3L2VA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and mk0518 (raltegravir)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 97
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2vA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2vA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2vA03
2E6MA 4CEDA 4FYDA 5J2MA 2XK0A 1BHLA 3AO3A 3AVLA 1VSLA 4C5IA 2VG6A 3ZSXA 3RMBA 4HUGA 1WSJA 3V6DA 3NE6A 2X4YA 1TK5A 2IOCA 1D8YA 3AO5A 1C0TA 1HPZA 3NF7A 3O4QA 4QAGA 4E1MA 3PMTA 3CFPA 2GBZA 4KB1A 3PX6A 2FBYA 3L8BA 3ITHA 4BE0A 2IAJA 4I2PA 3AVKA 4PA1A 3AVCA 1KVBA 1BGXT 1C0MA 1MU2A 3AVJA 4OKJA 4CHQA 4AHRA 3ZSOA 1HQUA 1RDDA 3HVTA 4DTMA 2JZ2A 3PMIA 4R5PA 3VA0A 4CHPA 3OS1A 1I3AA 5HLFA 4FZYA 3OMCA 2EQJA 2G8FA 4Z02A 2LSNA 4DFPA 1U47A 4FJLA 2JTFA 3QNOA 3V9SA 2K3XA 4C8OA 1FK9A 4DQIA 5CZ1A 4M41A 3AA3A 1RT2A 2OPSA 4DTOA 4KREA 2IGIA 1T7PA 1RBSA 1LAWA 4DS4A 3K57A 3DB3A 4UC4A 5IN1A 1JKHA 2P0KA 3E9FA 4CF0A 3SUQA 3PUFA 1JLAA 2PQWA 1LWFA 1KRPA 2X4XA 4C8KA 1HMVA 4DQSA 1OZ3A 2RI5A 1VSKA 2Z1GA 4CJQA 2QK9A 2FBVA 1J54A 3LLRA 3S3OA 2XY7A 1TL3A 4OLAA 5J39A 1RBRA 1RDBA 4YFUA 3S6WA 2X78A 3WNGA 2HNDA 3S3NA 3OYAA 5CYQA 4CIFA 2YKNA 4FJJA 4QVZA 4TSXA 3L3VA 2EX3A 4OKEA 5FRMA 3UT1A 2MWOA 1A5WA 1DLOA 2YNGA 4CIEA 4B8AB 3D0PA 3QETA 3AVNA 3MEAA 3IS9A 3MEVA 2E6LA 1VSDA 1J53A 3LX7A 1UAXA 1WSIA 3PX4A 3T3FA 1IG9A 4DSIA 3EAEA 4F2RA 1B92A 1C1BA 5HRPA 4N5SA 4DSFA 2A1RA 4FJIA 4CF1A 2DFFA 3SZ2A 1WN7A 4IUVA 4E3SA 4KI4A 3DMJA 3LPUA 2B5JA 4Z4CA 1FKPA 1RBVA 4NCGA 3V9XA 2X6SA 2Z1IA 2BUDA 3KLIA 3PO4A 4E7LA 1HYZA 2Q3SA 4DFKA 3NF6A 3LZJA 3V9UA 3U6FA 3QIIA 3AVBA 3B6PA 3VQCA 1X9WA 4FZZA 1LW0A 4KPYA 3L3UA 4CF9A 3LP2A 4DS5A 2NUBA 4CEZA 5FDLA 1VSEA 4N56A 2VWKA 3TAPA 4M45A 3CM6A 5IAYA 1J5OA 4M3YA 2WACA 2YRVA 4W5NA 3MP8A 1Q9XA 4KHSA 4A4HA 1HNVA 1S1TA 3ZSZA 4B9WA 3CFOA 4FLVA 3SJJA 4CIGA 3OYBA 4ZHRA 1ZBUA 4CK1A 1T05A 4E7IA 1DTQA 5KE2A 1OI1A 1YTAA 1IKVA 3WNHA 3M8SA 2R57A 3QIOA 3VQDA 4AHVA 2XY6A 3KLEA 2A1SA 3OA6A 2OZSA 2VYTA 1RNHA 5HP1A 1HQEA 2B6AA 3IG1A 3TAQA 4CJRA 3OYEA 3S9HA 4KHQA 1BL3A 2OPPA 3OYMA 3OYLA 2YV0X 4B9UA 4G1QA 2BANA 3C95A 1BCMA 3TAMA 3HXMA 3NCIA 4DG1A 3SV4A 3LP0A 3SPZA 1T8EA 3RRGA 2O4IA 3LPTA 3M8QA 2OZMA 3ASMA 4N4GA 1TK0A 4N76A 3RR8A 4XIUA 4KB0A 4KHUA 2BGGA 5J26A 4CF2A 1R0AA 2OPRA 4FK4A 2HHSA 1KSPA 2QQSA 3LYIA 4CJ5A 3PV8A 3RMCA 3PNWC 5FROA 4BDZA 4DTPA 3HSTB 4CK2A 3ZSQA 3F70A 1TKZA 3O3GA 4DSEA 3OB9A 1S1UA 1WSGA 4AHCA 1L3UA 3LAMA 2LVMA 1QSSA 2RHZA 3T1AA 1RT7A 2GUIA 1S1VA 3OYJA 4ZTJA 4C8MA 1C1CA 1S1XA 4N47A 3TAGA 1NK6A 5CY4A 1XI1A 3QBYA 1U48A 4DF8A 2YHBA 1Q9YA 4N4HA 3AVIA 2QKBA 3QEWA 4AHUA 1G15A 4CESA 3ZSRA 2JGUA 2ZQBA 1VSIA 4CEBA 3JYTA 3PX0A 1NK8A 3V9WA 4B9MA 4KV8A 1WJRA 2D5RA 1RTJA 3DLEA 3HL8A 4F8RA 2YNFA 4CJPA 3MECA 3MEDA 4CGDA 4QW2A 4CJ3A 1I39A 3DLGA 4IG0A 3ME9A 2XO7A 5HBMA 3IAYA 3RWUA 2D0CA 4CRIA 5K14A 3WNFA 4CFDA 1S1WA 2HQEA 2HHTA 5I3UA 2KZMA 2DIQA 3V1OA 2K3YA 1Z25A 2HB5A 4OGCA 4OGEA 5D6WA 3SV3A 5KGXA 4DQRA 4E0DA 3NGYA 4LSLA 1WAFA 2FBTA 4M3ZA 3LDSA 4KRFA 1VSHA 4CECA 1KVCA 3AV9A 3HYFA 4DU4A 4F4KA 2AJQA 3SCXA 5KRTA 3I8DA 2O4GA 4NYNA 2Y1JA 1TVRA 4DTSA 3ZT3A 3UIQA 3KK1A 4KO0A 3SPYA 1QSLA 3JSMA 4J2EA 4ID5A 3ZSYA 2G8KA 4O55A 4AH9A 5D6YA 1CLQA 4HUEA 3MEEA 2X6NA 3RRHA 2LRQA 3OS2A 4DF4A 4O5BA 1G5VA 4BWJA 3SQ0A 3HT3A 4CERA 4ELUA 1ZBIA 4BD3A 4IUUA 4OVAA 1EX4A 4B9TA 4FLTA 4ID1A 4CJUA 4X34A 3EZ5A 5JS1A 3M8RA 3RMAA 2M0OA 1KCFA 2PY5A 1NKCA 4CJEA 2Y1IA 2HVHA 2RHXA 4GVMA 4FJMA 4DTXA 5M9OA 1L3VA 2G8WA 1D9DA 5FRNA 3SUNA 4DTRA 1L3SA 1CXQA 1EKEA 5SZTA 3LWMA 2LTOA 2ATQA 3QEVA 4PL6A 1NK7A 4E7HA 2RJFA 1WNSA 3AA5X 3UWNA 2XHBA 3S3MA 4I7FA 1Q8IA 4J2AA 4EP4A 3RTVA 3KK2A 1OZ2A 1KTQA 3NTIA 3U3YA 4CFCA 3KTQA 4RG8A 4W5OA 4Z0UA 1RT5A 3OY9A 4E7JA 1YT3A 3VQ8A 2RHUA 4FL6A 2D9TA 5T7BA 2ETJA 4CHYA 4PLLA 1SSFA 2YKMA 3V1QA 4DTNA 5J2NA 4DSKA 4M42A 3MP6A 4M3XA 4Z4HA 3SQ4A 4HHTA 4GMJB 3FLGA 1JLQA 5C42A 4Q5VA 4DU1A 4E7KA 1IO2A 4DTJA 1Y97A 3HP9A 1QQCA 2M16A 5KCHA 5KH6A 3NF9A 3P1GA 4ELVA 1JLCA 1RT4A 2P1JA 3LWLA 2L89A 3DLBA 3H08A 4Z4IA 2HHWA 4CJLA 2O4XB 1JL2A 4HCZA 3HPHA 2EKOA 4CHNA 3SYZA 1ZYQA 2PYJA 3CEYA 1UA0A 4RW6A 3AVHA 1U49A 5KE3A 4K8XA 1RCHA 1UWBA 3OJUA 3O3FA 2GV9A 2EQKA 4KHYA 1MHNA 2XDPA 4PQUA 1TKXA 1BISA 1NJXA 5D3GA 4F3TA 4DWIA 2LDMA 1WLJA 4M3UA 4KFBA 4QCLA 3NBPA 1J9AA 3M9QA 4CHOA 4OLBA 4FJNA 3WNEA 4DQQA 1VRUA 3F9KA 4KKOA 1XHZA 2YNIA 5DMRA 3NHGA 3MXIA 4EZ6A 1X1PA 5KGWA 5CZ2A 3I0SA 3VQBA 4FLZA 1KFSA 4B9LA 4F2SA 2RI3A 4OVLA 3QKJA 4DSJA 4L59A 2GFAA 5C6SA 1ZBHA 3AVAA 2EQMA 3GOXA 3KLHA 5J2PA 3QESA 1IKWA 4FLYA 1A5VA 1EXQA 4FJXA 4BE1A 3OJSA 4I2QA 2RF2A 1WJQA 1BIUA 2RJDA 2RPIA 4BE2A 3LAKA 4ICLA 4QQDA 3K59A 3V9ZA 2HQXA 3SUPA 3F73A 4KTQA 3TR8A 3V1RA 3K2PA 3NTKA 4NZGA 1CXUA 3NDKA 4NCBA 3TI0A 4QQ6A 3O4NA 1KLNA 3C4SA 3LZIA 3HO1A 4CHZA 2RJEA 3LANA 3VQ5A 3NH2A 2KTQA 1SV5A 3SQ1A 3LP3A 3KUFA 3L2WA 3NAEA 2E6NA 3SI6A 4J2BA 1VK0A 2BIVA 5HROA 1W9HA 3G10A 3OQ5A 3THVA 4MQ3A 3NF8A 2G3RA 1RILA 4C5HA 1UOCA 2Z1HA 3VQ4A 4AHTA 3TABA 3QEPA 4BDPA 4HCCA 2R5MA 