3L2RA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2rA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2rA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2rA03
4FJ5A 1RBTA 2YV0X 1G15A 3SQ4A 2VWJA 2RI5A 3O4QA 4Z4CA 4CHZA 3SUPA 2PYLA 2HVHA 1CLQA 3C6TA 3JSMA 4C5IA 4OJRA 1C0MA 1BI4A 5CZ1A 5HRSA 1N5YA 1S1TA 1WLJA 1RT2A 4ELTA 5HRPA 3PO4A 4F3TA 2AJQA 4IUQA 1S6PA 1C1BA 2FC0A 4FJKA 2DFFA 4DSLA 4CGFA 4DF4A 3OJSA 3OYAA 3NFAA 3F9KA 3ZSOA 4DMNA 3KLGA 4JS4A 3QNNA 2XY7A 4CECA 1U49A 4DQPA 4Z4FA 5HP1A 4CHYA 3PFSA 1I39A 3HL8A 3ZT3A 3DB3A 1HRHA 4ID5A 2FBVA 4AHSA 3ZSWA 4CJ3A 2M16A 3QESA 1XHZA 3CFRA 1S1VA 4W5TA 4FJ8A 1BGXT 2RKIA 4OGEA 4AH9A 3SQ0A 1LWCA 3PV8A 5J2PA 1ZBLA 2QQRA 2D5RA 2GV9A 3SUOA 1J5OA 4DSKA 2KW4A 4DTUA 4KHYA 4JRPA 3QERA 2DY4A 2PYJA 4E7IA 1HQEA 1L3TA 3DI6A 4FJGA 3NGZA 3QLHA 1NJXA 3S3OA 1DTQA 3LDSA 4KB1A 4CJEA 2HHXA 1TVRA 2A1SA 4LD6A 4AHTA 1U45A 4UC4A 1YTAA 1NKEA 1QSLA 3FFIA 4E1MA 4H4MA 3TAEA 3PX0A 3C94A 4ELUA 2VG7A 1S9GA 4W5NA 2D9TA 3EYZA 4AHRA 3NF9A 1J9AA 3E01A 4KO0A 1Q9XA 4Z02A 3UT1A 1RT5A 1H3ZA 2FBYA 3ZT0A 3P8HA 1U04A 3CM6A 2IDOA 3LAKA 3ZSYA 4CRIA 3NAEA 3EY1A 2IS3A 3AVFA 2ZE2A 4BACA 1YT3A 5J2MA 4KHSA 4CFCA 4N4IA 1VSFA 3H8ZA 3TAPA 4K8ZA 3E9FA 5IAYA 1ZBUA 3B6OA 2HHWA 3NF7A 4G1QA 2GFAA 1KFDA 2EQKA 3FLGA 4E1NA 4KHQA 3V1OA 1DLOA 3ZSQA 3ZT1A 3KUFA 3HP9A 4CEBA 3OJUA 2ETJA 4PUOA 3K5LA 1WSEA 4CHNA 4ELVA 3V9SA 2DTUA 3DLEA 4KREA 3NE6A 3CM5A 3V81A 3OYDA 1WN7A 3V9WA 3FC3A 5KCOA 2XY6A 3KKRA 4DSEA 2YNGA 5D3GA 1FKOA 3H08A 4JS5A 3SQ2A 3WNGA 3ALYA 1G5VA 5IN1A 1JLCA 1QHTA 4RW9A 3PO5A 3MXMA 4I2QA 4QQGA 1KFSA 2YKMA 4FK2A 4M3TA 2D0AA 4KKOA 3HP6A 1IKWA 2G3RA 2VG5A 3QEPA 1QTMA 1B9DA 1KLMA 4F4KA 4IBNA 2G8FA 1JLEA 3AVNA 2YNIA 1TGOA 2Z1GA 3NDKA 3DRPA 3QO9A 4OGCA 1WAFA 3U3YA 1SKWA 1LAWA 4FW1A 3VQDA 1NKCA 4FU6A 3QNOA 1L3UA 2HMIA 4E0DA 3E9GA 3F70A 4KI6A 2HHVA 3K57A 4CEOA 2Y1JA 4OVAA 4DFKA 1RDBA 2X74A 3OYJA 4CJQA 2RN2A 3AVBA 3OS1A 3QIPA 2KZMA 2BGGA 2M0OA 4DU3A 3AVHA 4Z4HA 4I7FA 3B6PA 3LZIA 5HLFA 1UWBA 5J26A 4BE1A 2IC3A 4KHUA 5FRMA 2R5AA 3NNQA 1EP4A 5T7BA 3NH1A 4PA1A 3DM2A 3VQ6A 1WNSA 4RW6A 1NK9A 3AVKA 3PX4A 4UQGA 1KVBA 3LP2A 3K58A 2R57A 3LX7A 4N41A 2DIQA 1JLAA 4M3UA 1HNIA 3OYNA 1BQMA 5KI6A 3UIQA 3PUFA 2MWOA 4QAGA 1L3VA 2OZSA 4OLBA 4FJ7A 3S3MA 4M3RA 4N5SA 3MP1A 4M3WA 1HMVA 3QEVA 4N76A 1UA0A 4FJ9A 3IS9A 1I3AA 2XDPA 3CG7A 3HVTA 3QINA 3MEAA 5KGWA 1SL0A 3SPZA 4CERA 3K5OA 2X4YA 3P8DA 3KJVA 2O4XB 4DLGA 1S9EA 3AA4A 4BD3A 4JLHA 2GBZA 2BE2A 4N4GA 4MQ3A 3CFPA 4BWMA 4Q5VA 4IDKA 3M8SA 4HUGA 3V9ZA 3G10A 3L2UA 2K3YA 3OS2A 3AVAA 3HPHA 4KTWA 3M8RA 2RF2A 3HO1A 2RHUA 4KV8A 3C4SA 3KLEA 2BUDA 3OMGA 1RT4A 1R0AA 2G8VA 1T7PA 4J2AA 2JTFA 3ITHA 2KTQA 2MWPA 2W42A 1RBUA 3LH0A 5HBMA 2LDMA 3META 4FVMA 4AHVA 4B9MA 5KCHA 3I0RA 1OYXA 2QQSA 1MHNA 1ZBFA 1NJWA 4DSJA 4HUFA 3HPOA 1KRPA 1VSDA 3L2QA 1BL3A 1EKEA 2X4WA 1LW2A 1JXEA 1WJQA 4NZGA 2HB5A 2O4GA 1KLNA 4BDPA 1D5AA 1LV5A 2RPIA 2F5KA 4GW6A 1ASUA 2DFEA 1NK0A 3RRHA 1IH7A 3ZSVA 2R58A 3O3FA 1SKRA 3QEXA 1HYSA 2HHTA 3O4NA 4C8LA 1OZ2A 4B9UA 1HQUA 3LGLA 5CYQA 2HHUA 3RWUA 3CQ8A 2FHDA 1HYVA 4DTOA 4C5EA 4B9XA 4DSFA 3ME9A 5J2NA 1NOZA 2FBTA 1TAUA 1O1WA 2RJCA 1VSJA 3MXIA 4A4FA 4LSNA 3K5NA 3LP3A 3P5JA 2E4LA 2E5QA 4H8KA 3WNHA 1NKBA 4L59A 1RT1A 2RJFA 1SV5A 3NF8A 3P1GA 1A5VA 2QXFA 3OYIA 4F2SA 4KAZA 4DTMA 2IOCA 3AO2A 3OB9A 4FJXA 3DLKA 1HNVA 4B9VA 1C1CA 4LY7A 4M42A 2HQXA 1N27A 4CEDA 4C8MA 4J2DA 4CJSA 2XY5A 2X6SA 1CZ9A 3QJ6A 3VQBA 4FM0A 1X9SA 3BGRA 1K6YA 4O5BA 3ZSXA 4DLEA 3LALA 4FLWA 3SV4A 4FK0A 1XWLA 2HNZA 1RT7A 4B3OA 4CIGA 4QQ6A 4MFBA 1T8EA 3GOXA 4CJRA 4CGDA 1VSKA 3OYGA 3SJJA 3NTKA 1BCOA 3VQ9A 3VQQA 4DTXA 1OZ3A 4DU4A 4DQQA 2A1RA 5JS1A 4TSXA 3SUNA 3ULDA 3PY8A 4CGHA 3HSTB 3KK1A 4FZYA 3AVCA 3V6DA 3ZSRA 4DFJA 1OI1A 2OPQA 2YHAA 2OZMA 4QQDA 4E19A 4AHUA 4J2EA 1IKVA 1L3SA 2X78A 3OMCA 4II1A 4CJTA 4HUEA 2R7YA 1WJSA 3AO5A 5C6SA 1ASWA 4RW4A 5FRNA 3CEYA 1B92A 5C24A 5KRSA 1CXUA 1RTHA 2GFUA 4N47A 3VQ7A 3MXJA 1S1UA 4CJFA 4EP4A 5KGXA 3S3NA 2RHYA 1RTDA 2OYQA 1WSIA 3H6ZA 1QE1A 5CYMA 2Z1HA 3DLMA 2E6NA 1JL1A 4ICLA 4Q5WA 4IG0A 5CZ2A 1C6VA 1TAQA 5J2QA 4A4GA 4I9QA 2X4XA 3QIOA 4CJ5A 3VQAA 1KSPA 4OVLA 4B9SA 1LWEA 2P1JA 3VQEA 4B9NA 2IG0A 1JLBA 1TKXA 1YTUA 2P0KA 1RTJA 1WSHA 2RHZA 1RCHA 1UA1A 4FL6A 4Z4GA 4EDUA 1JL2A 3WNFA 2OA8A 2X35A 4FLYA 3P83D 5M9OA 3MEGA 2B4JA 3M8QA 4C8KA 1RDCA 5K14A 1GOCA 3C6UA 3O3HA 3NGIA 2IAJA 2K3XA 4CHQA 3D0PA 3RMDA 4EP5A 3RR7A 3K5MA 3LGFA 4CK1A 4FW2A 1RT3A 4CHOA 4QVZA 2YNFA 3AV9A 3I8DA 4K8XA 4KHWA 4HCZA 2QKKA 2HHQA 4C5GA 3VA3A 2HVIA 1ASVA 5DMRA 4CK2A 4CK3A 3K59A 4F3OA 4DTNA 3PMTA 3T19A 4FLZA 1Z26A 1RBSA 1TK8A 3NH0A 1Z25A 3SQ1A 1JLQA 4M41A 3NTHA 3OS0A 4HVJA 1Q9YA 4M3ZA 1GOBA 2JZ2A 1EXQA 3OY9A 4E7JA 1RT6A 4RW8A 4AHCA 5CIUA 4CGJA 4CEQA 3QEWA 4HCCA 3OA6A 2FBXA 3LPUA 1C0UA 3SZ2A 4DFPA 4FLTA 4N4HA 5CY4A 4DSIA 3DMJA 3AA3A 1VRTA 4NS5A 3MECA 2M1HA 3TABA 3RRGA 3MAQA 2E6MA 2QK9A 4C5HA 4GMJB 2F8SA 1NK5A 3SYZA 4O44A 4FM1A 5HRRA 1NJZA 4FJIA 4QW2A 1XNIA 3KD5E 1ZBIA 1RILA 4CESA 2R5MA 4DQRA 3NTIA 3VQ5A 5KRTA 3SPYA 