3L2VA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and mk0518 (raltegravir)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 97
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2vA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2vA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2vA03
1RCHA 4M3UA 4DSFA 2XO7A 4OGCA 3HSTB 4KPYA 4O0IA 2QKBA 3SV3A 3OS0A 3DLEA 3OYAA 2JGUA 1MHNA 2E5QA 2NUBA 2WONA 3QIIA 4OKKA 1KVBA 4PA1A 3EYZA 3V6DA 3KD1E 1TAUA 1BL3A 3VQAA 2GFAA 3AO4A 3META 3DRRA 4FLWA 3SZ2A 2RJEA 4E1MA 1SUQA 1VSHA 1UOCA 3AVBA 1RTHA 1S1VA 2RJFA 3LWMA 3TAPA 2YHBA 1XWLA 2YNGA 4DFPA 2IAJA 3DB3A 3NTIA 2IS3A 4I7FA 3SYZA 4QCLA 4RW6A 4EP4A 2HB5A 2A1RA 3WNFA 3K59A 2O4IA 3EZ5A 2RKIA 3IAYA 1YT3A 1T03A 4OPKA 2G3RA 4FM2A 4B9VA 1VSKA 4DQIA 4KHSA 3QEPA 4X34A 2A1SA 3SPZA 3H08A 4DFKA 3DLHA 4M41A 4Z4CA 1Q9XA 3G10A 3JSMA 3RR7A 4KAZA 1XHZA 1U4BA 4W5OA 2KW4A 4M3XA 4GVMA 3I0SA 4OGEA 3KLGA 4DLGA 5FRNA 3NF9A 1NK0A 3UIQA 2HNZA 2OPSA 3CFRA 2PYJA 4QQDA 3CQ8A 4I9QA 2IG0A 1DTQA 3AO5A 2XDPA 4KV8A 4DWIA 1TL3A 3CM6A 3MXIA 3OVNA 4KTWA 2R58A 3ZSWA 4AH9A 3QJ6A 4M3YA 3FDRA 1VSEA 1LAWA 3MEWA 3DOLA 3MECA 3F70A 1CXUA 1TKDA 2F8SA 3HT3A 4ELVA 2KZZA 2GV9A 1IO2A 1RI0A 1RBTA 1ZBFA 3E9GA 2YHAA 4N4IA 5HRRA 2IDOA 3VQDA 2LRQA 5KGXA 5CZ1A 4JRQA 4HCBA 3NGZA 2DFFA 4B9TA 2G8UA 2R57A 4C8LA 4FJ7A 4QQGA 3CM5A 4AHUA 1CLQA 3QEVA 4IUPA 3RMAA 1HYSA 2RHZA 1S1TA 4CHQA 3O3FA 1U49A 1T7PA 4F2RA 3OYHA 2RI3A 1LAVA 4O0JA 3KK1A 4DQQA 2EKOA 1NJWA 1J9AA 1GOBA 3DMJA 3NH2A 5I3UA 3CEYA 4FCYA 1KHCA 2O4GA 3TANA 1U47A 1N6QA 4CCHA 1LWCA 1I3AA 2MWOA 3AVMA 1Q9YA 4M42A 3MEEA 2RI2A 2E4LA 4CEEA 3OYFA 3LZJA 3NFAA 4CJKA 4AHSA 5CZ2A 1HYZA 1W9HA 1REVA 4NCGA 2HVHA 3ZEHA 3M8QA 4WE1A 3P8HA 4HCCA 5CY4A 5C24A 4DMNA 4CGFA 3T19A 4B8AB 3V81A 4FJIA 2HHQA 4KI6A 2Y1IA 1C1BA 2BUDA 1SV5A 2B5JA 2VG7A 1B92A 2XY6A 4YFUA 5KCOA 2JTFA 1B9FA 2X35A 5FDLA 1QSYA 4J2BA 4FK2A 1R0AA 4ELTA 5IAYA 3NDKA 2GFUA 1J5OA 3HP6A 2B6AA 1NOYA 4C5EA 1BI4A 4KRFA 4BWJA 4CJEA 1L3VA 3LANA 2X4YA 4B9SA 4UQGA 2HHVA 4CF9A 4E7JA 4IUUA 1TK5A 4F2SA 2RPIA 4FJ5A 3E9FA 3RR8A 4FYDA 3M8RA 3LX7A 4FJLA 4DTXA 3SJJA 3NNQA 4GW6A 5D6YA 3AVCA 1NKBA 4CF1A 1ASVA 1FKPA 4FXDA 3VQCA 3KLEA 1RT1A 2Q3SA 4Z0UA 1BGXT 1C0MA 3OYCA 1IG9A 2GBZA 4DSLA 3B6PA 1LW2A 4JLHA 1N27A 3KUFA 1UA0A 2XK0A 3MP6A 2DIGA 1WAFA 3QIPA 4UC4A 3VQEA 4CHPA 4MQ3A 4CFAA 5KTQA 4OLAA 3KLHA 4CJRA 4DF4A 3TARA 2X6NA 1U48A 4DSIA 5JS2A 3QESA 1WN7A 3AVAA 2QKKA 1S1UA 4M3ZA 2RHIA 3OA6A 1YTAA 4PQUA 5D6XA 3C95A 2HHXA 3OYBA 3AA2A 3DLKA 1JLFA 1WSFA 3VQ4A 4N5SA 1TAQA 4DLEA 5J2NA 2XY5A 5J2PA 4BE0A 5J26A 1XHXA 3KKSA 3OY9A 4N56A 4DTJA 4B8CA 3HPOA 4EDUA 2O4XB 3VQ9A 4CK1A 3OJUA 1ZYQA 4EZ6A 4B9MA 2OYQA 1QSSA 5KRSA 1IKVA 4I2QA 1L3TA 4QVZA 3V9UA 4OKEA 4J2AA 2HHSA 4Q5WA 3OYIA 5HRNA 2B8AA 3FLGA 3U3YA 3PNWC 4I9LA 4BE2A 4IURA 1WSIA 5HRSA 2X4XA 3H6ZA 3SQ2A 3LP2A 3DI6A 4ELUA 4RG8A 2WACA 2X4WA 4BD3A 4M3WA 1VSDA 1RBSA 5FROA 5KH6A 3E01A 4DTPA 1T05A 2HQEA 5CIUA 4CEFA 1OZ3A 2HMIA 1BQMA 4OVAA 1SKSA 3NF8A 2QK9A 1U45A 4FL6A 1XNIA 3KLIA 3QO9A 4FW1A 1JL2A 2G8KA 3LP1A 3ZT1A 4FM0A 4W5QA 3MP1A 3NBPA 1I39A 2EQMA 2ITGA 1RILA 3OMCA 1C6VA 1RT3A 4AHVA 1ZBUA 4Y1DA 5C0MA 4FJ8A 2K3YA 2LDMA 4CEQA 2G8HA 4F3OA 3S3OA 4FK4A 4Z4IA 3NTKA 1QS4A 4LH5A 1RDBA 3MEAA 2RJCA 5KGWA 4CERA 4FZXC 4DS4A 3TAFA 1NJXA 4CJ4A 1KRPA 3SUPA 1BCMA 4DTMA 1A5VA 3TAQA 1D9FA 4CGIA 4L8RB 1NJZA 4B3OA 2RHXA 3QERA 1KLMA 2L8DA 3LGFA 4CRIA 1BCOA 4RG2A 5IN1A 2IC3A 4FVMA 4ID1A 1EETA 4KKOA 3MXMA 3I0RA 3OYLA 2BIVA 3L42A 1BIZA 4QQ6A 2R5MA 3DM2A 4N4GA 2VG6A 1RNHA 3O4NA 4RW7A 1OI1A 2YRVA 4CFBA 4FLTA 4CEOA 4BDYA 3RMBA 1X9MA 3L3VA 1LV5A 3HPGA 2R7YA 3S9HA 2G8WA 3L2UA 1SSFA 4CGJA 2VWJA 4FJMA 4CJFA 3PX4A 3FFIA 4CGGA 3QLHA 3RRGA 3V9XA 3S3MA 4PL6A 4W5RA 4DU4A 4B9LA 2Y1JA 2EQKA 3AVHA 2JLEA 3P5JA 1D5AA 1VSFA 3JYTA 3CFPA 3NE6A 4FM1A 1BI4B 1WGSA 1VRTA 4CF8A 4TSXA 4CHYA 4FJNA 3IG1A 2IOCA 4HTUA 4CF2A 3K5LA 1IKYA 1HNIA 5J39A 1ZBLA 2K3XA 3QIOA 3HK2A 4B9XA 1JLGA 1U04A 3DRSA 2PZSA 4Z02A 3CG7A 3RMCA 3ME9A 2YKNA 3C94A 4CK2A 1EXQA 3ZCMA 3K58A 2FC0A 3S3NA 1BISA 3VQQA 3OMGA 3CFOA 1ITGA 2PY5A 4Z4GA 2GF7A 1A5WA 3MEVA 1O1WA 3OYGA 2L3RA 4PWDA 1QSLA 4BDPA 5M9OA 4EZ9A 4KB0A 4H4MA 2VYTA 1VRUA 3LH0A 2KQ2A 3VQ8A 1W0HA 2HHWA 4CECA 1UA1A 3PMIA 4FJXA 1HPZA 1WLJA 3AV9A 2X74A 1G15A 3MAQA 4ZTFA 4FLZA 3LP0A 4ICLA 3OYNA 1CXQA 3KLFA 4KHNA 2HVIA 4PLLA 1VK0A 3SUQA 2W42A 4IUVA 2D5RA 1WNSA 2BANA 2VWKA 2BE2A 2X78A 4NCBA 4Z4FA 1WSEA 4DTNA 2KTQA 3K5OA 5J2QA 3NF7A 3LLRA 5K14A 3VA3A 4C5IA 5C6SA 4CFDA 1GOAA 3NF6A 2X6SA 1QHTA 5KE3A 4R5PA 4PY5A 4BE1A 2OZSA 3MEUA 4CESA 4JS4A 1L3SA 4CJ3A 1TKTA 4EP5A 4NZGA 3THVA 2KFZA 4HCZA 2BGGA 4FLUA 3LDSA 1KFSA 1XI1A 2E6MA 3AA5X 3DLGA 1Q8IA 2VG5A 1SL2A 1KVCA 5KRTA 1WJQA 3AO3A 1HNVA 3FC3A 1QE1A 2FBYA 4H8KA 5KCHA 2IGIA 2XY7A 4E0DA 3PO4A 3I8DA 3G0ZA 2ZE2A 3AVJA 1HQEA 3VN5A 4FLYA 3TI0A 3L2VA 3AVKA 4QW2A 4FJHA 4KHQA 1OYXA 5HRPA 1UWBA 3OYEA 3U3GA 3NH1A 3V1OA 2OZMA 4FLXA 3TWHA 4IFVA 4L59A 3LGLA 1D8YA 4CGDA 4C5HA 1JXEA 4DSJA 3RWUA 1RT2A 2HHUA 2EQJA 2RO0A 3MXJA 4B9NA 2FHDA 