 1S6QA 3CG7A 3QNNA 4ID5A 2LDMA 3F70A 4FW2A 2Z1GA 4FLXA 5KRSA 2DY4A 1S5JA 1RT6A 1HNIA 4LY7A 3O3FA 4FK4A 1WSIA 1QSYA 3ZSOA 1EX4A 4W5NA 1SKSA 4FJ9A 1C0MA 4E0DA 4DF8A 2VG6A 3AVGA 1RCHA 4JRPA 3ZSZA 3PNWC 1TK0A 4DS5A 5IN1A 2Z1HA 1S6PA 5JS1A 3LP3A 2Z1IA 1LWCA 3TI0A 1IKVA 3LALA 1CLQA 2BIVA 4IG3A 4HUEA 4FU6A 3PX0A 1WSJA 1LWFA 4YFUA 3HO1A 3TAGA 2HHXA 3SUPA 1B92A 3V1QA 4DF4A 2FBYA 3KLIA 2XHBA 4W5RA 3GOXA 3K57A 1LW2A 4DG1A 4CJ4A 2D5RA 3V1OA 4IKFA 5SWMA 3V6DA 2EQMA 1DLOA 4I7FA 3L2RA 2BKDN 4DTMA 2Z1JA 1S1TA 3TARA 4CERA 2G3RA 1VK0A 1BL3A 2W42A 3VQ6A 2YNFA 4N4GA 2ITGA 4FLTA 1WJQA 2KW4A 3QEPA 4ICLA 2OZMA 3JYTA 3C4SA 1OYXA 4CJTA 3RTVA 3SYZA 4F2SA 3ASKA 3AVKA 1ASVA 4Z0UA 1KFDA 2AJQA 3M8RA 3LPUA 4Z02A 3NF8A 4LSNA 3B6PA 1RT3A 2X4YA 4CFBA 3MO8A 1VSMA 2K3XA 5C0MA 3VQDA 4M3YA 4A4HA 5HRSA 4J2BA 4DTOA 3VQ9A 3ITHA 2E4LA 1MHNA 4CFAA 4EP4A 3U3GA 1RDCA 2B6AA 5KE3A 5D3GA 1C1BA 3VN5A 5HLFA 3HK2A 1A5WA 1SKWA 1KVCA 3OYHA 1RNHA 5CY4A 4BWJA 1WSFA 3TAPA 4QVZA 4C5GA 3HP6A 3CQ8A 1QHTA 3WNFA 4RG8A 3I0RA 4FLZA 5CYMA 4Z4CA 2HNYA 5KCOA 4CEFA 2KFZA 4B9VA 4Z4FA 4NCGA 2IGIA 2Y1IA 1DTTA 4CK2A 2RJEA 3NGZA 1NKCA 4DFMA 2O4XA 4CHYA 2G8HA 3AO5A 1RDBA 2HW3A 4HUGA 5I3UA 1C0UA 3AVJA 2YHAA 3K5NA 3MEAA 2XY6A 2MWOA 1RILA 5KGWA 5JS2A 4IUVA 2OA8A 3DMJA 3RR8A 2VWKA 5HBMA 4HCZA 3T1AA 2F8TA 2LTOA 4DQPA 1NK0A 5EU7A 4DQRA 2G8FA 3ASMA 3AA5X 3OQ5A 2BUDA 3E9GA 3FC3A 1HRHA 2GFAA 3EY1A 5KCHA 1GOCA 1BHLA 3DI6A 3IG1A 4DFJA 4DTPA 4OVAA 4H8KA 1JXEA 4FW1A 3QEWA 4FJKA 3CEYA 5C25A 2HQXA 2R58A 4W5OA 4KHUA 4CIFA 3SQ0A 4BE0A 4JRQA 4K8ZA 2G8WA 3VQEA 3MEVA 3VQQA 3NGYA 3O3HA 1A5VA 3PX6A 2DIGA 1KCFA 3P83D 4FJ5A 4CGIA 1X9SA 3QIOA 3MP1A 1WJSA 2L3RA 1WSGA 4O4GA 2FBXA 1REVA 1G15A 4DLGA 4KHYA 1SL2A 3SCXA 4F2RA 2FC0A 5J1EA 2ETJA 4DSIA 4E7JA 1VSIA 3MP8A 4LSLA 3M8SA 3OMGA 4CJUA 3RMBA 5KRTA 1W0HA 4KHQA 4CF1A 2XY8A 3MECA 1BIZA 4H4OA 4XIUA 2P0KA 4CF2A 2VWJA 5M9OA 2EFIA 3L2QA 1CZBA 1RBRA 3TWHA 2HHSA 3LP2A 4M45A 3P8DA 3V4IA 5KGXA 3TR8A 1VSKA 3OYGA 2XDPA 1ZBFA 4M3RA 3SUNA 3LP1A 3S6WA 1FXXA 1TAQA 3AO4A 2X4XA 4RW7A 4NYFA 4FLWA 2P5OA 4KTWA 3AV9A 4Z4EA 5FRNA 3DYAA 2I5JA 2E6LA 1YTUA 1HMVA 3V1RA 4QQDA 3ALYA 1LAVA 1QQCA 4CCHA 1U49A 3H6ZA 2LSNA 2RI2A 1RTDA 3SZ2A 3LGFA 2YKMA 3SI6A 5HP1A 2X35A 4IFVA 3AVHA 3NDKA 4CF0A 4E7IA 2JTFA 4CEQA 2DTUA 1J5OA 1RDDA 3PFSA 2IAJA 1OI1A 3HVRA 1JXBA 1OZ3A 4E89A 1RTIA 4EDUA 4CHPA 1NJYA 3QKJA 4CGDA 2QKBA 4L8RB 1X1PA 3VQ4A 3NAEA 2BE2A 1RBVA 4KB1A 4DQQA 2X78A 4FM0A 5C42A 4KV8A 1NK7A 1VSEA 3LWMA 3NF7A 4ELUA 4PLIA 4DMNA 4DU3A 3S3MA 1D9FA 4OVLA 1J54A 2R57A 3F73A 1HQUA 2PZSA 4BDPA 4WE1A 4FZZA 1BCOA 4J2EA 2E5QA 2B8AA 2X6SA 2X4WA 3SPYA 3K5OA 2D9TA 4KHNA 4RW8A 4AHRA 4M3TA 1L5UA 2RHIA 3NH0A 1QE1A 5KE2A 4LD6A 2DIQA 3OS0A 2M0OA 4QQGA 3TABA 1BI4B 3ZSYA 2DFHA 4DQIA 1BCMA 1TGOA 2RPIA 3SV4A 1UOCA 4IDKA 4DU4A 4QCLA 3NFAA 1RBTA 4HTUA 4FJGA 2YRVA 5J26A 4KTZA 3PO5A 1D8YA 3VQ8A 3ZT1A 2DAQA 2VYTA 3LWLA 3KKRA 3ULDA 2LVMA 4N4HA 3CM6A 3QERA 3OYIA 4AHSA 1Z25A 3DLHA 4CHQA 2B5JA 3UT1A 1YT3A 3HPHA 1C0TA 1XC9A 3ZT4A 2RHZA 1TKZA 4CJFA 4CECA 3OA6A 4O55A 3NE6A 3NGIA 1TK8A 4PA1A 3ZSRA 1BI4A 3K59A 3FDRA
chains in the Genus database with same CATH superfamily
2KR3A 4JZ3A 3CHWA 2YRDA 3G2BA 5F64A 2CRGA 4X0GA 1VQKI 2EV6A 4F7UA 2HMAA 2OPRA 5KAFC 1PWTA 3CD6N 4C92E 4XH4A 2F69A 1UGRB 1QZ6A 4E7LA 1VIEA 1XI1A 5DPKA 1XHZA 1ATNA 3JV3A 2YLCA 5IH2A 1TKTA 1VQLI 2PUKB 3HSTB 2CGHA 1GL5A 3NTKA 2WFBA 3J81E 4YHHK 1B8IB 3IH4A 4C8MA 3PFYA 5IT9Z 1B34A 4RTXA 3M53A 4L9TA 3W2VA 3WTSC 4B9MA 5KTQA 2E34A 5E18F 5C6SA 1OU9A 3BR2A 2JHNA 4OGCA 2BZ8A 4MGRA 5K14A 2OQRA 3S1RJ 3BC8A 1Y56A 2CSIA 3DOLA 1ZTRA 4P1WA 4GVEA 1Q81U 3TSWA 1VSFA 1SEMA 2EGCA 3MQ0A 4IF4A 1S3JA 1BC7C 5EZHA 1K6OA 2QZ8A 2NRVA 1MMSA 2A6HF 4U0VA 3TAMA 1T6CA 2X48A 3E0JB 4IHTA 1X3UA 2JLEA 4UB8C 2XPUA 1HNXK 3CC2I 2DA7A 2DPNA 3CETA 5FLMJ 3V42A 3WE2A 1NJIR 1X01A 2R7YA 4QT7A 3CUQA 3ZR8X 3MK6A 3KZIC 4J19A 4BUPA 3VS2A 2DVJA 1JXMA 3SBTA 1X9MA 3AL0C 1E7OA 2CGLA 2GIVA 3X24B 4EMHA 3GF5A 2D0CA 2AS5F 3TL4X 4FWLA 1OJLA 5AQLA 1YJ9A 1J59A 1F9NA 2XAJA 4FWOA 3FEOA 2V9KA 3TANA 4G6TB 2OX7A 3QETA 1MPGA 3VERA 3QNOA 1O4XA 1GV5A 4ORZA 1X1BA 1M30A 1WIEA 4FASD 3BGRA 1RDWX 2M9HA 3B02A 5I2MA 2XRNA 1XNQK 3M0UA 1LPQA 2DT5A 3QOPA 2Z33A 2QWRA 4Y15A 2LBFB 3OYLA 3VWBA 5FWBA 1CXUA 5DCMB 2KL4A 2FOKA 2WBMA 2UUBK 4BREA 2RC4A 3VEZA 4QS9A 4IWVA 3MN9A 3DU6A 