3L2VA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and mk0518 (raltegravir)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 97
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2vA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2vA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2vA03
1I39A 3T3FA 4R5PA 3HPGA 4KHYA 4ID1A 2FC0A 3HYFA 2EKOA 4IFYA 3QNNA 2PZSA 2YNGA 5E41A 2YKMA 4NZGA 2D9TA 2EQJA 4CK2A 4HTUA 1U49A 4DLEA 4ZTJA 4FLVA 4DSFA 5CIUA 2DIQA 1BI4B 1WSGA 3DRPA 4O0IA 4CK3A 2HHQA 3HT3A 4B9UA 4O5BA 3TAQA 1NK8A 1L5UA 1HQEA 3UIQA 3H6ZA 3KLHA 3ZEHA 1NK9A 1JXBA 2EX3A 2HB5A 4FLUA 4BWMA 3MP8A 3THVA 1X9MA 1TV6A 1ASUA 3S3NA 3ASMA 1ASWA 4X34A 4DSKA 2GV9A 1RTIA 5DMRA 4IUTA 2NLUA 1WSEA 5SZTA 1YTAA 1KLNA 2XRIA 3FLGA 3OA6A 2YV0X 4DF4A 2IAJA 5KI6A 1VSFA 3CFRA 1JLCA 3AVCA 4J2BA 3QKJA 5IN1A 4QQ6A 4CJUA 4M3UA 2RHXA 3IAYA 3NTHA 1BIUA 1O1WA 1TAQA 4AILC 3SUNA 2QK9A 4OLAA 1RDCA 4MQ3A 4WE1A 3VQBA 4M3RA 4CJFA 1NJXA 1S1UA 4CEZA 4B9MA 4FJMA 3MP1A 4E1MA 4ZHRA 3LWLA 1TL1A 1XWLA 3T1AA 3QEXA 3OYGA 4A4FA 5CYMA 4LH5A 3VQCA 4AH9A 3PUFA 4J2AA 4KHWA 1VK0A 3I0SA 1VRUA 4DTUA 4E89A 4N56A 2XDPA 3P8HA 3O4NA 1TKXA 2D0CA 3VQ6A 3B6PA 4QVZA 4B9LA 2KW4A 4B3OA 3NBPA 3D45A 2YHAA 3KK3A 2DIGA 4YNQA 1IH7A 2DFFA 3ULDA 2RHIA 1RT6A 1SV5A 3DLEA 2LRQA 3K2PA 3OB9A 2OPPA 3KK1A 1VSEA 1BQMA 2ZQBA 3OYKA 2XY7A 2RJCA 4B9TA 3NH0A 4FJLA 1KFDA 3QESA 1HPZA 2E4LA 4BE1A 2X78A 4Z4CA 4B8AB 3P1GA 3M8RA 1W9HA 1HMVA 2P51A 3QLHA 4CJSA 4FLYA 1W0HA 3NGIA 2R5AA 3C94A 2IC3A 2LSNA 3HVTA 3D0PA 2KZMA 1BIZA 1KCFA 1F21A 3HPHA 4DQIA 1D8YA 1VSLA 3TAPA 4FJ5A 1NK5A 1HJRA 1RTJA 4NCAA 2FBTA 3T19A 3AV9A 4GMJB 4KFBA 3V9SA 4EP5A 1WAJA 4DU4A 1C1CA 1EKEA 4O44A 2R58A 5KGXA 1X9SA 3TABA 1N6QA 4N76A 1SL1A 3L2RA 2G3RA 3OYDA 3MEEA 3VQDA 3CM6A 4CEQA 3ME9A 3HL8A 4YFUA 4LD0A 3MAQA 1LAVA 3UT1A 5JS1A 1IKVA 1WGSA 1RI0A 4IUPA 4O0JA 4KHSA 3PX0A 1C1BA 4A4EA 3VA0A 3E01A 2YHBA 4PY5A 3NE6A 4DTXA 1TK5A 4FCYA 3QETA 3VQPA 4CF8A 3JSMA 4JRQA 4I2QA 3S3MA 4I2PA 4FJGA 3NDKA 5CYQA 3QEIA 4J2DA 1UOCA 2HNDA 1KFSA 1J53A 2WONA 4DTMA 4L8RB 1WN7A 5FROA 4CEFA 3TAGA 3WNEA 3FC3A 3L3VA 1QTMA 4F4KA 3RMCA 1RNHA 3DYAA 1OYXA 1XNIA 1A5VA 3KKSA 1S1VA 3A2FA 3MEGA 3TAFA 3NTIA 1RBRA 2RO0A 1C0MA 3V6DA 1CXUA 1LV5A 3CYMA 2XY6A 3V4IA 3NH1A 1FK9A 3RMBA 2RKIA 3H08A 4KV8A 4Q5VA 2QKKA 3ZSVA 2D5RA 1HYSA 2HQEA 4BD3A 1RDBA 2RJFA 3M8QA 4W5QA 3TWHA 3PY8A 4FK2A 3O8VA 1TGOA 3OS0A 2FBVA 4C5HA 3IRXA 5C6SA 5JS2A 3LX7A 2IDOA 4CJ5A 2R7YA 3META 2BE2A 5C25A 4DF8A 1KLMA 1QQCA 4JRPA 2I5JA 4IG0A 1HRHA 1I3AA 3LYIA 1U04A 2O4GA 1RDDA 1QE1A 2IG0A 3I0RA 3KKRA 4OKKA 5HBMA 4HCZA 3WNHA 3BDLA 3ZT0A 2RN2A 3LLRA 1JLFA 2MWPA 3V1RA 3OYLA 3VQ8A 3M9QA 3HP6A 1RT5A 1DTTA 5J1EA 4LSLA 3HXMA 2JTFA 4FZZA 3ITHA 2OPRA 4KO0A 4FM0A 1TKTA 1G5VA 4IKFA 3PX6A 3DLBA 3KD5E 4QW2A 1BGXT 2VWKA 3TR8A 3C6TA 4FW2A 4F3OA 1NK4A 3OYHA 5C0MA 3LH0A 4PA1A 4HUEA 2ATQA 4QQDA 5M9OA 2E6LA 3OS2A 3F70A 4GVMA 1KHCA 4BE0A 3LGLA 1LW0A 3TARA 3ZSYA 4UQGA 4M42A 3SQ4A 3SQ0A 5J39A 1QSLA 4F2SA 1MU2A 4DQQA 5KE2A 4NYFA 3LANA 4CJKA 3AVNA 2X6NA 3NH2A 3I8DA 4BDZA 4DS5A 3PFSA 2OA8A 3KLFA 2OZMA 1SKWA 3O3FA 4B9WA 4HCCA 2B6AA 1G15A 2Q3SA 4CF2A 2E6MA 2KQ2A 1U4BA 2AJQA 4W5NA 4OPJA 1BISA 4CGDA 1GOAA 1IO2A 3MECA 4UC4A 4OVLA 3M8SA 3AVLA 4CERA 1XI1A 5D3GA 2X4WA 5KGWA 1T05A 2X4XA 4E7IA 3E9GA 3AO3A 3CFOA 3LGFA 4B9VA 4K8XA 5J2QA 2P1JA 2L89A 1LWEA 5K14A 3FEOA 3NF7A 4O4GA 4CFAA 2HQXA 3HPOA 1SKSA 4QCLA 1KVCA 4IDKA 3SQ1A 1HNIA 4E1NA 1BHLA 4C8KA 3AVBA 2O4XB 4AHSA 1T8EA 2Z1IA 4AHRA 1VSMA 2YRVA 3KLGA 2RI3A 2RHYA 4FW1A 3MEDA 1UA0A 3U3GA 1IKWA 4KREA 1NOZA 2ZD1A 2RHZA 1SSFA 4ZTFA 4ID5A 3SYZA 2HHUA 4CFDA 4CGJA 3U3YA 3OYBA 1UAXA 3WNGA 4AHTA 3LPUA 1KSPA 1CZBA 4H4OA 4OKJA 3BDPA 3P5JA 3Q1JA 1LWFA 3QBYA 3L3UA 1RT7A 1D9FA 3L2VA 1FXXA 1TKZA 3VN5A 3NGYA 1ZYQA 1L3SA 3SCXA 1XHZA 4N41A 4B9XA 3LAMA 4KRFA 4PL6A 1SL2A 1HYVA 3DRRA 3ZCMA 4EP4A 4CHPA 3V9WA 4DQSA 4DSIA 2KZZA 4KB0A 1BI4A 1BCMA 3QJ6A 2YNHA 4C8MA 1C6VA 2P5OA 1Q8IA 1NK6A 1FKOA 3PMTA 3AO4A 5KCHA 3RTVA 3AO1A 3ISNC 1SL0A 4CEAA 2XHBA 5FRNA 1DTQA 3OMGA 4NCGA 2X74A 3VQ9A 4CIFA 2BANA 1NJZA 2BDPA 1JLGA 4ELUA 4DFKA 4CEBA 1L3VA 1S9GA 4E7HA 1JXEA 4CJRA 3HVRA 3SQ2A 1R0AA 3KD1E 3L2QA 1BQNA 1S1TA 1TKDA 4A4GA 4W5OA 2LVMA 4NS5A 4KAZA 2B5JA 4N4HA 4II1A 2KFZA 1JLEA 3H8ZA 3VQ7A 3AO2A 4FJ9A 5DK5A 3V1OA 3HP9A 4FM2A 3TANA 4DG1A 4HCBA 3K57A 2L3RA 3QIPA 3K5LA 5HP1A 2YNFA 2BKDN 1VSIA 3K5NA 3QEVA 4DWIA 4KB1A 1TL3A 4J2EA 3CFPA 4M3XA 4LD6A 3QEPA 3OYIA 2QQSA 2RI5A 2VG5A 3OYFA 2MWOA 3QINA 2HVIA 4KHNA 2VYTA 1RTHA 3MEUA 4IUUA 3G0ZA 3DRSA 3QIOA 4DFJA 3AVFA 4FLTA 1U45A 3SI6A 4OGCA 3KLIA 3GOXA 1NK7A 4HHTA 3DLRA 4RW7A 4F2RA 3FFIA 1J9AA 4N4IA 4CHYA 4CHNA 2OYQA 4FK4A 2GFAA 2G8VA 3L2UA 4OKEA 4CGGA 4LH4A 5C42A 3V1QA 4BE2A 3LZJA 3OYAA 1NKBA 1ITGA 3VQAA 3EY1A 3SJJA 2F8SA 4A4HA 2ZE2A 3AA5X 3JYTA 3TAEA 5HLFA 1CLQA 3ASKA 4W5RA 1N5YA 3AVHA 3RR8A 2OZSA 4Z02A 1IKXA 4JLHA 3VQ4A 1B9DA 3KJVA 3EYZA 1C0UA 3C6UA 4CK1A 4M3WA 4CRIA 4Z4GA 2F5KA 2B4JA 2D0BA 2WOMA 3ZSXA 5I3UA 1T03A 4F8RA 1JL1A 1BCOA 2JLEA 3MXIA 4CJLA 5HRSA 