4NS5A 3L3UA 4AHCA 3O3GA 1RBRA 3O3HA 3RMDA 1QTMA 2AJQA 3EAEA 1KVAA 3P1GA 3TR8A 2D9TA 3MP8A 3V9WA 3SPYA 3K2PA 3AVLA 2BKDN 2ETJA 3NHGA 1JLEA 4FZZA 4K8XA 2KFNA 4N47A 1VSIA 4NYNA 1A5XA 3NH0A 2JZ2A 1G5VA 1C1AA 2Z1GA 3C6TA 3C6UA 3LALA 4DFMA 3S6WA 1QQCA 4CJSA 1NK5A 4DF8A 5HP1A 2YKMA 3LZIA 1T8EA 2PYLA 4FJGA 3HO1A 4OLBA 1S9EA 2MWPA 4KFBA 2OA8A 1IH7A 1RT5A 5D3GA 2G8VA 5T7BA 5I42A 2XHBA 1CZ9A 4IKFA 4DG1A 3ISNC 4E7KA 2L89A 4DSEA 3OJSA 2BDPA 4H4OA 3PY8A 2RN2A 4CJUA 3PX0A 4BWMA 3V1QA 2XY8A 3LPTA 5J1EA 5HROA 1KSPA 4QAGA 2ZQBA 5DMRA 3ZSVA 1NK9A 1RTDA 3PMTA 3L2WA 4II1A 3GOXA 1DTTA 2Z1IA 1FXXA 2M1HA 2RHYA 3KJVA 1L5UA 3M8PA 2EHGA 2WOMA 3DLMA 1BIUA 4A4HA 4C8MA 2YV0X 1KLNA 4W5NA 1UAXA 1ASWA 2ZD1A 4CEBA 3PFSA 4F4KA 1RDDA 3L2QA 2HNYA 4DTOA 3VQ7A 3SUOA 3AA3A 4HVJA 4LH4A 1S5JA 4NCAA 2OPPA 4HUGA 1HQUA 3HP9A 3KD5E 3NTHA 4CJQA 4F8RA 1RBVA 3F9KA 3OYKA 1RBUA 4CE9A 5SZTA 4DQRA 3LPUA 3SQ4A 3OS2A 2FBTA 4CJPA 3AO1A 4E19A 4ID5A 4A4FA 4E3SA 3ZT4A 1X9WA 4CJWA 4KO0A 2RF2A 4DTRA 1X9SA 4IBNA 4J2EA 1C0TA 1BQNA 1K6YA 3ITHA 1ZBHA 3ZSXA 4AILC 3LWLA 3KK3A 4CEZA 1NK6A 3D45A 1N5YA 4DTSA 3AO2A 1NKCA 1RDAA 3P8DA 2LCCA 4CK3A 3KKRA 4Q0BA 2HW3A 4N41A 4CIEA 4Y1CA 1OZ2A 1ASUA 4GY5A 4BACA 3VQ6A 3DOKA 3QINA 3BGRA 1LW0A 4RW9A 4E7HA 3H8ZA 2QXFA 1J53A 3BDLA 1JKHA 2OPRA 2PQWA 3KK2A 1LWFA 4KHUA 3QNNA 2DFHA 3AVFA 2I5JA 1LWEA 3BDPA 1J54A 2LVMA 1Y97A 1JLQA 4FU6A 1CZBA 4O44A 4Z4EA 3WNEA 4HHTA 4JRPA 3HVTA 2E6LA 3DRPA 1IKWA 5CYMA 4KHYA 1RTIA 1TK8A 1SL0A 2P0KA 3CYMA 4PUOA 2GUIA 1EP4A 4Q5VA 3K5MA 3SV4A 2RHUA 4CFCA 2HQXA 3QBYA 4CEDA 3WNHA 2R5AA 1FKOA 4CIFA 3PX6A 4HUEA 3OQ5A 1VSMA 1EX4A 2F96A 3AA4A 1WSHA 2P5GA 3M9QA 2DIQA 4XIUA 4DFJA 3HJFA 4LD0A 4C5GA 2DAQA 4HUFA 3L2RA 4LD6A 1S6QA 2LTOA 1KFDA 3PUFA 4DQSA 4LY7A 4LSNA 4E1NA 1NKEA 1TGOA 4CEAA 2D0CA 4CJVA 3IRXA 1JXBA 4NYFA 3T1AA 2FBXA 3ZSRA 3NCIA 2QQSA 4QOZB 5D6WA 4KTZA 1S1WA 1KTQA 4KREA 4M3RA 5FRMA 3OS1A 2M16A 4FW2A 4IFYA 4CJTA 4ZHRA 3VQBA 1IKXA 1HRHA 3SNNA 2B4JA 3O4QA 4IUQA 3V9ZA 1ZBIA 3OYJA 3QNOA 2EFIA 4C8NA 3V4IA 2P51A 3ZT0A 4DS5A 4B08A 3HL8A 1H3ZA 2YNIA 4DTUA 5C42A 1B9DA 3HM9A 1BHLA 3QKJA 3D0PA 2E6NA 1TV6A 2P5OA 4O55A 4IDKA 5KI6A 5E41A 4YNQA 2Z1JA 4OPJA 4MFBA 3NGIA 3K57A 3V9SA 2M0OA 4K8ZA 2DFEA 3A2FA 4KB1A 3UT1A 4A4GA 3ZSYA 4CGHA 1WJSA 3LYIA 3T3FA 4C8KA 2ATQA 4DU1A 1JLAA 3ZT2A 4FJJA 1S9GA 4E7IA 3O8VA 3AVGA 4DQPA 3L8BA 2RJDA 1VSJA 3HXMA 2P1JA 1NK4A 3B6OA 4CJ5A 4OJRA 3U6FA 1NK8A 3TABA 3VQ5A 3ZT3A 3OYMA 1X1PA 1C1CA 1JLBA 2LSNA 2Z1HA 3UWNA 3TAGA 3SUNA 4B9UA 2O4XA 3VA0A 3QEXA 4M3TA 4RW8A 3RRHA 1YTUA 2OPQA 3DLBA 1DLOA 2HNDA 4OVLA 3K5NA 4FZYA 4O5BA 3ZSZA 1RT6A 1HMVA 4I2PA 4IG3A 1WSGA 4IG0A 3MEDA 5C25A 3KIOA 3EY1A 4ZTJA 4C8OA 3OYDA 3SQ0A 2F8TA 3KTQA 1RTJA 4CHOA 4O4GA 3HPHA 4FJ9A 3RTVA 4N4HA 4CF0A 3QEWA 3M8SA 3ULDA 2EX3A 1NJYA 4N76A 1RT4A 1JL1A 4W5TA 3AVIA 4F3TA 4JS5A 1F21A 2FBVA 1Z26A 1NOZA 2EQUA 4IUTA 1Z25A 4DU3A 3ZSQA 5HLFA 1XC9A 4FK0A 3PO5A 1FK9A 5CYQA 1C0UA 1RDCA 1WAJA 2QQRA 1TVRA 3WNGA 3Q1JA 4AHTA 2DY4A 5DK5A 2F5KA 2YNHA 3ASMA 1YVUA 3SD4A 4CHZA 5KE2A 3ALYA 3AVNA 3MEGA 3P83D 4RW4A 4CJLA 4FJKA 2HHTA 1L3UA 3HVRA 3TAMA 2CKKA 1HJRA 1TL1A 3VQPA 1TKZA 1WJRA 3ZSOA 4B9WA 4GMJB 4LSLA 1SL1A 1HYVA 3LAMA 4G1QA 4CIGA 3DB4A 4A4EA 3SI6A 1S1XA 5EU7A 1SKWA 2YNFA 4DSKA 2KZMA 3QETA 3TAEA 2D0AA 4M45A 3SCXA 2NLUA 3C4SA 4PLIA 1GOCA 1RT7A 1VSLA 2D0BA 1D9DA 2G8FA 4KTQA 4KHWA 4J2DA 3QEIA 3ASKA 3OB9A 1WSJA 3LAKA 3FEOA 4FLVA 4AHRA 3PV8A 1S6PA 3V1RA 3LP3A 3HYFA 3IS9A 5HBMA 4E7LA 5SWMA 1SKRA 4KI4A 3F73A 4CHNA 5J2MA 4BDZA 3DYAA 4OKJA 2XRIA 2DTUA 5JS1A 3DLRA 2G8IA 1EKEA 1KCFA 1MU2A 4E89A 3NGYA 1JLCA 2RI5A 3MO8A 4Z4HA 1NK7A 3NAEA 1TKXA 1TK0A 3SQ1A
chains in the Genus database with same CATH superfamily
2DOEA 1NYGA 2W82A 2RQUA 4KPYA 3HC7A 4G7HF 4W1UA 4JHDA 2NOJB 2ZKZA 3G0QA 1SFEA 3CCEQ 1RTHA 4OX9K 2RJFA 5EG0B 4EP4A 2L9RA 3LQRA 3WNFA 3G6EN 1YJWN 4RTVA 1QVFA 4DQIA 4D0PA 2AO9A 2AXTC 2MAMA 2M2EA 4Z4CA 2CREA 1DQUA 4YOQA 2XDPA 1TL3A 2V9KA 1MUNA 1D4XA 1OH6A 3HT3A 3KZYA 2P9PA 1XDSA 1HNXK 1MMDA 3KP2A 1YHQQ 3GEZA 5GANf 3O9RA 3OW2M 3JCMb 1W7PA 3RQ4A 2EFQA 3HM8A 4ILHA 1GOBA 3GX4X 4FCYA 3PJRA 5DCFA 3SHWA 1SAZA 4ZYDA 3M0QA 3BROA 4NCGA 1VQKA 2GXGA 5C24A 1UGPB 1A0NB 4KI6A 2Y1IA 1SV5A 1C1BA 1O75A 4KN7X 2V1NA 4E4HA 1JE8A 1FEXA 1EV7A 2OU2A 3WU0A 4HX8A 2EVRA 4QLCU 1J5EK 4HRIA 4MQ9F 3G6EA 2EINH 4YY3K 3ZGKA 2R5YB 4GYIA 1Q86R 2CH4A 4OLAA 2WTUA 2JW4A 4AI4A 4UXNA 2WAEA 1VQNT 2KXCA 3CMMA 3S32A 1NKUA 3TVTA 4MFDA 4FK0A 5J2NA 3KKSA 3WQUA 1IN5A 3OJUA 3ZPLA 2Z16A 4ZYEA 1DKGD 1ZSZA 1D1BA 4B4CA 2DT7B 5HRNA 3H9GA 2GQQA 3DLAA 5LLQA 3F5TA 2XPVA 5M1QA 2F6CA 3CO7C 1NG6A 5DS9A 2KK4A 2EQMA 2D1HA 2NRZA 2LJ3A 4K41A 4FJ8A 4NLBA 3ROUA 4XSXF 1RDBA 4UUSA 1YJNA 5K5QA 1BCMA 3ERED 2H56A 3VU3C 2L8DA 2EYQA 4PJJA 1T08B 3EG9B 3RMBA 2R7YA 3VOVA 2DTHA 3ZR8X 1VYTA 3PX4A 1UB4A 4NBQA 1KQSA 3CJ7A 1VF9A 3CPWP 2JLEA 5EX5A 3THYA 2WSEE 1BI4B 1GV5A 2R7VA 3CCRA 1IKYA 1HNIA 1ITYA 4BVPA 5AFUA 1F1BB 1TWFJ 5CQGA 1QCFA 1I1GA 3WU2C 1QMCA 1S72I 1MBEA 2DN0A 5GMKh 4F52A 4BRPA 1QA6A 3HSCA 4AQYK 3REAB 2L0KA 2FF3B 1RLQC 