4AIAA

The structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
188
structure length
188
Chain Sequence
GAMNECAFGTKDPVYLNYHDHVWGQPLYDSKALFKLLALESQHAGLSWLTILKKKEAYEEAFYDFEPEKVAQMTAQDIDRLMTFPNIVHHRKKLEAIVNQAQGYLKIEQAYGSFSKFLWSYVNGKPKDLQYEHASDRITVDDTATQLSKDLKQYGFKFLGPVTVFSFLEAAGLYDAHLKDCPSKPKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-METHYLADENINE GLYCOSYLASE I
publication title A Model for 3-Methyladenine Recognition by 3-Methyladenine DNA Glycosylase I (Tag) from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 77
structure length 188
sequence length 188
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2012-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4aiaA00
3S6IA 2I5WA 1ORNA 1NKUA 2YG9A 1RRSA 4B22A 1YQMA 1KG2A 3I0WA 4UNFA 2JHJA 3OH9A 3OGDA 3KTUA 1YQRA 1FN7A 2JG6A 3I0XA 3F0ZA 2JHNA 4YPRA 1RRQA 1LWVA 5CHZA 4AIAA 1YQLA 5AN4A 1PU8A 1LWWA 2NOIA 1N39A 1MPGA 1MUYA 1PU7A 3CWUA 1MUNA 4AI4A 3N0UA 1EBMA 1KG5A 1WEGA 1HU0A 1KG7A 1KO9A 3IH7A 3F10A 2H56A 1LMZA 4EA4A 4OFAA 3D4VA 2NOHA 2NOFA 2YG8A 4EVVA 4EW0A 1P7MA 3KNTA 1KEAA 2ABKA 5DPKA 1WEIA 4EA5A 4HSBA 1YQKA 4OFEA 1N3AA 1XG7A 2NOEA 3CVSA 4UOBA 3FSPA 4E9FA 4PIIA 1DIZA 3FHFA 1KQJA 1WEFA 2XHIA 2OFKA 4OFHA 1KG4A 2NOZA 4AI5A 1LWYA 1PVSA 1ORPA 1N3CA 4YOQA 4EJZA 4EJYA 2NOBA 1XQOA 1KG6A 4E9HA 1NGNA 4YPHA 3G0QA 3CWTA 3N5NX 1MUDA 4E9EA 1PU6A 4E9GA 5KN8A 4DK9A 3CWSA 1KG3A 3FHGA 3CWAA 3OH6A 1VRLA 4B21A 1M3QA 1P59A 5KN9A 3CW7A 4B24A 1XQPA 2NOLA 2OFIA 3IHOA 1M3HA 4B23A 3CVTA 4EW4A
chains in the Genus database with same CATH superfamily
3S6IA 2I5WA 3OYMA 3L2VA 5FRMA 3LCNA 1ORNA 1NKUA 2YG9A 1RRSA 4B22A 1YQMA 1KG2A 3OYFA 5FRNA 3I0WA 4UNFA 3OYCA 2JHJA 3OH9A 5FROA 3OYHA 3OYGA 3KTUA 3OGDA 1YQRA 1FN7A 2JG6A 3I0XA 3R2XC 2V75A 3L2RA 4BDZA 2W04A 3F0ZA 2JHNA 4YPRA 3OYAA 1RRQA 1LWVA 5CHZA 4AIAA 4BE1A 1YQLA 5AN4A 1PU8A 3VW4A 4BE0A 3OYIA 4E7IA 1LWWA 2NOIA 3L2WA 1N39A 1MPGA 1MUYA 3NNQA 1PU7A 3CWUA 1MUNA 4AI4A 4E7JA 3N0UA 1EBMA 4BE2A 3S3OA 3OY9A 1KG5A 1WEGA 3S3NA 1HU0A 1KG7A 1KO9A 4E7LA 3IH7A 3F10A 2H56A 1LMZA 3OYKA 4BACA 4BDYA 4EA4A 4OFAA 3D4VA 2NOHA 2NOFA 2YG8A 4EVVA 4EW0A 3S3MA 1P7MA 3KNTA 1KEAA 2ABKA 5DPKA 1WEIA 4EA5A 4HSBA 3OYEA 1YQKA 4OFEA 1N3AA 1XG7A 2NOEA 3CVSA 4UOBA 3FSPA 4E9FA 3OYBA 4PIIA 3OYJA 1DIZA 3FHFA 1KQJA 1WEFA 3L2UA 2XHIA 4NZGA 2OFKA 4E7HA 3OS2A 4OFHA 3L2QA 1KG4A 2NOZA 4AI5A 1LWYA 1PVSA 1ORPA 1N3CA 4YOQA 4EJZA 4IKFA 2JPSA 4EJYA 2NOBA 3OYDA 1XQOA 3OS0A 1KG6A 3OYNA 3OYLA 1NGNA 2W03A 4YPHA 4E9HA 3G0QA 3CWTA 3N5NX 1MUDA 4E9EA 1PU6A 4E9GA 5KN8A 4DK9A 3CWSA 1KG3A 3FHGA 3CWAA 3OH6A 3OS1A 1VRLA 4B21A 1M3QA 4ZTJA 1P59A 5KN9A 3CW7A 4B24A 1XQPA 2NOLA 4E7KA 4ZTFA 1U84A 2OFIA 3IHOA 1M3HA 4B23A 3CVTA 4EW4A