4B9TA 4Q0BA 5FDLA 4KFBA 3HJFA 2Z1JA 3IRXA 2X6NA 4QOZB 1ZYQA 4DF8A 3MEDA 3LANA 2CKKA 2BKDN 2RHIA 3ZSZA 2P5GA 2P51A 3MP8A 1TV6A 4C8NA 1WSFA 3MEEA 2YNHA 1IG9A 4J2BA 2KFNA 3RR8A 3OVNA 1REVA 2OPSA 1U47A 3SUQA 4DWIA 3KLHA 3D45A 1L5UA 4DTRA 4H4OA 2G8IA 1BCMA 3ZCMA 2VYTA 3DOKA 1VSEA 4BE2A 1IKXA 5JS2A 3VN5A 4CJVA 3JYTA 4DQIA 3HK2A 3L2WA 1DTTA 1KVCA 4I2PA 4FLUA 3NHGA 2L8DA 3KLIA 3MEUA 3PNWC 1SUQA 2HNYA 3AVJA 2DAQA 4IUUA 4PLIA 1WAJA 4FLXA 4QCLA 3OYFA 5KH6A 2YHBA 4PY5A 3THVA 4E7KA 4ZTJA 2WACA 5SWMA 2IGIA 3KK3A 1W9HA 1NJYA 1X1PA 2B8AA 2XO7A 1QSSA 1F21A 3CFOA 3TAMA 2WONA 1WJRA 4ZTFA 1EETA 2E6LA 4KB0A 2QKBA 4CF8A 3LPTA 4OKEA 3HVRA 4FCYA 4CF1A 5C25A 4OPJA 1TKTA 3LP0A 2B5JA 4CF9A 3TI0A 3ZEHA 4F8RA 2G8UA 3AO3A 4FJMA 3Q1JA 3ASMA 3IAYA 4F2RA 4HCBA 1C0TA 4DTPA 3SV3A 3FDRA 3ASKA 4CJKA 3M9QA 2ITGA 4OPKA 1RNHA 3A2FA 2PZSA 4FJJA 3G0ZA 1BHLA 2ZQBA 3V1RA 4DTJA 4IUPA 1NK4A 3VQPA 1U48A 4L8RB 3DLGA 2Y1IA 1T05A 3DYAA 2HNDA 3KD1E 3BDLA 4W5RA 3TWHA 2KQ2A 3L3UA 2GF7A 4IG3A 3RMAA 1FK9A 4FZZA 3ZT2A 1BIZA 4PWDA 3TANA 1QS4A 3NF6A 2JGUA 4HTUA 4E7HA 4B8AB 1LAVA 4W5QA 3DLBA 4CIFA 2D0CA 2YRVA 1TL1A 3LAMA 1SKSA 4DQSA 4KRFA 2EHGA 4NCBA 3S6WA 4CJWA 4FJHA 1SSFA 1FKPA 4ID1A 2B6AA 4CFAA 5C42A 4Z4EA 5KE3A 1A5WA 4CIEA 3TAQA 4A4EA 4M3YA 1BISA 1C1AA 1RDAA 3O8VA 4CFBA 4FM2A 1X9MA 4FYDA 3DB4A 1TKZA 1JXBA 2LRQA 1JLGA 5D6WA 1WSGA 4BE0A 2XRIA 4DU1A 2L3RA 3V9UA 1GOAA 4CEFA 3T1AA 4PQUA 4CGIA 4HHTA 1UAXA 5FROA 2PQWA 4BDZA 1Q8IA 3LYIA 1XC9A 4BDYA 4JRQA 4DG1A 1HPZA 4E7LA 2NUBA 4E3SA 2O4XA 4DFMA 3CYMA 4Y1DA 5KE2A 2G8KA 1D9DA 4PLLA 2OPPA 4LH5A 4KTZA 1S5JA 3QBYA 4LSLA 4C8OA 3DOLA 3AVLA 4FK4A 4LH4A 3HT3A 3K2PA 4PL6A 2EFIA 2RI3A 3LP1A 1BQNA 3NCIA 1EX4A 4B08A 2EQUA 4IURA 4N56A 2VWKA 2HHSA 1RTIA 4AILC 2BANA 3OYHA 2RO0A 2LTOA 2GUIA 3HPGA 1SL2A 2BDPA 2G8WA 3NBPA 3AVGA 3L2VA 1FXXA 4IFYA 1YVUA 3EAEA 2F8TA 4W5OA 3MP6A 3OYEA 4RW7A 3HXMA 1D8YA 4KTQA 1ZBHA 1XI1A 1BIUA 1X9WA 3TARA 3AO4A 1SL1A 2EX3A 3SNNA 4KPYA 2LVMA 4OLAA 1N6QA 1BI4B 3OQ5A 4FLVA 2I5JA 1RBVA 3MEVA 1RI0A 3DRSA 5HRNA 4YNQA 1J54A 4GY5A 3NGYA 4CF0A 4E89A 5E41A 4DTSA 3PMIA 1VK0A 3KLFA 5J1EA 3LWLA 1TK0A 1Y97A 4KI4A 2KZZA 5KTQA 4O4GA 1NK6A 2XHBA 3AVMA 3L8BA 2YKNA 3V1QA 3OYKA 4A4HA 4IFVA 4R5PA 3TAGA 5HROA 1WGSA 5D6YA 1MU2A 2P5OA 4NCGA 2RI2A 4I9LA 5DK5A 2EQMA 3AVIA 3RMBA 4RG2A 3C95A 2L89A 3QETA 1VSMA 1RDDA 2XY8A 1UOCA 1U4BA 1TK5A 2WOMA 4LD0A 2ATQA 4FXDA 5D6XA 1HJRA 4DS5A 3DRRA 4M45A 3MO8A 3RTVA 2RJDA 3EZ5A 3IG1A 2ZD1A 3KIOA 1J53A 4Z4IA 4X34A 3ISNC 2HW3A 3DLHA 4IUVA 5I3UA 4CHPA 2LCCA 3QIIA 4IKFA 3SD4A 1B9FA 4NCAA 2DIGA 2Z1IA 3OYCA 1VSHA 3AA5X 4CFDA 3QEIA 3AO1A 3BDPA 3L2RA 1HYZA 5J39A 1LWFA 1RBRA 4CGGA 2O4IA 2XK0A 2DFHA 2EQJA 3M8PA 4CCHA 1S1WA 3VQ4A 1T03A 1JKHA 1TL3A 4O0IA 3V9XA 3V4IA 3L3VA 4B9LA 4OKJA 3TR8A 3HM9A 3PX6A 3U3GA 4KHNA 4XIUA 4GVMA 1NOYA 4BWJA 3LWMA 1D9FA 2JLEA 3ZT4A 3O3GA 3VQ8A 4B8CA 3SI6A 2PY5A 1LW0A 2EKOA 4DS4A 2BIVA 3U6FA 3LLRA 1KVAA 1TKDA 4RG8A 4EZ9A 4CF2A 5C0MA 4O55A 4Z0UA 3OYMA 4CJPA 1VSLA 3HYFA 2G8HA 4OKKA 5SZTA 3OYBA 1XHXA 3OYLA 3L42A 5I42A 2D0BA 3WNEA 1IO2A 1QQCA 1VRUA 3I0SA 4Y1CA 4CJUA 3KK2A 1NK7A 3KTQA 2RHXA 2LSNA 3S9HA 1KHCA 1IKYA 1JLFA 2F96A 4IUTA 1KTQA 4CE9A 4ZHRA 2HQEA 1WSJA 4CJ4A 4CEEA 4FJLA 2Q3SA 3QKJA 4YFUA 4EZ6A 1QSYA 3RMCA 4WE1A 1S6QA 4O0JA 3KKSA 2KFZA 1W0HA 2OPRA 2NLUA 3FEOA 4M3XA 4NYNA 4CEZA 3VA0A 1S1XA 4FJNA 3UWNA 1ITGA 4FZXC 3VQCA 4B9WA 1KCFA 5EU7A 4CEAA 2VG6A 1NK8A 3NH2A 3SCXA 3TAFA 4NYFA 1VSIA 3DLRA 3MEWA 3F73A 3LZJA 3T3FA 2RJEA 3AA2A 4CJLA 1A5XA 1CXQA 1CZBA
chains in the Genus database with same CATH superfamily
4DGWB 2P6TA 4PJOF 3JCMJ 2COMA 4HT9A 1CGPA 2Y31A 4CI0C 2OJ2A 4LG3A 4FJKA 3OYAA 4Z4FA 3PFSA 2Q97A 3BY5A 3DB3A 1TBXA 2EZHA 2VQGA 4B4CA 4FT4A 4AH9A 5B1AH 1R0CB 3SUOA 1EF4A 3ZETA 1M3AA 3K4LA 3QLHA 3CC2N 4D8KA 3NPFA 3EFOA 4JI6K 5BRDA 2VOOA 1R23A 4HLXA 4NC6A 5AJ3K 1H3ZA 3NVMA 5F64A 2F5CA 1NG7A 3NAEA 2J5OA 1LFPA 5LD2C 4A59A 2AZSA 3CCVA 1DLOA 3KUFA 3DLEA 3KKRA 4JBAA 1FKOA 3SQ2A 3WNGA 4IHVA 4EJYA 4DR1K 4PIIA 1UG1A 2FZKB 1BU1A 3L00A 3LFUA 1KFSA 2ASPA 2PG4A 1KQSA 3WXKA 1D3BB 1TGOA 3CVSA 3CCMT 1YVNA 4FU6A 3HZ6A 4HWIA 2CH6A 4ZYEA 3OH9A 5KQ8A 3AVHA 1NTCA 2IA1A 4GKJK 2HZYA 1EP4A 3NH1A 5FFXA 2F4OB 2RE2A 1JLAA 2HHHK 1PVSA 1Q81O 3MEAA 1FX7A 2A69F 3A98A 3PE0A 1QBJA 3OS2A 3AVAA 4BGBA 2RHUA 5AN4A 3JAMO 5KN8A 4GLKA 2LDMA 3EFOB 1J3TA 1VQ7T 4DYCA 2A40A 2ZMEB 1Z9ZA 1Y0NA 1KLNA 1UCRA 3W6VA 1S22A 3FXKA 1W70A 4G6TB 1XG1A 2HHUA 1XMAA 2VJ4A 3QUIA 1XD7A 2COYA 2VXDA 3ABKH 3JCMg 3I4PA 5L8RE 1AD5A 2CZ7B 1JT6A 3QDFA 3NF8A 2BY2A 3GXOA 4F2SA 3ONQA 2CYZB 1GL5A 2DU9A 4X6AJ 3TU4K 1VQ4N 3M58A 1R1VA 4PSWA 5EX5A 1SD7A 1PD0A 2UXCK 4ME7A 1HLUA 1F1BB 5BS6A 5FKOA 1YJ9A 2AHQA 2AP1A 1FJLA 4M78G 1VSKA 3SJJA 3BTIA 4H5TA 4XU2A 3KK1A 1BO5O 2D0OA 3AAFA 3BZ6A 4BNCA 2Y69H 3G4SN 2O8FA 4FVUA 2R7YA 3H3UA 1YITA 2LY1A 4JI3K 2V1NA 3EEQA 1KQSP 4N47A 4O8KA 1QE1A 4Y92A 3N4PA 3CC7T 2GBYA 2ZGYA 5EG2A 1YQMA 1OCCH 4HRIA 1FBQA 3A0IX 5ADXA 2O8FB 1N3AA 1RESA 2V9KA 4EDUA 5K14A 3C6UA 2F9TA 3W2VA 2K40A 4C0ZA 4CK1A 