2ZNZA 1AHDP 1KC8U 3LP0A 2E1MB 2H09A 4XICA 5CQYA 3AHUA 5GTIC 4JI2K 3NF7A 1ZN2A 1XGMA 5FKNA 4A3GJ 1IG7A 2XGXA 4K2EA 5KYUB 3E6MA 1IRFA 2OAZA 2E2JJ 2IEKA 2DT6A 2V8IA 2DETA 3H5NA 1TT5B 1J7KA 5LD2C 4Q47A 3CPWS 2IGIA 2XY7A 1HQEA 3P31A 2VKDA 2RQQA 1YJWQ 1X3MA 2VL8A 5CCAA 1VQNI 2L4MA 4CO8A 1ATRA 4CGDA 3WXKA 1SHFA 1RT2A 2HZTA 3SZTA 2AJQA 1RPWA 2X3WD 3EAEA 5GAN2 5ILSA 1V54H 3DBLB 1GHCA 1FX7A 2E5NA 1NGEA 3S6WA 1VQ4I 3HO1A 1N8RU 2M02A 4KFBA 3MZ8A 5T7BA 3Q7CA 4P5OA 3JRFA 3OJSA 4PDKA 2XY8A 1S72N 1NK9A 5AN4A 2VJ5A 2M1HA 3MDQA 1ORNA 1ATNA 4UNOA 3FBNB 3PGGA 2FB7A 4ISGA 2X6XA 2X9HA 3BW1A 3H41A 1WHLA 3JAMZ 2V7YA 1HQUA 2A3SA 3RDIA 4FJXA 1DUXC 4NL3A 2YUNA 3ZT4A 1BQNA 4EPCA 3BR6A 2NUPB 4CEZA 3T5XA 3BQYA 4GRIA 1XD7A 3JRBA 1FNNA 3IKMA 3HOUJ 2M30A 4CIEA 4GY5A 3N97A 5J1UA 2DMQA 3E19A 2V1RA 4II2A 2Q31A 3QNNA 1EIFA 5E3MA 1XOVA 3WTYC 1Y97A 2X1CA 2CS3A 3X25B 3LDNA 2E6LA 1IKWA 1ZQ3P 1T56A 3LSMA 4CZLA 5FU6C 2RHUA 2O8BB 3HFNA 1KQJA 2EA2A 2OTLQ 5GPAA 4LY7A 4LSNA 4E1NA 3CD6I 3NCIA 4KREA 2QQSA 3WTZA 1WRJA 3I56A 3PTAA 2COBA 3O4QA 1ZC6A 2HKXA 2HBWA 3CJBA 4CZMA 4DV2K 3ZMZA 3ZT0A 1LMZA 4P5NA 2CZ0B 4RTXA 1ARKA 5C42A 2KQWA 3QKJA 2E6NA 3DXKA 2VXDA 2FPEA 1IW7F 3GTOJ 2M0OA 2NYXA 4RDUA 2IVPA 5AFUH 4DQPA 3DAWA 2NNYA 5EEGA 1X3WB 5KYXA 4BI3A 3WGHA 3VA0A 1MBJA 3GXOA 7AT1B 2OPQA 3HBLA 1DLOA 4BJ6C 4F7UE 2FRHA 2ZJ2A 4ENMA 2HEOA 3GOIA 3IV5A 4IZZA 3UB5A 3KTQA 3WTVC 1UUEA 2H6BA 2KGTA 5LL6S 4LF7K 2MFZA 1OCCH 1RRSA 1R59O 4A0YA 2VE8A 3IWZA 3EGDB 2OAUA 2BY1A 2DY4A 2M5WA 2XGCA 1XTDA 4M7AB 1W7AA 3A1YA 3SD4A 5KE2A 3AVNA 2FNPA 1NBEB 1SL1A 3PLAA 3LAMA 4PL7A 3SI6A 3QETA 4FWRA 1YG2A 2KPMA 3WE3A 4RMNA 2DMPA 4XR6A 2PQ8A 2HOTA 4Y0WA 5LJ3e 3WUHA 2DTIA 1MJ9A 2XO7A 2XPUA 3CMYA 2FBIA 4AMCA 4M7DA 4EVVA 3CETA 3JXUA 2E5QA 2EFWA 3BP8A 4DBFA 4M7AC 2RJEA 4CCMA 2XU8A 4BR0A 1XWLA 1HXDA 1U1SA 4I7FA 4FWOA 5DTDA 2DA7A 1HLUA 5KN8A 1T03A 1REPC 3R60A 1APLC 2CQKA 1MDMA 1XHZA 5A0LA 3RSEB 3CFRA 4XLHA 4RAYA 4IHTA 4BEHB 4AH9A 2R58A 4JKGB 3F70A 2CZ7B 1IO2A 1V76A 1UE9A 3NGZA 5FW9A 3GBGA 4EHTA 3T1YK 1UJ8A 4F2RA 4XKWA 3DWLE 1BN5A 4DQQA 3TANA 3OBWA 4M42A 2K57A 1LWCA 2MWOA 2UUBK 4KICA 2E4LA 3SDGA 3K4NA 2EJGA 3T19A 4HAMA 3W6JB 2NYSA 4XK8E 4CCJA 1CSKA 4NC8A 2ASPA 1R0AA 1YHQT 3HP6A 2OQRA 4IL6C 4BGBA 4CXFA 1ON2A 5F0CA 4LUDA 3W2AA 1TK5A 5AQJA 2P0QA 4DV7K 2L3QA 4D8KA 1F9NA 3CCVI 4IHYA 1PHTA 2PJRB 3B6AA 4KT5C 2JNGA 4NLCA 5FFZA 4MQ3A 1IXDA 1F5TA 5JLXA 2CSIA 2HMPA 2ZFUA 4RWTA 1WSFA 5LJWA 3MHXA 3L1AA 3CPEA 2Y0SN 4EZ6A 4F3QA 5H20A 1L3TA 4Y91A 3PSIA 1JJ6C 4BE2A 3LH5A 5E3NA 1P8ZA 3W6VA 4R79A 1YIJT 3EZWA 1ULYA 2NOBA 4L5GA 3CC2I 4Z4IA 3S1QJ 1N9SA 1VA7A 4H0OA 2R0QC 2JOYA 2VQGA 3MWMA 2G9WA 2HR3A 4FE7A 2NRTA 4CJFA 2CQ7A 3EH1A 4ZDPA 1HJOA 1F36A 2A42A 2ZB9A 3V4GA 1QCNA 4G94A 1F4KA 4KGVB 1KQSM 4AG2C 1OR7A 4HF2A 4OMOA 2PG4A 3BPXA 3VOEA 1W0UA 2NVTJ 2BZ8A 2GF7A 4HVVA 3O8MA 2LREA 2DYIA 2F5VA 2W0ZA 4ISEA 1K9MC 2DM1A 1VRUA 2FOKA 4G12A 1WLJA 3AV9A 1HNWK 5F1JA 5B8HA 2GGRA 3RESA 4KIGA 4OO1J 2ROLA 4NCBA 1S7OA 4M75F 1A5JA 4C5IA 4CFDA 3A03A 4C0ZA 2QASA 2KFZA 3KYLA 2H27A 3QG1A 4JDSA 3AA5X 3ZLJA 3CCSA 3SXYA 4JI1K 1IF1A 2RQPA 4OB3B 2UUAK 5AQPA 4G8XA 3MN7A 3JRZA 3LGLA 3HGGA 2F5TX 5JFRA 1K8AR 3JRGA 3ECOA 1YW8A 3DTKA 3NHGA 1BU1A 3FK6A 4CJ7A 2GLOA 4RTTA 1ZXOA 1ZG1A 1A5XA 4DBQA 4B3RK 4DF8A 3IH4A 2D0OA 3KYDB 1X1BA 3A5LC 4A61A 2DNUA 3KE2A 4H5VA 4BWMA 3FZVA 1BDGA 3PMTA 4DR1K 2JA7J 1Z05A 4D7MA 5KN9A 1HCRA 2Q36A 2XC7A 2KLAA 3QBXA 1S5JA 1ZAOA 2OPPA 2IA1A 2IGKA 3C6HA 4KGXB 3P8BB 3CCUA 4CBWA 4UVCA 4Y3OA 3CD6T 1HKSA 3LWLA 3K6GA 3AO2A 3FXUA 4C8QC 4Q0BA 4RLFA 4LG3A 3ASOH 4RBOA 1K9MU 2ZM6K 4CBXA 3DOKA 3KK7A 1JGGA 1FSEA 3VEWA 2LOOA 1JJ8C 3KP5A 4WX9A 4IHSA 2CT3A 1W5CC 4O44A 3UR3C 5IHNA 2VPRA 5TKWA 3C2HA 1TK8A 3CYMA 3SZGA 4EJOA 1MBFA 2K5CA 1O7FA 2JWKA 3S2WA 4LD0A 2DAQA 4HUFA 2YS9A 1TGOA 3T1AA 1JXBA 4UUSB 4FW2A 4M3DA 1K4US 3DJCA 4J6YA 3OYJA 2XROA 1D3BB 1RGIA 1HD3A 1NG2A 4B1XB 1TV6A 3E0JB 3D1NI 2F2VA 5KI6A 4AM3A 1NPRA 1VQKQ 5AQGA 4MZMA 4E6RA 5K5RA 5FD5A 1X1PA 3GFIA 2OTLA 2WWYA 3HEFA 3VF4A 1FY7A 1YTUA 2YX6A 2V51B 2LLKA 4O5BA 4I2PA 3KIOA 3OYDA 1LEBA 3N5BB 2ZNYA 2CFOA 4HNTA 1X2KA 1TNTA 3BY7A 3M0UA 3B6CA 3F9MA 2R7OA 1FK9A 2O2OA 3JB9F 5GANd 4B3SK 4IXAA 1USSA 1VQ8A 3J7AF 3QDFA 3PFIA 1HJRA 1WDXA 3M0PA 4G1QA 4KGZB 3KP6A 2NAZA 3BR1A 4AIJA 1IV8A 1Z21A 3OB9A 3FEOA 3PV8A 1J0RA 3DLRA 1BJAA 2RI5A 5GAMh 4BBSJ 4C0DC 4JKHA 5EXWA 2BY2A 5C10A 3CMAI 1QGPA 2NOHA 1WZ2A 3AO4A 2YLBA 1Y56A 3JTGA 2WA0A 4PJOF 4A3FJ 2VGNA 5J8FA 4V19S 2NNNA 1H8KA 4FM2A 2P4WA 3UKRB 2DPPB 4QVDA 2JT1A 4MEYF 3CCQA 5AONA 2IP2A 3CCMN 2BH1A 1U2VB 3CM6A 2YU3A 4LIUA 2O8FB 4PUSA 3OA9A 3DOLA 4XU3A 1TKDA 3HRUA 3E9GA 1MGTA 3HI0A 5LJ5d 4JK8A 4UV9A 1U5TA 4A93J 2VKHA 1LOTB 1ZRFA 4BR4A 3SFMA 4CI0C 1U49A 4JKEA 4MLOA 2KJBA 4F17A 3A2KA 3G1JA 3AVMA 1Q9YA 3RUXA 3NFAA 1GLNA 1W9HA 3M8QA 3N0UA 3O9UA 2BTTA 4LLNA 4B1WB 2MA3A 5K7HA 5KCOA 3K4CA 3H1QA 3TP0A 5JVGF 4XIDA 4O8KA 3R8EA 3NVMA 3ZL7C 2J7IA 4F2SA 3EH2A 4JI5K 3FKJA 1D1AA 2X85A 4AIHA 1XQHA 4FXDA 1WHJA 1YCSB 3JAMO 1VQ4Q 1N27A 3KUFA 4ANJA 1O57A 3VQEA 5LMUK 4DSIA 