3L2VA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and mk0518 (raltegravir)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 97
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2vA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2vA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2vA03
1TKDA 4IDKA 1VSHA 4J2EA 4X34A 3F70A 3NTIA 4W5QA 4C8LA 3MEDA 3QIIA 4CJ4A 3AVCA 1RDDA 3UWNA 4I2QA 1GOAA 3SPZA 5CYMA 4QOZB 1HYZA 4CIEA 1REVA 3VQDA 2RO0A 3MEWA 4FL6A 2IAJA 3LPUA 3DLBA 3ZSWA 4LH4A 4DQQA 4O0IA 1QTMA 2RHUA 2XY8A 3AVHA 3TARA 4FJ9A 4CJQA 1A5WA 3K2PA 2RJCA 4HUFA 3L3UA 1XNIA 1TK8A 5HBMA 1TAUA 2OPRA 4XIUA 3O4QA 1ZBHA 4OLAA 1UA1A 4FK4A 1KSPA 3SUNA 3K58A 3B6PA 3QIPA 4O4GA 4OVLA 1TGOA 3D45A 4PA1A 4KREA 1VRUA 3SQ0A 4AHSA 4E7JA 1NK4A 4FVMA 3U3GA 5J2NA 4L8RB 5J26A 3ZCMA 4M3XA 4E0DA 3OMCA 4HVJA 4M3ZA 4PQUA 4ELUA 1VK0A 2D0CA 2ZQBA 2YNHA 4CEAA 4CK2A 2DIQA 1LV5A 3P5JA 3EZ5A 3CFOA 4I9QA 3ZT4A 3LANA 4PY5A 2HQXA 2P51A 1FK9A 4DLGA 4AH9A 1RT1A 2HNZA 2HHUA 3L2WA 4LD6A 4NZGA 3THVA 3TANA 1VSMA 3OMGA 1IKVA 4KKOA 4M45A 4OLBA 3MEVA 3TI0A 3FDRA 3LGFA 3HSTB 4MQ3A 1TL1A 1DTQA 1L3SA 3NTHA 3DMJA 4J2BA 3DB4A 1ITGA 3SI6A 2MWPA 4B9UA 3DRPA 1X9WA 3NH1A 1BL3A 4OKJA 1NJXA 3LWMA 3VQPA 5C6SA 3SZ2A 2QKBA 3MP6A 4OVAA 3NNQA 2KQ2A 1MHNA 1GOCA 4CJWA 2VG7A 1HYSA 4OPJA 3HYFA 4FJXA 4ID1A 2P1JA 3ME9A 4OKKA 2EX3A 3PNWC 3ZSZA 2ETJA 4C5IA 4ZTJA 2LVMA 1JLFA 1NK5A 3LLRA 1D9DA 2R57A 3CM5A 1QSSA 2EQMA 2R7YA 3OYIA 4DFPA 4DTOA 1GOBA 2X78A 3OYNA 1KVCA 3VQ4A 3QNOA 4ID5A 4C8OA 4II1A 5KGWA 2D0BA 2L89A 2HHSA 2G3RA 3EY1A 2YHBA 1U4BA 4CEZA 1RTIA 4I2PA 2RF2A 4AHVA 3KK1A 4NYFA 3ZSQA 4KRFA 4GMJB 3M8PA 2WOMA 3CEYA 1BHLA 3LAMA 4PWDA 1BCOA 3O3FA 3NAEA 1N5YA 4BD3A 4JS4A 4FZXC 4FJ7A 4DQSA 4FW1A 3V81A 4F8RA 4NS5A 2A1SA 3QEXA 4CEFA 4KPYA 4Y1CA 1K6YA 3I0SA 3OYHA 4GVMA 4F2SA 4J2DA 1WSJA 3CYMA 2GUIA 3PX6A 4QCLA 4CF2A 1QHTA 3VA0A 2YRVA 2FBVA 3KLEA 2LDMA 1S6QA 3EAEA 4KTZA 3OJUA 2DTUA 5DK5A 2Z1HA 4B3OA 2HNDA 3OYGA 4EZ6A 3BDLA 2FC0A 3SQ1A 1IKWA 4QQGA 3FFIA 3MO8A 3AVIA 2EFIA 4JRPA 4DQIA 1U49A 2B4JA 1RNHA 2Y1JA 2QKKA 3OYJA 4DMNA 3CFPA 3UIQA 3P83D 1KRPA 4B9WA 2R58A 1B92A 4IUQA 1KLMA 5SWMA 3DRRA 4DFJA 1VSDA 1KFSA 4DTSA 4CJSA 4Z4EA 3QERA 3T3FA 3NCIA 4IFYA 1Q8IA 3TABA 4CRIA 3S6WA 2GF7A 3VA3A 1WJQA 5HRRA 3S3OA 4B8CA 3SUOA 4I9LA 4CJUA 4C5EA 1SSFA 1QE1A 3KK2A 2RHXA 3ITHA 1EKEA 1U04A 2BGGA 2NLUA 4M41A 4Q5VA 3OYAA 2RJFA 4BE2A 5J39A 1TVRA 1VSLA 4CEEA 3WNGA 1VSJA 1SKSA 4PL6A 1CLQA 2OYQA 4LSLA 3VQ8A 4Z4GA 1CZBA 3NF8A 1C0UA 3DLKA 3AO3A 3VQBA 4BDZA 2ATQA 4RW8A 4JS5A 1UWBA 4E19A 2EKOA 4RW6A 4CHQA 4W5OA 2O4XA 3L42A 4A4FA 2DIGA 2ITGA 2PYLA 3RR7A 4CJEA 4CJKA 4KHYA 3H08A 3DI6A 2I5JA 3QEVA 4KFBA 4N5SA 3SJJA 4RW9A 4CIGA 2RN2A 3DLEA 2E4LA 2P5OA 2X35A 1L5UA 3MP1A 1TKXA 4DS5A 4RG2A 3NH0A 2EQJA 3V1OA 2IDOA 3C94A 1BQNA 4KHSA 4FJIA 3AO5A 1TK5A 4N4GA 3I8DA 3C6UA 5CZ1A 3TAMA 3WNHA 3KKRA 3K5LA 1U45A 3RMCA 1A5VA 2YNGA 1ZBUA 4W5RA 1TAQA 4BACA 5HRNA 3ZT2A 3DB3A 4DSEA 3TAEA 1RILA 5J2PA 4FLUA 4MFBA 2KTQA 2IG0A 4EP4A 1JXBA 4DSKA 4FJJA 1OI1A 4B9VA 1JL1A 3KKSA 1J9AA 2HQEA 3LPTA 5KRSA 4Q0BA 1N6QA 1IG9A 1SL2A 3WNFA 5C0MA 3BDPA 3LGLA 2YKMA 3VN5A 3QBYA 3KIOA 1IKYA 3KUFA 2QXFA 3HL8A 4YNQA 3CM6A 4FJKA 3V9WA 3DYAA 3DOLA 1YVUA 3DLMA 4O55A 2O4IA 3AO4A 2NUBA 3ZT0A 4B08A 1JLEA 3OS2A 2VYTA 4CERA 1U48A 4I7FA 2JTFA 4FLWA 2XHBA 2G8UA 3K5OA 2HHQA 2BDPA 2G8VA 3LP3A 5KCHA 3AVFA 4B9SA 1H3ZA 3TAQA 2ZE2A 4CECA 4FJMA 3NDKA 4ZHRA 1NOYA 1S6PA 3UT1A 4F4KA 1S5JA 4CF0A 4W5TA 1EETA 3HXMA 2RKIA 3QETA 3QEWA 4DFKA 1HRHA 2EQUA 3NGZA 3F9KA 4CGDA 4HHTA 4KB1A 4KO0A 1RT6A 1S9EA 3AV9A 1LWFA 4KHUA 4BDYA 3MAQA 3OYLA 3PMIA 1O1WA 4CEQA 5CZ2A 1XI1A 2D0AA 1QQCA 3P8DA 3ZSXA 4CJ5A 2YNIA 1RDBA 1NJWA 2B8AA 4ELVA 1UAXA 3ZSRA 2BKDN 3VQQA 4FLVA 3MXMA 4YFUA 2F8SA 2PZSA 3OVNA 3LZIA 3HPOA 5K14A 3WNEA 2BE2A 1YTUA 4E1MA 2BIVA 1A5XA 3LX7A 2F5KA 1SL0A 4CFDA 3PY8A 3HPGA 4KAZA 2M0OA 5I42A 2P5GA 5IAYA 3AA3A 5C42A 1JLBA 1HPZA 2RI2A 3VQ5A 4CJFA 1WSFA 4CHNA 4Z4FA 5KE2A 3SUPA 4E3SA 3H6ZA 2YV0X 3HPHA 4KI6A 2HW3A 1NOZA 1RBRA 2HVHA 3SCXA 4FW2A 5HRSA 4KB0A 4C8KA 4CHYA 3M8SA 5T7BA 2BANA 4Z4HA 1B9FA 1S1XA 1NJZA 2IC3A 3QO9A 3AVJA 3S9HA 4DSJA 4FM1A 2CKKA 2XO7A 1RT5A 2IOCA 4FJGA 4N47A 2G8KA 4DF4A 3L8BA 4DTJA 2Z1GA 1TV6A 3AVBA 3LP2A 4DS4A 5C25A 2RHZA 1WNSA 3M8RA 4PLLA 1QSLA 4CEOA 5D3GA 4AILC 5M9OA 3ZEHA 2L8DA 1HMVA 3CFRA 2FHDA 4GY5A 1NK9A 3O4NA 1S1UA 1RBUA 3PMTA 3RWUA 1J53A 2LRQA 3ZT3A 2XY5A 1QSYA 4FYDA 3MEGA 2HVIA 2MWOA 2KW4A 1BGXT 1DTTA 2OPPA 3IRXA 2D5RA 2KZZA 2PYJA 2Z1JA 3V1RA 3T1AA 3KD1E 3NF7A 4CFAA 3HVTA 3KLGA 2G8IA 5DMRA 4M3TA 2O4GA 3LWLA 3K59A 3LAKA 3S3NA 1NK6A 1XHXA 3I0RA 1WLJA 3V9SA 3KD5E 2YNFA 4CJRA 2XY7A 2VG5A 1T05A 4DTNA 1WGSA 3AVLA 4NCGA 4DSLA 3ZT1A 2OZMA 1VSFA 4HUEA 4C5GA 2OA8A 2OPSA 4N56A 4B9NA 4H4MA 5FRMA 1C0TA 4HCBA 1MU2A 4K8XA 2RHYA 1WSIA 3V9UA 4CEBA 3AO1A 3HP9A 4UQGA 2PQWA 2KZMA 4DU4A 1EP4A 5JS2A 4CJPA 2Q3SA 4CHZA 2YKNA 4F2RA 4NCBA 4A4GA 2LSNA 1C0MA 1NJYA 1WJSA 2RI5A 4FLZA 5HP1A 1TK0A 1RBVA 2EQKA 2FBYA 3F73A 2VWKA 1WSEA 3G10A 3CQ8A 4CEDA 1IH7A 