3KTQA 3SV4A 2R57A 4CEEA 2G8HA 4CJTA 3NF9A 1JLAA 1CXQA 1S1XA 1GOBA 3PO4A 2ETJA 4Q0BA 1TAUA 4OGEA 2DY4A 2M1HA 3L42A 3BGRA 3FDRA 3KK2A 3UWNA 2L8DA 3CEYA 3OS1A 5SWMA 4HUGA 3QERA 4KTQA 3DOLA 2EQMA 4AHVA 2IGIA 4N47A 3ZT1A 3SZ2A 2K3XA 4ELTA 1L3TA 4DTSA 4EDUA 2VG6A 1WJSA 4CHOA 1TK8A 1J5OA 1WSFA 1Z25A 4Z4IA 4FLXA 1NKCA 3AO5A 1CZ9A 1Z26A 4KPYA 5CZ2A 2IS3A 1QHTA 1RDAA 4CGFA 5J2MA 2BUDA 3DLGA 1RT3A 3QO9A 2IOCA 5HRNA 3DLHA 4CIEA 2W42A 4G1QA 4Q5WA 2HW3A 3SUQA 3AVIA 3L2WA 3MP6A 1C0TA 1LWCA 1YTUA 3MXJA 3VQ5A 3ALYA 1NK0A 5FRMA 2F96A 5D6WA 2M16A 3HSTB 4CHQA 1TK0A 3RR7A 1FKPA 3VQQA 3SPYA 1C1AA 2WACA 1EX4A 1ZBUA 5KCOA 1D5AA 3OQ5A 1RBVA 4GW6A 2VG7A 3OYNA 4BACA 3DLKA 3HO1A 1LW2A 3LALA 4N4GA 1JLBA 1RCHA 1TVRA 3G10A 4H8KA 2XO7A 3CQ8A 1Q9YA 4BDPA 5CY4A 4B8CA 1NKEA 2KFNA 1WSIA 1J54A 1EETA 2FHDA 1B92A 2RPIA 4IUQA 4ICLA 4Z0UA 1DLOA 3AA2A 5KRSA 3L8BA 3PO5A 3HJFA 3NF8A 2HHWA 1VSHA 2XK0A 4CF1A 3K59A 3MEAA 4PLLA 3DOKA 3ZT4A 1N27A 1S5JA 3LZIA 1NJYA 4FJHA 3U6FA 4LY7A 4C5GA 4B9NA 2RI2A 3LP0A 4C8LA 4EZ9A 4FJXA 4FJKA 4Z4FA 3DI6A 1KVAA 3ZT2A 2HMIA 4FZXC 4K8ZA 1HQUA 2EFIA 4IBNA 3VQEA 4Z4HA 2GUIA 2R5MA 3K58A 2P0KA 4N5SA 3ZSWA 3F73A 3OJSA 2A1SA 4M3TA 4QOZB 4FYDA 4FLZA 1YVUA 2Z1JA 3OVNA 2X6SA 5KRTA 3TAMA 4CEDA 4KHQA 4O55A 2QKBA 4F3TA 1JLQA 3LDSA 5HRPA 1RBUA 3PNWC 4GY5A 3ZSQA 3ZSRA 2CKKA 1BL3A 4L59A 1HNVA 2RJEA 5IAYA 1WSHA 2HNZA 4M41A 1A5XA 1OZ2A 2PYJA 1WAFA 2ITGA 4AHUA 4DTJA 4OLBA 3QIIA 3SV3A 5J2NA 3AA3A 4HVJA 4H4MA 3P8DA 3KLEA 3O4QA 4TSXA 3LAKA 4FXDA 3NHGA 4DFPA 4KHUA 3F9KA 1KVBA 4Z4EA 3CM5A 4KTZA 4MFBA 3NCIA 2F8TA 4I9QA 3AVAA 1RBSA 2DFHA 4DTPA 4KI4A 2EHGA 4IUVA 4CJPA 4IURA 1S1WA 3AVGA 3ZT3A 3V81A 2RF2A 3RMAA 1U47A 4RW6A 2G8KA 5D6XA 2HHVA 1Q9XA 3O3GA 3QEWA 3PX4A 1QSSA 4RW9A 2X35A 5KTQA 4Y1CA 4RG2A 3IS9A 1U48A 4AHCA 3OJUA 4KKOA 3HM9A 3TI0A 2O4XA 4E7LA 4DMNA 3PV8A 2DFEA 5J26A 3MEVA 1OZ3A 4IFVA 3MXMA 3SNNA 1QSYA 4BDYA 4E7JA 3NNQA 2RHUA 3K5OA 1SUQA 3LP2A 2FBXA 4RW4A 4Y1DA 3OYMA 3NTKA 4DSEA 4C8NA 4LSNA 1NJWA 4C8OA 2RJDA 1L3UA 2KTQA 2JZ2A 3MO8A 3CG7A 2QQRA 3RWUA 3HK2A 2DAQA 3WNFA 4NCBA 4FU6A 5CZ1A 4DQRA 2G8FA 3ZSOA 1WJRA 4OVAA 1S6QA 1RTDA 2BIVA 1LAWA 4QQGA 3AVMA 2Z1GA 5I42A 1X1PA 3V9ZA 3LWMA 4DU3A 2G8WA 3SD4A 2QXFA 3RRGA 1VSKA 4CJEA 3LPTA 3NFAA 4QAGA 4CECA 4B08A 5C24A 4FJ7A 3E9FA 3RMDA 4FL6A 3S3OA 3AVKA 2XY5A 4M3ZA 1VRTA 4E3SA 4DQPA 1H3ZA 4PLIA 4FVMA 4E7KA 3MEWA 1XHXA 4CJ3A 1K6YA 4JS5A 4DTRA 4C5EA 4BWJA 3LP1A 2Z1HA 4CIGA 2EQUA 4IG3A 1RT4A 2A1RA 1NOYA 2P5GA 4FZYA 1A5WA 3M8PA 3OYJA 4W5TA 1UA1A 2GFUA 4CFCA 3ZSZA 4CJQA 1EP4A 1OI1A 2E5QA 1RBTA 4RW8A 4CJVA 1WLJA 3IG1A 3V9UA 3OY9A 2GBZA 1WNSA 3DLMA 4ELVA 4FJ8A 3KIOA 3SUPA 1S6PA 4KTWA 4CESA 4DSLA 1JKHA 4DS4A 3NGZA 1ZBHA 2HHTA 4KI6A 1B9FA 5FDLA 5D6YA 2BGGA 2LTOA 1IKYA 1REVA 3DM2A 4EZ6A 1QS4A 4CEOA 1S9EA 3OYEA 4OJRA 4DFMA 2OPSA 2HHXA 3SPZA 2G8UA 3AA4A 1GOCA 3LP3A 1MHNA 3DB4A 3QNOA 4M45A 4C5IA 4FJNA 4CJWA 3VA3A 5KH6A 5KE3A 3S6WA 1JL2A 1KRPA 4CF0A 5T7BA 4HUFA 1ZBLA 4CCHA 3RRHA 2LCCA 2PQWA 2HHSA 3C4SA 3S9HA 2PY5A 4FJIA 2EQKA 4CFBA 2PYLA 3KUFA 4PQUA 3OMCA 4CGHA 4PUOA 2HNYA 4PWDA 4M3YA 3B6OA 1ZBFA 2X4YA 1UWBA 1WSJA 2FBYA 1RILA 2E6NA 1KTQA 1XC9A 2G8IA 2GF7A 2NUBA 2HVHA 4CGIA 1IG9A 2LDMA 2JGUA 1X9WA 4RG8A 3EZ5A 3SUOA 4DSJA 2YNIA 4DTNA 1HYZA 2XY8A 4FK0A 3OYCA 4I9LA 4B9SA 2DTUA 2YKNA 3EAEA 4I7FA 1D9DA 4OPKA 2O4IA 1Y97A 3NAEA 4FLWA 4DU1A 4JS4A 4DTOA 2D0AA 3V9XA 4CF9A 5HRRA 4CJ4A 4FJJA 3DB3A 4CE9A 4E19A 4XIUA 4FM1A 3AVJA 1ASVA 3NF6A 4CHZA 1SKRA 2OPQA 1RT2A 2Y1IA 2VWJA 1EXQA 2M0OA 3PMIA 1RT1A 1WJQA 1YT3A 4DLGA 2Y1JA 4E0DA 1T7PA 1ZBIA 2B8AA 3P83D 5HROA 3C95A 1VSJA 4NYNA 5EU7A 3DMJA 3O3HA 2K3YA 5J2PA 3K5MA 1VSDA
chains in the Genus database with same CATH superfamily
4B1XB 5HS9A 2PJRB 4ZGEB 5BPIA 1KHIA 4M7DF 2LH9A 3T1HK 2OAZA 4CUGA 1AVZC 4FLVA 2DIQA 1O7FA 3RUXA 4BI4A 1IGUA 4M77C 4O5BA 2V7ZA 1HQEA 2M4KA 1W70A 2P0WA 1RTIA 1SC7A 3J7ZI 3BP8A 3FLGA 3WGGA 4PKCC 3N4PA 5F6FA 3KK7A 1U6ZA 2CGLA 3T1YK 2HBJA 4M3RA 4NXNK 4J6WA 4OB1B 5CHZA 4ZHRA 2ZJQL 4BL0B 3K10A 1GXPA 2QG9B 3VQ6A 4M78F 3H6EA 2CH6A 3F2KA 1YIJN 4XOTA 2L3DA 3RQ4A 4DCHA 4OFHA 1ZHIA 3VS4A 4FLYA 1KC8C 1YUWA 2NRZA 1KCFA 2P6SA 1UB9A 1RTJA 4BG8A 2O8DA 1HKGA 1YITI 2M1BA 2IS4A 5D4RA 3TP3A 2MD5A 2CU7A 4Q5SF 2FE3A 1SL1A 1ZG5A 4PSWA 4OB2B 3L7WA 1MUDA 3GNFB 4PY5A 3CC4A 4UV9A 4F9OA 3JSMA 2COZA 4Y33A 1R36A 3MN7A 2NVUB 3M4OJ 2HYGD 1WN7A 4WX9A 3TSUA 2XICA 2GBYA 2KMTA 2Z99A 1LV5A 3H08A 3DEWA 4Q5VA 4JKHA 2EWNA 4MQVA 1HYSA 3ABMH 1FSHA 3HSBA 1W36D 5JS2A 1WEGA 3JCMJ 3VS3A 1A5JA 3QWYA 1RABB 1RT5A 4LSLA 2CP3A 2ZMEC 5EZHA 3C6TA 5CAIA 3U9DA 2IVPA 2EA2A 4BE0A 2EGEA 3ZSYA 4UQGA 4YTLA 2GWKA 1NG2A 1BI3A 2VASA 2JT1A 1A35A 1G15A 1BISA 4RAFA 4Y13A 2CGKA 1K73C 2OA4A 3LGFA 3HHGA 4IRIA 1AA7A 3S32A 5GANj 3ENOA 5JLWA 2JS0A 3JRZA 4QLCU 3DLLF 1R49A 3FLCO 3S41A 2Q2EA 4HQMA 3VYRB 1JJ2A 4MLHA 4NXMK 3M0UA 1S1NA 4RCBA 2YPRA 3SCXA 2IP2A 1MBKA 1RAGB 3ENBA 4KB0A 1BI4A 1SG5A 1VQ9N 1W7PD 1MDUB 2E71A 2COYA 4CEAA 2P9KA 5HDKA 4CEBA 5TRDA 3L2QA 3CD6I 1BQNA 3JCMh 4A57A 1ZRFA 3AO2A 2JMAA 5GADP 1VOMA 3DKMA 1PUFB 