2DDBA 5GAOq 1R0CB 4BRMA 2QKKA 4HVUA 2DMUA 2QLZA 2PTKA 3OYBA 4M7AF 3KZZA 3CW7A 4CK1A 4BJTA 4QVZA 2O5RA 1YJWI 1HKCA 3PNWC 5HRSA 1YTYA 1TW2A 2ACJA 2EFOA 3ZMTA 1PU6A 2DA4A 5CIUA 1IN7A 4HSBA 1KG3A 5DYMA 4JJNK 1FC3A 4HW0A 1YN8A 1X1AA 3HZJA 2DX1A 2GTDA 5F1RA 4IOAF 1KD1O 1MMGA 3MEXA 3EO3A 3HRGA 4XOTA 3D2FA 5L3BA 2KFDA 4FVMA 2XG8D 4KKOA 5AQZA 1PJRA 4FWQA 2G8WA 4JRKA 2HYFA 3VB2A 1SSFA 3SBGA 5AQOA 1KK7A 1ZR2A 1Y71A 2UUZA 2V26A 3CFPA 4FM1A 4FJNA 4G9ZA 4CGZA 1DEJA 1XNQK 2K3XA 3W6KB 2XUBA 1JLGA 1U04A 1TUCA 4PJNA 1GLCG 1SANA 4OMYA 4LF4K 2CJJA 1DJ7B 2BGCA 4PWDA 2ZPGB 1M2OA 4EIAA 2IAIA 4YOVA 1IG8A 2HHWA 4A3CJ 3G71A 5IY5H 1G3YA 3S17J 5LJVA 1WSEA 4Y15A 5KE3A 3WEEA 4L5JA 1RLPC 4P1WA 2WFBA 1QPMA 4A4KA 1XI1A 4M6YA 4LDWA 1WYXA 5L23A 2E1NA 1EA3A 2ZE2A 5GAEP 3E9PA 4KHQA 1JHHA 3OYEA 3SWNA 3CDHA 5LJ3g 3QP6A 4NXMK 3D5SC 4UVAA 1QTMA 2OTJN 1U0JA 3V9WA 4LB5A 1H0MA 4DR2K 1VQ4A 1VQ8T 3ZP5A 1VQLA 1QQCA 1BU6O 2AHJB 2PYLA 1VQ7N 2X0LA 1YX5A 4FL9A 4YPRA 3FZKA 2CW8A 3DV8A 5FKMA 1BO5O 4H4OA 2F4IA 1RTDA 4F04B 4MFEA 3HOZJ 4XTUA 3EDPA 2A08A 2MD5A 1Z67A 3CC4Q 1TUYA 2FMLA 3M55A 5GADJ 4DOWA 2KHOA 2K9QA 4HV6A 3NTHA 1TH7A 2DZ9A 1BOTO 2DA3A 4CJPA 1QZEA 5CQEA 5AJ3K 1BUPA 2KEAA 2P6TA 3CCQQ 1JI8A 2JPCA 2O8XA 4AC0A 1YJ9Q 4M7XA 3BGRA 5HNFA 4FOEA 4E7HA 5GTHC 2QXFA 1QBJA 2NRHA 4ZGJB 1J54A 5D5VB 3M0SA 3VWBA 4DZPA 1NJIO 1RTIA 2M9HA 3NVKA 2RH2A 2GUIA 3L4QA 4CEDA 1WEFA 2KJCA 1IUYA 1BIBA 4M75E 2GUPA 3N4PA 4C5GA 1W1WE 1BL0A 3RERA 3QYGB 4PGHA 5ICFA 4KTZA 3FKIJ 1HOMA 1UJ0A 5FLXE 3EUHC 2YUSA 1VQ9N 1KAYA 3BG7A 1VQ5N 3HM9A 1K73R 2ZCFB 1FPQA 2Z1JA 3V9SA 2ROTA 2LMDA 1JT0A 1GCQA 2IW5A 3RZOJ 1S9GA 3O8VA 2XAFA 5AYFA 1QHHD 5CYVA 3BZKA 3O2PE 4F9OA 3UWNA 5CVVA 1OKRA 3I54A 3G1OA 2BW3A 4XLAA 3FSPA 4FWPA 2F8TA 2TDXA 1RTJA 3S14J 1B7TA 2MW8A 3ULDA 3QEWA 2ED0A 1JL1A 4NL2A 4AM7A 3RBBB 3AFHA 2FX0A 5CYQA 1UHCA 4R55A 1T8IA 1TS9A 4N0BA 3ZN0A 4XRMA 4B9WA 4OPHA 5ILUA 1SKWA 1R5ID 1BR2A 2DA1A 1VQ6I 4A59A 2QBYB 4CHNA 1MJBA 3CUQA 5JS1A 4CCOA 1WJAA 1H9GA 1JLCA 3ZOBA 2ZGZA 5B3SH 3M07A 1NLVA 2OBPA 4Z88A 5AQWA 3EFSA 2E7XA 3ELKA 4IOCL 1C0GA 3J7YJ 3D7SB 2E6ZA 3I5UA 1BI1A 4OMMA 1ON1A 1X1CA 2DI3A 4OMZA 2YHBA 2E88A 5HLGA 2I0NA 2Q97A 4JRIA 4C92F 4B3MK 2A6EF 4HQMA 2EKHA 1IRGA 4Z94A 4DFKA 2QAZA 5FLXO 3IFRA 3IAS2 4OB0B 1SFOJ 2GNCA 5IXBA 2CMPA 1IHWA 5CHIA 3PQKA 2LJ0A 3I5SA 4LD5A 3OVNA 2X3XD 1I07A 2L7KA 2CGLA 3G6EQ 2JTVA 2ZWHA 3QWYA 5MLCQ 1HNZK 1FW6A 4C8LA 3SAHA 3JRCA 4CZZA 3CCSN 4I2OA 2VASA 3BQZA 3O3FA 2BVLA 3CCQI 3OYHA 2IT0A 5BRDA 1HQCA 5I3UA 3QMLA 3CUQC 4F7UF 4OIQF 2QSFX 3GPLA 3CXCM 3CC7A 2GIVA 2XASA 4BRDA 4RTZA 5CY4A 1WLPB 3CLOA 3I0TA 5GAOn 3EL2A 4YFUA 3CCJA 4HVWA 3I3LA 4GLMA 5M1NA 1LPQA 2HZYA 4UQGA 2HHVA 3TTDA 2I10A 1BBYA 4FJLA 2ZBKA 3ERMA 3DLLA 3OYCA 1IG9A 3B6PA 4S0HB 1LW2A 2OTJA 2XK0A 5LJ5h 4NQWB 1N36K 4DF4A 3TARA 1HR0K 1YOVB 3WHBA 3QESA 3BTCA 4M3ZA 3JR9A 1JLFA 2F4OB 1WH7A 3HBTA 5GINA 1PD1A 4E0DA 4B8CA 3AGKA 4B9MA 4ISFA 1WIEA 4MMLA 4BEHA 1A31A 5FGMA 4M78B 5FB2A 2XSJC 3K9KA 2YRDA 3E9LA 3HKSA 3QO3A 2ZZDA 4FSXA 4M3WA 3IH7A 3Q9SA 3VEPA 1KEAA 4H5RA 3DEEA 4X9DA 4JI3K 5E8IA 1T3SA 5LRRA 4LOCA 2DD4A 3SEMA 1YAGA 3TAFA 2E36A 2UU9K 1ZBXA 1S8NA 4M7DD 1EETA 2ZJQF 2BIVA 1OI1A 2KMTA 2VWJA 3V9XA 4C0GA 1VSFA 3JYTA 3J81Z 3B8AX 4CHYA 5H6RA 1XSXA 3FIFA 1Z7UA 4OMQA 1FMKA 5CPRB 3K58A 5EDNA 2ELKA 1IJWC 1QSLA 1M2VA 2E2QA 4DW6A 4I76A 2L9VA 4B6MA 5JI6A 3K1NA 3MAQA 3WXJA 1SAXA 3LOCA 3SUQA 3I35A 2O8EB 2ZPEB 4M7DE 3LFUA 4Z4FA 3CC7Q 1VQ7I 4X6AJ 2E5LK 1O13A 5K7FA 2FG0A 2VPLA 3MEUA 2AZVA 2V7FA 3CJCA 2FJ1A 3VESA 5ADXA 1MMNA 1XQOA 1VHXA 4L3QA 1ACMB 2F5EA 5KYWA 1BA1A 3AVJA 1JKPC 3CP2A 4AUXA 1PSFA 3LA2A 3CCMQ 2FHDA 1R4NB 5B1BH 5LL6Z 2OD5A 2FQ3A 3DLLF 2YKMA 5D3GA 2EYWA 2L89A 2IS1A 1TWHJ 5CR4A 5TKYA 2CYYA 3LPTA 3CQZJ 5TJJA 2R7RA 1FXXA 2WOMA 3S15J 2QA4Q 3J7ZI 3PT9A 2HHHK 1ASWA 2VI6A 4CEBA 2YXYA 1RDDA 3L2QA 4J00A 1UG1A 1R5HA 5LJ5j 2YJFA 4ILJA 3KD5E 4J7IA 4CYCA 2NOGA 5SZTA 4AI5A 4KRTA 1FMWA 1UCRA 4EHUA 1N5YA 4MDAA 2QEXA 1TWCJ 3VV0A 1NJIC 1T95A 2IA2A 3SAFA 2R93J 3WNEA 1RI9A 1O7LA 4AIDA 4CZGA 2J4RA 3C6AA 4DJAA 4PL8A 2YX7A 2YWWA 3K5MA 3SV4A 2QQAA 3HTUA 3SWNC 2WV1A 3VJPA 2F69A 4LUEA 2E12A 4CJTA 4J8OA 3M1FA 3QPTA 1OMIA 2QA4I 4FT2A 1P7MA 5EZGA 2UV1A 3LA7A 3JRAA 3VERA 2UXDK 3CMAQ 5IT9E 2JZYA 2OJ2A 5BRHA 3A2FA 4YHHK 2LTPA 1RETA 4N4NB 5GANj 3FHFA 3KHYA 2Z1HA 2FL7A 1OKJA 4I6MA 3JCMP 4U67L 3JV3A 2DL7A 3ZQ7A 5BN9A 4EQQA 2AQFA 3EY1A 1IC8A 2XD0A 4HX7A 3CCMI 1MDMB 4BHCA 3RZDJ 3U1DA 4BC3A 4JUVA 3J80O 3V7SA 5IOYA 3CPWA 3CCMT 3E5QA 3X20B 2EWNA 3ALYA 3TQ7P 3MEGA 3EEQA 3T8TA 2W4SA 1GXIE 3EGUA 5ADXH 1RAHB 1WJRA 2QI2A 4LSLA 1J75A 5GAGP 2BW3B 4M45A 1GOCA 3UA6A 1E7OA 1JQQA 1DP7P 3EN9A 4EVIA 4C3IJ 3CC7I 3H6EA 3ATUA 1S6PA 3LP3A 1SKRA 2BY3A 3GFJA 2O0YA 2JPSA 3VGLA 2G7HA 3K4BA 2NOIA 3MMYB 1MWMA 3CJNA 4U0YA 4DR5K 3LMMA 2JUGA 1H9TA 1VQKI 3Q0WA 4CZHA 3IAM2 3EYZA 1TWBA 3ULEB 2Y31A 3QYEA 3B02A 1UECA 4E1MA 1AWCA 1NLPC 3K4MA 2EBPA 4H4KC 2A1RA 2COMA 4MQVA 3J80K 5FPDA 3E5UA 4QS8A 4KHSA 3FDYA 3OGDA 2A1SA 4FTHA 3R4KA 4DQ2A 4KAZA 2LCSA 1XMXA 3URGA 3CXCS 3NF9A 