4AIAA

The structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
188
structure length
188
Chain Sequence
GAMNECAFGTKDPVYLNYHDHVWGQPLYDSKALFKLLALESQHAGLSWLTILKKKEAYEEAFYDFEPEKVAQMTAQDIDRLMTFPNIVHHRKKLEAIVNQAQGYLKIEQAYGSFSKFLWSYVNGKPKDLQYEHASDRITVDDTATQLSKDLKQYGFKFLGPVTVFSFLEAAGLYDAHLKDCPSKPKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Model for 3-Methyladenine Recognition by 3-Methyladenine DNA Glycosylase I (Tag) from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords DNA-3-METHYLADENINE GLYCOSYLASE I
total genus 77
structure length 188
sequence length 188
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2012-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4aiaA00
3OH6A 4YOQA 4B21A 1P7MA 1MUYA 2OFIA 3N0UA 1HU0A 4E9HA 4B22A 4YPHA 1PU8A 1KG4A 1PU7A 1KEAA 1DIZA 1P59A 1WEIA 1WEGA 1MUDA 3CW7A 2NOIA 1VRLA 4UOBA 4E9EA 1WEFA 2NOZA 1ORPA 1KG5A 3CWAA 4AI4A 4EA5A 1N3AA 3S6IA 3FSPA 4EVVA 3IH7A 1LWWA 2JHJA 1PVSA 2XHIA 1KG3A 4EJYA 1NKUA 3F0ZA 1LWYA 4AI5A 3I0XA 1MPGA 4DK9A 1KO9A 1RRQA 3CVTA 2NOLA 1YQLA 1N3CA 2OFKA 1YQMA 3IHOA 5CHZA 1KG2A 2JG6A 2JHNA 3FHGA 2ABKA 2YG9A 1YQRA 1N39A 3OH9A 1MUNA 4OFEA 3I0WA 3G0QA 3FHFA 4AIAA 2I5WA 4B24A 4EJZA 1M3HA 4OFAA 4EW4A 1LMZA 1PU6A 1XG7A 1LWVA 3OGDA 4E9FA 3KNTA 1NGNA 1YQKA 1XQOA 4EA4A 4OFHA 3CWTA 1EBMA 5KN9A 3D4VA 1ORNA 1XQPA 2H56A 2NOHA 4EW0A 3F10A 4UNFA 5AN4A 1FN7A 4YPRA 5DPKA 3CWSA 4HSBA 3N5NX 5KN8A 3CVSA 3CWUA 4PIIA 2NOEA 2NOFA 2YG8A 2NOBA 1RRSA 3KTUA 4B23A 1KG6A 1KG7A 4E9GA 1KQJA 1M3QA
chains in the Genus database with same CATH superfamily
3OH6A 4YOQA 3S3NA 4B21A 1P7MA 1MUYA 2OFIA 3N0UA 3OYMA 1HU0A 4E9HA 5FRNA 3OY9A 4B22A 3L2VA 3OYDA 2JPSA 4YPHA 3OYEA 3L2UA 1PU8A 1KG4A 1PU7A 3OS0A 1KEAA 1DIZA 1P59A 1U84A 1WEIA 1WEGA 4BDZA 1MUDA 3CW7A 2NOIA 1VRLA 4UOBA 4E9EA 1WEFA 2NOZA 1ORPA 1KG5A 3CWAA 4AI4A 4BE1A 3OYGA 4EA5A 1N3AA 3S6IA 4NZGA 2V75A 3OYJA 3FSPA 4EVVA 3IH7A 4BE2A 1LWWA 3OYAA 2JHJA 1PVSA 4ZTFA 2XHIA 1KG3A 2W04A 3L2QA 4EJYA 4E7IA 1NKUA 3F0ZA 3OYIA 1LWYA 4IKFA 3R2XC 4AI5A 3I0XA 1MPGA 3OYHA 4DK9A 1KO9A 3VW4A 1RRQA 3CVTA 2NOLA 1YQLA 4E7KA 1N3CA 3OYCA 2OFKA 1YQMA 3IHOA 3OYLA 3S3MA 5CHZA 1KG2A 4ZTJA 2JG6A 2JHNA 3FHGA 2ABKA 2YG9A 1YQRA 1N39A 3OH9A 1MUNA 3OYBA 3LCNA 4OFEA 3I0WA 3G0QA 3FHFA 4AIAA 3OYKA 4B24A 2I5WA 4EJZA 1M3HA 5FRMA 3NNQA 3S3OA 4OFAA 4EW4A 1LMZA 1PU6A 1XG7A 3OYNA 1LWVA 3OYFA 3OGDA 4E9FA 3KNTA 1NGNA 1YQKA 1XQOA 4EA4A 4E7HA 4OFHA 3CWTA 1EBMA 4BDYA 3L2RA 5KN9A 3D4VA 1ORNA 1XQPA 5FROA 4E7JA 2H56A 2NOHA 4BE0A 3F10A 4UNFA 4EW0A 5AN4A 3OS1A 3L2WA 1FN7A 4YPRA 5DPKA 3CWSA 4HSBA 3N5NX 5KN8A 3CVSA 4BACA 3CWUA 4PIIA 2NOEA 2NOFA 2YG8A 4E7LA 1RRSA 2NOBA 3OS2A 3KTUA 4B23A 1KG6A 1KG7A 4E9GA 1KQJA 2W03A 1M3QA