2HVSA 1SFXA 2XAQA 5AIPA 4NBQA 2GXBA 3OYFA 2E1NA 4RTFD 3CCMA 2MG4A 2K40A 1YQAA 4M78G 1HNXK 2I0NA 2OZUA 3J81Z 1T8IA 4E6KG 1K76A 1Y71A 4HW0A 2X6XA 5EX5A 1LCUA 3LZJA 1IW7F 2K5FA 5KYWA 3JSPA 3HOZJ 5IXBA 3RR8A 2OZSA 4YOWA 2A68F 4CK1A 1TUCA 2B4JA 3A8MB 4I6MB 4JD2A 2XGDA 1T08B 1S1XA 3K70D 4H03B 3OS1A 1M2OA 3BG3A 2DQRA 4YIRX 5GAOl 3L09A 2FXAA 3LSGA 4XOPA 4JDSA 1ABOA 2JWKA 2X3WD 4QS9A 1UHCA 1Y1WJ 4Y4RA 3L2WA 3UA7A 2OTLI 1V3FA 1W7PB 1D5AA 2ASOA 1KA8A 4Z0UA 2FHDA 3L8BA 3FXMA 1OISA 3KWIA 1VQMT 4JI7K 3NF8A 3THXB 1ZG1A 4RTWA 4AD9A 2P7VB 2NUTA 4C5GA 2K9SA 4Z4FA 3ID8A 4OAYA 4B24A 3ZT2A 5LJ3f 1RL2A 3ZSWA 2A1SA 3BEXA 2IS1A 4FYDA 3KZIC 2ZJ2A 2MAMA 4H0VB 1DDNA 2Z1DA 1JLQA 2HDWA 1YQKA 1OX8A 1OZ2A 4BRAA 2YS9A 2DVJA 1KG1A 4Z4EA 4KHUA 1D0ZA 1NGGA 3CDLA 2G6FX 2UUAK 2EYQA 1LFUP 2MH9A 1ETWA 3PX4A 5EG2A 1KU9A 2X1EA 2HBPA 4IF4A 4FWPA 5JICA 4DV0K 4ZYGA 4LE9A 1XGSA 1UG2A 2LQNA 5DD4A 2FOKA 3ZMDA 2E41A 3MHXA 4BY1J 4X64K 3EYIA 2JOYA 2CP2A 1WJRA 3ULEA 2DOAA 5D6EA 2EBPA 5FU6B 3H92A 3H3ZA 3LPTA 4PHTX 4B08A 4PLIA 3TQ7P 2BY2A 4C5EA 3ULQB 3VW4A 2ZJRL 4B47A 1A0NB 5LLQA 3M58A 3K1PA 3KZZA 1EP4A 3HPWA 1OI1A 3DFGA 2HMPA 1KONA 3G4SQ 3DLMA 2HS5A 3HFNA 1R1TA 1XSXA 2HHTA 4DR2K 3FGUA 1RKTA 5I2MA 4CZHA 4ZC3A 2O2OA 1MZBA 2XDVA 2RMOA 3FZMA 3ZGKA 4IRGA 4WXDA 3EGDB 1I50J 2X51A 1OPKA 1I5OB 1VQLT 3CC7T 4K42A 1D9DA 4KGXB 2E2QA 5E20A 2I5WA 4CJ4A 1BW5A 3E97A 4DLGA 4DR5K 3GBQA 1T7PA 1ZBIA 2I5UA 5HROA 4M72A 2WWYA 3M57A 5D4SA 3CVTA 2EKOA 2PZSA 4HQEA 2Y9YA 3JCMe 1Q82R 1W2BM 5CIUA 1XOVA 5BN8A 4BQLA 3NMUA 3CPWP 3IH4A 2Y30A 1X9MA 4HWIA 1WSEA 3UKUA 2CUFA 1NJIR 2IAJA 1VYTA 3PIPF 4AILC 1JJ8C 2WV1A 2QQBA 4OLAA 3CCQN 4BHPA 1YHQI 5M3MJ 2MH2A 4Y3OA 1WBBA 5CYMA 1R00A 4DIQA 5KHDA 1NGBA 2DA2A 1NPRA 1ZN2A 2DZCA 3CCLA 4R0KA 1MGQA 3CQTA 4N56A 2BV6A 2YHAA 2E5ZA 1JE8A 2DJZA 3T5XA 5C4XJ 3CCUI 3K2PA 1G59A 3LAJA 1NLPC 4JI6K 1OQYA 2ZQBA 3CJ7A 1M1KR 2EIKH 4M6YA 4M75D 2O8CA 2K9LA 3GO5A 1MMNA 3K69A 5K7ZA 2O8EA 4FJ5A 2LC2A 1PC0A 3M9AA 4O44A 3OIOA 3OYDA 1SD7A 1TG0A 3O9UA 5F0CA 3HHTB 3WU2C 1Q1VA 3AL0B 3FXQA 4FO0A 4BRIA 3JSCA 2VJ5A 1GDTA 3ZQFA 3R0JA 5E26A 4BYYA 2A0FB 5TISC 3TAGA 4A0YA 1QTMA 3H0DA 4L5GA 3QDRB 3JREA 3WXIA 3CF5L 3SEZA 2JHNA 2RKIA 5J47A 2HQEA 2XAHA 1BBYA 3IRXA 2P0PA 3H3UA 3KKRA 2IG0A 2KQRA 4HCZA 5HKCA 1ETOA 2R7OA 3LOCA 2HI3A 2GQQA 4HUEA 5AQKA 3LGLA 1WH7A 3SQ0A 3BG7A 1PSFA 2Q1NA 2FA5A 5LJ5d 4FHTA 3KLFA 2FQ4A 4U7DA 3CCQT 2E6MA 1YHQN 1F9NA 4I98B 5IH2A 5LL6Z 4XLNF 2XAUA 3MN9A 1YWPA 1T05A 1LFBA 1V76A 3I0TA 2KT8A 4GKJK 2HAXA 2OQRA 1KG3A 3DPLC 4LDXA 4AHRA 1RI7A 4C8QB 3KTUA 2GTJA 2OCEA 3J7YP 3O3KA 1Z9ZA 3U3YA 4PJOA 4JZ3A 2F4VK 1R0BG 1UFFA 1NG7A 1VQNN 4DZJA 1ZYQA 1FPQA 5B1AH 3V8JA 4RKUE 4B9XA 3V9WA 3GOIA 4WQ5A 2ESWA 1BCMA 1OH8A 1KQSM 3PMTA 3ABUA 3CCJN 2OC6A 1Z67A 4KBOA 3L4QA 3SAHA 2PLYA 4WQ4C 2D1HA 4YPRA 1S29A 1TKDA 2ZZDA 3C2GA 1V5FA 4II1A 1JCFA 3CCVN 1EH6A 4ZN3A 3DWLE 4KB1A 1U8BA 4LD6A 4PL8A 2L9NA 2ZPIB 2BYVE 1R6RA 4B3SK 3VTIA 3C6AA 3O80A 3AVFA 4FLTA 4ILHA 4JK1X 1VQ7A 3KEQA 4E7SA 4LOCA 5EEAA 2JN0A 1Z21A 3FFIA 2OYQA 5AZJB 3ASOH 4ISGA 4BE2A 1PHTA 3ZXSA 2ZXJA 4OO1J 2W24A 3ASKA 3AVHA 3CVSA 2PUOB 1UG1A 3KJVA 3U21A 1LB2A 3BQYA 2XKPA 1BG3A 2V4JC 3V42A 2DK8A 4IXAA 4OGEA 3CCRQ 4RB0A 3M3YJ 5AQZA 2QTDA 3AG2H 1L3TA 2CS3A 1M1EB 1WSFA 4ZYAA 3C0CA 4XU3A 1QHTA 2PNIA 4UNFA 1K9MC 3AVIA 3J81E 1YTUA 3FMSA 3ALYA 4UV8A 2M9HA 1C1AA 2WACA 4P96A 4M7XA 4GW6A 4PKGA 4A2BA 5EC7A 3G1OA 2JM9A 2O6GE 3PFYA 1B92A 4IUQA 3BR6A 3N5BB 3DOKA 1SFUA 4C8LA 4K8ZA 3BTIA 2EFIA 3P9KA 3L6QA 3F73A 3SZGA 1UECA 4QT7A 4FWLA 3CP2A 5GAN3 2JHJA 5FW9A 2ZWHA 1SKUB 3LDSA 4BRLA 2DE0X 3M5AA 4DTJA 3SDZA 3QP5A 3CC4Q 4KTZA 4KI4A 4XN0A 3V7SA 1U47A 1IXCA 2E1CA 2X35A 4YOXA 3BTCA 4JKDA 4E2FB 3ZRGA 1WZ2A 2UWMA 2CQXA 3E1SA 4M77A 2E70A 4G8XA 5ECAA 4H5RA 4JX5A 2X3XD 3VDXA 5LEKA 2FBXA 4MHGA 4RW4A 2F69A 4C8NA 1NJWA 3I4PA 3CG7A 4CBUA 1G8XA 2CREA 3NVMA 4MIMA 2P4TA 5CZ1A 4DQRA 1IN6A 4JKAA 2BIVA 3AARA 1YI2N 2EYWA 4AIDA 5E84A 4J83A 1VSKA 3H5NA 1RRJA 4QAGA 5C24A 1N8RR 3E9FA 4FL6A 4M3ZA 3MEWA 3DLLA 1RT4A 1O57A 1FN7A 5LMNK 1QMCA 3DEEA 3GWZA 4JKBA 1GCPA 4HYEA 2OU2A 1NMNA 1D0YA 1UGPB 3A5ZB 4KTWA 4CESA 4FX0A 2M0CA 3DM2A 4AU7A 1FIPA 5HLGA 5T7BA 4HNTA 1Y07A 2PQWA 2EQKA 3MJXA 1IHWA 3K4NA 5I22A 1XGNA 2NUBA 4M73A 4O3MA 3UATA 4XU2A 3N0UA 4M75F 5CKDA 5GAMd 5CKEA 1LDJA 5GANg 4EHTA 5D5WB 1G6NA 3CO6C 3AVJA 2VWJA 3PMIA 3CPWM 2Y1JA 2MOXA 1N8RO 4JI0K 2I10A 5AQWA 1EIFA 2P9KB 2ITMA 1I39A 1GT0C 1QRYA 1PNJA 4IIMA 4BC5A 4XTXA 3W3CA 2EQJA 5BPNA 4DLEA 1SVLA 3TAQA 1U2VB 1FYNA 1G3YA 3K4LA 4BWMA 3GVAA 1M1KC 1ASWA 4HLYA 2NLUA 2RNAA 1MBJA 1ZHFA 1N6AA 3WVDB 1JLCA 4LK1F 1R0CB 2D6FA 2QA4Q 4WE1A 2IPQX 1TW3A 3TO9A 1AOYA 3CC4T 2YWWA 2DIGA 4FWMA 2OTJT 2VJ4A 5B5EC 3DLEA 2M7AA 5GPCA 1BQMA 3MD2A 4XNFA 4JK9A 1APLC 4A3JJ 3F6OA 4UY8O 4Z94A 3CCRI 2KZMA 1ZR4A 2W10A 1VQ6A 2BW3A 2RAEA 1S3JA 1FMWA 4IOAF 1WJBA 1WAJA 4FT8A 1JT6A 1GHCA 3CM6A 3UT1A 3TW7A 2W84A 3GMEA 3T0YA 1NGHA 5DCFA 3KHYA 4KHSA 3CPWS 2K57A 3KETA 4KISA 1N25A 1TK5A 4BQQA 1KQ8A 1FYMA 1KFSA 4WWCA 4JEPA 3QFPA 3BG6A 3RMCA 2ED0A 1RNHA 1XNIA 