2RI3A 4MTDA 2GUPA 1ZHIA 5D8KB 4C5IA 3I55A 1JUMA 4PUSA 1GVDA 1XQPA 4LB5A 1VQNI 1NK9A 3LAJA 1ZARA 3H3OB 4X34A 5CLSA 2LMDA 3HHTB 2SRCA 5EDNA 4W5TA 3QFUA 4M75G 2MABA 3ZCMA 2OJED 1IDYA 1OCRH 3VYRB 5D6WA 2K27A 1EBMA 1JU5C 3M0SA 3MX2A 5M5XJ 2QENA 1W2BS 1O7FA 4QKUA 5HKCA 4HKEA 4FVUA 3K4JA 1HJRA 4OB3B 1PC0A 3T3FA 1X3ZB 1WLJA 4MDAA 2FUG2 3KZBA 1HXDA 1KIKA 4C0DC 3DV8A 3RDIA 4I0BA 4B9QA 2DX1A 4OJRA 3H35A 1WH5A 3TDUC 4ENNA 1YQKA 2E64A 4KO0A 4KH5A 1R36A 2YT6A 2PEXA 5FO5A 1X69A 2IGMA 3E5XA 3M58A 4LIUA 2YNIA 2NOJB 4XTWA 2NRZA 1OH5A 1WFWA 4J00A 4HSBA 4K2EA 4C5HA 4I02A 3KEOA 4DBRA 3K9JA 2XAHA 2FL7A 2CUFA 5LJ5d 1LDKB 4AFZC 2XAGA 4ZN1A 4IHWA 3GW2A 4GLKA 4JUVA 2F4MB 1JXOA 3RYRA 3K5LA 4DHYA 1RAHB 2HHWA 2XF7A 1GOAA 4U7BA 5C12A 2YR2A 1S9GA 3R6NA 4M77C 4BXUA 1U2VA 1IGUA 1X1CA 4WQ5A 2KYMA 1W7PD 3OTOK 5LHIA 3S2HJ 1YIJQ 4CO8A 3NPFA 1ZG5A 3OGDA 4IUTA 5LJWA 3VOEA 1YJWA 5C2DA 3EUHA 2QF7A 1S3XA 3WG9A 1HQEA 2NNYA 1FY7A 3MN2A 1BA1A 3CXCA 2A3LA 4GNIA 4QWQA 4DTXA 1W36C 2XUBA 1ZSZB 4IZZA 1K79A 1NG7A 5A2QZ 5J2NA 2DO3A 2XK0A 2QBYB 3P8BB 4F14A 4RB3C 3OYKA 4UXNA 1GDTA 5AYFA 2AIRB 1E3PA 1LMZA 4UVAA 1I0CA 1D5AA 5DCFA 4BRKA 3LDNA 4CEOA 1UCRA 2YWWA 4N0BA 3RNJA 3E19A 3CPWM 1MMGA 1BIBA 2RJFA 5D6YA 2FNAA 1QVFM 2V8JA 1VQ8I 1BQMA 4QS7A 4PJMA 4MQ3A 3VW4A 1JLEA 4NB5A 1NG9A 2OPPA 1M90O 4IUQA 2IEKA 3KWIA 3C0BA 3SQ4A 2P0PA 2CGPA 1TUUA 2CQKA 4DTJA 1UA1A 1UHMA 4M77F 3V9ZA 1R4MB 4A4GA 1ZSGA 1YYVA 4A3FJ 1OYWA 3WNGA 3ZQLA 3OW2S 2E1MC 4C8NA 4HCCA 3LAKA 4KN4X 2EFPA 4CCLA 3CCJT 4MO7A 1OCTC 1WSEA 2WY7Q 4E7KA 1S1NA 1TV6A 3B6AA 2PYJA 3VEOA 1MWMA 1QBJA 4Z4GA 2RHKA 1T08B 2A07F 1XMQK 2V1UA 5CVJA 1L3UA 5M3FJ 2XO7A 5HLGA 4CD3A 4PKHA 1P2FA 1SRLA 4KI4A 1LVKA 3OYJA 3E2UA 2RF2A 5EJCA 4OLBA 5E3LA 4HYEA 2Z1DA 3PIPA 1IO6A 3WEEA 3LSJA 1XDSA 3DAWA 1HR0K 3GX4X 5CVUA 2PQWA 2UXBK 4L6V5 1EETA 3FZLA 3JXUA 1RKWA 3X26B 3GMEA 4B22A 4BUGA 2JUFA 1VQKQ 4B3SK 3IV5A 3I4MJ 5CQXA 2DFEA 2KT8A 1IF1A 3VEVA 3SPZA 2IW5A 4M78D 1YO5C 1X3NA 4F3OA 3RDVA 1HLVA 1R4NB 1WUAA 1W7PB 1I1GA 4LF5K 2XGXA 3U1DA 1VQLQ 1VQ4N 2JTMA 4HA8A 3DWLA 1ZAOA 4IJAA 1DPUA 3CCUA 3L6QA 2W03A 3K5MA 2J06A 1SL1A 2VG7A 1K8AO 4GV6A 3CDLA 4XTXA 3K58A 4DTSA 3LQQA 1SS6A 1N3CA 5T7BA 3KK1A 1L3VA 3ZT0A 3EG2A 1SRMA 1XDUA 2H3EB 4XTVA 5J1UA 3KEYA 2P7CB 4DTUA 4A4FA 2JG6A 5GAN7 1S1UA 3VQ7A 2RNGA 5J8CA 2A0FB 3LSMA 4LD9K 3TU5A 2P5GA 1VYTA 3E9FA 1YVUA 2F4OB 2L54A 2LQKA 3W6KB 3WNHA 2XGDA 1VQ5I 2PTKA 4KRFA 2NS8A 4DGWB 3LAPA 2IG0A 5HK0A 4FXDA 4B3OA 2VL8A 2AHQA 3HSRA 3O3GA 1LJOA 4EGYA 3KLFA 2VQHA 3FMQA 4XL9A 2ABLA 1JJ6C 1KC8R 1JCFA 3OSVA 1JT6A 3DLBA 2VGMA 2NUTB 4WF2A 3CC2Q 4B9WA 4O0JA 5H20A 1OULA 4JX5A 2DJNA 3MXIA 3NF6A 3LP0A 4IIOA 4DV1K 1HKCA 1WQWA 4N5SA 1GLNA 5C4XJ 2XC7A 4RA2A 4IJNA 4HSRA 1I1JA 3E01A 1VQ6Q 2R7RA 4CK1A 4PHTX 2R5ZB 3EGDA 3LSKA 4J9EA 1T8EA 2IVNA 4BC3A 3FXKA 4HVWA 1QSSA 2QQRA 2F5TX 2BE7D 4CCKA 3TSQA 3SFZA 4MNUA 4PGHA 2CDTA 4WFAL 1AZGB 2O9SA 3CCRA 1Q86C 4IOCL 3PMIA 3QPTA 3H6EA 5ILVA 1POGA 3CQYA 1ZKGA 3T69A 3ZT3A 2QDYB 4JPBW 4BACA 5H1SQ 1NWKA 1KFZA 4BDYA 2VLAA 4KA4A 1YNZA 4ZDPA 4MEXF 2BY2A 4IURA 3Q3SA 5I22A 3URGA 3MXMA 4BY1J 2DAOA 1MU2A 3GFMA 2Q2EB 3N4QA 5F0FA 4LH5A 1QNTA 4RUGA 2W10A 1T05A 3DRSA 3PIOL 2VJIA 5AQVA 1JL2A 2IBDA 4JNEA 2OCCH 4DLEA 1LWWA 2RI5A 2BYVE 2XU8A 4M7DD 2CV0A 1VQNQ 4BD3A 3TW7A 5FLXK 2KDSA 1VQ9T 2CQQA 4JD2B 1KA8A 1U5TC 2HI3A 1R49A 3NTIA 1ITGA 5TKYA 1FKOA 4DEXA 3LWFA 1Q81O 4RTTA 1SV5A 2IS4A 5CAIA 3ZEHA 1IG8A 1N78A 1R71A 4KISA 3HPOA 3G1OA 2C0IA 2OAWA 5CVIA 4PJOG 3U1KA 3DPTA 1SFOJ 3J7AF 5AJ3K 4C92G 2ZPIB 4BU2A 4J6WA 2ZJQL 2XF6A 3WNEA 2HOSA 2ZWHA 3MEGA 3HXMA 4XEIA 4FE4A 1T0FA 4L5IA 4M3ZA 1FBSA 3RZOJ 1TTYA 1AOJA 1M2VB 4CF8A 4C5EA 1JUSA 2L7MP 1HDPA 3CFOA 1WXTA 2GTDA 3EE9A 3ZSWA 1VSDA 2PLYA 1WN7A 1Q9XA 2G8VA 1UG1A 3BR3A 5BPIA 3M0RA 1Q18A 3Q7CA 3G71I 1RTHA 1XTDA 2Q1ZB 4XLFA 1HYVA 3HUGB 1ON2A 4E6RA 3CCVT 5EVZA 1M5Q1 5JMVA 2R5YB 2GBZA 2X6YA 3CMAA 4E1MA 4BE2A 3MCZA 1YXQA 5LJ5h 4DR7K 4CI6A 1JKHA 5GPCA 5L3CA 3VEWA 4ZYAA 4CZCA 3NGPA 1MBEA 2XG8D 2GAUA 2CG4A 5LRSA 1HKGA 1S1VA 5TGTA 4XTYA 2P9PA 2Q0RA 1SANA 2F6CA 3DKMA 2FBVA 1K6YA 3CPWS 4TVRA 3KLNA 4M9SA 1GFCA 2KKZA 2E10A 4B43A 2VKEA 3H3ZA 5HS9A 2JM8A 3V7CA 4L3QA 2RQWA 4H0TB 1NJIC 5E1XA 3CC7I 1RBUA 2HU9A 2IRFG 2HTSA 2QWQA 2XASA 1QVPA 2I10A 5CHIA 1HYZA 4GW6A 3ZX3A 3LNQA 5D6XA 3OIOA 2AP1A 2NVTJ 1EV7A 4RMNA 3DXKA 4NYNA 1H0MA 4OF1A 