2O7OA 2LREA 1FJGK 3AARA 4M74A 5GAMj 2X51A 2ZJ2A 4JKCA 5LHIA 5GJWB 1HKTA 4EA5A 2IS2A 2CP3A 4N4HA 5AQXA 3ATVA 1IO6A 4CZCA 3HHGA 2DE0X 3WU0A 2EA2A 3A5OC 1LDJA 1ZSGA 1ZBIA 1RILA 5L3GA 4AVPA 4MEXF 2Z1JA 4A57A 3V8KA 1M1EB 3S93A 4ZJZA 4CZGA 3BR5A 2A28A 1K78A 3H1VX 4WQ5C 3D2FB 3KPHA 3FISA 2VYTA 2NS0A 4DNCA 4I2PA 3M1FA 2QTXA 4L9VA 2PEXA 1WVRA 1TUDA 3ABUA 5F27A 2YHBA 1XDSA 1NLPC 1NHAA 4JHDA 2EFNA 3ZMVA 4M3GA 2DL7A 2M02A 1S9HA 1NZ9A 4IXCA 4CF1A 4CF9A 3Q1JA 3IAYA 2D0NA 3MZ8A 1ZLJA 1B8IB 2DETA 3J7AY 4QVCA 1VQ6T 2PAVA 3I56N 3PJRA 3I59B 4W5QA 4DBHA 4DQSA 4NOYA 1ULYA 4G8XA 1H89C 3O6WA 4M7AD 4AF1A 3QAHA 1QU3A 1AVZC 1TKZA 3CCJI 4OPAA 2LQNA 4CEFA 3CIPA 1FOWA 2O8BA 4AD9A 1XC9A 1TC3C 1HPZA 4ZNXA 4DFMA 1YW7A 2DA4A 4JP0A 3K1NA 3L2CA 2W57A 3F8FA 5E1XA 3ABMH 1K9MC 4IURA 4DBRA 2GTJA 3OYHA 1Y96A 3VUBA 3BTCA 4HX8A 3RDIA 1XQPA 2L3QA 2G8WA 1FZPB 1ORKA 3MP6A 1D8YA 1YI2A 4OLAA 3DRSA 1IZ1A 4JLGA 4C2TA 3RBBB 4O4GA 1NK6A 3AVMA 3BJ6A 4FIBA 3VESA 2OI3A 5AONA 3VOEA 3VSLA 2JMAA 5IT9E 2VWBA 4J7IA 2VQHA 3FXUA 2ESWA 2RJDA 2YG9A 3S41A 1Y71A 1XTAA 5BPDA 1SRLA 3L2RA 5HY6A 1LDDA 3VFZA 4EJOA 2NRVA 2NNYA 3EKSA 3R61A 3QOPA 3QZ5B 4B8CA 3BFMA 2YHXA 5D5WB 2K57A 1IGQA 3PQJA 5TKWA 3HGGA 1M2VA 3CJCA 1XQSC 3FSPA 4O0JA 3G4SA 4DB3A 2ME0A 4BXFA 4CEAA 4J9IA 3T3FA 4OB2B 3F73A 1RBSA 2FXAA 4Z4CA 2OU2A 2AK5A 1CLQA 4BRMA 4Y4RA 4M6VA 3WTSC 1AKHB 5GAMe 2E1NA 5I11A 2NLXA 2D1VA 2JA6J 2WTEA 3DEUA 1FN7A 2FBIA 2GQIA 3CFRA 4ZN3A 1ZYRF 4HVUA 4OGEA 2RKIA 4CYCA 4B8XA 5DS9A 3G73A 1BI1A 4M75F 2BYVE 2HHXA 1QSLA 4LD6A 1YTAA 1U1SA 3PX0A 1M1KU 1J9AA 4PFPA 5B3SH 4M7AF 3CPWM 5HDGA 3RMQA 4N4IA 3GTQJ 2HHWA 3B6OA 1ZBUA 2HGCA 1B1BA 3ZMZA 1OFCX 2CH5A 1BIAA 2DL4A 2DK3A 4C92D 1KZHA 2VASA 1XGMA 3PO5A 2E19A 4C0DC 4B3TK 1YRNA 5LLQA 3BQYA 1WJDA 1XN7A 2G3RA 1WRJA 4G6DA 2G6FX 4IBNA 2I7PA 5AIPA 1ZLKA 3K6GA 3LDNA 5BREA 4KI6A 5C2DA 4M7DE 2O01E 4X1VA 1PYVA 1WBBA 1V4TA 2HDAA 4LLNA 3FGUA 4Z4HA 4DOWA 3JB9J 3CCEI 1LJ9A 2DA7A 5HLTA 2VGNA 1HNIA 3M5RA 2PLYA 5B66C 1BDGA 3SAGA 1IUYA 3NAUA 2HSEB 2F5EA 3JSPA 5LJ3g 2E1MC 3ZMDA 4FWMA 3M8SA 4D8DA 3CHWA 5E8GA 1GLLO 2RF2A 1P4AA 3C4SA 1WPYA 4LK0F 1R0AA 5M3MJ 4BUPA 3GZ6A 4YIFA 2W41A 1X9JA 5JVGL 1SKRA 4J5YA 1T0FA 4WQ4C 2JW4A 2VBZA 5J2NA 3C0CA 3DKYA 1TAUA 2RJCA 1NKBA 2V52B 3B6CA 1OQYA 2RJFA 5F0CA 2WWYA 4DTMA 4OMZA 3TDZC 1C0GA 3WU2C 2FB7A 4IIOA 3KFVA 2P4WA 1IDYA 5FFZA 2NUTB 1K6YA 4XOPA 1TT0A 1N34K 3ESWB 3WQUA 1D0XA 2DEUA 2OTJA 4XKWA 1TP4A 3E6CC 4RKUE 2ID6A 3V6DA 1SD4A 4IDHA 4J2EA 4IHXA 4LJZF 5HLHA 1WHUA 1CXUA 5DM6L 5CYMA 2L7MP 3G71N 1ZUUA 1IV6A 1JL1A 4FASD 4I9QA 1OKRA 4L5JA 2EH3A 1RTJA 2WFBA 1JCFA 4PJNA 3KYLA 3CI5A 1LEBA 4PNOA 4LG0A 3CC2I 3ASOH 2DA9A 4MMLA 3RMDA 3SEMA 3CLQA 3PT9A 4AIAA 2HEQA 2KRHA 3J80K 1VQON 5F1XA 3I0TA 5DMRA 3GDQA 4DTNA 4LUEA 3KEQA 4FLZA 2QWOA 1TK8A 4PJOC 1XNQK 3ZQCA 4M3ZA 4G7OF 2A6EF 5E1WA 2V8IA 1DGWY 1BI0A 4PDKA 3GTOJ 1Y56A 1R4MB 2DBKA 4M63C 1BR1A 4B23A 1K78B 3TABA 1ZG5A 5DDGA 1EJ9A 2EJFA 1ZA1B 2O8EB 4KGVB 1EH8A 2W04A 1D1BA 1YAGA 1OCOH 2DO3A 1MJBA 3HOXJ 3SFZA 1RAEB 3L7WA 3IH3A 4A3MJ 4BEHA 4U0VA 4Y52J 4NXMK 3CPWS 2K7AA 3CJQB 2LJ0A 3MEEA 2ESHA 3VS3A 3NRVA 3PFYA 1L5UA 3VF2A 3JYTA 1FMWA 4FLUA 3TDUC 4FWSA 4KUDK 2Z9OA 4IUUA 3D7EO 5KNLA 2IGMA 3JREA 3U9DA 3SLCA 2DD5A 1Y6IA 1X75C 3ASMA 2NOJB 1DJ7B 4HT8A 1EBMA 2E3HA 2DO7A 1VQ9I 3BDLA 2DXIA 4CZLA 3R6OA 1KG5A 4C8QE 2H6CA 4A3KJ 1V3FA 1W5SA 2RQVA 3S6WA 3L6QA 4FJHA 2DODA 1YIJT 1GBQA 1ZUYA 4FM2A 2EAYA 4FYDA 3GLLA 1ZSZB 3CC4T 5KPTA 4HHTA 1YIJQ 2KRMA 4IZZA 3DJCA 4I6ZA 2V26A 3CCSQ 4P55A 1VUBA 1ZSZA 3CQZJ 3TL4X 1P8ZA 5HS9A 1UHFA 1O3RA 1FNNA 2GWRA 3VYTB 4EFHA 2HTJA 4C9YA 1TSFA 3ZQQA 2EX3A 2LVMA 2O9LA 2M0CA 8AT1B 1GLFO 3NWTA 1J54A 2W6LA 3BZCA 1W97L 3FX3A 4K11A 1FIAA 1WQ7A 1R1TA 4AU7A 1VSMA 2P6SA 2ATQA 3VW4A 3MN7A 1O7LA 3U9GA 2OC6A 3GOIA 2J06A 3LWIA 4JKGB 4DR2K 4DBQA 2ED0A 1M9SA 3RR6A 1OVQA 1T03A 2A05A 4P9UA 1WIEA 2LBFA 2DZ9A 2YSRA 2VT3A 3ZT4A 3LFKA 1T56A 1A04A 2BIVA 1GLDG 3ZYYX 1TKDA 4RG8A 2JSCA 2JS2A 5GAEJ 4GFBA 4RTVA 4PJOE 4KH1B 5KAIC 7AT1B 2XAHA 4UB8C 3OW2M 2YHYA 1UEBA 1VQMT 1XQOA 1RRQA 3CD6A 2H3GX 4M3XA 4JI0K 3VA0A 4K43A 1O7FA 4A3BJ 2M7BA 4H0TB 1TYQB 2DPUA 3EDPA 2IGOA 1YWOA 2V6EA 1LJOA 1YJ9N 1CZBA 5IXFA 2Z1DA 3TTFA 4AFUC 4MQVA 1BI4A 2VKEA 3ZQFA 1VQ4A 1Z67A 1N39A 4E70A 1Y0MA 2D6FA 4DQPA 2VJJA 2YRDA 5GAOl 2A42A 3S8PA 4M3EA 1S1VA 5BPNA 1GV5A 2W82A 1Z7LA 1T3VA 2JWLA 1VQ9A 4RCCA 1MBHA 3NWSA 3LDSA 1TVRA 1U45A 1NKEA 5GMKj 4W5NA 2DI3A 1YJNA 1WCMJ 2V1QA 2V4JC 2VC1A 2FBYA 3DP7A 2XD0A 3LAKA 2IS3A 2MYSA 4JX4A 3TAPA 4JAXA 3IUOA 2KT1A 2OTJT 2HXOA 3GF2A 3GTPJ 4CEBA 4PUOA 1SAUA 3CCLQ 1WSEA 5CKBA 4EM1A 3H08A 5CQYA 2ED1A 2CREA 3H3VK 3S1NJ 4BI3A 4I2QA 3R3LA 2KYBA 2NZTA 2QA4A 2HQHA 2HBMA 2A07F 3WTYC 1SKWA 4YRVA 4A5BA 4FYVB 3A8GB 2UUZA 4ILGB 4CJQA 3GFJA 4H0OA 5GANf 3I54A 3HOTA 4GO1A 3NNQA 4C8QF 2KXDA 4M3UA 2P8TA 2WUSA 4N5SA 2KP6A 1UGPB 1PC0A 5KGWA 4YPRA 4CERA 1S9EA 4BD3A 2Z0WA 4JOMA 4F9OA 2GX9A 4Q5VA 3H0HA 2K3YA 3GE1A 2IW5A 3KLEA 5AQUA 1UELB 2JUGA 5IHKA 4MIMA 5KCHA 1ZBFA 2XHCA 1IGNA 4OWRB 4YIIA 1D8JA 4GW6A 1ASUA 