1P7MA

Solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine dna glycosylase i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
187
structure length
187
Chain Sequence
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFVNHQPQMTQATTLSEIPTSTPASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCCCYPGNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase I
publication title Solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine DNA glycosylase I
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 50
structure length 187
sequence length 187
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2003-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03352 Adenine_glyco Methyladenine glycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1p7mA00
2NOBA 5KN9A 3CWTA 4B22A 1N3CA 3N5NX 1WEGA 3CW7A 1PU7A 2NOLA 2H56A 2OFKA 3CWAA 2NOFA 3IH7A 1ORNA 1NKUA 4AIAA 3CVTA 5KN8A 4B24A 2NOZA 3CWUA 1YQMA 4HSBA 2I5WA 5DPKA 1FN7A 4YPRA 4EVVA 2NOEA 3OGDA 1WEIA 3KTUA 1MUYA 2XHIA 2JHNA 1M3HA 2JG6A 4E9EA 4E9HA 1P7MA 3FSPA 4OFHA 5AN4A 4PIIA 4EW0A 1KO9A 4UNFA 1LWVA 4YPHA 2ABKA 1VRLA 3I0XA 3IHOA 1RRSA 1MUNA 3OH9A 4E9GA 1PU8A 1RRQA 3FHFA 1KG6A 1MUDA 1XG7A 1LWWA 4EW4A 4EA5A 2YG8A 1XQPA 1NGNA 1MPGA 3D4VA 2NOIA 1YQLA 3CWSA 1XQOA 4DK9A 4E9FA 4B23A 1M3QA 4OFAA 1KG5A 1WEFA 3I0WA 3CVSA 4EJYA 1PVSA 3KNTA 1KQJA 1LMZA 5CHZA 4EA4A 2OFIA 1P59A 4AI5A 3OH6A 1ORPA 1KG4A 1HU0A 1DIZA 2JHJA 1KEAA 1KG2A 4YOQA 1KG7A 4OFEA 4UOBA 1YQKA 4EJZA 3N0UA 1N39A 2YG9A 1PU6A 3FHGA 4B21A 4AI4A 1YQRA 2NOHA 1EBMA 1LWYA 3S6IA 3F0ZA 1N3AA 3F10A 1KG3A 3G0QA
chains in the Genus database with same CATH superfamily
3OYEA 3L2UA 2NOBA 5KN9A 3CWTA 4B22A 1N3CA 3OYNA 3R2XC 3N5NX 1WEGA 3CW7A 4E7IA 1PU7A 2NOLA 2H56A 2OFKA 3CWAA 2NOFA 4ZTFA 3IH7A 1ORNA 1NKUA 4AIAA 3CVTA 5KN8A 4B24A 2NOZA 3CWUA 1YQMA 4HSBA 3OYAA 2I5WA 5DPKA 1FN7A 4YPRA 4EVVA 2NOEA 5FRMA 4BDZA 3OGDA 1WEIA 3KTUA 1MUYA 2XHIA 3L2RA 2JHNA 4E7LA 1M3HA 2JG6A 4E9EA 4E9HA 3VW4A 1P7MA 3S3OA 3FSPA 4OFHA 5AN4A 4PIIA 4EW0A 1KO9A 4UNFA 3OS1A 1LWVA 3OYMA 4YPHA 2ABKA 1VRLA 3I0XA 3IHOA 2V75A 1RRSA 3OYJA 1MUNA 3OH9A 4E9GA 1PU8A 1RRQA 3FHFA 1KG6A 1MUDA 1XG7A 5FROA 1LWWA 3OYDA 4EW4A 2JPSA 4EA5A 3L2QA 2YG8A 4BE2A 4BE1A 1XQPA 1NGNA 1MPGA 3D4VA 3S3NA 4IKFA 1YQLA 2NOIA 3CWSA 1XQOA 4DK9A 4BDYA 4E9FA 3OYFA 4B23A 1M3QA 4OFAA 1KG5A 3L2WA 4ZTJA 1WEFA 3OYGA 3I0WA 3CVSA 4E7HA 4BE0A 4EJYA 1PVSA 3KNTA 1KQJA 3L2VA 1LMZA 5CHZA 4EA4A 2OFIA 3OYBA 1P59A 4AI5A 3OH6A 3OYLA 1KG4A 3OY9A 3NNQA 1ORPA 1HU0A 1DIZA 2JHJA 1KEAA 2W04A 1KG2A 2W03A 4YOQA 4E7JA 1U84A 1KG7A 4OFEA 4E7KA 4UOBA 1YQKA 4EJZA 3N0UA 3OS0A 5FRNA 1N39A 4BACA 2YG9A 1PU6A 3FHGA 3OYIA 3LCNA 4B21A 4AI4A 1YQRA 2NOHA 3S3MA 1EBMA 1LWYA 3S6IA 3OYCA 3F0ZA 3OS2A 3OYHA 1N3AA 4NZGA 3F10A 1KG3A 3G0QA 3OYKA
