1P7MA

Solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine dna glycosylase i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
187
structure length
187
Chain Sequence
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFVNHQPQMTQATTLSEIPTSTPASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCCCYPGNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase I
publication title Solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine DNA glycosylase I
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 50
structure length 187
sequence length 187
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2003-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03352 Adenine_glyco Methyladenine glycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1p7mA00
4OFHA 4UNFA 2OFIA 4B21A 1M3QA 1ORNA 3CW7A 1WEFA 3FSPA 1LWWA 1VRLA 4EA5A 1XG7A 2XHIA 4AI4A 1RRQA 1YQLA 4HSBA 2I5WA 4E9HA 1MUNA 1M3HA 4EW0A 1P59A 1FN7A 3IH7A 1XQOA 3CVTA 2NOHA 1NGNA 1PU6A 3CWUA 1WEIA 1LWVA 2H56A 3I0XA 5DPKA 3KNTA 4B22A 1MUYA 4OFAA 2JHNA 3OH9A 1PU8A 4YOQA 1KG6A 3N0UA 3CVSA 1MPGA 4AIAA 1LMZA 2ABKA 1KQJA 1PU7A 4PIIA 1ORPA 2JG6A 3N5NX 2NOFA 1NKUA 1HU0A 3I0WA 3FHGA 1KEAA 1KG2A 3G0QA 3IHOA 4AI5A 3OGDA 3CWTA 4E9GA 1RRSA 5AN4A 2OFKA 1YQRA 2NOIA 2NOBA 2NOLA 4YPRA 1YQKA 1KG3A 2YG8A 1N3AA 4DK9A 4B23A 2NOZA 3F0ZA 3OH6A 1N3CA 2YG9A 4EJZA 1N39A 1PVSA 3CWSA 4EVVA 1KO9A 4E9EA 1DIZA 4YPHA 4B24A 1KG5A 1YQMA 5KN8A 3D4VA 3S6IA 1P7MA 4OFEA 1EBMA 3KTUA 3F10A 4E9FA 5KN9A 3FHFA 5CHZA 1LWYA 1KG4A 3CWAA 1MUDA 1WEGA 2NOEA 1XQPA 4UOBA 4EW4A 1KG7A 4EA4A 2JHJA 4EJYA
chains in the Genus database with same CATH superfamily
3R2XC 5FROA 4OFHA 3OYGA 4UNFA 2OFIA 3OS0A 4B21A 4E7KA 1M3QA 3OYHA 1ORNA 3CW7A 3OY9A 3L2WA 1WEFA 3OYCA 3FSPA 4BE1A 1LWWA 1VRLA 4EA5A 4ZTJA 1XG7A 2XHIA 4AI4A 3OYMA 3OYBA 1RRQA 1YQLA 4HSBA 2I5WA 4E9HA 1MUNA 1M3HA 4E7JA 4EW0A 4BDZA 3NNQA 1P59A 3IH7A 1FN7A 1XQOA 3CVTA 2NOHA 2V75A 1NGNA 1PU6A 3CWUA 1WEIA 1LWVA 3OYNA 3L2UA 2JPSA 2H56A 3I0XA 5DPKA 3KNTA 4B22A 1MUYA 4OFAA 2JHNA 3OH9A 1PU8A 2W03A 4YOQA 1KG6A 3OYIA 3N0UA 3CVSA 1MPGA 4AIAA 4E7IA 1LMZA 2ABKA 1KQJA 1PU7A 4PIIA 1ORPA 2JG6A 3L2QA 3N5NX 2NOFA 3S3OA 1NKUA 1HU0A 4E7HA 3I0WA 3FHGA 1KEAA 4ZTFA 3VW4A 3OS1A 3OYFA 1KG2A 3G0QA 4E7LA 3IHOA 3OYJA 4AI5A 3OGDA 3L2RA 4BE0A 3OYAA 4E9GA 1RRSA 5AN4A 3CWTA 2OFKA 1YQRA 2NOIA 4BE2A 2NOBA 2NOLA 3S3NA 2W04A 4YPRA 1YQKA 4NZGA 1KG3A 2YG8A 1N3AA 4DK9A 4B23A 1U84A 2NOZA 4BDYA 3F0ZA 4IKFA 3LCNA 3S3MA 3OH6A 1N3CA 2YG9A 3OYLA 4EJZA 1N39A 3OYKA 1PVSA 3CWSA 3OYEA 5FRMA 4EVVA 1KO9A 4E9EA 1DIZA 4YPHA 4B24A 1KG5A 1YQMA 5KN8A 3D4VA 3S6IA 1P7MA 5FRNA 4OFEA 1EBMA 3KTUA 3F10A 4E9FA 5KN9A 3FHFA 5CHZA 4BACA 1LWYA 1KG4A 3CWAA 1MUDA 1WEGA 2NOEA 3L2VA 1XQPA 4UOBA 3OYDA 1KG7A 4EW4A 4EA4A 2JHJA 4EJYA 3OS2A