4XOPA 2M51A 3CERA 3AO5A 2YUQA 1ZSZB 3HUGB 2FEIA 5GJWB 1CXUA 3THWB 5ICGA 2BTFA 2QYOA 4HCBA 5CVUA 3A5MC 4KHPK 2DFFA 3J7AY 1T6CA 1N8RC 1JHFA 2DMNA 4PKGA 4EAHD 1SMYF 5H1SQ 2HQ5A 2R5YA 2E1HA 4EM2A 2K40A 2RREA 4IO9L 2QM3A 1WEIA 1T0HA 1VQMA 2TCTA 1PCXA 2QKLB 3V81A 2PFBA 3J80E 4N9IA 4N0AC 1YI2A 2FBKA 2X35A 3S16J 4EMKC 3NDKA 2EJFA 1SQKA 1NM1A 4A3JJ 2GZWA 1U3OA 4FYDA 2STWA 1O3SA 1D0XA 4XRFA 4JLHA 5CLSA 4WK8F 5JS2A 2JRTA 1VQ7T 2OAWA 2A5YB 2XHCA 2PMUA 2NUPA 4CSWA 1HUXA 1P90A 1I6XA 3PO4A 3CCQT 5J2PA 3KEOA 2O4XB 4JKAA 2JA5J 2QA4A 3OR2C 2EYXA 2HHSA 5F0XA 3C12A 2JA8J 2X4XA 1Z6TA 2RK2A 3ENOA 5FROA 1BQMA 1T44A 3C0BA 1U45A 4EFHA 3NBPA 5CKEA 3JB9J 2LZ6B 1ZBUA 2K3YA 1GXPA 2GQIA 1K8AO 4FZXC 4DTMA 4CGIA 1KLMA 2QQ9A 2IC3A 4LC9B 4DA4A 4QSHA 3VTIA 2CV1A 1X9MA 4BDYA 2LQWA 3FFIA 4FETA 5JMVA 2Y1JA 2ID3A 4A3BJ 4M77G 4A0ZA 2FF6A 1LDJA 3IG1A 3PM1A 4HTUA 1ZBLA 1HW1A 2J05A 5IP7J 3GTLJ 1STZA 1X1DA 2KDOA 3VQQA 3OIPA 1MBHA 4EZ9A 1RUNA 1Y8QB 1IZ1A 2L3SA 1O9SA 4CECA 4MZTA 2A07F 1I94K 5J4YA 1H88C 1OQKA 3E6BA 4F7UA 3ZEUA 2XVCA 4U0VA 1WNSA 5FWCA 2VWKA 4B23A 1UHWA 3A4CA 4YFNF 4A63B 4BVOA 1QHTA 3A0BC 1U8BA 2Z33A 4NZGA 1GLFO 1YIJA 5AZIA 1KVCA 1CKBA 1G4DA 4OMFB 4M9ZA 1I81A 4K11A 2DO7A 1KYZA 3C65A 4JI0K 8ATCB 2LQ8A 2CSQA 4JZ3A 1JXEA 1QZ5A 3MXJA 4NUBA 4YFKF 1KVAA 1W36D 4L0YB 5I2SA 4J5YA 1NGGA 1ENHA 4CJSA 5HP1A 4DCHA 3MQ0A 4IWVA 4FT4A 1ZRDA 2KLOA 1U5SA 2GEMA 2QWPA 1CZ9A 2ZPBB 1LWYA 3VYRB 1KSPA 2HMIA 2OTJI 2FBHA 3BR3A 1QVFP 3T1BA 4C92C 2EHGA 3G71N 1EWQA 4C8MA 4PHTX 5M5WJ 3P7NA 3WTTC 1H641 3SUOA 1UFFA 1M4ZA 1FP1D 2DODA 4CA0A 3G71T 3JCMQ 3ZQHA 5GAN5 2EBIA 1X9WA 4V19K 4CJWA 4DK9A 3MVPA 3A0HC 2L3DA 4VUBA 5KQDA 1KJWA 5M3MJ 2XPWA 3BDLA 3TCJA 1NGJA 5BRFA 4DV5K 3QZ9B 2I5JA 2GXAA 3QSUA 3AAFA 5DM7F 3FX3A 3V8LA 3AY9A 1EO1A 2D1KA 4BRGA 2YJEA 4CIFA 4QPQA 1GL5A 2P5GA 3AA4A 3G73A 3P4IA 3O1WA 4B3XA 3T8RA 1VQOI 2CP3A 4CJVA 4H0VB 2KVQG 5KYWB 1YITQ 1XN7A 4OINF 2ZC2A 2JMWA 3QU3A 5DD4A 4C8NA 3V4IA 4MIMA 1ZELA 3DTEA 4KIFA 2YNIA 5DUIA 4AU7A 3CCSQ 3X24B 5JR3A 4CDGA 1S3JA 5E41A 1MW7A 3DLLL 5E1XA 3ZSYA 2KR3A 1W4MA 1NK4A 4BHBA 4YORA 5FU7B 2FPDA 3QEXA 1CKAA 4YOUA 3VEVA 3MZHA 4ATOA 4FJ9A 3AVIA 2DD5A 2PUOB 3W3CA 1LWWA 1QQNA 2DDAA 4S04A 5EG0A 2UXNA 3DBHB 1TL1A 1WCMJ 4Q5SF 2F5DA 1SG5A 4M7AA 2NLUA 3SAGA 1GRIA 4WCIA 1I8FA 4J2DA 3UA7A 4FLVA 1L3SA 2AT1B 2Q1ZB 4E89A 2DK3A 3HRTA 3KTUA 1M27C 1N8RO 4JKFA 4PK4A 2Z5UA 3EE9A 5L3DA 2KZVA 5FKLA 4NXNK 2JM9A 4BKXA 4HV5A 1BC7C 2O9VA 1P9QC 1RABB 4RW6A 3CCEA 2HB5A 1XS9A 3K59A 2EV0A 2Z1DA 2VN2A 2P4RA 3M1EA 3QEPA 2C06A 3GTPJ 2VCPA 4CCNA 1Q7YR 3RR7A 1ZSZC 2VGMA 3JB9I 2EW3A 2H8WA 2H3EB 3UNGC 3LFKA 2W41A 2O9LA 1DTQA 4KT6A 1ZLMA 3MXIA 3ABLH 1I1SA 3MECA 1GLDG 1KU9A 1Y6IA 1J59A 3I5RA 4HYEA 2YT6A 4ITVA 1YJNT 3G25A 2RAEA 5KGXA 4O5FA 3H0IA 4CHUA 3QEVA 4IUPA 2KP6A 1POGA 5AQMA 1RR8C 3C1DA 1LAVA 4PKIA 1UDLA 1OCZH 2HTSA 1YWPA 4BGDA 3KFWX 1S22A 2P9LB 2E34A 2LX7A 3CBMA 4HCCA 4H5NA 2FUG2 3OH9A 2B5JA 1VQ8I 3CJQB 2LY2A 5GAMg 4J2BA 3TDUC 5D4SA 4E7SA 2K3BA 2O3FA 2XDVA 3IQLA 4IUUA 2DQRA 3K70C 1Q81R 4L9VA 5D5UB 1LVAA 4CYCB 2PUKB 4A53A 5GAEJ 1WSUA 5KTQA 2UUCK 1SD4A 4FIBA 3CF5F 3J7AP 1JKRC 1FLIA 3DKMA 5D6XA 3AARA 2HHXA 1KQ8A 1NE8A 5HLTA 4DTJA 2UXCK 2JA6J 1MJAA 1T0FC 1VQNQ 1IKVA 4MLEA 1OV3A 5LMNK 4XMYA 3MN5A 4I9LA 3A5NC 1YW9A 4XQ3A 2IJLA 5KNLA 2VQEK 4RG8A 2W24A 3KNTA 2K6DA 1GCQC 1LJ9A 2HVSA 4O6JA 2QK9A 2FVUA 4AG1C 1BYMA 1RT3A 2HXIA 2DL4A 1GFDA 1YFHA 3OSVA 1JTYA 1A5VA 3PQJA 4D1QA 2YHXA 1LVKA 1YFNA 1HKTA 2CUZA 2DAOA 5AQKA 4JKGA 3MCZA 4E9GA 5HDGA 5KYUA 5A2QE 3CLQA 4CEOA 1LV5A 1R8OB 3L2UA 1K0SA 3QLHA 4JX4A 3UE5A 3AVHA 3VMFB 1X4PA 1TWGJ 4DNCA 2KHMA 4KH1B 2HBMA 3CCVN 3LW5E 4M72A 2OTJT 4IO8A 2F9TA 1VQNN 4CF2A 1LFPA 4KJZA 2VOPA 4FISA 3QIOA 1DGWY 4B1RA 1W36C 3C94A 1EXQA 3S3NA 5EZHA 1X01A 2O01E 2RQVA 2R7DA 2K7LA 1G15A 4FLZA 3JRHA 4EJTA 2YR2A 3RIRA 2D5RA 3R3LA 1D8KA 1WHGA 1GLBG 4DTNA 1S7EA 5HK3A 5LJ3j 2E4HA 1IN6A 1GOAA 3NF6A 3CVTA 5KYNA 4J83A 3I4MJ 2CWEA 3H0GJ 2QXLA 1FBUA 3ZMDA 4JOMA 2VKNA 4BREA 3I53A 2M87A 1NGFA 4X0GA 1PUEE 3A8HB 3K70D 4FJHA 3U3GA 2P9NA 4IFVA 4WF2A 4CC7A 4KH6A 1FIPA 2DTRA 3TP3A 2O6GE 4LF8K 1KG1A 3OIQA 2QENA 1QVGS 4HZFA 2XAUA 3X26B 2WADA 3OMYA 4AVZA 2Z1GA 1W4SA 4P96A 3RQIA 5CK9A 4XRSA 4ZGEB 2XHBA 2KI7A 1FYLA 2OTLN 2F2EA 1XC5A 2STTA 2QCOA 4A3DJ 2EYZA 4YOTA 3AKZA 1TXQA 3DLMA 2QM1A 3BJOA 1BB9A 2HKQB 2PVDB 1Q86O 1QVFS 2Q0OA 4E3SA 3MX2A 4OF1A 4BR2A 4CD1A 4IBNA 2HBPA 3QJYA 4E6KG 2QKMB 2O8BA 2ZXHA 1P92A 4Y1CA 1OZ2A 1OCRH 4XK4A 3J7YP 2XAQA 4BRFA 4DV1K 1I5ZA 2R3SA 2EJ9A 1PSEA 2CUDA 1S6LA 4PNOA 4C3HJ 5D5WB 4Q5VA 3F72A 2VQFK 3QOPA 4DIQA 3G71Q 2CP6A 1BG3A 2VLAA 1EX4A 3M9QA 4DFJA 3JCMJ 1R6RA 2FXAA 4LD6A 3VYGA 1PUFB 2LC4A 4BXUA 4QOZB 1MNMC 1NGHA 1RAGB 3RKYA 1V55H 1ZBIA 3QUIA 1CGPA 2YDLA 1NG7A 4TV7A 4HX4A 1XGNA 3HKZA 2OTJQ 2NRWA 1VI0A 4ILGB 4YNQA 2LNBA 1K8AC 4BR9A 4A4GA 1WJSA 2PU9B 3LYIA 1HSTA 5GMKi 3B6OA 3ZYYX 4IVNA 1C1CA 1Y07A 4IRHA 1ETXA 3EE8A 3DLBA 3F8NA 2KDZA 4IG3A 2SEMA 5FPEA 3DEWA 5M5YJ 2Z99A 5FU7C 2LK2A 3TSZA 3AL0B 3EGXB 4CF0A 3M8SA 3VS6A 1FT9A 3CMEI 1F21A 3BR0A 