2P9LA 3J7YP 2LNVA 2R58A 3JRDA 5GIPA 1YHQQ 4BL0B 1VQ5N 4QVDA 3ME9A 2BEOA 4HG2A 1VSJA 1NJWA 1YHQT 2E1ZA 2E5QA 4YEJA 1DUXC 4KAZA 2RK2A 2CO5A 4A53A 1ZN2A 2GM4A 1VQ7I 2OD5A 1U5TC 4D7NA 3DBHB 4CGDA 2ZPBB 4DU4A 3R8EA 5FKNA 4DEXA 4JKHA 2MG4A 1IKVA 4NC8A 3WODF 2DYRH 4I76A 2ZKZA 5CZ2A 4LFUA 4Q5WA 3HTSB 2IGKA 4I09A 2QWMA 2KGTA 1VRLA 3K4CA 1QMCA 1WB9A 1TXQA 1IRFA 2R7SA 3LSGA 3F6OA 4CCMA 2AIRB 2X35A 1JUMA 3RTRA 2F5DA 3K10A 2VQLA 3O3HA 1U78A 2K3XA 1M1FA 1XTDA 3O2PE 5CPRB 4YIRX 2GELA 2O03A 3F5TA 2AQFA 3O1BA 2G9WA 2H6BA 3LSPA 3I9QA 2YT6A 3CJ1A 4CGJA 2DAOA 3MCPA 4HOBA 3G2BA 1FP2A 3DTIA 4JKBA 3EL2A 4CO8A 1Q82R 1E17A 4DSIA 1VRTA 2RQTA 2QK9A 2K5FA 4GMJB 2F8SA 2XICA 2A7YA 3G0QA 1KFZA 2WY7Q 2R5MA 3HSFA 2X6NA 4QOZB 4R79A 3M57A 1JJ8C 1VQPT 3N97A 1REVA 2DNUA 4KBMB 3D45A 3CMAT 1QHHD 4DTRA 3ZCMA 4D5FA 3MEXA 2AA4A 1WSUA 3AG2H 2X85A 3HXLA 4JJDA 4E7KA 2WACA 2HTSA 2QEXT 4EW4A 1E3OC 3WG7H 4WWCA 4HNTA 1FMKA 1FOYA 4B9QA 4XR6A 5EEGA 1W1FA 1SEMA 3ZQGA 3G0ZA 1KA8A 1NK4A 3SWNA 4PK4A 3PO3J 3BF3A 5M1QA 2VKNA 2FU4A 4XKBA 3PGGA 3MKZA 3QYFA 3OIQA 1H92A 1U6ZA 1V55H 1FKPA 3M59A 5GADP 6AT1B 4A4EA 2EVRA 1VQ6A 3DBLB 2LRQA 1WSGA 3T8TA 9ATCB 4AUXA 1VI0A 4PQUA 5FROA 2F5TX 1BA1A 1ORNA 2KQRA 1FYKA 3CPEA 3PIPF 1PKSA 1IV0A 3OYYA 1AOJA 3OOPA 1RAFB 3CMEI 5CKHA 3M07A 2EWSA 1X2QA 4A62A 2SRCA 4UXNA 3SDGA 3N5NX 1YVUA 4CGZA 5JHFA 3OYEA 3D5RC 1XCBA 5JFRA 1UGRB 1ZRFA 1QVFA 3CCJT 4M7DD 1TWAJ 3I5RA 5D4SA 2NXNB 2YKNA 1LE8B 4BHCA 2BXZA 1MWMA 3MWMA 1RAGB 4Z2YA 3MKWB 2JZYA 2FG0A 4RTXA 1M3HA 4LD0A 1Q86C 2VKDA 4EJTA 2P0WA 3CC7I 4G6QA 3EZ5A 2RQRA 2CSQA 1J53A 4Y7NJ 5JLHA 2KEAA 3TVTA 4C8QB 2RF0A 3SD4A 2R4GA 1Y8QB 1G4DA 3AA5X 2HCKA 3SEZA 3VF4A 4P96A 2I2LA 2XAGA 1KVAA 3F0CA 4JI7K 4HF0A 2LSOA 3MCZA 3A5NC 5I42A 1QQCA 5AIQA 5GAOp 1KXPA 2V1RA 4D7MA 1W7PA 1I6HJ 5DCMA 3MKYB 3VS1A 4LB5A 3KKSA 2Y9ZA 2HOEA 3J81O 1U06A 2OUMA 4F17A 1NK8A 3QHSA 3FXLA 4A3JJ 3DLRA 3MZYA 5I2MA 1YOVB 3RERA 2H8HA 4J8OA 2P84A 5HRPA 4ZYDA 2AJQA 2NAZA 2DFFA 3NFAA 2ITMA 1U49A 1P4WA 3QPSA 3HM8A 4CHYA 2FBVA 2OFKA 3QB0A 2B0LA 2JTMA 4JI2K 1Z7UA 3G6ET 3H9NA 1LQ1A 3DFGA 2CQXA 2WB1N 4EJUA 3HSEA 2VG7A 1OYIA 1FTTA 3IC7A 4KICA 2ZCWA 3CCUT 3CM6A 3U21A 3AVFA 2ZE2A 2P5KA 3PQKA 1W2BS 3FZKA 3FLGA 3U2RA 5E3OA 1KU9A 3KP7A 5JVGF 5D3GA 3MMYB 2R5ZB 1S72A 1QHTA 1AZEA 3JB9F 2R92J 1YWPA 4K2EA 1JJ6C 1KG7A 1BA0A 1KLMA 3FZMA 3LNQA 4QWQA 3K2ZA 4C8KA 3CCJQ 5J3BA 1Q86O 4ANJA 1MMDA 1RDBA 4PZJA 2C06A 1VQKT 1NEGA 1VQ8A 5KYNA 5J26A 2IC3A 3CCUI 4FWQA 2Q0RA 4H4KC 3WVEB 3UKUA 1Z9CA 4IL6C 3K58A 3AL0C 4YDUA 4ZYHA 1A6QA 5H20A 1HLVA 4YHHK 4JKGA 3FMRA 3UIQA 3ZQHA 1HW2A 4M3RA 2L3PA 5IT3A 3J81E 1LVKA 2OAUA 4BS9A 5BPLA 3G71A 5BR8K 2DT6A 4DLGA 2EIKH 2K9SA 2R7DA 1WZOA 3NFCA 3UA6A 3H5RA 4RLQA 8ATCB 4JHDB 4HKEA 3JCMX 1IN8A 1KRPA 4OMNA 1W0TA 2X4WA 3CCYA 4NZGA 1HJDA 2VXEA 3QQAA 4PKHA 4BRNA 2C0IA 1OZ2A 1BWFO 2FHDA 1HYVA 4OMLA 3ATUA 3ERMA 3LSHA 5J1RA 2JM8A 2KLOA 3MXIA 3R60A 1KD1U 4EW0A 5D5XB 3IHUA 2K5CA 4O3MA 4LY7A 1I50J 4C8MA 4FLWA 4NL2A 1PCXA 1OPLA 3GF5A 5A2QE 4B3OA 4CBXA 4QQ6A 3W0LA 4FE7A 3R4KA 2XDDA 2R7OA 3FHNA 3BR3A 2YJFA 4CGHA 3HHHA 5B1BH 3O9QA 5M5XJ 3FHFA 2LNBA 2D1XA 1QKXA 2F4IA 3GNGA 4I7HA 3OL3A 3H0DA 4EP4A 2DBBA 5C2FA 3A4CA 2JTEA 4BY6C 3FK6A 3QU6A 1TAQA 1IG7A 3CCJN 3ULQB 3VQAA 1ZQ3P 3E97A 2O9SA 1TKXA 4FE4A 3DPTA 1TYQA 1MW7A 3OGDA 1FYNA 2EJGA 1ZXOA 1GOCA 4BY1J 3RR7A 4KISA 3LGFA 4CW7B 2FMYA 4ZYAA 1YG2A 1E7OA 4HCZA 1MNEA 1MPGA 1OU9A 3JCMV 3P31A 4CK3A 4XQ3A 3ZCOA 3AAQA 1WXTA 2LVSA 3QOEA 4ETSA 2IS6A 3F8BA 2IBDA 3FZFA 3RPUD 1RR8C 2E65A 1KQSM 2VE8A 2O2OA 3RCOA 1I94K 4I6MB 1QQMA 3CCQQ 1RUWA 4B9TA 3VQ5A 1K7AA 1ZYQA 4CC3A 1DKGD 5DCFA 4U0WA 4YDUC 5GAEP 1WSFA 4KIFA 1JBMA 2MMPA 5JLFA 1QA6A 3WHBA 4DQIA 3CC2A 4WCGA 1GCQA 3TO9A 1MSFC 5D8KB 3X28B 2OAWA 1WAJA 4JJNK 3VUZA 2B8AA 3I4NJ 2XGEA 2XV4S 2XUBA 4IPAA 3FB9A 1KQJA 4XNFA 4YORA 3ASKA 2F5FA 4RMNA 1PRLC 4PJ0C 2DQLA 5I2SA 4M7AE 1Q7YO 4HDUA 4PFZA 3DYAA 2M45A 4W5RA 5FKMA 2GF7A 3LAPA 4HXJA 4B8AB 1D0ZA 4PGHA 5L3DA 3GWZA 2QSGX 2JUCA 4F91B 4Z4EA 4CIEA 1D1AA 1GLNA 1H0MA 1X9MA 2HOTA 5D6WA 2BHZA 3ULRB 2VOPA 4BJTA 3M4YA 1K73O 2HVSA 4CCNA 4GDFA 3CCMI 3MN9A 5AQKA 4KTZA 4LSLA 2DK5A 2QA4N 2RI3A 4CD3A 1BQNA 4EVVA 1IN4A 1G3TA 3OW2P 1HKBA 3L2VA 4IFYA 3LSRA 4OB3B 5KYYB 5B5EC 1JTYA 3HRTA 3KFWX 2FUG2 2STTA 1WI7A 3QU3A 3F10A 2R93J 1JKPC 3X20B 3KLFA 4DTSA 4KI4A 3MCAB 1Y97A 4GV9A 3CCMQ 2XHBA 4XH5A 3CTAA 4C8QA 2RH2A 5HROA 1OH5A 2L4MA 4DQ8A 5GANh 3GMEA 2IPOB 3MO8A 3ABLH 2XB0X 3R0AA 5ICCA 4CGGA 4HV6A 4U7BA 4H0VB 2H94A 4HW0A 2E2IJ 3FM5A 5C0MA 4Z0UA 1T33A 1YHQN 4OKKA 3FWEA 1YITT 4ZGEB 2R3SA 2ISZA 1VQ5I 4BR9A 2DOEA 3BDDA 3JRHA 3QDKA 3CCEA 1WPKA 3I9V2 5IY5H 3L1AA 4KH4A 4J6WA 3MEWA 3AA2A 1CXQA 1S3JA 2VWJA 4CHZA 5AQSA 1SFUA 2A6AA 4C5IA 4F7UE 3DEEA 1WI9A 4ELTA 3PO4A 3WGGA 2P5LC 1C1BA 1UJYA 5LJ3d 3OJSA 4DMNA 3MWPA 2H8RA 2QA4I 3OOUA 1K0SA 2DBMA 4W5TA 5TJJA 1FYLA 4MDAA 2DJZA 4UHTA 2GV9A 2O8EA 3UKRA 1Q18A 3CC4Q 1P4XA 4HDVA 4CJEA 1PHTA 4BQQA 4UC4A 2FF6A 1JCGA 1VQNT 4ELUA 2O5RA 3H9JA 3BZKA 3VGKA 1Q9XA 2W4SA 2WA0A 4ILJA 4Y28E 4ESBA 