4EW4A

Mouse mbd4 glycosylase domain in complex with dna containing a ribose sugar
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
142
Chain Sequence
KWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/dna
molecule keywords Methyl-CpG-binding domain protein 4
publication title Excision of thymine and 5-hydroxymethyluracil by the MBD4 DNA glycosylase domain: structural basis and implications for active DNA demethylation.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 142
sequence length 142
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ew4A00
1P59A 4OFAA 2NOLA 2XHIA 3FHFA 1LMZA 4PIIA 4OFHA 4B22A 4E9EA 3KTUA 1DIZA 3N5NX 1KG4A 3N0UA 3I0XA 1LWWA 3CW7A 4E9HA 1EBMA 2OFIA 4EJYA 4EA4A 3OGDA 1XQPA 1NGNA 1ORNA 1P7MA 2NOFA 1LWYA 4HSBA 1XQOA 4EW0A 1WEFA 1KG5A 1YQLA 1MPGA 2YG9A 4E9GA 3G0QA 1KG7A 4B23A 1RRQA 1PU6A 1PU7A 3F10A 1PVSA 4EW4A 2YG8A 4YOQA 1N3CA 2NOEA 1KEAA 4UOBA 1KG2A 1N39A 1KO9A 1KG3A 3CVSA 5KN8A 4E9FA 2ABKA 1YQMA 1ORPA 1M3QA 4AI5A 1MUDA 1RRSA 5CHZA 3CWAA 4AIAA 4EA5A 4AI4A 1MUNA 3FSPA 1VRLA 4OFEA 1XG7A 4EJZA 2I5WA 4YPRA 1PU8A 3OH6A 3CVTA 1LWVA 4DK9A 1M3HA 4B24A 3IHOA 2NOIA 3CWUA 4YPHA 3OH9A 3FHGA 4EVVA 3CWSA 5DPKA 1HU0A 1KQJA 4B21A 1WEIA 3KNTA 3D4VA 2H56A 1NKUA 3IH7A 5KN9A 1YQRA 3F0ZA 2JHJA 3S6IA 3CWTA 3I0WA 5AN4A 2JG6A 1WEGA 1MUYA 2NOZA 1KG6A 4UNFA 1YQKA 2OFKA 1FN7A 1N3AA 2JHNA 2NOBA 2NOHA
chains in the Genus database with same CATH superfamily
1P59A 4OFAA 4ZTFA 5FRMA 3S3OA 2NOLA 2XHIA 3FHFA 2W04A 1LMZA 3OS1A 4PIIA 4OFHA 3NNQA 4E9EA 4B22A 3KTUA 1DIZA 3OYNA 2JPSA 3N5NX 1KG4A 3L2UA 3N0UA 3I0XA 1LWWA 3CW7A 4E7IA 4E9HA 5FRNA 1EBMA 2OFIA 3OYGA 4EJYA 2V75A 3L2VA 4BACA 4EA4A 4BE0A 3OGDA 4IKFA 1XQPA 1NGNA 4BE1A 1ORNA 1P7MA 2NOFA 1LWYA 3OYAA 1XQOA 4HSBA 4EW0A 1WEFA 3L2WA 1KG5A 3OYMA 3S3MA 1YQLA 1MPGA 4E7JA 2YG9A 4E9GA 3G0QA 1KG7A 4B23A 3R2XC 1RRQA 1PU6A 1PU7A 3F10A 1PVSA 4EW4A 2YG8A 4YOQA 3OYJA 1N3CA 2NOEA 4E7HA 3OS0A 1KEAA 4UOBA 4E7KA 1KG2A 1N39A 1KO9A 1KG3A 3CVSA 4BDZA 1U84A 5KN8A 3OYIA 4E9FA 4E7LA 2ABKA 3OYHA 1YQMA 1ORPA 1M3QA 4AI5A 1MUDA 3OYDA 3OY9A 5CHZA 3CWAA 1RRSA 4AIAA 4EA5A 3L2QA 3LCNA 4AI4A 1MUNA 3FSPA 1VRLA 4OFEA 4NZGA 1XG7A 3OS2A 3OYBA 4EJZA 2I5WA 3OYLA 4YPRA 1PU8A 3OH6A 3CVTA 3OYKA 1LWVA 4DK9A 1M3HA 4B24A 3IHOA 3VW4A 2NOIA 3CWUA 4YPHA 3OH9A 3FHGA 4EVVA 3CWSA 5DPKA 1HU0A 3L2RA 1KQJA 4B21A 1WEIA 3KNTA 3D4VA 2H56A 1NKUA 3IH7A 5KN9A 1YQRA 4BDYA 3F0ZA 2JHJA 3S6IA 4BE2A 3CWTA 3OYEA 5AN4A 3I0WA 2JG6A 1WEGA 1MUYA 2NOZA 3OYCA 1KG6A 4UNFA 5FROA 1YQKA 2W03A 2OFKA 1FN7A 3S3NA 1N3AA 2JHNA 2NOBA 2NOHA 4ZTJA 3OYFA