3FMQA 2JK3A 1SD4A 4GRIA 4DV6K 3MVPA 2UU9K 3TSWA 4PDKA 2DT7B 5EOYA 4W5QA 4O8KA 3X28B 3CMEQ 1SANA 3VYGA 5C6SA 3S93A 4G6TB 4QTRA 3VQ8A 5GAN2 2ME0A 1W2BS 3PT9A 1NK4A 1GUUA 2LKXA 3QZ5B 2IIRA 3GTPJ 3AVNA 2L02A 3FJPA 3QSUA 4OMMA 2QWMA 4KRTA 3O8HA 5KGWA 3X26B 3LWIA 2ZXWH 5JFRA 1NLVA 1NGAA 4O4GA 3KWGA 4EIAA 4E7ZA 3A5MC 4MEYF 1GVJA 4B44A 1EFNA 4OF1A 4G6QA 4C92F 2PJPA 2DRKA 1KSPA 2LFBA 3CCRN 3TSPA 5EGOB 2YJFA 1QHHD 3DRRA 1SRLA 2Q8KA 1ZBSA 4YOQA 2VKNA 3QJ6A 2HZYA 4XTVA 4L9VA 2O9SA 2M0MA 3OMGA 5DM6F 2R7UA 4QIWN 1VQPQ 4HKEA 2LVMA 3JTGA 4J00A 3GPLA 3V1OA 5CQXA 2ELHA 1M27C 2JPCA 2OFIA 2CO5A 3SHFA 1XQPA 5CR2A 1KQSS 3FE1A 1K1ZA 4NB5A 1VI0A 2GA1A 3JCMc 3U4LA 1IO6A 5C42A 5DY9A 1K78A 5M5XJ 4YORA 1L0OC 3LWHA 1RR7A 3M1FA 1O3TA 2ASPA 3MXIA 2HBLA 4DB3A 3D7EO 4CJTA 3OBWA 1K8AO 3VTHA 3QERA 1TL8A 4C92A 3DOLA 4JYKA 1OR7A 1ZTRA 3ELKA 1Y56A 1FBQA 1NBEB 2R4GA 4OIPF 2WTUA 2QGGA 2E2PA 3FXOA 2STTA 2F2WA 1WXBA 5LJ5f 3VENA 1WEIA 4LK0F 2J05A 3MK6A 1J6ZA 3VQQA 5ICFA 1IGQA 1XQHA 1QQIA 3DBLB 1OKJA 1EETA 1RAHB 2NOFA 4M7AD 5JLFA 3AA2A 4ASNA 1TC3C 2O8BB 2VT3A 2V8IA 4RGXA 3C2HA 1NJYA 1W2BA 4FJHA 3HOTA 4XN3A 2LY2A 2YRCA 4IBNA 2R5MA 3A2KA 3ZBDA 2OFKA 4DEXA 2MFZA 4KITB 3FXRA 1BL3A 5D7UA 1F4KA 2IW5A 1ONVA 4OLBA 3ZQCA 5GP9A 3P8DA 3J7AF 1GLNA 3A8LB 1HDPA 1X6OA 1GXQA 3Q9SA 1FTZA 3DCFA 2EHGA 3CC7Q 4A3KJ 3JCMg 4HDUA 2NLXA 4BRHA 2J5OA 1Q81C 2AZVA 2HGCA 2DFEA 3N5NX 2CW7A 4PJOD 3QO3A 4BR0A 2XRLA 3CW7A 2X85A 4C8OA 3OYMA 4OMFB 4RTYA 3UKRA 2R3SA 2K79A 4BJ6C 1NNEA 4YEJA 3CJ9A 5FLXK 3V7RA 3WQUA 5HK3A 1S6QA 1ETVA 1VQKT 4CJEA 4RB3C 2FG0A 3D1NI 1LUJB 3I55Q 3BC8A 2EFOA 3LSRA 2FBKA 4BRPA 2EQUA 1E0EA 3JCMd 2Y0MA 4CDGA 1VQ6N 3F9MA 2HXIA 1A5WA 1RBTA 1M90O 4G94A 3TEEA 3H1QA 4AVZA 2Z9OA 1JKHA 2XKOA 3QNOA 3EGUA 4M45A 5KH6A 1JCEA 3ATUA 2FZCB 2VGNA 4V19K 2HHSA 4FJIA 4MLOA 3K9TA 2KQWA 2HNYA 1TS9A 4MZMA 1XC9A 2FBYA 2ECBA 2RN7A 5A0DA 3E5QA 4RMOA 3IKVA 5M3FJ 4ZYHA 2DTUA 1HLVA 1MNMC 2J6KA 1J09A 4FLWA 4M7DD 3ZQIA 3E3VA 1O4XA 3TTFA 4BROA 1F36A 1IN7A 2B8AA 1VSJA 1KU3A 3GNGA 5TKYA 1HBXG 3O6WA 3LSMA 4CK2A 4YDUA 4DEYA 1WHJA 3M54A 2P9PA 4HNVA 3CWTA 2V79A 1Z6RA 1FWZA 1ZELA 1P4XA 3A5OC 5AIQA 4M3UA 4B1RA 1P59A 1RDCA 3K4JA 2YLCA 1NZ9A 3ZN1A 4HAMA 3F10A 5LMUK 3OL3A 5KCMA 2GGRA 5J1UA 3P8HA 4B9LA 1K8AR 1TT0A 3JRBA 3ZX0A 3GX4X 2RJCA 1JB0E 3NFCA 4Z4CA 2DPDA 3A5NC 4BQZA 3K2AA 2IC3A 1GVDA 1DU6A 3K6GA 5GAGJ 4N0AA 1K4TA 4AM7A 3WGHA 1T0HA 1N3CA 3HSRA 4DU4A 3G6ET 3D2FA 3ECHA 1LAVA 2P9IA 1XC3A 1DGRM 5K1YA 4XRMA 1C1BA 3ER0A 2WAFA 2IGKA 4JRQA 4LLLA 5AQXA 1B72A 3ZR8X 2DA4A 1BOBA 2FOWA 4CXFA 4EJUA 1U1SA 1UZCA 2IXSA 4E9GA 4OIRF 1VQ8Q 2D5RA 3QQAA 3JR9A 4A3EJ 3X24B 1UA1A 2MLKA 3META 4BR2A 1KLMA 4AUXA 2IT0A 5HBMA 1KXPA 5CKFA 1JJ2P 1IG9A 3QWXX 5J1EA 2EV5A 2VXZA 5FD5A 1YJWT 4F3OA 3O6BB 3DJCA 1OJLA 5EZGA 1Q7YC 3CLOA 3W6VA 1K9MR 4LF7K 3JCMf 2DBKA 4DR3K 3M1EA 3QRFF 2QTXA 4CF2A 4O5FA 3AVLA 2X4WA 1GLDG 3HTSB 3AO3A 4B9VA 1JHHA 3MQ0A 4XLFA 4BR9A 5K14A 1VQ4Q 2HQXA 4LLNA 3FM5A 3H0FA 1BHLA 3BR0A 3EGXA 2W7NA 2XI9A 2ZD1A 5AQLA 2F5EA 1TTHB 2PFBA 3OYBA 4XH4A 3GYHX 3P5JA 3MN6A 3QBYA 3L3UA 4EW4A 3C3WA 3KP6A 4WYBA 5DEQA 4QPQA 4ZDPA 3G71I 3CDIA 3THWA 1YFNA 2KRHA 2KZZA 1E4GT 1KG4A 3H9JA 3MKWB 4A3FJ 4I01A 1DTQA 3VQ9A 4CIFA 1VQ5Q 3LSTA 3OSFA 3KD1E 2DYBA 2VCPA 2IGOA 3M4YA 2LY1A 3W2VA 4ESFA 3ZMTA 5FU6C 3TANA 4PWDA 2XUBA 1BKBA 5FKLA 4J2EA 2RI5A 2STWA 2CGHA 4HT8A 1ITYA 4M71A 5DM6L 1QQJA 2LX9A 2LC4A 4HHTA 2XDBA 2X48A 1HW2A 4A5BA 3ERMA 3O9SA 1U84A 1NJIO 4N4NB 1WKMA 3BY6A 5CVRA 3LW5E 4FSXA 1X75C 1VF9A 2VT2A 4KJZA 2FX0A 2K27A 1YW8A 3WODF 1U5TB 1JLAA 4F55A 1ZXOA 4WXHA 5GANh 2XPUA 3UWNA 4HUGA 4EATA 3IRQA 4N47A 1J5OA 3LSIA 4FLXA 3C1DA 4CCOA 5CZ2A 4AM3A 2YX6A 2FL7A 4RBOA 4CIEA 2EYYA 1VQNA 4AC0A 1UJYA 4OOIA 4V2GA 4M4ZA 2AKLA 5KCOA 3K2ZA 1FOXA 3CI5A 3OYNA 4BACA 4MDXA 1JLBA 2ADUA 4CCJA 2ABLA 2XK0A 5GAMg 5DCMB 1EF4A 2RI2A 4M78B 4KUMA 3HGYA 1B72B 3W0LA 2X6SA 3P8BB 3BTLA 2QUFA 5HODA 4F3TA 4L59A 1TTYA 2RJEA 5IAYA 1A5XA 2VGMA 3H9QA 4ZDLA 1Q1HA 3GTMJ 3H1CA 2KL4A 4IUVA 4IURA 5HDGA 3VS0A 1Q9XA 2W48A 1SRMA 2VC8A 1N78A 4GYIA 3IS9A 3SB2A 2D1XA 1X69A 1ZSGA 5LJ3e 4JI3K 3QPTA 2GIVA 1HOMA 1QSYA 3QJYA 5IT3A 1YHQQ 1GLCG 3LNQA 3LDOA 3J80K 3WNFA 1BUPA 4XLCA 1ZBXA 3RMQA 1GLBG 2Z1GA 1ATSA 1SF9A 2CSIA 2QGFB 3SD4A 5AQFA 3SZTA 1VRTA 1WPKA 3CMAI 3IRRA 2DNUA 2QA4T 3FBNB 3CD6Q 2X6OA 3OY9A 1JGSA 4ON0A 3I55N 5D6YA 4JP0A 1REVA 2F5DA 2FQ3A 4DFMA 2DTIA 4AYBN 4E9HA 1UHFA 3LP3A 1ZLJA 2QLZA 5KAFC 1MMGA 4DR1K 3G71Q 3M8FA 2H8WA 4HUFA 3EN9A 2LCSA 2XVCA 2X4HA 5E17F 3R60A 3ZLJA 4Z6YA 2BVLA 1SHGA 3SWNB 4B6MA 1UWBA 5GAHJ 2G8IA 3TSZA 1GV2A 1HYZA 4I9LA 3H1VX 3WXLA 4JK8A 2B63J 3FM3A 1YJNI 1J9IA 2UZKA 4Y52J 2EPDA 4PL7A 1YS7A 1C0FA 2GTOA 3S8PA 1R59O 5GMKh 1YAGA 3VU3C 4E9FA 3T3FA 4NL2A 3HSCA 2DTRA 1S72T 4IFYA 3AAPA 1YX5A 3SLCA 5CVJA 3CMYA 2DZ9A 2P5LC 4BQNA 1D8KA 2HB5A 4M7AA 3THVA 2YU3A 4RUGA 5SZTA 4DF4A 1XX5A 4JK7A 1GLLO 3IP4B 1IZ6A 3SUNA 1QHGA 3E19A 4MQ3A 4CEZA 2CRGA 3T1AA 2MSYA 1E17A 4KHWA 5LJ3j 1VK0A 4ATOA 4M75G 3M1CA 3UKRB 5JHFA 4MDBA 3S1NJ 2AHQA 5BPLA 3CJNA 1BYMA 2K3FA 