2F96A 2D9TA 3E01A 5KE3A 3MECA 3FC3A 3PO4A 2B5JA 2HHXA 3D0PA 5D6YA 3LP1A 1FKOA 2GBZA 1VSKA 4KHWA 3V9XA 3SPYA 4DTUA 1HNIA 3NF9A 4BWJA 4Z02A 4KI4A 4LD0A 1I3AA 3VQCA 3KJVA 1OZ3A 3OB9A 1NKEA 4FJLA 3V1QA 3RMBA 3A2FA 3VQ7A 1IKXA 2DFFA 3AVKA 4WE1A 3QEPA 3IS9A 1R0AA 1SV5A 3LH0A 4N76A 2K3YA 5FROA 3L2UA 4DF8A 4E7KA 3NH2A 1RTDA 3ZSVA 1ASUA 4CK1A 4W5NA 4FK2A 3DM2A 4Q5WA 4CJLA 2VWJA 5HROA 2A1RA 4RW7A 1Z25A 3FEOA 5SZTA 3IG1A 1X9MA 3TWHA 3OYFA 5J2MA 1Q9XA 4OPKA 1SUQA 2DY4A 3SV3A 2RJDA 1RT3A 4FLXA 3C95A 2X6NA 3HO1A 2XDPA 3MXJA 4JLHA 5KTQA 1G15A 1JL2A 3PFSA 2IS3A 2HHVA 3KLHA 3OQ5A 1BISA 4CGHA 2JZ2A 3M8QA 1C1AA 4DU3A 1HQEA 1NK0A 4QVZA 3OYEA 4FJ5A 3OYCA 2XRIA 3E9GA 4O0JA 3NGYA 3QIOA 3U6FA 4DWIA 1BQMA 4B9LA 4CJVA 4QW2A 3HM9A 3K57A 3ZSYA 2YHAA 1BI4B 4IBNA 1S1TA 1JLGA 4DFMA 1WAJA 4KTWA 4E89A 3HVRA 4EP5A 4NCAA 3ASMA 2XY6A 4KV8A 1D9FA 2M16A 3FLGA 3JYTA 1RT7A 4QAGA 4F3TA 3OYBA 3VQEA 5EU7A 5CYQA 3OYKA 2E6LA 4CF1A 1QS4A 4NYNA 4DSFA 3QLHA 1N27A 4CF8A 2JLEA 4O44A 3V6DA 4IUUA 3K5NA 4QQ6A 1BCMA 1TKZA 2E6MA 1WAFA 4E7LA 4H8KA 4DSIA 2EHGA 4CCHA 4CFCA 1RT2A 3OA6A 3ULDA 2KFZA 3AVNA 2XK0A 2PY5A 2G8HA 4K8ZA 4OKEA 1I39A 4FJNA 1Q9YA 1EX4A 2M1HA 4BDPA 3AVMA 2G8FA 1C1BA 3RRGA 4FLYA 4KTQA 3G0ZA 3NTKA 1RTJA 1ZBLA 2LTOA 1ZBFA 3Q1JA 3AVGA 2GFAA 3LYIA 1S9GA 1TKTA 3SNNA 1X1PA 3K5MA 5KCOA 1D8YA 3META 4M3UA 2RJEA 1G5VA 3C6TA 4LY7A 4CJTA 3TAFA 3S3MA 1T03A 4AHRA 3MEEA 4CE9A 3RMAA 3L2QA 4A4HA 4QQDA 3OS1A 3C4SA 4IUPA 1X9SA 4M3RA 3U3YA 4LSNA 4CHPA 4F3OA 1W0HA 1S1VA 3HT3A 2AJQA 3NGIA 3OYMA 2E6NA 1Y97A 1BIZA 1ZBIA 4DTMA 5KRTA 2Z1IA 4GW6A 4KHNA 5KH6A 4CESA 2O4XB 3DLGA 1ASWA 5KI6A 4N41A 2X74A 1NK7A 4HCZA 1WSGA 4DLEA 4RW4A 3MEAA 3LDSA 3QNNA 3M9QA 1XHZA 3JSMA 4LH5A 1LWCA 4OGCA 1LWEA 3H8ZA 3O3GA 3NHGA 3GOXA 4ELTA 1XWLA 1T8EA 3KTQA 4DQRA 4J2AA 2HNYA 3PX4A 3AO2A 2R5AA 2FBTA 1DLOA 3HP6A 1UOCA 4FK0A 1FKPA 3ALYA 4N4IA 4CHOA 4DG1A 1RI0A 1J5OA 5KGXA 3SYZA 1EXQA 2HB5A 1L3UA 4ZTFA 2DFHA 1D5AA 1Z26A 3QJ6A 3DRSA 1B9DA 3ASKA 1TL3A 3DLRA 4OJRA 3AA2A 1KTQA 3TR8A 1CXUA 1RTHA 4CGIA 2Y1IA 5CY4A 2JGUA 5HLFA 4B9TA 4IUVA 4CK3A 4KHQA 1CXQA 3KK3A 5CIUA 2HHTA 1VRTA 1VSIA 4Z4IA 1KHCA 4CGFA 3OS0A 3AA5X 1L3VA 3CG7A 1T7PA 1KVAA 1OZ2A 5D6XA 1KCFA 3E9FA 3VQAA 1HYVA 4DTPA 1HQUA 2R5MA 4DTXA 2QK9A 4PUOA 3NF6A 2X6SA 3OJSA 2WACA 5IN1A 2F8TA 3QEIA 1BI4A 3LP0A 4FZZA 4IKFA 1F21A 2QQRA 1C6VA 3SQ4A 2K3XA 3NFAA 2DFEA 4CGJA 3TAPA 2RI3A 4B8AB 1J54A 3T19A 3RR8A 4IUTA 2P0KA 2X4WA 2B6AA 1RT4A 5JS1A 4DQPA 3QINA 1HNVA 3B6OA 4JRQA 4E7IA 4FU6A 2L3RA 1ZYQA 3PX0A 3OYDA 3O3HA 5FDLA 3KLFA 4FM0A 3ISNC 2G8WA 3P8HA 2BUDA 5I3UA 3SQ2A 1W9HA 1RCHA 4C8NA 2VG6A 1JXEA 4IFVA 3L3VA 4HUGA 3VQ9A 5FRNA 4DU1A 4FM2A 3DLHA 3RTVA 4O5BA 3BGRA 4M3WA 1WJRA 4BE0A 3OY9A 5J2QA 3IAYA 1RBTA 4HTUA 1UA0A 1NKBA 1RBSA 2X4YA 1NKCA 3SV4A 1SL1A 3RRHA 2OZSA 1NK8A 1YT3A 4HCCA 1LW0A 5E41A 3HK2A 4EZ9A 3O8VA 1OYXA 2ZD1A 5C24A 1KVBA 4E1NA 3AA4A 4L59A 4E7HA 4CFBA 3AVAA 4EDUA 3VQ6A 4A4EA 2W42A 2RHIA 4UC4A 4FJHA 1LW2A 1RDCA 1RDAA 3PUFA 4FXDA 1C1CA 4PLIA 3PV8A 1VSEA 2QQSA 3LZJA 4CIFA 4DTRA 1LAVA 4FZYA 4IG0A 2OPQA 4IURA 1JLAA 1HJRA 4CF9A 1S1WA 4C8MA 1IO2A 2FBXA 1CZ9A 3NE6A 4RG8A 4M42A 4FJ8A 3SUQA 4Z0UA 2KFNA 4C5HA 1FXXA 1JKHA 4OGEA 1YTAA 3RMDA 4Y1DA 3EYZA 1BIUA 4AHUA 3LALA 5J1EA 1U47A 4BE1A 4ICLA 1XC9A 1L3TA 3SD4A 4H4OA 3KLIA 1KFDA 5D6WA 1JLQA 3QKJA 3L2VA 4B9XA 4AHCA 2GV9A 2HMIA 3MXIA 2HHWA 3TAGA 4B9MA 3ZSOA 2X4XA 1ASVA 2RPIA 4FCYA 4BWMA 1JLCA 4TSXA 3PO5A 3V9ZA 3MEUA 1SKRA 3QESA 3V4IA 4R5PA 2DAQA 4M3YA 1KLNA 3DOKA 4Z4CA 4AHTA 4IG3A 1SKWA 1WN7A 4N4HA 1LAWA 4CGGA 5HRPA 2IGIA 4FLTA 1WSHA 4CJ3A 3HJFA 3MP8A 2WONA 3L2RA 2E5QA 2LCCA 2GFUA 4G1QA 3P1GA 3NBPA
chains in the Genus database with same CATH superfamily
2YU3A 2DRKA 3N4QA 2GZWA 2R5YB 5GANh 2BUPA 4G6TB 3H5AA 1N8RC 1VSHA 1OH5A 4J2EA 1K8AR 1HPMA 4KT5C 3P4IA 2L7FP 3NTIA 2HNHA 4W5QA 4JKAA 4C8LA 2HYJA 3QIIA 4CJ4A 3UWNA 1GOAA 2K9GA 1ZUYA 1G83A 5IHNA 3TSZA 4GYGA 1VQ5Q 4HAMA 2HKXA 4FSXA 3I56A 4XL9A 4JK8A 3LFUA 4DQQA 5GANf 1I8FA 4M7DF 2HYFA 1CKBA 2RHUA 1FTTA 1UUEA 1FLIA 1YQMA 3G3ZA 1YJ9T 1GRIA 1KQ0A 4PL8A 1A5WA 3E2UA 4HUFA 3L3UA 3QZ9B 2ZJQF 2WV1A 1RDWX 1GCQA 1O3RA 1ZELA 1TAUA 2OPRA 2FLOA 3GXOA 4C0DB 3S1QJ 3HSRA 4WK8F 2J4RA 5JVHL 4HG2A 2CGPA 4Y7NJ 3CC7N 2KJBA 3S1RJ 3ZQIA 1BJZA 3OMYA 5AQGA 2OI3A 1KSWA 2HKNA 1C0WA 2IVWA 3D45A 4PA1A 4WQ4A 2IS6A 1Q82R 1YN8A 1NK4A 2A68F 3CCQT 2P4RA 4CCKA 5A0DA 4B22A 1XDUA 2XIGA 3CPFA 2CS3A 1VQLT 5BRFA 4M3XA 1O75A 2KKZA 2DA7A 1FMKA 3MX5A 3RPQA 1FIPA 2D0CA 2VI6A 2CH4A 1QVUA 3O80A 4A3FJ 2JHJA 1AT1B 2YNHA 4CEAA 4PZJA 2B0LA 5L23A 2GTOA 4I9QA 4J9CA 1WJ5A 2ZMEC 1M1KR 2DOFA 2HQXA 1CGPA 3U23A 2DTZA 4IPAA 1ZGAA 1VQPT 3CJCA 2ZPGB 4HF0A 2OTLA 1IKVA 2P4WA 3TI0A 3F21A 1TQPA 3FDRA 2X3XD 3LGFA 1TOVA 3QP5A 3X25B 4WX9A 5HNHA 1QZEA 4DZJA 3NTHA 1M90O 2QM1A 4NC8A 2QDYB 4JJBA 1K73O 3QU6A 5J8CA 4ZZDA 1HLUA 2NNYA 3WXKA 3SI6A 4KGXB 2MWPA 4ZC3A 3DRPA 3S8PA 2JWTA 5J47A 3H5NA 2Y9YA 3D2FB 1UG1A 4OKJA 3SQNA 1S7OA 4WFNL 3I55Q 2ZXWH 4BJ5C 2DPNA 4LE9A 5EZGA 3EH2A 2VG7A 2HZTA 1FMVA 1Q1VA 3HOUJ 1HYSA 3NVMA 5H20A 