chains in the Genus database with same CATH topology
3S6IA 2I5WA 1ORNA 1NKUA 2YG9A 1RRSA 4B22A 1YQMA 1KG2A 3I0WA 4UNFA 2JHJA 3OH9A 3OGDA 3KTUA 1YQRA 1FN7A 2JG6A 3I0XA 3F0ZA 2JHNA 4YPRA 1RRQA 1LWVA 5CHZA 4AIAA 1YQLA 5AN4A 1PU8A 1LWWA 2NOIA 1N39A 1MPGA 1MUYA 1PU7A 3CWUA 1MUNA 4AI4A 3N0UA 1EBMA 1KG5A 1WEGA 1HU0A 1KG7A 1KO9A 3IH7A 3F10A 2H56A 1LMZA 4EA4A 4OFAA 3D4VA 2NOHA 2NOFA 2YG8A 4EVVA 4EW0A 1P7MA 3KNTA 1KEAA 2ABKA 5DPKA 1WEIA 4EA5A 4HSBA 1YQKA 4OFEA 1N3AA 1XG7A 2NOEA 3CVSA 4UOBA 3FSPA 4E9FA 4PIIA 1DIZA 3FHFA 1KQJA 1WEFA 2XHIA 2OFKA 4OFHA 1KG4A 2NOZA 4AI5A 1LWYA 1PVSA 1ORPA 1N3CA 4YOQA 4EJZA 4EJYA 2NOBA 1XQOA 1KG6A 4E9HA 1NGNA 4YPHA 3G0QA 3CWTA 3N5NX 1MUDA 4E9EA 1PU6A 4E9GA 5KN8A 4DK9A 3CWSA 1KG3A 3FHGA 3CWAA 3OH6A 1VRLA 4B21A 1M3QA 1P59A 5KN9A 3CW7A 4B24A 1XQPA 2NOLA 2OFIA 3IHOA 1M3HA 4B23A 3CVTA 4EW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6I A;  2I5W A;  1ORN A;  1NKU A;  2YG9 A;  1RRS A;  4B22 A;  1YQM A;  1KG2 A;  3I0W A;  4UNF A;  2JHJ A;  3OH9 A;  3OGD A;  3KTU A;  1YQR A;  1FN7 A;  2JG6 A;  3I0X A;  3F0Z A;  2JHN A;  4YPR A;  1RRQ A;  1LWV A;  5CHZ A;  4AIA A;  1YQL A;  5AN4 A;  1PU8 A;  1LWW A;  2NOI A;  1N39 A;  1MPG A;  1MUY A;  1PU7 A;  3CWU A;  1MUN A;  4AI4 A;  3N0U A;  1EBM A;  1KG5 A;  1WEG A;  1HU0 A;  1KG7 A;  1KO9 A;  3IH7 A;  3F10 A;  2H56 A;  1LMZ A;  4EA4 A;  4OFA A;  3D4V A;  2NOH A;  2NOF A;  2YG8 A;  4EVV A;  4EW0 A;  1P7M A;  3KNT A;  1KEA A;  2ABK A;  5DPK A;  1WEI A;  4EA5 A;  4HSB A;  1YQK A;  4OFE A;  1N3A A;  1XG7 A;  2NOE A;  3CVS A;  4UOB A;  3FSP A;  4E9F A;  4PII A;  1DIZ A;  3FHF A;  1KQJ A;  1WEF A;  2XHI A;  2OFK A;  4OFH A;  1KG4 A;  2NOZ A;  4AI5 A;  1LWY A;  1PVS A;  1ORP A;  1N3C A;  4YOQ A;  4EJZ A;  4EJY A;  2NOB A;  1XQO A;  1KG6 A;  4E9H A;  1NGN A;  4YPH A;  3G0Q A;  3CWT A;  3N5N X;  1MUD A;  4E9E A;  1PU6 A;  4E9G A;  5KN8 A;  4DK9 A;  3CWS A;  1KG3 A;  3FHG A;  3CWA A;  3OH6 A;  1VRL A;  4B21 A;  1M3Q A;  1P59 A;  5KN9 A;  3CW7 A;  4B24 A;  1XQP A;  2NOL A;  2OFI A;  3IHO A;  1M3H A;  4B23 A;  3CVT A;  4EW4 A; 
#chains in the Genus database with same CATH topology
