3L2VA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and mk0518 (raltegravir)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 97
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2vA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2vA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2vA03
3PFSA 2EFIA 5HBMA 1BCMA 3IG1A 1S1WA 4HUFA 1QHTA 4DU4A 4C5HA 2LTOA 2O4IA 4E7JA 2GF7A 1WJSA 3KLHA 4E7KA 4CGDA 3L3VA 3OJUA 2X74A 4FJNA 4R5PA 1JLCA 3AA3A 3QIPA 3DYAA 5CZ1A 4DSJA 5JS1A 3KTQA 1D5AA 1U45A 4DSKA 1WSJA 4DG1A 4Y1CA 3KD5E 4FLWA 4DLGA 1F21A 3C6TA 1S6QA 4FJMA 1IO2A 3ZCMA 3CFRA 3WNGA 3DLGA 1HRHA 4C5EA 3KK1A 3SJJA 2X4YA 4HCZA 3V6DA 3QESA 2D0BA 1UA1A 1C1BA 3DLHA 1DLOA 4FJIA 3AVFA 2BANA 1HMVA 1NKCA 2VWJA 3THVA 3S9HA 1KVAA 3PNWC 1GOBA 4KKOA 5J39A 3OYMA 3L2RA 1QSSA 3FDRA 3RMAA 2XDPA 2OZMA 3D0PA 1N5YA 3KKRA 4A4GA 3LAMA 2IGIA 3MEVA 1TVRA 2LRQA 3VQPA 1T8EA 3VQ7A 5J2QA 4E7HA 3RRHA 3OMCA 3KIOA 2G8WA 2RKIA 4M3RA 4L8RB 4E7LA 1R0AA 3V81A 1JKHA 1ZYQA 5J2PA 1D9FA 3ZSVA 1YTUA 1XC9A 3MXIA 3AO2A 3SQ4A 3HVRA 2X78A 4KHNA 1RTHA 4CERA 2KW4A 4CJ4A 5D6WA 3QBYA 2E6NA 1RTDA 4DSEA 2QKBA 4IG3A 4IUTA 4CJTA 3TR8A 4CRIA 3NTKA 2YKNA 1K6YA 2WACA 1NK5A 5IN1A 4KB0A 3M8PA 1C0MA 3AVAA 5FRNA 3KJVA 2IS3A 1LAVA 1VK0A 3SV4A 2LSNA 1NK6A 1Z26A 4HHTA 1Q9XA 3LANA 3META 4DTSA 1BQMA 2KFZA 4FJKA 4C8MA 3S3MA 3OB9A 2YV0X 4J2BA 2HHWA 3LPUA 3T19A 3OJSA 3RRGA 2RJCA 1TKZA 2RN2A 2PYJA 2FBYA 1RT2A 4RG8A 4C8LA 4PWDA 4W5OA 3QNOA 4QQ6A 4CK3A 2E5QA 2XRIA 3DLBA 1JLAA 3O3FA 3B6PA 5SWMA 1WJQA 4BWMA 4MFBA 3NGYA 4PLLA 2GUIA 3ZSWA 2O4XB 4F8RA 1LAWA 1VRUA 3JYTA 2O4XA 4KTWA 5KTQA 3UWNA 3CM6A 1JL1A 4BWJA 3QLHA 4CJQA 3AO5A 1SKRA 3OYIA 2HHVA 4N47A 4BE0A 4FW1A 3MP8A 3ZSOA 4HTUA 1WNSA 3M9QA 1WGSA 4CGHA 4NYFA 1QTMA 4ID5A 5KCHA 2HHTA 3LDSA 4CJKA 4KI4A 1X9MA 4EZ6A 3WNEA 4FLVA 3I0SA 4LY7A 4CF2A 3ULDA 1OI1A 3M8QA 1CZBA 4QAGA 2KTQA 4E1NA 1SL2A 3PX0A 3MO8A 1BQNA 2F5KA 1I3AA 3TAGA 3NBPA 1VSFA 3LALA 4FM2A 1S9EA 1WSIA 3DOKA 2QK9A 4DLEA 4AILC 1TK5A 2KQ2A 3OYKA 1QS4A 3ASMA 4FLYA 3SQ2A 4KI6A 3EZ5A 4I9QA 3NTIA 4H8KA 1KSPA 1XHXA 4LD0A 3ZSRA 1IKVA 4EZ9A 4JS5A 3UT1A 4CF0A 3H08A 3OY9A 3S6WA 3AO4A 3LYIA 4BD3A 4DFKA 1L5UA 4BDZA 1RDDA 4DTMA 5KRSA 3QIOA 2QQRA 2RJEA 1VSMA 4O0IA 4B9WA 2RI5A 4M45A 3HK2A 1KCFA 2NLUA 3OYDA 2G3RA 3LWMA 3QEVA 4B9VA 4O4GA 3IRXA 4CEZA 1IKWA 3DRRA 3NTHA 4DQIA 3MEUA 4DTXA 1TL3A 3VQ4A 1TKXA 4CHQA 4CEEA 1GOAA 1RT4A 3RMBA 1TK0A 5D6YA 3ALYA 4Z4GA 4II1A 1L3UA 2F8SA 4A4FA 2Z1GA 3OYFA 3L2UA 3AA5X 3PY8A 4CF9A 4W5RA 2CKKA 3FC3A 1YT3A 3L42A 4FZZA 2L3RA 3VQEA 4LSLA 2QKKA 1BGXT 4CJSA 3DB3A 4CIFA 4CHPA 4IFVA 3ME9A 1T7PA 3NF7A 1X9WA 5J1EA 4CEOA 3AO1A 5D3GA 5JS2A 4FJ7A 3DRPA 5SZTA 3LAKA 4FJJA 5CYMA 4B9LA 4DS5A 1HNVA 3HPOA 4CHNA 1XI1A 2EHGA 4AH9A 1S5JA 4DF4A 3L2WA 1RT7A 4Z4IA 4I2QA 1KVCA 3QINA 2XY6A 1LWFA 3ZT0A 2BUDA 4OPKA 4CHZA 5J2MA 1WAJA 2NUBA 4E1MA 3B6OA 3WNFA 4KHUA 1NK0A 1NOYA 3QETA 2MWPA 2DFHA 4B9MA 3DLEA 2EQMA 2OPSA 3LX7A 1TGOA 2RPIA 4CEFA 1VSDA 5EU7A 3NDKA 2M0OA 1NOZA 1IKXA 1TAQA 1WSFA 2JTFA 3K5LA 3OYBA 4E89A 1LWCA 2EX3A 1C1CA 2PY5A 2HQEA 4GVMA 1HYZA 4YFUA 3AV9A 2D0AA 1Q8IA 4FLTA 5KE2A 2DFEA 1SL0A 4C8OA 4DS4A 2YNIA 2YNFA 5HLFA 4GMJB 2M16A 4N5SA 4DF8A 3ZSXA 3TWHA 3ASKA 3VQ5A 3CYMA 3P5JA 4LSNA 4EP5A 3U6FA 2VG6A 4TSXA 4Z0UA 3KUFA 4OLBA 4FLXA 3NH0A 1N27A 2HVIA 4FVMA 3K5MA 2ATQA 4WE1A 1BHLA 2B4JA 4AHSA 3EY1A 1KTQA 3HJFA 3O4NA 4B9NA 5T7BA 4CGFA 5E41A 1HQUA 3C94A 4LH4A 1VSIA 4DQRA 2F8TA 2FBXA 3V9XA 5C24A 3VQBA 5HRSA 4CFBA 3NF8A 1WSGA 4CGJA 1U49A 2X6SA 3Q1JA 3FEOA 3AVHA 4HUEA 1FK9A 3V9ZA 3AVKA 3C95A 4HCCA 3ISNC 4NCGA 4KAZA 4F2RA 4F3OA 3BDLA 1CLQA 3P83D 4QQDA 1UAXA 1RDAA 3SUPA 3ZSQA 2XO7A 1HYSA 3PX4A 4NYNA 3OYLA 1VSHA 3LGLA 4F2SA 1QSLA 2A1RA 5KE3A 2IDOA 5KRTA 3DOLA 5D6XA 2A1SA 3VQAA 4CECA 1RT1A 3NNQA 3L8BA 2G8IA 4LH5A 2DIGA 3S3OA 1B9FA 3FFIA 4O44A 5KGXA 2IOCA 4E3SA 1JL2A 3MEGA 3HP6A 3IS9A 4M3XA 1JLFA 5K14A 2HHUA 1NJWA 3VQ8A 4KRFA 4XIUA 3DLMA 1EETA 3HT3A 3PMIA 3DM2A 4E0DA 3OYEA 3NAEA 2D0CA 3CM5A 3DLRA 1REVA 3K57A 5I3UA 4IUPA 4ZTJA 2VG7A 3MP1A 3VQ9A 2Y1IA 4CEDA 3HPHA 1LW0A 4KHQA 1NK4A 2Y1JA 3SYZA 3A2FA 4QW2A 1U4BA 3VA3A 3O3HA 3OVNA 4Z4EA 2FHDA 1QQCA 2L8DA 3UIQA 2HNZA 2R5AA 1LWEA 3P1GA 3QKJA 4O0JA 1ASWA 2HNYA 2RHXA 3U3GA 1JLBA 4CIGA 2HNDA 2JGUA 4CGIA 1XWLA 4KPYA 1C6VA 3SUQA 1S6PA 3OS2A 4DMNA 2LDMA 4PA1A 3O8VA 3SQ1A 4CF8A 2OA8A 2W42A 1T03A 1BI4B 1ITGA 2RHZA 4ICLA 2QQSA 3AA4A 1BI4A 4G1QA 3V1RA 4F3TA 4QVZA 4OKKA 3C4SA 4DSLA 1EP4A 3KKSA 4DTUA 3OS0A 2HQXA 4Q5WA 4FJGA 5C42A 4CESA 3VQ6A 3L3UA 2RO0A 4CJWA 3TAMA 2I5JA 4HUGA 3LGFA 1WSHA 3CEYA 2P5OA 4KREA 5CY4A 3L2QA 4CFCA 4FJLA 4KB1A 5KH6A 3F70A 2JZ2A 1WN7A 2KFNA 1LV5A 1I39A 3SCXA 3MXJA 3QEXA 4DFMA 1MU2A 3I0RA 3SV3A 4O5BA 3F73A 2RHUA 3FLGA 1HQEA 3QIIA 3U3YA 3NF9A 2Z1HA 3AVGA 2R5MA 3ZT3A 4B3OA 1J54A 4FK4A 4HCBA 2K3YA 1CXQA 4B9XA 2FBVA 1RBUA 2XY5A 1TKTA 1ZBIA 2R57A 1D9DA 1ZBFA 4OPJA 4KHYA 2LVMA 3HO1A 4DTRA 2RHYA 3SUOA 4RW4A 4IBNA 2DFFA 1HJRA 3NE6A 4FXDA 1HYVA 1NK7A 4DTOA 5KI6A 2YKMA 4DU1A 4E19A 1SSFA 4BDPA 2AJQA 4AHCA 3TARA 2FC0A 