1NHAA 3DAWA 3I56N 3VFZA 2MW8A 4AT1B 1JUMA 1YYVA 4RWTA 1M8VA 4JBAA 4M7YA 4OKKA 3TEEA 3R6OA 4HVWA 3ENHA 1UDLA 2ETJA 1JT6A 2JTMA 2LVMA 3AGKA 1JLFA 4LOCA 3EFOB 1NK5A 3V7CA 4BY6B 2DL5A 1QSSA 2YUPA 2EQMA 4LB6B 3OYIA 5LGTA 4DFPA 4DTOA 2LDUA 1FYNA 2QM3A 4H0XB 3A0BC 2NAZA 3TCJA 3W6KB 5H2FC 2W41A 1RAGB 4DV5K 4QPOA 4HX4A 3GNFB 4EMGA 2YHBA 4DV7K 3T1HK 1YRNA 4CEZA 1U4BA 2ZC2A 1M1FA 5M5YJ 4FWNA 3HG9A 4I2PA 2KDZA 4UV9A 4XU3A 3WU0A 2RF2A 1M30A 2IAIA 3MZ8A 5H1SQ 4BXXJ 2WOMA 4CUGA 2P9NB 1BHLA 1V54H 3EKSA 1ABQA 4I7HA 2ZJRL 2WSFE 4YTLA 3RDIA 1N5YA 2CUDA 4FW1A 4RGSA 4ZH4F 3MMVA 3H36A 2DNUA 1MDUB 1VQ5I 4AUXA 1YJNQ 3CF5F 5GMKm 1ULYA 2FF4A 5CQGA 4Y1CA 1RAHB 3QYHB 3O2PE 3I0SA 2AXLA 3PM1A 5IYCJ 4J2DA 2NUZA 1QRYA 2P9IA 2LKPA 4QCLA 5D8LB 1YJWA 1QHTA 1BM9A 5F64A 4IQJA 5FKLA 1H9TA 2F5EA 4M71A 4XQ3A 1J09A 5FPMA 4AFZC 4BG8A 5GAN3 3QAHA 4EZ6A 1MMDA 3BDLA 5TISC 2HQHA 4C92F 2JG6A 1IKWA 2QKMB 3L1PA 2OTLN 1MBHA 5J6XA 2OZUA 1FN7A 3MO8A 5HVQC 3BJOA 1VHXA 4KYWA 1CF7B 2LCSA 4NB4A 1VQ8A 2MH2A 4JRPA 2RN8A 4HV5A 3LM2A 3PNVA 1Q81C 4MNUA 1RNHA 1N32K 5DM6L 2ZGWA 2KLAA 4JZ3A 4NXMK 2LRDA 1MD0A 4BGBA 1KRPA 1J7KA 2R5ZB 4AI4A 3QPSA 3VEXA 3DRRA 5IXFA 5L3BA 3CPEA 2DA1A 4BAYA 4L9VA 1A36A 3H0GJ 1TQMA 2EYXA 2QBYB 4CJSA 4XLEA 2YWWA 5KYWB 3GIBA 3BG7A 3TABA 1ATNA 3S6WA 2GF7A 3BC8A 4OMOA 3SUOA 4F55A 3CCUT 2OCEA 2A0FB 2P9LB 1R22A 3VETA 3S16J 3TTFA 1QQMA 3CF2A 2IGOA 3ITHA 5LRRA 1EKEA 2NLUA 3Q9SA 3MWTA 4RAFA 3EG1A 4Q5VA 4GRIA 2NUTB 5HK0A 1DEJA 3PSIA 3UKUA 3DXMB 1VUBA 2ZXHA 4CEEA 3LSPA 4J83A 2HQAA 1MBEA 3CCMA 4PL6A 1S9HA 5BN8A 1CLQA 5J8FA 3EGXA 1VQ4A 2MBFA 2J6KA 4LSLA 2QCOA 2IRFG 4JJCA 4Z4GA 1CZBA 2FRYA 3AO3A 2RMOA 5JMVA 2K9SA 3VQBA 3ZX3A 3HC7A 5LJ3h 4BC3A 5FU7B 4XLPF 2L9SA 2MABA 3RTRA 5AZIB 1F43A 2QW9A 3NWSA 2EKOA 2EYWA 2EGCA 3GFMA 3TO7A 3I56T 1C0FA 4CJ7A 3KP4A 4RW6A 4W5OA 1QMCA 5HY6A 3I55I 2XAFA 2O4XA 3L0QA 3L42A 1NM1A 5M1KA 4PKIA 1I3QJ 4LK0F 4K2EA 3WTTC 1TWBA 4KHYA 4XRSA 2AIRB 1OQYA 2FA5A 2I5JA 1A31A 3QEVA 1D8JA 4N5SA 4F7ZA 2ED0A 1YCSB 3TTCA 3S6IA 4B1XB 5K5QA 4EHTA 3CDLA 3HUGB 1S72N 1X19A 2FBKA 5CYVA 2FMLA 4X64K 5AYFA 3MP1A 4RG2A 3NH0A 3S15J 1YJWN 3V1OA 3TBIA 3ZL7C 3OH9A 1MMNA 3FWEA 4RA2A 3G71A 1NGJA 1F36A 1OYYA 2IDOA 1M2OA 4O6JA 5GAOm 2NOBA 4EM2A 1MWKA 2ISYA 2ZJQL 5EYRA 1FNNA 3J80E 1JQQA 1RESA 3K5LA 2EFOA 1WHMA 1A5VA 1H3HA 3VJPA 3O9QA 2W40A 1VQ8N 5IT9K 3CERA 5HRNA 3J7YJ 2F5VA 3NEUA 4JUVA 2A40A 2XDBA 3C1DA 5GAN5 2LF8A 4BU2A 3OIQA 4DSKA 1SRMA 2XI9A 4J8FA 4QLCU 4OMNA 4IHTA 2O61A 4Y28E 4NBQA 2KRMA 1T0JA 1OCPA 4NNJA 1VQMQ 1IUYA 1SL2A 1FYLA 4Y92A 1YJNI 1LMZA 4L0YB 4WTOB 4M78B 3F5TA 3RMSA 1KZHA 3VS6A 4NLBA 2QYZA 1IKYA 1EBMA 4YNQA 1BB9A 2E1MB 3CM6A 5F27A 4BR7A 1KU7A 5EG0B 3BUZB 1FZPB 3CLQA 3UA7A 2E3HA 2O4IA 2NUBA 3FZFA 3C7NB 3ZT0A 4B08A 5LJ3j 2G0EA 3DWLE 4CYDA 5M3MJ 2DZCA 3CCMN 2X85A 5IP9J 1Q86U 1VQ4N 4YIRX 2A37A 4FLWA 3IH2A 4JI7K 4OMZA 2QGGA 2G8UA 3K5OA 3F8NA 4JJDA 3LP3A 2EZLA 2EZHA 4B43A 5KCMA 3F2KA 4B9SA 1H3ZA 4HVUA 1GLLO 3TAQA 1WA7A 3WVDB 1S5JA 2DERA 3PQKA 4W5TA 3GTJJ 2K3FA 1VQKA 4DFKA 1QHHD 2R7SA 2W48A 2BH1A 1WHJA 3AFHA 3K4MA 2A36A 3CCVT 4MDXA 2XASA 5IWAK 1RT6A 1S5LC 3W0LA 1Y96A 2LQWA 1R6RA 1Y0MA 4AIJA 4CEQA 2NRWA 1QQCA 1U8BA 3P8DA 3CCLT 3VODA 3ABKH 2YNIA 3TL4X 5AIQA 3TVTA 2B8AA 1D1BA 1UAXA 1Q7YO 4CCLA 3FHFA 3OR1C 3G6EA 3BR2A 2PZSA 1FTZA 3CC2Q 4LDYA 1FC3A 3WNEA 5GMKl 2L9NA 4OP0A 1KHIA 4E1MA 3QP6A 2V4JC 3WQUA 4J8OA 2BIVA 3KP2A 3S17J 3JCMc 4QPQA 2RKHA 3FBNB 2F5KA 3MCAB 5JLFA 2K9MA 3VS3A 4YFXF 5GAGP 1HSJA 3HPGA 1QKWA 5AN4A 4AVPA 3AKZA 4FOEA 2P5GA 1E6GA 4A3IJ 1E3OC 1JLBA 3WGGA 4JRIA 5F0XA 3VQ5A 3FMRA 5KAIC 3AARA 2BOLA 5DV5A 4NOYA 2FNPA 1U5TA 4E3SA 1VIEA 3L00A 4KH6A 3CF5L 4G7ZF 4KI6A 1XSXA 3J80Z 1KJWA 2RVCA 1RBRA 2EJFA 4EM1A 2ZZDA 3KX2A 2ASOA 4LDUA 1I6HJ 4KB0A 1NJIO 3IH3A 2OF7A 4Y3OA 1TT5B 2QA4Q 1Z9QA 4I01A 4G94A 2M0MA 4KISA 3H5RA 5BNGA 3JCMX 2ZNZA 2XO7A 4I6MB 4IL6C 4FETA 3BFMA 2IOCA 3CJ1A 4N47A 2G8KA 3L8BA 1SVLA 2DETA 2ELJA 2V7ZA 5GAEJ 2KLOA 2KRNA 3FJ5A 2ROLA 3CETA 3TSUA 2PX9A 1WNSA 4A2UA 4PLLA 1QSLA 3RKQA 2ZJPF 4ZN1A 4W97A 2B63J 1GBQA 2XDVA 1LDJA 1AD5A 2FHDA 3R1XA 2YUQA 4UUTA 1SAXA 3M4OJ 2M4KA 5J4VA 4D8DA 1H88C 1YIJQ 3TW6A 3NMZC 1KQJA 1NBWA 1VQMI 3MEGA 4XH4A 3JRCA 2OTJQ 3VYGA 2KW4A 2R7RA 1XTAA 3QYFA 2KZZA 4KIBA 2PYJA 5EX5A 1Q81O 3T1AA 3BY7A 1YW9A 3ROUA 3JB9D 4JEPA 3V7RA 5JLHA 2XHIA 2O8DB 1XDSA 3GTQJ 2LP5A 3LAKA 3ZMUA 3S3NA 3OSSC 4IHXA 4JD2A 3IV5A 4JI8K 2YNFA 1R71A 2JQ7A 5LMUK 2QWPA 3G6EN 3AAPA 2VG5A 1T05A 3RMQA 1WGSA 3HPWA 3H3OB 4N4NB 1QLYA 2MC3A 1VSFA 5FU6C 2OZMA 4WXCA 2O2OA 4DJAA 4J9BA 2KP6A 4N56A 4B9NA 4CVNE 4H4MA 4LGWA 4ZZLA 1C0TA 3ML6A 4HCBA 2WV0A 2RHYA 3V9UA 1CQTA 4C8QC 4ESJA 1M9SA 3ZQQA 1Z0XA 2PQWA 1NG6A 1RUNA 5LL6S 5JS2A 3S2WA 2Q3SA 2HHHK 4HQEA 4AG1C 3DBRB 1WJFA 4AMCA 3G71T 4H5TA 4P9FA 3L6QA 2V8KA 3J80O 2Y90A 5J40A 2HD0A 2V1NA 4RGUA 1Q1HA 5L3GA 2M5WA 2KYMA 4BEHA 2D0PA 2HL5C 5HK3A 1TK0A 5KN9A 1KD1R 3JRAA 2JW4A 2CZ0B 1TYQB 1YJ9I 1WSEA 1KFZA 3TO9A 3TEDA 1VA7A 4RBOA 2K4YA 5CKTA 4FYVB 2IP2A 2D9TA 3BPVA 3S32A 4BRIA 3CC7Q 5IHIA 2HHXA 4RMOA 2HF4A 4OMMA 