2CUBA 1HR0K 2HOSA 1U5TA 3RKWA 3ULEB 3OJUA 1XPXA 2P9SA 3NE6A 4LC9B 1PJRA 2L7ZA 1J5EK 2ZXIA 5IN1A 3RZOJ 3DTKA 2VG5A 1U5SA 3U3YA 1EQYA 2QLZA 3HOVJ 5CYVA 2QASA 3A0HC 2BZXA 3OS1A 3QIPA 4B6MA 4BY9C 5IT9O 2QQ9A 3HSBA 2FVUA 4EAHD 3BG9A 1TNTA 2EYXA 4M3BA 3LSMA 1BQMA 1L3VA 1CF7B 2OANA 2XPWA 4IHSA 1F43A 4LDWA 2EW3A 3H3NO 2YUOA 4H03B 2GEMA 1JXSA 1T6CA 3TW6A 4PJOG 2IEKA 2GWKA 4RB0A 2EFWA 1CF7A 3A2KA 1TTHB 2O8CA 5H2FC 4H5RA 3VETA 2PU9B 1TW3A 2F5KA 1QHAA 3QZ9B 5LHHA 1VQ5A 1GFCA 4HAMA 2QSHX 1AHJB 2STWA 2QVOA 3CQ8A 5CKTA 4IOAL 2Z16A 4XRFA 2XDBA 3PVLA 2Z99A 3VOVA 1AWWA 2ZC2A 2M87A 3P1GA 2HSTA 2K85A 4N9IA 3E66A 2IOCA 4FM4B 5GAN3 4XICA 4FJXA 2HQXA 2Q2RA 4XTXA 4M7DG 4DLEA 4XLHA 2JRMA 5DY9A 2XF7A 1BCOA 4XLPF 3VRZA 1WQWA 2X78A 5C24A 2DFIA 2E5ZA 3A8HB 3VQ7A 4CJFA 3OSSC 1ETYA 3SZPA 4ICLA 2R7XA 1YQAA 3NEUA 2VGMA 3G71T 3H9QA 4UVBA 1YTUA 1WSHA 2R7UA 1PP8F 4DR4K 4RB1A 4A6DA 1OV3A 4A4KA 3HUGA 4AC0A 3ZPLA 3KP6A 2NOFA 1TOVA 2E8AA 3CJ7A 3ZEUB 2HHQA 5J8CA 5F08A 2R7TA 3PMTA 1Z26A 3SQ1A 1Z25A 3OS0A 4KT5C 1BB9A 1D3YA 1C0UA 3I3LA 4B1WB 3H41A 4YOWA 2LBFB 3ZEUA 5BOXA 3CCET 4OB1B 4JK1X 1BOBA 4O44A 3CCLI 3REBB 1WHGA 2E71A 1JUSA 2X6OA 1KQ1A 1GBRA 3K1PA 4KBOA 5C0YA 2GQQA 4Z89A 3C6AA 2E2OA 1M90U 2RA2A 2HQAA 2G8IA 3K0LA 1E0EA 2OPTA 4D5CA 4PLIA 3JB9G 3CPWP 4XKCA 3DQVC 1X1PA 2V75A 3ENOA 4DQ2A 1EETA 4KB0A 2KRCA 3T69A 1C0TA 5F6FA 4KN4X 1QLYA 3A2FA 2I5WA 1O4XA 2NYSA 4JI5K 3GFLA 2V79A 5HNHA 1BN5A 4HA8A 4WFAL 3ZT2A 4MTDA 1LB2A 4KRTA 2LT1A 2CS3A 3LAMA 3WVDB 3HZJA 5FD6A 1ZSZC 2JVGA 4CFAA 1B59A 1YX5A 4M3YA 1C1AA 3O8VA 2IVMA 1X3ZB 2YPRA 3EG2A 4YY3K 3VJPA 1EH7A 4CCOA 4AG2C 3JCMb 1OR7C 3M54A 1R00A 3LQQA 1OPKA 3CBOA 4C8QD 1S5JA 4C8OA 4FK4A 4R0KA 4FOIA 1PDNC 5FPEA 2GUIA 5D5UB 2Q1NA 4BB7A 2HDCA 3ZL7C 3FK7A 4N4OB 3LSJA 4YNQA 1RETA 2YU9J 3PMIA 5HLGA 3IKMA 2JN6A 3EPZA 2EPFA 2EIFA 3TAGA 3DPUA 1QCOA 1TK5A 1ATRA 1E3PA 4M45A 5J47A 5GJVB 3KIOA 2QENA 3F22A 1B9FA 4KJZA 1MZBA 1OCPA 3B73A 2HKNA 2ZZDA 2FJ1A 5FWBA 2O4IA 2EQJA 4C2UA 3H6EA 3HM9A 3DF8A 3OWTA 3ABTA 4RAFA 4YOQA 3T1BA 2WAQA 4EMGA 3OYMA 2ZXJA 4BRHA 2H09A 1XHXA 3OH6A 1VQMN 3L42A 3WNEA 1NK7A 2RHXA 2PMZA 2LSNA 3ZX2A 4BROA 1H9TA 4ELYC 1NGCA 3HGYA 2P9LB 3AAPA 4A2BA 2LY9A 1JTXA 2VQFK 1ZQ1A 4JZ4A 1QW1A 4FJ5A 1GLAG 2HNHA 1R8OB 4BI4A 4MLEA 1N5YA 2NRZA 2W6KA 2FC0A 2UXXA 4BR7A 2YX7A 4LMYA 1BR2A 1XHZA 1KC8R 3HRGA 2DJNA 3O1WA 4M77E 1TH7A 2X9DA 3WU1B 2V7ZA 4L18B 1PUEE 3QERA 3ZMSA 3TW7A 4IF4A 4E7IA 1VNDA 2FD5A 4IHYA 4FJGA 5IPAA 1BW6A 1NJIU 3TAEA 2IA2A 1ETKA 4X1EA 5HK0A 3HOZJ 3TSZA 3TTCA 4MZMA 4M71A 2VUBA 2LT4A 1WXBA 2JSPA 4PJLA 5DPKA 2DEQA 4E1NA 4G9YA 2JVHA 2ETJA 4FL9A 3K5LA 5FLXO 1W5CC 4KREA 3E19A 5IYBJ 3CMYA 5CQXA 1B72B 1VQKQ 1MDUB 2LG4A 4LF5K 1P59A 1YI2T 3JRGA 1HYOA 2YNIA 5LL6Z 2P0QA 3MPUB 3ZX3A 1JGGA 2ASMA 2HHVA 1PP7U 4ENMA 3T5XA 1PVEA 3LZIA 5HLFA 1MBKA 4KHUA 2L2PA 3K4KA 3CMEQ 4PA1A 1VQLA 1NK9A 4E9GA 2V7FA 4QT7A 2FEZA 2JM9A 4OMYA 5EZHA 1KG2A 1ETVA 3QEVA 2CRGA 1K9AA 3HVTA 1SL0A 2X4YA 1HXDA 3KCCA 2GBZA 3KZBA 2VPLA 4A93J 1ZHFA 2DFUA 2BZTA 3M5AA 4BRLA 2G8VA 1VHXA 3N4QA 3I0XA 3LAJA 1MHNA 2EGCA 5AQVA 1BL3A 3S2HJ 3HIFA 1RLPC 2MH9A 3JAMK 3O9UA 3MHXA 4LE9A 2DXBA 4LDXA 2DD4A 4F3QA 2FPDA 1NOZA 3CJBA 4OPHA 3I53A 1O1WA 3P5JA 1RT1A 3OYIA 5C4JJ 2RAEA 2JN0A 3A5MC 3DLKA 2L54A 5FU6B 4LF9K 2RQPA 3LCNA 2YU3A 2ATCB 1U0JA 3F8MA 5J1YA 4FM0A 4IJAA 3KP3A 4JYKA 1WXUA 2HNZA 4KH6A 1D1CA 2BVMA 4JX6A 1J5YA 2A1RA 4TSXA 3O8MA 2XF5A 1NEBA 4NLBA 2HBWA 4M77D 1YXQA 1GUUA 3TTDA 3MXJA 1S1UA 1TWCJ 4UUTA 2HYGD 4BC3A 2CV0A 4LLGF 1C6VA 4LDUA 5AQYA 4DV4K 2K2VA 2MLGA 2B7EA 2DK8A 3QPTA 3UKUB 2CZ6B 4FL6A 1HBXG 5M9OA 3ZMTA 3EGDB 2DA3A 1HDPA 3L09A 3SK3A 2UU9K 4CK2A 3K59A 3D0SA 2Q36A 1RUOA 4GLMA 3LDOA 1EXQA 4RW8A 5CIUA 5DD4A 3T1YK 3LMMA 1XJWB 3PFIA 3HPWA 1VQOT 3FF5A 1FOXA 1NLOC 3MECA 3MAQA 4AQYK 4C0FA 3CJRB 4FM1A 5HRRA 2BOLA 1VQOQ 3E1YA 4DQRA 5DM6F 4UUVA 4KUMA 2JPCA 1GLEG 1KIKA 3HUGB 1TTYA 2NVTJ 3BJAA 1X3NA 4C8NA 3RYRA 1IUFA 3JSOA 2XVCA 4OFHA 3TU5A 4BUGA 1KD1C 1PRMC 1RRJA 1VA7A 2VWFA 2QCOA 2FZCB 1XX5A 2P9SB 2GOMA 1NBEB 3THVA 1KQ8A 2RHKA 2XO7A 4LF6K 4ZTFA 3JCUC 2XGDA 3SBGA 2Q0OA 3RKXA 2KVQG 3VTIA 2Y30A 3CERA 1SANA 4CC4B 3S32A 2E1OA 2PZSA 3WE2A 3F0ZA 3BTLA 3RDVA 2W84A 4ABZA 2YX6A 2KRSA 2YUNA 5GMKh 2A6TA 2GLOA 2VKHA 1SG5A 2O8DA 2RNJA 2NRXA 3MWTA 4CIFA 5KYWA 1TQIA 1M90C 2A68F 4K25A 2EQRA 5KE3A 2BHYA 1YCYA 1RDAA 1WHKA 4N9HA 3CXCM 2CG4A 2VXZA 1R9TJ 4DU1A 5E3LA 1P90A 2CZ1B 5KVRA 4IFEA 3J7ZI 2ZB9A 3TCJA 5KE2A 3EUKL 4M7XA 2CH4A 1C0WA 3BF1A 3HT3A 2EFIA 2V8KA 5LJ5h 5LEJA 1EX4A 5ICEA 3CUQB 1SL2A 2YI1A 3H1QA 3EAEA 2ZSHB 1MBGA 4KTQA 1NK3P 2YCHA 1X3UA 3HXMA 4B24A 3AO4A 5LEKA 1SL1A 3I59A 1N78A 1ATNA 1BI4B 1N9RA 2BBYA 3ZOBA 3CCVQ 2UV1A 4MO5A 2EJRA 4PJJA 3PSFA 4R5PA 1IREB 3CCVT 3VEVA 3GX4X 5DK5A 3AL0B 3QETA 3TGNA 4XSZF 2LP5A 1LEAA 1IHWA 5C10A 4XMYA 1VF9A 2X3XD 1K6OA 4X34A 4C2MJ 1JB0E 2DIGA 4AFSC 1YI2N 4HSTA 3H5NA 1R5GA 1JKHA 3TR8A 2QWRA 2DN0A 1VQ4T 3GEZA 2G7UA 1ZGAA 4KIGA 3EUHC 2JLEA 4EM0B 4AIDA 4ESRA 2EKOA 3IAM2 3F21A 3HYFA 4MLOA 1ZR2A 3I0SA 5EEAA 3CMAI 3QYBA 