2JUGA 3CCST 1KXPA 4YDUA 3LSTA 1VQMT 1D4XA 2E8AA 2BHZA 2WUSA 2F5FA 2DI3A 4H5RA 2ZGWA 1LDJA 1TUCA 4M7DB 1MD0A 1BU6O 5H6QA 4BR5A 3FXUA 5K5OA 3OOPA 4BBRJ 4B3TK 5EG2A 1VQ8Q 1G2HA 4OX9K 1E3MA 4ZGJB 3J8AA 3LDSA 1SC7A 3IH2A 4IHSA 2HNZA 2ASPA 5BS6A 2HB5A 3IKMA 4HV6A 2CKKA 1VQ6N 2YHTA 5KYWB 3EL2A 1SUQA 4J7FA 2FE3A 1YRNB 1HW2A 2K02A 2Y31A 1W5TA 4HF1A 1WSHA 5FD5A 2DMUA 4BR4A 1P92A 4IO9L 2P9LB 3T1HK 2FNPA 1KG5A 3VENA 4A3GJ 2W00A 4ZYHA 4FZYA 1RDUA 4IOAL 3WTXC 2HHTA 1ZR4A 3PUBA 1QTMA 1NLVA 2A08A 1UHFA 2XDDA 3HT3A 2HWVA 3TTFA 3MN5A 1JGSA 2PZ1A 2ISYA 2EJ9A 2KT1A 2Q31A 5BOXA 1QGPA 3K69A 2VKVA 2BOLA 4BQAA 5AQHA 1SAZA 1SF9A 4IUPA 2DJQA 2YLBA 4H4KC 3CPEA 3B6OA 1XSXA 4GLMA 1TBXA 3FM5A 4I9LA 4BRCA 4HSTA 5FRMA 5GAN2 1YQAA 4B6MA 1UHSA 1LV5A 1FSEA 3G6EA 3BTCA 2YX6A 2KKOA 3EN9A 5E41A 3J80K 4B47A 2D0NA 3ZSXA 4NUBA 1LKXA 1V3FA 1G3YA 2CV2A 1OR7C 3QEXA 1W1FA 5J4VA 1FJGK 3F8CA 3GTQJ 4DU1A 2V26A 1BDGA 1VQ7A 2HHUA 2P4WA 4FWSA 5IY5H 2PVGB 3BR5A 1YX5A 4D8KA 3OMCA 3PJRA 1FYKA 1H8KA 1J9IA 4FT8A 3JSMA 1KD1C 5BMZA 3SQNA 2FBHA 2PMZN 1BYMA 4GY2B 1ETVA 1RT5A 3V9XA 1ZG3A 2NNNA 3O1BA 2AHJB 4BRQA 4C3HJ 2CH5A 1WPYA 4FLUA 1LFPA 1VQ5Q 2DL4A 2LQNA 2ZJRL 4A0YA 3HM5A 2MFZA 9ATCB 1HUXA 2QG9B 2G8UA 2NRHA 4FT4A 4BVOA 5DY9A 4L59A 1EP4A 5IP6A 1G59A 2HD0A 2YNHA 4PY5A 5KYUA 3M1FA 3JAME 1OVQA 1NU0A 1YTYA 1AHDP 4NS5A 4II3A 2KTQA 1IN7A 1X1AA 3VA0A 4KAZA 3VS1A 3SJHA 2EYQA 2V1RA 3QZ5B 1DGKN 4Y91A 1KG6A 3D2FB 3VQ5A 1J53A 4LFUA 2DOEA 3QPSA 4BRNA 2DILA 1EWRA 5KK1A 5LD2C 5FU7C 1G3SA 4B9TA 3LZIA 3K7AJ 1SEUA 3VTIA 1WJ5A 2PJRB 1MUYA 2J6KA 2Y1JA 2B9SA 4Y3OA 4OO1J 4FLXA 5KRSA 2DY4A 2CMPA 2K5IA 3O3FA 1VQOA 4LF6K 4M78C 3OBWA 3P38A 2KQRA 2KY9A 3JCMe 4XSZF 4DF8A 3AG1H 3TEEA 3CCEA 1LB2A 3CMEI 4KT0E 4R0KA 2O88A 2GA1A 4QSHA 1UJ0A 2FOWA 3CJBA 1TK0A 2LCSA 1D1BA 3E9LA 3VTHA 2QEXI 1DKGD 2Z1HA 3KNTA 4GDFA 3A01B 5JS1A 1QQMA 2CW0F 1XG7A 4LLLA 1IKVA 3LALA 4HUEA 4M77A 3VF4A 3QMLA 3DJCA 5B66C 4PJOB 2LREA 3TAGA 3K9KA 3A5ZB 3VRYA 2QQ8A 5KQ8A 1YW9A 3BG7A 3J7AY 5GAGP 4W5RA 3GOXA 3C7NA 3EG3A 3FMRA 1XS9A 1H3HA 4CW7B 4CJ4A 3VRZA 2ZXWH 2G0EA 2XKOC 4A3KJ 3V4GA 2RDPA 3HBLA 3V1OA 1I8FA 5SWMA 3V6DA 1WLPB 2DOAA 3FMSA 5JHUA 5M1FA 3TARA 4LLNA 4UNOA 4CERA 3TKYA 1VK0A 4ZNXA 1BL3A 1NJIU 2YNFA 1X58A 2LVSA 2QKLB 2F2EA 2VJJA 2ZFUA 1P4AA 1XN7A 2QYZA 4FLTA 1N25A 1DEJA 2F5EA 5HDKA 1NGNA 2EBPA 3L0QA 1VOMA 4ICLA 3C4SA 3KP7A 1AA7A 3K1NA 3QU6A 1G8XA 3H9JA 2RGVA 1YWPA 1T6DA 1Q82U 4F16A 3N05A 1ZUUA 4HDVA 1RT3A 2X4YA 3GO5A 5GAMj 1FZPB 3ZOBA 1SFXA 5GANd 4L9JA 4M3YA 4ZGEB 3FZVA 1QQJA 3KE2A 1NZ9A 3HFOA 1HLUA 1PP8F 4WXHA 3G73A 1RPWA 3VQ9A 3G71Q 1K1ZA 3I35A 1X2KA 1MHNA 1NH3A 4EP4A 4FSVA 3CCJN 2RREA 1UGSB 1S9HA 2VWFA 4JKDA 3HOWJ 3WTTC 2B6AA 3SAFA 3NQOA 3UKUB 4EEFG 2EFWA 3ZX2A 3ZN1A 2X9DA 5HLFA 1ILYA 1X1DA 1SKWA 3SHFA 4ITVA 3OYHA 5GADJ 4XSXF 1GLAG 3O80A 2R7ZJ 1FTZA 4M7DC 5E79C 4M6XA 1U1SA 2L0KA 1G4DA 5FFXA 1WA7A 2XHCA 3FHGA 3PO3J 4QVZA 3OW2A 3EQLF 1KC8C 1R59O 1BC8C 5CYMA 5KCOA 1FP1D 4CEFA 3VOVA 4DV5K 1KG1A 2IGIA 2Y1IA 3OV8A 3HKZA 2NUPA 3FZKA 4A61A 1OV3A 4LNPA 1YI2T 3CC7Q 2O4XA 4FSSA 4BR0A 5IXBA 3K10A 2G8HA 2HDWA 3VFZA 3NWSA 4L0YB 1C0UA 3KK7A 1E2XA 2OBPA 3CW7A 4EJTA 2YHAA 5TKWA 3GEZA 5GMKh 2MWOA 1WJEA 3SZGA 3BUZB 3DMJA 1M1FA 4BI8B 2ZMEC 4DR3K 4D0PA 5EEAA 3T1AA 4LLGF 2F8TA 2VOOA 3WXKA 2NRXA 1S8NA 2L0AA 2P9KB 2E1NA 4KMFA 3ASMA 3OQ5A 2O8EA 1IAWA 1HRHA 1NPRA 1KD1U 2Y0SN 3H1QA 2L5QA 2M8GX 2CQ7A 3U21A 3EFOA 4YOQA 4H8KA 4FW1A 4FJKA 3G0QA 3SQ0A 4BE0A 4G7OF 3WHBA 3HHHA 3DTIA 4XBFA 2V52B 3NGYA 2EV0A 3VPZA 5EF6A 4C8QC 1A5VA 1QP2A 3OBYA 2DIGA 1CZAN 1ZLKA 1KCFA 2AZVA 2RQRA 3P83D 2RAEA 5KCMA 3KXTA 5LJ3j 1XCBA 4CZIA 1CQTA 5A0GA 3G4SQ 3CCLN 3OWTA 3RESA 2DJIA 2FBXA 3I55T 2HKNA 5ADXA 3HTVA 4FYYB 3A8LB 2X6OA 2ATCB 3ZQ7A 1KG2A 2RM4A 1KQSS 5BN9A 1QZEA 2OTLN 4O5VA 3DPUA 3OMYA 1WSUA 3FJ5A 1K78A 3U4LA 3MP8A 5AQRA 4LSLA 3PGGA 4TV7A 5GAEJ 4LF8K 1Q95G 3MECA 4B1RA 4A3EJ 1I27A 4HF0A 4HBLA 1RLQC 1YIJA 3QSUA 2WAQA 2X1DA 3KZYA 3L2QA 1RBRA 3J7ZI 3LP2A 4M45A 2PBDA 2GA2A 1QKWA 1P4WA 4IQJA 3Q0WA 2XPVA 2PMHA 3CLQA 4FSXA 4WX9A 3VESA 3SUNA 2FF6A 5AQOA 5L23A 4OFEA 1UECA 4C8QF 3JAMZ 2KISA 3JCMb 1I3QJ 3TO9A 3E6CC 4Z4EA 1U5TA 1NLPC 2WAFA 4A6DA 1HMVA 1HBXG 4DR4K 3H3UA 4QQDA 1QQCA 2CH4W 1JXSA 3PQJA 3G71N 3C3WA 2E3IA 1KK7A 3O8GA 4BGBA 4KUMA 2L4AA 3COAC 6AT1B 1OVYA 3SZ2A 3BFMA 4HLXA 5BPLA 1UFMA 3NRVA 5AQZA 3T5XA 