3CC2I 2LQNA 2JUGA 1Z9ZA 4DEYA 2RH2A 3V9XA 3SPYA 3BR3A 4DTUA 3JREA 3KNTA 4FIBA 2XB5A 2P0PA 3A8OB 3NF9A 4BWJA 2P9KB 4IDHA 4LK1F 4C8QE 3KJVA 4ASNA 4G9YA 3FLCO 2MAMA 4YOQA 3OB9A 4N0AA 4XOPA 3QBWA 3QMLA 4FJLA 1HKSA 3RMBA 3A2FA 3G73A 1XOVA 3K70D 3ID6A 5FKKA 5JLXA 1R0AA 3UF4A 1JI8A 3A8LB 3F8CA 2KDOA 4N76A 3FHNA 4DF8A 5FW9A 1P6RA 1IN5A 2CZ6B 4RS8A 4NQWA 3CWAA 5I22A 2Q31A 3CQYA 2NZTA 2PVDB 1PD1A 3S1MJ 1SMYF 5HROA 2GTDA 2HXOA 4E47A 3GFLA 4RW7A 4IHWA 5LJ3g 2PQ8A 3THYB 3BTIA 3VB2A 2C0OA 3OYFA 1ZBSA 1Q9XA 1D09B 2GUPA 1SUQA 2DY4A 1XQHA 1Z6TA 1RR7A 1U8RA 3ZETA 2X6NA 1OQKA 2J7IA 4BXFA 2HQNA 4M77C 2XDPA 5A2QE 5KTQA 1UB4A 1VQKT 1JL2A 3T8TA 3QU3A 3T5XA 4HWIA 3OQ5A 1BISA 5KYXB 5DM7R 3IWZA 1JRIA 3VTHA 4CZKA 4DU3A 1HQEA 1NK0A 1JXOA 2GM4A 2RN7A 1R49A 3E9GA 4N9IA 1G8XA 3QIOA 1YIJI 2IGNA 4Y91A 1BQMA 4CJVA 1O3SA 1RAAB 3THXA 2OTJI 4B3MK 3VENA 1S1TA 4E7SA 5IYBJ 3KXTA 5GAN4 3VYUB 3IL2A 1PVEA 2YLBA 3HVRA 4NCAA 1GL5A 4KV8A 1LEAA 1SF9A 1WH7A 1VQ6Q 4DR6K 4LIVA 5KHDA 2M16A 3FLGA 1BUPA 1UZCA 5D6FA 1EJ9A 2E1ZA 1PG5B 3F0CA 4QAGA 1ZBXA 1U3EM 2YX7A 2CUEA 3WGHA 2A6AA 2OFKA 3CMAN 4F16A 1B72B 1G2HA 3OYKA 1G3TA 2BZTA 4Y13A 5D5WB 4XRSG 4NYNA 3ENOA 3L1AA 4CXFA 4RB1A 3RSEA 2L7ZA 1N27A 3EFRA 3JCMd 4O44A 4UY8I 2R7ZJ 1R4MB 3J81K 3K5NA 2R4GA 4PKHA 1TKZA 3J7ZO 1WHLA 4RTTA 3CC4A 4ISGA 3Q0UA 4JN4A 1LDKB 3F23A 4DR3K 1K9MC 2LQKA 1RT2A 2KFZA 4XRFA 1I39A 1ATSA 2QSHX 4BY7J 1GLAG 5B1BH 1Q9YA 2J06A 5CR4A 1UCRA 2A5YB 2LY1A 2G8FA 1C1BA 5EY4A 2AZSA 2DEUA 2Z1DA 3G0QA 4D1QA 2X4JA 3A5ZB 1ZRCA 3G0ZA 1U6ZA 1ZBLA 1QVGM 1KEAA 1ZGWA 4O3MA 3A02A 3CUQC 2OTLQ 2YG9A 2XDDA 3FXKA 1X1PA 3K5MA 4GLKA 1QQOA 3CI5A 2E12A 4AF1A 2BXZA 2W82A 1LEBA 1ENHA 3HTUA 4IJAA 1JGGA 3CC7I 1WBBA 4A4HA 4IFEA 2O8BB 1WEGA 4O5VA 3C4SA 4PJMA 5E20A 4JYAK 1X9SA 4M3RA 3U3YA 1OCRH 2K7AA 2V9KA 1OEBA 3GG4A 1W0HA 2GXBA 2Y48A 2YJFA 5F0FA 3HT3A 4GV3A 4MZMA 3NGIA 2QGUA 3SDBA 2ZJPL 2K86A 2EILH 1ZBIA 2X3WD 1UHMA 2PJRB 3GX4X 3K2AA 1JTYA 1X2MA 4CSWA 3GTOJ 4BRDA 5IPAA 5GAMh 3AGRA 3RYRA 4M7XA 3DLGA 1KG4A 4ME7A 5KI6A 1HBXG 3TREA 1IUFA 1AA7A 3LCNA 3D7SB 1NK7A 4KN4X 4A2BA 5DPKA 4AYBA 1W5SA 4RW4A 5AIPA 3I59B 2CGHA 5C0YA 1POGA 5A2QZ 5I9EB 4M4ZA 1S8NA 2E2JJ 3M9QA 3JSMA 3U9GA 5F2RA 5HS7A 1U6GA 1OYWA 1EFNA 2JTVA 1KQ2A 3I5UA 3B8AX 3O08A 3SMSA 2M0CA 4F93B 3MKWB 1XWLA 2ASMA 1JTXA 2LF7A 3VYTB 3OR2C 3AO2A 5JICA 1FW6A 4L9NA 3TQ7P 3DPLC 3ZP5A 2GXAA 3HP6A 5K1YA 2HEOA 5DTDA 4YORA 3CC4N 5LJ5e 2H3GX 3GTLJ 4PJOC 4DG1A 3K4BA 1IGQA 2JPSA 2XIDA 4JI2K 1VRLA 2ECZA 1EXQA 2HB5A 3KP6A 3O8GA 4IRHA 4QVDA 3G4SQ 3M6GA 1TU0B 3BQZA 1L3UA 3S2DJ 2DFHA 1QP3A 2L01A 1S72Q 3QJ6A 1HKCA 1OCZH 1T6DA 1YJWQ 3ASKA 4J19A 1KTQA 3M9AA 3K4KA 3O9UA 4AI5A 2JGUA 2FSKA 5HODA 4C8QF 4B9TA 2A5WA 3DLLF 4OIRF 2OZ6A 2JVVA 2VV5A 2A08A 5C15A 4EM0B 1N33K 1VQ6I 3DP7A 1KHCA 4DV4K 4B21A 3OTOK 1VQ8Q 1LNWA 3ONQA 3E9LA 3E9FA 1HYVA 3FRNA 5BPMA 1HQUA 3GYHX 3VGLA 1SHGA 2P9PB 2DMQA 4DTXA 4JKBA 4PUOA 2ABLA 3NF6A 3UR3C 5LFAA 2K9LA 3ZQLA 5IN1A 4FZZA 1QQIA 1DP3A 4PJOE 1AOJA 1K8AC 3SQ4A 1OX9A 1PC0A 4CGJA 3AAFA 1O4XA 3BJ6A 4H4KC 1VQ9A 1XMXA 2QF7A 4B8AB 1W5TA 3TMOA 2WY8Q 1J54A 3K1NA 1UAAA 5GAMj 3KETA 2X4WA 2B6AA 2V79A 1YE9A 1RT4A 1QPMA 3WG7H 5AQUA 3W6JB 3QINA 3D5RC 4XLNF 3FJPA 2I8DA 1HNVA 4B47A 3KVGA 3M4YA 1ZYRF 2L3RA 5M1NA 3PX0A 4WXDA 3O3HA 1W2BP 5FDLA 3E6BA 2BBYA 1J0RA 2MSYA 4PGHA 2O7OA 4CZCA 1W9HA 2JMCA 2VG6A 1ON1A 3CCMQ 2UU9K 3GWZA 3ZPLA 5A2QO 5E3MA 2OTLI 1MNDA 2NOGA 1VQ4Q 4ZNXA 2JWLA 2WSCE 4KICA 3CCRA 4DU1A 1ZUUA 4M3WA 3O9RA 4KNYA 1TH7A 3IAYA 1JJ2S 3D5SC 3H45C 1UGRB 4C1NI 1HKQA 2SRCA 1Y1WJ 1IRXA 3VSLA 5E17F 1NK8A 4II2A 2VBWA 2NUPA 4K11A 2V1DA 3O8VA 1OYXA 3HDDA 1T3VA 4U87A 3DEEA 3GZNB 4AIKA 2YG8A 2ZD1A 4A4KA 3WXMB 1Y6IA 4XONA 1RL2A 5GAN8 2ICWG 4Y0WA 3L09A 1Z3XA 1KVBA 5KYUB 1ETOA 4BR5A 4M77F 4FISA 1VQOQ 4CFBA 1J5YA 3AVAA 1NM7A 3VQ6A 3FXLA 1TBXA 2FG0A 2PVGB 1D0YA 3G1JA 2HU9A 3SJHA 2AKLA 5IP7J 5CHIA 1HW1A 1WFWA 1IDZA 4FJHA 1DP7P 1M27C 1WI7A 1ZH5A 1M1KC 4M77D 3JSOA 2VQEK 3A2KA 4UUVA 3LZJA 3ZX0A 2PFUA 4A54A 1LAVA 3HI0A 1HF0A 3AT1B 1BN5A 2UUAK 5LEKA 1Q18A 2FNAA 2EIMH 2O8KA 2D1HA 4C8MA 4JI6K 1NG9A 2QEXN 4DK9A 1IO2A 2LC2A 2L3SA 2I5UA 4RG8A 3R61A 4Z0UA 2KFNA 2QWWA 2G7UA 2W10A 4IO8A 2DOAA 4B8XA 4OGEA 3CC4T 2F6CA 2WA0A 4Y1DA 2DBBA 1BIUA 3U1DA 4XLCA 4BYYA 3C2GA 3VS1A 2RE2A 1ABOA 4A3DJ 4MDBA 2O9VA 1W2BA 3EPZA 4BE1A 4J6YA 1XC9A 4OIOF 3SD4A 5BR8K 1VQ9N 2HDWA 2LT1A 3QKJA 3I4NJ 3IFRA 3L2VA 2F5TX 3BPXA 4AHCA 2HMIA 4UVBA 3TAGA 1QWFA 5F1JA 3BG5A 3E6MA 4B9MA 3ZSOA 3M5RA 2XPVA 2QGFB 3DKWA 2NVTJ 1ASVA 4FCYA 1S72I 1TUYA 3OW2P 2DL8A 1E7OA 2M34A 1YJWI 4EPCA 3CDIA 3V9ZA 2V9VA 4R5PA 2DAQA 1W5CC 2BE7D 3RR6A 2FOWA 1IHVA 3CMET 4BQZA 1OYIA 4R55A 3K4LA 4J9EA 4BRLA 1UHFA 2O0YA 3UPUA 4A61A 3U9DA 2P6TA 4XMYA 1Z67A 2XROA 1P7IA 1SKWA 1K9MO 3GDQA 4CICA 3EG0A 2M02A 1VQ8I 1VOMA 1VQNN 4N9HA 5E3OA 3A5MC 2L2PA 1SG5A 4QTRA 4MLOA 1A04A 3HJFA 5DCMB 4MMKA 2PZ1A 1BC8C 3JB9G 2E5QA 2LCCA 3PIOA 4J9FA 3RJPA 1TUGB 2P9IB 1U2WA 2Q36A 4HPQA 4IDKA 1XGOA 1KC8R 1T95A 1U1SA 4X34A 1BI2A 5GIPA 3HSFA 2EJGA 3MEDA 3BZCA 3AVCA 3V7SA 5BOXA 