2VG5A 4KFBA 1ZBUA 3KLGA 2X4WA 2F96A 1U04A 4C5IA 5J2NA 5CIUA 2G8HA 4FL6A 4Q0BA 4NCAA 4I9LA 2BGGA 2PQWA 2EQJA 1YVUA 1RI0A 1FKPA 1DTQA 3SPZA 1NK9A 2BKDN 1J5OA 3O3GA 3NCIA 2MWOA 4NZGA 4Z4CA 3MAQA 4IKFA 4OVLA 5HRRA 3LP3A 4PQUA 3CFOA 1RT6A 2IAJA 2RF2A 2YHBA 3G0ZA 1D8YA 1QE1A 1JLEA 3V1OA 1G5VA 4IUQA 3AVJA 3OMGA 1SV5A 3OYNA 4CF1A 4QOZB 4FK2A 3E01A 4AHRA 5M9OA 2ZD1A 4FJ5A 5FRMA 3ZEHA 4KO0A 3G10A 3AVBA 4GW6A 1UWBA 1J9AA 4UQGA 3F9KA 3TAQA 4I2PA 4DTJA 1S9GA 1OZ3A 4BACA 3LPTA 3LP1A 4RW8A 3AVNA 4H4MA 1RTIA 4DQSA 2RJDA 1RNHA 1UOCA 3QEIA 1CXUA 2DAQA 3TANA 5HRNA 3RMCA 2XY8A 3NFAA 5HRPA 1BCOA 1KLNA 5FROA 3HYFA 3PX6A 3CG7A 3C6UA 1LW2A 4DSIA 4FLUA 4JRPA 3KLFA 2XY7A 3HVTA 1RBTA 2P1JA 4DWIA 3BGRA 2HHXA 4DQPA 3SQ0A 4X34A 3AVCA 1L3SA 4LD6A 1Z25A 1Y97A 3OA6A 4IDKA 5KGWA 4AHVA 4CK1A 3OYHA 4NCBA 4FZXC 3TAPA 4ID1A 4IFYA 3K5OA 1BISA 2YNHA 4IUVA 3OYAA 3H6ZA 1KLMA 1XHZA 1JXBA 2YRVA 2K3XA 3RTVA 4DTPA 1SUQA 3V9UA 1GOCA 2ITGA 3MXMA 1RT5A 3NHGA 4FJ8A 4FW2A 4C8KA 3TAFA 2PZSA 1OZ2A 3H8ZA 3VQQA 1NK8A 1S1TA 1VSLA 4CHYA 2B5JA 3DMJA 1C0TA 4M41A 1EXQA 3V9SA 4B8CA 4N4HA 2M1HA 2VYTA 4FLZA 3ZSYA 1XNIA 5CZ2A 2GV9A 2IG0A 3QERA 5I42A 2Z1JA 4ELVA 2G8UA 3IAYA 3PUFA 1KVBA 3HL8A 4H4OA 4PUOA 4FYDA 3QEPA 4PLIA 1B9DA 5HP1A 3NH2A 4Z4HA 3SUNA 3HM9A 3RWUA 1S1VA 1WLJA 3E9FA 3SI6A 3PMTA 4FCYA 3MEAA 2G8KA 1TL1A 3EYZA 2GBZA 3P8HA 4FZYA 4N41A 3VA0A 4W5QA 2WONA 4AHTA 1OYXA 3E9GA 4KHSA 2HB5A 1TK8A 3QNNA 4CCHA 1FXXA 4QQGA 2XHBA 5CYQA 4B9SA 4CJEA 1RILA 4KHWA 1ZBLA 2P5GA 4CJ5A 4UC4A 3K5NA 1UA0A 2EQUA 3DI6A 4OKEA 3AVLA 3TABA 1TAUA 3I8DA 4K8XA 2Q3SA 3ZT1A 4B08A 4ZTFA 3HXMA 4ELTA 4BE2A 1X1PA 2B8AA 3MECA 3D45A 2DY4A 1FKOA 4CE9A 3TAEA 3HPGA 1IG9A 4F4KA 1VSEA 1KFSA 4OVAA 1EX4A 1ZBHA 3RR8A 4KV8A 4E7IA 2G8VA 4CEBA 2X4XA 3K58A 3OQ5A 4JLHA 2Z1IA 1RT3A 1DTTA 3PV8A 2E6LA 4W5TA 3M8RA 4EP4A 1BL3A 3T1AA 2OZSA 3QEWA 4Z4FA 1C1AA 5FDLA 4CJVA 3OYGA 1KHCA 1RBRA 3LZIA 4IG0A 5DK5A 1W0HA 2FBTA 4B9TA 2LCCA 4CJPA 2KZMA 1A5WA 3V4IA 3P8DA 3OS1A 4CFAA 4FK0A 1EKEA 2ZQBA 4GY5A 1W9HA 2OPQA 1HNIA 5C25A 4A4EA 4CEQA 4OLAA 4OKJA 4Q5VA 3LZJA 1T05A 3L2VA 1RCHA 3TI0A 4FJHA 5C0MA 4RW6A 2OPPA 3LWLA 3M8SA 3RMDA 1BIZA 1L3TA 4N76A 4JS4A 3OYCA 4CJRA 4CJLA 3MEWA 1KRPA 4AHUA 2D9TA 4YNQA 2EQKA 3VQCA 1JXEA 4J2EA 2D5RA 4C8NA 2JLEA 3CQ8A 2RJFA 1NKBA 5HROA 2G8FA 2GFAA 3ZSZA 4EDUA 4ELUA 2RI2A 1C0UA 3LLRA 4N4IA 3MP6A 2RHIA 1NJXA 3NGIA 1G15A 3O4QA 2ZE2A 2YHAA 4O55A 2GFUA 2B6AA 4CEAA 4W5NA 1VSKA 4IURA 1QSYA 3LP2A 2WOMA 4M3WA 3NH1A 1VSJA 1NKEA 3AA2A 3EAEA 4OJRA 4I7FA 4M3UA 3AVIA 1H3ZA 1J53A 2R7YA 2X6NA 3QJ6A 1RTJA 4CK2A 4J2DA 2OYQA 2RI3A 4PL6A 3LH0A 4RW9A 1BIUA 3WNHA 4FU6A 3NF6A 1YTAA 4CJFA 2ETJA 4RG2A 3ITHA 1WAFA 3KLEA 2BDPA 2QXFA 4IUUA 1L3VA 4J2AA 3VN5A 2X35A 4CFDA 4OGEA 2L89A 4A4HA 4CHOA 3LP0A 2PYLA 1S1UA 4HVJA 1CZ9A 1ASUA 4BDYA 1TKDA 2HHSA 1VRTA 1B92A 3HP9A 4DU3A 2HVHA 3KK3A 3DRSA 1A5VA 2P0KA 1RBVA 3AO3A 4NS5A 4N4GA 4QCLA 3CFPA 4DSFA 3SPYA 5DMRA 4Y1DA 3OYJA 4Z02A 4K8ZA 1ASVA 4KTQA 2BIVA 4BE1A 5C6SA 4JRQA 1N6QA 4L59A 2BE2A 4N56A 4DTNA 3KLIA 3KK2A 4RW7A 3PO4A 1U48A 1SKSA 4CIEA 3JSMA 3HSTB 1JLQA 3DB4A 4OGCA 3T3FA 4DFPA 5J26A 1RDBA 4M42A 5IAYA 4ZHRA 1SL1A 4KTZA 3ZT2A 1WJRA 3SZ2A 2P51A 2E4LA 2IC3A 4DFJA 3PO5A 4M3ZA 3V1QA 2VWKA 1A5XA 4CGGA 1U47A 3ZT4A 4FJXA 3NGZA 4FJ9A 2HMIA 4B8AB 3K2PA 2HHQA 1X9SA 3QO9A 3K59A 2OPRA 3GOXA 5KCOA 1TV6A 4B9UA 4MQ3A 2R58A 2E6MA 1NJYA 2O4GA 3SD4A 3S3NA 1S1XA 3AVMA 3RR7A 3DLKA 1IH7A 2EKOA 4M3YA 4M3TA 4FM1A 1NJZA 2DTUA 1JLGA 1RDCA 2KZZA 2XK0A 1O1WA 1WSEA 2DIQA 3MEDA 1HPZA 2HW3A 3MEEA 2YNGA 4FM0A 1SKWA 3V9WA 4CJUA 1KFDA 3BDPA 4CJ3A 4C5GA 1RBSA 4DQQA 3VQDA 1MHNA 1IKYA 1Q9YA 3SNNA 3KD1E 4PY5A
chains in the Genus database with same CATH superfamily
2OZUA 2W84A 2BBYA 5FD5A 1RAAB 4C5HA 3T5XA 2O4IA 3CZ6A 4E7JA 5LY3A 5K7FA 2BTTA 1R7JA 4J8OA 2NOBA 1RADB 1WJSA 3J81K 1GLLO 4CHUA 2CO5A 2F69A 5ILVA 1UHSA 1FTTA 1FP2A 3THYB 4R8HA 1QVGS 2RD1A 2IS2A 3VETA 3X2QH 1DPUA 4H0EA 4DSJA 1M90O 3KTQA 4JRKA 4IEEA 4CZFA 1U45A 4RGRA 4KH0B 2C0OA 5F6FA 4DG1A 4RGSA 3FRNA 4Y1CA 3ZEUA 2AXLA 1K4SA 3KD5E 1FYKA 2DJQA 1S6QA 1A35A 3WNGA 1HQCA 4B4CA 4A3MJ 1U84A 2IGMA 1KG7A 1PU6A 1K8AU 2P5VA 2HKQB 5ICCA 2FL7A 5DEQA 2X4YA 1WJDA 2D0BA 1UA1A 1WJBA 1TUDA 1XMAA 2JPBA 2L9VA 2RHKA 4XKBA 3PFIA 1WZ2A 1HMVA 1GOBA 3L00A 2CRGA 4C92C 4M78B 4C92F 3GO5A 4EAHD 3WXIA 3EEQA 2K86A 1UG2A 1AVZC 2DBKA 4BXXJ 1KC8R 4FWKA 4U0YA 2G8WA 2RKIA 3IMXA 1VQ8N 3CQTA 4UHTA 2GIZA 4E7LA 1K4TA 3CPEA 2W48A 1FBQA 4DA4A 2CWEA 3EPZA 4QLCU 4U87A 1PDNC 4C23A 1Q86O 2E1OA 1D9FA 4RS8A 3A5OC 2CW8A 1NGJA 2V9PA 3MXIA 1Y8QB 1WBBA 2XPUA 3JRFA 3CWUA 5DM7F 6PAXA 1R71A 4H03B 2ECBA 4EMSA 4ME7A 3INZA 3IKMA 4AWXB 3A98A 2WTUA 3QBYA 3J7YP 1Z7LA 2E6NA 4BRPA 4WK8F 2R3SA 3TTCA 3GEZA 1RESA 5J8CA 2YPRA 3NTKA 2Q0OA 2OCCH 2MW8A 4BEHA 4FYYB 3HOYJ 2QSFX 4KBOA 1MMSA 4KB0A 2EFWA 3M8PA 1AHJB 1CKAA 3CCVA 2YUSA 1IV6A 2M45A 4KMFA 1PKSA 2Y2ZA 4CYCA 1Z3YA 4FWPA 3QWXX 1A31A 2XKPA 5LJWA 1W1FA 3CD6N 4UB6C 1XGOA 3S3MA 2YV0X 5AZJB 2NUTA 3GDQA 2HHWA 3LPUA 4OX9K 3OJSA 2EILH 3KP4A 3KFVA 5IXBA 1KG3A 5I2SA 3SDGA 