1P7MA

Solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine dna glycosylase i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
187
structure length
187
Chain Sequence
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFVNHQPQMTQATTLSEIPTSTPASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCCCYPGNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DNA-3-methyladenine glycosylase I
publication title Solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine DNA glycosylase I
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 187
sequence length 187
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2003-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03352 Adenine_glyco Methyladenine glycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1p7mA00
4EA4A 1EBMA 1KG2A 4DK9A 4E9FA 1MPGA 5DPKA 3CWSA 1WEFA 2NOFA 1PU6A 3OH6A 3I0XA 2JHNA 3G0QA 1LWVA 3F0ZA 4B21A 1N39A 2OFIA 2H56A 1XQPA 2NOHA 4E9GA 4UOBA 4AI5A 5AN4A 4EA5A 4E9EA 3CWTA 1PVSA 1DIZA 1KO9A 1YQKA 1PU7A 1M3QA 4B24A 4OFHA 1KG7A 4AI4A 1NGNA 4EJYA 1RRQA 1KG5A 2YG8A 5KN9A 3CWUA 4EJZA 4B23A 4YOQA 1PU8A 1MUDA 2JG6A 2NOLA 4EVVA 2XHIA 4EW4A 3N0UA 1ORNA 3I0WA 3D4VA 4PIIA 1LWWA 2YG9A 3KNTA 5KN8A 2ABKA 1NKUA 2OFKA 1XQOA 1KQJA 4EW0A 3CVTA 2NOZA 3FHGA 3IH7A 2I5WA 3OGDA 1RRSA 4B22A 1VRLA 3CWAA 1M3HA 1LMZA 1KG6A 4AIAA 4HSBA 4UNFA 1WEIA 3IHOA 2NOBA 2NOEA 3CW7A 1YQMA 3KTUA 1P59A 1P7MA 1WEGA 4OFAA 3FSPA 1HU0A 4YPHA 3FHFA 3N5NX 4OFEA 1KG3A 1N3CA 1LWYA 2JHJA 1YQRA 1MUYA 1XG7A 1ORPA 1KG4A 1KEAA 5CHZA 4YPRA 3F10A 1FN7A 2NOIA 1N3AA 4E9HA 3S6IA 3OH9A 3CVSA 1YQLA 1MUNA
chains in the Genus database with same CATH superfamily
4EA4A 1EBMA 1KG2A 3L2VA 4DK9A 4IKFA 4E9FA 1MPGA 5DPKA 3CWSA 1WEFA 2NOFA 1PU6A 3OH6A 3OYAA 3I0XA 3OYJA 2JHNA 3G0QA 1LWVA 3F0ZA 4BE2A 4B21A 4E7IA 3L2WA 4ZTFA 3L2QA 1N39A 2OFIA 2H56A 1XQPA 3VW4A 2NOHA 4E9GA 4UOBA 4AI5A 5AN4A 4EA5A 3S3NA 4E9EA 3OS2A 3CWTA 1PVSA 1DIZA 1KO9A 1YQKA 1PU7A 1M3QA 4B24A 4OFHA 1KG7A 4AI4A 1NGNA 4BACA 4EJYA 1RRQA 1KG5A 2YG8A 3OS0A 5KN9A 1U84A 3CWUA 4BE0A 4BDZA 4EJZA 4B23A 4YOQA 1PU8A 1MUDA 2JG6A 3OYLA 4EVVA 2NOLA 2XHIA 4EW4A 3N0UA 1ORNA 3I0WA 3D4VA 4E7JA 3OYGA 4PIIA 4BE1A 4BDYA 1LWWA 2YG9A 3OYCA 5KN8A 3KNTA 2ABKA 1NKUA 2OFKA 3L2UA 1XQOA 1KQJA 4EW0A 3CVTA 2NOZA 3FHGA 3IH7A 2I5WA 2JPSA 3OGDA 3LCNA 1RRSA 4B22A 1VRLA 3CWAA 1M3HA 1LMZA 1KG6A 3L2RA 4AIAA 4HSBA 3OYMA 4UNFA 1WEIA 3IHOA 2NOBA 3OYBA 4ZTJA 2NOEA 3CW7A 3S3MA 1YQMA 3KTUA 4E7LA 2V75A 1P59A 1P7MA 1WEGA 4OFAA 3FSPA 3R2XC 1HU0A 4YPHA 3S3OA 3FHFA 5FRNA 3N5NX 3OYDA 4OFEA 1KG3A 1N3CA 5FRMA 1LWYA 2JHJA 4NZGA 3OYNA 1YQRA 1MUYA 1XG7A 2W03A 1ORPA 3OY9A 4E7HA 1KG4A 3OS1A 3OYEA 1KEAA 5CHZA 4YPRA 3F10A 1FN7A 3OYIA 2NOIA 2W04A 3OYKA 5FROA 4E9HA 1N3AA 3S6IA 3OYHA 4E7KA 3OH9A 3CVSA 3NNQA 1YQLA 3OYFA 1MUNA