5M5YJ 2BE7D 1POGA 3FZLA 4L5IA 3NH0A 4FJLA 2LREA 1FT9A 1HPZA 1R9TJ 1MJAA 1YX3A 2XB5A 4KULA 4N9HA 4L9JA 3RCOA 3HEFA 2RHKA 4HF0A 4M9XA 2KSSA 1NK5A 3CJQB 2VBYA 4I0AA 5F0HA 4ESRA 4KFBA 1WJAA 4L0ZB 3EFSA 4RLQA 4AIKA 2JRMA 2WV0A 1HW5A 3LSJA 2XASA 3IWFA 1Z05A 1WGSA 1NKUA 3TGNA 5F64A 4K43A 2KT0A 2ZGYA 5CYQA 3QEIA 3VGLA 4XKBA 3ZOBA 3DLLL 4F17A 5F1XA 4X0GA 2F2EA 1OYXA 3MEGA 2P5KA 1ZRCA 2WFBA 1S7AA 2XGEA 3WTYC 4AYBA 4CVNE 4V2FA 2RQVA 3P4IA 2O8BA 3OS0A 4C5HA 2Z2SB 3IH2A 4B9QA 3IC7A 2JW4A 1QQCA 5GPAA 4IJNA 4OKKA 3ZT0A 1VQ5T 3OYLA 1PVSA 2XV4S 1MH3A 4KA4A 2OPRA 4PUSA 4QW2A 3G71T 3LH0A 4DV4K 3HRMA 3O08A 3MN2A 4HBLA 5GAMh 1ULYA 5GTIC 4CJKA 1YIJA 4BUPA 4H5TA 4B9WA 1M3QA 1PCXA 1P2FA 1XI1A 2YUQA 2DTOA 1M90C 1S5LC 1UELB 1ZR2A 4YPHA 2RQUA 5CJ9A 1QU3A 2YX4A 1ACIA 2HSPA 1MSEC 3OWTA 3RDVA 2KIQA 1UGSB 2LLKA 5GAN5 2YRVA 4BBSJ 2QZ8A 1LPQA 4FW1A 2DERA 1P8ZA 1HSJA 1NOZA 4EGYA 3CWAA 3IAM2 4ID5A 3A0IX 1YI2I 2L3PA 3FHFA 1UAXA 2HNIA 2FEIA 2A6EF 1GBRA 2ETHA 5C44J 3VN5A 1PP7U 1SZ2A 1W1FA 1WCMJ 4PJ0C 1W4MA 3M4GA 3ISNC 3KEOA 3WT0A 4FL9A 5FRNA 1BB9A 2F5VA 2KAFA 2Z33A 1JXEA 4BB7A 2RQRA 1HJOA 1WQ2A 3GTOJ 2CV0A 1BOAA 1ZRDA 1C6VX 3BJ6A 5GAN4 3OYYA 1QBJA 3X2QH 3N05A 2VYTA 3IFRA 2F5CA 4RAGA 5DUIA 3PO3J 1UGQB 3G7ZA 3JV3A 3SI6A 1DQUA 4I76A 1X3UA 1JQQA 1Q86C 3G4SN 3Q7BA 3GL1A 1VQ5N 1ITGA 2F4OB 1Y96B 3CC2A 3GIBA 2DKGA 4YG2F 1HKTA 3LMMA 2L9VA 4ZZDA 2XGCA 4EJZA 1YE9A 4Y92A 2QA4N 3JAME 3HDDA 1BCOA 2KDZA 3SV4A 4IOCF 2Q1ZB 3REAB 2KROA 2DY4A 5EEHA 3TU4K 1ORNA 2CQ7A 4HF2A 4A3LJ 1XMKA 4FETA 3CCMT 2VG6A 2M4GA 2V26A 1HCRA 2KGTA 1RNLA 5K7HA 3VWBA 2LQWA 2WUSA 4PJMA 2KXCA 3T8TA 1O3QA 4A6EA 1N8RC 4BHBA 4DUZK 3VQ5A 5FRMA 4MMLA 2P81A 4FT4A 3SPYA 3CUOA 2IGNA 1S72I 1TVRA 2FSWA 1KAYA 1Q9YA 5C4JJ 4RTVA 1VQ7I 2R92J 1R5HA 4LUDA 2VKHA 2ZO4A 4M77B 1DP7P 5ICGA 1S5JA 1VQ7N 4O5VA 4L6V5 4EZ9A 1YIJT 3PJRA 5HVQC 3O5ZA 1Y6IA 4JAXA 3L2ZA 2WSCE 5E8IA 1SFEA 4FLZA 2D2WA 4IHSA 3H9NA 3JRIA 4M3EA 4M3GA 1RBUA 2R7DA 2CKKA 3SFMA 1K9MU 2ZXHA 1P6RA 1VQLQ 3QIIA 3IKMA 4LFBK 3AA3A 4G6DA 3EUKL 4TSXA 2EYXA 4RAYA 1JXMA 4D0PA 1NGEA 2G8KA 1UHSA 2NRRA 5A0GA 5D5VB 3TQNA 4EQQA 3PGGA 3IMXA 2V8KA 2E34A 1OU8A 3THKA 2HPIA 4IFVA 1ZSZA 2VI6A 2HDCA 1HSQA 5J6XA 1Z0XA 2FXUA 5CKBA 2L7ZA 2J7IA 3EUAA 4H0EA 3P9IA 2EH3A 4DOVA 4M7YA 3JAMZ 3FB9A 1KZHA 4LD5A 4IO9F 1U3OA 4KUIA 1IV8A 4E7KA 3EH1A 3SYTA 4IG3A 2A1RA 4RW8A 3VRZA 2H1KA 3SHWA 2D8JA 3BJOA 2K02A 2FYKA 1UJ8A 2J6FA 1IDZA 4CO8A 5BPMA 3DAWA 3SPZA 3AA4A 1EA3A 1BI2A 1YCYA 4D5CA 3VGKA 2LCCA 2PY5A 4G7HF 4X66K 5FLXZ 1AWWA 2GAUA 1ZBFA 2Y48A 2E2OA 3S17J 3L1AA 4DKWA 4J9HA 4C92E 1LNWA 2IA0A 3JB9H 1Y97A 1BI1A 2P9LA 3FZHA 1Q7YR 1XDUA 3NF6A 3JRDA 1JKOC 2M0OA 4ZGJB 1WJQA 3MKYB 3P83D 3O3HA 4B8XA 5J2PA 3HPGA 4MGRA 2YSQA 3HYFA 1KQ1A 2I7NA 1MMAA 1W0TA 5LJ5h 1FOWA 4J8FA 4Z89A 2DO7A 3NWTA 2W57A 4X34A 3W6JB 1G3SA 2YV0X 1VSFA 1M3CA 2VQCA 5M1FA 3IAYA 1VQ4A 2X6YA 4M6VA 4CBXA 1ZUUA 2CZ0B 1R22A 5KYUB 3HRGA 3AKZA 3CCQI 3WTXC 1IXDA 4F7UG 2LX7A 5HNFA 1IREB 1IH7A 4IHXA 2CDTA 1SV5A 2OPPA 1ETKA 3BCAA 3IKTA 2O8XA 5DM7R 3CC7N 5KN8A 3QU6A 1LVKA 1WGXA 2DX1A 5KYYB 4CZKA 2VQLA 2V1RA 3HZ6A 3BPXA 4D5FA 3HL8A 1BI0A 4LD0A 2LQ8A 2FPFA 5E1ZB 4FWQA 4FASD 1XNQK 2CGJA 2AXTC 1VQOI 3MKDA 4J2DA 2LK2A 5AQIA 4L8RB 2WC9A 3CETA 4EV0A 1MNDA 3M55A 4OU0A 5HK0A 3KYDB 3KKSA 2A42A 1S1VA 5AZIA 2CT3A 3QICA 2CG4A 1FK9A 1N75A 4HG2A 1VQOA 3CD6N 3ZSVA 2HKNA 3R6MA 3GEZA 2UXDK 2R7YA 2HF3A 3RVCA 2QQ8A 3CJTB 4HXJA 4DU1A 3OSVA 4DBHA 2L3SA 3PNYA 3HRUA 1KEAA 1TKTA 1ZGWA 2CUBA 4I2OA 2ATQA 3F70A 3CCJQ 1OYWA 5GANe 2YHTA 3NH2A 3DBHB 4LITA 1H641 2B6AA 2LNBA 4L5JA 1VQNQ 1I0CA 2X4XA 4NDLA 1K8KB 3HUGA 4QCLA 4M78E 4R56A 2Z5UA 2DCEA 3S1QJ 2SEMA 3U3GA 1E3MA 1U5TC 3VYUB 4AHTA 1ETQA 1TWFJ 1QKWA 3UB5A 2MYSA 3SFZA 2C06A 1ZARA 3F8MA 1HD3A 2AQEA 2H3GX 2HU9A 2ZPEB 3BG9A 1FYLA 2RD1A 3HHHA 4RTXA 2H3EB 4DOZA 3IQLA 5JVTA 1QGPA 1VQ9I 4PK4A 4UNOA 3TO6A 1H0MA 1VQLI 3SAGA 3LSPA 3A0BC 3EEQA 4DG1A 3AHUA 5ICCA 1IGNA 4M3XA 2WSEE 2QQSA 2BE9B 2VKVA 2UXCK 4A62A 1YITQ 3AA5X 3U1KA 1TU0B 2HYJA 2A3SA 3H46O 3RNJA 2KLOA 2HXOA 5F04A 2LQKA 2QYZA 4M3WA 1D3YA 4Z4GA 4MZPA 5DCMA 4OIQF 2D0BA 2LY9A 1JL1A 5GIPA 1K8KA 5FB2A 2KIUA 3MCPA 4Q0BA 2Q36A 2ZJPF 3CWSA 2H8RA 2NRVA 2F8SA 1IRFA 2F5FA 3FBIB 4KTQA 1V55H 1VQ8I 4AHVA 4XK4A 5ILVA 3WTTC 4EDUA 4ILGB 4J8OA 2LF8A 2VL8A 3KP7A 2X4JA 1CZ9A 3EFOA 4P55A 3DLGA 1RT3A 2VXDA 1WIEA 1NWKA 4PJJA 3KVGA 1TLHB 2DXBA 1EWRA 1LDDA 1KQJA 3RYRA 3TPQA 5F2RA 2NNNA 1T0FA 1P4WA 3CCVT 4B8CA 2YUPA 3HJFA 1QVFS 4PLLA 3TDUC 4LY7A 4ENKA 2LSOA 2QDYB 2RV8A 2Z1JA 3RPQA 5EY4A 2GZWA 3R8EA 5KPTA 4AHUA 3KP4A 3U23A 2K2MA 4HVJA 5IY5H 4RGRA 2MGQA 3BF3A 5D6FA 2Y4XA 1GBQA 2HCKA 4CCNA 1USSA 1RBSA 1BK2A 4IQJA 4ITVA 1LCKA 1JBMA 3REOA 3WXKA 1S7OA 4BGBA 2COBA 4RGSA 4Y1CA 1I81A 2HDDA 2PMHA 3DKXA 1QW1A 4KKOA 4HSRA 3I5UA 2K4YA 3O4WA 2NRTA 3NNQA 2J06A 4JN4A 3WG7H 2I7PA 4Y1DA 4DV7K 2RJDA 3ABLH 1MMDA 3F21A 3JXUA 1K73O 3NWSA 4WF9L 2FMLA 4DU3A 4ELZC 3HOSA 2VOPA 2ROTA 1QQOA 1H3ZA 4CZMA 2K9GA 4V2SA 1PU7A 2CH5A 2P6TA 4KICA 3RESA 3UKUB 3OYJA 1QP2A 3HIFA 4JI8K 3PTAA 3BY5A 2MC4A 4HA8A 