 3S6I A;  2I5W A;  3OYM A;  3L2V A;  5FRM A;  3LCN A;  1ORN A;  1NKU A;  2YG9 A;  1RRS A;  4B22 A;  1YQM A;  1KG2 A;  3OYF A;  5FRN A;  3I0W A;  4UNF A;  3OYC A;  2JHJ A;  3OH9 A;  5FRO A;  3OYH A;  3OYG A;  3KTU A;  3OGD A;  1YQR A;  1FN7 A;  2JG6 A;  3I0X A;  3R2X C;  2V75 A;  3L2R A;  4BDZ A;  2W04 A;  3F0Z A;  2JHN A;  4YPR A;  3OYA A;  1RRQ A;  1LWV A;  5CHZ A;  4AIA A;  4BE1 A;  1YQL A;  5AN4 A;  1PU8 A;  3VW4 A;  4BE0 A;  3OYI A;  4E7I A;  1LWW A;  2NOI A;  3L2W A;  1N39 A;  1MPG A;  1MUY A;  3NNQ A;  1PU7 A;  3CWU A;  1MUN A;  4AI4 A;  4E7J A;  3N0U A;  1EBM A;  4BE2 A;  3S3O A;  3OY9 A;  1KG5 A;  1WEG A;  3S3N A;  1HU0 A;  1KG7 A;  1KO9 A;  4E7L A;  3IH7 A;  3F10 A;  2H56 A;  1LMZ A;  3OYK A;  4BAC A;  4BDY A;  4EA4 A;  4OFA A;  3D4V A;  2NOH A;  2NOF A;  2YG8 A;  4EVV A;  4EW0 A;  3S3M A;  1P7M A;  3KNT A;  1KEA A;  2ABK A;  5DPK A;  1WEI A;  4EA5 A;  4HSB A;  3OYE A;  1YQK A;  4OFE A;  1N3A A;  1XG7 A;  2NOE A;  3CVS A;  4UOB A;  3FSP A;  4E9F A;  3OYB A;  4PII A;  3OYJ A;  1DIZ A;  3FHF A;  1KQJ A;  1WEF A;  3L2U A;  2XHI A;  4NZG A;  2OFK A;  4E7H A;  3OS2 A;  4OFH A;  3L2Q A;  1KG4 A;  2NOZ A;  4AI5 A;  1LWY A;  1PVS A;  1ORP A;  1N3C A;  4YOQ A;  4EJZ A;  4IKF A;  2JPS A;  4EJY A;  2NOB A;  3OYD A;  1XQO A;  3OS0 A;  1KG6 A;  3OYN A;  3OYL A;  1NGN A;  2W03 A;  4YPH A;  4E9H A;  3G0Q A;  3CWT A;  3N5N X;  1MUD A;  4E9E A;  1PU6 A;  4E9G A;  5KN8 A;  4DK9 A;  3CWS A;  1KG3 A;  3FHG A;  3CWA A;  3OH6 A;  3OS1 A;  1VRL A;  4B21 A;  1M3Q A;  4ZTJ A;  1P59 A;  5KN9 A;  3CW7 A;  4B24 A;  1XQP A;  2NOL A;  4E7K A;  4ZTF A;  1U84 A;  2OFI A;  3IHO A;  1M3H A;  4B23 A;  3CVT A;  4EW4 A; 
#chains in the Genus database with same CATH homology
 3S6I A;  2I5W A;  1ORN A;  1NKU A;  2YG9 A;  1RRS A;  4B22 A;  1YQM A;  1KG2 A;  3I0W A;  4UNF A;  2JHJ A;  3OH9 A;  3OGD A;  3KTU A;  1YQR A;  1FN7 A;  2JG6 A;  3I0X A;  3F0Z A;  2JHN A;  4YPR A;  1RRQ A;  1LWV A;  5CHZ A;  4AIA A;  1YQL A;  5AN4 A;  1PU8 A;  1LWW A;  2NOI A;  1N39 A;  1MPG A;  1MUY A;  1PU7 A;  3CWU A;  1MUN A;  4AI4 A;  3N0U A;  1EBM A;  1KG5 A;  1WEG A;  1HU0 A;  1KG7 A;  1KO9 A;  3IH7 A;  3F10 A;  2H56 A;  1LMZ A;  4EA4 A;  4OFA A;  3D4V A;  2NOH A;  2NOF A;  2YG8 A;  4EVV A;  4EW0 A;  1P7M A;  3KNT A;  1KEA A;  2ABK A;  5DPK A;  1WEI A;  4EA5 A;  4HSB A;  1YQK A;  4OFE A;  1N3A A;  1XG7 A;  2NOE A;  3CVS A;  4UOB A;  3FSP A;  4E9F A;  4PII A;  1DIZ A;  3FHF A;  1KQJ A;  1WEF A;  2XHI A;  2OFK A;  4OFH A;  1KG4 A;  2NOZ A;  4AI5 A;  1LWY A;  1PVS A;  1ORP A;  1N3C A;  4YOQ A;  4EJZ A;  4EJY A;  2NOB A;  1XQO A;  1KG6 A;  4E9H A;  1NGN A;  4YPH A;  3G0Q A;  3CWT A;  3N5N X;  1MUD A;  4E9E A;  1PU6 A;  4E9G A;  5KN8 A;  4DK9 A;  3CWS A;  1KG3 A;  3FHG A;  3CWA A;  3OH6 A;  1VRL A;  4B21 A;  1M3Q A;  1P59 A;  5KN9 A;  3CW7 A;  4B24 A;  1XQP A;  2NOL A;  2OFI A;  3IHO A;  1M3H A;  4B23 A;  3CVT A;  4EW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...