1NJWA 1WGSA 2BKDN 2QXFA 5CIUA 1JLGA 2P51A 3MEWA 3CYMA 1CZBA 4IG3A 1TL1A 1JL1A 5CYMA 3VQ6A 4CGFA 1RBUA 3CQ8A 3A2FA 3C6TA 4PUOA 3CFRA 1ZBLA 2DIGA 3QEXA 2G8HA 4KAZA 4Z4GA 1JLEA 2R7YA 4DSLA 3LGFA 3KLGA 3VA3A 3PY8A 4IUQA 4W5TA 1HYSA 4KHNA 2B4JA 2DAQA 1QS4A 3LALA 2O4XA 4FLXA 1ASUA 4E89A 2PZSA 1NOZA 1O1WA 3OMGA 1L5UA 4LH4A 4JRPA 2KQ2A 2FBXA 2WONA 4DLEA 5C24A 2F5KA 3O8VA 4FLWA 2QQRA 4WE1A 1WSFA 3P83D 4B9SA 4RW8A 3RR7A 1FKOA 4RW7A 2HVIA 1YTUA 3FDRA 4LD6A 5I42A 1DTTA 1U04A 4CEFA 4DQPA 3TAEA 3G0ZA 4N4IA 3OS0A 1KLMA 2RN2A 2IC3A 1D5AA 4LH5A 5C0MA 1HRHA 4CGJA 1LV5A 3MEUA 3BDLA 1K6YA 4CGGA 1F21A 3DYAA 1RBTA 4FVMA 1S6PA 4C5EA 4C5GA 4CJSA 3VQQA 3VQ7A 4W5RA 3KIOA 2HNYA 1N27A 4O0JA 3DRPA 3ZT0A 2L8DA 1BIZA 2JLEA 4CJFA 3ULDA 4EDUA 4DFJA 2W42A 1NJYA 1SKRA 3EYZA 1BQMA 3OYGA 4F3OA 4N41A 2G8UA 1TV6A 4BDYA 4KHWA 3HJFA 3KD5E 3M8PA 3ZT1A 1SL1A 3PFSA 3MP1A 2IS3A 4C8NA 3VQPA 3AA4A 1RT1A 3IRXA 2GFUA 5C25A 2X35A 4DU3A 4DMNA 1X9MA 3AVGA 1NKBA 3MAQA 3FEOA 4B08A 2CKKA 3OYDA 2NLUA 3ISNC 4LSNA 5KCOA 1XC9A 1WJSA 3P5JA 2G8VA 4I9QA 4II1A 4KI6A 3E01A 3QJ6A 1RT3A 4CGIA 4FJ5A 3NH1A 1RI0A 2RO0A 3ZEHA 4AHSA 1TK8A 2BDPA 1LWCA 1S9EA 2OPQA 4Z4FA 4B9XA 4O4GA 3DLRA 4B8CA 3DLMA 4NCAA 2HHVA 1IH7A 1RDAA 4PWDA 1ASWA 3VN5A 4FJ7A 3QIPA 2EQUA 3BDPA 2HHUA 4RG2A 4AILC 3DM2A 3KJVA 3D45A 1BQNA 4FLUA 3Q1JA 3AA2A 4IKFA 4QQGA 1NK4A 4A4GA 3HPOA 4O0IA 5HRSA 4GW6A 1C0UA 3QNNA 2L3RA 3OYIA 1TGOA 2IG0A 4E19A 4H4MA 2R58A 5J1EA 3RMDA 3QO9A 1TAUA 3OYHA 4B3OA 4HUFA 5DK5A 4DLGA 3L2VA 1TAQA 3K5NA 4IBNA 1HJRA 4Y1CA 3MXMA 2RI2A 4CK3A 3LGLA 1JXBA 4EZ9A 3NNQA 4JS5A 1QTMA 2GF7A 4PY5A 2DY4A 3P8DA 1T03A 4H4OA 4LD0A 3NGZA 1KVAA 2HNZA 4YNQA 4FJHA 4OKKA 4EP5A 3L2QA 3DB4A 3TAFA 2QKKA 2FHDA 2EHGA 1S5JA 1GOAA 4B9NA 3HK2A 1GOCA 2X4WA 4FXDA 1FXXA 2EFIA 4OPJA 2F8SA 2R5AA 4CJWA 1UA1A 4FK0A 4CEOA 3ASKA 4JRQA 1KHCA 1RDCA 3SD4A 3U3GA 2OYQA 3LH0A 3C94A 3K5OA 4RW9A 4HTUA 2X74A 3E9GA 2YNHA 1XWLA 3MO8A 1RTIA 3LP1A 4HCBA 3SNNA 2Z1JA 3OYKA 4DTUA 1NKEA 1JLBA 4IFVA 3C6UA 3QINA 2D0AA 5KRSA 2E5QA 1W0HA 2XRIA 3V4IA 2MWPA 3TARA 1NK5A 3H6ZA 4CF8A 1QHTA 3DLKA 2IDOA 3DOKA 4FW2A 4MFBA 4A4EA 4FJ9A 4OPKA 4CEEA 3HPGA 2G8IA 2OA8A 4M3RA 1C6VA 2VWJA 3NGIA 4CE9A 4CJ4A 1NK9A 1REVA 3HM9A 1N6QA 2KZZA 2VG5A 1D9FA 3QLHA 4O44A 4RW4A 2WOMA 2DFEA 4IUPA 2RHYA 5KTQA 1CZ9A 1XHXA 3H8ZA 3ZSVA 4IDKA 1IKXA 3SUOA 1XNIA 1LAVA 1N5YA 1VRTA 4CFAA 3KD1E 3OVNA 4CJTA 2HMIA 2F8TA 1H3ZA 2HHXA 4CCHA 1RTDA 4K8ZA 3L2RA 3ZCMA 3P8HA 4FU6A 3ALYA 1BI4B 4JLHA 3AO2A 4FM1A 4Y1DA 4J2DA 2P5GA 4FJKA 2I5JA 4L8RB 4KTWA 3KKSA 3OYNA 1ITGA 2P5OA 1WSHA 3AVFA 3L2UA 3VQAA 4CEAA 3K5MA 5J2QA 3DRRA 1U4BA 3DI6A 1NOYA 1B9DA 2KFZA 4M3TA 4FJ8A 1KFDA 4CJVA 3HP6A 4IURA 1TKDA 3FFIA 3META 3EY1A 3OYCA 4PLIA 4A4FA 3AO4A 3I0RA 3NTHA 4IFYA 5JS2A 4FM0A 4CFBA 3QEIA 4HVJA 1RT6A 3SQ2A 1Z26A 4I9LA 3KKRA 2D0BA 3VQEA 1EP4A 4CGHA 3DLHA 4QOZB 4GY5A 3ZT4A 1IKYA 4Q0BA 2E4LA 1VSFA 2KW4A 5D6XA 4H8KA 1EETA 1NJZA 1X9SA 1ASVA 4BACA 1VSJA 2RJCA 1C1AA 3NH0A 4JS4A 1LW2A 1S9GA 2ZD1A 1YVUA 2ZE2A 1WAJA 3AO1A 4W5QA 2XY5A 2M1HA 1SKWA 1U45A 3FC3A 4IUTA 1VSMA 3K5LA 1NK0A 4B9VA 1A5XA 2B8AA 1LWEA 4DFMA 4ELTA 3KLFA 3TANA 1QE1A 3OYFA 3CM5A 4CJKA 2KFNA 3ZT2A 3L42A 1RTHA 4UQGA 4C8LA 2DTUA 2LCCA 1JLFA 3AVMA 2DFHA 4BWMA 1S6QA 1WSEA 2HHQA 3QERA 4KTZA 5SWMA 4OJRA 2F96A 1TKTA 5HRRA 2FC0A 2XY8A 4Z4EA 1B9FA 3ZSWA 3DOLA 1GOBA 1HNIA 4ZTFA 5KI6A 5HRNA 1QSYA 2PYLA 3O3HA 1BCOA 1SUQA 2BE2A 1SL2A 4Q5WA 2VG7A 3K58A 4FM2A 1SL0A 1JXEA 1L3TA 3MXJA 4FJGA 4LY7A 2YHAA 3CG7A 3BGRA 4FK2A 1HYVA 2RKIA 4NYFA 3HVRA 3KK3A 2HW3A 3B6OA 3V81A 4FZXC 1OYXA 3DRSA 3NFAA 3VQ9A 2ITGA 1BI4A 4E1NA 5E41A 4NS5A 1SKSA 4FW1A 3MEGA 3TWHA 4CEQA 1ZBFA 4FCYA 2RHIA 3PO5A 5EU7A 4M3WA 3T19A
chains in the Genus database with same CATH superfamily
4FYDA 2CH6A 3HRSA 3JRIA 3ZLJA 5GAOn 1Y96B 1OX8A 3O4WA 3QG1A 3AVJA 3AL0B 2ESNA 3HVTA 2JZ2A 3OS1A 1UHSA 2EB7A 1M90U 4DQIA 3V9SA 2K3XA 1R71A 4GV6A 3AA3A 4DTOA 4GXOA 4OFHA 2O31A 2A6HF 4CA0A 1EWQA 2MW8A 1OZ3A 2M51A 1M3CA 5FU7B 2W24A 3J7YP 3C0BA 1Z6TA 1AWJA 1YP5A 1X27A 1YG2A 3AVNA 1NG2A 2FPDA 3FX3A 3QO3A 2AQFA 3IAS2 1IV6A 2A1RA 1ACIA 1O7LA 4KI4A 3ENBA 4O5FA 2UXDK 2ECBA 3KLIA 4DV4K 3NF6A 5LMNK 4AVZA 4AIDA 3HDDA 4F52A 1QVGP 3HOYJ 1VSEA 1FMWA 4DV5K 4OOIA 2AHQA 1N8RO 2I5WA 3WNHA 4E47A 2UXCK 2VJ4A 2F9TA 2J6FA 2G0EA 3DKWA 2HKNA 3LP0A 5A2QE 2AQEA 2O8EA 2RNAA 3ASMA 1REPC 4PSWA 1MWKA 4D6WA 2W25A 2HKXA 1JXMA 2CP3A 3KYLA 3I9QA 3ZSQA 4CVNE 3EQLF 1ONVA 4L0ZB 5AZIB 2CP7A 1M3HA 8ATCB 2W85A 3A8MB 2A6AA 4Q0BA 4ELTA 3MECA 1NG9A 2EZIA 3G4SA 3HOXJ 3M0RA 5HBMA 2BVLA 2DA5A 4YFKF 2HF4A 2K5FA 4ENJA 5BMZA 2QASA 4BI3A 2PFBA 1HK9A 4F4KA 2D1XA 2EIFA 3A8HB 3JRAA 3E9OA 3CMET 2JMCA 3MKZA 1SF9A 3OS2A 3RPQA 4I98B 3MKLA 4M78A 1W36D 2NVTJ 1XDSA 4MTEA 5FRNA 1CXQA 2OTLI 4EJZA 4OMZA 1IG8A 4RS8A 3M55A 2H1LA 1Q8IA 5D8KB 3FHGA 1GXIE 1XSDA 4Z0UA 2L5QA 2QA4Q 3HTUA 4M9XA 3U9ZA 2ZM6K 4CI6A 3SQ4A 1A04A 4H0EA 5KH6A 3VDXA 1ETOA 2KISA 2GELA 3ZEUB 4CZFA 3G7ZA 3THYB 5KE3A 2Z99A 4XTVA 3OJUA 1ILYA 3JTGA 1VYVA 3JCMc 