chains in the Genus database with same CATH topology
4OFHA 4UNFA 2OFIA 4B21A 1M3QA 1ORNA 3CW7A 1WEFA 3FSPA 1LWWA 1VRLA 4EA5A 1XG7A 2XHIA 4AI4A 1RRQA 1YQLA 4HSBA 2I5WA 4E9HA 1MUNA 1M3HA 4EW0A 1P59A 1FN7A 3IH7A 1XQOA 3CVTA 2NOHA 1NGNA 1PU6A 3CWUA 1WEIA 1LWVA 2H56A 3I0XA 5DPKA 3KNTA 4B22A 1MUYA 4OFAA 2JHNA 3OH9A 1PU8A 4YOQA 1KG6A 3N0UA 3CVSA 1MPGA 4AIAA 1LMZA 2ABKA 1KQJA 1PU7A 4PIIA 1ORPA 2JG6A 3N5NX 2NOFA 1NKUA 1HU0A 3I0WA 3FHGA 1KEAA 1KG2A 3G0QA 3IHOA 4AI5A 3OGDA 3CWTA 4E9GA 1RRSA 5AN4A 2OFKA 1YQRA 2NOIA 2NOBA 2NOLA 4YPRA 1YQKA 1KG3A 2YG8A 1N3AA 4DK9A 4B23A 2NOZA 3F0ZA 3OH6A 1N3CA 2YG9A 4EJZA 1N39A 1PVSA 3CWSA 4EVVA 1KO9A 4E9EA 1DIZA 4YPHA 4B24A 1KG5A 1YQMA 5KN8A 3D4VA 3S6IA 1P7MA 4OFEA 1EBMA 3KTUA 3F10A 4E9FA 5KN9A 3FHFA 5CHZA 1LWYA 1KG4A 3CWAA 1MUDA 1WEGA 2NOEA 1XQPA 4UOBA 4EW4A 1KG7A 4EA4A 2JHJA 4EJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OFH A;  4UNF A;  2OFI A;  4B21 A;  1M3Q A;  1ORN A;  3CW7 A;  1WEF A;  3FSP A;  1LWW A;  1VRL A;  4EA5 A;  1XG7 A;  2XHI A;  4AI4 A;  1RRQ A;  1YQL A;  4HSB A;  2I5W A;  4E9H A;  1MUN A;  1M3H A;  4EW0 A;  1P59 A;  1FN7 A;  3IH7 A;  1XQO A;  3CVT A;  2NOH A;  1NGN A;  1PU6 A;  3CWU A;  1WEI A;  1LWV A;  2H56 A;  3I0X A;  5DPK A;  3KNT A;  4B22 A;  1MUY A;  4OFA A;  2JHN A;  3OH9 A;  1PU8 A;  4YOQ A;  1KG6 A;  3N0U A;  3CVS A;  1MPG A;  4AIA A;  1LMZ A;  2ABK A;  1KQJ A;  1PU7 A;  4PII A;  1ORP A;  2JG6 A;  3N5N X;  2NOF A;  1NKU A;  1HU0 A;  3I0W A;  3FHG A;  1KEA A;  1KG2 A;  3G0Q A;  3IHO A;  4AI5 A;  3OGD A;  3CWT A;  4E9G A;  1RRS A;  5AN4 A;  2OFK A;  1YQR A;  2NOI A;  2NOB A;  2NOL A;  4YPR A;  1YQK A;  1KG3 A;  2YG8 A;  1N3A A;  4DK9 A;  4B23 A;  2NOZ A;  3F0Z A;  3OH6 A;  1N3C A;  2YG9 A;  4EJZ A;  1N39 A;  1PVS A;  3CWS A;  4EVV A;  1KO9 A;  4E9E A;  1DIZ A;  4YPH A;  4B24 A;  1KG5 A;  1YQM A;  5KN8 A;  3D4V A;  3S6I A;  1P7M A;  4OFE A;  1EBM A;  3KTU A;  3F10 A;  4E9F A;  5KN9 A;  3FHF A;  5CHZ A;  1LWY A;  1KG4 A;  3CWA A;  1MUD A;  1WEG A;  2NOE A;  1XQP A;  4UOB A;  4EW4 A;  1KG7 A;  4EA4 A;  2JHJ A;  4EJY A; 
#chains in the Genus database with same CATH topology