chains in the Genus database with same CATH topology
3OH6A 4YOQA 4B21A 1P7MA 1MUYA 2OFIA 3N0UA 1HU0A 4E9HA 4B22A 4YPHA 1PU8A 1KG4A 1PU7A 1KEAA 1DIZA 1P59A 1WEIA 1WEGA 1MUDA 3CW7A 2NOIA 1VRLA 4UOBA 4E9EA 1WEFA 2NOZA 1ORPA 1KG5A 3CWAA 4AI4A 4EA5A 1N3AA 3S6IA 3FSPA 4EVVA 3IH7A 1LWWA 2JHJA 1PVSA 2XHIA 1KG3A 4EJYA 1NKUA 3F0ZA 1LWYA 4AI5A 3I0XA 1MPGA 4DK9A 1KO9A 1RRQA 3CVTA 2NOLA 1YQLA 1N3CA 2OFKA 1YQMA 3IHOA 5CHZA 1KG2A 2JG6A 2JHNA 3FHGA 2ABKA 2YG9A 1YQRA 1N39A 3OH9A 1MUNA 4OFEA 3I0WA 3G0QA 3FHFA 4AIAA 2I5WA 4B24A 4EJZA 1M3HA 4OFAA 4EW4A 1LMZA 1PU6A 1XG7A 1LWVA 3OGDA 4E9FA 3KNTA 1NGNA 1YQKA 1XQOA 4EA4A 4OFHA 3CWTA 1EBMA 5KN9A 3D4VA 1ORNA 1XQPA 2H56A 2NOHA 4EW0A 3F10A 4UNFA 5AN4A 1FN7A 4YPRA 5DPKA 3CWSA 4HSBA 3N5NX 5KN8A 3CVSA 3CWUA 4PIIA 2NOEA 2NOFA 2YG8A 2NOBA 1RRSA 3KTUA 4B23A 1KG6A 1KG7A 4E9GA 1KQJA 1M3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OH6 A;  4YOQ A;  4B21 A;  1P7M A;  1MUY A;  2OFI A;  3N0U A;  1HU0 A;  4E9H A;  4B22 A;  4YPH A;  1PU8 A;  1KG4 A;  1PU7 A;  1KEA A;  1DIZ A;  1P59 A;  1WEI A;  1WEG A;  1MUD A;  3CW7 A;  2NOI A;  1VRL A;  4UOB A;  4E9E A;  1WEF A;  2NOZ A;  1ORP A;  1KG5 A;  3CWA A;  4AI4 A;  4EA5 A;  1N3A A;  3S6I A;  3FSP A;  4EVV A;  3IH7 A;  1LWW A;  2JHJ A;  1PVS A;  2XHI A;  1KG3 A;  4EJY A;  1NKU A;  3F0Z A;  1LWY A;  4AI5 A;  3I0X A;  1MPG A;  4DK9 A;  1KO9 A;  1RRQ A;  3CVT A;  2NOL A;  1YQL A;  1N3C A;  2OFK A;  1YQM A;  3IHO A;  5CHZ A;  1KG2 A;  2JG6 A;  2JHN A;  3FHG A;  2ABK A;  2YG9 A;  1YQR A;  1N39 A;  3OH9 A;  1MUN A;  4OFE A;  3I0W A;  3G0Q A;  3FHF A;  4AIA A;  2I5W A;  4B24 A;  4EJZ A;  1M3H A;  4OFA A;  4EW4 A;  1LMZ A;  1PU6 A;  1XG7 A;  1LWV A;  3OGD A;  4E9F A;  3KNT A;  1NGN A;  1YQK A;  1XQO A;  4EA4 A;  4OFH A;  3CWT A;  1EBM A;  5KN9 A;  3D4V A;  1ORN A;  1XQP A;  2H56 A;  2NOH A;  4EW0 A;  3F10 A;  4UNF A;  5AN4 A;  1FN7 A;  4YPR A;  5DPK A;  3CWS A;  4HSB A;  3N5N X;  5KN8 A;  3CVS A;  3CWU A;  4PII A;  2NOE A;  2NOF A;  2YG8 A;  2NOB A;  1RRS A;  3KTU A;  4B23 A;  1KG6 A;  1KG7 A;  4E9G A;  1KQJ A;  1M3Q A; 
#chains in the Genus database with same CATH topology