1JKRC 4FIBA 4YG2F 2LDMA 4J9CA 1NPPA 3NBPA 2HEQA 3NHGA 4HYEA 2MMPA 1STZA 1EH8A 3FXMA 4OVLA 3DPUA 1E4GT 3OBWA 3HC7A 4JYKA 2VQGA 1PHTA 1WJQA 2L3SA 5GAMj 1SFKA 4KTQA 3S2HJ 2F4MB 1GLNA 3L09A 2JTVA 3M3ZA 3G71I 2AXTC 4A3FJ 3P9IA 3QMLA 2XF6A 3MWTA 4I0AA 2NWMA 3OL3A 4IPAA 3N4MA 2NOZA 3A2FA 4AC0A 2X1EA 2H3GX 2MSYA 4MDAA 1M9SA 2CGKA 5E8IA 5TKYA 3BG5A 3O8VA 1QQIA 4EEFG 3G0ZA 1AT1B 1QMCA 1SD7A 4CGJA 2VWFA 5F1RA 3F21A 4LXCA 5I9EB 4UXNA 2WY8Q 3VQQA 4KNYA 3CD6T 4M6XA 2HNYA 3H46O 5GANh 4N41A 4PSXA 3EYZA 2JVVA 2G8UA 3HZJA 1SL1A 4DU3A 1U84A 3ZETB 3I9V2 1U8RA 2W1OA 1XC5A 1GVJA 3ZEHA 1YFHA 3QP6A 3PGGA 4CBUA 5A2QO 1S22A 1Q7YC 1YS6A 3IL2A 4E19A 2R58A 2VT2A 2BE5F 1NTCA 4IBNA 3SAFA 5I2MA 2FO0A 3WE2A 3P8DA 4OKKA 5BRHA 3PFIA 3S1QJ 1W2BM 3EPZA 4OPJA 1K4SA 2L7MP 2M0MA 4FK0A 1KJWA 4FL9A 1RPWA 3U3GA 4HTUA 2HZYA 1RTIA 1LWVA 1Z21A 3K0SA 3SNNA 1QCNA 5DDGA 5DYMA 3U9DA 1JKQC 1ZRCA 1OCTC 4H0XB 3VEWA 1WA7A 4CEEA 3GNFB 4DHYA 4NC6A 4CJ7A 1QVUA 4C23A 1ZKGA 4NUBA 2P9LA 2HZTA 2YWWA 4FE4A 2L3DA 2RHYA 3ZSVA 1IKXA 5FPDA 1D1AA 1XX5A 1JUMA 5EEAA 4BKXA 4L8RB 3OH6A 1FOKA 4XKWA 2BY2A 2HMPA 4A3MJ 2NUPA 4RCBA 3FHZA 2QEXI 5CYVA 4NBQA 5E26A 2Y4YA 1WEFA 1CQTA 4A4KA 2QWQA 4GY5A 4JJNK 2ZXWH 1ASVA 4WXDA 2ME0A 4ZN1A 2OTJA 1YVUA 1SKWA 2DXTA 3KLOA 1VSMA 2H8RA 1D4XA 1FBUA 3ZT2A 5J47A 1IRGA 2M7BA 2AZVA 1GOBA 1BCOA 3CD6Q 1VQ5Q 4RAGA 1QW1A 3VOVA 3CP2A 4HQMA 2PBDA 2PJRB 3QBXA 2VB6A 3VQ9A 4UUSA 4J6YA 4C8QD 1KA8A 4XLCA 3O3KA 3A5OC 3T19A 2GCXA 1P4WA 3AO3A 3AVLA 2E20A 1JGGA 3KCCA 2IOCA 4EQQA 4QAGA 2FSNA 3O4QA 2QZ8A 1S5LC 2GNCA 4J9EA 3IH3A 2WB1N 2QM1A 3RYRA 3I56N 2EFOA 4HF1A 1QCOA 3QPSA 1UHWA 1Q86C 2OAWA 4U7DA 1P6RA 1JLAA 4OLAA 4K2EA 2P5LC 3EGXB 3H3NO 1QWEA 1PKTA 3K4BA 4L9JA 5FPEA 3IC7A 2VT3A 2Q8KA 3HOUJ 3MEVA 2E6LA 2ISYA 1U6GA 4DSIA 1IG9A 3R61A 1SS6A 3TQ7P 4C0FA 2KSSA 1ABOA 3M54A 1LEAA 5E3LA 4JKHA 3DPTA 2KQRA 2CWEA 5L3CA 3V4GA 5JR3A 4ZDOA 3CPFA 4KPYA 1UGPB 1G4DA 2HDCA 3TAPA 4N56A 3OS5A 4II2A 4Z6YA 4DV6K 2KP6A 4E6KG 2IT0A 3OYBA 2ESWA 2DNUA 2R57A 3ASNH 2GIZA 2OZSA 2VYTA 1VQ7I 2B6AA 3IG1A 1M8MA 2D1HA 1HKCA 1JUPA 3OYLA 1WPKA 3G71N 3SMSA 1I6HJ 3RRGA 2JW4A 3K1NA 5L3EA 4PGHA 3D4VA 2DMOA 5J26A 2HHSA 2JUFA 4DR2K 1OEBA 3LOCA 3CVSA 3BEXA 1S1UA 1RLPC 1Q81R 1S1VA 4HCKA 1C1CA 1NK6A 1W4MA 2R5YA 1Q7YO 5GP9A 2QKBA 2JGUA 2DK8A 2BZYA 5E8GA 2JA5J 4UV8A 1E3HA 2XO7A 1WNLA 2A05A 3E5UA 2K3YA 2HB5A 4IOXA 1ZX6A 1RKTA 4ANJA 4LSLA 1U78A 2F2WA 4XL9A 2XAJA 1OULA 5LGUA 1TVRA 4LIVA 1S72N 4ID5A 3DTIA 1FIAA 5ADXH 2AT1B 2VE8A 1OFCX 3FXRA 1SRMA 5CLSA 3EZ5A 2M0OA 4JYAK 2COWA 3SUNA 1QVGA 3QEVA 1WHJA 1I1SA 5LRRA 1VQNA 1KTQA 3NTIA 5JHFA 5CR2A 2D9TA 3W6VA 3CCLA 2VC0A 4HHTA 3VFZA 2GQIA 3H08A 1ZYQA 4BRGA 3R3LA 1RRQA 5FLVA 2LJ1A 3SBGA 4M78E 2X4JA 3EH1A 1GBRA 4F3TA 3AAFA 2B86A 3UKUB 1A6QA 2UUZA 3EEQA 4OIOF 1QHAA 4FJNA 2QWWA 2TRTA 1TZLA 1X1PA 1PD1A 2HZDA 3SEQA 1I07A 4M7YA 3WU1B 3BF1A 5J2PA 2MGQA 1IKWA 3L1PA 4BE1A 4BE2A 2KHOA 2QGGA 4PCQA 3VS0A 2HQXA 2H94A 3R0JA 1ETXA 4Y4RA 1SVOA 5GJVB 5FLXZ 3LZIA 3MKDA 2Y0MA 2O8BB 3UA6A 3LANA 1YI2T 1T95A 2L4MA 3HYIA 3I4NJ 2ZCFB 4OAZA 2F5EA 4ENNA 5LL6S 2NOLA 1UOCA 5FLXK 3TABA 1NJWA 3M8FA 4XU1A 3B73A 3I55T 1FJGK 2DXCA 2OC6A 1WI9A 3R0AA 3LGFA 2QWRA 3JRFA 1RAFB 4RAYA 3CBMA 4X1VA 3P83D 4RW7A 3UE5A 1YTUA 4IVNA 4M3BA 3Q3SA 4JX4A 1YRNA 1TXQA 4GCVA 3OS0A 3LNQA 2COZA 1HRHA 2E5KA 1VQ4N 3GWZA 2DMPA 4WK8F 3AG3H 1EH6A 3LDLA 4CZHA 1ZGJA 3ZT0A 1VQKQ 3CPWP 2QSGX 4NXMK 1TV6A 4BDYA 5EF6A 5BQTA 4B3TK 2D8HA 3I8BA 4DMNA 5GANe 2G8VA 3THXA 3NWTA 2FX0A 2OAZA 1W70A 1VQPA 5FFXA 2J6OA 1DJ7B 3I5UA 1RC9A 2NUTA 1TGOA 1KONA 2P7CB 3ZCOA 3FLCO 2ZAEA 4L9VA 5F27A 5IP6A 5DK5A 1QNTA 2Z5UA 1T0FC 2XU8A 4LF7K 4LD0A 3H0FA 4LDVA 2LRDA 2M3AA 1AWOA 2VQCA 1QCFA 5AQLA 2XDDA 2EYQA 4C92F 4CJWA 3AGKA 3EG2A 2IRFG 1KHCA 3L2ZA 3E9GA 1NU0A 3RPUA 1KAXA 4H0VB 3CCRT 2DRMA 2NRTA 4O6JA 5KPRA 1DP3A 4A4EA 3UF4A 1I50J 5BRDA 1REVA 1LFBA 2X48A 4KBOA 3CBPA 1VRTA 6PAXA 1I94K 4ABZA 1BWFO 3EHRA 4JLHA 2IP2A 3AO2A 3KKSA 3ZP5A 2LNVA 2K3BA 3M5RA 3KP2A 3EUKL 1YJWT 1JUSA 2PNIA 5EJCA 1T6CA 2NRRA 1Z26A 2NUPB 3SWNC 3DLHA 1H8AC 4Z89A 2J05A 1X9SA 3DKYA 2RQVA 3JRHA 4UY8I 2GEMA 2E1MC 1A5JA 2DFIA 3CM5A 5FKNA 2QGUA 3H0HA 2RMOA 1SHGA 2KVQG 2L0KA 4J9FA 1U1TA 2L0AA 3F9MA 3MXJA 2FVUA 4OMPA 1U6ZA 5AQNA 5CKDA 3I33A 2GGRA 3NVMA 3TTDA 1FP2A 1SKSA 2FRYA 4CEDA 3TVTA 2XV4S 1MBEA 2RREA 2F2XA 2X4YA 1H3HA 5EGOB 1TWAJ 2D4WA 2Z16A 5AONA 3E9LA 4BE0A 3GTOJ 3AVKA 5AQJA 3SEMA 1K78B 3VA0A 1I3AA 2EQJA 4XMYA 3CDLA 4ILHA 2YI1A 1FK9A 4MLHA 3ML6A 2B63J 2OPSA 2IGIA 1DGRM 2HBLA 2PX9A 2CZ0B 5IH2A 2Z1GA 1VSKA 1IB8A 1AA7A 4DQ2A 1J54A 2D8JA 2GM4A 1HXDA 3PO3J 4M75F 2E7WA 4QVZA 4CCOA 4HWIA 1VQLT 4OKEA 5IWAK 5ICFA 2OTLN 1OYWA 4LDXA 4NQWA 3PIOL 3T3FA 3RKQA 2Y69H 2P0WA 1YN8A 1MW7A 2X6SA 1YJ9N 5GAMd 2LMJA 3BTCA 2GTOA 4ZN3A 1HJOA 3P39A 3H9NA 4M77E 1RRSA 3CM6A 2A40A 4YOTA 1KC8O 3G6ET 5H1SQ 3KZIC 2O01E 3CJCA 5GAN8 4CZKA 4H5TA 5KQ8A 1X01A 1BL3A 3ROUA 3OYMA 3VEVA 2VBYA 3MDQA 1PUFA 2E12A 5LJ5j 1UB4A 3GF5A 4FK4A 2QDYB 1KSPA 1X4PA 4C2TA 4A5AA 1VQNI 