1QSYA 4II2A 5FKLA 2COWA 3FZHA 2OPRA 1OCRH 1Q86U 1I8FA 2XGCA 2A41A 2YJEA 3LWFA 2WC9A 3FR0A 3RQ4A 3RI4A 1WJBA 2MI6A 1RBTA 3GBTA 3O4QA 3R0JA 2MGQA 3I55I 3CCQI 5CCAA 4M75C 4F3TA 4C3HJ 1NM7A 3SQNA 2Y0MA 4DSLA 1NGEA 3QNNA 4DOVA 1H8AC 2M4GA 3ZN1A 5GAMg 5FLMJ 1Z91A 4JRKA 1LWCA 5J2PA 2D5RA 3S17J 3AHUA 5EDNA 3K1MA 2YDLA 1L3TA 3DI6A 1IBKK 1YE9A 1B34B 1SVLA 3HOYJ 3LSKA 5GAN2 3C94A 2EYYA 2A37A 1S9GA 1USTA 2WY8Q 2CT4A 3E01A 3G6EA 3HTVA 2XPUA 1DP3A 2LC2A 3VEPA 3DKXA 1YT3A 1YJNT 1VQPA 1AKHA 3X2QH 2CJJA 3VPZA 3H8ZA 3DXKA 3NF7A 2P9PB 3CC4I 4EPCA 2D1KA 3FFKB 4RCHA 2VL8A 5KPZA 1BU6O 3V8LA 2WC2A 2OZ6A 4RW9A 2E2NA 2P7CB 1ZG1A 1M90R 2KIQA 4I99C 4E6KG 4JKDA 4NB5A 2BY1A 5GAN7 2P5VA 3JB9D 4FW1A 3VQDA 4E0DA 4WK8F 4U88A 4HSRA 1UG0A 3OYJA 2R7VA 4NUBA 3BR2A 2ZM6K 1QWFA 1VQ6N 4CBUA 3WGHA 4WFBL 4WQ5A 2M0YA 5T7BA 1YJNI 4UQGA 1GV2A 2QEXI 1JQQA 3LX7A 4OLBA 4QAGA 2UXNA 3OL4A 2A3LA 3H0IA 2K9GA 1JJ2S 4LITA 2JA5J 3PTAA 1GFDA 2CSIA 3FKIJ 1YFNA 1IBLK 2BE2A 2L9NA 2OZUA 4QS7A 1OH8A 1KD1R 1YRNB 1KAZA 2ZXHA 3HKZN 3OMGA 2JNGA 4FSSA 1BL0A 1LNXA 2L9VA 3QG1A 5LJ3e 3OA9A 3F8NA 3JRAA 4BI8B 1YQLA 4S05A 4HF2A 1OX8A 2RPIA 1WJEA 3CUOA 4BXUA 4KH5A 5CYQA 4QTRA 2EQIA 4Y91A 4JK8A 3EG0A 2D5VA 4NDLA 1Q7YR 1WQ2A 4LSNA 3K5NA 3LP3A 1OEBA 1IJWC 3TPQA 1TWBA 3I56T 4C92B 1U2VB 1HNVA 1GLBG 3M0QA 2I5UA 1R58A 5AQLA 3K4BA 4CJSA 4KGXB 4JJBA 2XKPA 4MZTA 4MFBA 4KT6A 1JU5C 3VQQA 3VQ9A 5AQPA 3ECOA 5TGTA 3MJXA 4J7FA 1U3EM 4FZYA 1BC8C 2VN2A 3BR0A 4HX7A 2ZGZA 1WJSA 4ILHA 1VQ8N 2FBHA 3EN9A 4W1UA 2NRTA 2BE5F 4M77B 1Q1HA 5DM7L 4F7ZA 3EGDA 1LWEA 2CV2A 2JWTA 3SZGA 3PUBA 4DEYA 1I1GA 3WNFA 1PWTA 2ZPFB 4XU0A 2IAJA 1UHCA 3QYHB 4EP5A 1YX3A 4RB3C 4QVZA 3PO2J 1R6RA 2BTFA 5LJWA 3T19A 3NH0A 3RZDJ 4YPHA 1IXCA 4IVNA 4EQQA 1RT6A 4CEQA 5AQQA 1IRXA 5TRDA 4HCKA 3SZ2A 4DFPA 1J75A 1YJNN 5F2RA 2HEOA 4NS5A 2OTLQ 1MV0B 1FY7A 3FXQA 1KK7A 3DPLC 1FT9A 1NK5A 2KBTA 4F7UB 2J6OA 1U3OA 5KRTA 5M5YJ 4KFBA 3MEDA 4BG9A 5LRSA 2E88A 2KKOA 2A3SA 2AQEA 2WSFE 1F5TA 3S2WA 3WTUC 4CJVA 1RI9A 1VQ7A 1ZC6A 1DTTA 4MGRA 1TL8A 3RUXA 3AVJA 1SUQA 1NJIR 3A8OB 2JA2A 3AKZA 2LKXA 1NJYA 4RTYA 2QKBA 2L0KA 1OLTA 1OJLA 3PIOL 2RC4A 5ERIA 1S72T 3QWXX 3G4SQ 1VTNC 1UHMA 5KYWB 2DVJA 5HK3A 2LCSA 1QQOA 1MBJA 1Y1VJ 1FSEA 1UHWA 4H5VA 1MWKA 4FQGA 1S7OA 2JGUA 1LAVA 1SKSA 3KP2A 3ZX0A 5DD8A 1A35A 4BRDA 5AQTA 4HX4A 2AS5F 3QMLA 4DOZA 4BQOA 3WHCA 3JB9I 2KMTA 4DIQA 3ER0A 3KEOA 3SDBA 4XIDA 2G8KA 1J9IA 3IHOA 1D9DA 2JRTA 3CQTA 3AVLA 1OVYA 4PL6A 5DLOA 1DQUA 2M7AA 3M9AA 4I0AA 2XGXA 1J6ZA 1N6QA 3OQ5A 1U84A 3MEVA 4LLLA 1SZ2A 1E3HA 2O88A 1W1WE 4ENKA 2V8JA 1DIZA 1KC8C 4CC2A 4I9LA 2GQVA 5CO7A 1K9MR 3C95A 1U4BA 3RYPA 2LLKA 3CQYA 1BJAA 3LL7A 1VSHA 4BRQA 4OIQF 1RBRA 2DFHA 1X4OA 2QA4T 1W36C 1OMIA 4XQFA 5GAMd 1YS6A 4XIUA 2DPPB 4GVMA 1HPMA 3EYIA 3AG3H 1LW0A 3LLRA 4JN4A 1W6XA 4CF2A 4CJPA 3ECHA 2EZKA 2QUFA 5AR0A 2UUAK 3IAS2 1ZTRA 1A5JA 4W97A 2KDZA 3WEEB 4EM2A 4ISFA 1M1GA 1JLFA 4B3XA 1KTQA 2E7XA 4WE1A 3VS6A 4Y0WA 3PSIA 1N33K 3WXLA 3FEOA 2Q2EB 4M77G 3NMUA 1ITGA 4CZHA 4PJOD 5HNFA 1U9OA 4M75A 5FLXZ 2VV5A 1G15A 4C3IJ 2NNWA 1FP1D 5E1ZB 3GNFB 3M0PA 2DMTA 1O13A 5AQRA 1QZ5A 5HRSA 4CZEA 4GGGA 5MLCQ 1R71A 2XY7A 5K1YA 5HP1A 1I39A 3ZT3A 4JV5K 4EJWA 2M30A 4M7AA 1WJCA 2PMHA 1XMOK 1J5OA 4OAYA 3GLXA 2A3ZA 2DY4A 1VQMQ 3CWUA 2PYJA 3NGZA 4KB1A 5A2QK 4K41A 3FFIA 2EBPA 2P9PA 4GXOA 3NF9A 1D09B 4A0ZA 1R7JA 3EUHA 3U23A 3A1YA 3P8HA 1V5EA 1U04A 4BY7J 1AWJA 1UDLA 3CC7A 2H8WA 1G83A 1ZUKA 4CFCA 3HFOA 3BWGA 4MHGA 2IVWA 1VQMI 3V1OA 2A08A 1DT9A 4M78F 1HKQA 1EWRA 4RGRA 2B9SA 4G94A 2V7YA 3V7SA 2XKOC 3S14J 3BR6A 4M3TA 2K9MA 1IKWA 2L7KA 2Z1GA 2DTZA 5LJ5e 4CEOA 4JK9A 5BRHA 3KYDB 2RN2A 3AVBA 4GBQA 3DKMA 1ACIA 3BP8A 4I7FA 2CGHA 3K2AA 2PN6A 1YJWN 3RPUA 4IZ9A 3DM2A 4ELZC 2M8EA 1KVBA 4JI1K 1QVUA 3OYNA 5AFUA 3PUFA 5ADXH 4GV6A 1BI2A 2CT3A 3EFSA 3GTJJ 3FM3A 3KJVA 4MQ3A 1UHSA 2X48A 2FZGB 1SVOA 3G10A 1G3WA 1TNSA 4XRMA 1CKAA 1T3SA 2GIZA 1SAXA 2ZF5O 3CUQA 1O75A 4B9MA 1SF9A 1K73R 2QQSA 2CH0A 3REAB 1D5AA 2YX4A 2PTKA 1F9NA 2GUPA 1R4NB 1JUPA 3NQOA 5AZIB 1AOYA 3EG1A 3O5BA 2ZXWH 3BG6A 4M7DF 2XAFA 4DUZK 1XCVA 4C92C 2W7NA 4AFZC 4BBSJ 1NGDA 2CGJA 3W2WA 1XWLA 1K76A 4XTYA 4JD2B 3ZN0A 4I02A 1K4TA 5LJ3f 4CIGA 4DV6K 4KDPA 4JI4K 1TT5B 3R6NA 3W2AA 4DTXA 2DRMA 1B72A 5GAN4 3AVCA 2OPQA 5AQJA 3Q0VA 1XSDA 2HS5A 2W00A 4EMSA 3AO5A 5C6SA 1ASWA 4DCHA 2QTVA 2ZAEA 1OYWA 3S3NA 4AM6A 2LF8A 2IAIA 2UUBK 1YIJA 2E60A 1LPLA 2CP7A 2E6NA 5E26A 1LPQA 1RRSA 3HBTA 2GTOA 3D5LA 4JZ3A 3CCUA 4C92A 3F9MA 2YUQA 1I1JA 4B9NA 2DTHA 1UA1A 3ZLJA 1RCHA 1K8AR 3TKYA 3PNVA 1YJWQ 1SFXA 2JVVA 4M7YA 5J40A 4OFEA 4M6YA 1MMGA 3GCMA 4A3FJ 4IX7A 4K8XA 2ISYA 4BC4A 1HDDC 1KSWA 2EFQA 4N0AC 2AXTC 4PHTX 3KETA 3NTHA 1GOBA 1U5TB 4G12A 5CQGA 3LPUA 1ESVA 3TSPA 1FBSA 2RB6A 2ADUA 2X1CA 3RRGA 3DLAA 5FB2A 2KPMA 3SMPA 3G1JA 3E2UA 5FDLA 4OIPF 4CJ7A 3VU3C 1UAAA 2BKDN 5CK9A 1VQKI 2PZ1A 4B3AA 2JXBA 3CCRN 2KK4A 2X4JA 5AQOA 3ML6A 3KLHA 5B8HA 4XM3A 2AKKA 5DM7F 4GVEA 1Y8RB 5ECAA 3PNWC 2QKLB 2QQBA 2GOXB 2CUEA 4PKCC 3P38A 4FHTA 3E7LA 4FTHA 4OKEA 4OPJA 3CD6Q 4F8RA 2XKOA 2FPEA 