3BQZA 1RETA 1S6PA 2L9SA 4ENMA 1KQSA 1LWYA 2COWA 3V8LA 1B9FA 3CP8A 3CCVI 2HEOA 4MFEA 1DP3A 2PBIA 2YUNA 3QPSA 1K6OA 1YIOA 3G6EN 2JMCA 3GZNB 3H5RA 2GF7A 2AO9A 1R4MB 4EVIA 2EINH 1HA8A 2ZPHB 1PUFA 3EGDA 3BDUA 2F4MB 5HOOA 3K4KA 4CGZA 2ZPGB 2NNYA 1HDDC 4UVAA 4BRFA 1Z3XA 4E9EA 1WDXA 5E41A 1VQ8A 2V6EA 1BI4B 2HOTA 3NGPA 3OA9A 2O5RA 2CP5A 3ZEHA 1ABQA 2MPXC 3HXLA 1ASUA 5D8LB 1IF1A 4YOYA 3LQQA 1H8KA 2YX7A 4EMKC 1WHUA 5IN1A 5JMVA 2RHXA 4FWKA 1Z6TA 2V1UA 1XWLA 3GFIA 3QEXA 3R3LA 5CKTA 2IJLA 3ZMVA 1RESA 4G12A 2W03A 3S15J 3B6PA 1VQKQ 4B3OA 3NBPA 1HUXA 5LJWA 2W6LA 3ULDA 3ML6A 1E2XA 5JR3A 2JUCA 5GAEP 5DS9A 4X65K 2HYFA 3QESA 4BE1A 1W9HA 1NJIC 1KC8R 3I56I 3Q0WA 1WVRA 3TAPA 5LHIA 2FUG2 3MCAB 4EP5A 4BI8B 4N76A 3VS6A 2D4WA 1VQMI 5JS1A 1IKVA 5L3CA 4C0GA 1WJDA 3NE6A 1EQYA 2RPNA 3EE9A 3S3MA 3CCMQ 2DLLA 1KJWA 4DTMA 4LF9K 3WNEA 3L3VA 1Z7UA 3NTIA 2K3BA 3V6DA 1C0MA 4C9YA 2NUTB 4BRMA 4HNUA 1D5VA 2OZ6A 2FF3B 1WXUA 2B9SA 2FBVA 2ELKA 3OW2S 1I3AA 2ZSIB 3WXMB 3JRHA 3BDLA 1BOTO 2RN2A 1FNNA 3K4CA 2VC1A 2O8DB 4JHDB 4XIDA 3KD5E 1BGXT 5C0MA 3EKSA 5HY6A 3EPZA 1QSLA 3G4SI 1D1CA 4KIFA 4DQQA 5AQJA 1PP8F 2OA8A 1XJWB 1OVYA 2DA5A 4UC4A 2NUZA 1TQPA 2D0PA 4A93J 2OTJQ 3TKYA 4G9ZA 9ANTA 3U9ZA 1YITT 2HOEA 3P9CA 1WFXA 5FKNA 1KVCA 2NRXA 3LWFA 4B3MK 3RTRA 1Q81U 4KREA 2M8GX 4AM6A 3EH2A 1TSFA 4LIUA 4QWQA 2MABA 1RR8C 2D0OA 1AKHB 1QVGP 1YJWN 2EJGA 4KRFA 3ZCMA 2W41A 1E7OA 4LFUA 4MZTA 2YNHA 4JJBA 3RTVA 1Z3YA 2R5ZB 4NCGA 5LBQA 1JLGA 1M1KU 3RI4A 2DT5A 3S2HJ 1JLEA 3LA7A 2EW3A 2F5TX 2FRHA 3G1MA 3QIPA 4N0BA 1XTAA 1J3TA 2O61A 4DWIA 4A12A 3VUBA 1O9SA 3CMET 5C15A 5JLHA 3DRSA 2W1OA 3E1YA 4GCVA 1A6IA 3MDQA 1QQNA 3DTIA 2OJED 2ENMA 4HVUA 3SJMA 1XSDA 3GXOA 4CCMA 3X25B 4A3IJ 3JB9J 4I0BA 3EYZA 5CQGA 2P84A 3LM2A 1ZG3A 2P9NA 4ENJA 5HRSA 2G8HA 4BREA 2ETJA 3D4VA 2L01A 1GRIA 4YOUA 3B6CA 1FSEA 2DK5A 1YO5C 3M07A 4J9CA 2NWMA 2ZGWA 2JTMA 2WY7Q 1RDAA 1GFCA 2DDBA 1MWMA 4JV5K 2E60A 2KRSA 4ZGDB 5IHNA 2X9DA 3MXJA 3DLAA 2M16A 1JKQC 1FKPA 4C92B 2HTSA 3LALA 3VEXA 2CFOA 2HNHA 2LVSA 2UYTA 3EG2A 5AQTA 1TZLA 3ZMSA 1FYKA 1KVAA 3CC2N 4JLIA 3M56A 2B7EA 3OVNA 1V29B 2EKHA 5KRTA 3VGMA 4CEDA 4KHQA 4YOVA 5EXWA 2ZB9A 1HNVA 3KNTA 2W25A 1BDGA 3LAKA 4FXDA 1M3AA 1JHFA 3CM5A 1CGPA 3NCIA 3WQTA 2DFHA 4CJPA 2HHVA 2M2EA 4RW6A 1BA5A 5KTQA 1YN8A 1U48A 1KC8O 3EZWA 3N4MA 2RH2A 1WI9A 2AKKA 3RSNA 4IJAA 1WUAA 2YXYA 3J80Z 3SNNA 4XBFA 4S0HB 1JCGA 1MDMB 4LSNA 4GDFA 2QQRA 4LMYA 3QU3A 2DAQA 2KIMA 5FKOA 1AKHA 1RRSA 3D5LA 1LWVA 3LWMA 4M75C 1TWGJ 2QXFA 3VSLA 1DKGD 1XQSC 2DXUA 1T56A 3BZCA 3RERA 1ENHA 3I56T 5LD2C 1XHXA 1M2VA 3DTEA 1K6YA 4JKFA 1ZA2B 4C8QG 4IPAA 2OAUA 4IQ4A 3FKIJ 4CJVA 1V5GA 2O31A 2DK3A 3B02A 1UAAA 3SUPA 1CQTA 4C3JJ 1CF7B 4GFBA 3CJCA 3OYEA 1Y7XA 3S2WA 3R9PA 3GLXA 3S6IA 2V9KA 1XMOK 1ZBLA 3I0WA 3C4SA 5C2DA 1HKSA 2LR8A 3B6OA 2FSNA 3TBIA 2QSGX 2X4YA 2HF4A 4JHDA 4XAXB 2JGUA 2LG4A 1S22A 2YNIA 1YJNN 3H35A 4D1QA 2A5XA 1PU8A 3SWNA 2V8JA 4BU2A 4HOBA 2Q0OA 2H3JA 3AAFA 1X2KA 4YFNF 1B34A 3GTJJ 2CGPA 2D5VA 2R7TA 2KIFA 2ZJRF 2A5WA 5GAOr 4IHTA 2DFUA 4NLCA 4EMSA 1TYQA 1C0WA 3TCJA 1NEGA 2BW3B 1YJWQ 1KLNA 2OTJN 3H9GA 1LVAA 2GOMA 3CCJT 4A2AA 1O13A 2CW8A 1O1WA 4BNCA 3ZCOA 1N9SA 4E1MA 1UG0A 2DMTA 2MCNA 3OYGA 3OS5A 4J2AA 2L2OA 2NOZA 2ESHA 3A01A 1VRUA 4DTUA 2PBDA 2J5PA 1TKXA 2NYSA 4QVZA 2GNCA 4ELYC 4DK9A 2CT4A 1RT6A 1IJWC 4HVWA 4XU1A 5J1YA 3EG0A 3SYZA 2LF7A 4RTZA 1Q86O 3M8RA 3P1GA 3LSKA 1X3ZB 2R5AA 2ZAEA 4M63C 5FPDA 5E3OA 4IZ9A 4NCAA 1VQPT 5ICEA 4LG3A 4LXCA 5KQDA 3DTKA 3CJAA 1AWCA 1BR1A 1Y0NA 2HPMA 5KAIC 1DIZA 4CF8A 4F14A 3REBB 4X1VA 2R5YA 2CQQA 1HU0A 1M1GA 5B3SH 1YBYA 1VQ7Q 3PNVA 3DP7A 3DYAA 5JI6A 4UOBA 3HKSA 2M30A 2HQ5A 4LG0A 2JS2A 5H20A 1ATNA 2RJFA 2E3IA 1Z7LA 2HVIA 4NB4A 3CCQA 5C25A 1AEYA 1MBEA 1QE1A 2XMFA 1VQ5I 2JTFA 3FJ5A 3ITHA 4BEHA 4IKFA 5IWAK 4B48A 5M9OA 4GVMA 2EV0A 4M42A 5AQQA 1X2QA 2LOOA 1HR0K 4E4HA 4IHVA 1HPMA 1AWXA 3A1PA 2ZNZA 4RMNA 2KQ2A 4OVLA 3M8SA 4CERA 2JA8J 1OV3A 2FB7A 2WTEA 2ZXIA 3E6DA 1ZAOA 1YJ9T 4ZYDA 1IBLK 3NF7A 1SKSA 3C7NA 4NQWB 2CH0A 3VEYA 2WAQA 3AVBA 5GMKi 2XB0X 3R6SA 3K1NA 1UA0A 2UUZA 1V4RA 3WNGA 4HV5A 1TKZA 4CHPA 2AK5A 4KN4X 4JX4A 2JQ7A 2CS7A 3WHCA 2KK4A 1NJZA 2FNPA 3OL4A 5LHHA 1L3VA 4E7HA 1NHAA 3F3XA 4FQGA 2LD5A 2XDDA 3Q0UA 5KQ8A 4N4HA 1PSEA 3GW2A 1NK3P 3ZMZA 5DK5A 3E6BA 3KP3A 2VE9A 5HP1A 2HQNA 3ZQLA 2V1DA 4MDWA 1WWXA 2GTDA 3N97A 1RTHA 4IUUA 2YLBA 2RGVA 2DA3A 1XSVA 4PJOG 2BZTA 4C92G 2XGXA 2EYZA 2OTLQ 4CGGA 2EAYA 3ZFJA 3SJJA 2ZC2A 2ZE2A 3TAEA 2Q97A 4P9UA 4YFXF 4M78C 1VQ9Q 4XK8E 4A59A 4UUSB 1E6HA 2LKSA 3RYPA 1IRZA 2JNGA 2R57A 4B22A 1CXQA 2QA4I 2VKEA 1AU7A 2HOSA 3BGRA 3CEYA 3GLLA 2ZFWA 3CIPA 1RIOH 1MUYA 5BR9A 3RBBB 3S1MJ 2H94A 4BY9C 1OKRA 4KPYA 1DPUA 5E3MA 5J2MA 1GV5A 3WG9A 2GWRA 3EFOB 5IT9E 3BR5A 4BRNA 5FJ8J 1KQSP 2P4RA 1TK0A 5CO7A 3INZA 4XRSG 3JW4A 1NKEA 1VIFA 4U87A 1XB4A 2LNHB 1T3SA 4ICLA 4BRDA 3RKWA 5CVVA 1O3RA 3RKYA 3D7SB 4BRCA 1QVGS 2LDUA 4G7ZF 1PM3A 2RNGA 1N27A 3LZIA 5LJ3d 1LE8B 2NS8A 3NAUA 3WTUC 4CJ7A 4HSTA 2EIJH 4HX8A 4OP0A 1VQLA 5HLHA 4X9CA 5AZJA 2GOXB 2E65A 1R23A 3LAPA 4ILJA 1Q95G 2ZCWA 4C3HJ 