4C92A 4C9YA 1TVRA 1Q82U 3QRFF 3VF2A 3ASMA 3R6SA 1ETKA 3TAMA 2L01A 3QFUA 3DB4A 2KZMA 4IHXA 3MK6A 2L0AA 3U9DA 3FFKB 2XRNA 3OBYA 1N6AA 3H0DA 4EGYA 1VQPA 1EKEA 5E79C 3PIPF 2OZ6A 4Z4HA 2E2NA 3NAEA 5HVQC 3M3ZA 3FXQA 3DLEA 3DXKB 1KIKA 1Q86C 3A0IX 3K9JA 4PA1A 4CW7B 1BL3A 4RCHA 4DV4K 2GWJA 5ECAA 3NTIA 2Q2EB 4R8HA 5LY3A 1WHMA 2RKIA 1WOQA 5I2MA 4OPKA 1JKQC 3FJPA 4B9VA 1SRLA 3MZYA 3VSLA 2EYYA 3DLHA 4UUVA 1UEBA 2ELJA 1D5YA 1ZUUA 3UIQA 2HQAA 1NM7A 3EQLF 3BDDA 3FDRA 3MEWA 4B09A 1ERDA 2QEXN 5E84A 2Y4XA 1VIFA 4Y17A 3CM5A 2GWKA 2HQRA 2DLLA 3M8JA 3LSIA 3CC2A 1IBMK 1RL2A 1VRLA 4F16A 1XMQK 2EKOA 3S41A 4CCHA 3WVEB 1AKHA 2O8DA 4B43A 5J8CA 1HYZA 2ZGWA 2PMZN 3FB9A 4ORZA 5AZJB 3OOPA 3SBTA 4CGFA 1MSEC 5LJ3f 3ZX2A 1PP8F 4E2FB 2MC3A 1YP5A 1VQOT 5CKFA 2ITMA 1MUYA 3H3ZA 4CJEA 1MV0B 4BQOA 2W40A 2RPIA 4FJ5A 2ED1A 2ABLA 2CW0F 4GW6A 1ASVA 4B22A 4OWRB 3NWSA 3CCVQ 3BFMA 3CC4N 4BRCA 1T39A 1T0FA 2EJRA 1KG7A 3OA6A 3FE1A 3CJ9A 3AA2A 4DV0K 2J5PA 5J26A 3TL4X 5FFXA 4WTOB 2IGNA 1VQ6T 3M58A 3THXB 4J2AA 2X51A 4XONA 3U3YA 1WB9A 3LP2A 2P9KB 1RBSA 4DYRA 3CPFA 3NF8A 4FL6A 3EUHA 3TGNA 3BE3A 3LP1A 1K78A 4BY6C 3TEDA 4UY8O 1SPKA 5AQSA 2KRMA 4KA4A 4F3OA 3RSEA 4CERA 2ME6A 4CJ4A 1HW2A 5LJ3h 2BHZA 3WTSC 5HLHA 1B34A 3SWNB 1Y0NA 3L42A 2MG4A 3RDVA 4CGJA 1X43A 4KYWA 4KH5A 1ZA1B 2E64A 1VQLT 2IOCA 1DP3A 4RM2A 1OJLA 4HPQA 3EKUA 1HU0A 2PZSA 4GGGA 4V2GA 4CK2A 1VQ7A 1ZYRF 1KZHA 2PY5A 3CC7T 2VQHA 3WQTA 4G6DA 3OW2S 2A41A 3VQ8A 1K73U 2YG9A 3JCMX 1OLTA 2BV6A 2I8DA 1SRMA 1ZGJA 1BIAA 2X48A 2FZGB 4MNUA 1IB8A 1YIJI 3CD6A 4I01A 3W2VA 1AKHB 4JJBA 3KP4A 2CSOA 1TKTA 3E97A 3LDSA 2GCXA 3CC2N 3LCNA 4WQ4A 3I8DA 3G0ZA 5F0HA 4HXJA 1OYXA 5KYYB 2V79A 2FOWA 2K9SA 2JG6A 5AR0A 4LF6K 2ATCB 4HNUA 4G6TB 3RWUA 3GO5A 3C7NA 5GP9A 1K9MO 1FOKA 4RGUA 2D9TA 5J1RA 4FQGA 5IP6A 3AVLA 4E1JA 2YU9J 2M45A 4MO4A 1G5VA 1T98A 2CH5A 2LT1A 3LZIA 2OA8A 3HSRA 1IH7A 1DIZA 4KUIA 4JJCA 4IKFA 2OFIA 1V5GA 2RN2A 4D9JA 2FE3A 2O8KA 1YQKA 2MH9A 1A6IA 2H8HA 2MIOA 5H6QA 4U88A 4CD3A 3KLNA 1UAXA 1CQTA 4GKJK 3GFLA 1Z7LA 1KC8C 3CD6Q 2OTLI 1P4AA 1YJ9A 2JA2A 3SQ4A 3PIOF 4E19A 2P0PA 4J2EA 3BJAA 4A3EJ 3CCRN 5E8GA 3D45A 2HBLA 3M0TA 3KKRA 1IV6A 4KH0B 1AA7A 4GVEA 2LP0A 4AD9A 4RW9A 3M9AA 3H0HA 5F2RA 2W6LA 1QVUA 1M1EB 2A68F 3GDQA 2V6CA 3LM9A 2V7ZA 3RKQA 3VKIA 4XLCA 5LGNA 4FX4A 2HF3A 4OFEA 2H3GX 4BI4A 3E3VA 5J1YA 3SMSA 1TP4A 3GBTA 1HDDC 2ZPIB 3J7AO 1XPXA 1T6DA 3W3DA 1X3UA 1ONVA 2CGKA 2M1BA 4J7FA 4DQSA 1KFDA 3V42A 3WODF 1R1UA 4B44A 2MPXC 3IWFA 3R9PA 3OS1A 3BR5A 1YIOA 1IAWA 3V9ZA 4IUQA 1KXPA 1MH3A 1XQSC 4IHWA 3FR0A 3FZLA 4EMHA 2L7FP 2KNBB 1T0JA 1RAEB 1M1KC 3H46O 2F4VK 1K7AA 3VFZA 4YOXA 1LCKA 3DTIA 1WEGA 3M6GA 1IXRC 1Q7YO 2QSHX 3WG9A 1JJ2S 2JPBA 4XNFA 3HOXJ 2NWMA 3TQNA 1M90C 2L9SA 3I4NJ 3UKRA 4BUGA 1S1NA 4D6WA 4B9UA 1FYNA 2BE9B 3REBB 1JUSA 2O4XA 4IQJA 4AF1A 3O9SA 4EJWA 4IG0A 3GBQA 4J9GA 4ZTJA 4NOYA 2HSTA 2P5LC 1LQ1A 2P8TA 1HPMA 1Z26A 1TW3A 2P5VA 2EQUA 3CMEN 2K27A 3E5XA 2LY1A 3PO5A 5IHIA 1D0ZA 2F5KA 2YNHA 2DF6A 4DZJA 3I9QA 1Y39A 2R4GA 2X6YA 3QHSA 1N25A 3TBIA 1YW7A 3GW2A 3TAEA 2E1CA 2OJED 3C4SA 1RT7A 1VSLA 1KQ0A 4IF4A 5FJ8J 4B9QA 3RTRA 4WQ5A 3GF2A 5J2MA 3G4ST 2KIQA 3QQAA 1VOMA 4EM0B 1Q95G 4HTLA 3SFIA 3QYHB 2CT4A 2MBFA 2B0LA 1S72Q 1ETYA 5IPAA 2OV7A 1S1VA 3D7EO 4PJOG 2YNGA 3EG9A 1U5TC 1PNJA 1RUOA 3RCOA 5KYYA 3F2KA 1V29B 5LEKA 4A5BA 4OFHA 3DXMA 2DA6A 4RKUE 4M41A 3TPQA 1Q9XA 1AOJA 1U4BA 2OUMA 5ELZA 1NK0A 1U1TA 2LRDA 5KQ8A 2B86A 4C3JJ 3CCUQ 3N4QA 4W97A 2KZZA 2D2WA 4RTWA 4ELVA 3D4VA 1QLYA 1RI0A 3AG3H 3FZMA 2HD0A 2HMAA 4DR6K 4FJ7A 2FQ4A 1FTTA 3PUBA 5F08A 1M30A 2RHZA 2VBWA 1T33A 2QEXT 2K7AA 4XLEA 3OHRA 4CYDA 1WXTA 2IBDA 3CCJT 4CEEA 2DERA 1W2BS 2LBFA 2HDAA 2ZMEC 4JX6A 4BR7A 2VVKA 3H36A 1PKSA 3SZPA 3QZ5B 4FJIA 1ZA2B 2JTFA 1E3MA 4L5EA 2IGOA 2ISYA 3ABTA 3BWGA 2D0PA 4O3MA 2QA4N 1R5GA 3RPUD 2CYZB 3JCMc 3SEZA 1NGAA 1MWKA 3LSPA 4AIAA 1GXQA 9ATCB 2PBDA 3O5ZA 3JTHA 3OW2A 2JS2A 3NFCA 1B9NA 1EH8A 4DUZK 1EH6A 3JSPA 1WAFA 1Q81O 3M7GA 3QAHA 3M57A 3O3KA 2ZO4A 2EK5A 3EYYA 2J06A 1HDPA 2HAXA 3C95A 3K0LA 1V5FA 1TTHB 1AEYA 1YRNB 1MKMA 3ISPA 4I2QA 5EJCA 4A5NA 3HB9A 3H6ZA 3BY5A 1M1GA 3F21A 3PVQA 2LMJA 4DTPA 2CH4W 4O8UA 4DHYA 1R7JA 2Y90A 3DCFA 4FW1A 4FT8A 1I39A 2ITGA 4V2FA 1RILA 2K86A 1YQAA 2I5WA 4A69C 5KK1A 4EA5A 1YHQI 3HRMA 4DOZA 3BZCA 1RADB 3TAQA 5DUKA 4BY6B 2RK1A 3G1MA 4B3OA 2RHXA 4D7NA 1BIZA 4N4GA 2DBBA 4FJMA 2FZKB 2WAFA 1K79A 5BPLA 3P5JA 3NE6A 4CF8A 3FIWA 1B72A 2K3PA 4B9XA 3DRSA 5GAHP 3ME9A 2XSDC 2GTJA 4A5AA 5HODA 3NQOA 4Q48A 1IGQA 1TQIA 5DEQA 4XEIA 2O31A 3CDLA 3CCJQ 2QDYB 5GAOl 2BY0A 1YI2T 1LCUA 4C0FA 5AQQA 3JB9H 4R1HA 3OYNA 4PLLA 3HOSA 2KIMA 3QPSA 4DYQA 1LFBA 2VBXA 3ZXSA 2LSOA 4R5PA 1ETWA 4DR7K 4JS4A 3CCUT 4M7DG 1NHAA 2DJZA 3I33A 3HTVA 4M75B 1PU7A 3SMPA 2H1KA 5EF6A 1U9OA 1TYQB 4LFAK 3TSQA 3AVKA 3BOQA 1UWBA 2LNHB 4FWNA 4M7YA 3CC2T 1TNSA 2XMFA 2A7YA 1BA0A 5HLIA 2O61A 1UGSB 2HDDA 3O3HA 3K2AA 1TYQA 1X75C 4K8XA 5E3LA 1VSIA 2F1LA 3GYHX 2HF4A 2V9VA 2DPDA 4M78G 3GNFB 4DSEA 3JCMf 3QYFA 2X4JA 2EGAA 4U7BA 5L3EA 2Z1IA 3IKVA 1BIUA 2DXUA 1JCFA 1MBKA 2KE9A 3A01A 3ENBA 