5EEGA 3IQLA 1SHGA 4CF0A 1PVEA 3D5LA 3GIBA 1IXDA 1FJLA 3PFSA 2LYCA 2IAJA 1YJNN 1OI1A 3HVRA 2OFKA 1JXBA 2ZKZA 5GAHJ 2FBIA 2QA4I 1WJCA 2EYXA 2DFUA 3WTUC 4EDUA 2R4GA 1U78A 1NJYA 2DA6A 3QKJA 4F93B 2Z2SB 4B24A 4BRIA 4L8RB 3LSRA 1X1PA 3A1PA 1Q7YR 2HXIA 4MIMA 4H0PA 2L02A 1TU0B 3M59A 2X1CA 2AT1B 5KQDA 3GOIA 3CMEQ 5B3SH 5DUKA 4M75D 3DTKA 1X3MA 2XDVA 4KB1A 4YOYA 4GRIA 2X78A 4FWPA 2DL3A 1Z21A 1NK7A 3FKJA 2IA1A 3WTYC 5KYXB 1VSEA 1X2MA 4ELUA 3PTAA 4PLIA 2QEXQ 3F6VA 2YUNA 1Q86O 1VRLA 3GZ6A 4IRHA 1R77A 4Y28E 2WY8Q 5AQSA 2WAEA 4E2FB 5GIPA 1AZEA 2P81A 3KPHA 3GTLJ 2FSWA 5IYCJ 2X6SA 1VQKA 2DD4A 5IWAK 1AWWA 2GX9A 3EUAA 4W1UA 2FJ1A 2JMCA 2LX9A 3DTEA 3HTRA 4RW8A 1KONA 1G2BA 4M3TA 1L5UA 5J3LA 3PLAA 4C2TA 2HKQB 2O8XA 5TISC 5CR4A 1VQLA 5CKTA 4YIRX 4J8OA 3TABA 3BTLA 1NK2P 3ZSYA 5K5RA 4AUXA 3JB9G 2JQ7A 2ZCWA 1RIOH 1TGOA 2W84A 3SV4A 2LNVA 1PUFA 2STWA 1C6VX 4DU4A 1W6XA 3JCUC 1RBTA 4IOCF 2X85A 4FJGA 4F7UB 4KTZA 4R56A 3PNYA 3C1DA 1D8YA 3CPWA 3DLLL 3ZT1A 4L18B 2FO0A 3OSSC 5GAN3 4XICA 2VYTA 1XMXA 3ROUA 3OH6A 3LWLA 4LXCA 2UXCK 3CC4Q 5AQXA 4CXFA 2XIDA 2L7FP 3QERA 4BY6C 1SVOA 4CYDA 2O0YA 3CCQN 4AQYK 3SXYA 2B5JA 4B23A 1B34B 3G4SN 3F0CA 3QFPA 1BW6A 5BPDA 2M5WA 1C0TA 1JT0A 1YITT 1XC9A 2DBKA 5L3EA 1AKHA 4B21A 2ITMA 4YFXF 1TKZA 5HY6A 3ZPLA 5KPTA 2OJ2A 1YHQN 3DLAA 4QPOA 4FO0A 1UGPB 3MZ8A 4H0VB 3UE5A 2G9WA 4HX4A 3CC2A 1SG5A 2EYZA 3CDIA 2A5YB 2R3SA 4Z89A 3MCPA 3I56T 4I99C 4ZZLA 4PFZA 3OL3A 5GANh 1HSJA 2E1ZA 3QJ6A 3V9SA 2LH9A 3L7WA 2ZJ2A 1MMDA 3ZQGA 4H5WA 4A3IJ 4JYAK 3W3CA 4J9HA 2OTJQ 3NEUA 4BHPA 2NOEA 1CSKA 2QW9A 5FJ8J 5I42A 2IT0A 2DXTA 4CHUA 4ISEA 2EINH 3L2VA 1H89C 3AVMA 2CP7A 3VGKA 4XLCA 3VMFB 2R7UA 4JI0K 4FHTA 2P4TA 3CUQB 1XGMA 5JLFA 5F1JA 3FR0A 2LC4A 4J9GA 4CJVA 5KI6A 4MDBA 4M7AC 3F21A 3CWSA 1XQHA 3A2KA 2VXEA 3FZHA 4XR6A 1FOXA 2JVVA 2VG5A 1MBGA 1S72T 2XY7A 4E7HA 3X20B 1P9QC 1BR4A 2JN6A 1AWJA 4CICA 3AO1A 3O4WA 4CHOA 1WYXA 3OYYA 1OR7A 3AVLA 1N3AA 2A6TA 2NNWA 3P9CA 3MEUA 1G3WA 1SL0A 5D7UA 1NJIO 2VC0A 2JWTA 4QW2A 4OOIA 1VQNA 3HYFA 4UUSB 4BI3A 3ATVA 3A0HC 5AQNA 5BNGA 1AWCA 2FD5A 1BOBA 4DSJA 1BOTO 3QPHA 5GPAA 3BP8A 1ZC6A 3A8YA 1Y0MA 3EKSA 2JMWA 1T44A 1VRTA 4O6JA 1XJWB 2XY5A 4PDKA 3CYMA 2COWA 3FIFA 1V55H 1PU8A 2AKLA 3FISA 3D7SB 3UDCA 3JCMX 5GMKl 3CCMT 1VQ9I 3L1PA 3PL8A 3F2KA 2V9VA 2WTUA 3Q0VA 3F8BA 4AF1A 1W2BP 3ZT2A 3LW5E 3V9UA 1NBEB 3U2RA 3AG3H 3VYGA 3RMAA 4JKEA 1EH6A 3CF5L 4KUIA 4ESBA 2R7OA 5EX5A 2RJDA 1XNRK 4E6KG 3KEQA 5B1BH 5AQMA 2W1OA 2NOFA 2CUDA 1V29B 1P7IA 1N75A 2RO0A 3ME9A 1IRXA 4OB0B 4PZJA 3X28B 3DKXA 3G1LA 2FXUA 1QRYA 1XOVA 2X3XD 2MH2A 3THXB 1NGEA 2E2IJ 3OS2A 2WBNA 2W0ZA 1WX6A 2IGOA 1OPCA 1X9JA 2HL3A 1W97L 2VXZA 4FL9A 3HRTA 1H8AC 4CJ3A 3QDKA 3KJVA 2A7YA 2D0AA 3CXCM 2MA3A 3ATUA 2MH9A 2YCHA 4DYQA 3MZYA 1L0OC 4A4KA 3EZWA 5JICA 4M3WA 2Z9OA 1U9NA 3CCVI 4WQ4C 3E9PA 4OLAA 3K70C 2HOTA 1U04A 5FDLA 3WXLA 5E17F 3WU1B 2BTTA 3CC4N 1U2VB 4BEHA 5DLOA 1W7AA 4BQQA 2BVLA 4DUZK 3C95A 4BG9A 1LW0A 2YUSA 1E3HA 2RKHA 2IXSA 4BI4A 1NJZA 4Z8AA 3SB2A 3JCMW 5JHFA 5M1PA 1Z0XA 2ZSHB 2IVOA 4B1UB 5K7HA 2W6KA 3R0JA 1FYNA 4JHDA 4FJ7A 3KLEA 1VQ8A 3CWUA 2CP3A 1W0TA 1RLPC 4ZDOA 1E6GA 4F8RA 2LKSA 3SYTA 4OAYA 4DV4K 5MLCQ 3J81K 1VQPI 2YKNA 3RMDA 3VA3A 5EOYA 2MW8A 2K57A 4IUUA 4K11A 4NL3A 2OTJN 4EP5A 3VODA 5AONA 1WEFA 3CCSI 1VQMI 1IBLK 2QA4Q 2VBWA 3H5NA 2LZ6B 5I21A 1N39A 1USTA 4B1ZA 2EFOA 4JKGA 2CU7A 1IKWA 2NOGA 4GXOA 3QG1A 4PFOA 4B08A 3S8PA 2QQAA 4OPJA 2B4JA 1FYMA 2DA3A 2CP2A 2OPSA 1XGOA 1XC5A 1Z77A 3DLMA 1JLGA 4BR2A 1FIAA 4KHPK 3EO3A 3CQZJ 2IIMA 2TDXA 2NLUA 1JGGA 4EW4A 3S1QJ 3EAEA 1OISA 2ECCA 1GFDA 1VYVA 3SDGA 3CQTA 2KQWA 1N33K 1W0UA 1N8RC 3UA7A 4LG0A 1YJWQ 2A68F 4LB6B 3TW6A 1HYSA 4YPHA 4FETA 3RMCA 3CD6T 2FVUA 3OSFA 3VEYA 4FVMA 4GKJK 3H92A 4ELVA 3WTWC 4FK0A 5D5WB 1ABOA 1F1ZA 1T95A 4P9UA 1NEGA 5DK5A 3I0SA 4Q4ZF 3OYNA 4ETSA 4MO5A 1U47A 2GUIA 2O4GA 4FJHA 2LG4A 3FK6A 4DBQA 5JLXA 3ZMSA 3KD5E 3WEEB 4DA4A 1RUWA 4AYBA 4YFNF 5KH6A 1ZELA 5F2RA 1YLFA 1RR7A 3MFKA 4ELTA 2LF8A 2D1VA 1PM3A 3BDUA 3ULQB 1X6BA 4YEJA 2MCNA 1D09B 3EH2A 3M0TA 3REBB 4KT5C 3SFIA 4M7XA 2ZQBA 4FJNA 2E70A 2YS9A 1C0WA 2ZMEA 2UXDK 1TXQA 2DFIA 2HZDA 1B9FA 4IZ9A 3GTGJ 3UB5A 3AA3A 1VQ5A 4IFYA 3OYMA 5ADXH 2F5KA 4HOBA 1YJ9N 1MGQA 3M6GA 3IKVA 4AFSC 1E4FT 4OIRF 2GBQA 3U9GA 1RI7A 3CDHA 3A0BC 3ECHA 3KLHA 4M75C 3QOEA 2K5LA 4Q0BA 1WNSA 1GV2A 1XSDA 4BRHA 4RMOA 2O8CA 2CT3A 