3HSTB 1TKZA 4EIAA 1IBKK 3GZNB 3WG7H 2KI7A 5AQHA 3BPXA 3CESA 4KN7X 2NRWA 1D5YA 5LHIA 4AHUA 1G15A 4CC7A 3HOTA 1NK8A 2JA8J 3F8NA 1WJRA 2OF7A 1YS7A 2JPBA 4DGWB 1AVZC 1SFXA 4OGEA 4RGUA 1MMSA 4E0DA 3LDSA 4HZFA 1X6OA 3SCXA 4A61A 5LY3A 4EJWA 5EG2A 3KK1A 3ZBDA 1XMQK 3JCUC 1UJ0A 5D6YA 4DBQA 3RRHA 1VQMT 4CO8A 2LRQA 4DF4A 4CERA 2D45A 2Y9YA 2KDSA 1M90R 1KCFA 1T08B 2QWMA 2IA0A 2Z2SB 3TPQA 3OSGA 3MCPA 3CF2A 2LTOA 2O8CA 2L4AA 2PUKB 4ZDPA 3KZZA 2YX6A 4XLFA 2R0QC 4DV1K 4OAYA 4XRMA 4C1NK 3V1QA 5I21A 3QU3A 3FLGA 1QVGM 3HM8A 4LD9K 2M16A 4EM1A 4IIOA 1LJ9A 2JUGA 5B1BH 3VPRA 3O1BA 2UUAK 2ADUA 1Y0NA 3SYZA 5CKFA 4CHNA 4LNPA 3CCVQ 1NJXA 5D3GA 4BXFA 1VQKA 3HOZJ 4M3UA 4X6AJ 2X85A 4CHOA 4F93B 4YOVA 4KKOA 4EZ6A 4J8OA 1VQ7Q 3AVAA 1N9RA 2EQMA 2WFBA 1A5VA 3BPVA 2MOXA 4A62A 3ABTA 1Q86U 1VQ5T 3TEDA 2P9SB 1CSKA 3SXYA 3VYSB 4D9JA 3TR8A 3BFMA 2DPPB 2M2EA 2JHJA 5AIPA 3NF8A 4OMMA 4AHTA 3LFKA 2ISZA 3ID6A 3C6HA 1W1FA 1S72T 1KG7A 3CC4Q 1CZBA 5AJ3K 3V8JA 1ZBLA 2DIGA 2OV7A 2FMYA 2QK0A 1ASUA 2W6LA 1O1WA 5IP7J 1VQ6N 5KNLA 4PK4A 2QYOA 2LNBA 3G6EQ 4XKVA 4I6MA 5GJWB 3TAEA 1BG3A 1M1FA 3M4GA 1IW7F 3T0YA 3CQXA 4FHTA 1QGPA 1ORNA 4PFPA 1G3YA 4J6WA 4PJOC 1E7OA 1K79A 3TL4X 4OO1J 4F16A 1ZA2B 1YIJT 4XK4A 4KI6A 2Q97A 1TYQB 3HRGA 3GCMA 3BY7A 4ON0A 2QWLA 1WBBA 4DIQA 2JRMA 1K8AR 3FB9A 4H0YB 2Z0WA 4JK7A 1X2QA 3QO9A 3QBWA 3IH7A 4HUFA 3KWIA 3DXKA 1S7OA 5HODA 2V75A 3SFMA 4PY5A 5GIOA 1YWOA 1KVAA 3EH2A 4UB6C 4JQFA 2DILA 2CV2A 2FZCB 2F8SA 4AM7A 3VEZA 1BJZA 3CCJQ 2ECZA 3K5OA 2XKOA 1IXRC 4M7DG 1Z77A 3BLYA 3OYKA 2RHKA 1NKEA 5LJ3j 3CCQQ 2O8DB 3GL1A 1ZUKA 3ATUA 4DZPA 3ZFJA 2ZNZA 4XQ3A 3GYHX 3BZKA 2EYWA 2VPLA 1LAVA 3QRFF 1SG5A 1WJCA 1QHHD 2K3FA 2E19A 2HHXA 2DBBA 4B4CA 1P7IA 2BTTA 5CVRA 4Z88A 1GLCG 1PRLC 3HFNA 3ZMUA 1M90O 2ZNYA 2XGCA 3NTHA 5KYWB 3SQ2A 3MCAB 1VIEA 2DYBA 2LKSA 4BJ6C 1VQ8A 2KW4A 4UNOA 3AAPA 1PYVA 2HQNA 1S9GA 1BR4A 3Q0WA 2DXIA 4KRTA 3CJ7A 1Q7YU 2PVGB 4OMQA 1QHGA 2BYVE 1VQ4A 1WSEA 5KYUB 1VQ6A 2GLOA 3ZSWA 3FRNA 4HF0A 4HX7A 1TUYA 5IT9K 3LA2A 2YG8A 2WBNA 1HYVA 3G1MA 3OW2M 4I2OA 1Y07A 3V81A 3N05A 2QBYA 3W2VA 1B1BA 4ESRA 1KXPA 1UFMA 5LJ5f 2YG9A 1K8AC 2A68F 1R5ID 2QKLB 3PX6A 3L8BA 2EFQA 3AVCA 4OKJA 4B6MA 1NE8A 3MVPA 3OMCA 5HS7A 1QZZA 4CD1A 1BN5A 2XAGA 5GANg 3GE1A 4YIRX 3TTFA 4M7DD 2F4OB 3GMEA 3LL3A 4MQ9F 1ETQA 3ULQB 1KD1O 2F4IA 1YITQ 2KEAA 1WZOA 3F0CA 1GLLO 3I59B 3UT1A 4CIEA 2JTMA 3CMEN 1YI2Q 3JB9J 1ZA1B 4ZZLA 1GXQA 1IXCA 2JOYA 3ZL7C 2FOKA 1WN7A 3LPUA 3QDFA 2DK3A 4F7UA 1D8KA 2VQLA 5KVRA 2EIJH 1BIBA 3AVBA 2CYZB 4ETSA 4XKCA 2LC4A 2YX4A 4W5NA 4IRIA 4WF2A 2DJNA 3R6OA 1ZBUA 2Q36A 1KQ8A 5CHIA 2Q0OA 4O5VA 1ACMB 3CCRQ 3CXCS 4CZEA 1WHMA 1UUEA 1Z3YA 4Y28E 5A0LA 3CCVT 1HKTA 2WC9A 1DDNA 2V6EA 4BRCA 1J0RA 4M75E 2OTLA 2FLOA 1X3UA 4ZTJA 4JUVA 4JKAA 5KCMA 4I6MB 4N4HA 4J7FA 2ZZDA 3X26B 4CZZA 5AR0A 4KV8A 3DBHB 2D5RA 3VGLA 2RVCA 1UELB 3IAYA 1EIFA 1QQJA 1BC7C 1JJ2P 5K14A 4NC8A 1I5LA 1S1WA 5JLHA 1ABQA 1IN4A 1UJYA 2FBTA 1F4KA 3IRQA 4P1WA 3UKGA 5KYYA 4E7SA 3SAHA 4DTSA 2DEUA 4J00A 2G8KA 4LN2A 1BI1A 2LFBA 2JT1A 2PY5A 2HVHA 3DKMA 1HJDA 1D9DA 1ZBJA 2IA2A 3GPLA 3EDPA 1S6LA 3A01B 3AA5X 3UWNA 3S3MA 2P0PA 3M58A 1NK3P 3E6MA 5DM6L 1V55H 3R9PA 3FZMA 4ISGA 2EKHA 1R9TJ 3DV8A 4M3DA 1Y57A 4X9CA 1OVYA 3CC7T 2IIMA 1IO2A 3PVQA 1Y97A 2RM4A 4RAZA 3MMYB 4HG2A 1JLCA 4E9EA 1HU0A 1O13A 1Y1VJ 2BHYA 1KHIA 2VV5A 4J9BA 1X2KA 2TDXA 1SHFA 4K8XA 3HXLA 1M2VA 3TDZC 5HKCA 2NRAC 4D8KA 2ELHA 2IA1A 4R56A 2M45A 1XGSA 1XUPO 4FLZA 4F2SA 2WSCE 3CCJT 4WQ5C 3QZ5B 1T6SA 3BROA 3FF5A 3N97A 2QGFB 2DFUA 1BIUA 4I02A 1J7KA 4BC2A 4M78G 3HB9A 2NLXA 1SMYF 2GQQA 4AYBA 5L3BA 3FXUA 2QA4A 2HVSA 2XRLA 4CZIA 2AKKA 1N32K 4U67L 3NAEA 3SQ1A 3CJTB 1AZGB 1E0EA 4XIDA 1MZBA 1SPKA 3ULRB 2IJLA 4IG3A 2PFUA 1RR7A 1H9TA 1M2VB 3DLLF 4OMYA 4DEYA 3LALA 4ZZDA 3JR9A 1L5UA 4LFAK 4OPAA 2OTJN 4RW8A 2JN0A 4BQZA 4N4IA 3L6QA 2X6YA 1Y6IA 1QKWA 1D5AA 1Y71A 5AQSA 4LLGF 2HPIA 2P6TA 3OIQA 3T1YK 1NYGA 3A01A 2L8DA 1SKRA 4C8QC 1BQMA 1HA8A 2JSCA 2FSWA 4C8NA 3AA4A 3IRXA 3KZBA 1MBHA 2X35A 3ID8A 2LC2A 2EJGA 3M1EA 1U2VA 2G7UA 3VYTB 2V1NA 2P9LB 3BT9A 2RO0A 1LWCA 2KIQA 2YJEA 1N33K 5CQYA 4AVPA 5LMUK 2IS4A 2VODA 2LT4A 3KEOA 4Q4ZF 3IKVA 1YHQQ 2X1DA 2KIUA 2ZSHB 2DYRH 4C0DC 1NGAA 5FKMA 4IRHA 3NWSA 3SDBA 2UYTA 1WFWA 2HNZA 2CQXA 2JA7J 3J7YJ 2BZXA 3TSUA 2L9VA 2EHGA 4M75B 4BR4A 4FXDA 1R59O 2K9QA 1NYFA 5EG0A 2L3QA 1T56A 2JA6J 2AA4A 1TWHJ 2YNHA 4H5NA 3MO8A 3JCMX 1F9NA 4IXCA 4DTUA 2D0AA 2XRIA 1QHTA 4E9FA 1ZH5A 1K1ZA 1K76A 2OQGA 3CCLT 1VOMA 4OPKA 2OA8A 4IDHA 1WJDA 2VWJA 2UV1A 5GAOq 1K9MO 4CJ4A 1K78A 4HAMA 3CCMA 2ASMA 3M0TA 3VEXA 2MA3A 3I56T 2E71A 2HSEB 2HOSA 1PU7A 4E9HA 1ETYA 3AG1H 2QG9B 3P8HA 4N4OB 3G1JA 4BQQA 1NOYA 4C2MJ 1F5TA 4GKKK 3UNGC 3A5ZB 4IURA 3KHYA 3MFKA 1YIJN 2DRKA 1T98A 5D6XA 1NJZA 3ZX3A 2RJCA 3NH0A 2L3PA 5HNHA 3A02A 4IUTA 4BGBA 1YI2A 1LWEA 5IXBA 2P9PB 2JM8A 3TDUC 2LCCA 2DTIA 1BUPA 4EW0A 3FM3A 3LFUA 3I55A 3QERA 5GAGJ 1UCRA 4HQEA 3VJPA 3I5RA 4S0HB 5KI6A 1HSTA 3ZOBA 3CC4T 1L3TA 1Q82C 1BI0A 2F5CA 4E1NA 5GTIC 3OYYA 5EU7A 4M75D 4M3WA 