2STTA 1TKZA 2RN2A 3G1MA 2V51B 5C44J 1IJWC 5DS9A 3MZHA 4C8LA 2XC7A 4JK8A 4FWOA 1X3NA 2VIXA 1M1GA 4AUXA 4N0AA 2WBNA 3B6PA 5LFAA 2KZVA 3E0JB 3UB5A 4G12A 3CXCP 5IT9Z 5FLXO 1C0WA 2JWTA 3C6AA 1D5YA 2QSHX 4C30A 4KFCA 1ENHA 2YHXA 2O4XB 4F8RA 1BR1A 1LAWA 3HB9A 1OMIA 4KTWA 1E3MA 1GV5A 2O0YA 2VE9A 1UFMA 3CM6A 2Q0RA 3ZQIA 2Q1NA 3VS4A 4HNVA 4JHDA 4NBQA 4OB3B 5JHFA 1X58A 2A6TA 4IFEA 1S22A 4CJQA 2DX1A 1T3LA 2E2PA 1Q7YR 1SKRA 1AWOA 5DUKA 3H6EA 3VU3C 3S15J 1ZARA 1V4RA 2WV1A 1STZA 5HK0A 1ZR4A 3FXLA 3KZYA 1M8VA 1WGSA 3CCJI 5IOYA 4U7BA 1LPLA 1G83A 4AVPA 5HK3A 1IRFA 1I6HJ 1U1SA 1Z9QA 3NVMA 3M58A 5AFUA 1QCOA 4L5EA 4FLVA 3TOAA 3F22A 2JA7J 4LY7A 1NTCA 2O8FA 3CJRB 2VN2A 4BBRJ 4G8XA 3MO8A 3TO7A 1BQNA 3R1XA 4BRHA 5TRDA 3GG4A 3NBPA 4PK4A 1VSFA 2EWSA 3LALA 1UDLA 3HOWJ 4IJAA 5M1KA 3QBWA 3KYDB 3IDHA 2RNGA 2XF6A 2DT7B 4AILC 1RRSA 2ASMA 2KQ2A 3OYKA 2TDXA 3HHGA 5FPNA 2ASPA 2RC4A 4DHYA 1HNWK 4FLYA 2DMTA 3ZGKA 3TDZC 2R7SA 1CZAN 1R36A 3CCSQ 4H8KA 1KSPA 1XHXA 4B3AA 4H5NA 5I11A 1T44A 2M8GX 2NOGA 1OKRA 3HJEA 3ZSRA 1QBJA 3L6QA 3J7AF 2D0PA 5GMKl 1MJBA 3QPLA 1SMTA 3S6WA 3AO4A 2Y4XA 1HW5A 4IHVA 1L5UA 2WBMA 2QYOA 2GWRA 5H2FC 2G7UA 4CO8A 3N97A 3QIOA 3M07A 4EMHA 1L0OC 2QGGA 4J6XA 1Y96A 2RJEA 4RB1A 2XB5A 5DM6F 4GO1A 3OHRA 1MV3A 2V1NA 3LH5A 3C18A 4QTRA 3IRQA 3HKSA 4B9VA 1PC0A 2ZB9A 5GADP 4UUSB 1KG4A 5EZHA 4LIVA 1O57A 5FJ8J 1TYQA 1EH8A 4UY8I 2PX9A 3VEPA 4A2UA 2L02A 4DGWB 4KH1B 3VRYA 2QCOA 4ASNA 1RT4A 3FGUA 3RMBA 3N05A 3ALYA 3LL3A 2D0OA 1L3UA 2ZPEB 3CC2N 2HPMA 3OYFA 4I6MA 4C0FA 3L2UA 3WEEA 1KAYA 2IVMA 2A37A 1IN6A 2VC1A 2ECCA 2K5CA 2CKKA 3A8HB 5HKCA 1JUSA 2LBFA 2JUFA 3ATUA 2R7VA 3TEEA 4MDWA 1BIAA 1I8FA 3VQEA 2BZYA 2BY3A 2AK5A 1TUGB 3R0AA 4MEXF 3HRTA 5LJ5g 4XONA 5HS8A 2PI0A 3VJPA 4CC7A 3DCFA 1VQ8A 2L01A 4B3MK 2WY7Q 2IIMA 3J80Z 3CO6C 1VQ9A 3CVTA 4CIFA 3GX4X 1K1ZA 3K69A 3ME9A 1OV3A 2FBIA 2DW4A 2VXFA 1B59A 3NF7A 2CGHA 1X9WA 1Q81R 4FM4B 5J1EA 4CEOA 5E84A 5D3GA 2PG4A 1FC3A 1B8IB 1U8BA 5IT9O 3C7NA 5JS2A 1P4XA 3DRPA 4FJ7A 4C9YA 2OTLT 4BJTA 3LAKA 4NLCA 3QYFA 2EFQA 5CYMA 4XMYA 3ISPA 2L3SA 5FWCA 2LOOA 2P9KA 1N33K 2EIFA 3QP6A 4DF4A 2LY1A 4NNJA 2V1QA 4Z4IA 4DZJA 2H27A 1TW3A 2PMZN 1O9SA 3QINA 2FPEA 3TW6A 1CGPA 2M0MA 2QDYB 4OPKA 2RKHA 3QHSA 4J9IA 4PGHA 3B6OA 3WNFA 1IN5A 3QETA 2MWPA 4A53A 5GANg 2H6CA 2P0WA 3DLEA 5B3SH 1V1CA 4M75F 3K7AJ 3LX7A 3PO3J 5J1UA 1YJWT 1BKBA 4CEFA 2YS9A 2M0OA 5CQYA 4UUTA 2EV0A 1QU3A 4M75D 1YWOA 3G3ZA 2JTFA 2GWKA 2D45A 2VXDA 4J00A 2GCXA 4CD1A 1PNJA 2VBYA 4M77B 1YQAA 4OFAA 3A0IX 3FXKA 5GMKi 4G7HF 4KIFA 5KE2A 4ABZA 4FYWB 1SL0A 4C8OA 1IV0A 2YNIA 1V5GA 1R59O 5HLFA 2ISZA 4H0YB 2FOWA 2NVQJ 4BQQA 5CAIA 2VVKA 2CGLA 4N5SA 4YRVA 3DXMB 3CYMA 1VQPA 2EIKH 4M4ZA 1NM1A 2VG6A 4B09A 2FEZA 1F1ZA 3CJ9A 4TSXA 4YDUA 4Z0UA 3KUFA 4OLBA 3E6BA 1N27A 2HVIA 1MUYA 1M3QA 4G6TB 2ATQA 1RR8C 4WE1A 2B4JA 3ZMDA 2ZAEA 4F7UB 1EWRA 5KQDA 1WB9A 4AHSA 1S1NA 3EY1A 5IYBJ 2PFUA 4KT5C 4VUBA 3V8KA 1ZC6A 2R7UA 4CGFA 4B44A 1MGQA 4L5GA 2PJRB 4LUDA 4H0PA 2DMQA 2NRXA 4BQZA 4DKWA 4L18B 1XDUA 4QKUA 1PG5B 1VQLN 2F8TA 4JUVA 3EG2A 3ASNH 3I5UA 4EMGA 4MHGA 4A62A 1RI7A 3DTKA 1WSGA 5FO5A 5EYRA 3I8BA 4XEIA 2O8DB 1WI3A 3V4GA 4LC9B 1M2VA 1E3PA 2X9HA 3CMEQ 3FEOA 4IQ4A 5IY5H 4HUEA 3AVKA 3ISNC 3MWPA 2B63J 3CLOA 1RABB 3BDLA 1CLQA 5F1XA 4AIHA 4B43A 3L1PA 1Y39A 5LHIA 3HC7A 5B5EC 5B1BH 5IYDJ 1IN4A 3CCQA 3QWLA 1SSHA 2EJFA 2HQRA 3V8JA 2LSOA 1VSHA 4LLLA 2KQWA 5DCFA 2Y4YA 1QSLA 2OA4A 4RA2A 2EJ9A 3MN6A 2A68F 5B8HA 2Y31A 3CCRT 2FEIA 2LG4A 2IDOA 4K41A 5D6XA 2A1SA 3VQAA 2LLKA 1RT1A 3CCEQ 2TCTA 3JCMf 1HNXK 2GZWA 1JTXA 2NWMA 4LGWA 1I94K 2DIGA 3QUIA 3S3OA 1XQSC 2OBPA 3FFIA 3MKZA 4O44A 1YBYA 2VUMJ 5KK1A 3KZBA 1FJGK 4BC3A 3J80O 5KAIC 1IC8A 2HHUA 3D6RA 1KC8U 5HLIA 5DTDA 2KP6A 1LMZA 1TSFA 3HT3A 1UJ8A 1UE9A 4E0DA 5AQPA 1VYUA 2HPIA 1S72T 3DLRA 3CO7C 2NUTB 4BVPA 2KIFA 5I3UA 2JPCA 3KZIC 2KRMA 4IUPA 5I22A 1QVGA 1JKPC 4OAZA 2VG7A 2Y0SA 1VQ6N 4CEDA 1SD4A 2XROA 2R7TA 3KEOA 3CC4I 1KQ2A 3HFOA 3SYZA 3WGGA 2XV4S 3O3HA 3OW2S 1SEUA 3OVNA 3VEOA 4Z4EA 1J9IA 3UPUA 1QQCA 3K4MA 2R5AA 1LWEA 4CI6A 1S29A 2HNYA 1ETKA 3PL8A 1HA8A 3JCMg 1I5LA 2DETA 3BG5A 4H5WA 3CC2A 4X0GA 1XWLA 1J7KA 1N34K 3CCMQ 4J9DA 2YRDA 2IT0A 1WHLA 3Q7BA 2HQNA 4DMNA 3CJTB 1FMKA 4G94A 3S16J 3QBXA 3O8VA 5GAMe 2QTDA 3SQ1A 3FZFA 1QGPA 3HRMA 4DUZK 4B3TK 4A2AA 4J9GA 1HXDA 2OTJQ 1N8RR 4CF8A 4OO1J 2OA8A 2W42A 4JOMA 1T03A 3G6EN 1EA3A 1MUNA 2XU8A 1ITGA 4BR9A 4BROA 4ICLA 2QQSA 4E6KG 2SRCA 1KC8O 1S5LC 4DTUA 3REOA 2V7YA 3FJ5A 4Q5WA 1UGPB 1YI2T 3BF1A 3CJCA 4AM6A 2HBWA 3LGFA 1WSHA 4YOTA 3CEYA 4KH5A 5CY4A 2ZF5O 2BTFA 4CD3A 4CCJA 4L0YB 4JLIA 4KULA 4FJLA 1MV0B 3FZHA 2P4WA 2JS2A 5ICFA 4X1VA 4XOTA 3PLAA 1U06A 2KFNA 1LV5A 3UA7A 3E5QA 4AVZA 4OMNA 4M63C 3J81Z 4XICA 3G4SA 3I0RA 4O5BA 1VYVA 4C8QC 3FLGA 1HQEA 4C8QF 1X19A 1KONA 1KU7A 1EV7A 5IYCJ 2MBFA 4QPOA 3P31A 2PMZA 2KYBA 4BRMA 3OIPA 2YWWA 5K5QA 3FM5A 1FY7A 3ZT3A 2D2WA 5AQMA 1YJWI 2VJ4A 5BN8A 5AJ3K 4C8QD 2PQ8A 1K0SA 3JTGA 5JHUA 2K3YA 1U3OA 1FJLA 4B9XA 2FBVA 5HDGA 1VQKA 4LFCK 2M9UA 1ZBIA 4CC4B 1JHHA 1HKBA 2BUPA 2O8CA 1Q7YU 2IVOA 2MLKA 4AC0A 