1W2BP 3PFSA 4DTOA 1NEBA 1PP7U 2O8EA 3HP9A 2CO5A 2EPDA 2VOOA 2AKKA 5AQUA 2LC2A 1Y96B 2LCCA 2P84A 2DXIA 3H5AA 4EMKB 2XB5A 3KFVA 2DXBA 3IUOA 5CQXA 1YJ9I 1OFCX 5IYBJ 3I55N 2QVOA 3WNHA 2E2OA 4MO5A 2JUFA 2K5IA 3F6VA 3AAPA 1VQPQ 1QKWA 2GX9A 4XBFA 5AQYA 2WB1N 4XIUA 3HJFA 4BGAA 2ECZA 1NNEA 3I55T 2A6HF 1K4TA 3CC4I 1IHVA 2KAFA 3QNOA 3MN6A 2IS4A 4LN2A 4IDHA 3CTAA 5CVJA 1BHLA 2FRWA 4EA4A 3R6NA 2P5OA 2Z9OA 4O55A 4IDKA 1XCBA 3K57A 4A3KJ 2A05A 3TDZC 2Z0WA 2XGDA 2QEXQ 3ZT2A 2J6OA 4E7IA 4L6V5 3F0CA 2RJDA 1ZRCA 4XU2A 1HW5A 2NVXJ 4M78A 5JICA 2OA4A 4CZCA 2FEZA 4HCKA 3NAUA 1KONA 2MC4A 3RR6A 1FOYA 2JMCA 3DP7A 4C8OA 3HPHA 3ABKH 1F1ZA 2EIMH 1Z25A 4DU3A 1A04A 2FRYA 3ULRB 4E47A 1L3UA 3HVRA 1NBWA 1S1XA 2YNFA 3SCXA 2PBIA 4LD9K 3ASKA 2VXEA 4RGXA 3KEQA 1Q82C 3QWLA 3LM2A 2YI1A 1SSHA 4PSXA 3RSNA 4OB1B 3NPFA 5C15A 3SQ1A 3VS2A 4M3UA 4M75C 2RC4A 2A5XA 1XQPA 2NZTA 1B9MA 5CKTA 3VQAA 1R23A 3GLXA 3OW2P 3TAPA 2VKVA 1ORKA 5C4XJ 2JRMA 1LWVA 3DB3A 4M9SA 5KPZA 2AK5A 3VS1A 4BQAA 5TRDA 2HOEA 3A02A 2G7UA 5GAN4 3I0SA 3G6ET 2CP0A 2OPSA 2PYJA 1NMNA 1OCPA 4DWIA 4Y33A 3O4WA 3P9KA 4NB4A 1LAWA 2KRSA 1ZBFA 1JJ2A 4RB2C 4B9TA 1CLQA 1DPRA 3HSEA 4ESFA 2LDUA 4BR5A 3VRYA 4CZKA 3K4KA 3VSKA 3R2XC 2RI2A 1XG1A 1QPIA 3LZJA 2AP1A 2D1VA 4M75A 1W2BA 2CUEA 1KC8O 1F43A 4OOIA 2BUDA 2F2WA 3BDUA 3DXJF 2LCLA 3FGUA 1H8AC 2CG4A 5J4VA 1NU0A 2E5KA 1O4XA 2LD5A 3LANA 4CF9A 3R6MA 3QP5A 1RUWA 3CJ1A 2KMUA 3L4IA 1FIAA 1XC3A 2P9PB 2GWRA 1MZBA 1C0MA 1XNRK 4R0KA 4A2BA 1R9TJ 3H9JA 2LP5A 3TO9A 3ATVA 5K7ZA 3KLHA 2DZCA 3EFOA 3F8MA 1S1UA 1QZZA 2LH9A 5BPMA 3CXCP 3ZQGA 2CRGA 1SF9A 3AAQA 3EGXA 3JB9G 2DJQA 4X1EA 1QVFM 1WZOA 1OU8A 1M1KR 2JVHA 2Y9YA 1X2QA 2HSPA 2NS0A 1K0XA 3SQNA 2K4YA 1O3TA 2OFKA 2BZTA 3FLCO 2R7WA 5C44J 5E1WA 2C0IA 3OWTA 1DDNA 5A0GA 4XRSG 3MX5A 1G99A 2E20A 3I8BA 2M8EA 4ZC3A 1BCOA 1K73O 3I0RA 4QQ6A 1BI0A 3LQQA 2BOLA 3HPGA 3RRGA 2FLOA 2K9GA 3S3MA 3T9NA 4W5RA 1VQNA 1SVMA 2E71A 2KY9A 1M1KU 3JSOA 3FRNA 1YRNA 1WGSA 4F14A 4HOBA 5J39A 4C2UA 1S7AA 2X1EA 4M77E 2WY8Q 1BISA 3WVDB 1N78A 2L3RA 5BPIA 1N3AA 4E9HA 4M77A 1V4SA 4RCCA 2HEQA 1WPKA 3PMIA 3P9IA 3RYPA 1VQPT 2VODA 4IUVA 2FXUA 2EFNA 4IJNA 5C6SA 2LQNA 3VYUB 3BTIA 4H0EA 1DPUA 3THYB 1NK3P 2DO3A 1WUAA 1XGSA 1Q8IA 2GAUA 1SL2A 2OPTA 2HTJA 4DQ8A 3LL7A 3EHRA 1RDUA 3L2VA 2X4HA 2DK8A 3ZBDA 2VWBA 3IUCA 3THWA 1YS7A 5AIPA 3VF6A 4JAXA 1BC8C 3KWGA 4AHCA 3TOAA 4QIWN 3SPYA 3TR8A 3MP8A 3K7AJ 1KQ1A 2BKDN 5GAHJ 4M78E 1M90R 1LNXA 2PMHA 2BE5F 3NH0A 4UY8I 2KQRA 3INZA 1AZGB 2KROA 1ZBJA 4D5FA 2G8VA 4WWCA 3E2UA 4DKWA 3F6OA 5IHKA 3LNQA 3PY8A 3V1QA 3CJTB 5JLHA 3UATA 1GBQA 2QUFA 1LKXA 1E4FT 3BUZB 1X2NA 3VEZA 4NDLA 3NWTA 1ILYA 4M7AG 1YITA 2HNYA 3VQ7A 3JCMg 1X2MA 1RBVA 4ME7A 1H89C 2NUTA 3LPUA 1OQYA 2ZAEA 4WCGA 3M3YJ 4KO0A 3I71A 1C0TA 1T6SA 2I5UA 3ZSXA 3KK3A 2NRRA 2GA2A 1JTXA 1RDAA 5HS9A 1U8RA 3QDRB 4XL9A 5LHIA 2EZIA 4OB2B 4Y4RA 2KKZA 3ZETA 4N9HA 5ILVA 4J9DA 2A28A 1K83J 3AG1H 2LVMA 3OYYA 3FXOA 1SD7A 4HHTA 5K5OA 1R00A 3ECHA 4CFCA 2HQXA 1M8VA 4PJOC 2DIQA 3AGRA 4C2MJ 4B48A 3IRXA 5D6WA 3M53A 3WG7H 2B4JA 2HCKA 2P51A 4DS5A 4HWIA 5KPTA 1PWTA 4MHGA 4FWKA 5FWBA 4NC6A 5KCMA 1G59A 1GUUA 3HOWJ 1TBXA 4LIVA 4DU1A 4DV6K 4UB8C 2XGEA 2KZGA 2QA4T 3KP3A 4M71A 3CC4A 3OYMA 2LSNA 3LDPA 4BG9A 5FKKA 1UGQB 2HNDA 4ENJA 4B3AA 3MEDA 3SQ0A 2A61A 4C1NK 1JUMA 1YBYA 3SFZA 5M1FA 4CVNE 1OPKA 1NGDA 3FXRA 4CHZA 2ZXWH 3D2EB 2HHTA 3FBIB 1HYVA 2WV0A 3OL3A 1LEAA 4X64K 3RNJA 2JQ7A 4EEFG 3HOVJ 1KQSS 3IS9A 3DQVC 4FO0A 4G9YA 4KI4A 4H5TA 4EW0A 3I0XA 1K9AA 1KCFA 1ZHIA 3QODA 1MU2A 2K9LA 1PVEA 4M78F 5FLVA 5A0DA 1YITT 3BPVA 2P0WA 2JGUA 4OPAA 3FJ5A 4Z2YA 2NUBA 2ICWG 2WONA 1KVBA 4BI8B 5C4JJ 1IO6A 3META 4FWMA 2WSFE 3A8GB 4FLWA 1X19A 4AWXB 3K9TA 3SYZA 5F04A 5GANh 1B8IB 1KAXA 4HNVA 1U06A 1XUPO 2O8FA 4H5WA 3GMEA 1T3VA 1M5Q1 5C3EJ 1BWFO 1NLOC 2P6SA 3F22A 4QQDA 4KV8A 3ZMUA 1GLLO 2P81A 1X6BA 4U87A 3QFPA 2F8SA 4BS9A 3VQDA 5HRRA 5CZ1A 4XH5A 2VT3A 2A3ZA 3CC2Q 3ZX3A 3C7NB 3F23A 1MA9B 4F7UB 2HOSA 4CHQA 4HG2A 4FHTA 2RI3A 3O9QA 1J9AA 5IYCJ 2ECCA 3CEYA 1KHCA 2X6WA 2B7EA 2PN6A 4BC4A 1YITN 3OYFA 5DM7R 1B07A 4AHSA 3CCLN 3HXLA 3ZEHA 4WE1A 2HHQA 2KDSA 3ZQCA 5LHHA 4ZZDA 2EGCA 1WQWA 3BG5A 1J5OA 3CCLT 5AQNA 3FXJA 3KVGA 1K8AU 1M2VB 2WAQN 1P2FA 3MAJA 2PZ1A 2XF6A 2CQQA 4JD2B 4DTXA 1ZLJA 2W57A 3AVCA 4CF1A 2QTXA 1FKPA 1IV0A 4Z0UA 3BG6A 3D6RA 2KYBA 2HL3A 3OS5A 4PIIA 3M0RA 1BJZA 2VE9A 4CHPA 4UC4A 1RAFB 4E9FA 2O7OA 3IH2A 4RGRA 2LVSA 2JK3A 4C8QA 3FZHA 1NKCA 3E1YA 1VQ9T 3HPOA 4ESBA 4EDUA 5KVRA 1QSSA 3ZMVA 4LDVA 1YIJN 3FXMA 4HSTA 1WSIA 4IRIA 1ACIA 4WF9L 4BD3A 4YDUA 3TKYA 1TL8A 1K8KA 2QW9A 2EQRA 3SYTA 1S29A 1VQ6N 2V1UA 2DKGA 1B34B 3OMCA 2IVWA 4G6QA 2SRCA 3NTKA 4Y13A 1R49A 1QS4A 6AT1B 5KGWA 1K9MR 2EZLA 4XN3A 4BAYA 4A3IJ 1D9FA 1VFCA 2A3LA 1K78B 3MN9A 4AFQC 2EV5A 2ESWA 2P9UB 2R5MA 1Q86U 4DR4K 2VG6A 4DSLA 3HHTB 3VW4A 2UXBK 3SB2A 4J9IA 1VRTA 3GLLA 2EWSA 2P4TA 4QS9A 2OC6A 3GZ5A 5DV5A 4Z02A 4C92G 4B3TK 3MEVA 1J5YA 5IH2A 3R0AA 4PKHA 3VS4A 4GFBA 1UGRB 3Q7BA 5GANg 1KSWA 4JKDA 2M0MA 2M7BA 3VENA 1HPZA 3C2BA 1PYVA 3Q9VA 2JWLA 4JKCA 1ABQA 2JJ7A 2HFHA 1RC9A 