4FOIA 4WX9A 3ZSXA 2VUBA 2EV6A 3CJBA 4BY6C 3CCET 3M9AA 4BRDA 4EMKA 3ENHA 4I2PA 1BGXT 3MN6A 2H6BA 4HDVA 4ZYGA 2HGCA 1GFCA 3KP4A 4CHPA 2VIXA 2IS6A 3VYUB 3T69A 4C8QE 3GF2A 2PAVA 3DB3A 3E6DA 4CF0A 2OCEA 3FXKA 4C8KA 1YQKA 4B48A 1MH3A 2M1BA 2P9NB 2ZJQF 3ERMA 1HF0A 4CIFA 2DL7A 2KQWA 5E18F 2VASA 2BE9B 1S7AA 3PX4A 3EAEA 3EGUA 2XDBA 2ID3A 2MLGA 1RUNA 3S32A 5J6XA 1DQUA 2EYXA 4NCGA 3V9XA 2Z1IA 2KIMA 4FETA 3QIIA 5M1OA 3VQCA 3O6WA 3O9TA 2NUTB 2YUPA 2NUBA 4CEZA 4G7OF 3TREA 2BGCA 1J5OA 3TCJA 3QPTA 4XTUA 3G4ST 2W82A 2FOWA 2KAFA 3M3YJ 2AHJB 4FPBA 1HQEA 2LQNA 4XNFA 5JLWA 5DM7R 2L9NA 4H4KC 3KK7A 3LPTA 2OZMA 2VQFK 4CF2A 2VKHA 2OPRA 1TQMA 5AZIA 3B6AA 3GFMA 5GAHJ 3PNWC 2KKOA 2EYZA 2MCNA 3O9SA 3LAMA 1GCQC 3SHFA 1WH5A 5BS6A 1YJNA 4A3EJ 2YHBA 2LH9A 1U0JA 4CESA 4F8RA 3K7AJ 3HL8A 1KG1A 2GWKA 1MUYA 2VUMJ 1ENHA 4IO9L 4RBOA 5D6WA 1FX7A 5K5RA 4KRFA 5LLQA 4CYDA 2Y1JA 1K9MR 4BY7J 2KDZA 4AF1A 4C8QG 2FRHA 1O3SA 1CLQA 4HUEA 4ELUA 1E6HA 1VQ8I 2PQ8A 2Y1IA 3WTUC 4A2UA 9ANTA 5AN4A 2AIRB 2FZKB 5C44J 4PL6A 1K8KA 4KIGA 2BY1A 5K7HA 2IS2A 4M78B 2EJ9A 2NVUB 5BN9A 1M27C 1YYVA 3FMQA 3V7CA 4PFOA 4HSRA 2CT3A 4ZYAA 1BL0A 4ZDLA 4L18B 4J01A 3EGXA 3F22A 4ELVA 3LWLA 5E1XA 1HNWK 2HHWA 2RQPA 3TP3A 1BC8C 4CGZA 2CP2A 3CTAA 1KQSM 5E3OA 3G3ZA 2P9KB 1K6OA 1HKQA 3VMFB 5F2RA 1QZ6A 3ZGKA 3K69A 4E9GA 4ILJA 1IDYA 3SUPA 3DQVC 2VC8A 5DM6F 3CCQI 1KLNA 1UHCA 1A0NB 3EUHA 4J2BA 5CVUA 3SI6A 1QVFM 3OQ5A 1PUEE 4L3QA 1ZUUA 4NXNK 1JBMA 5ILVA 1V4SA 2DE0X 2O61A 1RBUA 3C6TA 3H5AA 4M7DC 2QQAA 2NYXA 1C6VX 3CCUQ 2STWA 2EIKH 3DXMB 3W2WA 2O4XA 2QQRA 4EMHA 1WSFA 2RK1A 4RB0A 2V26A 2CS7A 4DQPA 2RKHA 1FNNA 1V4TA 2M4GA 4Y92A 3F72A 5JMVA 1U5TC 2MF2A 1K8AU 2YRCA 2DA3A 2O8EB 3MAJA 4C5GA 2V9KA 4M77C 4MNUA 1WOQA 3HJFA 1D09B 5M5YJ 3P9CA 1PG5B 3RESA 1LEBA 3EE8A 3O1WA 4E70A 5EX5A 3IKMA 1RT3A 5F1XA 2BE7D 4HF2A 4JP0A 1IH7A 1V76A 3Q0UA 4FJ7A 3WODF 1D0YA 4MQVA 5AQXA 4QVCA 1U8BA 3S1NJ 2FRWA 2IG0A 4QKUA 2YHWA 3MN2A 4UUTA 3MXMA 3GVAA 1EBMA 3NNQA 1GV2A 4CI0C 2YUQA 1NK2P 4C92A 3H41A 4L6V5 5J1YA 4BG9A 1OCPA 5KK1A 4F7UF 4HCBA 3PT9A 2ZXHA 3FKJA 5LJ3h 2KR3A 4CF8A 2QTDA 1ZAOA 4LLNA 2DU9A 1N8RU 4M3RA 4WFAL 1TLHB 3KVGA 2OTJT 3KNTA 1JEGA 4PJOB 3QOEA 2PTKA 1MBFA 2J7IA 4P9FA 4OP0A 1OLTA 2B0LA 4FVUA 1BW5A 2W4SA 1I6XA 4CXFA 1N8RR 2P5GA 1ITGA 4PJNA 3VQAA 2LSOA 2FA5A 1B9DA 2KFZA 2W00A 2VKEA 1GLDG 1QA6A 3EGDA 3JREA 1IXSB 3VERA 3RDIA 2E64A 3JXUA 4CGHA 3ZT4A 4AT1B 4DR4K 1UB9A 2QA4I 4H8KA 3VS3A 1WEGA 3CJNA 1T3VA 4B9VA 1R4MB 1Z3XA 3JRCA 1D8JA 3U4LA 3C3WA 4J5YA 4XTYA 3F8FA 1WLPB 3AVMA 4BWMA 5SWMA 1D3BA 1TKTA 3THKA 2HL3A 2JWKA 4AFQC 3HGYA 1DGWY 4ZTFA 4EMKB 4EVIA 1YJ9A 2BE2A 1EJ9A 4RB1A 1LWYA 2YHAA 2OBPA 1SD4A 3BZ6A 2QWPA 4EA5A 2OJ2A 3CQZJ 2VXFA 3GUDA 3I3LA 3CCSQ 1W0UA 1RKWA 2D5VA 2LG4A 1KVBA 4CHQA 2ZXJA 4YHHK 2A5WA 5FWBA 4ELZC 5CKBA 3GFJA 2CH4W 5HLGA 2BY0A 5F0HA 3VB2A 2XUBA 3IHUA 4YELA 2X6WA 1N6AA 1MV3A 5IYCJ 2QK9A 3DLLA 3BOQA 2WWYA 2ECCA 4R1HA 2AK5A 3PTAA 2MD0A 2ZJPL 3OYAA 5K5QA 4M72A 1NLOC 4DOWA 4LOCA 1J75A 1JJ6C 4NB4A 1VQMN 2UU9K 1J53A 4IEJA 1UAXA 4YOUA 3S17J 3S41A 1FKPA 4DV0K 4E7LA 3U6FA 3ABUA 3FZVA 3LZJA 2VGNA 4R0KA 1X9WA 4Y15A 2W7NA 1OV3A 4C8QA 1IBMK 2MFZA 1LVAA 3CERA 2E4HA 1Q9XA 1B8IA 2DEQA 1R58A 1W0TA 5GMKi 5KE2A 2ASPA 4RTVA 2XY6A 1LPQA 3VRZA 1G83A 3FMRA 4B21A 4A3BJ 1YITI 4G1QA 2HR3A 2VONA 2CT4A 4JI4K 3SV4A 2VJ5A 2O7OA 4BYYA 4KHUA 1NWKA 9ATCB 3IMXA 1USTA 5HCKA 3E19A 3S15J 3THWB 1EF4A 4AFUC 1FBQA 1B6AA 4DB3A 5L3FA 3C7NA 5TJJA 5GAEP 1P4XA 5ICEA 1FW6A 2K86A 3PNYA 4WWCA 1PUFB 4B9MA 3PNVA 3H36A 1VTNC 3OHRA 2HQRA 1I39A 4IG0A 3ME9A 5AQYA 1IG7A 2DMTA 3O6BB 3KPHA 5I3UA 3LSHA 5CVVA 4FQGA 2M30A 2PZ1A 3ISPA 1B8IB 1P92A 3EUAA 3WGIA 3BW1A 1YIJQ 5A2QK 4FE7A 1U06A 3CUOA 3SQ0A 5EGOA 3HT3A 4IUUA 4LFUA 1BR1A 4EMGA 1WJ5A 4X34A 5JS1A 2I5UA 2CH0A 5B3SH 2RHXA 2L2PA 4DTRA 4ZYDA 4GLKA 2ZGWA 3KP3A 1OZ2A 5EY4A 2Q2EB 2EQIA 4FL6A 2D0NA 1IO6A 3E3VA 3C0CA 4M42A 4P5OA 3M1CA 4Q5VA 3O5BA 1JGSA 3X25B 4G94A 5J4VA 5KCHA 1SQKA 4BR5A 2L89A 1AHDP 3WEEB 3H0DA 3N5BB 4YPHA 1RCHA 2YU9J 3I54A 1MHNA 5AQVA 4KFBA 4QCLA 4B9LA 2COYA 4YTLA 3LSRA 2O8BA 2B7EA 3HBTA 2EK5A 2N8GA 1UG1A 3Q7CA 1SV5A 2BIVA 1Z6RA 5C0YA 1ZLKA 5CYMA 5D5WB 5EVZA 1VUBA 4Q48A 2G8HA 5HDNA 2DMNA 1UGVA 4KHNA 2F5FA 4FLXA 1OISA 2A5YB 3ECOA 4M9SA 5GMKh 2KGTA 3SMPA 4FLWA 1SD6A 2DOEA 2LYCA 3BDDA 1SKUB 1HX1A 4JAXA 5E1WA 1KK7A 4YORA 1BDGA 3SEZA 3JB9H 2IC3A 1OCRH 1MD0A 4PJ0C 5JFRA 5CAIA 1U5TA 5DD8A 4DFJA 2O88A 1NJYA 4F3OA 5GIPA 5A0GA 1CF7B 1S3XA 1YJWQ 1YITA 1X9MA 2JG6A 1KC8U 3MAQA 1XC9A 2V52B 3TP0A 2ZC2A 1E3PA 1S9EA 3OTOK 1X3WB 3A0IX 4HDUA 2WBMA 3VN5A 1X3NA 3CCYA 2R7OA 2VKDA 2G6FX 1NK4A 2XAFA 3OYIA 3RMDA 1PP8F 2DJZA 1JJ2M 2HFHA 2O6GE 4DV7K 1QTMA 2GF7A 1ON1A 5TKWA 2ABKA 3TAFA 4FO0A 2EJFA 1S5JA 5FKOA 4EPCA 2KBTA 1GOCA 4BHBA 4Q47A 2JPSA 1NJIC 2K9LA 2NYSA 1XG7A 1RAGB 2LT1A 4CCMA 1VQ8N 1OX9A 3DU6A 2VGMA 4EM2A 1YJWA 3ZQFA 2CREA 5D8LB 3NGIA 2FXUA 4QPOA 3E6CC 5D7UA 4MMLA 4AG1C 3GLLA 1N34K 4JKCA 1WI3A 2X9DA 3PO2J 2I5JA 1LE8A 1TG0A 1JTYA 3AT1B 3BWGA 4W97A 1KZHA 4AIHA 