2D5VA 2XRIA 3G6ET 1TH7A 4AILC 1M1GA 3QESA 3ABUA 1XGNA 1WJRA 3BJAA 3WHCA 1XCVA 2FSJA 5DM7L 3H5AA 3RMSA 1U8BA 3SNNA 2E5ZA 4EW0A 2JRMA 2A6EF 4N76A 5DEQA 2M7BA 3CMMA 3OR2C 4C8QA 2NUBA 2HR3A 4FISA 5LBQA 2LJ3A 5FD6A 3OHRA 5DD8A 2WOMA 1Y97A 4FWRA 1SKRA 4H03B 2B0LA 4O5BA 2PG4A 5BQTA 3ZYYX 3T8TA 3I55N 4MLEA 4MDXA 3ISPA 2OA4A 4PCQA 3A2FA 1U48A 2VODA 3MEEA 2CP0A 1WAFA 1IXRC 4JEPA 1YQLA 3EGDB 3E66A 2K3BA 3LSIA 3PX4A 1QVGS 3KHYA 2E35A 4RB0A 2QSGX 5LJ3d 3K4KA 1RUNA 4QS8A 2K40A 2EZHA 2EKOA 1SD4A 1KC8O 2GV9A 1DP7P 2P0QA 1FBQA 2KE9A 4AC0A 1EJ9A 2M9UA 3RI4A 1U8RA 2DF6A 3OS1A 4BJTA 3PSFA 1DGRM 1X6GA 1Q7YC 2CT4A 1ZBJA 4ZYEA 1KQSA 1K7AA 3TSPA 3KWGA 1PUEE 3IAYA 1BBYA 4F3TA 5AFUA 3R4KA 2BDPA 2I7PA 3NVMA 4XRSA 3CFPA 4JLHA 4IX7A 3TSUA 5LJ5j 4AH9A 2YRCA 3CVTA 1Y0NA 2N8GA 3RKXA 2O5RA 3QBYA 2NVQJ 5BR9A 4HHTA 1T03A 5HOOA 2HCKA 1RT7A 3CERA 4DUYK 3C12A 3Q5FA 2OI3A 2PUOB 5F04A 1Y6IA 2PVOB 2FB7A 4EIKA 1MGTA 3RKQA 3ENBA 4KHWA 1VQ9Q 1D8JA 4EIAA 3OR1C 3NNQA 2EV5A 2VWBA 4HNUA 4ZGDB 3C2BA 4RS8A 3MZHA 2RF0A 5J8FA 2AA4A 2HSTA 5FLXO 3CCYA 3OSGA 4OKKA 1R9TJ 1PU7A 1ZYQA 2YJFA 3RTRA 2A5XA 4CCMA 1YJWN 4F4KA 1V76A 3SMPA 2YU3A 2P6TA 3KLGA 1EH8A 3G71A 4I98B 4KFBA 1IRZA 5IHIA 1S1XA 2DLPA 2DTIA 3DU5A 3LX7A 2XKPA 5LGUA 2KRHA 2FZKB 1TL1A 1HKBA 2KVQG 2CS7A 1HKSA 3UWNA 3QYHB 4HCKA 3CTAA 2ME6A 4JK9A 3RSEA 4XU0A 4MLOA 5ICFA 5EZGA 2G8IA 3F23A 2EJFA 4H5TA 1TAUA 3QODA 3S3NA 1U0JA 2DQRA 3QICA 3WU2C 3AFHA 2FLOA 1ETQA 2COBA 1OH6A 2GNCA 3TAQA 3M9QA 2CGKA 1OEBA 3CCVQ 2YSQA 1RDAA 1TQIA 5AIPA 4HAMA 3C6HA 4CJQA 1N8RU 3I64A 3R60A 4ENJA 3D45A 3JCMc 3SLCA 3DLGA 2LP5A 3D0PA 3JRDA 2KYBA 4M78E 2Q2RA 1XNIA 2L01A 3L09A 1KQ2A 1XQSC 2Q3SA 3CC7A 5LJ5e 2MMPA 1S5LC 2MI6A 5GAN4 2M4KA 3KZZA 3D6RA 3HP9A 4XLPF 2P9PB 3BT9A 3S16J 4IHXA 1JI8A 5GJWB 2RJCA 4MQVA 5GAOl 3CPWP 4DFKA 1J9AA 2LQWA 2P51A 4AT1B 3LYIA 1UEBA 2YU9J 3WTZA 2FRWA 4B9SA 3KP4A 4QOZB 2EJRA 3SQ2A 4XMYA 4BGAA 3SQ1A 1ZLMA 4WTOB 3RQIA 3OIQA 5LJ5g 3RKWA 5BRHA 1GXPA 1N27A 2GM4A 1UUEA 3DBHB 2F9WA 2QUFA 2Z16A 1YI2I 4J83A 3DXKB 2KXCA 1VQPQ 2O8DA 1IGQA 1OU8A 3KYDB 2ZD1A 3OYAA 2HEQA 2J4RA 2NOHA 3SMSA 4B9LA 2GIZA 2XB5A 3NARA 1MKMA 2JHJA 1WI7A 1NOYA 2IIRA 1VQMQ 4RGXA 3TDZC 1MNEA 1CGPA 2K2VA 3HXLA 1J5YA 1Z7LA 2DE0X 2AQEA 1TVRA 1Y1VJ 4I76A 3H0DA 3M0QA 3CMAQ 2L89A 3OVNA 4KH1B 4CEBA 4C0ZA 2A1RA 5ILUA 2CZ6B 4FX4A 5J2MA 1XHXA 3HOSA 3QIIA 2X6WA 2M34A 3I59A 3JCMQ 3MAJA 4RW4A 3R1XA 4PUOA 2V8IA 1FW6A 4NC6A 3META 4MO4A 2GLOA 3CCUN 3EFSA 3VKIA 5D6FA 1REPC 4A3CJ 3R6SA 4H4MA 1Z67A 4JI3K 5JVHL 3VUBA 2MYSA 2R7QA 4CC7A 5GADP 1N5ZA 3S41A 4KTQA 4YOVA 2ZPEB 1TSFA 1NKBA 2KZZA 3ZQIA 1IGNA 1PSEA 1JKPC 1LPLA 5HLIA 1NGFA 2DZCA 2KRFA 2D2WA 3O6BB 1IKYA 1VQ4T 2CZ1B 4NQWB 3FK7A 2NS0A 2F8SA 2JSCA 4M7AA 2YSRA 4CIEA 1WH7A 1R1VA 4B9UA 2M1HA 3AL0B 2QQSA 2ZPGB 1JUPA 5B1AH 5EEHA 3M57A 4M77D 4KHSA 4CJLA 4AIHA 2ATQA 1I4K1 1WAJA 4FE7A 3BDPA 1M3QA 3ZL7C 2ZE2A 2XD0A 4M7DE 3AAPA 4Z2YA 4JI4K 2HKOA 2E71A 3FFIA 5GJVB 1HF0A 1U4BA 4AI4A 2E1YA 2KROA 3KD1E 3FFKB 1IN8A 2VQLA 1PP7U 2ZJPL 2ICWG 1W36D 4WFNL 3O8VA 2OPQA 4L5GA 2VE9A 4H0XB 3ZMUA 4J9CA 2M3AA 8AT1B 3H46O 1Q7YU 1UB4A 4FJIA 2WSFE 4M3GA 4JX6A 4A2BA 2IPOB 2NOIA 2K3YA 3J80O 4FYXB 4J2DA 4CUGA 2HMPA 2R7TA 3DRRA 4LFBK 3CCRN 4NCBA 3HOUJ 2F96A 3AO3A 4HVJA 1WB9A 2EHGA 3AGRA 4PFPA 5KN9A 3FZFA 4UQGA 2AKKA 1FMKA 1TG0A 4AIKA 1SAXA 3ISNC 4RLFA 2CV1A 4EMKC 2OV7A 1EF4A 1K73O 2DLLA 1B9NA 2CSOA 5FKMA 3C6UA 4G1QA 1QWEA 3PNTA 4DS4A 4DBHA 4FJMA 1T7PA 1YIJT 1IZ1A 2J5PA 2A42A 3TP0A 1BUPA 4C8OA 2HQEA 3QXEB 2B86A 4WK8F 4KN7X 1GOBA 2Y30A 4C92C 5KYUB 1WEIA 3FXQA 2CYYA 2RE2A 4CEAA 4CK3A 2FPDA 1BK2A 1LNWA 3SFMA 1NGCA 2LNBA 4KIGA 4C0DB 2Q1NA 1W1WE 3O1WA 2JGUA 4AFQC 2M30A 2HVSA 3CMEA 3ZSVA 4CJPA 3KFVA 2C0TA 4UOBA 3ULRB 4IPAA 5KPZA 3HM8A 2CFXA 2QBYA 4ELZC 4MZTA 3AARA 3PIPL 1VIFA 2QEXA 1WBDA 4KI6A 5A0DA 2A40A 4J5YA 3O8HA 1BWFO 1BA0A 1VQ7Q 2CUEA 5GAEP 2F2XA 4EMSA 4C8KA 1KVBA 4J9DA 1R0CB 3IL2A 1MMAA 4AHVA 3MAQA 3FSPA 4RTZA 4P55A 2NOLA 1FOKA 1EKEA 3G1MA 1GRIA 4KULA 4B4CA 4C8LA 3MKYB 4EVIA 4WQ4A 4JV5K 4JZ4A 4CFCA 1JLBA 4MQ9F 1X3WB 4B44A 4M77B 2CO5A 3P1GA 4HRIA 2CZ0B 4I6MA 4PJOF 4JOMA 1QHAA 2JTEA 4C92F 4QIWN 2JXBA 1UELB 2G6FX 3C7NB 2VBYA 3GYHX 2GOMA 2ESHA 3MMYB 3GF2A 3CMAN 4YIFA 1GLDG 3QNNA 4ID5A 2LDMA 3F70A 2NVYJ 4HX7A 5TJJA 3TO7A 1S5JA 1TWCJ 3SDBA 3WVEB 4LY7A 4FK4A 1WSIA 1EX4A 4W5NA 2IPQX 4XU3A 