2SRCA 2JPSA 1WX6A 1I3QJ 2FRWA 1SSHA 5GMKj 4JI4K 1WBDA 2XAGA 4JKCA 5HCKA 2ME6A 4LD9K 1A04A 2OJ2A 5CLSA 3TI0A 2PVOB 3DU5A 3RPUA 3E9OA 1WHHA 4NNJA 1QWFA 2RVCA 3K5OA 5KVRA 2RHUA 2FSKA 3JCMW 3RWUA 4M3DA 1BW6A 1OCPA 3AVMA 5F0XA 5LJ3h 4MTDA 5AQGA 5E1XA 3CCLT 3RRGA 1QVTA 1YJWA 1B3QA 4CECA 4JX6A 4NC7A 1GFDA 2XY5A 4DYQA 1LMZA 3G4SA 1S3XA 4BGAA 3TW6A 2NOIA 4A63B 1T39A 5IT9Z 2QEXT 2XD0A 5E3NA 5K5RA 4A0ZA 4EM2A 3K70C 4LJZF 5F1JA 2COMA 3CJ1A 4DSLA 1CKAA 4KGZB 2DN0A 5KE3A 1JL2A 1J5YA 2DF6A 3GF5A 1P7JA 3OMCA 4LIVA 2W00A 1T95A 1UUEA 2QWNA 4RS8A 4XKWA 3VF4A 2C0OA 1IRGA 4J9GA 3OSGA 4KNYA 4C1NK 1X9WA 1I5ZA 4CSWA 4I7FA 1IUYA 3M8EA 4OPKA 3LL3A 4JS4A 5J4VA 2F2XA 2DBBA 1QP3A 3ZMUA 1FEXA 4CA0A 2MBFA 2B86A 2OTLA 1RKWA 2VQEK 4ZN1A 1SKRA 1ZUYA 3WE3A 4OFAA 4WXCA 2VYPA 3C95A 3JRFA 2PMZA 4C30A 1JJ2S 4AWXB 3QNNA 1BWFO 2YKMA 4NZGA 3RDIA 1I1GA 2YU9J 1XGOA 2IIMA 4PJOC 1WQWA 4HVVA 1IG8A 2OV7A 1VQ7T 4IUTA 2KYMA 4XTWA 3CC2Q 1HJDA 4KBMB 2WBMA 1VQOT 4X1EA 1M1FA 1OEBA 1KAZA 1YHQA 1S1UA 3FZKA 4B9MA 3MP1A 1W5SA 3S1RJ 3GDQA 3CBMA 4LH5A 3VS7A 2A6HF 4AH9A 1NJIU 3ATVA 3I0SA 2PZ1A 1Y0UA 3ESWB 3CCMI 1HC8A 4OX9K 2OPTA 1UGVA 5E79C 3C2BA 2LRQA 1Q82U 4EHUA 1I6HJ 1IXRC 1A31A 4M77E 5D5UB 3H3OB 2CMPA 2BBYA 1X9JA 5A0LA 5AR0A 4BI3A 2D1KA 3F22A 2X0LA 3MKZA 1WQ7A 1YJWI 2YR2A 1KD1O 1IRXA 2V1XA 3L2RA 3EL2A 4XM3A 5L3GA 1K8AC 3HRTA 3U1DA 3QETA 2E64A 3G4ST 3NDKA 1EH8A 2ZNYA 3D2EB 3H0GJ 4IFEA 4BS9A 2VJIA 4EMGA 4FYXB 3PSIA 1DJ7B 2GQIA 4X9DA 1X19A 3ROUA 4ISEA 4KT0E 1TUGB 1OULA 1P4AA 2QKKA 3PY8A 3SEMA 1YRNB 4FK2A 3QYGB 2L9RA 3UDCA 3J81K 4DF8A 2O4GA 2E20A 1VQMA 4DV2K 3PX6A 3OOUA 3MZHA 4FM0A 2VOOA 5CR4A 3DLBA 1HK9A 5BRHA 3OS2A 4LB5A 3SQ4A 1QKXA 3HTUA 2K9MA 1MU2A 4Q47A 5IPAA 2KRMA 3Q7CA 3LFUA 3PQKA 4OPJA 4J9EA 4CGDA 1Q18A 4U67L 2PUKB 2ATCB 1H9TA 2ZF5O 2OCCH 3R1XA 2TCTA 4ESBA 4CZJA 4C8KA 1W0UA 1WPYA 4QSHA 3ZN0A 3SK3A 4BR5A 4CCKA 3GBTA 2DJIA 1IG7A 1VQNI 3QYEA 1SSFA 4MO4A 2HKOA 2E3HA 5B8HA 3ZX2A 3V7CA 1PDNC 1CZBA 2NZTA 4S04A 2KY9A 4N41A 4XORA 3CXCA 1SL2A 4DQSA 3BJAA 5K5QA 2UXNA 1BIAA 3EO3A 2HL3A 5FKKA 4B3AA 1Y0MA 1MMSA 4RB1A 4XH1A 4PKHA 2AHJB 1FX7A 2DL4A 1QVFP 2B5JA 5CCAA 4CI6A 2HHHK 3T9NA 1VSIA 4J6XA 2C6YA 4F16A 3QINA 3RKQA 5IYDJ 1ZUKA 3QIOA 2LMDA 1J59A 2XIDA 5GAOm 5J4YA 1VQKN 5FD6A 4F2RA 4CHNA 1J2XA 1YCSB 5DLQE 3VS2A 4LH4A 1TWAJ 3OYAA 4Y7NJ 2RDPA 3I8BA 4JI1K 2LT1A 1B9DA 2O8FA 2VXEA 5BS6A 3QUIA 3NMZC 3BCBA 2NOLA 3HB9A 1Z91A 3KTQA 3THXA 4FE7A 3HKZN 3WE2A 4JPBW 2TRTA 2QENA 1EJ9A 2ZJPL 4XRFA 1TAUA 1W5TA 3NARA 1JXSA 4BC3A 2EQMA 3JCMV 3MWMA 3UF4A 2QSHX 1Z26A 4DNCA 2P9UB 3DF8A 3QO9A 1E6GA 3ZETB 2L7MP 1C0TA 3LL7A 1YJNA 1EZZB 3OQ5A 1PD1A 2V7FA 2Z3YA 4ZJZA 4QS7A 1NM7A 1RCHA 3PLAA 2P0QA 1K7AA 3HBLA 1D5YA 5L23A 3A8YA 3MN5A 4I6MA 4CF1A 4Y28E 4FJXA 2QBYA 5J1RA 1WHLA 3H41A 5HS8A 2NRWA 4LUEA 1Y96A 3TAMA 3O8MA 2N8GA 2VC0A 3WXJA 5HRPA 1FBUA 1R5ID 3E6CC 4BXFA 4M41A 4OMPA 5FLMJ 2FPEA 2XSJC 4DFPA 1HKQA 1VZ0A 4EW0A 2F8TA 1SVOA 3CXCS 1VYUA 2JPBA 4RW9A 4WTOB 5EJCA 3NPFA 3E9LA 1OZ3A 5GANd 3AY9A 4E1JA 1MBFA 1LEBA 2KXDA 4DR6K 2EFWA 2PTKA 3RQIA 1YI2Q 3PIOF 3C0BA 4OINF 1HW1A 4Q48A 3MZYA 3PO2J 3TTDA 2ZGZA 2VONA 4M3BA 3J81O 1JXOA 1MBHA 3PFIA 3JAMO 2A28A 5GAOn 6AT1B 2QM1A 3CDHA 3RMDA 5LGUA 2E2JJ 3VYSB 4CIGA 4BEHB 3AL0C 5AQOA 4CJQA 3R0AA 1U2VA 2QEXI 2HBKA 2M34A 5IP6A 1XCVA 4AFQC 2R93J 3LA2A 1E3HA 2OPSA 4LG0B 1KRPA 3D5RC 3M0QA 4CCHA 4B09A 2EGAA 4L9NA 5GJVB 3G71A 2GLOA 5EYRA 4B3XA 1QZ5A 2GBQA 5L3DA 3CPWA 4EJYA 4HSBA 2CUJA 3A1YA 4CZIA 3DB3A 4XIUA 2HVRA 2VUMJ 1SHFA 4OB3B 4C0DC 4F7UA 2DRMA 3U2RA 1AZEA 1T44A 1R5GA 1ACMB 3L4IA 4CK3A 3F8FA 4B9UA 3CCUA 2QGUA 3A01B 3VERA 5BQTA 2IEKA 4PZJA 4FSVA 2LYCA 1FW6A 5EVZA 2XRIA 4B23A 4D8KA 4JJNK 1KFZA 3IDHA 2KJCA 2M8EA 3VOEA 3JCMP 4HT9A 1TYQB 1YQRA 1KG2A 4JKEA 1U2WA 1WNLA 2FD5A 2KW4A 1HNZK 4C8QF 3K0LA 1XGMA 5CK9A 1IV0A 2EV6A 2CFXA 1VSEA 1B34B 3CCSN 3QLHA 2P51A 4CZCA 5IYBJ 2LP5A 3W2WA 1F21A 3FDYA 1LKXA 3T19A 4GMJB 2VBWA 5LJVA 4C0DB 1N6QA 1EKEA 1AZGB 3CC2T 2G3RA 3CUQA 3JS6A 3A0HC 3MAQA 3D0SA 1VQON 4O0JA 1R8OB 2W85A 3PX0A 3VRYA 3E01A 3MWPA 3ZP5A 4X6AJ 4FCYA 4GYGA 3F72A 1VTNC 5FGMA 2H56A 1X1AA 1SQKA 4OMNA 3V4IA 4BD3A 3TWHA 1ETXA 1YQLA 2VQFK 2EIMH 5LFAA 1TGOA 5KNLA 3PE0A 1MUZA 4ELTA 3LYIA 2ZMEA 1FMKA 5EG0A 1DTTA 1P7MA 2P9SA 5GAN7 2VWKA 1QCFA 3BLYA 1RLPC 2DXTA 3TARA 5BRFA 3NEUA 2AZSA 5KE2A 2RC4A 4EM1A 3MFKA 1VIEA 3PUBA 4BDZA 1T3LA 3NHNA 4BVOA 4BGDA 4ZNXA 5AFUH 3CXCP 1JTYA 2IS2A 4K8XA 5C12A 3RJPA 5GAN6 1FIAA 2UXBK 3SQ1A 1X43A 2X1DA 4BQOA 2O4XB 4EMKA 4H0YB 1OH5A 3ABTA 5I9EB 2O7OA 2EBIA 4H0PA 2EWSA 2DD5A 2QWPA 1SAUA 2Y2ZA 5GMKm 4ZTFA 2NVXJ 2NXNB 4CFDA 3I9QA 4O8UA 3BDPA 4H5WA 2YDLA 3L2VA 1FXXA 2BE5F 1JUMA 2VBXA 2GELA 3SAFA 2CZ6B 3VFZA 2DL8A 2M5WA 3PIOL 2X1CA 2FU4A 2E12A 4F7UB 2RKHA 2M87A 5GAN8 1KSWA 3CLQA 3OHRA 4KH1B 4DA4A 4M9ZA 3ZPLA 4A4GA 1UFMA 2A3LA 4KYWA 4KAZA 1YFHA 4HX4A 4NHJA 2HW3A 3V4GA 3FSPA 1P9QC 1XPXA 2YNFA 3K4MA 3OYIA 4C3IJ 1FOKA 1U9NA 4B1UB 1MPGA 2DOFA 3PSFA 2NRAC 3GOXA 1NK7A 4DUYK 2E2NA 2OANA 4OKEA 4DQ8A 5AYFA 3I55T 4EVVA 4OFEA 4BR4A 1N5YA 4A3DJ 4J5YA 5FU7C 