4I2QA 4IOCF 4IZZA 1SSHA 1VTNC 3O3KA 3P8BB 2QTDA 2E3IA 3VF6A 2XAGA 3IWFA 4CZZA 1YI2N 4M77A 4M63C 2LFBA 3ZSWA 2JSCA 1HSQA 2DE0X 1IBMK 1N78A 5LEJA 4BG9A 4HBLA 3FXMA 2W57A 3G6EQ 3CWUA 3CCMI 4MQ9F 2LG4A 3K2PA 3FIWA 1XNIA 1M1EB 1VQ4I 1O13A 1TK8A 1RETA 3LSGA 4YPRA 1WXTA 1ZLMA 3O4QA 2IT0A 5D7UA 2MCNA 2E2PA 1X6GA 3FDYA 2RQPA 3SUNA 1RIOH 3QIPA 4DB3A 4DW6A 4P5OA 4OIQF 2P7CB 2COZA 3OBYA 2FBHA 2V75A 4KIGA 1TGOA 1T0FC 3UKUB 3DJCA 4GV9A 3GL1A 4J5YA 3U3GA 1MGTA 3MKYB 3I4PA 3CCSA 1UJ0A 2WUSA 2ED1A 2A41A 4PJOF 1K7AA 1WPKA 2CT4A 4M3ZA 4A53A 4ELUA 4ESFA 2O9SA 5EZHA 2NS8A 3BG9A 4BH9A 4E7ZA 2VVKA 4LDXA 3T69A 4EFHA 3UATA 1AWCA 3P5JA 3EZ5A 4UV8A 1VIFA 3DLLL 3AL0B 3LANA 3ZR8X 4H5NA 1ZARA 1FK9A 2E5KA 1N36K 1T6CA 4U7BA 3E6CC 4J6XA 3DTIA 1RT1A 2HNZA 1JKOC 2FX0A 4X1VA 1M90U 2H09A 4FQGA 4UVCA 3RERA 2VKDA 3L2ZA 2DMUA 4M45A 4OLBA 1LWVA 2VASA 1IXSB 1OR7C 3H6EA 2I7NA 3HSTB 4MQ3A 5ADXA 2VOOA 1VQ9T 2DYSH 1KQSS 1V76A 4EATA 3RKWA 4A0XA 5FFZA 4FT4A 1RDUA 4OMQA 3WEEA 2A28A 1ITGA 2Y4YA 3ASNH 5CKFA 5J1UA 4J9DA 5AZJA 2EQIA 4B9UA 2FSJA 1X9WA 4M75D 4F7UF 2EV0A 2Q1NA 5GANe 1NMNA 5CVUA 1PP8F 3MP6A 4OVAA 1QVTA 2NOIA 3NNQA 3MN7A 2KQ2A 3DFGA 3BZKA 1GOCA 5E8GA 4U67L 5ELZA 2JWKA 4FJXA 2EIJH 2XF7A 5F1RA 3QYEA 4MLHA 4C92B 1WUAA 2Z0WA 1NEBA 2GEMA 2GELA 2EX3A 3QHSA 3QYGB 3G2BA 5GPAA 1H9GA 4A5NA 4G9ZA 1UGPB 3CCRT 4ZTJA 1B07A 2COWA 1P90A 4BNCA 2AP1A 2CUZA 4U0VA 4B3SK 3NHNA 2VC8A 3PVLA 2GGRA 3GFIA 4UUSA 1XG7A 1BO5O 5AFUA 5CVVA 3HOZJ 2QWRA 3GOIA 5FLMJ 4EJOA 2V1QA 4II1A 1R36A 4NC6A 2VKVA 2HHSA 2HOSA 1R8OB 2W84A 5BPNA 5IT9E 1M8MA 4AHVA 3ZSQA 3M3YJ 2F4MB 4GMJB 3M8PA 2C6YA 2HZYA 4C3HJ 3JS6A 3UNGC 4EV0A 2RAEA 2X48A 1KG7A 3LAMA 3MWMA 4PWDA 3PSFA 4B1WB 3CO6C 5L3FA 4P5NA 3NAEA 5J1RA 5DD8A 1X2NA 1ITYA 2VGMA 5B8HA 1QVFP 4F8RA 1SFKA 3BE3A 2R7OA 3A01A 2A1SA 3REOA 2A6HF 3QEXA 1IREB 5CPRB 4BQLA 2YDLA 3QRFF 1U2VA 4GVMA 4F2SA 1JCEA 4A63B 4EW4A 4JKCA 4CF2A 4ZYGA 3BTLA 3VA0A 2YRVA 1KYWA 3KLEA 2LDMA 4CZHA 3CMAQ 4ENMA 1R23A 3F8MA 1HDPA 3G6EI 4M7DG 4H0YB 5C2DA 5KN8A 1T38A 2Z1HA 4K43A 3OYGA 3CPWP 2XPWA 5EEHA 2M0YA 4RTFD 4JDSA 1YUWA 1QWEA 4LUEA 3FXRA 1D5YA 3SBGA 2DMNA 3ZYYX 4DQIA 1U49A 3BQYA 4HT9A 2B4JA 4DMNA 1NGBA 4DQ8A 1F4KA 1FBSA 1M1KO 4M75A 4CC2A 3ZCOA 1GXPA 4IUQA 3J8AA 4LB5A 1WQ7A 3HSCA 3HXLA 3EHQA 1KFSA 4FHTA 3SDZA 1MMAA 2CSOA 3M58A 4IFYA 3K9KA 4F7UA 2W0ZA 1UGSB 3VA3A 4DBHA 4Q5SF 3CCEQ 2BE9B 1R5ID 3DPTA 4B8CA 4DOVA 4YRVA 4CJUA 2JA7J 1QE1A 3KK2A 3K0LA 4EJTA 2RHXA 3JTHA 2F48A 1QZ5A 4BI4A 1U04A 5LJ3d 3C6HA 3TW7A 4C30A 2H56A 4C23A 2Z99A 3UKRA 2L4MA 2RJFA 1T0HA 3QG1A 3R6MA 3BCBA 3H3ZA 4X9CA 3S14J 3DKMA 4FWOA 1SKSA 3LSMA 1WGXA 2KIQA 1R7JA 1QVFA 1C0UA 3J7AY 3DLKA 2HTJA 4NDLA 4LJZF 5JVGF 3M0QA 4IOXA 1G99A 1SPKA 5M5WJ 3ULEA 4HYEA 4Z6YA 2RF0A 1USSA 2IS4A 2HSEB 2E60A 2RQQA 4CHQA 1IDYA 3C18A 3FZKA 1M3BA 2F5FA 3WHCA 4MZPA 4IOCL 4A4FA 1EF4A 3CPWA 1LVAA 4M6XA 3H08A 3DI6A 2QAZA 2CV2A 4JHDA 3BTJA 3OOPA 3VUZA 4II3A 2J6OA 3DLEA 4Z88A 3IRRA 2X35A 3WQTA 1L5UA 5IT9Z 2E5NA 1D1AA 4L9JA 2P5KA 1VYUA 1TT0A 3C94A 1M90R 4KHSA 2RNGA 1K73R 3AO5A 4N4GA 3I8DA 3C6UA 5D5XB 3WNHA 4IRGA 3A8MB 2B86A 2YNGA 2ZSHB 2A5XA 2EV5A 2E88A 3OL3A 2M9HA 5K7ZA 1WJDA 1ZBUA 3QSUA 4PJLA 4BACA 4ZYDA 5IXBA 2HBJA 3DB3A 1BWFO 1S3JA 3LSRA 2EINH 1ETVA 2FB7A 3ZQCA 5J2PA 2OJ2A 3DKYA 1V29B 4MFBA 1GCQC 2IPOB 1OCTC 3VS0A 3CCST 3QICA 4FJJA 1OI1A 4PNOA 2EPFA 4KA4A 4B9VA 2V26A 2Y69H 1JL1A 3QBXA 1FMWA 4AQYK 5GMKh 3WNFA 5GAHP 2X9DA 4IRIA 4XTXA 4MEYF 1S7EA 2LKXA 2DDBA 4H5RA 3THWB 4DV2K 4WQ4C 2YKMA 5CJ9A 2H8WA 3DU6A 1HQCA 3KUFA 3MD2A 3HL8A 4H0PA 3E0JB 2IBDA 2ZPBB 3DYAA 3QOEA 1YVUA 3CMAI 2JOYA 3TOAA 3MZYA 2DA2A 2K7LA 3OS2A 2HSPA 5FD5A 2KAFA 4CERA 1U48A 1IG7A 3DPUA 4LF8K 2JTFA 1YO5C 4HA8A 1PRMC 2BDPA 5KCHA 2YHWA 4I99C 2LJ0A 1KG2A 4HEA2 4M6VA 2OANA 1SEMA 4M72A 1SFXA 3KZYA 4CECA 4FJMA 3L4QA 3UKGA 4WFBL 4D0PA 2KGTA 1S6PA 3P7NA 4F4KA 2FMYA 4Z94A 5KYYB 1W7PD 2Q8KA 3PT9A 3QETA 3QEWA 3CCYA 2NS0A 1PUFB 1M2VA 1S1NA 1HRHA 2RK2A 1I0CA 2EQUA 6PAXA 3F9KA 1JCGA 4M7AG 1V55H 3LH5A 3AV9A 3H35A 3IKVA 4HF2A 2P9UB 3ATVA 1B9NA 4JK7A 3JCMf 1KD1C 2RPNA 5AQHA 1HUXA 5CZ2A 2KR3A 1KAXA 3NARA 4PFZA 3JCMV 5IT9O 1S29A 3ZSXA 4D8KA 3GLLA 3I53A 1RUOA 5E1XA 2BVMA 3VPZA 2NS7A 2ASPA 1PD0A 3LL7A 3ZSRA 3VQQA 4FLVA 2O3FA 1OX8A 3I35A 3PJRA 2JJ9A 3O5ZA 1RZ4A 1BG3A 5BRHA 2KHOA 1T6SA 5K14A 2W6LA 3KP7A 2M87A 4V2FA 1BR2A 3CZ6A 1N34K 3LX7A 5BRDA 1NYGA 4FT8A 4EVIA 2AA4A 1UEBA 2CQXA 1NGNA 2HBWA 4AFQC 1FX7A 2JHNA 4ITVA 2VLAA 2KYBA 1WJEA 1XB4A 4RTUA 3I9QA 3CXCP 5C42A 5EGOA 2XVCA 4GKKK 1QVGA 4CJFA 4CHNA 5CE3A 1NJIU 2DA4A 5KE2A 1SRLA 2OV7A 3X20B 1YP5A 2XAQA 2JMAA 2O8XA 4A3LJ 3VGMA 1Y64A 1VQ7N 1PUEE 1WNLA 4XQFA 2QEXQ 4WF2A 2BTFA 4FW2A 3CWSA 1T0FA 4A12A 5CKHA 4Z4HA 2Y0SA 1AKHB 1ZSZA 3I8BA 1YHQQ 1B9FA 2GWJA 3QO9A 4DZPA 1W97L 2BW3B 4FM1A 2CKKA 2HF3A 3SAHA 1U06A 4KH0B 3F6VA 4KH1B 2HXIA 2STWA 1K8AU 2RV8A 2GWRA 5JR3A 4XKBA 1OULA 3CC4I 3T1BA 4DF4A 1UFMA 2VWFA 1TV6A 3LP2A 3CJTB 3I4MJ 2DLLA 3JSPA 1W7PA 4CZJA 4AILC 5TJJA 1UB9A 3CCQA 3ZFJA 1VQLA 2VN2A 4GY5A 3O4NA 1MH4A 3EGDA 3PMTA 4BVPA 2LRQA 3ZT3A 