chains in the Genus database with same CATH topology
4EA4A 1EBMA 1KG2A 4DK9A 4E9FA 1MPGA 5DPKA 3CWSA 1WEFA 2NOFA 1PU6A 3OH6A 3I0XA 2JHNA 3G0QA 1LWVA 3F0ZA 4B21A 1N39A 2OFIA 2H56A 1XQPA 2NOHA 4E9GA 4UOBA 4AI5A 5AN4A 4EA5A 4E9EA 3CWTA 1PVSA 1DIZA 1KO9A 1YQKA 1PU7A 1M3QA 4B24A 4OFHA 1KG7A 4AI4A 1NGNA 4EJYA 1RRQA 1KG5A 2YG8A 5KN9A 3CWUA 4EJZA 4B23A 4YOQA 1PU8A 1MUDA 2JG6A 2NOLA 4EVVA 2XHIA 4EW4A 3N0UA 1ORNA 3I0WA 3D4VA 4PIIA 1LWWA 2YG9A 3KNTA 5KN8A 2ABKA 1NKUA 2OFKA 1XQOA 1KQJA 4EW0A 3CVTA 2NOZA 3FHGA 3IH7A 2I5WA 3OGDA 1RRSA 4B22A 1VRLA 3CWAA 1M3HA 1LMZA 1KG6A 4AIAA 4HSBA 4UNFA 1WEIA 3IHOA 2NOBA 2NOEA 3CW7A 1YQMA 3KTUA 1P59A 1P7MA 1WEGA 4OFAA 3FSPA 1HU0A 4YPHA 3FHFA 3N5NX 4OFEA 1KG3A 1N3CA 1LWYA 2JHJA 1YQRA 1MUYA 1XG7A 1ORPA 1KG4A 1KEAA 5CHZA 4YPRA 3F10A 1FN7A 2NOIA 1N3AA 4E9HA 3S6IA 3OH9A 3CVSA 1YQLA 1MUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EA4 A;  1EBM A;  1KG2 A;  4DK9 A;  4E9F A;  1MPG A;  5DPK A;  3CWS A;  1WEF A;  2NOF A;  1PU6 A;  3OH6 A;  3I0X A;  2JHN A;  3G0Q A;  1LWV A;  3F0Z A;  4B21 A;  1N39 A;  2OFI A;  2H56 A;  1XQP A;  2NOH A;  4E9G A;  4UOB A;  4AI5 A;  5AN4 A;  4EA5 A;  4E9E A;  3CWT A;  1PVS A;  1DIZ A;  1KO9 A;  1YQK A;  1PU7 A;  1M3Q A;  4B24 A;  4OFH A;  1KG7 A;  4AI4 A;  1NGN A;  4EJY A;  1RRQ A;  1KG5 A;  2YG8 A;  5KN9 A;  3CWU A;  4EJZ A;  4B23 A;  4YOQ A;  1PU8 A;  1MUD A;  2JG6 A;  2NOL A;  4EVV A;  2XHI A;  4EW4 A;  3N0U A;  1ORN A;  3I0W A;  3D4V A;  4PII A;  1LWW A;  2YG9 A;  3KNT A;  5KN8 A;  2ABK A;  1NKU A;  2OFK A;  1XQO A;  1KQJ A;  4EW0 A;  3CVT A;  2NOZ A;  3FHG A;  3IH7 A;  2I5W A;  3OGD A;  1RRS A;  4B22 A;  1VRL A;  3CWA A;  1M3H A;  1LMZ A;  1KG6 A;  4AIA A;  4HSB A;  4UNF A;  1WEI A;  3IHO A;  2NOB A;  2NOE A;  3CW7 A;  1YQM A;  3KTU A;  1P59 A;  1P7M A;  1WEG A;  4OFA A;  3FSP A;  1HU0 A;  4YPH A;  3FHF A;  3N5N X;  4OFE A;  1KG3 A;  1N3C A;  1LWY A;  2JHJ A;  1YQR A;  1MUY A;  1XG7 A;  1ORP A;  1KG4 A;  1KEA A;  5CHZ A;  4YPR A;  3F10 A;  1FN7 A;  2NOI A;  1N3A A;  4E9H A;  3S6I A;  3OH9 A;  3CVS A;  1YQL A;  1MUN A; 
#chains in the Genus database with same CATH topology