2E1OA 1H92A 4M78A 3DPUA 3CPFA 3DPTA 3F5TA 1R4NB 2FBHA 4M75E 1KGSA 3GCMA 1XG1A 3PO4A 4FSSA 1NGCA 2PMUA 4U88A 4K2EA 2DEUA 4RM3A 1JEGA 1P90A 1I07A 2JUGA 2NOGA 3I59B 1VHXA 2HZTA 3R4KA 1X3WB 1Z25A 1CKBA 3PIOA 1NLOC 1Q86R 1AOJA 1B9NA 3KYCB 3KP2A 2V51B 2IOCA 1Q86U 4G1QA 2ID3A 2V7YA 2D45A 3A8GB 4MFDA 5E8GA 3E66A 1K0SA 4A3BJ 4OAZA 4CD3A 1XMQK 5M1PA 4D9JA 2VG7A 7AT1B 3IV5A 3PVQA 1NGIA 3H3VK 1QZZA 1DLOA 5KPRA 2Q0RA 1YJ9N 2ZKZA 3HTRA 4KDPA 3VS5A 1KU7A 2IVNA 2W0ZA 3U9GA 8ATCB 4EEFG 5CVIA 4FZXC 4IIOA 4DBRA 3F6VA 3KEYA 3CXCM 4N5SA 3CQYA 1D09B 1YVUA 3M6GA 1YQMA 2EILH 2DQLA 5IYCJ 1WSHA 1H1VA 4NUBA 3MMYB 1G4DA 1W7AA 3JRGA 1VQ5A 4HDVA 4J01A 2Z16A 1DGKN 3M8JA 1KVBA 4DTPA 3A8HB 4PJOF 3QEWA 2O8EB 5L3FA 2QBYB 2WSFE 3HM9A 3MPUB 2O8CB 5J26A 4H0OA 4A0XA 4E7JA 2ASMA 1VQPN 3FR0A 2QA4A 1PG5B 1U6GA 3THWB 2VN2A 2HQHA 2C0IA 1X4OA 2LBFB 3GTKJ 1FJLA 1N32K 4PFZA 2MA3A 4OVAA 5HLTA 1VQ4I 1RAIB 4BUGA 5FPNA 2P9UA 3ERED 3AG1H 2FBIA 3FK7A 2EFQA 1IN8A 4FVMA 2QTVA 2KT1A 4DTRA 2GUPA 9ATCB 1RACB 3KE2A 1W5CC 4FZYA 4W5TA 2QEXN 4CFCA 1XNRK 5A2QK 1QVFM 3IG1A 3I55A 4I02A 3PIPA 4GV3A 4KI6A 3VPRA 1M90U 4XONA 5EF6A 2HHXA 3GFMA 4MTEA 4GBQA 5FO5A 3M3ZA 4K25A 2O8FB 1XMAA 2K6DA 1JGGA 1ZKGA 1ATRA 1QPIA 4CFBA 2JUFA 1YNZA 4GVEA 4M77D 1JTXA 2H8HA 1O7LA 2E6NA 3CCST 3AGKA 2MD0A 2HZDA 3SUOA 1OYYA 3CC7A 5IT9O 1ZBJA 1TUDA 1LQ1A 2EFPA 4XH5A 4CF9A 4D8DA 3BOQA 3M7GA 1T0JA 4CHZA 2Y1IA 1RT1A 2BY1A 4HCKA 2K3YA 4R5PA 2QXLA 1YHQT 4ID1A 2EJ9A 2OI3A 4DSFA 2L2PA 3E9PA 2P9IB 1NK8A 1VQ4N 3E6MA 1LDKB 1VNDA 4E6RA 3CCEQ 2QAZA 5AQUA 2NUPA 3EHQA 4FLUA 2GV9A 3J7AP 5GINA 3VESA 3TMOA 1X6GA 2LJ1A 1OU9A 5M5WJ 4G7OF 3QKJA 3C18A 1NK2P 4A4KA 1JKPC 1TAQA 1VQKI 4DJAA 3HM5A 1N9RA 4NOYA 3LWLA 4XLHA 3BR3A 4WQ4A 3CCLI 3H0HA 2D0CA 1XUPO 5FWBA 5FFZA 3PVLA 2ISZA 2D0QB 1TWCJ 1UTIA 5H6RA 2L0KA 4HEA2 4B8AB 1UDLA 2KHMA 1OCOH 2LSNA 1VQ8N 2XSDC 4OB0B 1D8YA 1FLIA 2XKOC 1YJNQ 4RDUA 3EQLF 1U5SA 3G2BA 2BTFA 3JB9F 2DL5A 3R61A 3G6EI 1F1ZA 4P1WA 2WADA 4LDUA 4CEQA 4YFUA 2BZ8A 3FISA 3VA0A 3VETA 4KN7X 4FJGA 3DXMA 1UOCA 2KDOA 2ZM6K 2EPFA 3ZX3A 4F4KA 1S8NA 2RQWA 1IBMK 1A5VA 3TAFA 3D2EA 3A2FA 2QW9A 2LZ6B 4R1HA 4U0YA 1LNXA 2H6BA 1TNTA 3X20B 2QASA 2NS0A 1WH5A 3CPEA 4JRPA 2MI6A 2JA5J 4AMCA 1RDDA 1QQMA 4A5NA 2W04A 1KK7A 1LW0A 1Q81O 3I5SA 2L5QA 5HNHA 1X1DA 4MDAA 2Q3SA 3TSQA 2QSFX 4W5NA 2LBFA 4FWNA 1IO2A 4L18B 3MECA 4G9YA 4GO1A 3TVTA 3E9GA 1LOTB 2J6OA 3KLOA 4JD2B 2QYOA 2RM4A 2WB1N 4GY2B 4E1NA 2HQAA 4AHSA 2Z1IA 4XTYA 1ZSZC 1VSMA 2RI3A 2E1MC 4KT5C 1YG2A 1X01A 3HI0A 3CQXA 4EM0B 2QKMB 1OPCA 1XHZA 4EP4A 4C92D 4CD1A 1P92A 4DV1K 1C6VA 3IL2A 1KO9A 4IHWA 3RMSA 1N39A 2Q31A 1WJEA 2HVQA 1S1TA 2A37A 3HC7A 1NM1A 4IOCL 3URGA 2GCXA 4DQ2A 4XTUA 3M0PA 3VQ7A 4HCBA 2XF5A 2KDSA 3K57A 2ED1A 4C92C 3A8OB 1U1TA 5GAGP 2DMQA 1BU1A 3MZ8A 3CCEI 4M7AE 4KHNA 2QDLA 1U45A 1WHKA 4OGCA 3ZQHA 3J7AO 3KBGA 4N4IA 4WQ5C 4CHYA 4XR6A 2IPOB 1M1KO 3CJRB 3JAMK 2E36A 1QVFA 5HL7L 2DJNA 3C6UA 2DODA 3MX5A 2HL5C 2BOLA 2OUMA 1QA6A 1AHDP 4AFUC 3ZSXA 3EG1A 2XPVA 1JUPA 1IBKK 1W36C 1WRJA 3GF2A 4XICA 2QEXA 4N9IA 3KK2A 2L8DA 4DR4K 5ELZA 2E7WA 3IWZA 2HDAA 3Q3SA 1NGFA 2PEXA 4D6WA 4Z4IA 3EG9A 2VWBA 3CMAN 1HQCA 2IS3A 2BUDA 1TH7A 3IUOA 4JLGA 1EBMA 2FNAA 3H5AA 4LLGF 3CUQC 3I3LA 2BGCA 3CBOA 4Y15A 5M1KA 3AG3H 4F3QA 4PSXA 1WI7A 2JA6J 2Y9ZA 4H8KA 3LDLA 1X1BA 4OMQA 2WB1A 2HHWA 4OMZA 3MEAA 3BZKA 2ID6A 3VF2A 3LP0A 1TBXA 2HMIA 4YRVA 1N34K 4Z4HA 2P0KA 4DHYA 1SMYF 2NOHA 3FIWA 2YT6A 2IRFG 2EZIA 5KYXB 3S16J 4J9FA 4L0YB 1ZLMA 3SV3A 2YUSA 4DYRA 3O4QA 1DGWY 2P4WA 3FXJA 2EFNA 3I9V2 2NVTJ 1K73U 2K7AA 5M1OA 2PAVA 5GIOA 4PJOE 2YHWA 3S14J 4AFZC 1VRLA 5FKMA 1LE8A 2LT4A 2O4XA 4RGUA 5J8CA 1VQOQ 2WBNA 5FLVA 3OMYA 4GGGA 2CV2A 3CTAA 4D7NA 1M30A 2FMYA 3A4CA 3JTHA 2OTLT 2EJRA 4YY3K 4YIIA 4F52A 2ESNA 2VODA 3WTZA 4BXXJ 3V8KA 1IXSB 3ZSOA 4UUVA 2VLAA 1LAWA 1Q7YO 5HLIA 4AIJA 5I42A 2KRCA 1YJNT 2FZKB 3NFAA 1S7EA 4E3SA 4DQPA 2ABKA 3FXLA 2YG9A 2P9SB 2GFUA 3F8NA 5I2SA 3CCJI 2E5QA 2QWOA 3DKWA 3J7ZO 2HD0A 1BA0A 4F7UF 2NRHA 1DUXC 3SZPA 2IVWA 5H2FC 5FDLA 1TOVA 2A61A 2KMUA 3DKYA 1QS4A 2PFUA 2PJRA 4M7DG 1MHNA 5LJ5e 2E1ZA 4ZH4F 1G2BA 3K4BA 4B3TK 4CZEA 2DMUA 4A6DA 2PYLA 5DM7F 4PUOA 2GXGA 4CYCA 2H6CA 3TOAA 2DL3A 1OVQA 2EVRA 4CGIA 3UNGC 1CSKA 5FFXA 1N77A 4M7DE 3HGGA 4DTNA 4FK0A 3FXKA 3FKJA 1UGRB 5I11A 3WEEA 1FC3A 3HOYJ 4WCIA 5LL6S 3NAEA 3C6HA 2VQHA 1U78A 4FJJA 4B43A 4IO9L 2CYYA 1EXQA 4EAHD 5IHKA 3GE1A 2RQQA 2E1YA 2NNWA 4KHYA 3I0XA 1MBGA 2BHYA 5AFUA 4HTUA 3DRPA 1AWOA 4OMYA 1EO1A 2EX3A 3QMLA 5LY3A 5KYUA 1W1WE 4XSZF 3OA6A 2VIXA 4J2BA 1H89C 2VUBA 3WTWC 2F1LA 4C23A 3FHZA 1N33K 3EG3A 4A4FA 4F91B 2QCOA 1T6SA 4FX4A 1K8AU 5LRSA 5DDGA 1KG7A 1MV0B 2ISYA 3O9RA 2YHXA 1MJBA 3DXKB 4J7IA 3OBYA 1D4XA 2YSRA 3OB9A 3EETA 2XY7A 3OYKA 3CF2A 4M7DA 2DL7A 4FYVB 1AHJB 4A53A 2RK1A 3HVTA 2I2LA 2QWWA 1UHMA 5BNGA 1HJRA 2P9LB 5CQYA 3E5XA 1PRLC 5B66C 4ISFA 3ME9A 3WUHA 4JRIA 4IUPA 3LSHA 2R7WA 2YHBA 5F27A 2Q0UA 3OIQA 2IAIA 3WU0A 2A05A 1RUNA 4BRQA 4KHPK 3I56A 1PKTA 2HNDA 1J53A 2G9WA 5C2FA 2V1QA 3FC3A 4B3RK 4M7AG 1BJAA 1T38A 4DGWB 1WFWA 1X2NA 3NH1A 2DD4A