1QSYA 1G4DA 4FYDA 2HVIA 1GUUA 2VT3A 2VJ4A 3BY5A 2PMHA 3IRXA 2YXYA 3AHUA 3J7AF 2Z1JA 2YLCA 3DXKA 1JKQC 4EJVA 1MMSA 2KMUA 1VQNQ 4XH5A 4KGZB 4BQQA 5DMRA 3LWLA 4ZDLA 3CBPA 1J5EK 1VQPA 1NK6A 2NOJB 2COMA 2OU2A 1XHXA 3V9SA 3KD5E 1YTYA 3PLAA 2JJ7A 3PO2J 2R5YA 3J7AO 1UECA 5JVTA 3AVLA 4L6V5 4DSLA 2KIFA 3ASOH 3EG2A 4HUEA 1Q82U 4X66K 1GDTA 1B8IB 2OA8A 5JVGL 3J81E 2ZXIA 2CO5A 1B1BA 5GTIC 4I6ZA 5FRMA 2IGMA 2CMPA 3ABLH 2DX1A 2HR3A 2CYYA 3ZLJA 1MU2A 3VEZA 3EYIA 1YI2Q 1QHGA 3C65A 4KRTA 3HP9A 1N3AA 1QZ6A 2EWNA 4ZYEA 3EO3A 4XSXF 4LF6K 2L7MP 2QWLA 4CJPA 2E5LK 1ZRDA 5EOYA 2CH0A 4CI0C 2RNAA 5F1XA 5LRSA 2IIRA 4GXOA 2BE5F 2VYPA 1T3SA 2KFDA 4CHZA 1BBZA 2CP7A 1XCBA 2LSNA 5DD4A 4BL0B 3HHGA 1NJYA 1WJSA 1LE8A 2V1UA 2NRRA 5HP1A 1YS6A 3OOUA 1RBVA 2EQKA 3FZVA 2F5CA 2D1VA 1K61A 3MN5A 1KAYA 2CP6A 5ADXH 1UG0A 1WPYA 1YG2A 2A3ZA 1IH7A 2ZPEB 2CUFA 3E01A 1X1AA 4M3BA 1IB8A 2Q0OA 3R6SA 5AQZA 2EZIA 3LM9A 3WGIA 3VERA 2PFBA 3GW2A 1FKOA 4A3MJ 1VSKA 3CD6T 2BHZA 2FXAA 2RHKA 4KHWA 3U1KA 1I07A 1PDNC 3M54A 3PIPA 3EH1A 1YITT 3DBHB 1WZ2A 1O3TA 1T08B 3E1SA 2DU9A 1I3AA 2F69A 4ZN3A 5LL6Z 1WHUA 3CCQN 2KIUA 4CCMA 1VQLN 1P9QC 2KROA 1NKEA 2O8CB 3QOPA 3EUHA 1PU7A 1MIJA 3G25A 2W25A 2NXNB 1IKXA 1SV5A 1AU7A 4A57A 1MUZA 1HCRA 3LH0A 4C2UA 3HBTA 2K3YA 1Q7YR 5FROA 3R3LA 2GOXB 4EIAA 4E7KA 3NH2A 2QEXI 4B9QA 3HOSA 3QDFA 2BVLA 3ZSVA 4IQ4A 5AFUH 2NRVA 3DM2A 4Q5WA 2YSRA 3M07A 4CJLA 1YHQI 1OKRA 1VQPN 3FEOA 4L5IA 4DBQA 5SZTA 1XQSC 3IG1A 1BU1A 2V8JA 1X9MA 3KP5A 3BY6A 2E41A 2ZCFB 2UYTA 3DQVC 3B6CA 2P81A 1FY7A 3WODF 2KK4A 2CP0A 2QXLA 2YCHA 4RCBA 3D2FA 3MN2A 1VQ9I 4A3EJ 1G15A 2VXFA 2AXTC 3PFSA 3I0WA 1HOMA 1G3WA 4OFEA 2DYBA 2JZ2A 3M8QA 1SHFA 1C1AA 4UOBA 2BV6A 3H3VK 3VTIA 4O0JA 2DD5A 2DPUA 2EW3A 1NJIR 4DWIA 1N5ZA 2V6EA 2VKEA 4QW2A 2WB1N 3EFOA 4JKDA 3K10A 4C0ZA 2CGLA 1R59O 3KPHA 3EHRA 4B09A 4E89A 4BBSJ 3M0SA 2E1NA 5FJ8J 2XY6A 2ZPHB 3VRZA 1RI7A 5BR9A 2GNCA 4GGGA 4DNCA 4YG2F 1DPUA 2FF3B 1RRSA 5AQTA 1VQNI 3J81Z 4KH5A 4KBOA 2L3QA 4RMNA 1S3XA 4LDVA 2CV1A 3JYTA 3M57A 1SAUA 2ZCWA 2E10A 5AQNA 4WCIA 5CYQA 3REBB 2O9LA 2E6LA 1QS4A 1I94K 3CCJA 2E1CA 2GA2A 3O6WA 3CUOA 3V6DA 2RQWA 3D2EA 2EJRA 2YUSA 2E6MA 4BREA 4QT7A 4E7LA 3FMQA 3VYRB 2XKOC 1MUDA 4CC3A 4BRNA 4LNPA 4CFCA 5FB2A 3OA6A 2D0OA 3H9JA 5CVIA 1XGSA 1K1ZA 3K2ZA 2GIZA 1LDDA 4FJNA 4J9IA 1UE9A 1Q81R 1YI2I 5DUKA 2DA6A 1Q86O 2R7XA 3U8XA 4JV5K 2XRNA 3VDXA 2AQFA 2D0NA 3WU1B 1RAIB 2LTOA 5J4YA 1Z7UA 3H9QA 2NUPB 2SEMA 3KK7A 1N77A 1QU3A 1BI3A 1T39A 5KCOA 4ESRA 1U5TC 2H3EB 5CK9A 3META 1E3MA 2RJEA 1G5VA 3C6TA 2WAQN 4ZYAA 4CJTA 5GJVB 1YQKA 3TAFA 5LGUA 3BR0A 4BUPA 1TSFA 2DILA 2LREA 2K4BA 3S3MA 4AHRA 1T03A 5FU6B 2BXYA 2OAZA 2G6FX 4B1RA 4CZIA 1L0OC 2YHYA 3LDQA 4LF9K 4FWQA 2NRHA 3Q0WA 1A35A 2ECBA 2K3BA 3E3VA 5GAMd 4LSNA 3X24B 4CHPA 3VW4A 3VMFB 2KIMA 2JMWA 2RQRA 5CCAA 4C8QB 2D0QB 2VBYA 1I5OB 5C2FA 2BGCA 1NPRA 2K2MA 4X6AJ 2XV4S 1W4SA 2QTVA 1OISA 4M78D 1W0UA 4F3QA 1QZYA 1R4NB 4J01A 4KHNA 3CCUN 4CESA 5B3SH 1RLPC 2AHJB 2F2XA 2NUTA 2DN0A 3K6GA 1YVNA 2GBQA 4XTVA 1ASWA 4HCKA 4OB2B 3E5XA 1NTCA 4N41A 4RGRA 2X74A 5TKYA 4HCZA 3D6RA 4EMSA 3JAMK 4AU7A 3LAJA 4XOTA 1UJYA 4JKEA 3LDSA 1N9RA 4XM3A 2CGJA 3J81O 1XHZA 4LH5A 4IX7A 5KPRA 1LWEA 3KHYA 4B3TK 2UXNA 1ACMB 3NHGA 4B3XA 4B6MA 5I11A 2ZPFB 3WTZA 4OAZA 5AZIA 4U88A 2HNYA 1XGMA 4LITA 2R5AA 3CCJN 2FBTA 3QPLA 3N4PA 1ZREA 4FK0A 1FKPA 2XRLA 3VEOA 2EPDA 2VXEA 1LOJA 5BPDA 5CQEA 1HK9A 2DQRA 3E19A 1H641 4ZDPA 1XMQK 2JPBA 1MZBA 2P0WA 3RQIA 1YW8A 1NYFA 4PJJA 3DKXA 3C7JA 2QDLA 3HUGA 4LG3A 3CCVA 4ZTFA 1TUUA 3C0BA 2DZ9A 1D5AA 2IEKA 3HL2A 1TL3A 3DLRA 4ESBA 3AA2A 2VQLA 4K0KK 1CXUA 4M9XA 4CGIA 4M6YA 2F4IA 2Y1IA 2EB7A 5HLFA 4DR4K 1N3CA 3HRUA 3A4CA 2XGDA 4OF1A 3CCLA 1WXBA 3BTCA 1VRTA 2VC1A 4ILHA 1IBLK 4CC4B 4Z4IA 1IGUA 4CGFA 2FRHA 3IDHA 4JRKA 1JB0E 1IRGA 3AA5X 1L3VA 4FWMA 1T7PA 1TWGJ 3ZQHA 2DTOA 5D6XA 3VQAA 1G59A 2EAYA 4DV1K 2KJCA 2OQRA 2MIOA 3GPLA 4C0FA 5BREA 2AKKA 4FO0A 2WC2A 2O8EA 2QK9A 4M77B 2LVSA 2K40A 2X6SA 2DVEA 1HXDA 3JTGA 1BI4A 5I2SA 4DA4A 2XGXA 2DVJA 1C6VA 3NFAA 3L2CA 3TAPA 2KE9A 2YHTA 3N5BB 4IUTA 1K9AA 4XU1A 5DY9A 1DKGD 4IOAF 1E4GT 4M78A 2HEQA 2E1YA 3HFNA 5F0CA 1QVGS 1ZLKA 4E7IA 3MN6A 1E2XA 1JKPC 4FU6A 4B3AA 4DV6K 1M5Q1 1WYXA 2K2VA 3F10A 2DTHA 5EG0A 2CH5A 1WH5A 2LP0A 1SMTA 3KLFA 2CP2A 3ISNC 4PL7A 1ODDA 3P8HA 2Y9ZA 4XRMA 2YS9A 1RPWA 3WXJA 4N0AC 2IA0A 1BR1A 2OD5A 4YELA 3DTEA 1X4PA 2D8HA 1YBYA 3EG9A 4YDUA 2QLZA 1TQIA 4Q4ZF 4HUGA 5D5VB 4JNEA 4O5BA 3BGRA 1WJRA 1P7MA 4UXNA 3I0XA 4MO4A 1ZR2A 3GTPJ 2NVQJ 4WWCA 4M9SA 1R1TA 2X4YA 1I27A 1NKCA 2KXDA 5B66C 4L18B 4JYKA 2HCKA 4A6DA 1W2BM 4A69C 1X3MA 2PUKB 1YT3A 1KA8A 3BR5A 2YRCA 3RPUD 3CJ7A 3HK2A 5C24A 1P8ZA 4DBRA 3AA4A 1JUPA 1FYMA 1X3NA 3NFCA 2W42A 3CCVN 3KFWX 3H3UA 2RHIA 3DEUA 4UC4A 2M3AA 2GQVA 2E4HA 1QCFA 3QB0A 3X28B 2YSQA 3GTKJ 3IAS2 4Z8AA 3JRGA 4LFUA 3PUFA 3ZQ7A 4FXDA 2VJ5A 4C9YA 2CH6A 3PV8A 2KRHA 1MV0B 3E66A 2X6WA 2NRZA 1MUYA 2KISA 3CUQB 2IW5A 5LY3A 2DPDA 1ORKA 2DM1A 4FZYA 1E3PA 3QWLA 3ECHA 4KULA 4U7DA 3CCLN 1LPLA 2LNVA 1JLAA 1T44A 1HJRA 4CF9A 1S1WA 4KUMA 1LCUA 4CW7B 1WJAA 3CCJT 