1EF4A 1WHUA 4A3BJ 4QIWN 4WYBA 2CGPA 1AKHA 3VOEA 4GVEA 2DL7A 1A5JA 3SUOA 4XLPF 5J3BA 2PFBA 1HJRA 3NE6A 4FXDA 3SFIA 2P4TA 3CCUQ 3KX2A 4DIQA 1SAUA 3W2VA 1OH6A 3SEQA 2XKOA 1HYVA 1R5GA 2NRTA 5KI6A 3IC7A 4UVBA 2YCHA 2YG9A 2FPFA 4E19A 4DU1A 1BBZA 3IHUA 3TSQA 3RR6A 2LVSA 3BZ6A 3TARA 1IRZA 2VG5A 1ZBUA 4NHJA 5AIQA 3RTRA 1G99A 1SVLA 3VESA 1M27C 1MGTA 2E41A 2ESHA 2ELHA 4NQWA 4OIRF 1DTQA 1TUUA 2Y69H 2FRHA 2BKDN 4C3IJ 4WXHA 5DY9A 4A6EA 2O9VA 3M57A 3NCIA 1Z6TA 3HFNA 2WC9A 3EKSA 1JUPA 4X66K 3LP3A 4PQUA 2F4MB 1ARKA 1U2VB 2YHBA 4WCIA 2P7VB 2KIMA 1QE1A 5HS7A 4NOYA 1Q7YO 5AQWA 1PHTA 1SV5A 4TVRA 4J7FA 2CP5A 3FBNB 4PJNA 2PLYA 5CJ9A 5AQKA 1I1GA 1JXSA 4FK2A 4YIFA 4AHRA 2ZD1A 4AI5A 3EKUA 1U78A 3ZEHA 1RAGB 4CDGA 3GMEA 4GW6A 1H92A 1UWBA 5KCMA 2PN6A 3CF5L 4DTJA 1WJEA 4UVCA 4CZZA 1OZ3A 1B9NA 2P5KA 4BACA 3LPTA 1BC8C 5GP9A 1LFBA 2WSFE 3HBTA 4H4MA 1ZSZC 1I3QJ 1BM9A 2NYXA 3JCMQ 4BG9A 2EA4A 2BE9B 3M56A 3CCRI 1KIKA 4QS7A 1WHJA 1R1VA 1X75C 2XY8A 2IRFG 2HKNA 1KLNA 5DM7R 1E4GT 2ME6A 2BVMA 1WQ7A 3C6UA 4L3QA 1Q18A 2EAYA 3SB2A 3O6BB 4J6WA 4OP0A 3ZETB 2XY7A 5FB2A 1J5YA 3F8FA 5M5WJ 1ZRDA 2XHCA 1RIOH 1RBTA 3RKXA 2DTZA 3AGRA 5JI6A 4IOCL 1OU8A 1L3SA 4RAYA 1Y64A 2E2JJ 1Z25A 3FISA 5B66C 4IDKA 4CZGA 4AHVA 4CK1A 1QNTA 4M7AC 4ID1A 2DERA 4M7AF 1LEAA 2MC4A 4F55A 2P7CB 4OMYA 1D8JA 4IUVA 2JQ7A 3OYAA 2YRVA 2K3XA 3L4QA 3JCUC 2MAMA 4M7AD 4JKAA 1P90A 4FPBA 3H92A 4PFOA 2J6FA 1GOCA 1BUPA 3H0HA 3MXMA 3ULQB 1Q81U 2CH0A 2MGQA 1RT5A 2ID3A 3NHGA 2NRAC 4I09A 2F5FA 3J81O 4U88A 2PZSA 1YJ9T 5HLGA 2CQKA 1GCQA 1VSLA 4LFBK 2B5JA 1WH5A 2ZJPF 3Q5FA 8AT1B 5FKMA 2EV5A 3DPTA 3H1CA 1J3TA 2M1HA 2CG4A 3VENA 3FK7A 4JKDA 1XNIA 3ZQLA 4U7DA 1USSA 3QERA 3ZQ7A 1VQ8T 3TSZA 4BRGA 2ELKA 2LX9A 2G8UA 3IAYA 2R92J 1KVBA 2P9PA 3DKWA 5E26A 1BG3A 3BG6A 3H9QA 4XTZA 5BR9A 1K9MC 4DBHA 2KY9A 1MMDA 1M90C 1QKWA 3G6EA 4C3HJ 3OOPA 3H3ZA 4BR5A 1R5ID 3TCJA 5DYMA 2G0EA 1S1VA 4MQ9F 1WLJA 3E9FA 3SI6A 1HLVA 4C92B 2Y9ZA 3KXTA 2E65A 2EQRA 3CW7A 3LDOA 4BRFA 3PMTA 1CSKA 4BRQA 2DF6A 3NWSA 3CCVI 4A57A 3KTUA 4MMKA 1TL1A 4Y7NJ 3EYZA 3M9AA 1WQWA 3C7JA 3GZNB 3VA0A 1V54H 4W5QA 1Q81O 3O9QA 1JCGA 2FBHA 5AONA 3SDZA 2BHYA 5KPZA 2YJEA 1KYZA 1OYXA 3O5ZA 4C1NK 2JT4A 4PNOA 3E9GA 4YOXA 3GXOA 2C0TA 3IWZA 3TSPA 5LJ3j 4CCHA 4W97A 1LE8B 5CYQA 2K9LA 3BY7A 4FOIA 4RMNA 1RILA 3E6MA 4AYBN 3DQVC 1JKRC 4K42A 3ABLH 2ZJQF 1MWKA 2MD5A 4JBAA 2CYYA 1IZ6A 3CD6T 4HF1A 1JT0A 2HNHA 3UR3C 2WTEA 3ZT1A 2QWOA 4B08A 4ZTFA 3R3LA 1Q86C 1LNXA 2M51A 1OISA 1YIOA 2DPDA 2B8AA 3MECA 3D45A 3SFMA 4GV9A 4LF7K 5HS9A 3TAEA 2R7DA 4F4KA 4ZC3A 1G59A 3PFYA 1IXDA 1GV2A 1KD1R 5FKNA 1U6GA 3HUGA 2K27A 2G8VA 1B07A 1MMAA 4FOEA 4JK9A 4BI4A 2PZ1A 1DTTA 3PV8A 2E6LA 1DT9A 4EP4A 2VOPA 1D4XA 1PSEA 1OJLA 1BL3A 1ZUKA 5EVZA 3G71N 3WTWC 3QEWA 1C1AA 1ONVA 3AG1H 5GAOp 1WJFA 3DAWA 1KHCA 4EM2A 3E5UA 1YIJT 1RBRA 1YE9A 3S1QJ 3M54A 1VQMN 4IG0A 4HPQA 5FU7C 4UV9A 3SQNA 4E7SA 2FBTA 4KUIA 3RUXA 1YS7A 2Y75A 4IOXA 1DU0A 2KZMA 4J5YA 1H641 3G7ZA 5F08A 3CCJQ 5AN4A 1JJ2S 4BKXA 1TWAJ 2RQVA 3P8DA 4A0XA 1I0CA 3REAB 3HRSA 4IX7A 2AKKA 2KJCA 4GY5A 1W9HA 2D1XA 1NLOC 4JDSA 1HNIA 4LNPA 4E9HA 3I0TA 2DJIA 4Q5VA 2K9MA 1ZRCA 2KRSA 2R4GA 4HLXA 1RCHA 4FJHA 1TQIA 1Q82C 5LJ5e 2QUFA 2O8XA 3U4LA 2VQFK 1AZEA 4M75E 1ZLKA 4BNCA 2F2XA 1IAWA 3RMDA 3MN7A 4N76A 4JS4A 1NKUA 3OYCA 2F6CA 5C2DA 3OIOA 1PUEE 3MEWA 3EHRA 4YNQA 2P9SA 1PUFB 2DT5A 2D5RA 2D8HA 3GFMA 2A3LA 3I9QA 3JAME 1NG9A 3OSSC 2G9WA 2XGXA 1NKBA 2E2HJ 1XMXA 4LIUA 4IPAA 1TTYA 3CJ1A 2LJ3A 3H0GJ 2DMNA 2RI2A 4J9FA 2I5WA 4Y92A 2CREA 2K9GA 2YX7A 1HJOA 5FFZA 5AQOA 3JB9H 1O75A 4BR0A 1N75A 2RHIA 1N78A 2Q97A 2DEUA 3TL4X 4EGZA 5KHDA 1G15A 1S7OA 3DKYA 3TP0A 2YHAA 3GBGA 4W5NA 1QZEA 1V76A 3LP2A 3EGXB 3FIWA 3NH1A 4OJRA 5GANe 1RLPC 3BC8A 4B24A 2R93J 3OH9A 3F8BA 5AIPA 2HMPA 2R7YA 1N8RU 5F0FA 2QQAA 1QLYA 3HZ6A 4PKCC 2R7FA 3JS6A 2XIGA 4H5RA 5BQTA 1PVSA 4PL6A 1BIUA 3WNHA 2FE3A 5GTIC 2N8GA 3ENBA 2IBDA 1W2BM 2WB1N 3HKZN 1WAFA 3KLEA 2QXFA 4IOAL 1LDJA 2DNUA 3CC2T 1NJIC 2GELA 1LWWA 4BYYA 3CCLN 1VQ5N 4OGEA 2MD0A 2CS7A 4CHOA 1PSFA 3OW2A 1CZ9A 2K79A 4M7DG 1TKDA 1VQ8I 2QA4N 2EZLA 2BV6A 4RTFD 1YUWA 4JJCA 1VQ9I 5GAGJ 1K7AA 1K8KA 4DU3A 3RZDJ 3I58A 3EL2A 1H8AC 3DRSA 2HOSA 1Y1WJ 3Q9VA 2XGCA 2LY9A 3F8CA 4ESRA 3CUQB 4FQGA 2H09A 1B9MA 2K5IA 4M9SA 2Q2EA 4Z02A 3KP3A 2WAFA 4XRSG 5C6SA 4IZZA 1N6QA 4L59A 2BE2A 1N8RO 4N56A 2WAQN 3KK2A 3NGPA 4L9VA 1BI2A 1ZRFA 4RW7A 1SAXA 4UV8A 1FYNA 3SWNB 1WCMJ 3JSMA 2H8HA 3JRAA 5EEGA 4JI2K 1C6VX 2L7KA 3ASOH 4OGCA 3FKIJ 3E5XA 5D6FA 5M5YJ 1TQMA 1MIJA 3FZLA 4KTZA 2WA0A 3ZT2A 2JS0A 4H0XB 2P51A 2XGDA 1YVNA 2IC3A 4L6V5 3PO5A 2JVHA 5E20A 3V1QA 3DKXA 2L2PA 1XMQK 3ZT4A 4FJXA 5AZIA 1EZZB 2W85A 3CD6I 3O8GA 3K2PA 5ADXA 4HW0A 2E3HA 2NUZA 1HW2A 3P9CA 2MCNA 2EV6A 1M30A 1ORNA 3GVAA 4AYBA 1HR0K 5LL6S 5CR2A 3A02A 1WIEA 4B9UA 1IHWA 3BR3A 2DXCA 4EQQA 3M53A 3ID8A 5AQXA 3RR7A 4E47A 4B1YB 1IH7A 3KLNA 4M3YA 1NBEB 1T39A 2KHMA 4F92B 3J8AA 1QVFS 4QVCA 3H36A 1VQPI 2XK0A 2EIJH 1ERDA 1WSEA 3D5LA 1ETXA 2DD4A 2M3AA 2RN7A 2HW3A 2MH2A 3HL2A 1F43A 2D8JA 3MEEA 1NBWA 1TWHJ 1U2WA 4FM0A 4OFEA 1NYGA 