 4EA4 A;  1EBM A;  1KG2 A;  3L2V A;  4DK9 A;  4IKF A;  4E9F A;  1MPG A;  5DPK A;  3CWS A;  1WEF A;  2NOF A;  1PU6 A;  3OH6 A;  3OYA A;  3I0X A;  3OYJ A;  2JHN A;  3G0Q A;  1LWV A;  3F0Z A;  4BE2 A;  4B21 A;  4E7I A;  3L2W A;  4ZTF A;  3L2Q A;  1N39 A;  2OFI A;  2H56 A;  1XQP A;  3VW4 A;  2NOH A;  4E9G A;  4UOB A;  4AI5 A;  5AN4 A;  4EA5 A;  3S3N A;  4E9E A;  3OS2 A;  3CWT A;  1PVS A;  1DIZ A;  1KO9 A;  1YQK A;  1PU7 A;  1M3Q A;  4B24 A;  4OFH A;  1KG7 A;  4AI4 A;  1NGN A;  4BAC A;  4EJY A;  1RRQ A;  1KG5 A;  2YG8 A;  3OS0 A;  5KN9 A;  1U84 A;  3CWU A;  4BE0 A;  4BDZ A;  4EJZ A;  4B23 A;  4YOQ A;  1PU8 A;  1MUD A;  2JG6 A;  3OYL A;  4EVV A;  2NOL A;  2XHI A;  4EW4 A;  3N0U A;  1ORN A;  3I0W A;  3D4V A;  4E7J A;  3OYG A;  4PII A;  4BE1 A;  4BDY A;  1LWW A;  2YG9 A;  3OYC A;  5KN8 A;  3KNT A;  2ABK A;  1NKU A;  2OFK A;  3L2U A;  1XQO A;  1KQJ A;  4EW0 A;  3CVT A;  2NOZ A;  3FHG A;  3IH7 A;  2I5W A;  2JPS A;  3OGD A;  3LCN A;  1RRS A;  4B22 A;  1VRL A;  3CWA A;  1M3H A;  1LMZ A;  1KG6 A;  3L2R A;  4AIA A;  4HSB A;  3OYM A;  4UNF A;  1WEI A;  3IHO A;  2NOB A;  3OYB A;  4ZTJ A;  2NOE A;  3CW7 A;  3S3M A;  1YQM A;  3KTU A;  4E7L A;  2V75 A;  1P59 A;  1P7M A;  1WEG A;  4OFA A;  3FSP A;  3R2X C;  1HU0 A;  4YPH A;  3S3O A;  3FHF A;  5FRN A;  3N5N X;  3OYD A;  4OFE A;  1KG3 A;  1N3C A;  5FRM A;  1LWY A;  2JHJ A;  4NZG A;  3OYN A;  1YQR A;  1MUY A;  1XG7 A;  2W03 A;  1ORP A;  3OY9 A;  4E7H A;  1KG4 A;  3OS1 A;  3OYE A;  1KEA A;  5CHZ A;  4YPR A;  3F10 A;  1FN7 A;  3OYI A;  2NOI A;  2W04 A;  3OYK A;  5FRO A;  4E9H A;  1N3A A;  3S6I A;  3OYH A;  4E7K A;  3OH9 A;  3CVS A;  3NNQ A;  1YQL A;  3OYF A;  1MUN A; 
#chains in the Genus database with same CATH homology
 4EA4 A;  1EBM A;  1KG2 A;  4DK9 A;  4E9F A;  1MPG A;  5DPK A;  3CWS A;  1WEF A;  2NOF A;  1PU6 A;  3OH6 A;  3I0X A;  2JHN A;  3G0Q A;  1LWV A;  3F0Z A;  4B21 A;  1N39 A;  2OFI A;  2H56 A;  1XQP A;  2NOH A;  4E9G A;  4UOB A;  4AI5 A;  5AN4 A;  4EA5 A;  4E9E A;  3CWT A;  1PVS A;  1DIZ A;  1KO9 A;  1YQK A;  1PU7 A;  1M3Q A;  4B24 A;  4OFH A;  1KG7 A;  4AI4 A;  1NGN A;  4EJY A;  1RRQ A;  1KG5 A;  2YG8 A;  5KN9 A;  3CWU A;  4EJZ A;  4B23 A;  4YOQ A;  1PU8 A;  1MUD A;  2JG6 A;  2NOL A;  4EVV A;  2XHI A;  4EW4 A;  3N0U A;  1ORN A;  3I0W A;  3D4V A;  4PII A;  1LWW A;  2YG9 A;  3KNT A;  5KN8 A;  2ABK A;  1NKU A;  2OFK A;  1XQO A;  1KQJ A;  4EW0 A;  3CVT A;  2NOZ A;  3FHG A;  3IH7 A;  2I5W A;  3OGD A;  1RRS A;  4B22 A;  1VRL A;  3CWA A;  1M3H A;  1LMZ A;  1KG6 A;  4AIA A;  4HSB A;  4UNF A;  1WEI A;  3IHO A;  2NOB A;  2NOE A;  3CW7 A;  1YQM A;  3KTU A;  1P59 A;  1P7M A;  1WEG A;  4OFA A;  3FSP A;  1HU0 A;  4YPH A;  3FHF A;  3N5N X;  4OFE A;  1KG3 A;  1N3C A;  1LWY A;  2JHJ A;  1YQR A;  1MUY A;  1XG7 A;  1ORP A;  1KG4 A;  1KEA A;  5CHZ A;  4YPR A;  3F10 A;  1FN7 A;  2NOI A;  1N3A A;  4E9H A;  3S6I A;  3OH9 A;  3CVS A;  1YQL A;  1MUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...