 3R2X C;  5FRO A;  4OFH A;  3OYG A;  4UNF A;  2OFI A;  3OS0 A;  4B21 A;  4E7K A;  1M3Q A;  3OYH A;  1ORN A;  3CW7 A;  3OY9 A;  3L2W A;  1WEF A;  3OYC A;  3FSP A;  4BE1 A;  1LWW A;  1VRL A;  4EA5 A;  4ZTJ A;  1XG7 A;  2XHI A;  4AI4 A;  3OYM A;  3OYB A;  1RRQ A;  1YQL A;  4HSB A;  2I5W A;  4E9H A;  1MUN A;  1M3H A;  4E7J A;  4EW0 A;  4BDZ A;  3NNQ A;  1P59 A;  3IH7 A;  1FN7 A;  1XQO A;  3CVT A;  2NOH A;  2V75 A;  1NGN A;  1PU6 A;  3CWU A;  1WEI A;  1LWV A;  3OYN A;  3L2U A;  2JPS A;  2H56 A;  3I0X A;  5DPK A;  3KNT A;  4B22 A;  1MUY A;  4OFA A;  2JHN A;  3OH9 A;  1PU8 A;  2W03 A;  4YOQ A;  1KG6 A;  3OYI A;  3N0U A;  3CVS A;  1MPG A;  4AIA A;  4E7I A;  1LMZ A;  2ABK A;  1KQJ A;  1PU7 A;  4PII A;  1ORP A;  2JG6 A;  3L2Q A;  3N5N X;  2NOF A;  3S3O A;  1NKU A;  1HU0 A;  4E7H A;  3I0W A;  3FHG A;  1KEA A;  4ZTF A;  3VW4 A;  3OS1 A;  3OYF A;  1KG2 A;  3G0Q A;  4E7L A;  3IHO A;  3OYJ A;  4AI5 A;  3OGD A;  3L2R A;  4BE0 A;  3OYA A;  4E9G A;  1RRS A;  5AN4 A;  3CWT A;  2OFK A;  1YQR A;  2NOI A;  4BE2 A;  2NOB A;  2NOL A;  3S3N A;  2W04 A;  4YPR A;  1YQK A;  4NZG A;  1KG3 A;  2YG8 A;  1N3A A;  4DK9 A;  4B23 A;  1U84 A;  2NOZ A;  4BDY A;  3F0Z A;  4IKF A;  3LCN A;  3S3M A;  3OH6 A;  1N3C A;  2YG9 A;  3OYL A;  4EJZ A;  1N39 A;  3OYK A;  1PVS A;  3CWS A;  3OYE A;  5FRM A;  4EVV A;  1KO9 A;  4E9E A;  1DIZ A;  4YPH A;  4B24 A;  1KG5 A;  1YQM A;  5KN8 A;  3D4V A;  3S6I A;  1P7M A;  5FRN A;  4OFE A;  1EBM A;  3KTU A;  3F10 A;  4E9F A;  5KN9 A;  3FHF A;  5CHZ A;  4BAC A;  1LWY A;  1KG4 A;  3CWA A;  1MUD A;  1WEG A;  2NOE A;  3L2V A;  1XQP A;  4UOB A;  3OYD A;  1KG7 A;  4EW4 A;  4EA4 A;  2JHJ A;  4EJY A;  3OS2 A; 
#chains in the Genus database with same CATH homology
 4OFH A;  4UNF A;  2OFI A;  4B21 A;  1M3Q A;  1ORN A;  3CW7 A;  1WEF A;  3FSP A;  1LWW A;  1VRL A;  4EA5 A;  1XG7 A;  2XHI A;  4AI4 A;  1RRQ A;  1YQL A;  4HSB A;  2I5W A;  4E9H A;  1MUN A;  1M3H A;  4EW0 A;  1P59 A;  1FN7 A;  3IH7 A;  1XQO A;  3CVT A;  2NOH A;  1NGN A;  1PU6 A;  3CWU A;  1WEI A;  1LWV A;  2H56 A;  3I0X A;  5DPK A;  3KNT A;  4B22 A;  1MUY A;  4OFA A;  2JHN A;  3OH9 A;  1PU8 A;  4YOQ A;  1KG6 A;  3N0U A;  3CVS A;  1MPG A;  4AIA A;  1LMZ A;  2ABK A;  1KQJ A;  1PU7 A;  4PII A;  1ORP A;  2JG6 A;  3N5N X;  2NOF A;  1NKU A;  1HU0 A;  3I0W A;  3FHG A;  1KEA A;  1KG2 A;  3G0Q A;  3IHO A;  4AI5 A;  3OGD A;  3CWT A;  4E9G A;  1RRS A;  5AN4 A;  2OFK A;  1YQR A;  2NOI A;  2NOB A;  2NOL A;  4YPR A;  1YQK A;  1KG3 A;  2YG8 A;  1N3A A;  4DK9 A;  4B23 A;  2NOZ A;  3F0Z A;  3OH6 A;  1N3C A;  2YG9 A;  4EJZ A;  1N39 A;  1PVS A;  3CWS A;  4EVV A;  1KO9 A;  4E9E A;  1DIZ A;  4YPH A;  4B24 A;  1KG5 A;  1YQM A;  5KN8 A;  3D4V A;  3S6I A;  1P7M A;  4OFE A;  1EBM A;  3KTU A;  3F10 A;  4E9F A;  5KN9 A;  3FHF A;  5CHZ A;  1LWY A;  1KG4 A;  3CWA A;  1MUD A;  1WEG A;  2NOE A;  1XQP A;  4UOB A;  4EW4 A;  1KG7 A;  4EA4 A;  2JHJ A;  4EJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...