2DI3A 3U8XA 4M75B 4CJUA 3V9WA 1YG2A 2XIDA 2JMWA 3Q0UA 4JKGA 4V2GA 4CJ3A 1RBSA 4A6DA 1IKYA 4KRTA 2FBKA 2FUG2 1TT0A 1BI3A 2WFBA 1K0XA 3RYPA 1RGIA 3KD1E 2NLXA 3PFSA 1BCMA 1S1WA 4HUFA 1NMNA 1QHTA 4XLHA 3QPSA 1W7PD 1WXTA 3VV0A 2HBMA 4CA0A 3AGKA 3WHCA 1VQMA 1GUUA 1WEIA 2DYRH 1OOTA 4I99C 4CGDA 2HQAA 4B1RA 3JB9J 1VQLT 3SHFA 4GGGA 3RSEB 4PJJA 4R5PA 3AA3A 2BVLA 1KAXA 5GAMd 3DXJF 2XMFA 4RCCA 2P9PB 3WXMB 1D5AA 4E4HA 2FSWA 3FFKB 4P9UA 3I5SA 3P8BB 2Z16A 1K6OA 3D5SC 4GYIA 2DFUA 3KCCA 3CCQI 4FLWA 2I7PA 5D5VB 1F21A 2H6BA 4M72A 1KQSM 1BWFO 2C0IA 1UAAA 4AMCA 4GKJK 4PDKA 3M4GA 1G8XA 5A2QK 1HRHA 4B48A 3SJJA 3QESA 2DVJA 3DLHA 5L3BA 3PNVA 3B8AX 2BANA 2MA3A 2HI3A 3S9HA 1KVAA 4NC7A 3PNWC 3OYMA 3CCST 4ITVA 5I2MA 4Q47A 4Y15A 2ELJA 2HR3A 3RMAA 2Z33A 3BCBA 1WI7A 4A4GA 1DDNA 3BLYA 2IGIA 2JVGA 3GNGA 3PIPF 2R5YB 3OR1C 4QSHA 3HOXJ 1H88C 3RRHA 3T1HK 3H41A 7AT1B 3PIOF 4A5AA 2P9NA 4FSVA 1ACMB 1U0JA 1Y6IA 4Z88A 1R0AA 4IZ9A 3QPHA 4DBRA 1KZHA 3ZQCA 2QQBA 1X01A 1ZYQA 3EUHA 3S32A 1WJCA 4AQYK 2X6WA 3PSIA 1QCFA 2JW4A 2B86A 5BNGA 3HVRA 4BY6B 3X28B 3MAJA 3LAJA 1VQ6T 4CERA 2PMUA 2KW4A 2XVCA 4CJ4A 3CC4Q 5D6WA 2G6FX 1T08B 4GXOA 5LHHA 5CO7A 1K73C 2L9RA 1F1BB 2CSQA 3QYGB 2Q36A 3HTUA 4DSEA 2QKBA 3CC2I 1R00A 4IUTA 4CJTA 2WSEE 1VQON 2VCPA 2R7XA 3O5BA 1TBXA 2WACA 4YFXF 3CQYA 1PRMC 5IN1A 1DGWY 3HKZA 2GTDA 5J40A 3TQNA 2MOXA 3UKUB 3H5AA 5FRNA 3CCLA 3M0UA 2IS3A 1LAVA 4EEFG 1VK0A 5GAMh 3SV4A 2LSNA 1NK6A 1SD6A 1Q9XA 4FWRA 1IRGA 1XG7A 2QA4A 3RBBB 3LANA 3MCAB 4XK8E 3X24B 2J5OA 4QPQA 3BOQA 2D1KA 3LDPA 1BQMA 4EHTA 2KFZA 4FJKA 4C8MA 2AZSA 4J2BA 1WEFA 1AOJA 4BY1J 2V75A 2IS6A 2DRKA 5TKYA 1JEGA 2RJCA 5EZGA 1BW5A 3F9MA 3SK3A 1A6IA 1KU9A 1RT2A 3HPWA 2M9HA 2AHQA 4DQ2A 3BEXA 2DU9A 3OWTA 3C0BA 4CK3A 3DLBA 4B21A 4XNFA 3BFMA 5SWMA 1WJQA 2JWKA 3G4SI 3MD2A 3KEQA 2K5LA 4ZH4F 4BWMA 3JB9G 1OYIA 1YQLA 2ETHA 4LLNA 3T9NA 4EMKB 2LNHB 1VRUA 3JYTA 4Y33A 5F2RA 4XSZF 3I54A 2W0ZA 5KTQA 4AIAA 3UWNA 5EG0A 3K10A 3R6OA 4KT0E 1QZ6A 1ABOA 2OAWA 4CCKA 1WPYA 4PJOF 1JL1A 4XN3A 5ICGA 2LP0A 1VQKI 2L54A 4PL7A 5D5XB 1HPMA 4BWJA 3QLHA 2YHYA 4A12A 1FBUA 4BS9A 1YJWQ 2VQEK 2IW5A 5LGTA 4PJOD 1Z7UA 2X3WD 1TP4A 3I53A 4FW1A 3ULEB 4HV6A 3MP8A 3ZSOA 1VTNC 4X64K 4HTUA 3TEDA 5JICA 2QZ8A 4CGHA 1IDZA 1BJAA 3E2UA 3MN9A 5E8GA 4GY2B 1XNRK 3MWTA 3D5RC 2YR2A 2GBQA 2WC2A 1X9MA 4EZ6A 1JE8A 1MUZA 4YORA 1LFUP 5E3OA 1P59A 3ULDA 5LJVA 3M8QA 1CZBA 3IRRA 4MO4A 4C8QB 4E1NA 4WCEL 1ZAOA 2BXYA 2DPPB 1RRJA 1WSIA 3DOKA 1QRYA 5C2FA 4M3DA 4V19K 2CZ0B 2IIRA 1XX5A 1TK5A 1KD1O 3J7AO 2Y9YA 3S8PA 4NDLA 2P9IB 1N36K 3ASMA 3EZ5A 2HU9A 3RNJA 5D5WB 4BRLA 4ILJA 2VGMA 2P0PA 1IKVA 5CQGA 4EZ9A 3UT1A 5AQGA 3H08A 1VQLI 3LSKA 2V1XA 4RTYA 2A41A 5TKWA 3D7EO 3MKWB 4II3A 1EFNA 1NHAA 1U6ZA 2VBXA 2X1CA 3LDNA 3A5LC 5M1PA 3CMMA 5AYFA 3VUBA 4BD3A 2DA2A 3CC7N 4BDZA 4DV0K 1RDDA 4W1UA 2LT4A 5KRSA 4BR4A 5LL6Z 2DJNA 3GTLJ 3N5NX 2E5LK 4EATA 3CUOA 4LG3A 1VQ7N 2HTJA 2RV8A 1JJ2A 2KT1A 4A0YA 4G9ZA 2RGVA 3VEXA 5C4XJ 2G3RA 3VS0A 3QMLA 1X6BA 3LWMA 4C2UA 4RLFA 1VI0A 3HGGA 5CQEA 5L3GA 3DRRA 3DLLF 4DTXA 1EWQA 2AIRB 4BRKA 3OW2P 2GGRA 1TL3A 2YSRA 1BYMA 3CCRQ 2O8EB 1GOAA 1K9MR 3WODF 2E34A 4Z4GA 2QBYA 4II1A 3FZMA 4BBSJ 1RL2A 4YPHA 4A4FA 4GBQA 2Z1GA 2HKXA 2V79A 1DQUA 3COAC 3FXOA 3AA5X 4BRAA 3PY8A 4CF9A 1YW8A 2WAEA 2B9SA 4AFSC 5GPAA 3VEYA 4FZZA 3BJAA 1Y1VJ 3I4NJ 1P7JA 3Q3SA 3GLXA 2GQQA 1ZLJA 2LC2A 1YRNA 1S72Q 4CJSA 1Z3XA 3R6NA 4CHPA 5AQYA 3HTVA 1UMQA 3HM5A 1ZSZB 1MJ9A 1T7PA 4NC8A 1VQ6I 2A3ZA 4O8UA 4JX5A 1M3CA 4YY3K 4X9DA 1ZKGA 4DR5K 5CVVA 4K11A 5J1RA 3VYRB 2E12A 3GF5A 1M2OA 3GE1A 3VS6A 2DO3A 5SZTA 2YHTA 1X4PA 2ZCFB 3SAHA 3BG9A 4DS5A 4ANJA 1XI1A 4HNTA 3NRVA 4Y4RA 2R7OA 2ZJRF 1I81A 2RVCA 1VIFA 4AH9A 2QF7A 5CVIA 4DR6K 1DIZA 1S5JA 1KK7A 2E1HA 1Q86R 3L2WA 5GADJ 1NGHA 3I56N 1VQOA 2XY6A 1LWFA 3ZT0A 5GAHJ 3BTJA 1WAJA 3OSFA 3QFUA 5D6EA 4E1MA 2PU9B 4BJ6C 4FTHA 3KWIA 3G6EI 3LL7A 3P7NA 4M7AB 1WPKA 2OCEA 4ESJA 4H4KC 1LJOA 2OTJT 4MEYF 2QWLA 1SC7A 2HXOA 1YJNN 3JAMO 4HF2A 1YHQN 2P9UB 5EU7A 3NDKA 2BW3A 2HSTA 5L3EA 1NOZA 1TAQA 4WTOB 2EZKA 2F2EA 5E3MA 4RUGA 4HYEA 4M7DF 3NFCA 3HOVJ 3K5LA 3OYBA 5FKOA 1NU0A 2IA1A 2EX3A 2J6KA 3SJMA 4EJTA 4GVMA 1KQ0A 1HYZA 2PEXA 4JYAK 1O7FA 2VODA 4M7DD 4R79A 3OGDA 5K5RA 3CJAA 2ACJA 3CCVQ 2D0AA 3LMMA 3OYYA 2KT0A 4X65K 1BB9A 1T3VA 5LJ5d 1OX9A 2E1MC 2FX0A 3FZKA 1ATRA 1MDMB 3DXKA 1HUXA 1V5EA 3E6DA 3A0HC 2LCLA 1KQ8A 4RB2C 1RUNA 2FF4A 4FLXA 5GMKm 3FBIB 4FVMA 3M59A 5KYYB 1Q82R 1V4SA 3D2EB 1QHAA 1XSXA 1BHLA 4JRIA 2M8EA 3HJFA 1M1KU 1IBKK 2HQ5A 3O4NA 4L5IA 1UJ0A 3VWBA 2VQCA 1ZLMA 2Q0UA 4H0VB 2P5LC 1VSIA 2Z0WA 4F17A 5EF6A 3TU4K 3KP7A 2L3DA 3RKWA 1ZQ3P 5HRSA 3VYTB 4CFBA 4YOQA 3KFWX 1U49A 3BP8A 2IVNA 3NVKA 1PVEA 2VXZA 3IH2A 2MK5A 3Q1JA 3AVHA 2CP0A 1HKGA 1BA5A 5GANd 5GMKj 2O8BA 4HCCA 4FWSA 5LMNK 3A8MB 3GP8A 3ZMUA 1IF1A 2DXUA 4AT1B 2QWMA 1WJAA 3THWB 4JI1K 1BJZA 5MLCQ 1JXOA 3ZPLA 1QVFA 3VS1A 3M3ZA 3G71T 3CMAN 3PX4A 1AEYA 3THXB 3OYLA 3LGLA 3D2FB 1X3ZB 2D5VA 3U9ZA 1FTZA 1MNEA 5KE3A 2ECZA 2QXLA 2W41A 3ER0A 5KRTA 3JREA 3DOLA 2XDDA 1GLEG 2W57A 2ZBKA 1YYVA 4FT2A 2RNJA 3BE3A 1IREB 