chains in the Genus database with same CATH topology
1P59A 4OFAA 2NOLA 2XHIA 3FHFA 1LMZA 4PIIA 4OFHA 4B22A 4E9EA 3KTUA 1DIZA 3N5NX 1KG4A 3N0UA 3I0XA 1LWWA 3CW7A 4E9HA 1EBMA 2OFIA 4EJYA 4EA4A 3OGDA 1XQPA 1NGNA 1ORNA 1P7MA 2NOFA 1LWYA 4HSBA 1XQOA 4EW0A 1WEFA 1KG5A 1YQLA 1MPGA 2YG9A 4E9GA 3G0QA 1KG7A 4B23A 1RRQA 1PU6A 1PU7A 3F10A 1PVSA 4EW4A 2YG8A 4YOQA 1N3CA 2NOEA 1KEAA 4UOBA 1KG2A 1N39A 1KO9A 1KG3A 3CVSA 5KN8A 4E9FA 2ABKA 1YQMA 1ORPA 1M3QA 4AI5A 1MUDA 1RRSA 5CHZA 3CWAA 4AIAA 4EA5A 4AI4A 1MUNA 3FSPA 1VRLA 4OFEA 1XG7A 4EJZA 2I5WA 4YPRA 1PU8A 3OH6A 3CVTA 1LWVA 4DK9A 1M3HA 4B24A 3IHOA 2NOIA 3CWUA 4YPHA 3OH9A 3FHGA 4EVVA 3CWSA 5DPKA 1HU0A 1KQJA 4B21A 1WEIA 3KNTA 3D4VA 2H56A 1NKUA 3IH7A 5KN9A 1YQRA 3F0ZA 2JHJA 3S6IA 3CWTA 3I0WA 5AN4A 2JG6A 1WEGA 1MUYA 2NOZA 1KG6A 4UNFA 1YQKA 2OFKA 1FN7A 1N3AA 2JHNA 2NOBA 2NOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P59 A;  4OFA A;  2NOL A;  2XHI A;  3FHF A;  1LMZ A;  4PII A;  4OFH A;  4B22 A;  4E9E A;  3KTU A;  1DIZ A;  3N5N X;  1KG4 A;  3N0U A;  3I0X A;  1LWW A;  3CW7 A;  4E9H A;  1EBM A;  2OFI A;  4EJY A;  4EA4 A;  3OGD A;  1XQP A;  1NGN A;  1ORN A;  1P7M A;  2NOF A;  1LWY A;  4HSB A;  1XQO A;  4EW0 A;  1WEF A;  1KG5 A;  1YQL A;  1MPG A;  2YG9 A;  4E9G A;  3G0Q A;  1KG7 A;  4B23 A;  1RRQ A;  1PU6 A;  1PU7 A;  3F10 A;  1PVS A;  4EW4 A;  2YG8 A;  4YOQ A;  1N3C A;  2NOE A;  1KEA A;  4UOB A;  1KG2 A;  1N39 A;  1KO9 A;  1KG3 A;  3CVS A;  5KN8 A;  4E9F A;  2ABK A;  1YQM A;  1ORP A;  1M3Q A;  4AI5 A;  1MUD A;  1RRS A;  5CHZ A;  3CWA A;  4AIA A;  4EA5 A;  4AI4 A;  1MUN A;  3FSP A;  1VRL A;  4OFE A;  1XG7 A;  4EJZ A;  2I5W A;  4YPR A;  1PU8 A;  3OH6 A;  3CVT A;  1LWV A;  4DK9 A;  1M3H A;  4B24 A;  3IHO A;  2NOI A;  3CWU A;  4YPH A;  3OH9 A;  3FHG A;  4EVV A;  3CWS A;  5DPK A;  1HU0 A;  1KQJ A;  4B21 A;  1WEI A;  3KNT A;  3D4V A;  2H56 A;  1NKU A;  3IH7 A;  5KN9 A;  1YQR A;  3F0Z A;  2JHJ A;  3S6I A;  3CWT A;  3I0W A;  5AN4 A;  2JG6 A;  1WEG A;  1MUY A;  2NOZ A;  1KG6 A;  4UNF A;  1YQK A;  2OFK A;  1FN7 A;  1N3A A;  2JHN A;  2NOB A;  2NOH A; 
#chains in the Genus database with same CATH topology
 1P59 A;  4OFA A;  4ZTF A;  5FRM A;  3S3O A;  2NOL A;  2XHI A;  3FHF A;  2W04 A;  1LMZ A;  3OS1 A;  4PII A;  4OFH A;  3NNQ A;  4E9E A;  4B22 A;  3KTU A;  1DIZ A;  3OYN A;  2JPS A;  3N5N X;  1KG4 A;  3L2U A;  3N0U A;  3I0X A;  1LWW A;  3CW7 A;  4E7I A;  4E9H A;  5FRN A;  1EBM A;  2OFI A;  3OYG A;  4EJY A;  2V75 A;  3L2V A;  4BAC A;  4EA4 A;  4BE0 A;  3OGD A;  4IKF A;  1XQP A;  1NGN A;  4BE1 A;  1ORN