4LF7K 2FBXA 2RREA 1IXCA 3NE6A 1K83J 3N0UA 1BC7C 1KQ9A 2QASA 4JI1K 2KEAA 4JLGA 1GXIE 4RTVA 4EAHD 2MI6A 1X9JA 3CMMA 3RMDA 4HZFA 4PCQA 3QODA 3LALA 5J1EA 1U47A 2YHXA 4ICLA 1TG0A 4BHBA 5LJ3f 3LFKA 4B9XA 1MBJA 2BYVE 4UUSB 5M1OA 3MXIA 2HHWA 1VQ7Q 3A8GB 3FZHA 1LFUP 1QQNA 3HOVJ 4QS7A 2RPIA 1M1GA 1BI1A 3CQZJ 2EVRA 4BWMA 3GNGA 1DGKN 3EE9A 5AQRA 1JLCA 1N8RO 1GXQA 4Y33A 3C2BA 3FISA 3PO5A 3TP3A 4M3YA 3QDRB 3F8BA 1K78B 5KVRA 4HLYA 1VQ5T 3DCFA 4CDGA 3DOKA 4Z4CA 4AHTA 4I6MA 2ZPIB 2CSQA 3SJMA 3U4LA 1PSFA 2AT1B 3K70C 2NRAC 4KMUX 4RGXA 1WHGA 4KJZA 5M1FA 2FD5A 3VF4A 3PO3J 3OL4A 1UGVA 3ZMVA 2QSGX 2PBDA 3NRVA 4OWRB 2NOFA 1U2VB 4IEEA 2WONA 4RB3C 4CBUA 1NMDA 3HKZA 1VNDA 3FE1A 4G1QA 3OW2M 4PJOB 4MHGA 3ERMA 1TKDA 3RPUA 1X43A 2BEOA 1WX6A 4ON0A 4RTYA 1O57A 4AM7A 3SYTA 3WTXC 1ZG5A 2QQBA 2YUOA 1VZ0A 4CH7A 2F9TA 2XMFA 5FKNA 3ZN1A 5CYMA 4QOZB 4A3GJ 2QUFA 1HYZA 4CIEA 1BYMA 5DM7L 4OB1B 4K25A 2WTEA 4BC2A 5ICCA 3ULRB 2O8DA 1KD1U 4FL6A 1WLPB 3M8FA 3LPUA 1YS7A 1X1DA 4F92B 1AHJB 1Y7XA 1HKTA 4BQOA 2M4GA 1JKRC 1SKUB 1QCOA 1QTMA 4M75B 3KLOA 4JX6A 2QQ9A 1UFFA 2XY8A 3AVHA 3U21A 3BR6A 4FJ9A 3LQQA 3MKDA 1YQRA 1HLVA 1MSEC 4CJQA 2E2OA 1VQMA 1TW2A 1KGSA 1NWKA 2J05A 5B1AH 2BY3A 3S93A 2CZ7B 2X1EA 4F7UB 4XIUA 1JXSA 4GV6A 1ZBHA 4OLAA 1UA1A 3IRQA 4HTLA 3GE1A 2CDTA 4K42A 1TS9A 1ZQ1A 3H92A 4MDWA 5HNFA 3RESA 3EL2A 2KT0A 2DBKA 2EA4A 2ZXJA 3ERED 2QWOA 2CFXA 4O4GA 1K79A 4OVLA 1MV3A 4KREA 1VRUA 3SQ0A 3IP4B 5GAGJ 4FVMA 1KXPA 3RQ4A 1ARKA 5J2NA 1E17A 3VGKA 2CH4W 5J26A 4NL2A 5IY5H 3ZCMA 4E0DA 2L2OA 3JCMQ 4YOWA 4PQUA 1YJ9Q 5BN9A 3LSIA 3G71N 2JZYA 2GTJA 4HX8A 2K57A 1TYQA 3I55T 4AG2C 2FBIA 4CK2A 2DIQA 2XKOA 2CUBA 1LV5A 1DQUA 5FLXK 3CFOA 1P4XA 3ZOBA 4JZ4A 4PIIA 2Q2EB 4PY5A 4IHSA 1L3LA 2P51A 4DLGA 3K69A 2HQ5A 1JHFA 3THKA 4JKGB 1ORNA 3L2WA 1DDNA 4LD6A 4NZGA 2D45A 3TANA 5AQOA 1LJOA 4XKCA 1F9NA 3I9V2 3SWNA 4DOWA 4DBFA 2NOEA 3R6NA 4XU2A 1TL1A 5HLTA 4JHDB 3E7LA 1DTQA 2EFQA 1L3SA 3BZ6A 3W2AA 4IEJA 3HKZN 5LJ5j 2DD4A 3CCQQ 3WT0A 3DB4A 2MD5A 1VQLQ 3QWYA 2E2NA 1U9OA 4RAGA 1J3TA 5AQPA 2VQFK 5C6SA 2QKBA 4AM3A 3CC2A 4IOAL 1VQ7I 4CJWA 5M3FJ 1ONVA 4E4HA 1W1FA 3HYFA 4ID1A 3EGUA 3SZTA 4DV0K 3D4VA 1RNLA 3WTVC 4L9TA 3IUOA 3PNWC 1VQPQ 2Y30A 3PL8A 1ZR4A 3THYA 4C5IA 3GCMA 3KZIC 1YJNT 2VONA 5CHZA 1R0CB 1O3QA 1M90C 1D9DA 4B23A 2L54A 2CZ1B 3CM5A 2XAJA 1KK7A 2R7YA 3SHWA 3VS5A 4JI4K 5CQYA 4I09A 1AWOA 3R8EA 3C12A 1GOBA 2X78A 3OYNA 1KVCA 3BOQA 5D8KB 4B1ZA 2QWNA 2MOXA 4C8OA 1USTA 2RK1A 5KGWA 4EJWA 5ICGA 3WVEB 3LAPA 2L89A 2G3RA 3EY1A 3FK7A 1RTIA 4MFDA 1APLC 3JB9J 3KBGA 5LHIA 1VQKN 3KK1A 4NYFA 2R7UA 3JB9F 3T9NA 2QA4A 5KK1A 3CEYA 5HOOA 1IC8A 4G12A 4LLNA 1KU3A 2DF6A 3P9CA 4BRAA 4FWPA 4KGVB 2IIMA 3PFYA 3O3FA 4N4OB 4BD3A 5FD6A 3JCUC 3ZRGA 4EA5A 4FJ7A 4ZDOA 3V81A 2Q1ZB 2DL3A 3E9PA 4JX4A 4CHUA 1XMOK 1J75A 4BC4A 4CEFA 4KPYA 5E1ZB 1K6YA 2J5OA 5EDNA 1IXRC 2P9SB 5E84A 3MZHA 4S0HB 2DYIA 1K9MR 3MCPA 3OYHA 1WSJA 2GUIA 5LHGA 3JRIA 5J1YA 4FE7A 1OPKA 3BG3A 1B72A 4EVVA 1YF5L 5KQ8A 4KTZA 5GAOr 3OJUA 2DTUA 1M2VB 2ZSIB 3SAGA 5D5UB 3BP8A 2K85A 3SQ1A 1D1CA 3SDGA 4QQGA 4HT8A 3FFIA 1MWMA 3TSPA 1GHCA 4J9GA 3F0ZA 2RC4A 1QVFM 2QYOA 2CP3A 1XD7A 5GAOl 2QKKA 3CFPA 3TU4K 4LD5A 4DEXA 4B24A 2CYZB 3P83D 3HM5A 2R58A 5SWMA 1IZ6A 3U9ZA 4BVOA 1ETWA 4E6KG 1V5GA 1DT9A 4WYBA 1IHWA 4DTSA 4Z4EA 4A0YA 2JA2A 3H1VX 3I5RA 1OU9A 4FM4B 1BU6O 1UHWA 2ETHA 3CPWM 5EEAA 4A62A 1J59A 3GLXA 2GX9A 3AAQA 1SSFA 3ZEUB 1KU2A 2WBMA 2VBXA 1IV0A 2G9WA 2J5PA 3JRHA 4RTWA 2BGGA 4F04B 1TWAJ 3QFUA 2DI3A 4M41A 2L7KA 2Y2ZA 2O8BA 5ED4A 1LQ1A 3EZWA 2MA3A 3KWIA 4M78G 4MEXF 4BE2A 5EGOB 5J39A 3N97A 1VSLA 1MJ9A 3ECOA 1VAZA 4HXJA 3NQOA 4EGZA 3R0AA 3NMUA 2ACJA 1JEGA 1WCMJ 1YFNA 2OYQA 2ZFUA 4BBRJ 1B4AA 1FOYA 2LX9A 3VQ8A 3OHRA 3OSVA 3OV8A 4PK4A 1BI0A 4A5MA 2NOZA 1QGPA 3K7AJ 3KYCB 2RQTA 1NLPC 2PJRA 2VE9A 4BDZA 4CO8A 1OFCX 3CCQI 1GFCA 2FPDA 2R92J 4RW8A 1FBQA 4UB6C 4CCOA 1VQLI 2QA4N 1HR0K 4JS5A 4E19A 1XMAA 2KZGA 4YOTA 3CCUQ 2W7NA 3G1LA 4KN7X 5EEGA 3TPQA 1I1JA 4M7AC 2L5QA 1XNRK 2H6BA 3H9NA 2ITGA 3IKMA 3OA9A 1HYOA 3PUBA 1MNEA 3RR7A 3I59A 4CJEA 4CJKA 4XSZF 3I58A 4MTEA 4KFBA 4JX5A 2VWBA 5AQMA 2F7TA 4DHYA 4CIGA 2RN2A 2EYZA 2HMPA 5GADP 1K4SA 1NEGA 3PTAA 1VQMT 2H1LA 1VQPI 4QWQA 1TKXA 3RNJA 5LJVA 2EQJA 4XIDA 3SEZA 4GDFA 3RSNA 4QS9A 3VSKA 4PJ0C 1QP2A 4FJIA 1RACB 1UMQA 1ORPA 5CZ1A 2QK0A 1E4FT 3TAMA 3KKRA 4BY9C 5JI6A 2QSFX 4WFAL 3I56Q 3ZT2A 3TAEA 1RILA 3HGGA 2PNIA 4FLUA 4HW0A 2DXIA 3A5NC 4O8UA 2IG0A 1Z3YA 3QYBA 1JXBA 2CQQA 2GAUA 3IMXA 1BW6A 3LOCA 1LVKA 1Y1VJ 3EE8A 1PRLC 3FM3A 2HQEA 4H5VA 1BOAA 4XEIA 1MDMB 3G1MA 4Q0BA 4XKVA 1NGGA 1IG9A 3DU5A 3WTYC 5C0MA 4EW0A 3GVAA 1Y56A 1HKGA 3LGLA 2Q0RA 1X58A 3EUAA 4BGAA 2QXFA 2H8HA 3KFVA 2L3DA 4FJKA 5ICFA 3V9WA 2C06A 4P55A 4XK8E 2P9PA 3DLMA 2IVNA 2K79A 3AO4A 4M77E 2UXBK 1EWRA 5CO7A 1IAWA 3P38A 1TWCJ 4E9GA 2V1RA 3VEYA 1TNSA 4ZGDB 2XHBA 2QZ8A 3Q5FA 1K8KB 4RTZA 5LJ5g 1LE8B 2FQ4A 3TOBA 4M7DD 3HRTA 2STTA 1VQ6A 5DYMA 2EKHA 4BR0A 3A98A 4RAZA 1W0TA 3CC2T 2NOHA 3UT1A 4CF0A 3BJAA 5K7FA 3M0TA 2YR2A 1EETA 4J6WA 1W36D 2A69F 3P9IA 1NGCA 2RKIA 5C44J 4C2TA 4FSVA 