3BCBA 4E0DA 2DMNA 2HF3A 1VAZA 1JTYA 1SD7A 3JB9I 3I5RA 4BRGA 5HNHA 4XKCA 3A5LC 5D4RA 1YE9A 4LITA 1T6SA 3DQVC 1IUYA 3FE1A 5IT3A 4DS5A 1M1EB 5GAHP 3GFIA 5IN1A 1NE8A 5GMKj 3ZMDA 4FM4B 1LNXA 4DZPA 2RQPA 3LP3A 5B8HA 3H1CA 2DBMA 1LWCA 2BIVA 4IG3A 4BY7J 2HL5C 2J05A 1WSJA 1LWFA 3HO1A 2HHXA 2K79A 1VQLT 2EAYA 2IP2A 5FW9A 2BZTA 3V1QA 1SVMA 1YITI 3OW2M 1VTNC 3P9IA 4DG1A 1NGIA 3ZP5A 3CJNA 1S7EA 4KITB 2E1MB 2ESWA 1DLOA 3L2RA 5K7FA 4G9YA 4PJOE 1XGSA 1S1TA 2JJ7A 2G3RA 2M4GA 2V6CA 2O7OA 1PDNC 3I56I 1OCPA 4IDHA 1Z3XA 1ZBSA 2L3SA 1AEYA 3LM9A 4YDUC 3BDDA 5IOZA 2LNHB 1MDMA 1V4TA 3S32A 5HODA 5HVQC 2OZMA 4BC4A 4CJTA 1KZHA 4GKKK 3AAFA 2KHMA 4HG2A 4X1EA 4BC5A 1ASVA 1KFDA 5FB2A 4KBMB 5AIQA 3LPUA 4Z02A 2O31A 3B6PA 5FKKA 4XU1A 1ITYA 2MC3A 4CFBA 2NUPB 3MO8A 2K3XA 5C0MA 1RAFB 3IH7A 3JCMd 4V2GA 1I94K 1FC3A 2KLOA 5AQIA 3NAUA 4HT9A 1VQ6T 1NBWA 1S72I 1XC3A 3NHNA 4XRFA 4A59A 2JVGA 4AVZA 5IOYA 3ABLH 3MWMA 1MJBA 3U3GA 1RDCA 1HCRA 1WBBA 4IO8A 4CZGA 2ELJA 3VN5A 2H1KA 3BG3A 3HK2A 1RESA 4ESFA 3O5ZA 4A6EA 1ZXOA 1G83A 4JKCA 1KVCA 2VYPA 1UMQA 3ASNH 1RNHA 1CF7A 4BWJA 3RVCA 2UXNA 2EGEA 2O8EB 3PT9A 3G6EN 4M75A 1Z6TA 2DEQA 1QQIA 1K0SA 1RFQA 1MA9B 4IEJA 4G94A 2DTRA 3J80E 4RG8A 3I0RA 3THYA 4FLZA 1FTTA 3ZEUA 3EFOB 3F8MA 4IOXA 4A5NA 2OCEA 4LDVA 3G7ZA 4Z4FA 4MEYF 1VQ7N 3JAMK 1VI0A 1LCKA 1Q82R 2FXAA 4BXXJ 1WJFA 2NUZA 4LD5A 2K86A 1VQNT 1PRMC 5AFUH 4BRAA 5I3UA 3E7LA 5FWCA 3CCMI 1BJAA 2OU2A 2EIJH 4UHTA 1F43A 3MEAA 1UGQB 2PMUA 2KFDA 5KGWA 3N4PA 5BRFA 4KGVB 2OA8A 3RR8A 5HBMA 3HB9A 4KMUX 4HCZA 4MLHA 3LDQA 2LTOA 3BG6A 3HJEA 1T2KA 1Q1HA 3FXRA 5KAIC 1VUBA 3AA5X 4AIAA 1E3OC 1ZQ1A 5KCHA 2HNIA 1NHAA 1NM7A 5FPDA 1ZRFA 2I8DA 1AWXA 1BI2A 4DFJA 4DTPA 4XM3A 4RWTA 1QQNA 4CSWA 1JXEA 2ZPFB 1NGDA 5C25A 3A03A 2HQXA 4W5OA 3A02A 3W3DA 1M2VA 4ESRA 3VSLA 3REOA 3VQQA 3VQEA 4E70A 1SMTA 2O9VA 5GIOA 5D5VB 2QCOA 3O3HA 1QVGA 2DU9A 3VU3C 5DLQE 1HW1A 2JWKA 1VQON 2CFOA 2HVRA 4RGUA 1X9SA 3QIOA 2K9NA 3M8JA 1JCGA 2J6OA 3E6BA 3CCEN 3N5NX 2RQVA 4M78G 2L3RA 1N32K 1T56A 1Y64A 2DETA 3TQNA 2ED1A 4O4GA 3H9NA 3H41A 3N5BB 2V1QA 1LFBA 5DYMA 1U5TB 3BY5A 4KHYA 1SL2A 3FLCO 4F2RA 1X27A 2D8HA 1NGGA 2FC0A 5J1EA 5CKEA 4DSIA 4C0FA 3L1AA 2XHIA 1HSQA 1NMDA 1VSIA 3OIPA 2QA4A 4CVNE 1KD1R 3M8SA 3OMGA 5KRTA 4EGZA 1W0HA 2XY8A 2K4BA 1Y71A 2ME0A 3FX3A 3EKUA 4Q47A 2P0KA 2OZ6A 5HS7A 4HNVA 4CF2A 1HNZK 2RMOA 5C0YA 3VYHB 5CR2A 2HHSA 1X4OA 2JT4A 1M3CA 3TQ7P 3ZETA 1VSKA 1MMNA 3OYGA 5BN8A 2XDPA 3FHZA 4F9OA 2CUZA 2P9NA 3P7NA 3BZKA 2P0WA 2MAMA 3A1YA 1MWKA 3LP1A 2CH4A 1RAIB 5KN8A 3FWEA 1MV3A 1T8IA 3AO4A 3IH3A 4RW7A 3DXMA 3ENOA 3DF8A 1OOTA 1TC3C 2K9SA 1I07A 1VQ8T 3Q7BA 4DV2K 3CF2A 4RM2A 4JAXA 1R7JA 1QVTA 2DTZA 4LGWA 5KYNA 3FGUA 1WQ7A 5DM7F 3J7ZO 2V7ZA 3S6IA 5GANj 5IT9O 4DV0K 3O9SA 2Z99A 1RRSA 1RTDA 3LGFA 4LN2A 3SI6A 2E1CA 2X35A 5CCAA 4AFUC 2PAVA 4JKHA 2LOOA 3CD6I 1J5OA 4PK4A 2P9LA 2XV4S 2DYSH 4RGRA 2QXLA 1ATSA 2XRLA 2FEIA 2AZSA 2QKBA 4OU0A 4YOUA 3DKWA 4HV5A 4RCCA 2LY1A 2VB6A 4A57A 1V4RA 1PUFB 3QYFA 4B09A 2DMOA 3SJMA 2XSDC 2HAXA 4KH6A 1WCMJ 1Y57A 1LOTB 3I3LA 4A5AA 3QB0A 4KV8A 2CW7A 4M7DG 2DMPA 4BR7A 2V9PA 1K9MR 3S3MA 2UU9K 2HSPA 2DZ9A 2KBTA 1E6HA 1RABB 1QO0D 1VZ0A 3HKZN 2QTXA 4NNJA 2QDLA 4JRKA 3IMXA 4CZZA 2KK4A 2KNBB 1G6NA 1TZLA 2GTOA 1AKHB 4CJ7A 4M71A 3K5OA 2GGRA 3IHOA 4Y13A 3UR3C 1ZGJA 2LMJA 3ZMVA 2Y4YA 1ZBXA 2JA7J 4XN3A 3VETA 1GLCG 2KZGA 2FF3B 3O9QA 4JX4A 1QE1A 1SQKA 2M0OA 3J81Z 4CZKA 3EG9A 2HHHK 1MDUB 5LL6S 4DZJA 2Y9ZA 4ZZDA 3I56Q 2VI6A 1Y8RB 3F6OA 1UOCA 4QCLA 2E5NA 3NFAA 3JREA 3ULEB 4BRDA 4RAFA 2YI1A 2E5LK 3VQ8A 4Y4RA 3QYGB 2P9IA 1Z7UA 1SAUA 2R7WA 2DA5A 5HCKA 2XGEA 2LVMA 1UZCA 3OYIA 1WQ2A 1Z25A 3DLHA 1FX7A 4NOYA 5HS8A 3B73A 2RB6A 5L3GA 4F7UE 5GANg 2L7KA 1YS7A 3NMUA 3LWHA 2VQGA 4B1WB 3INZA 1PNJA 1WFXA 3D2FA 4Z6YA 2BW3A 2KJBA 3RCOA 4RCHA 1OYIA 4O55A 2PX9A 2V75A 2IVPA 5LLQA 1MBHA 1MIJA 2M0YA 3M4OJ 3NGIA 1M90C 2F48A 1TK8A 1S72Q 5D6EA 3EG1A 3V7SA 1P90A 5E8GA 4PA1A 2RNJA 3TVTA 3EE8A 3A5NC 5GAN5 1KO9A 1G5VA 3JCMh 2Z3YA 3OY9A 4M4ZA 2ZXJA 2PNIA 1ZG1A 5E8IA 3A8GB 2YJEA 3MPUB 3QDRB 3CVSA 1R00A 3K1MA 4RM3A 2DEUA 1IUFA 1J5EK 3G25A 2EQJA 5I11A 3MMVA 1C6VA 2XSJC 3QO9A 1VQ9A 2KI7A 3L2WA 3D5SC 1BQNA 2NYXA 2HVIA 1HD3A 1IN4A 4PL7A 1FKPA 1MSFC 2GBYA 3R2XC 3CCLT 4ASNA 4XRMA 4EMKA 5ICGA 2VN2A 2EBIA 5EYRA 3V9WA 1YIJN 4WCIA 4CYCA 1UG2A 2WAQN 2YG9A 1VRUA 4CZJA 4HVUA 4DTNA 1AU7A 1TUYA 5C4JJ 