3AO3A 3HOUJ 2GA1A 5HVQC 1UECA 4OINF 1PSEA 2X1DA 2LMDA 1EZZB 1BHLA 2QF7A 2Z33A 1T05A 2HNDA 3IV5A 1N32K 1Z3XA 1KC8O 1H1VA 1ATSA 5M1PA 2P9NB 2QGUA 1KQ9A 3NF6A 1P7JA 4IEIA 2XIDA 2NRAC 1G99A 2A0FB 1USSA 3CCEN 1MBEA 2KJBA 2X4HA 3O3KA 3MD2A 3KNTA 2L3RA 2PUOB 1Q8IA 4B1RA 1SMTA 1VQ9Q 1SRMA 1WJAA 4MQ9F 3H9GA 5LY3A 1P92A 4LH5A 5LMUK 3QBYA 5BR9A 2M2EA 3K2PA 4C92E 2XI9A 1YJNQ 2DA1A 4N56A 2BANA 1WA7A 5IT9Z 2LTOA 1KAXA 5AQZA 1I6XA 5IOYA 4KPYA 4XTWA 1RBVA 4HNVA 3NGYA 4RTWA 3CCLA 1EA3A 4F04B 3P9KA 4IFVA 2YWWA 3FBNB 2RM4A 4BG8A 2HYJA 1IW7F 4BEHB 2YRCA 2L89A 1DDNA 2J7IA 2F5VA 1LFBA 2KYMA 2KLAA 4CHPA 3M53A 3BDPA 3QEIA 2P9UB 3NHNA 1W2BA 4CCHA 5M1NA 3WEEA 3KBGA 3VQ8A 3SZTA 4C0GA 4CD1A 1QCNA 2GZWA 4CUGA 2QAZA 3ULEA 2GXBA 4LOCA 1N9SA 1LE8A 4Y1CA 1KHCA 2WBNA 3G1LA 1M30A 4FJLA 2Q3SA 3DXMA 3EE9A 4B1UB 1SKUB 4NYNA 3A1PA 2HBJA 4BHPA 4XTZA 2VG6A 1ERDA 3NH2A 3TAFA 1UGVA 2PVOB 1Y1WJ 3KLOA 1ZG3A 2BE9B 4F7UG 2DLLA 3VKIA 1YHQA 1Q82U 1SHGA 1BUPA 4B3MK 1RDWX 5BNGA 4KUIA 4I98B 5F1RA 1ITYA 2JT1A 4IIMA 1QVFP 4NB4A 1HRHA 3T8RA 2LKPA 3KXTA 5DCMB 4DSKA 3VRYA 1SVMA 2UWMA 1YUWA 1HW5A 2EA4A 4AI5A 4U0YA 1SFOJ 2XRLA 4E1MA 5BRFA 1X19A 2EYQA 3P39A 3EYZA 1QCFA 1B8IA 1KQ0A 1MD0A 4Z02A 1S5LC 3NGPA 1Q7YC 1MUYA 4JQFA 2RREA 3ZSYA 3QYGB 4L0ZB 2DMQA 4QPQA 5ELZA 4ELVA 1F1ZA 4FETA 4M7AB 1HF0A 1MSEC 3EE8A 1ZGJA 1T2KA 4LUDA 1QP2A 1WHJA 4FK2A 4KKOA 1MJ9A 1B9DA 3FZLA 4ITVA 4ZZDA 3RIRA 3E9GA 2R5YB 2EGAA 2RVCA 2O0YA 5CVJA 2FNAA 1TUUA 5DM7R 3DLLF 3VQ6A 2P0PA 1PG5B 3SMSA 4NNJA 2F2VA 2X6WA 1J2XA 4FJ7A 4FWPA 3P7NA 3IS9A 4BRFA 1C0FA 3QINA 2DYIA 4JJCA 1NPPA 2ELHA 4AYBA 4IDKA 4HBLA 2RGVA 1PU6A 3ISPA 2MWPA 3CETA 3META 4YG2F 5AZIA 5H6QA 4PFOA 2CUJA 3KVGA 4BDPA 4NHJA 3I56Q 2M3AA 3CF5F 3O08A 2J4RA 2COBA 1N36K 3CC4N 2P9IA 4B1YB 3VPRA 2FQ4A 3WTZA 2EIMH 4YFKF 2PJPA 2JJ7A 5CJ9A 4ZH4F 3A5ZB 5E8IA 1M1KC 1LKXA 4M42A 1RADB 2IP2A 2P9IB 5BQTA 1CZ9A 3VQBA 4Z88A 1RABB 3IKTA 1SFKA 4C0DB 2GAUA 3OYGA 2MABA 2JQ7A 4A54A 5L3BA 3HG9A 1KHIA 4E19A 2QEXN 4HUEA 4CJTA 3QFPA 4RW4A 1TUGB 3JRIA 1CKBA 2HWVA 5IHIA 4UY8I 1ZH5A 3OW2S 3TQNA 2EYWA 5FKKA 1QZZA 2DJQA 3QPHA 4YFNF 3Q9VA 4RAGA 2FXUA 4K0KK 1KSPA 2DZCA 1HC8A 3THXB 1VQNI 4Y13A 3I58A 1JL2A 4FLYA 3P83D 5FLXE 3MDQA 1JT0A 2LR8A 1QPIA 3QDRB 1TUYA 2QG9B 1OISA 4I6MA 3M8JA 2CFOA 2RDPA 1Q9YA 3A0BC 4HPQA 4V19K 1SHFA 1WJFA 3CJNA 3TEDA 3GZNB 3WQTA 2R7QA 2WSEE 2HKQB 1D5VA 2Q8KA 1TUCA 2E6MA 1RAAB 4C5HA 1IDZA 4QW2A 2ICWG 2NS7A 4CESA 1YLFA 3TSQA 1MMSA 5BPIA 4BGAA 1WJ5A 5KYXB 1T95A 1UFFA 1AWCA 1HNZK 1UMQA 4J8FA 2AT1B 3CCSN 2LNHB 3VN5A 3HK2A 2XHIA 2QM1A 3L2WA 1KVCA 2MF2A 3JS6A 4J9HA 2DAQA 4QCLA 4U7DA 4BH9A 1TU0B 2Y0SA 3H36A 2LJ3A 1X2NA 4Q4ZF 4M6XA 2DMOA 3GPLA 3C2HA 4B44A 3L1PA 2L7FP 2J6KA 1A36A 3SV3A 3K70C 4OMFB 3M9QA 3HSCA 4RTFD 1TQPA 1HD3A 2RQQA 3V1RA 1U48A 4V19S 1XMXA 1NU0A 1QVFM 4YFXF 4VUBA 1AT1B 3EGXB 2F4MB 2YRVA 3ZGKA 1FPQA 1N25A 4CFBA 2Z3YA 4D6WA 4C23A 3C3WA 3T9NA 3LW5E 4GYIA 1UAXA 1IRGA 2W1OA 4FOEA 3K9JA 3M1CA 4A3DJ 2O4XA 5F0HA 1VQ4I 4OMMA 3K70D 1ZHIA 1KU7A 3N5BB 1I3QJ 4BJ6C 4XL9A 3P4IA 2CUFA 2RO0A 1T6SA 3HPGA 4M78C 1XMQK 3H3OB 3NBPA 3AFHA 5AQWA 2HQRA 1H88C 3KYCB 1TG0A 4XORA 4N0AA 5ICFA 5CE3A 4YOTA 2PNIA 2CP6A 1VK0A 1O3QA 3SAFA 2VBWA 3BJOA 1NGJA 3V1QA 1HU0A 1WGSA 4NCGA 4BREA 3AVIA 4PWDA 2JOYA 2XY8A 4FXDA 4UB6C 2QK0A 3VWBA 4DYQA 3IG1A 3FMSA 3DLHA 1EO1A 4IKFA 1ZR4A 4EHTA 1P2FA 2ZJRL 5DV5A 2JPSA 3LH5A 4E9EA 3D5SC 3V4IA 3K4JA 3JXUA 1NOYA 2QQAA 4ESJA 5AQHA 1D9FA 4N4NB 3SI6A 2PY5A 2NOIA 3UDCA 5GAOr 1Y57A 2PBDA 3CCLT 2HL5C 3OYBA 2PQ8A 2VJ5A 1N6AA 3JW4A 2FE3A 2BXYA 4II3A 3C2BA 2L9RA 2BE7D 2F96A 2ENMA 3TREA 4OIOF 2BUPA 2HKXA 3WTWC 4CZFA 4FJNA 2QEXA 2JA7J 1S1XA 1HQCA 2JHNA 2LFBA 2Y0SN 4NC7A 2H3JA 1H9GA 2IIRA 1HSJA 3T0YA 5BN8A 3SUPA 2PX9A 4A3EJ 4O5FA 3TBIA 5CZ1A 4RB2C 1RT2A 3J8AA 1KQ2A 3F9KA 2FSJA 3W3CA 4JS4A 2G7HA 3CUQC 1RUNA 3HL8A 2L0AA 1YS7A 1WNLA 3I33A 2RQUA 4FJ8A 4AM3A 3B8AX 2XC7A 3PL8A 4BRGA 2E2HJ 5I9EB 4BGDA 5BN9A 1KG1A 3B6AA 3CVTA 4AHRA 3HC7A 1YN8A 1T98A 4M77A 4ZDPA 1XG7A 2KZZA 1X1CA 4BACA 2FNPA 3HP9A 1LMZA 2CH4W 2MBFA 1VQOI 3VS5A 3JCMP 2E1YA 2FSKA 3GVAA 1RFQA 4RLFA 2JUFA 1YW9A 4QQGA 4XN0A 2QQ8A 2NOGA 4MZPA 4ZZLA 4F4KA 2VODA 5DLQE 3QO9A 2DDBA 2E5NA 1M1KO 4XRSA 4Q47A 1B7TA 3IFRA 4DFKA 2CUZA 1T08B 2I8DA 1W7PB 2M0OA 5ED4A 4DU3A 4JK7A 2E70A 3VYRB 3CD6I 4RW6A 3PX4A 4M73A 4N41A 2DIQA 3T1HK 3GZ5A 3MP1A 1FLIA 1Q1VA 5JVTA 2L02A 2EFPA 2XDPA 4BVOA 1VYVA 1LCUA 3HYIA 4M75B 4JLHA 1QRYA 4N4GA 3D6RA 4HUGA 2B86A 4KTWA 4M9XA 3JR9A 3C12A 1QWEA 3C6HA 1SEUA 1ETWA 3I0RA 4HUFA 4BRAA 1JXEA 1N5ZA 3KTUA 1GLJO 3RRHA 2KDOA 2FEIA 4C8QG 2BZYA 1IH7A 3ZSVA 3O3FA 2DTRA 3O4NA 3VERA 4B9UA 2HBKA 2KL4A 2Y4XA 5H1SQ 3GUDA 5JR3A 2E4LA 4B21A 4A12A 2LY2A 2WV1A 3GG4A 4DJAA 3AO2A 4A0YA 3VGMA 3BLYA 1LCKA 2QWLA 4AWXB 2RK1A 2X6SA 4C30A 2BV6A 4IHWA 4IWVA 2H1LA 1IHVA 1RT7A 3J7YJ 2D45A 4NLCA 4OAZA 4RM3A 1MDMB 1IB8A 4FWNA 2R5ZA 2QSFX 3G3ZA 2RN7A 4AM7A 1B4AA 2P81A 1ABQA 3OMCA 4XN3A 3Q9SA 5EGOA 1CQTA 2KNBB 4OO1J 1OPCA 4M75D 3QSUA 3J7AP 4KITB 2MA3A 2KHMA 4KHPK 1NGNA 5AYFA 3DLMA 5GANe 