chains in the Genus database with same CATH topology
2NOBA 5KN9A 3CWTA 4B22A 1N3CA 3N5NX 1WEGA 3CW7A 1PU7A 2NOLA 2H56A 2OFKA 3CWAA 2NOFA 3IH7A 1ORNA 1NKUA 4AIAA 3CVTA 5KN8A 4B24A 2NOZA 3CWUA 1YQMA 4HSBA 2I5WA 5DPKA 1FN7A 4YPRA 4EVVA 2NOEA 3OGDA 1WEIA 3KTUA 1MUYA 2XHIA 2JHNA 1M3HA 2JG6A 4E9EA 4E9HA 1P7MA 3FSPA 4OFHA 5AN4A 4PIIA 4EW0A 1KO9A 4UNFA 1LWVA 4YPHA 2ABKA 1VRLA 3I0XA 3IHOA 1RRSA 1MUNA 3OH9A 4E9GA 1PU8A 1RRQA 3FHFA 1KG6A 1MUDA 1XG7A 1LWWA 4EW4A 4EA5A 2YG8A 1XQPA 1NGNA 1MPGA 3D4VA 2NOIA 1YQLA 3CWSA 1XQOA 4DK9A 4E9FA 4B23A 1M3QA 4OFAA 1KG5A 1WEFA 3I0WA 3CVSA 4EJYA 1PVSA 3KNTA 1KQJA 1LMZA 5CHZA 4EA4A 2OFIA 1P59A 4AI5A 3OH6A 1ORPA 1KG4A 1HU0A 1DIZA 2JHJA 1KEAA 1KG2A 4YOQA 1KG7A 4OFEA 4UOBA 1YQKA 4EJZA 3N0UA 1N39A 2YG9A 1PU6A 3FHGA 4B21A 4AI4A 1YQRA 2NOHA 1EBMA 1LWYA 3S6IA 3F0ZA 1N3AA 3F10A 1KG3A 3G0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOB A;  5KN9 A;  3CWT A;  4B22 A;  1N3C A;  3N5N X;  1WEG A;  3CW7 A;  1PU7 A;  2NOL A;  2H56 A;  2OFK A;  3CWA A;  2NOF A;  3IH7 A;  1ORN A;  1NKU A;  4AIA A;  3CVT A;  5KN8 A;  4B24 A;  2NOZ A;  3CWU A;  1YQM A;  4HSB A;  2I5W A;  5DPK A;  1FN7 A;  4YPR A;  4EVV A;  2NOE A;  3OGD A;  1WEI A;  3KTU A;  1MUY A;  2XHI A;  2JHN A;  1M3H A;  2JG6 A;  4E9E A;  4E9H A;  1P7M A;  3FSP A;  4OFH A;  5AN4 A;  4PII A;  4EW0 A;  1KO9 A;  4UNF A;  1LWV A;  4YPH A;  2ABK A;  1VRL A;  3I0X A;  3IHO A;  1RRS A;  1MUN A;  3OH9 A;  4E9G A;  1PU8 A;  1RRQ A;  3FHF A;  1KG6 A;  1MUD A;  1XG7 A;  1LWW A;  4EW4 A;  4EA5 A;  2YG8 A;  1XQP A;  1NGN A;  1MPG A;  3D4V A;  2NOI A;  1YQL A;  3CWS A;  1XQO A;  4DK9 A;  4E9F A;  4B23 A;  1M3Q A;  4OFA A;  1KG5 A;  1WEF A;  3I0W A;  3CVS A;  4EJY A;  1PVS A;  3KNT A;  1KQJ A;  1LMZ A;  5CHZ A;  4EA4 A;  2OFI A;  1P59 A;  4AI5 A;  3OH6 A;  1ORP A;  1KG4 A;  1HU0 A;  1DIZ A;  2JHJ A;  1KEA A;  1KG2 A;  4YOQ A;  1KG7 A;  4OFE A;  4UOB A;  1YQK A;  4EJZ A;  3N0U A;  1N39 A;  2YG9 A;  1PU6 A;  3FHG A;  4B21 A;  4AI4 A;  1YQR A;  2NOH A;  1EBM A;  1LWY A;  3S6I A;  3F0Z A;  1N3A A;  3F10 A;  1KG3 A;  3G0Q A; 
#chains in the Genus database with same CATH topology