4A3IJ 2YLCA 8ATCB 3QAHA 3VS3A 2ZO4A 4F14A 1AD5A 3HP6A 2Z3YA 3ABUA 5BMZA 4P55A 1JLFA 2I8DA 1YCYA 2GQVA 5K14A 3GNFB 4JKFA 3HOUJ 4LG0A 3VQ8A 2JUCA 1ZG3A 1NJIR 3CC7A 2HF4A 1K4US 3J80K 3DLMA 1EETA 2FVUA 3EGDA 3DM2A 2L3QA 2D0CA 4H0TB 2PVGB 3TREA 5LJ5h 5L3FA 1WLPB 3HI0A 1VQ7A 4L5JA 3GZ5A 5FKLA 1CF7B 4EW4A 4S04A 2DJZA 1WH7A 3VS7A 3MP1A 3VQ9A 3JRZA 2Y1IA 2M34A 3HPHA 2AT1B 1M3HA 4KHQA 3ERMA 1NK4A 3O6WA 3S41A 3VA3A 1WVRA 1TUYA 4BY9C 2MYSA 3KHYA 4PSWA 2FHDA 3F5TA 3HRUA 1OPKA 1MBGA 4OIPF 4N0AC 1X2KA 2BY1A 4A3KJ 4LK1F 3ZN1A 1JLBA 1R0BG 4MGRA 3U2RA 1C6VA 2CSOA 5FKKA 3IWFA 3K70C 4PA1A 2VL8A 2K85A 2DK8A 4J9HA 4XTYA 4R55A 4DOZA 1PRLC 4CZHA 1YLFA 3M8JA 1BI4B 2XHIA 4RTTA 3K70D 3HTSB 3V1RA 4Z94A 4I01A 3QOEA 3WG7H 3C4SA 4D7NA 3W3CA 1NM7A 4OB2B 5GANh 4DSLA 3K0LA 4J9EA 3OS0A 2M4KA 2HQXA 1QQNA 5F0HA 2DA5A 5C42A 4HX4A 3VQ6A 3JCMV 1SRMA 5EY4A 4CJWA 2GAUA 3TAMA 4HUGA 1HKSA 4A54A 2IPOB 2E5KA 3CCEA 2EWNA 3M0PA 4KB1A 4YIRX 3SEMA 4BJ5C 5KH6A 3F70A 1NGNA 3M1FA 2JZ2A 3U9GA 2CP6A 3HBLA 2CQXA 1R49A 3MDQA 1I39A 3SCXA 4E2FB 3MXJA 3CCLT 3QEXA 2ZPHB 1NEBA 1VQ5T 1O3SA 1W0UA 3SV3A 2FOKA 3F73A 2DTRA 2V7ZA 1ZBXA 1VQ8Q 4HKEA 3FSPA 3ZFJA 3I56A 5LRRA 2K02A 1ETQA 2ZCWA 1HSTA 3U21A 1OCZH 1QVTA 2ZXHA 4LFUA 1LOJA 1RZ4A 4FK4A 1CXQA 1RBUA 2XY5A 1KAZA 4A3JJ 1U5SA 3KZZA 4TV7A 1YJNA 1YHQA 5A2QZ 2JPSA 4E9EA 3H3UA 2HZDA 3GUDA 2LVMA 3O9TA 5GAN8 3S1NJ 2P84A 1TNTA 4XKWA 2LK2A 4DTRA 5GINA 1QMCA 3JCMd 4RW4A 3I4MJ 4J83A 2LCSA 5ADXH 5CPRB 1NK7A 3OR2C 1R1UA 5J3LA 5LD2C 4IEIA 3GF2A 3QO3A 4WQ4A 3CCMA 2XAHA 1LWYA 1SSFA 1VAZA 4BDPA 3ABMH 3TOBA 1KFZA 4PJMA 4KFBA 5GAMf 2AQFA 4I02A 2F96A 1NWKA 3KP6A 5CIUA 2KDSA 4B8XA 2FYKA 4FL6A 4M77G 3N4MA 2BGGA 3F6VA 2PQWA 4J9BA 1UZCA 3UNGC 2EQJA 5IPAA 3DKMA 2WADA 2D0QB 1W36D 3FF5A 1NK9A 4B1ZA 3HSBA 1J5OA 5LMUK 3I5RA 2EA2A 3CD6Q 3OTOK 3O3GA 1MDUB 3PQKA 2E1YA 5CHZA 4Z4CA 3CP2A 3MAQA 3H9NA 3DEWA 4OVLA 1N32K 4ESBA 4D8KA 1JJ2P 2LQNA 3GBQA 2FPDA 1RT6A 3O8MA 5AQFA 1D8YA 3JB9D 1JLEA 2DODA 4YFKF 3V1OA 3CVSA 3TO6A 2ASOA 3O9RA 1YW9A 2V4JC 3AVJA 3OMGA 4F7UG 5TJJA 1X6GA 2X85A 2UV1A 5LBQA 1O3QA 3OYNA 2HSEB 1JRIA 3FXRA 2FF3B 4FJ5A 5FRMA 2IP2A 3UDCA 2UYTA 2KNBB 4DW6A 2EQIA 4KO0A 3MN2A 3TAQA 1ZTRA 3H3NO 2R5ZB 1YF5L 2ZMEB 3G71I 1JU5C 1I4K1 3WE2A 1QPIA 2NUPA 4AG2C 1RTIA 5GAN6 3IP4B 2X0LA 2KPMA 4V2FA 1POGA 1UOCA 2GA2A 1T0FA 1VQMI 2DAQA 3M1CA 1CXUA 3CESA 4JI8K 3CMAA 2HXIA 3JRIA 3H45C 3NFAA 3F8NA 2ZPGB 3O3KA 1BCOA 3C1DA 1PU8A 1B1BA 4PKGA 3HYFA 3R9PA 2J06A 5IP6A 2VOOA 1K9MU 4MO5A 5H6RA 4DSIA 4ELZC 1U5TB 1M90U 3O9UA 3CCJT 3KLFA 3E1YA 4RCHA 2P1JA 3JCMh 1K73R 1R77A 1FOKA 2QLZA 3AVCA 1T6DA 3MEXA 3DFGA 4LD6A 2J4RA 3EYYA 1Z0XA 1Y97A 4PJOE 3SMPA 4ZDPA 5KGWA 3HOZJ 2M1BA 1DP7P 2BW3B 3R4KA 4IO9L 1S3JA 4IFYA 1BISA 4KIBA 2YNHA 1W7PB 2W6LA 3JRDA 1UFFA 3F6OA 1N9RA 1KLMA 4EJZA 3O08A 2HQHA 1JXBA 3QODA 4DTPA 5CR4A 4ISGA 3GLLA 1KG6A 3V9UA 2UUCK 4XH5A 3CPWM 1MH4A 2V52B 1NLVA 2XG8D 2K4BA 3TPQA 4O3MA 4M7DA 3HOSA 4HTLA 5LEJA 3EYIA 1UTIA 3Q0VA 4DV3K 3I59A 9ANTA 4C8KA 3TAFA 3IQLA 3LQQA 1ZXOA 9ATCB 4FWQA 3L4IA 3VQQA 3K6GA 4EPCA 1OH5A 2KFDA 3CXCS 1K78A 1S1TA 3DMJA 3LSIA 2PVOB 4M41A 5GAN3 2XRLA 4BY7J 2K6DA 3TSUA 3SYTA 1K9MO 5CZ2A 2M7BA 1REPC 2AZVA 3MX2A 4P96A 5I42A 2FZCB 1XN7A 1Q86U 3L9FA 2LNVA 5AQNA 1DGRM 4B23A 5HVQC 4XRSA 5LEKA 1WBDA 4YDUC 3BR0A 4EJWA 4BQOA 3FDYA 4GLMA 3KETA 5A2QO 3EFOB 3N4QA 3M6GA 2ZM6K 3NH2A 2E19A 2HHHK 2V1UA 2W82A 3SUNA 3RWUA 3V7SA 4J01A 2HF3A 3QICA 3OOUA 3KK7A 4M78F 1JGSA 4LK0F 4DV5K 1KQ9A 4HCKA 1BDGA 4FCYA 3MEAA 2LMDA 3CC2Q 3U23A 4B1VA 3F10A 2AO9A 4FZYA 4N41A 4LN2A 3CCLI 2GOMA 4M78D 1VQ5I 4XR6A 3MKLA 1TC3C 2NRRA 3NPFA 2QA4I 1Z05A 1E3HA 2OFIA 2A61A 1RKTA 2EIMH 2K2VA 2F5DA 1TK8A 3QNNA 1OEBA 1VQ9N 2KK4A 3RIRA 4QQGA 2MSYA 5KYXA 2X6YA 1YAGA 4P5OA 1Z1DA 4ELYC 2I7NA 2HDAA 4UC4A 1JI8A 2NOZA 3OH6A 5E1WA 1RAFB 5K7HA 3TABA 5FFXA 3VUZA 1V5FA 2EGEA 1GLAG 1GLNA 4IDHA 4K8XA 2O31A 5HL7L 1PP7U 1Q82U 2JHNA 2VQHA 1X1CA 2E88A 4K43A 2VC8A 1FKOA 5B1AH 2L7MP 1QVFP 1ZBHA 2LQWA 4E7IA 3JRGA 1FIAA 2L2OA 4HSRA 5BS6A 4B9QA 2HKOA 3NMUA 2X4XA 4JYKA 2M5WA 5KYUB 3K58A 5K7ZA 4JN4A 3WTSC 2Z1IA 4U67L 2V7FA 4W5TA 3E7LA 2W40A 2CSIA 1GRIA 1Y0NA 1D3BA 4MFEA 4HWIA 2C06A 1FMVA 2HSPA 2LY2A 2F9WA 3HIFA 4A5NA 2GA1A 1GBQA 1D1BA 3MZ8A 3U1KA 4DV4K 2XPVA 2LNBA 4XN0A 4ISEA 3MQ0A 4ZDOA 3SJHA 4LE9A 1T95A 1W6XA 5DLQE 2DOEA 1BI0A 2LCCA 1ZHFA 3H1QA 4CJPA 3WE3A 3CHWA 1A5WA 3V4IA 3H0IA 4BRNA 3REBB 1XQPA 1Q82O 3WG9A 3EZWA 4A63B 5DM7L 2RDPA 4O8KA 2OPQA 4CEQA 3M0QA 4LDUA 4OLAA 2VKDA 3BR6A 5BPDA 1NGFA 1T05A 5GMKh 3FHFA 1VQPN 2IEKA 2DD5A 4PJOB 2YRCA 2JHJA 3AFHA 1XGNA 4RW6A 2H3EB 2OPPA 4EVVA 3LFUA 3LWLA 1YN8A 1NJIU 1BIZA 2F2VA 3C65A 3EG9B 2D9TA 5IP9J 1LCUA 4OIQF 4M7DE 2EQKA 3GL1A 4C8NA 1TQPA 4OFHA 1R22A 2XF5A 2JT1A 3CQ8A 2QVOA 3KNTA 1UHWA 2F5CA 2VONA 5CQXA 2W4SA 2P81A 3GTKJ 4JD2B 1RAIB 1TT5B 2ZPIB 4ELUA 1VQLQ 1C0UA 4GFBA 3LLRA 4N4IA 3FHNA 3UE5A 1Y07A 5A0GA 1NJXA 3NGIA 2X6XA 3GTMJ 2A5XA 3O4QA 3UKGA 1FSHA 2ZE2A 2DDBA 3BG7A 4O55A 2GFUA 2B6AA 4RAFA 1VQ7T 3AA2A 1XMOK 3EAEA 4I7FA 4M3UA 3S1RJ 3CCQN 2YDLA 3AVIA 3RYRA 