1H1VA 5J2QA 4LFUA 2JWTA 3L2CA 5K14A 2JHNA 3RYRA 2X6SA 3F8BA 4ZYAA 1KQ9A 2BGGA 2GA1A 3B73A 1M90O 5AZJA 1WXBA 2L4AA 5GIPA 3AO3A 4OMNA 3GP8A 1ETOA 1OVQA 3CCRT 2J6KA 1NJIR 4WQ5C 2RVCA 4LITA 1QQMA 5CKBA 3NH1A 2OZMA 2VONA 2CGJA 4MEXF 5L3CA 4XKBA 3C0CA 4B9NA 4IIOA 2HSEB 2YSRA 2GOXB 3L7WA 1VQMQ 3BEXA 1JLEA 1H3HA 2DW4A 2JZ2A 2R92J 1XSVA 3C6TA 4DFMA 1KG6A 1NK5A 4RMOA 1A35A 1W70A 2EGEA 4B1UB 5EY4A 4X65K 4IX7A 5LFAA 3L00A 2E2IJ 3GOXA 2DJIA 1GLAG 4A57A 2E19A 2V8KA 2YPRA 3X2QH 4JLGA 1W5TA 5LEJA 1RZ4A 1N3CA 2CS7A 4CE9A 1TG0A 5LRSA 3WGIA 4DBRA 4JKBA 2DCEA 4Y28E 1NK6A 5GIOA 5GJVB 1BK2A 4CK3A 2HW3A 3CDIA 3HHGA 2DFUA 4FPBA 5LBQA 4IOAL 2V8JA 5A2QO 1SAUA 3JCMd 3FHZA 2HL5C 1WI7A 2CV2A 3AVFA 1ZKGA 2Y69H 2J6FA 2OF7A 3HVTA 1FMVA 2MLKA 4LK0F 1SL0A 1A36A 1EP4A 3CMET 1R58A 2F48A 4PJOB 1VSMA 2QGFB 4I99C 2GTOA 2HOAA 4JJDA 3PUFA 2LTOA 4IHVA 2W10A 3ML6A 2VYPA 2ECBA 3WHCA 4M3RA 2JJ9A 4H0PA 1BR1A 3T7ZA 2CH0A 4M4ZA 2D0QB 5DCMB 1B9DA 3M4GA 4UUTA 2WBNA 3OSFA 2H8RA 2NOLA 4FE4A 3AG4H 2P9SA 2MABA 3E6DA 4FJJA 5FU6B 4RAFA 1VSJA 3HXMA 4UB6C 3K5NA 4WFAL 4B47A 1S3XA 3VEYA 3WXIA 3GZNB 3RTVA 2EFPA 4N4HA 4J6WA 1RT4A 3OTOK 2BVMA 2EIFA 2Q2RA 1RDCA 2BYVE 2QQRA 5AQXA 2CGPA 3P83D 4FJKA 2XI9A 2V1XA 3E66A 1TKZA 4EATA 2JTMA 3SJMA 2P9LA 2KFNA 4KTQA 1HC8A 3QEIA 2AZSA 3HFOA 2E35A 4E7LA 4HLYA 3HG9A 1YS6A 3G3ZA 2QTVA 4OKJA 1GVDA 1S72T 1VYVA 4BY1J 4A6EA 1XSDA 1D8JA 1YJ9N 3CCLQ 5AIQA 1KU7A 4IEIA 3COAC 1FBQA 3OS0A 1JXMA 4M75D 3HYIA 5AQRA 5FPMA 3BCBA 3PL8A 3UDCA 5DY9A 2GQVA 1V4RA 1VSHA 2D1XA 1QHGA 3LWMA 3H45C 1WBDA 2IS3A 4QCLA 3H0FA 2O4IA 1TSFA 3EZ5A 4ELYC 2NOEA 1FBSA 2ETHA 3CP8A 3DPTA 5GAN6 4RAZA 2NS7A 3OSGA 1P4WA 4IOXA 4DLGA 5FRNA 1MPGA 1Q82O 1PG5B 3CQ8A 4I9QA 3JS6A 3J81E 1BM9A 4GBQA 4LE9A 4M3YA 5TGTA 1JCEA 1RBTA 1SD5A 1AD5A 1XMAA 1GLEG 5GADP 4YRVA 3UF4A 1TQPA 3A8LB 4V2SA 3ZQQA 3TSWA 2XHKA 5HOOA 2KISA 5LJ3d 2HYJA 4MZPA 4BY7J 5GAOm 3ONQA 3W2WA 1ATSA 2MH2A 3QU6A 2O4GA 3WEEB 1LDKB 2AS5F 2MOXA 1R71A 1YLFA 1WHKA 4HT9A 4CJKA 1M1KO 5GMKe 4FWSA 4GO1A 1KHIA 1HKGA 4I7HA 4EM1A 1JJ2M 1B9FA 3VGKA 3TOBA 3EPZA 1E17A 2L3PA 3R61A 2ELHA 4KRFA 2VV5A 3K4JA 5BMZA 2X4YA 1KAZA 3OV8A 2QWQA 3RR8A 2NVQJ 5EEAA 4GY2B 1M90U 1VQ9A 2E60A 4TVRA 4EMGA 1K61A 1W1FA 5GAN7 4MDBA 3EUKL 4CJRA 1SD6A 1HKBA 1WN7A 5GAMd 1J3TA 2DU9A 3SJJA 5KRSA 2IPQX 2M7AA 1VQMT 2CQXA 4OKEA 2G6FX 2Y2ZA 4KDPA 3DI6A 2AQEA 2DLPA 3I56N 2JSPA 5LJ5f 1T05A 3CVSA 1L0OC 2RPNA 5D6EA 5GMKl 4JBAA 3VDXA 3CBPA 2BUPA 3BLYA 4ZYGA 4AHVA 3DEUA 3ABUA 4KNYA 3LL3A 2LY9A 4DS4A 1WNLA 4LG0A 1NK2P 3THXA 3SUPA 2L02A 5BS6A 4L8RB 5BPDA 3LGFA 1RNHA 3KEYA 1YJNI 1VQ4T 1I6HJ 1Q1HA 1WXUA 1Z9ZA 4B9LA 5HS8A 4LFBK 1ZR4A 3FF5A 2L7ZA 5JLWA 4TSXA 1UTIA 3A98A 1IN8A 3CUOA 1Z3YA 5D8KB 3CG7A 2YKNA 3CCEI 5IT9K 3OMGA 4CC2A 1ITGA 2DFIA 1P59A 2LKSA 3CCRI 3JCMh 3FZFA 1USTA 4KB0A 1G2BA 2VWFA 2KQ2A 3AG2H 5DLQE 1UA1A 4C23A 3S93A 3CCYA 1CXQA 5E26A 4AM6A 4C0DB 2EV6A 4KBOA 2NVUB 1SFKA 1IXCA 2KTQA 4LK1F 3K5OA 1IGUA 4ASNA 3BZ6A 1ETQA 4O5VA 2D5VA 1RRJA 2YCHA 5J40A 4CCKA 1KFSA 3DLGA 4K42A 5BOXA 1WJQA 2RHKA 3FC3A 1QE1A 1Z91A 4CICA 5FLXK 4LXCA 3TWHA 2ID6A 4N0AA 3K1PA 3UPUA 1VQ5I 1RR7A 3CI5A 1RBRA 2E2PA 2E1YA 3FXKA 4XM3A 3ASNH 2XKPA 4FZZA 3WTWC 3TREA 4E7ZA 5L3GA 1T8EA 2YRCA 2GBYA 1BW5A 3O08A 5I42A 2A69F 1TUUA 4LMYA 3CUQB 4FX0A 5K1YA 2QF7A 4II1A 1DTTA 1BOAA 2GXBA 1L5UA 1FZPB 3ZMSA 4W5NA 4L9NA 2GIZA 2DTZA 2CW7A 3JAME 3HM5A 4LH4A 4HUGA 1XB4A 1QO0D 2Y30A 4Y52J 3FM3A 4M3EA 1VQ9I 2Q1NA 2R7XA 1UGVA 4BACA 1IGNA 2CZ6B 1G2HA 1V5EA 2MMPA 3J7ZO 1JKHA 4KHUA 1VQ8N 1OCOH 1CF7A 1LUJB 4FU6A 1CZBA 3NHNA 5AT1B 2IA0A 4LF5K 1VQLI 2IS2A 3CMAA 2FSJA 4BQNA 1NGCA 1I5OB 1VQOA 4NO7A 3FISA 1FKOA 2L2PA 4B1YB 2F96A 1WSHA 2ZGYA 1WJBA 4FWLA 3L2RA 5GAGJ 2D0CA 1RKWA 1IBLK 1QQJA 5BN8A 4GV3A 1Y1VJ 2EFIA 3KBGA 1B4AA 4F92B 1QCOA 5DD8A 3HTSB 5EVZA 3QDKA 2MD0A 4JZ4A 4OAZA 5HL7L 1KQ2A 4AFZC 3LWFA 4ESRA 4C8KA 3AVGA 1ZTRA 2WY7Q 2B63J 1AWOA 2P1JA 3GL1A 5EC7A 3W0LA 3TAGA 3SUNA 3MPUB 4OVLA 2C0OA 1NMDA 3TSPA 3V9UA 3ESWB 4CHOA 2LJ1A 2VC0A 4PCQA 3S1NJ 1MDUB 4FOIA 5GAMf 3Q1JA 4IEEA 5DK5A 1R0BG 4I02A 1YVUA 2ASOA 2HBJA 1YI2N 2HNHA 4GMJB 5E17F 2IS6A 2NRAC 1MUZA 1PC0A 5D6FA 2D0BA 1D0YA 1WSJA 4BL0B 1ZARA 3F8FA 5HBMA 3HYFA 2W04A 3K2ZA 4KULA 2XRIA 5M1KA 1ABOA 3PNYA 4I98B 1TKXA 5J3LA 2MF2A 4KMFA 1AHJB 1RCHA 2EIKH 4LJZF 2HPMA 4OGCA 3S2DJ 2CUBA 3SV3A 1TTYA 3PNVA 3S1MJ 2M4GA 1G8XA 1EWRA 4ABZA 4ZZLA 3MKWB 3UKUA 4IIMA 3AVBA 3DWLA 4HDVA 2AA4A 4YTLA 3VEOA 2LF8A 3I56Q 2UWMA 2XDDA 3I59A 1WFWA 2WAQA 1VSKA 1LE8A 5CVIA 4X34A 3N5NX 1M1FA 3DPLC 3JSMA 2BXZA 2KW4A 1W97L 4J19A 2DK5A 2OTLT 3ZSWA 3QJ6A 1VSEA 5DM6L 3EG2A 1U6GA 1G6NA 1MBGA 2OQGA 2G0EA 3MD2A 1LFUP 2YHAA 4N4IA 3V8JA 4RB0A 4U0WA 3I55I 2R57A 3JCMW 1B6AA 1AWWA 2HQNA 4ON0A 1YJNN 1T7PA 4JHDB 1XJWB 4O0JA 1GVJA 1VQ9Q 1QWFA 1WI3A 2M8GX 2PI0A 3K10A 1I3AA 3GTMJ 5JHFA 2E7WA 4II3A 2F4MB 2H3JA 4XTYA 4ZYHA 4BB7A 2O8CA 1VNDA 3DKWA 3O80A 1N39A 3NGPA 5C2FA 1RAIB 3ID6A 1YXQA 1KD1U 2RNAA 1QW1A 3IP4B 5HK0A 5F6FA 1FYKA 4WQ4C 3ZEUB 1WHHA 1NGNA 4J8FA 1NKBA 2QBYA 3KZIC 4MO7A 2RMOA 4CZIA 3T1HK 4H03B 4YIRX