3FFIA 2EFNA 3OYCA 4PLIA 4IFYA 3HKZA 1TU0B 2ED1A 3CCJA 3FFKB 1MJAA 2H3EB 2CW7A 3ZMVA 3PIOF 1EETA 4BACA 4IOAL 4OPHA 3CCMI 1BU1A 4RAFA 2XY5A 2Y2ZA 4DFMA 3OW2A 3JV3A 1UFFA 2VXDA 2KFDA 2LDUA 3L42A 2DTUA 1Q81U 4DUYK 1VQ9Q 1MJBA 5E1ZB 2K5IA 1LVKA 3KFVA 1AHJB 3DOLA 3OV8A 1QSYA 1SL2A 2JWTA 1YHQI 3HOVJ 1MSEC 2DJQA 1T0FA 1LFUP 2DLLA 1E3OC 3DRSA 5F0CA 2ITGA 5E41A 3H45C 2LK2A 2LMDA 1Q86R 2H3JA 2R7VA 3AY9A 4K41A 4OMFB 3NE6A 4LB6B 5BREA 1D8YA 4DW6A 3VUBA 4B3XA 3ITHA 3LQRA 1E3MA 4KICA 2OTJQ 4WF9L 2YT6A 1GCPA 4AHRA 1JJ8C 3PMIA 1WBDA 1FMVA 3CC2A 2VBWA 1U9NA 4MEYF 2JTFA 3QNOA 5HDGA 2XGDA 4WCGA 1VQ4Q 4D7MA 5M1FA 4E2FB 1XQHA 3KLNA 3H35A 4M7DF 1IGUA 1JKHA 3E9FA 3K4CA 1SEUA 2KDOA 5LGTA 1MMAA 2RB6A 3CPWS 2QTXA 4ELYC 1DLOA 1YX5A 4CBWA 6AT1B 1LCUA 3LX7A 4F2RA 4JI5K 4BXXJ 2NOFA 1GLBG 3D2FA 5KN9A 4H03B 1EO1A 4BC5A 1AKHB 3DMJA 4PL8A 3EFSA 2QDLA 1NGDA 3C2GA 4DS5A 1Y8QB 1EFNA 1BIAA 2D6FA 4HSTA 5IAYA 2DTRA 3JCMe 1VA7A 3CWSA 1VHXA 2WTUA 4CK1A 2K40A 5DUIA 1FIPA 3DLLL 4QVDA 4WYBA 3OA6A 5HP1A 3DTKA 4F7UB 5IXFA 2OPPA 3H6EA 1ZBXA 2YV0X 3NCIA 4XH4A 2O4IA 1QZEA 4N76A 4DNCA 5J8CA 3RR8A 4LK1F 3I56A 2WAQN 4BNCA 1GRIA 3CWAA 1MDUB 2RC4A 4QTRA 2DA7A 1QWFA 4YEJA 2D1KA 4AHCA 3SDGA 4A0XA 1VFCA 5AFUA 1TBXA 1R7JA 4U0YA 3QBYA 4NHJA 1WX6A 5GAN3 3D1NI 4CEBA 2XB0X 4IOCF 3V9WA 4CJPA 1IUFA 3RWUA 4CRIA 1TUUA 5GANj 2HHTA 2H1KA 1DPRA 4HRIA 3ELKA 3TOAA 2Z1DA 4IQJA 2R7QA 4B3RK 2QA4N 2X6NA 1KQJA 5CKHA 1Q1HA 1ZBIA 1HW1A 4B9TA 3JCMW 3M8RA 4CZCA 4CJEA 4DBRA 4I09A 2QEXN 2G8WA 2WB1A 1VQ9T 5AFUH 1UHMA 1JU5C 1R4NB 1BO5O 4EP4A 3I0TA 5F0XA 4CFCA 3KTQA 2A5XA 2XKPA 1PU6A 1A31A 4CC2A 1MNMC 1HUXA 3MX2A 3SJMA 4UV9A 1JLQA 4A63B 1XPXA 1QP2A 4G9ZA 1WJAA 5BR8K 5FLMJ 2O9VA 2DXBA 2RQUA 1SSHA 3WXKA 4KH1B 2E2OA 1ZG3A 2NOJB 1BISA 1CGPA 2BW3B 2DMUA 2UWMA 2EGEA 3PLAA 4G9YA 1MA9B 2LD5A 2K9GA 4JZ4A 2XD0A 2VVKA 3WTSC 4XH1A 3M4OJ 2GFAA 2COMA 2O8CB 4K42A 4MHGA 4KDPA 2P9IB 2RF2A 2LOOA 2RPIA 4D5CA 3V9ZA 4E7ZA 3VYGA 2LBFB 4R8HA 1W6XA 4QIWN 4ORZA 3EUHC 1KSWA 2L54A 1M3AA 4G6DA 2ROTA 3QPLA 1LKXA 2XIDA 1KQ0A 4B23A 2G3RA 4XLNF 1A6IA 4F7UE 3ZMSA 2TCTA 2R5MA 1IHVA 4HPQA 1VYTA 3PJRA 3PY8A 1R49A 4B43A 1WWXA 3LCNA 1VQLN 1ZXOA 3CCLN 4J6XA 4IO9F 5C24A 1HDPA 1SC7A 2AZSA 1FMKA 4CUGA 2HVIA 4CEFA 1YX3A 3D0SA 4XOPA 1KLMA 4BRAA 3BE3A 4EJUA 4PKCC 4BGDA 2DVJA 3FZKA 3BDLA 1K6YA 1ZBSA 1K9MU 5DLOA 3DEEA 4RGXA 1BB9A 5HS8A 1AD5A 1NNEA 3A1PA 1TWBA 5M1QA 3ZN1A 4LE9A 2IS3A 2L7KA 4BUPA 5FLXE 3RUXA 3JCMd 4FWMA 2W41A 2ZFWA 2GBQA 2DK5A 2HHVA 1ODDA 2AO9A 4MLOA 1XTDA 3J81K 1S3JA 2HHUA 3OH9A 1WB9A 4FLUA 3FXOA 1LUJB 1MNEA 1XQSC 4DLGA 2ZJQL 4EHUA 4N0AA 1BBYA 3HTRA 3NGZA 5GAOr 3LSGA 3L2QA 2OCCH 1GOAA 4AFZC 3A5MC 1C0GA 2IEKA 1BBZA 3SD4A 2OYQA 2K85A 1XWLA 2YS9A 2K7AA 2QQ9A 2DVEA 3V4IA 5KYYB 3AG2H 1SFOJ 3DOKA 1MGQA 3CCEN 1DPUA 1VQON 1KD1U 1C6VA 4LDYA 2E1HA 2KZZA 2VG5A 1D9FA 3PIPL 3AKZA 1CZ9A 1XHXA 4IDKA 3SUOA 4FX0A 1JB0E 1P59A 3WT0A 4CJTA 1VQ4T 1H3ZA 4Q5SF 3CZ6A 3K0LA 4CCHA 4K8ZA 3ALYA 1YOVB 5I2SA 5DPKA 4KTWA 3ABMH 5BPDA 3N0UA 1VQPN 4HX8A 4RTUA 1MKMA 2XSDC 4JKBA 4N0BA 2F5TX 2OAUA 4C2UA 3QEIA 1Q81O 2FBHA 4M7AE 1NHAA 1BM9A 1WHKA 2ZPGB 1L3LA 1M2OA 2PI0A 1VSJA 4M6YA 3K2AA 4J83A 2ZD1A 1BKBA 2YHXA 1D1BA 1B34A 2DZ9A 1A5XA 4CH7A 2B8AA 2BZ8A 3S2WA 1IRXA 3CCEI 5HDKA 3T8TA 2DFHA 3J81O 3NGPA 2Y0SA 3WHCA 2A3SA 1SL0A 5C2DA 2RKIA 3HVRA 1J59A 4BH9A 2ZBKA 1F36A 2GWJA 4FISA 1Z91A 2XPUA 1R0CB 4L5EA 1WSJA 3G1LA 2FU4A 4GYIA 1T0HA 2WSEE 2JQ7A 3OSSC 4BHPA 1H92A 4PA1A 3DAWA 1MU2A 3HG9A 2P4RA 1X3ZB 1K61A 2F1LA 4AFSC 2KE9A 4JOMA 2W6KA 4FJLA 2JZYA 4C8OA 2XHCA 1HKGA 3TSZA 3BCBA 2DQLA 2XRNA 1QPMA 1K4TA 3PUFA 5BN8A 4VUBA 3EO3A 2X4XA 4DQSA 2XGEA 1OQKA 5IOZA 4R79A 4YOWA 1G8XA 3S6WA 4FJJA 2YKNA 2DQRA 1N5ZA 4BY1J 3ZR8X 3QYEA 2HF3A 2A41A 3L2CA 3WGGA 3O8HA 1B92A 1QQMA 2MK5A 3PO4A 3DEWA 3I4MJ 1XQPA 2VWKA 3B02A 2CGPA 3HSFA 3CDIA 4KHSA 1TC3C 4B3SK 3TOBA 1WHUA 1OU8A 2A1SA 3R6NA 4I01A 5CK9A 1TT5B 4B44A 2V51B 2AKLA 3HXMA 4DG1A 2BGGA 1ETKA 5IY5H 3CC2N 1JT6A 3PV8A 2O0YA 1ERDA 1FEXA 5CCAA 4DTPA 4CK2A 3O3GA 1KU9A 3OB9A 2CGLA 1L3UA 3QFPA 4U88A 2OD5A 3OYJA 2KHMA 3GTKJ 4JLGA 2FZGB 3ZQQA 2KRCA 4XTZA 1VQKI 1VQOT 2ZQBA 2NNNA 2V8JA 1YLFA 3U1DA 4OGCA 3QJYA 3RBBB 2O9LA 3H0IA 3BCAA 3PM1A 2XROA 2O2OA 4BI8B 2O4GA 1W2BP 2EWSA 3FE1A 3ZT3A 1WJEA 3GNGA 4UVAA 4J2EA 4AH9A 4WQ4C 4FWKA 2LTPA 3MEEA 5K7FA 3A2KA 2YSQA 1UGQB 3QOPA 3RMAA 1Z7LA 1NJIU 2YXYA 1P4AA 1ESVA 2QYZA 2M8EA 2H56A 5J4YA 1ZUYA 2XF7A 4I7FA 2YUOA 1NBEB 4F92B 4W5OA 1GLEG 3R2XC 4HT9A 2EQRA 4NC7A 4DUZK 1SSFA 4DSKA 1NGEA 3A8LB 1IN6A 3RPUD 2M7AA 3QU6A 3QICA 1RT4A 3F6OA 1NJIR 1TYQA 4AUXA 3RDVA 2M34A 5ADXA 4G6QA 3M53A 4NNJA 3O08A 3CCMN 1CF7A 2R5ZB 1WLJA 4DQQA 1FYNA 2YNIA 3TO9A 2DKGA 2E5ZA 3EZWA 1QVFA 2KMUA 2VKNA 4OIRF 4RA2A 4RM3A 2NS0A 5L23A 2QAZA 3LAKA 4A3CJ 4QQDA 3F73A 5FPMA 4XONA 3VU3C 4B22A 1YIJA 3WVEB 1T33A 3DWLE 3CCQA 1R0BG 4F04B 3OWTA 1VK0A 5DS9A 2QEXA 3GTJJ 1HW2A 4LGWA 1U3OA 5CKTA 5CIUA 1SZ2A 4CGFA 3CQ8A 2V79A 3UKRA 2E1ZA 1OU9A 4KAZA 1W7PD 3KLGA 1BOBA 5GAN2 4E89A 5A0DA 3FBNB 