4BHCA 5FLVA 1SFOJ 5KYWA 2CZ1B 3QJ6A 1JTYA 3CBMA 1YITN 2COBA 3E19A 4J2DA 2RI3A 5ERIA 3LH0A 2BGCA 3K9KA 1YTYA 1NJIO 2ZXJA 2JJ9A 1OX8A 5M5XJ 4KICA 4CJFA 5L3CA 3ZX3A 2KIUA 5GIPA 3SZPA 4YTLA 4KGXB 1KD1C 1ZGAA 4XU0A 2XKOC 4P9FA 1B4AA 4J2AA 1GVDA 5DCMB 3KP5A 4EJYA 4O6JA 2X35A 4B3XA 1LDKB 1FT9A 2MIOA 4HVJA 2EPDA 1ASUA 5FWBA 4BDYA 4PSXA 2VQGA 1HBXG 1BK2A 1VRTA 1WWXA 3HP9A 2SEMA 5LJ5f 2HVHA 3KK3A 2F7TA 4G6QA 1A5VA 5HNFA 2Y30A 3BY5A 2P0KA 4KITB 1I07A 3CPWP 4N4GA 2VV5A 2Y0SN 2VE8A 2BY0A 3AAPA 2V9KA 3CUQC 2KRHA 4PJLA 1WHMA 4XH4A 2OAZA 2BIVA 1VQ6Q 3I3LA 4BE1A 2DBMA 1MBFA 2CUJA 4F9OA 4JRQA 2DYIA 2PUOB 3TGNA 2DOAA 4DTNA 3CDLA 3PO4A 1U48A 3FXUA 3CC4T 1B34B 4CC3A 4CIEA 2HMAA 1HC8A 3S14J 1PJRA 1VQOI 4EA5A 4B47A 3FKJA 2IPQX 4CCLA 2OQRA 3LSJA 3SWNC 3OV8A 4JJDA 5J26A 4JI7K 1QZYA 5IAYA 1QHGA 1SFKA 1SL1A 2P9LA 4C92G 2KI7A 1R6RA 2JSCA 1WJRA 1LEBA 4RTWA 1M1FA 3VF4A 5JLWA 4E9FA 3UKRB 2FXAA 1TW2A 2FNPA 4MLHA 5GANf 4CGGA 2E5NA 4XLNF 3G6EQ 3JCMb 5JFRA 4A59A 4UY8O 3C0CA 4JKHA 3KYCB 5CKDA 1X9SA 1W4SA 3AT1B 4RKUE 1RNLA 2LDUA 4M7YA 2KRNA 3GOXA 5DM6L 3FE1A 2ID6A 4MQ3A 1FN7A 1H9GA 1NJYA 1HOMA 2O4GA 1UECA 3TDUC 2YG8A 3N4PA 1EH6A 3MX5A 3AVMA 1JO8A 1BOBA 3DLKA 3TMOA 1VQNN 2EKOA 1VQ4N 1FOXA 2E7WA 4FM1A 3G4SN 1JLGA 3A01A 2CT3A 3LM9A 5FLXE 2KZZA 1K8AR 4LUEA 1M1EB 5J4VA 4FSSA 1O1WA 3VERA 2M87A 1QQOA 4FE7A 3MEDA 4CZJA 5JLXA 2YNGA 1HNZK 1MBEA 2O5RA 3FK6A 3QYEA 3W3DA 1SKWA 2HOEA 4E70A 3ESWB 1VQKN 3BDPA 1WHGA 4YG2F 4M75C 5D8LB 3GYHX 1Q9YA 2OTLN 2RQWA 3ATVA 5HBMA 3IG1A 5F0XA 4GNIA 2M30A 2ZXWH 4HVWA 2BHZA 2LTOA 2OJED 3FR0A 3KLHA 2EYZA 4E7KA 4WQ5A 1DUXC 3L3VA 3OJUA 4FJNA 2P8TA 1GCQC 2O6GE 2VGNA 2KRCA 1JLCA 3QIPA 2EFPA 2NOIA 5CK9A 5EJCA 5CZ1A 4M77D 3THYA 2E1MB 5JS1A 1K79A 1RDUA 4C1NI 3M8FA 1SD5A 2IVWA 2F48A 5JVGF 3FHGA 5M1NA 4DSKA 1WSJA 3ZEUB 1DGKN 4LF6K 1K73U 5JLHA 2H1LA 4H5VA 1NK2P 3LA7A 3PNTA 4HQMA 3HZJA 1XS9A 2X1DA 3DLGA 2YUQA 4XTVA 4C5EA 1GLJO 1BU1A 3DTEA 2EBIA 3V6DA 4A5BA 4HNUA 1DLOA 4FJIA 1KG2A 1ZH5A 1QP2A 3M3YJ 3QRFF 1ZA1B 2VWJA 3V7RA 1MD0A 3THVA 5J39A 3L2RA 2FLOA 2VB6A 5E8IA 2A08A 1N5YA 2O9LA 3KKRA 4M78A 2DL8A 1MUDA 2A5WA 4BXFA 2EVRA 1TVRA 4CBUA 2EYQA 3RQIA 5BRDA 1YCSB 3VQ7A 5J2QA 4UNFA 1XUPO 3OMCA 3CC7I 4XRMA 4XRFA 3EHQA 2XAJA 4MZTA 5IHNA 4L8RB 2H56A 1VQ7I 2JJ7A 2DA6A 5CKTA 1FPQA 3SDBA 2XGEA 2KXDA 4A0ZA 5AQSA 1G2HA 3IFRA 1NEGA 3K4BA 1UB9A 3ZSVA 1YTUA 1K73O 3AO2A 2DT6A 1VRLA 1GBRA 3M7GA 3PE0A 1N5ZA 2A40A 4KHNA 1RTHA 3A5MC 1ETYA 4CZCA 4LF8K 1YITA 4BY6C 2EKHA 3G1JA 3BR5A 3CF2A 3RZOJ 2ROLA 3OBWA 4I98B 2CW7A 2Q2RA 4CYDA 5H20A 4G7OF 1UGRB 4WXDA 1NGDA 4BEHB 2YKNA 1K6YA 3RSNA 1P92A 5GAEJ 4CW7B 2LYCA 5CHIA 3DTIA 5CCAA 1WSUA 3QPTA 4ZN3A 3VF6A 3KJVA 2MF2A 3VTIA 4CYCB 1O3RA 3QQAA 1Z26A 3CTAA 4XTWA 4BGAA 4IJNA 4LOCA 1KA8A 1NGIA 3CXCA 4K25A 1GXPA 2KZGA 3OB9A 1FNNA 1I1JA 2COWA 2YU9J 3F21A 5AZJA 3T19A 3JSCA 2JA8J 4DB3A 3RRGA 2Y48A 1HKCA 2IGNA 2RAEA 4RG8A 1T0HA 4F93B 4IWVA 1TU0B 5IT9E 4RAZA 4QQ6A 2GWJA 2XRIA 1TNSA 2ABLA 4FASD 1JLAA 3IH7A 1SMYF 1S8NA 4XLAA 3URGA 1S3XA 4GYGA 2DXTA 4CSWA 3GFLA 1NK3P 3E9PA 3NGYA 1WI9A 3A8OB 4PLLA 4ZDLA 1KG1A 3I56I 2GUIA 2UXDK 3ZSWA 4YOUA 3SBTA 2Q8KA 2A05A 2O4XA 2HEQA 5ECAA 1RFQA 4EMKC 4JHDB 2L0KA 1SS6A 3C3WA 1H8KA 4OU0A 4YHHK 1EIFA 3QJYA 5GAOm 1ZX6A 4MTDA 1YJNI 1YHQI 1SPKA 2HZTA 1HDDC 2HHVA 2NRZA 3BDUA 2VWBA 4N47A 2DL4A 1YWPA 2AP1A 1YQKA 1QWEA 1SQKA 3QG1A 1PD1A 4ZN1A 4G9YA 4QVDA 3C2GA 5KCHA 5M1QA 2HHTA 4CJKA 3WTZA 4LD9K 2X48A 5I21A 1AT1B 3I0SA 2O8FB 3H35A 3KPHA 4CF2A 3MZYA 4LMYA 1D8KA 1OI1A 1OCCH 3S2WA 2GLOA 1MPGA 4QAGA 3CCVT 2RQUA 1SL2A 4RB0A 4XIDA 1VQNA 1VQ4A 2F5KA 1ZG5A 3TAGA 2DZCA 1BOAA 3M0RA 3IAM2 4NC6A 5HY6A 5FPDA 4FM2A 1UG1A 1S9EA 5BPLA 1YI2N 4EJOA 2QK9A 2RMOA 4MNUA 1T0JA 2BH1A 1QS4A 3I55N 2OPTA 4KI6A 3B73A 2A6HF 3HSEA 4M6XA 1MA9B 2RQTA 1UG0A 1ITYA 1UEBA 2HVSA 4GLKA 4LD0A 5KVRA 2XASA 4M78E 2WWYA 2GNCA 2Z1DA 2OTLA 3AG2H 1FOWA 4M75G 4CF0A 3GFJA 3OBYA 5E3LA 2HDWA 2BEOA 3OY9A 1HYOA 3GTOJ 2EFNA 2LH9A 1GLDG 2HZYA 1B3QA 3LYIA 1RAEB 1R0CB 2CP7A 5CVRA 4DFKA 2Y0MA 2KAFA 5EX5A 4DTMA 2UWMA 3WXJA 4L0ZB 1Z21A 1Y96B 5LLQA 3VYHB 3ZBDA 1Z91A 4KMUX 2F5TX 1VSMA 3LAPA 2RI5A 2MI6A 1KCFA 2LTPA 4OOIA 4A3GJ 1TYQB 1AWCA 3RDVA 3NARA 3ZQGA 3G71Q 4UUSA 1IKWA 3CMAI 2CZ6B 1YXQA 3VQ4A 2TRTA 1P4AA 3BPVA 4ETSA 3G1LA 2JK3A 4D0PA 1KGSA 4JX6A 1FBSA 1VQMQ 1KEAA 4AI4A 4I6MB 3ZRGA 2F8SA 4F16A 3WEEB 2ED1A 2VT3A 4MDBA 2QWWA 5LJ3f 4JAXA 3GTPJ 2IS4A 1X2QA 2KE9A 3MMVA 2VBWA 2HBPA 2OZ6A 5EGOA 4W5RA 1UHMA 2LBFB 2EBPA 1NPRA 2F2WA 2JN6A 2DQRA 3QYBA 1Q95G 5FGMA 5LGUA 1N3CA 4M9XA 3L42A 2NRHA 1C0FA 3I33A 5C10A 2V8KA 3J80E 2AS5F 2D4WA 2VLAA 1W1WE 1I6XA 4BR7A 4LSLA 1J6ZA 2QKKA 1LNWA 1BGXT 1IN8A 3DB3A 2HTSA 1TS9A 4IRIA 2NOEA 3T8RA 2E2QA 2ZWHA 3EG3A 5J6XA 2FRWA 4XLEA 3T0YA 3N5BB 2DN0A 1RACB 3C7NB 3M55A 3AO1A 2CUZA 5AQZA 2DLPA 1B8IA 2V9VA 4HDUA 4FJJA 3RI4A 5C0YA 3FMQA 4IRGA 1HNVA 4CHNA 1TH7A 4JPBW 2P9KB 2DTHA 4V2SA 1SANA 2GTOA 3HHHA 4DOWA 1VZ0A 5LJ3g 4DV7K 2QKMB 1RT7A 2FD5A 4I2QA 2CUDA 1KVCA 4CCOA 1SFXA 2F4OB 3EG1A 3PSFA 4BC5A 4OIOF 4LF5K 4CHZA 5J2MA 2L4AA 4KHUA 