A;  1P7M A;  2NOF A;  1LWY A;  3OYA A;  1XQO A;  4HSB A;  4EW0 A;  1WEF A;  3L2W A;  1KG5 A;  3OYM A;  3S3M A;  1YQL A;  1MPG A;  4E7J A;  2YG9 A;  4E9G A;  3G0Q A;  1KG7 A;  4B23 A;  3R2X C;  1RRQ A;  1PU6 A;  1PU7 A;  3F10 A;  1PVS A;  4EW4 A;  2YG8 A;  4YOQ A;  3OYJ A;  1N3C A;  2NOE A;  4E7H A;  3OS0 A;  1KEA A;  4UOB A;  4E7K A;  1KG2 A;  1N39 A;  1KO9 A;  1KG3 A;  3CVS A;  4BDZ A;  1U84 A;  5KN8 A;  3OYI A;  4E9F A;  4E7L A;  2ABK A;  3OYH A;  1YQM A;  1ORP A;  1M3Q A;  4AI5 A;  1MUD A;  3OYD A;  3OY9 A;  5CHZ A;  3CWA A;  1RRS A;  4AIA A;  4EA5 A;  3L2Q A;  3LCN A;  4AI4 A;  1MUN A;  3FSP A;  1VRL A;  4OFE A;  4NZG A;  1XG7 A;  3OS2 A;  3OYB A;  4EJZ A;  2I5W A;  3OYL A;  4YPR A;  1PU8 A;  3OH6 A;  3CVT A;  3OYK A;  1LWV A;  4DK9 A;  1M3H A;  4B24 A;  3IHO A;  3VW4 A;  2NOI A;  3CWU A;  4YPH A;  3OH9 A;  3FHG A;  4EVV A;  3CWS A;  5DPK A;  1HU0 A;  3L2R A;  1KQJ A;  4B21 A;  1WEI A;  3KNT A;  3D4V A;  2H56 A;  1NKU A;  3IH7 A;  5KN9 A;  1YQR A;  4BDY A;  3F0Z A;  2JHJ A;  3S6I A;  4BE2 A;  3CWT A;  3OYE A;  5AN4 A;  3I0W A;  2JG6 A;  1WEG A;  1MUY A;  2NOZ A;  3OYC A;  1KG6 A;  4UNF A;  5FRO A;  1YQK A;  2W03 A;  2OFK A;  1FN7 A;  3S3N A;  1N3A A;  2JHN A;  2NOB A;  2NOH A;  4ZTJ A;  3OYF A; 
#chains in the Genus database with same CATH homology
 1P59 A;  4OFA A;  2NOL A;  2XHI A;  3FHF A;  1LMZ A;  4PII A;  4OFH A;  4B22 A;  4E9E A;  3KTU A;  1DIZ A;  3N5N X;  1KG4 A;  3N0U A;  3I0X A;  1LWW A;  3CW7 A;  4E9H A;  1EBM A;  2OFI A;  4EJY A;  4EA4 A;  3OGD A;  1XQP A;  1NGN A;  1ORN A;  1P7M A;  2NOF A;  1LWY A;  4HSB A;  1XQO A;  4EW0 A;  1WEF A;  1KG5 A;  1YQL A;  1MPG A;  2YG9 A;  4E9G A;  3G0Q A;  1KG7 A;  4B23 A;  1RRQ A;  1PU6 A;  1PU7 A;  3F10 A;  1PVS A;  4EW4 A;  2YG8 A;  4YOQ A;  1N3C A;  2NOE A;  1KEA A;  4UOB A;  1KG2 A;  1N39 A;  1KO9 A;  1KG3 A;  3CVS A;  5KN8 A;  4E9F A;  2ABK A;  1YQM A;  1ORP A;  1M3Q A;  4AI5 A;  1MUD A;  1RRS A;  5CHZ A;  3CWA A;  4AIA A;  4EA5 A;  4AI4 A;  1MUN A;  3FSP A;  1VRL A;  4OFE A;  1XG7 A;  4EJZ A;  2I5W A;  4YPR A;  1PU8 A;  3OH6 A;  3CVT A;  1LWV A;  4DK9 A;  1M3H A;  4B24 A;  3IHO A;  2NOI A;  3CWU A;  4YPH A;  3OH9 A;  3FHG A;  4EVV A;  3CWS A;  5DPK A;  1HU0 A;  1KQJ A;  4B21 A;  1WEI A;  3KNT A;  3D4V A;  2H56 A;  1NKU A;  3IH7 A;  5KN9 A;  1YQR A;  3F0Z A;  2JHJ A;  3S6I A;  3CWT A;  3I0W A;  5AN4 A;  2JG6 A;  1WEG A;  1MUY A;  2NOZ A;  1KG6 A;  4UNF A;  1YQK A;  2OFK A;  1FN7 A;  1N3A A;  2JHN A;  2NOB A;  2NOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...