 3OYE A;  3L2U A;  2NOB A;  5KN9 A;  3CWT A;  4B22 A;  1N3C A;  3OYN A;  3R2X C;  3N5N X;  1WEG A;  3CW7 A;  4E7I A;  1PU7 A;  2NOL A;  2H56 A;  2OFK A;  3CWA A;  2NOF A;  4ZTF A;  3IH7 A;  1ORN A;  1NKU A;  4AIA A;  3CVT A;  5KN8 A;  4B24 A;  2NOZ A;  3CWU A;  1YQM A;  4HSB A;  3OYA A;  2I5W A;  5DPK A;  1FN7 A;  4YPR A;  4EVV A;  2NOE A;  5FRM A;  4BDZ A;  3OGD A;  1WEI A;  3KTU A;  1MUY A;  2XHI A;  3L2R A;  2JHN A;  4E7L A;  1M3H A;  2JG6 A;  4E9E A;  4E9H A;  3VW4 A;  1P7M A;  3S3O A;  3FSP A;  4OFH A;  5AN4 A;  4PII A;  4EW0 A;  1KO9 A;  4UNF A;  3OS1 A;  1LWV A;  3OYM A;  4YPH A;  2ABK A;  1VRL A;  3I0X A;  3IHO A;  2V75 A;  1RRS A;  3OYJ A;  1MUN A;  3OH9 A;  4E9G A;  1PU8 A;  1RRQ A;  3FHF A;  1KG6 A;  1MUD A;  1XG7 A;  5FRO A;  1LWW A;  3OYD A;  4EW4 A;  2JPS A;  4EA5 A;  3L2Q A;  2YG8 A;  4BE2 A;  4BE1 A;  1XQP A;  1NGN A;  1MPG A;  3D4V A;  3S3N A;  4IKF A;  1YQL A;  2NOI A;  3CWS A;  1XQO A;  4DK9 A;  4BDY A;  4E9F A;  3OYF A;  4B23 A;  1M3Q A;  4OFA A;  1KG5 A;  3L2W A;  4ZTJ A;  1WEF A;  3OYG A;  3I0W A;  3CVS A;  4E7H A;  4BE0 A;  4EJY A;  1PVS A;  3KNT A;  1KQJ A;  3L2V A;  1LMZ A;  5CHZ A;  4EA4 A;  2OFI A;  3OYB A;  1P59 A;  4AI5 A;  3OH6 A;  3OYL A;  1KG4 A;  3OY9 A;  3NNQ A;  1ORP A;  1HU0 A;  1DIZ A;  2JHJ A;  1KEA A;  2W04 A;  1KG2 A;  2W03 A;  4YOQ A;  4E7J A;  1U84 A;  1KG7 A;  4OFE A;  4E7K A;  4UOB A;  1YQK A;  4EJZ A;  3N0U A;  3OS0 A;  5FRN A;  1N39 A;  4BAC A;  2YG9 A;  1PU6 A;  3FHG A;  3OYI A;  3LCN A;  4B21 A;  4AI4 A;  1YQR A;  2NOH A;  3S3M A;  1EBM A;  1LWY A;  3S6I A;  3OYC A;  3F0Z A;  3OS2 A;  3OYH A;  1N3A A;  4NZG A;  3F10 A;  1KG3 A;  3G0Q A;  3OYK A; 
#chains in the Genus database with same CATH homology
 2NOB A;  5KN9 A;  3CWT A;  4B22 A;  1N3C A;  3N5N X;  1WEG A;  3CW7 A;  1PU7 A;  2NOL A;  2H56 A;  2OFK A;  3CWA A;  2NOF A;  3IH7 A;  1ORN A;  1NKU A;  4AIA A;  3CVT A;  5KN8 A;  4B24 A;  2NOZ A;  3CWU A;  1YQM A;  4HSB A;  2I5W A;  5DPK A;  1FN7 A;  4YPR A;  4EVV A;  2NOE A;  3OGD A;  1WEI A;  3KTU A;  1MUY A;  2XHI A;  2JHN A;  1M3H A;  2JG6 A;  4E9E A;  4E9H A;  1P7M A;  3FSP A;  4OFH A;  5AN4 A;  4PII A;  4EW0 A;  1KO9 A;  4UNF A;  1LWV A;  4YPH A;  2ABK A;  1VRL A;  3I0X A;  3IHO A;  1RRS A;  1MUN A;  3OH9 A;  4E9G A;  1PU8 A;  1RRQ A;  3FHF A;  1KG6 A;  1MUD A;  1XG7 A;  1LWW A;  4EW4 A;  4EA5 A;  2YG8 A;  1XQP A;  1NGN A;  1MPG A;  3D4V A;  2NOI A;  1YQL A;  3CWS A;  1XQO A;  4DK9 A;  4E9F A;  4B23 A;  1M3Q A;  4OFA A;  1KG5 A;  1WEF A;  3I0W A;  3CVS A;  4EJY A;  1PVS A;  3KNT A;  1KQJ A;  1LMZ A;  5CHZ A;  4EA4 A;  2OFI A;  1P59 A;  4AI5 A;  3OH6 A;  1ORP A;  1KG4 A;  1HU0 A;  1DIZ A;  2JHJ A;  1KEA A;  1KG2 A;  4YOQ A;  1KG7 A;  4OFE A;  4UOB A;  1YQK A;  4EJZ A;  3N0U A;  1N39 A;  2YG9 A;  1PU6 A;  3FHG A;  4B21 A;  4AI4 A;  1YQR A;  2NOH A;  1EBM A;  1LWY A;  3S6I A;  3F0Z A;  1N3A A;  3F10 A;  1KG3 A;  3G0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...