 3OH6 A;  4YOQ A;  3S3N A;  4B21 A;  1P7M A;  1MUY A;  2OFI A;  3N0U A;  3OYM A;  1HU0 A;  4E9H A;  5FRN A;  3OY9 A;  4B22 A;  3L2V A;  3OYD A;  2JPS A;  4YPH A;  3OYE A;  3L2U A;  1PU8 A;  1KG4 A;  1PU7 A;  3OS0 A;  1KEA A;  1DIZ A;  1P59 A;  1U84 A;  1WEI A;  1WEG A;  4BDZ A;  1MUD A;  3CW7 A;  2NOI A;  1VRL A;  4UOB A;  4E9E A;  1WEF A;  2NOZ A;  1ORP A;  1KG5 A;  3CWA A;  4AI4 A;  4BE1 A;  3OYG A;  4EA5 A;  1N3A A;  3S6I A;  4NZG A;  2V75 A;  3OYJ A;  3FSP A;  4EVV A;  3IH7 A;  4BE2 A;  1LWW A;  3OYA A;  2JHJ A;  1PVS A;  4ZTF A;  2XHI A;  1KG3 A;  2W04 A;  3L2Q A;  4EJY A;  4E7I A;  1NKU A;  3F0Z A;  3OYI A;  1LWY A;  4IKF A;  3R2X C;  4AI5 A;  3I0X A;  1MPG A;  3OYH A;  4DK9 A;  1KO9 A;  3VW4 A;  1RRQ A;  3CVT A;  2NOL A;  1YQL A;  4E7K A;  1N3C A;  3OYC A;  2OFK A;  1YQM A;  3IHO A;  3OYL A;  3S3M A;  5CHZ A;  1KG2 A;  4ZTJ A;  2JG6 A;  2JHN A;  3FHG A;  2ABK A;  2YG9 A;  1YQR A;  1N39 A;  3OH9 A;  1MUN A;  3OYB A;  3LCN A;  4OFE A;  3I0W A;  3G0Q A;  3FHF A;  4AIA A;  3OYK A;  4B24 A;  2I5W A;  4EJZ A;  1M3H A;  5FRM A;  3NNQ A;  3S3O A;  4OFA A;  4EW4 A;  1LMZ A;  1PU6 A;  1XG7 A;  3OYN A;  1LWV A;  3OYF A;  3OGD A;  4E9F A;  3KNT A;  1NGN A;  1YQK A;  1XQO A;  4EA4 A;  4E7H A;  4OFH A;  3CWT A;  1EBM A;  4BDY A;  3L2R A;  5KN9 A;  3D4V A;  1ORN A;  1XQP A;  5FRO A;  4E7J A;  2H56 A;  2NOH A;  4BE0 A;  3F10 A;  4UNF A;  4EW0 A;  5AN4 A;  3OS1 A;  3L2W A;  1FN7 A;  4YPR A;  5DPK A;  3CWS A;  4HSB A;  3N5N X;  5KN8 A;  3CVS A;  4BAC A;  3CWU A;  4PII A;  2NOE A;  2NOF A;  2YG8 A;  4E7L A;  1RRS A;  2NOB A;  3OS2 A;  3KTU A;  4B23 A;  1KG6 A;  1KG7 A;  4E9G A;  1KQJ A;  2W03 A;  1M3Q A; 
#chains in the Genus database with same CATH homology
 3OH6 A;  4YOQ A;  4B21 A;  1P7M A;  1MUY A;  2OFI A;  3N0U A;  1HU0 A;  4E9H A;  4B22 A;  4YPH A;  1PU8 A;  1KG4 A;  1PU7 A;  1KEA A;  1DIZ A;  1P59 A;  1WEI A;  1WEG A;  1MUD A;  3CW7 A;  2NOI A;  1VRL A;  4UOB A;  4E9E A;  1WEF A;  2NOZ A;  1ORP A;  1KG5 A;  3CWA A;  4AI4 A;  4EA5 A;  1N3A A;  3S6I A;  3FSP A;  4EVV A;  3IH7 A;  1LWW A;  2JHJ A;  1PVS A;  2XHI A;  1KG3 A;  4EJY A;  1NKU A;  3F0Z A;  1LWY A;  4AI5 A;  3I0X A;  1MPG A;  4DK9 A;  1KO9 A;  1RRQ A;  3CVT A;  2NOL A;  1YQL A;  1N3C A;  2OFK A;  1YQM A;  3IHO A;  5CHZ A;  1KG2 A;  2JG6 A;  2JHN A;  3FHG A;  2ABK A;  2YG9 A;  1YQR A;  1N39 A;  3OH9 A;  1MUN A;  4OFE A;  3I0W A;  3G0Q A;  3FHF A;  4AIA A;  2I5W A;  4B24 A;  4EJZ A;  1M3H A;  4OFA A;  4EW4 A;  1LMZ A;  1PU6 A;  1XG7 A;  1LWV A;  3OGD A;  4E9F A;  3KNT A;  1NGN A;  1YQK A;  1XQO A;  4EA4 A;  4OFH A;  3CWT A;  1EBM A;  5KN9 A;  3D4V A;  1ORN A;  1XQP A;  2H56 A;  2NOH A;  4EW0 A;  3F10 A;  4UNF A;  5AN4 A;  1FN7 A;  4YPR A;  5DPK A;  3CWS A;  4HSB A;  3N5N X;  5KN8 A;  3CVS A;  3CWU A;  4PII A;  2NOE A;  2NOF A;  2YG8 A;  2NOB A;  1RRS A;  3KTU A;  4B23 A;  1KG6 A;  1KG7 A;  4E9G A;  1KQJ A;  1M3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...