2OTLT 4PJOA 4C92A 3A5OC 4ZHRA 3E1YA 3S1NJ 3BOQA 3CCMQ 4EZ9A 3OJSA 2DXIA 2P9SA 1P7JA 4E1NA 2VV5A 1BGXT 5M5YJ 2R93J 2HVQA 3LH0A 3VQPA 2YNGA 3VQBA 4FZXC 5FU7B 1XUPO 2OAZA 3HPGA 2G8KA 3KX2A 2HNDA 4B9XA 1TP4A 3QRFF 2IGNA 4DBFA 4B3XA 3SDZA 3V81A 2ZCFB 3OB9A 1ZGWA 1MBJA 3CI5A 5KNLA 2K9LA 2P84A 5A2QO 3CCVA 3KCCA 2JS2A 4M78B 3CO7C 2W57A 3EZ5A 4MMKA 4PIIA 1WEGA 2IC3A 3G0ZA 2A3SA 1W9HA 2YX7A 5FU6C 4K43A 1J75A 1EA3A 3BJ6A 4A62A 3OYCA 2WV0A 3O5BA 3G71T 6PAXA 2FG0A 3BF1A 3ZBDA 5GMKm 4DV3K 1W4SA 2LY2A 1Z9QA 4RB2C 1ETOA 5IT9E 3AVNA 4JKAA 4AI5A 1XMOK 2DOFA 3V8LA 3LL3A 2O8FA 2DK5A 3A4CA 1YJNT 2EQUA 1VQPA 3C6AA 4D5FA 1PKTA 3BG9A 3S2WA 3CIPA 4IXAA 3S17J 1A31A 5FROA 2OZSA 5ILSA 3H1VX 3BQZA 4KJZA 4G12A 1JL1A 3CCSA 3HBTA 1VQMA 4JHDB 4AHCA 4L9NA 1JJ8C 2GWJA 1VQKN 1C1AA 2JA8J 4KICA 3K2PA 2DVEA 3FBIB 2O9LA 3DXJF 4M3UA 1GLFO 2V1XA 1SD6A 4RTYA 1VQLN 3D7EO 2XAFA 3E6DA 3H8ZA 4C8QD 5C24A 2VT3A 1KU9A 2UUZA 1OH7A 1TK5A 3AA4A 4WF9L 2KIQA 1X6OA 2YHXA 1RUOA 3LANA 4YOTA 1IDZA 4JKGB 3BDLA 1HPZA 4ANJA 3QHSA 1I39A 5DM6F 3FM3A 1JJ2S 3N4MA 3WODF 2O2OA 3F10A 4RGSA 1ZK8A 2LQ8A 3HVTA 5AQKA 4BDZA 1E0EA 3UNGC 2RHXA 4HWIA 1FWZA 4JI6K 4IG0A 4BNCA 3JB9F 4K8XA 4IVNA 2Y75A 2ENMA 1KQ8A 1RI0A 4LG0B 3GXOA 4U87A 2FMYA 4GYGA 2EZLA 3T8RA 4G6DA 2L3PA 4CGGA 4CZHA 1ASUA 3K0LA 3TBIA 1NK4A 2X0LA 1Q82C 1FMWA 4EJOA 3CD6Q 4CCJA 1MW7A 3CC2N 2V7YA 4JBAA 4OPHA 2L4MA 4FPAA 4FLVA 4BB7A 5GAOp 3CCQT 1VQ4I 3GWZA 3G4ST 2PN6A 3LDPA 4O0IA 4XTUA 1ZX6A 5CKHA 3L2UA 3X2QH 5LHGA 4CRIA 2PQ8A 2H94A 2P5LC 2M0CA 4IL6C 1YHQT 2BUPA 3KTQA 3I54A 5AQQA 4Z88A 4OKJA 3H3VK 4A2AA 2FHDA 1M90U 2KIUA 2F7TA 4M6YA 5CZ2A 3E6MA 1FT9A 1CXQA 3H3NO 2DT6A 3PO4A 3CJAA 3LCNA 3VS3A 2ZMEB 2QVOA 4KT6A 3QQAA 2FEZA 2BV6A 3IRRA 3HOYJ 3KK2A 4CGJA 1SKUB 2P5VA 2MGQA 4I09A 2BGCA 2K7AA 2ELHA 2RHUA 1Y96A 3O9UA 2O8CB 1C0GA 3JRBA 2DPPB 1F1BB 4C2MJ 2BGGA 1VQNN 3WVDB 4F52A 2EH3A 3VS6A 3FRNA 2H1LA 4E19A 4U7DA 3FHFA 4C8QB 3IRQA 2GTJA 1C1CA 4GCVA 1NJXA 1PHTA 4AHTA 5CVRA 4Y0WA 1ZUYA 1ZBLA 4UV8A 1JKQC 1JLAA 3WXJA 1KGSA 1MUDA 1JLQA 4C1NI 2WACA 1F5TA 1S29A 5L3FA 5FPMA 3NH1A 4AM6A 3K4NA 1D3BA 1NK6A 4DV6K 2HEOA 4FM2A 3RRGA 2K5CA 1KQSM 3T1BA 4M74A 2LP0A 3MDQA 3NF9A 3CP8A 3P8HA 1RT4A 5TRDA 4KDPA 2A41A 1RETA 4BE1A 3NBPA 3O2PE 2XIGA 3E5QA 4BJ6C 2F4VK 2VUMJ 2FA5A 5M5WJ 4BQNA 3DWLE 2CS3A 3ZQQA 4X1VA 3JRGA 1BISA 5A2QE 2O03A 1ABQA 2BZYA 3RSNA 2I5WA 1RT2A 5IPAA 3R6OA 4JQFA 4J8FA 2O4IA 1CZ9A 2Y48A 3ZXSA 3BW1A 3MKZA 2JA5J 3ERED 1BW5A 2COZA 3HOTA 4CC3A 3AT1B 3VJPA 2FBKA 4OPKA 4GV9A 3OYFA 3K4LA 3VQAA 3FXMA 1KSPA 5LJ5f 1IREB 2EW3A 2QEXT 2DQLA 4E3SA 1T3VA 2GFUA 1LFUP 1F4KA 2E6NA 2QTDA 4FIBA 5C2FA 4XKBA 3CFRA 2VC8A 4IBNA 4C1NK 3H5RA 5FLVA 4DKWA 1HA8A 1B4AA 2JW4A 3FXOA 4DOWA 1LWEA 4F17A 3H0FA 2DW4A 5JLWA 3U9DA 3AG4H 5GP9A 3DPLC 3FDYA 1X43A 5M1NA 2KSSA 2ECBA 2QGUA 2Y0MA 2A5WA 3A98A 4UY8I 3RJPA 1TLHB 1D9DA 4UNFA 3JSPA 2QK9A 3CXCP 3H9GA 4YIIA 3THWA 2FQ4A 4AIDA 1U6GA 2A28A 2LJ0A 3H08A 4LJZF 1BL0A 1VQ8N 3CC4T 5J6XA 1ORNA 1GVJA 3HOVJ 1K9MC 4C2UA 2VQCA 3K4MA 3RSEB 1ERDA 3VEPA 5GTHC 3NTHA 4KH4A 4M7AD 4PWDA 3T1YK 5FPNA 2HDAA 3ID8A 3M4YA 5AZIA 3ABKH 2FF4A 1QLYA 4DSLA 4RCBA 5LL6Z 4RW9A 4K41A 4AIJA 1CKBA 4N9IA 3T7ZA 5DDGA 5F0HA 2DK3A 3SUOA 4IQ4A 1OKRA 1DDNA 3HKSA 2QKKA 3OYDA 3R6MA 2ABKA 1NK8A 2EZIA 2E2OA 1K83J 4HQMA 2PY5A 2JVHA 1EIFA 5HRPA 4FLYA 1YI2A 4Y52J 3GBGA 1TOVA 1U45A 2OTJT 5EG0A 3IRXA 4R55A 3VUZA 3DEUA 1BN5A 2IS6A 2HMIA 1JHFA 1IN6A 1TWBA 4F7UG 1JEGA 2M0MA 2CREA 3HSCA 1R0AA 4DR2K 2JNGA 3SWNC 4A69C 1TUGB 2P6SA 2FSKA 3TTCA 3R8EA 2DXCA 1UA0A 1IJJA 1NOZA 1GUUA 3CWAA 2O8DB 3TAFA 3SD4A 4Y33A 1VQ6I 2FZGB 2H6BA 1QSLA 3PNVA 1MBFA 4Q48A 1TKDA 2ZSIB 3IAM2 4BY6B 2BANA 1J3TA 1OZ2A 2NS7A 1YTAA 4IFEA 2JZYA 4JN4A 4AYBN 5CO7A 1TKXA 4QQ6A 3I4PA 4XLEA 5LHHA 2FU4A 4XTZA 2QLZA 3M07A 2H8RA 1QHGA 4Y1CA 4EJWA 3C0CA 2QM1A 1UB9A 1FK9A 3GUDA 5LEKA 1R1TA 2GELA 2L2PA 3L3UA 1EQYA 4QPQA 4GMJB 3I59B 2PVDB 3THKA 4JJCA 4UUSA 3CBPA 3UPUA 2LY9A 3NCIA 3BEXA 4I01A 2HNHA 3EDPA 1VQ5N 2V79A 3LDOA 1YIOA 3THVA 1STZA 5GAOm 1M3HA 1UE9A 2MC4A 2GWRA 5CQGA 1K4US 1N6AA 3QUIA 3QWXX 2DO7A 3IC7A 3LZJA 2EYYA 2MLGA 2TRTA 2Y2ZA 3VYTB 4DQSA 3H0GJ 1K61A 3D2EA 4ISFA 3HFNA 1HSTA 4N0AC 3JCMV 2EK5A 1VSHA 2KXDA 1B9DA 1ACMB 3IDHA 1BIUA 2L3DA 4M7AB 4CFDA 3K70D 4CBXA 5CQYA 1ZYRF 1VQ4Q 5GAMe 2R0QC 3DOKA 5ERIA 1YJ9T 1N8RR 4FWKA 2TCTA 1H3ZA 3CO6C 4XLNF 2H8HA 