2HL3A 2DL4A 4HSTA 3QO3A 3NGZA 5HS9A 2XB0X 1XS9A 2L02A 4BRHA 3JCMg 5L3DA 2Y4XA 2VB6A 1FIAA 4ETSA 1S9EA 3PFIA 2K5CA 4EJYA 4JP0A 3BROA 3CMEA 1YW7A 2UZKA 5HCKA 2E2QA 3MAQA 3MEXA 2CQKA 3OYLA 3PGGA 2IA2A 2CQ7A 2V7YA 1JT0A 4CJ5A 3DV8A 4CCNA 1NJWA 2DLPA 2K02A 4ELVA 4A3BJ 3OYYA 3SFMA 3MXMA 2ZAEA 4YFUA 4OOIA 1NGEA 3OVNA 3LZIA 4XN3A 3TSWA 2QA4T 1H92A 1SD7A 2BE2A 2ZB9A 1IBKK 3EDPA 2E2HJ 4R8HA 1GLEG 4F9OA 2LCLA 3FSPA 1SVMA 4KBMB 5KYUA 2E36A 2VXZA 2KPMA 5EG2A 2EGAA 5GANj 5CAIA 5EXWA 4Y15A 1XC3A 2A07F 3H0FA 2HBPA 3CCVQ 2YI1A 2QENA 1Z7LA 5BS6A 1NGHA 4BRGA 3CCUI 2DXTA 3AA3A 1TL8A 1KG6A 1U1TA 2PU9B 4G6QA 3A0HC 1TXQA 4A93J 4LLLA 1R00A 1HPZA 2RI2A 1WSFA 3R9PA 5I2MA 4H0VB 5M5XJ 4DCHA 4NXNK 4OMLA 2YV0X 3HPHA 5GMKe 1M3QA 1Q7YC 3CCLQ 2HW3A 1R5GA 1ZKGA 2LC4A 1YIJT 2HVHA 3SCXA 3F8FA 2CGKA 3D1NI 5HRSA 5GAMf 4AVZA 3FXQA 4CD3A 4E70A 2OTJT 5T7BA 2COBA 1NJZA 3SFIA 4GFBA 3LDPA 3AVJA 3TO6A 1GLBG 4DSJA 4XU0A 3CCJI 3WXLA 3C2HA 1RT5A 3CXCM 3KZZA 1KC8U 2E2IJ 3HOTA 3CQXA 4M7DA 4PGGA 4DTJA 3I56I 1AOYA 1KG1A 5C25A 1VQ6N 3M8RA 4CEOA 3GFJA 2HVRA 1ZQ3P 5D3GA 1Z77A 4XBFA 3ZEHA 4YEJA 2M8EA 2DEQA 3JCMe 1NJIC 5DLQE 1NK9A 2Y75A 4YPHA 4PKCC 2KRFA 3ABMH 1RBUA 3K1MA 2OUMA 1VI0A 2DT6A 3RWUA 5LGNA 2HOAA 3CMYA 2IS1A 1LNXA 2EYYA 2DW4A 4M75C 3ELKA 1DTTA 2OPPA 4BJTA 2D5RA 2M45A 3CMEN 3D2EB 2VUBA 2B9SA 1N6AA 4FWLA 4CFAA 4L5JA 2EA2A 3HVTA 3KLGA 3ZGKA 1X6BA 3MDQA 3ZN0A 1RC9A 4IHVA 4M3TA 2DFUA 5HL7L 2NWMA 3G4SA 5DCMA 1SS6A 1P2FA 5GIOA 3I0RA 3EEQA 5A0LA 1IF1A 1WLJA 1S72A 2R7QA 3BF1A 3A5LC 2ITMA 2XY7A 2Y0MA 4DUZK 1KONA 4NCGA 2A6EF 1B3QA 1AVZC 3ZT1A 2FVUA 8AT1B 2HPMA 3FMSA 4G6DA 1JXMA 1GLDG 4E9EA 2OPSA 2K3PA 1C6VX 2D6FA 3CC7T 3TSQA 2AK5A 2M8GX 1I6XA 4K8XA 4ENJA 2X6OA 4RM2A 4CEBA 3AO1A 2EFNA 4UQGA 2HOEA 3P31A 2KZMA 2M7BA 3JV3A 4C92D 2E5ZA 3M3ZA 4XR6A 4AYBN 1EP4A 4M75E 1TC3C 2O8FA 2ZGYA 1M3HA 1HNXK 1GLNA 3ZMZA 4F2RA 2DMPA 1PCXA 4M7AF 1LCKA 4LFBK 5AQKA 3KEYA 1PKTA 3PIOF 2OFIA 1C0MA 3QXEB 2ZF5O 2HBKA 3RYPA 4F7UE 1TNTA 2JNGA 3HJEA 1A0NB 3F3XA 4BQAA 2MH9A 3N05A 2VWKA 1SQKA 1BA5A 2EJ9A 1IW7F 4BGDA 3G10A 3ZQGA 2DA3A 3CQ8A 4CEDA 4M7AD 5ILVA 3TDZC 4XKWA 5C12A 4HF1A 1Z9CA 3FIFA 3FC3A 3WU2C 1EH6A 4LIUA 2H27A 4PDKA 1U3OA 4D7MA 1Q82C 3D0PA 1ZUKA 5D6YA 5BPIA 1LPQA 1OLTA 4ILJA 2HDDA 2AS5F 1RI9A 2ECCA 2ZFWA 3HZ6A 2TDXA 4OB3B 4X0GA 4BQNA 4KI4A 1A6IA 3CCVI 3VQCA 3CP8A 3N4MA 1OZ3A 3G71Q 4H0TB 2JRMA 3RBBB 1PU8A 2XAUA 2PJPA 1HDDC 4V19S 2O31A 3COAC 1SD5A 3AVKA 3QEPA 1Z05A 2EBPA 3CCLI 5CVRA 4A6EA 1HNZK 1ZSGA 2OAUA 4B48A 3I5SA 1RTDA 3HGYA 6AT1B 3JAME 4JKHA 1ASUA 4PHTX 3SAFA 1Q95G 2VIXA 4Z2YA 4FK2A 5E3LA 1VQOA 4NLCA 3T1YK 2FJ1A 4B1YB 2A1RA 3G4SN 2EWSA 1WSUA 1Z25A 3CTAA 1K0XA 5CKBA 3TWHA 1JUSA 1D5VA 1T3LA 5KYNA 1VQ6T 4Y4RA 2J6FA 1T56A 4C3IJ 3C95A 3LWFA 2R93J 2BY2A 3V4GA 1LWYA 3GO5A 1Y8RB 4JLHA 4L5EA 4KT6A 2IS3A 4YHHK 2XKPA 2HHVA 3KLHA 5BMZA 3BDDA 2JUCA 5LBQA 4CGHA 1YRNB 2GBYA 1QHAA 4A59A 4QVZA 4WF9L 4FJ5A 3OYCA 2Z33A 5KAFC 3ENBA 4C92A 2COYA 2K6DA 3NGYA 4MTDA 3U6FA 2GIVA 1A6QA 3FXOA 5GAOp 4JI0K 4B9LA 3HM9A 4CCJA 2O8EB 3ZSYA 1T98A 3RKXA 4MIMA 1ZG3A 4Y17A 3OBWA 2YHAA 1UGQB 1BI4B 1P4AA 1QCNA 3HM8A 4KTWA 4AIDA 4D6WA 2LR8A 4EP5A 3CCRN 3ASMA 4BROA 4V19K 3OS5A 2OPTA 4LFCK 2FOKA 1GBRA 3A0IX 2W4SA 2I7PA 2FXUA 4IO9F 1LJ9A 1TTHB 4M7AA 1FOWA 1D9FA 1QVPA 2E20A 2K4JA 4F3TA 4EMKC 1R1UA 5FLVA 1VQKQ 4XLAA 1FWZA 4NC7A 4BC5A 5E1WA 4CF1A 1MBGA 2PI0A 3QLHA 1TP4A 2OTLT 4CD1A 3PE0A 4CF8A 3J7YP 1YOVB 1ZX6A 3GUDA 4ABZA 1NPPA 3RIRA 2H94A 5IT3A 4UNFA 5GANg 4DSIA 2EHGA 2O88A 4F14A 3ULDA 1ILYA 3O9SA 3EG9B 3Q9VA 2XK0A 2G8HA 4K8ZA 4ELYC 4IHYA 2QG9B 2V6CA 1YXQA 5MLCQ 2MLGA 3HOWJ 1FP2A 3QQAA 2ISZA 2M1HA 3AVMA 4V2GA 1MW7A 2RM4A 1JE8A 4AFUC 4KTQA 3HRMA 3LQRA 3OIPA 4OINF 3LA2A 1UJ8A 2DXUA 5ECAA 1JJ2P 1JHHA 1XQPA 3AVGA 4LFAK 3JXUA 2DA5A 2PLYA 3SZPA 2EK5A 2AZVA 3MPUB 4NB5A 1S9GA 3SNNA 4BHPA 5D4SA 1VQON 5HKCA 2IVOA 3OW2A 4LY7A 4JPBW 3EYYA 1P59A 4B1VA 5IH2A 1YCYA 2PMZA 3MEEA 3RMAA 2K5LA 3L2QA 4OPAA 3OS1A 2V9PA 2AO9A 2CUJA 4XTWA 4S04A 1ZSZC 4QS8A 2LK2A 1OH7A 3KWGA 1TZLA 1S1VA 2LY9A 3JB9H 5TRDA 3EGXB 4HDVA 1X3WB 2KRCA 2N8GA 4M74A 3E6DA 1IJWC 2HVSA 1KO9A 2E6NA 3JAMZ 3SLCA 2MGQA 3G71I 3OGDA 3URGA 1TWHJ 2Z1IA 3R0JA 4GW6A 5KH6A 3FR0A 2VJIA 2D5VA 1KG3A 3SEMA 1G3YA 3QUIA 4HX7A 5BQTA 2O4XB 3G4ST 1FPQA 1K73U 2VJJA 2YT6A 4DLEA 2LNBA 1S72T 1V3FA 2ENMA 1WEIA 4NUBA 2P8TA 1B7TA 5GMKi 1YJWT 4M75F 1LWCA 2E34A 3OH6A 2GCXA 2FZGB 3O3GA 5H6QA 1I5ZA 5C3EJ 4WCEL 3KTQA 2X51A 4HRIA 4BRMA 1WXUA 3M56A 3I33A 2VC0A 1DLOA 1VQ8T 2KNBB 5GTHC 3I0TA 5EC7A 2R7FA 2E6ZA 3ALYA 4ISFA 4DYCA 4N4IA 2PTKA 3BCAA 3OSFA 1JJ2A 1RLQC 1RI0A 3G7ZA 2XSJC 3NWTA 2FZCB 3VOEA 3SYZA 4FE4A 4FYXB 3ESWB 2ZMEA 3LA7A 3SB2A 5DLOA 2GA1A 2M30A 2YX6A 2H3JA 2VOPA 1K8AO 2W04A 4OJRA 1Y0NA 2TCTA 3TR8A 3O1WA 1RTHA 4DR7K 4YOYA 5CY4A 1ESVA 3K4CA 4HVVA 4CZGA 1WB9A 2P84A 3PIOL 2EIKH 4KHQA 1NH3A 3KK3A 4I02A 2HHTA 3SXYA 5GAN2 4I0AA 3PQJA 1KVAA 1OZ2A 4QIWN 2RGVA 2E19A 1MMGA 1VQKI 3CCMT 2PMZN 3W2WA 2E71A 2R5MA 4BXUA 4B3RK 2F2WA 1VQ4T 4BRQA 3R60A 5GAEP 4C0DC 3M7GA 1RKTA 1JO8A 2DXCA 1NGIA 1F21A