1S7AA 1XTAA 2DFHA 4B9MA 3E9OA 1L3LA 3NAUA 4ESFA 2QEXN 1Y57A 2OPSA 4KYWA 2E1NA 3DV8A 1TGOA 2RPIA 3FM3A 3CJNA 3ID6A 3JAMK 3H9JA 1IKXA 3G0QA 3CCRA 1DPRA 3H3OB 4E9GA 3FXJA 3BUZB 3BY6A 1C1CA 2HQEA 3WXLA 2E64A 1R5HA 4B1UB 3FXQA 2FSNA 4CCNA 4M77A 4YFUA 4EGYA 2NVTJ 3AV9A 2YJFA 1Q8IA 1XQHA 3EE8A 1T98A 3E6CC 1OH8A 3CCLQ 2FB7A 1VQ5Q 1XGMA 2YNFA 1H89C 5DUIA 4JI5K 3RPQA 2NNNA 4EW0A 1APLC 5JLFA 2QWRA 1BIBA 2QA4Q 3BR2A 3DU5A 3VQ5A 1S72A 3P5JA 4LSNA 1LCKA 1HKQA 4ZGDB 1HD3A 1A0NB 3DXMA 5GAMj 1VQ9T 1TWCJ 3ABKH 1T38A 3NH0A 2GXGA 3K5MA 3QZ9B 2KL4A 4CBWA 4LD5A 3PVLA 4F7UA 5T7BA 1B6AA 1YJ9N 2LX7A 2MMPA 4BB7A 3MFKA 3C94A 2PJRA 4DQRA 3LA2A 1T3SA 3AG4H 2P6TA 4WFAL 3VQBA 4HBLA 4C92D 3LM2A 1YO5C 4IHSA 4KDPA 1M2VB 1GHCA 4CGJA 2DMOA 1YNZA 3ZX0A 4DOVA 5DLOA 2O8DA 1M8MA 2J7IA 1SVOA 2DQLA 2YI1A 2OJ2A 4F2RA 3EUHC 2YUNA 4KAZA 3SZGA 1KU2A 3P83D 5FLMJ 2A6EF 2ZJPL 2DYSH 4MQVA 4N4OB 2NVUB 2A36A 3V7CA 2P4RA 5E1XA 1VFCA 4C8QG 1YI2A 4NYNA 1LOTB 1K8AO 1V3FA 2EW3A 2V26A 2J5PA 4EA4A 3I55A 1R23A 3EQLF 4CECA 3NNQA 3A5NC 3S2DJ 2DA4A 2E2OA 2QTXA 1ZBSA 3K1MA 1ETWA 1B9FA 5JVHL 2KKZA 2BZXA 2DVEA 5KGXA 3S1MJ 4EVIA 1FX7A 2Z2SB 2KRFA 5CVUA 1T8IA 1JL2A 3MEGA 5GAN2 2W25A 3IS9A 1ESVA 5M3FJ 4M3XA 1UJYA 4IIMA 1JHFA 1D0YA 3LSHA 1NJWA 4KRFA 1LUJB 5J4YA 2CJJA 3I0XA 2XUBA 2CGKA 4XIUA 1NPPA 1SRLA 1KXPA 1UHCA 2DK5A 3CM5A 4EIAA 1BU6O 1VQPT 4HOBA 3K57A 4ZTJA 4HVVA 1JT6A 1RLQC 2MPXC 3SEZA 1Y0MA 2ITMA 4DEYA 4AFZC 3BTIA 5KN8A 3WQUA 1MNDA 2WV0A 3A2FA 4QW2A 1U4BA 2MC3A 2YUPA 3JV3A 1S7EA 1DU6A 1CQTA 4IXAA 5ICEA 1P6RA 4H0OA 2HNZA 3P1GA 1JBMA 3JCMJ 4O0JA 1ASWA 2NS7A 1NLPC 3A5ZB 2YHWA 2JSPA 3PGGA 2RHXA 3R0JA 3U3GA 2ZJQL 4RBOA 4CIGA 2KLAA 4DR7K 3GPLA 3A4CA 4WXCA 4AM7A 2JGUA 4CGIA 1QVGP 3SUQA 4XTXA 3RPUD 3OS2A 5FPEA 4Q48A 3CWAA 1IBMK 1IXRC 2RF0A 5CE3A 1WDXA 5GAOn 4RTXA 3M0SA 3QSUA 2OV7A 1YIJN 1Z77A 2FRYA 4G1QA 5GTHC 1EP4A 2V6CA 1WNLA 1OCTC 4A2BA 3DU6A 3CCQT 5C12A 2KDOA 4KHPK 4FJGA 4II2A 4CZKA 4CESA 4G7ZF 4BGBA 3VOVA 1YITT 4ENNA 1FSEA 4XQFA 4X62K 4KREA 1HU0A 1R58A 4M77E 3DEEA 4CFCA 1KYWA 3PO2J 1LKXA 3H46O 4PGGA 4KN4X 1IRXA 1Z67A 3J81E 1ZSGA 1WN7A 1K9AA 1XSVA 4FYXB 2L7ZA 3H0DA 1XSDA 4UB8C 1IG7A 2NYSA 4Y91A 1RUOA 4HSTA 4XH1A 2UZKA 1DEJA 1GLFO 3LFKA 1MMNA 2HBLA 2R5MA 4XLFA 2QQ8A 1X1DA 1SKUB 1SFEA 4F7UE 1BBYA 4D8DA 3NWTA 2O8CB 3JB9I 4N0BA 2QEXA 2PJPA 2R57A 1LVAA 2LKXA 2J05A 1ZBFA 4UXNA 1AKHB 4M7AG 4MZMA 2O7OA 3ENHA 1J2XA 2QQ9A 2JN0A 2IJLA 2RHYA 4IBNA 2DFFA 4Y28E 4M3BA 3VEZA 3RERA 2CGJA 4DTOA 1VQOQ 3PQJA 1MJAA 2FZGB 4C3JJ 2X1EA 5AQLA 2AJQA 4AHCA 2H8RA 2FC0A 3M0TA 1EQYA 2X4WA 2JUGA 4C5IA 5J2NA 4XSXF 2G8HA 3TBIA 2X3XD 5AQTA 1A04A 4NCAA 1B7TA 4I9LA 2HYGD 3C2BA 4NQWB 2VQLA 1RI0A 3K9JA 2IVPA 1OYYA 5GAHP 2EYWA 2VYPA 2DL3A 1G3YA 4LF4K 5EC7A 1A6QA 2MWOA 4EM1A 1IGUA 1KJWA 5HRRA 2I2LA 2VJ5A 2XDBA 2IAJA 2RF2A 4L9NA 3VKIA 5EGOB 3TW7A 1U2VA 1YJ9A 1G5VA 1MMGA 3ZXSA 4IUQA 4DR1K 4IRHA 4RLQA 1WOQA 1OR7A 5DV5A 5F0CA 5H1SQ 4CF1A 4N9IA 4QOZB 2VI6A 1VQNT 1VQ4T 4HG2A 3LWIA 3E01A 3G4ST 5M9OA 5GAN7 2K2MA 5EEHA 2RQRA 3PT9A 4HZFA 1VA7A 1BOTO 3AVBA 1J9AA 4UQGA 3F9KA 1T2KA 1S9GA 3EO3A 2GXBA 2VXEA 2DBBA 2IAIA 2VBZA 2ADUA 2LRDA 4RW8A 1YP5A 4DQSA 2ZPBB 1FYMA 1C0GA 2ZMEC 3F2KA 4AIDA 3TTFA 1VQKT 4FPAA 1X3WB 2VC0A 4ZYEA 3QEIA 3O2PE 3D0SA 2YU3A 4EJVA 4LDXA 3J7ZI 5HRPA 3ML6A 2K3PA 2LKSA 5FROA 3PX6A 4XL9A 3EN9A 4BGDA 1HSQA 3CIPA 2CMPA 4FLUA 4JRPA 3WVEB 2O88A 3HVTA 3ZETA 4ZJZA 3RJPA 3ZMZA 1U5TC 3E1SA 3SQ0A 4M74A 4A3FJ 1UGQB 4HVUA 2STWA 3CJQB 3OA6A 4KUDK 1ON1A 1ZELA 5EXWA 1W0TA 3PTAA 3VTHA 4FX0A 3OYHA 3Q0WA 1RC9A 3K0SA 3WQTA 3K5OA 1ZA2B 3EETA 1SHFA 1W2BS 3CD6A 3J7ZO 2CFXA 3H6ZA 2L3PA 1XHZA 1E0EA 1QKXA 3NEUA 4M3GA 1WHHA 2O2OA 4OPHA 1SUQA 3GTGJ 1PWTA 1XQOA 3GW2A 1MSFC 1ZREA 5AQHA 1MKMA 3VDXA 3DJCA 2XAUA 1YFNA 1OZ2A 5GPCA 1NH3A 3OW2M 2DA7A 1C0TA 1YW7A 3BQZA 3EH2A 4BG8A 1WHKA 4B8CA 2ZFUA 4KH6A 1D0XA 4N4HA 2R7ZJ 2VYTA 4FLZA 3CC7Q 3ZSYA 1X3UA 4PCQA 2LKPA 3IKVA 3ZX2A 3T7ZA 4A3DJ 1VHXA 2Z1JA 2CH6A 4ELVA 3VPRA 1VQ7Q 2MLGA 1G6NA 5IWAK 4PUOA 4FYDA 3QEPA 5DD4A 1OYWA 1QPMA 4PLIA 1B9DA 2RN8A 3MMYB 5LJ5j 2MABA 2CT4A 1QCNA 1YITI 3HM9A 1YIJA 2K4JA 5AQUA 2FSJA 1F36A 3K4CA 2OFKA 4JZ4A 2ZC2A 1T33A 4C92A 5HLHA 3VPZA 3O80A 2GBZA 2GQIA 2R7WA 3P8HA 5DDGA 1ZG1A 5E3NA 5ELZA 3F0ZA 2WONA 1OKJA 4D6WA 4AHTA 4L9TA 2DPNA 1NGAA 5D8KB 3U1DA 2X9DA 4YEJA 3DEUA 5IHIA 4KUMA 2XHBA 1SF9A 3QU3A 1LE8A 4B9SA 2VJIA 2E2NA 1ZBLA 2DILA 4CJ5A 3MKDA 4O5FA 1J59A 1AWWA 3CCSN 3DI6A 4A93J 4OKEA 3AVLA 5GANj 1W5SA 2X51A 4XLCA 1TAUA 2CZ7B 2RQQA 3I8DA 2Q3SA 2O9SA 2V1DA 4Z89A 3F23A 3IUOA 4BRIA 3HXMA 2EB7A 2ME0A 4NL3A 4ELTA 2HEOA 4BE2A 1X1PA 3OS5A 2DY4A 1Q1VA 1Y71A 3HPGA 4KIGA 1KFSA 4OVAA 3SBGA 3HUGB 1FLIA 3RR8A 3BJOA 3CI5A 3RQ4A 2UUBK 1ULYA 1M1KC 4CEBA 2E5ZA 3P9IA 2A3SA 1KSWA 3CETA 3I56Q 1JB0E 1Z9ZA 1TL8A 5HDNA 3KE2A 3MCZA 3CP8A 3PIPL 3VYGA 5ED4A 3T1YK 4DUYK 4Z4FA 1ORKA 4CXFA 4DK9A 2GBYA 2DCEA 2X4HA 4F04B 3G6ET 3FX3A 3PIOL 2EGAA 1YJNQ 5GAN5 1YHQQ 4CJVA 3OYGA 4JNEA 3LZIA 2PVDB 1W0HA 4QS9A 3L2CA 1KG5A 3QYHB 3BW1A 1IUFA 4AM3A 4UUVA 2W03A 4JI3K 4CFAA 4DV2K 4KISA 1IXSB