3QYEA 5J3BA 3IKTA 4X6AJ 5GINA 1N5YA 4O8KA 4CBWA 4II2A 4E9HA 2PYLA 5M3MJ 2OYQA 2HBWA 3JSCA 1FBUA 4OMNA 3HOZJ 5GAMg 4BROA 1KVAA 3QIPA 3OOUA 3JRCA 3L4QA 4XKVA 2D1KA 1NEBA 3HRGA 3C65A 3NVKA 4DV7K 1ZH5A 3THXA 2L2OA 3TTDA 1X2NA 3WXIA 2WB1A 1Z9ZA 5J2PA 3DB4A 2HYGD 3TREA 4DJAA 4KPYA 4O8UA 3RBBB 5BPNA 5AQUA 5IYDJ 3UKGA 4BR9A 1WHUA 1TWGJ 2DN0A 1L3SA 2GF7A 1HQCA 1WDXA 1LCUA 2ZGYA 4QAGA 1Y07A 3KK3A 3MKWB 1ZBUA 2RN8A 2NRWA 4XKWA 3WE3A 3GBQA 2X6NA 5AZJA 3GFJA 4D7NA 4I7HA 4B48A 1RC9A 3SZTA 2G7UA 3AVCA 4FQGA 3EGUA 4G7ZF 4N47A 2P8TA 4F3QA 4RDUA 1D0ZA 2DL5A 1LE8A 4Q5WA 1SSHA 3QWLA 2OANA 2F2VA 2EFNA 4OB2B 4DFPA 5HRNA 2V1DA 3BY6A 4N9HA 4XQFA 2GXBA 1TWFJ 4N4IA 4CJSA 2K5FA 3HEFA 3UKRB 2Q0UA 1XTAA 2E12A 3GL1A 1JTXA 3AVBA 4IRGA 3BJOA 3HOXJ 3RMQA 1HJDA 4DSFA 2E7WA 3RPQA 3HRUA 4DTRA 1RT1A 1GCQC 3MEWA 4OMQA 3BF3A 5CKFA 3GVAA 3PQKA 1K9MU 3DLRA 4UVBA 2VJ5A 2QA4T 1U2WA 2K6DA 4FPBA 1NK3P 2XGCA 3VF2A 5J2QA 3F5TA 1KQ9A 3BZ6A 1TQMA 1XPXA 4Z4IA 3BR6A 1QW1A 4E7SA 4OPAA 4BVPA 5H6RA 4XQ3A 1NGHA 1WJBA 1WI3A 3LGLA 5LJ3e 1APLC 1KG3A 4CD1A 4OGEA 2EB7A 3I0TA 1XWLA 2W25A 4CEEA 1D0XA 2W82A 3LSGA 1KSWA 2WSCE 1KAYA 4I6MB 1I3AA 1WWXA 1RNLA 1UWBA 2AXLA 1KFSA 4J6XA 2RQTA 1YJWT 2UZKA 4DSKA 5JR3A 3PUFA 3JR9A 4BQLA 4WXCA 4NDLA 4D1QA 1U6ZA 1XQOA 3OL4A 4FWMA 4K0KK 1O57A 2WA0A 3EETA 5E3NA 3REAB 1S1WA 5LJ3g 2P9UA 1IO2A 4NCAA 3JCMP 2C0OA 2ROLA 4FYVB 1JB0E 2YUQA 4HXJA 4OFAA 5LY3A 3NMZC 1IG7A 2VKHA 1O75A 1CKAA 2ELKA 3CC7N 3L4IA 1KEAA 3MP6A 2PFBA 4WXDA 3CJ7A 4JYKA 1MZBA 3J7AO 2EGAA 2KMTA 5FKLA 1YITA 1FN7A 1P59A 1KU2A 1OCCH 2CJJA 3MKLA 1NTCA 3RWUA 3G3ZA 3SAHA 2XICA 2MWPA 4OFHA 1F21A 3DEWA 3CCJI 4CEDA 3FXJA 4WCEL 4FTHA 1ZQ3P 1YW7A 2E3HA 1QP3A 2BEOA 4BG8A 4Q5VA 2NZTA 3LAMA 3RR6A 2VKNA 2EA4A 4E9EA 5IAYA 4YFKF 4CHNA 2X9HA 3T9NA 2E1HA 3V8JA 3I56A 2LT1A 1GLEG 4M63C 4EFHA 5D8LB 1A5XA 1USSA 2E19A 5GMKi 3F9KA 2GOXB 3KP2A 3BPVA 3DP7A 3EYIA 3DLEA 4A3DJ 4M3XA 1I50J 1BOAA 1S6QA 3CG7A 4FW2A 2Z1GA 1N34K 3BTIA 4M77E 1HNIA 5B5EC 1SKSA 2KMUA 4X64K 4FJ9A 1C0MA 2EWSA 1QPMA 4OIPF 3VS5A 2VG6A 2YUPA 5HDNA 5AQJA 1IV6A 1KAXA 4H0OA 4JRPA 3RZDJ 1JJ2A 2EZKA 1YG2A 3WU0A 1DU6A 4IHYA 1MDMB 1NYFA 2EJGA 2UUAK 3C2GA 4RAGA 4G6QA 5KYYA 4PSWA 4D7MA 4FT2A 1S72A 4IEEA 2V6EA 2DKGA 1ZHFA 3TI0A 1O9SA 4FU6A 2FSNA 3RPUA 3PIOF 3HG9A 4FX0A 3SUPA 5I9EB 4J6YA 4WCGA 4XU2A 5JVGL 4QVCA 2XHBA 4BRLA 4PJJA 3HGGA 1H9GA 2V1NA 4ESJA 1MUNA 2MIOA 2BTFA 3S93A 1QCFA 3QBXA 3H45C 4IKFA 1PYVA 4Y7NJ 1QQOA 1K9AA 4I7FA 2BKDN 4DTMA 2Z1JA 4JKBA 3CCUT 2CSQA 4BHCA 2ZPHB 3VQ6A 2HYJA 5F0CA 1FNNA 1YS6A 2KPMA 2UUCK 2HPMA 1A35A 4P5OA 3QEPA 5FKOA 1EWQA 2ZJQF 1CF7B 2DA4A 1DIZA 4M75B 5AQTA 3JYTA 1OYXA 4YELA 3O8MA 3CCMA 3SYZA 4F2SA 4NHJA 1FMVA 1DU0A 4Z0UA 3THYB 3ZEUB 2DDAA 4CI0C 4KIBA 4B1YB 3NF8A 4UV9A 2Z5UA 3CCLI 4XK4A 1SHFA 2W4SA 1KG4A 1R58A 4UUVA 3ZFJA 4DTOA 5EY4A 1ORPA 5I2SA 2MF2A 3D0SA 2OTLI 2E4LA 4DIQA 2OPTA 3VF6A 3PVQA 1JE8A 4A0ZA 3TSZA 2HZTA 3JAMO 3GBTA 1OYYA 3ABMH 1GHCA 1A5WA 1TNSA 1QVGM 4J9BA 1I6HJ 3NFCA 1ARKA 5CY4A 1ZA1B 1K8KA 1Q82O 5J4YA 1UFFA 3TAPA 9ANTA 3CCRT 2R7XA 1U3EM 1KQ0A 3R0AA 1RRJA 4ENKA 1RGIA 3HP6A 4F91B 1WI9A 1RAAB 5M1OA 3WNFA 4Z4CA 3L2CA 3HTUA 4EATA 2KFZA 4B9VA 4NCGA 4ATOA 3CMEN 2XAUA 1DTTA 4CK2A 4DOVA 3N0UA 3IUOA 3RQ4A 4JLIA 3J7YJ 3F72A 3D1NI 3I0XA 4WWCA 3HSBA 3P31A 3TMOA 5JI6A 3AO5A 1RDBA 2QEXN 1IBKK 4J7IA 3K4CA 3WQUA 2B63J 1J6ZA 2XI9A 4NC7A 4YORA 2XY6A 5LEJA 5EGOA 2MPXC 1M1KR 1ZSZC 5JS2A 1ZLJA 4EAHD 4JRIA 3U8XA 3UF4A 3A8MB 1NNEA 2QWOA 1V54H 1NK0A 2VPRA 3O08A 1TS9A 4BKXA 3ESWB 2W24A 4FWQA 2XROA 2LSOA 3FC3A 1QZYA 3RKYA 1YJNI 1R6RA 1ODDA 1GOCA 1V4SA 1BHLA 2Q0OA 3PE0A 3MKDA 3EHQA 1T0JA 2M51A 3CJCA 1EH7A 3MVPA 4OMZA 2UYTA 3IG1A 4ZC3A 4MHGA 3PO2J 1BR2A 2M87A 3CJQB 4IO9F 3CEYA 4WFBL 1MH3A 4KHUA 1D5YA 4CIFA 1QVFS 3GPLA 4JRQA 4IOAF 4F04B 5C3EJ 4L0ZB 4K8ZA 1JQQA 5BREA 1NYGA 5DTDA 2JOYA 3PX6A 4ZJZA 4LOCA 4EJZA 1YAGA 1VQPT 3ZETB 4A5MA 2ROTA 5IXFA 1QZZA 4CGIA 2P9NB 1DPRA 1ETWA 1FP2A 3JTHA 1MUZA 4R8HA 1DUXC 2R92J 5ED4A 1WHLA 3JRAA 3DXMB 1YUWA 2ISZA 1KD1O 1IJWC 2H56A 3ENHA 4K42A 1G15A 4DLGA 2RN7A 2KIFA 5JLHA 1UDLA 3CJ9A 5ECAA 3CMAT 2JUCA 3CD6A 3SCXA 2D1XA 2JA6J 1PVSA 3HHGA 2CWEA 4ME7A 2ETJA 2EQRA 1GLLO 2M7AA 3DBRB 2BXYA 5GANf 1WOQA 4CJUA 3RMBA 3WT0A 4CF1A 3HIFA 4LDUA 4YPRA 5D4SA 2XVCA 4XIUA 1WHMA 4LMYA 4R1HA 2QWLA 4CCOA 1W5CC 4ABZA 2VWJA 4CCNA 5M9OA 2DBBA 3R9PA 4J9IA