4J83A 1TWHJ 5GAHP 4BRPA 4I01A 3HB9A 2ACJA 1M2OA 3VEZA 4C1NI 1BC7C 1J0RA 2HDDA 3VYSB 3OSVA 5IYDJ 2RHZA 4K42A 3CWSA 3DLLL 1B34A 2B4JA 1RDCA 2L3DA 4ASNA 4RDUA 1V4RA 3CMAQ 4DV3K 4F3OA 1S72I 2DMPA 3CCMA 2GWJA 1W5TA 3KTQA 2K02A 4F7UF 3QEWA 1DGKN 5LFAA 2IIMA 2MCNA 4RBOA 5CY4A 4ISGA 4ZDLA 1M3BA 4WCIA 3H92A 1LWWA 2LQ8A 5GANd 2NUPB 1NH3A 1RPWA 1STZA 4HV5A 4IEJA 2MIOA 1G2HA 2M9HA 4WTOB 4MDXA 3HJFA 4KT0E 3IRXA 3U8XA 3QWLA 2RHIA 2P51A 2VI6A 1RR7A 2MFZA 1BKBA 5I3UA 1VSEA 1IKXA 2HQNA 4FWRA 4L6V5 2HNYA 3IUCA 4FYYB 5KH6A 2H56A 3VMFB 4PY5A 1GVDA 2D2WA 4XLAA 3BG7A 4BKXA 5J4VA 3CCEQ 2BY0A 3ZEHA 3LDLA 4DTPA 1RKWA 2FL7A 5IP6A 2HVQA 4F52A 4XTVA 4CJKA 1QO0D 1FSHA 3HRMA 2DPDA 2JTVA 4DTJA 4L8RB 2ZSIB 3HFNA 4IG3A 4A3LJ 4WXHA 5IHNA 4KRFA 3KP5A 2WAQN 2EHGA 3VEXA 2B6AA 3IL2A 2HNIA 1XNRK 4IOAF 2PMZN 2QDLA 5GMKi 5ILUA 2QWPA 1QQJA 3CCVI 3EQLF 1NMDA 1PU7A 2IJLA 2EB7A 4LH4A 3RESA 3TEEA 3IDHA 5JMVA 2VYPA 2EKHA 4RW7A 1A31A 2LCLA 3SNNA 2BY3A 4Y3OA 3P9IA 1XB4A 4GKKK 1NG9A 4GY5A 1AEYA 4FX4A 1TK0A 3IKVA 1QP3A 5GINA 1RKTA 2EJ9A 1TZLA 2IGNA 2LKSA 1LDKB 4O5VA 2JK3A 1UOCA 2MLKA 2E34A 2WOMA 5CHIA 3CDHA 1HJRA 3IH7A 1FC3A 4Z4IA 2HW3A 3ISNC 3QIIA 1VQ9N 2Z1IA 3CF2A 3AO1A 3L4IA 4GRIA 4H0EA 4PJOB 1E4FT 1UZCA 4O0IA 3HOWJ 4AG1C 4MFDA 4BWJA 1TWFJ 2EILH 2DYSH 3O3GA 2EZLA 3HOSA 5E84A 3UE5A 4O55A 2DL5A 4BRIA 1N8RU 2M5WA 4CJUA 2K4BA 4OFAA 3PLAA 2NVQJ 5HOOA 3N0UA 1IN5A 5D4RA 2ZWHA 4YFUA 2JJ9A 4BQNA 1IRZA 1W0HA 3MK6A 1O3SA 2LH9A 3OV8A 2KAFA 4OMPA 3BPXA 3DWLE 1V5GA 3HEFA 2CP2A 5ICGA 3O8HA 4M7DC 3IQLA 1J7KA 3MX2A 1VQ5Q 2E12A 5IT9K 2KSSA 1G59A 5CAIA 1B07A 4CGFA 2SEMA 4UUSB 4EJZA 2H27A 1VQNQ 3BUZB 4CJ3A 2F6CA 4L9TA 1X01A 1YO5C 3KZIC 3LDPA 4JRPA 4H0PA 2M9UA 3GO5A 3S3OA 1UTIA 1X43A 1DGRM 2X3WD 2XAJA 3KEYA 1BBZA 3LWHA 2RKHA 3CCRQ 3CO7C 4KO0A 1OU8A 2DJIA 1RT5A 3M3ZA 3VF6A 3GTGJ 2D8HA 4CRIA 2YXYA 3OW2A 2GBQA 3M56A 3V8JA 2GFAA 4H0XB 4C3JJ 3V9SA 2DTUA 1W0UA 1DPUA 4IOCL 3V81A 3OYDA 1Z05A 1I07A 2YNGA 2PFBA 2K7LA 1ZK8A 3EETA 3RMSA 5LJ5j 1U2VA 1QTMA 4C92F 3C1DA 1N77A 4V2FA 3U1DA 3QEPA 3HHTB 1JLEA 2HFHA 1L3UA 4BRKA 2D1HA 2VONA 4OVAA 3DCFA 1G2BA 2XASA 5EYRA 1PKTA 3HL2A 4RTZA 3CCSI 3R2XC 1BOTO 3QO3A 2NS8A 3TSUA 1WNSA 3LP2A 4IO9L 4M3WA 4JPBW 4ENNA 4HVWA 3I55A 1T39A 2O4XB 2CUDA 4FX0A 3CFPA 3VEYA 4M3FA 4UOBA 3O5ZA 2VVKA 4A5NA 2VBXA 1T7PA 3E1SA 2KIMA 2F69A 3LH0A 3JRFA 2GXGA 3SDZA 5M5WJ 4JRIA 1TWGJ 3FBIB 3FJPA 1JKRC 4RGSA 4B43A 1NK0A 2O61A 3ELKA 2JMWA 3UKRB 2OCCH 2LX7A 1Z21A 5EF6A 4DTOA 5E3MA 1IAWA 2ECCA 2E1HA 3F72A 3WNHA 2DXUA 1SV5A 2LP0A 5IH2A 1K4US 3IH2A 2L9SA 2R7FA 4FYXB 5EVZA 1JEGA 4F7UA 3QJ6A 3IP4B 3ZSXA 5AFUH 2KJCA 5GTIC 3A01B 2TCTA 2P9UA 2FOKA 2AZVA 3NTKA 2C6YA 5CHZA 4ZC3A 1SQKA 3SUNA 4CHUA 1OI1A 1X6OA 4V2SA 5LJ3j 5GAMh 3ZBDA 4EATA 4YOYA 1ZA2B 2D4WA 2EYZA 2ZO4A 4RAYA 2HD0A 3M8EA 1A0NB 5A2QO 2OYQA 5J6XA 1P7IA 3BG5A 3A01A 2YG8A 2XG8D 3A8MB 5D6EA 4F16A 2CYYA 2E2JJ 4L5GA 1V5FA 3N05A 3QIOA 1T0HA 1SD6A 1SPKA 2XROA 3F8CA 1X69A 2P1JA 3DXMB 2D8JA 3THWB 4HTLA 3D0PA 1WHHA 1DPRA 2CMPA 1KJWA 5GADJ 2H1KA 4MEYF 1RT3A 4KHWA 3AV9A 4DV2K 2K9QA 4XONA 2CZ0B 2K3FA 3VENA 1R77A 4M41A 2OA4A 2ZMEC 1R1UA 2EV0A 2WADA 4LGWA 4XLNF 1IV8A 2WTUA 3G7ZA 1A6IA 3JAME 4E47A 1VQ9T 1M5Q1 4Q0BA 2F2WA 1ON1A 4J9DA 4ZDOA 2P5GA 4IRGA 2HL3A 4D9JA 2FF3B 3S6IA 3MP8A 1IG9A 1MNMC 3SUQA 3EZWA 4EIAA 2DERA 4CCKA 4FISA 1HJOA 2LD5A 1YNZA 3UB5A 2VXFA 2OQRA 2IVNA 5SWMA 3G4ST 1F21A 3CFOA 3TAMA 3FE1A 4A2AA 3TI0A 2UYTA 3DU5A 1ETQA 3BC8A 2HPIA 4HCBA 2O8DB 3THWA 2DM1A 4DK9A 4JYAK 4AYBN 1RAIB 4KMUX 1ZREA 1PUFB 3MMVA 4ORZA 1YJ9Q 3U4LA 2KQ2A 3ZXSA 4FT8A 1JKQC 3RMAA 1Z3YA 4LB6B 2D0CA 1Z6RA 3DU6A 5C42A 3TAQA 1YITQ 4O8UA 3DB4A 1JLGA 1QZYA 3I56I 4CGIA 3DWLA 4DV5K 2QDYB 4JRQA 4E3SA 4GCVA 2DXTA 4PJMA 1PSFA 3JSCA 4CZMA 1VQ7N 5H6RA 2PMUA 4CCJA 3O9SA 1RTIA 3HTUA 2V51B 4EV0A 4RWTA 3AVGA 2ESNA 2KRFA 2YS9A 4ZGJB 1YBYA 1NJIC 5GAN5 2ZJQF 1R36A 2ROLA 5DEQA 5E41A 3RMCA 1U2WA 3I71A 2CW8A 4MDBA 5J1EA 1HK9A 3I5UA 3C0BA 3CCQT 4EHUA 1Y7XA 4H5WA 1O3TA 1K61A 1EWQA 4B09A 3CCMN 1Y64A 2WB1A 3HDDA 1KONA 3S15J 1YW8A 2O8XA 2TRTA 1UB4A 4EMHA 3VSKA 4FJ9A 1SFEA 2V1UA 4B3SK 1W2BM 1GCQC 1PUFA 4FSVA 1JJ2P 4EGYA 3TO6A 1K8AU 1TL3A 3L3VA 4BQAA 2NWMA 1U9NA 2BW3B 1AHDP 4M72A 4CICA 4RMOA 3LWMA 3CMEA 3Q5FA 2NRWA 4DS4A 5ILVA 1I4K1 3GL1A 1Y0UA 2VC0A 1S7EA 2KDSA 2L01A 3S16J 3VGLA 1K83J 2BZ8A 3KK2A 5A0LA 4B47A 2ROTA 1NMNA 1Z0XA 1HX1A 1KG6A 3CPWA 5GTHC 3OBWA 2NLUA 3UATA 5HS8A 6PAXA 1I1SA 2I0NA 4UV9A 4WFNL 3VEWA 4Y33A 5HDKA 2ZFWA 3KWGA 4EZ6A 2YV0X 2R7RA 2RI5A 3QPLA 3S1QJ 1UJ0A 2P7VB 2K3PA 3GFMA 1PD1A 2O9VA 2JT4A 3EFRA 2EINH 3WGIA 3KLGA 4CECA 3J7ZO 1IG8A 4B1VA 4ID5A 2M16A 1TQMA 2K5LA 1PU8A 4I0BA 1YI2I 1ZBLA 4CA0A 3CP8A 1MBFA 2XMFA 1NJXA 3CZ6A 3LL3A 1VQ8I 3FLCO 2GGRA 2CW0F 1WUAA 3D1NI 1QKWA 2DTIA 1SS6A 1ILYA 3H0GJ 3ZT0A 1MNDA 1APLC 1YI2Q 3HKZA 1J59A 3G71I 5IAYA 2F2EA 3CO6C 4G1QA 5AQFA 4KHQA 3M0UA 2D0QB 1NGIA 5LRRA 1RACB 4JS5A 4LD9K 4BAYA 4J19A 2VE9A 3Q7BA 3AVNA 3EYYA 2QXLA 3DRPA 3JTGA 4BR2A 3JCMc 5K5RA 1LAWA 4J01A 5IXBA 2PUKB 2Y1JA 5CVIA 2VB6A 1IN7A 3LDQA