4JRPA 2KQ2A 2F5KA 3U9GA 4KH6A 5GANd 3RR7A 4K11A 1WI7A 3FIFA 1U04A 3J7AP 4C8QB 2VLAA 2J6KA 2FNAA 4Y0WA 2KZVA 1UHFA 5HL7L 2NS8A 5AQWA 3EN9A 2OQRA 4BBRJ 2H8HA 3TSPA 5KAIC 4WXHA 1LE8B 3MZ8A 2CDTA 4LFCK 2JLEA 4PNOA 1I5ZA 3GEZA 4KHWA 4NOYA 2IVWA 2E10A 5IT3A 3CCSI 4LITA 4FOEA 3CMEQ 4BJTA 3PVLA 1TK8A 1WGXA 3JRZA 4O4GA 4ENMA 4NCAA 4XLEA 3TO7A 5JVGF 3O9UA 2B9SA 1I3QJ 5B1AH 4XRFA 4JI2K 5C2FA 4M74A 4P55A 2JT4A 3RQIA 3HI0A 1ZARA 1TAUA 4FT4A 2RN7A 4Y1CA 2RI2A 2ZJPF 1R1TA 3SJHA 4FJHA 2E1YA 3KP7A 5KAFC 4RTWA 4OB0B 3MN7A 1K7AA 4JI7K 4BEHA 1FP1D 2R5AA 2YHTA 4DR3K 2O3FA 2A42A 3C94A 4QWQA 3PE0A 3LP1A 3JW4A 2D2WA 2ZJ2A 4U0VA 2VQHA 3T8RA 4PZJA 1APLC 4EVVA 1X2NA 1RDWX 3LDNA 4MFBA 4HLXA 5DCMB 1LNXA 1XCVA 3CMYA 3K4NA 4JJBA 3CJRB 2H6CA 2HVRA 1QVPA 1WHGA 3BR1A 4IUPA 2BH1A 4N0AC 3SDZA 2L7ZA 2JM9A 1FYKA 4JJCA 1JI8A 1P7MA 3GOIA 3L2UA 1M8VA 1BJAA 3HSEA 3EKSA 2PG4A 1H0MA 1OPKA 2HD0A 1K4US 3AO4A 4YDUC 5M1KA 4FM0A 3G71A 5KYUA 2E5LK 1RT6A 1YQRA 1TNSA 3OW2S 4Y7NJ 7AT1B 4M7AC 2R3SA 2D0PA 1I27A 1DP7P 1N8RC 2ZE2A 5AQTA 4GKJK 3HPWA 5JVHL 3T5XA 4LDUA 1U45A 3X28B 3K5LA 4M77G 1DGKN 4K0KK 3PFYA 4YRVA 3QQAA 4RLQA 1RUOA 2XIGA 1XG1A 1X3MA 5GAHP 3RKXA 3PIPF 4M6VA 4DBFA 4X62K 3VGKA 3CCSN 4B09A 1OOTA 3O3HA 2HU9A 4B9QA 3CG7A 4QS9A 2HW3A 5EEHA 1HR0K 4LJZF 2LKXA 2IGOA 3N4QA 3E2UA 2RHIA 2ELKA 3KEQA 1K73O 1YVNA 5J2MA 1LCKA 3BQZA 3MCZA 3WXIA 1VIFA 3NF7A 3CFPA 1SVLA 4DA4A 1HOMA 4XH5A 3C6AA 2LZ6B 4R5PA 2HNHA 3NARA 2J4RA 2QWNA 2NAZA 2G8FA 2BOLA 4DFPA 2GTJA 4IJNA 1AEYA 2KJCA 1YITT 3BR6A 1LAWA 4DS4A 5IN1A 4AG2C 2P0KA 2I7PA 2M5WA 1U2VB 1PP7U 1Y7XA 2HNIA 1KRPA 3J80O 2VOPA 1RDBA 3HUGA 4BROA 2ID6A 5LJWA 1O9SA 2XI9A 2DA1A 2HNDA 3C2BA 2Q2EA 2QTVA 3L00A 2EX3A 4OIPF 2BHZA 3D0PA 3IS9A 3WTXC 1HD3A 1K73R 1X1AA 3KFWX 4OF1A 4QS7A 1R36A 1EV7A 5IT9O 2Y0SN 1VQLQ 3LM2A 3JSOA 4C92E 4U87A 3WEEA 1HLUA 3HSRA 3ZRGA 1KU7A 4L0YB 4CF9A 2IPQX 1YJNT 4KH5A 2HKQB 4F9OA 4M45A 2FNPA 4BXUA 4EMKC 4B9WA 4XTXA 3VV0A 4XU3A 5FWCA 3HHGA 1O3TA 1X4OA 3NFCA 3JAME 5E17F 2NVXJ 2FEZA 1MBKA 4IHYA 4N4GA 4KB0A 5J3LA 1R0AA 4DV3K 3GBGA 2LKPA 5FROA 1FOXA 4MZPA 3F70A 4P96A 1VQNN 1WHLA 2A0FB 2MABA 5HLIA 5D6FA 1M1KC 2DT5A 4M73A 2GXAA 2D0OA 2JJ9A 2KXCA 5CY4A 4FWLA 4A57A 1S72Q 3E66A 5JLXA 3PX0A 3DCFA 3MD2A 1LFPA 1TTHB 2HMAA 4KITB 3VRYA 2KPMA 4OIQF 4LFBK 1N77A 1W7PA 4KT0E 2ZB9A 2H09A 2D0QB 5IP9J 3A5NC 3T1BA 2LF8A 5LGNA 4DZJA 3K1MA 2CUZA 3MKWB 4OX9K 2A61A 1HPMA 1MNDA 4GDFA 1EX4A 2CQKA 3MK6A 3FZLA 3V7RA 4KT5C 1KQSP 2P5VA 2V1QA 1M1GA 1IZ6A 1BU6O 2V4JC 5SZTA 1M1KU 1FOYA 2DPUA 1NK7A 3CPWM 2V7FA 3A03A 4E7JA 3M0SA 3V42A 2W48A 3DEUA 3R6MA 3A8OB 2YKMA 1S72I 3INZA 4IRGA 4GMJB 5C4JJ 4YDUA 4DTJA 3VODA 2P1JA 3MX5A 2UUBK 1NMDA 4YOQA 3K9KA 2PYJA 1UA0A 1TTYA 2Q1NA 2GTDA 2HTJA 1TKXA 1OPLA 3OMYA 1VQ5I 1DKGD 3U23A 4BRMA 1DEJA 2E2JJ 1XHZA 1YCSB 3LW5E 2XASA 3AHUA 2RI3A 3ZX0A 2R7TA 4C0GA 4FLYA 3ZQIA 2RJDA 2FQ3A 3P7NA 1VNDA 5FJ8J 4BR0A 3BJAA 2RJEA 2W0ZA 4M7XA 2KTQA 1YITN 3LSTA 1W9HA 1BR2A 3Q0VA 2VBZA 4IXAA 2Z1HA 2V1RA 3QEPA 2L7FP 2CZ1B 2BKDN 2FXAA 2DF6A 4H0OA 1RRJA 4IOCL 2KXDA 2K9MA 1ATRA 4IFEA 1I5OB 2B4JA 2EA2A 5B5EC 4LB5A 3OMGA 1X69A 3GIBA 2KLOA 1ZR4A 3CJ9A 4LD6A 2RPNA 1UECA 4DQ8A 3D2FB 2CP0A 1O7FA 3OIPA 1YHQT 3I71A 1RBTA 1G6NA 4LUEA 1YJNN 4JI8K 3S93A 1OVQA 1NGNA 1RL2A 2W42A 3VW4A 3RKWA 2CRGA 2NS7A 3ZT1A 2ZF5O 1FLIA 5C25A 4A3DJ 3KP5A 1X2MA 1PNJA 3FEOA 4J9GA 2HCKA 1X1DA 5TISC 3CCMT 2BDPA 4XRSA 4KUDK 4B8CA 1RDAA 1U9OA 1O3QA 4RG2A 3C18A 1IAWA 1N36K 3D45A 3Q1JA 2DA9A 3Q9VA 2L3RA 1MMDA 3SWNA 4NQWB 3G4SQ 3G25A 2L01A 5LJ5h 1HJRA 3LGLA 1U5SA 4TVRA 2YSRA 2DY4A 3L4IA 2FB7A 4LMYA 3KETA 4PKHA 1TQPA 3RZOJ 4JJDA 4UNFA 1VRLA 4WQ5A 1IN8A 3JSPA 4CEOA 4JRQA 2WV1A 5B66C 1VQ9A 4ITVA 2HXOA 4KISA 5C15A 2KROA 4RW9A 1LV5A 5BPLA 3I0WA 1W7AA 3L1AA 3SB2A 2L9SA 5C12A 2OPTA 1XSXA 3QINA 5KPTA 3MN9A 5KRSA 4KBMB 1QVFS 3W3DA 3A8YA 2HHHK 1VQOI 1VQKT 3HM9A 5JVGL 3CC4A 3K9TA 3VESA 2P9PA 2F8TA 4G7ZF 4Y17A 4FM1A 3CCQN 2EAYA 2JS2A 1VQ5A 1JRIA 3TSWA 3VETA 3VTIA 1KFDA 3HP6A 4LD5A 4HVWA 3I0RA 2FF3B 3EKUA 2ITMA 4FSVA 4RB2C 1JKOC 4OB3B 5CQGA 1U3EM 2P9UA 3J8AA 2DL3A 1LW2A 4G7HF 1WAJA 1QZ5A 2MC3A 3HFOA 4IQ4A 3KLFA 3PSIA 2XPVA 1R1UA 2VJIA 3RQ4A 5CO7A 1VAZA 2PLYA 2ZPEB 2R4GA 5HRRA 1MMNA 3EG9A 2EINH 2XY8A 5HRNA 4Q5WA 4BRPA 2GBYA 4FJGA 4FK2A 2EV0A 1GDTA 3KK3A 2YLCA 4EHTA 1OYXA 4CEQA 5DM7L 1FT9A 5AQRA 2DPDA 3LSPA 1VSLA 4C5IA 4HUGA 1RDUA 2LQ8A 3CJQB 4E1MA 4JN4A 3WVDB 4PJOD 3HOSA 3FM5A 2E8AA 2P81A 4MFDA 3M0PA 3LDPA 4A6DA 1YI2N 2W03A 5CZ1A 2VQEK 4ESJA 2F7TA 2OFIA 2CFXA 4JI3K 4LG0A 1MSFC 2JK3A 4ESFA 3TU5A 5GANf 4M7DA 1OR7A 2UUCK 3VTHA 3ZMTA 2CP6A 3VF6A 3X24B 5KYWA 2YNGA 4DR5K 4II3A 1WSIA 1H89C 4A2BA 2LVSA 4WFBL 4BY6B 1IRFA 5JI6A 4M3FA 4A69C 2RNJA 3F6VA 3B6PA 3L3UA 4IHWA 2VPRA 1UAAA 1PU8A 2FUG2 1I1GA 3ZSZA 1HNVA 1S1TA 3CFOA 4BREA 1T05A 2QM3A 4KGZB 4AHVA 4XK8E 3VWBA 3TAQA 3QYBA 3JRGA 4MIMA 2DOFA 2JPCA 1V4RA 2HWVA 1Q18A 1KC8C 2R7RA 4NLBA 2HQHA 3CCVI 5C10A 3TTCA 1DT9A 1VQ4I 2EH3A 2I10A 2MH9A 1OH8A 1VYUA 4N4NB 1SVMA 2E36A 2GOXB 4BRHA 1PKSA 1S7EA 5EZHA 3BG7A 4A2AA 3DLEA 2YNFA 2Q0RA 4AU7A 3LA3A 4CFDA 2KZMA 4YIIA 2VXZA 1Z0XA 1WAFA 3H5RA 5GPAA 4OB1B 4YPRA 3HYFA 5J1RA 3BR2A 4NYNA 1HKSA 3UIQA 1YIOA 2MI6A 2HDWA 5KYXB 4MMKA 2OZUA 2FYKA 4IZ9A 5GAN7 3LA7A 1H8KA 2EIMH 4JNEA 4GVMA 5D4SA 1Y56A 2LX9A 5KQDA 4ATOA 5LFAA 2XHBA 1FSHA 2Z3YA 3K70C 1B7TA 4LIUA 3M56A 1POGA 2VJJA 1E4FT 2RHUA 4CHYA 1I4K1 4JK8A 1FWZA 2CUFA 2R7SA 4FX4A 4A3GJ 5GAMe 3H9QA 3P8BB 3NF9A 3P1GA 3ER0A 1HNZK 2HKOA 3M8EA 3RCOA 3AVHA 1C0WA 3E6BA 1OPCA 4E1JA 2XGXA 3D2EB 2YDLA 3LAPA 4OLBA 2HSPA 4M3EA 1Y0MA 3QP5A 5DMRA 5KGWA 3VQBA 3TGNA 5ED4A 3F10A 2I0NA 4KH4A 3ECHA 2Z33A 4IHSA 3QESA 4FJXA 3I53A 4I2QA 3P31A 1QP3A 1AWWA 5JICA 4NCBA 3VGMA 1MV0B 3HUGB 2ASOA 1WXBA 3KUFA 2E6NA 1FBSA 4BDPA 2HYJA 3CWTA 2CO5A 4L5GA 3LM9A 1TL1A 1OH6A 3J7AO 3CFRA 4FYVB 4M77A 3RKYA 2PZSA 2DDAA 2ZPIB 4B9SA 2EFPA 1FKOA 3HZ6A 1OYIA 1DTTA 2V9PA 1WKMA 3M8JA 2FG0A 3J7ZO 4AI5A 2LP0A 4IIMA 5KHDA 4CJFA 4GBQA 3IFRA 3FWEA 2HBKA 3MP1A 4F7ZA 3AVGA 1QLYA 4O8UA 1JO8A 3ISNC 3P5JA 4RWTA 2M87A 1VQ7A 4CGIA 1RI0A 2JUCA 4Z4FA 3V8KA 3BTJA 4IOAF 2J06A 3L0QA 1HBXG 1MH4A 3E9PA 4XORA 2C6YA 5FLXO 4H4MA 3MMVA 3HSCA 2DYIA 3L9FA 1VQ9I 3ABKH 3UATA 3HHTB 2ZGYA 3BQYA 2Q2RA 1T03A 2CQ7A 2IW5A 4V19K 2FHDA 1FXXA 3FSPA 3NQOA 4Y52J 3ZXSA 5HY6A 3CJ1A 3WTZA 2C06A 4JEPA 3G71Q 2X74A 1VI0A 2FJ1A 3FIWA 1JLBA 2HVQA 3CQYA 5BR9A 3H6ZA 4B3AA 1YW9A 4FJ9A 1LQ1A 2XMFA 1RAIB 2DN0A 4G8XA 1XMAA 3S1RJ 3LSJA 4B1ZA 2WTEA 2QVOA 3EG3A 1L0OC 3W0LA 4HT8A 3G1OA 2HMIA 4M78D 1RTDA 3RMSA 1BI4B 4Y1DA 2WSFE 3OYNA 2PJRA 1WQ2A 3AVFA 4CEAA 2FL7A 4JPBW 2CMPA 3IV5A 2QA4T 2R92J 4XM3A 1HNXK 2YUSA 4CJVA 3ZQGA 5AZJA 3EY1A 3GW2A 4A5NA 1VQ9N 5LEKA 2LX7A 3VSKA 2RF0A 4IZZA 2W04A 1V5FA 4WCEL 4YIFA 3KP6A 2M1HA 5K1YA 4PJLA 1TNTA 4D8DA 1QE1A 4RGSA 2KFNA 3P4IA 2HDAA 3THXB 4JKEA 1S6QA 1UMQA 4QSHA 2FC0A 1WFXA 2ZPHB 4G12A 3HSBA 4IEEA 2VG7A 2DODA 3BC8A 2R7FA 3BY5A 2EZLA 2NUZA 1TW2A 3V7SA 1ATSA 4ZNXA 5GMKe 3V6DA 3CCUN 1BA5A 1OR7C 5AQKA 3HL2A 5HS9A 2IXSA 1VQ5N 3IWZA 2ZJRF 3SQNA 3GBTA 4GRIA 1RGIA 2WAFA 3A1YA 3IUOA 5AQOA 3BG9A 4RCCA 1LWFA 5FU6B 1TL3A 3TKYA 5F04A 3G0QA 3QODA 2X78A 4TSXA 3L3VA 4I6ZA 3R8EA 3RVCA 1VSDA 3CIPA 4PJJA 1VQMI 2NOEA 5ILSA 2KK4A 2VYPA 3CXCM 3ESWB 1WPYA 2HI3A 3HRMA 3HTSB 1RBVA 1N3CA 2M9HA 2BUDA 4N9IA 2V1XA 3S6IA 1PJRA 2D1VA 2FQ4A 4IJAA 2EZKA 4KUMA 1MIJA 3T1HK 2NOIA 3BG6A 4JD2A 4A4HA 4J7IA 4CDGA 1QVFP 3CPWA 1BOAA 1YTAA 2OUMA 3VQDA 4FASD 1NGHA 3OYEA 4KHQA 2P6SA 2A07F 1G3WA 4B9UA 3IKTA 2R7WA 2FSKA 2W57A 4LF9K 1TL8A 3IRRA 3B6CA 1YJNI 4CJ5A 5HNFA 2V9VA 4KA4A 2KRSA 4BB7A 3A98A 4IHTA 3LQQA 1UG0A 2LVMA 3CCRN 4M78C 5CKEA 2EPDA 4JX5A 1S1XA 1RETA 1U48A 2V7ZA 4UUSB 2HOTA 3ZSRA 4B1UB 5AIQA 2KRFA 1RTJA 1KC8R 2ELJA 3KEYA 4D7NA 2OU2A 2DIQA 1R00A 3REBB 2COBA 1JJ2S 3AGRA 2EJRA 4CECA 1WXTA 1NGBA 4DU4A 3WXJA 2HSTA 3EL2A 3CD6I 1YW8A 4O55A 4JX6A 2CUJA 2VBXA 1LOJA 4B1RA 2XSJC 1YTYA 2HQAA 4FLTA 4CJUA 2DTHA 2Q1ZB 1IJJA 2X1CA 1IXDA 1KG3A 1Y8RB 2V6CA 4FT8A 3SZGA 4E7HA 1Q1VA 5LD2C 3VS7A 4DKWA 4PUSA 2DCEA 5BRFA 2NOGA 4M75C 4MDWA 1KQSS 3MZHA 4AWXB 1CKAA 2LF7A 4HVUA 2FBKA 5LJ3e 1QQCA 3K1PA 3ZQCA 3MZYA 3DLBA 1K73C 3CMAN 4CJLA 1JL2A 4HCZA 1IGNA 2LCSA 3JCMQ 3CEYA 1U49A 2XAHA 3QDRB 3VUZA 1BI2A 1W1WE 4JI6K 1WJFA 3DPLC 5FD5A 2ZFUA 1J9AA 5M3FJ 5C6SA 1ZBHA 3H0GJ 1LNWA 1Q86O 4DYRA 1JTXA 3VEPA 2DJIA 2YLBA 3K59A 2XB5A 3O8MA 3K2PA 3RERA 4NZGA 2ME6A 5KN8A 3K6GA 3VEYA 2K4BA 2O8XA 3G10A 5ICGA 3S2DJ 1W2BA 1WGSA 1RUWA 2YUNA 2F2VA 2OI3A 4WCIA 4PUOA 2E5NA 5EDNA 5AT1B 2R7YA 2Y31A 3GDQA 3RR6A 4UUVA 1KQ2A 4CC4B 2E2HJ 3HKSA 3H1VX 2MBFA 3KBGA 1W4SA 4M63C 4P5NA 4C92D 2QBYB 2KMTA 2JVGA 3UDCA 1ETVA 1LOTB 2LLKA 4JI0K 1F21A 3UKUA 5H6QA 1B9MA 3I5SA 3DRPA 5L3GA 1KIKA 1ZELA 4ZGJB 3M8PA 2GXBA 2UXNA 2GFUA 4I76A 2CKKA 1KQSA 1M90C 3QJ6A 4FJ5A 3NH1A 2KKZA 4AHSA 3DLMA 1XQOA 1B34B 4QQGA 2E34A 4C3IJ 2JTEA 3CUQB 4HV5A 1RIOH 5D5XB 3CF5F 3VS1A 3MWMA 1IHWA 3CCST 2STTA 1TH7A 1YRNB 4ZH4F 5LL6Z 2YCHA 4C92G 2EFIA 3K4KA 4EW4A 2JHNA 1RESA 3UA7A 5HK3A 4ILGB 1JJ2A 4X64K 3RSEA 2W84A 1KEAA 3O9RA 3QWLA 4L5IA 4QPQA 4Y91A 3CCLI 2E5QA 1O75A 2MWPA 4AM6A 1KO9A 4DOZA 2QEXQ 3OL4A 3F5TA 4RUGA 2QI2A 2QKMB 5FO5A 1TP4A 1MWMA 2WOMA 2BEOA 5KTQA 2E1MB 1UGSB 1FOWA 4AMCA 1SAZA 2WAEA 3U8XA 3QWXX 2CU7A 4EM0B 3CVTA 1ZG1A 3DXKB 5H6RA 4LK0F 4A54A 4M3TA 5F0FA 3GFIA 4A4FA 4OMLA 4CFBA 2OJED 4HVJA 4HNVA 2VOOA 3FDYA 2PMUA 1AOYA 1C1AA 4JKGA 5DLQE 1EA3A 4HVVA 5LBQA 3AO1A 1NK0A 3GTGJ 1MPGA 1GFDA 1D1CA 4PJOF 1YI2I 4CJKA 3LMMA 1R77A 2EV5A 2K6DA 1B9FA 5AQGA 1QPIA 1JHFA 1JXEA 5GAOl 4FZXC 2VN2A 2K4JA 3J7ZI 1BI4A 5LJ3d 4ZGDB 4NS5A 4FW1A 3TWHA 4TV7A 1ZBFA 1HDDC 3CP8A 2HOAA 1PRMC 1BHLA 4F55A 1MBGA 2EVRA 4IX7A 1HPZA 5FB2A 1MMGA 2DO7A 2AS5F 1VQNT 1X58A 4MO4A 1XMXA 1HQUA 1Q82R 3FGUA 1H88C 4KUIA 5HLFA 4Z02A 1U47A 1G3SA 2R5ZA 4M4ZA 2E41A 2NRZA 1KU3A 1RBSA 3OSVA 1VZ0A 2A6TA 3EFRA 4CSWA 1T38A 2NOBA 1HMVA 2RI5A 2X9HA 4M77F 1WJBA 3S3OA 1JE8A 2RQTA 3MPUB 1RBRA 3G6EI 4MTDA 4YFUA 1ZTRA 1YJWN 3ABLH 5AQZA 1MUNA 1A5WA 1UE9A 3R60A 1Q82U 3MEAA 1B9NA 4GY2B 1XGNA 3GTQJ 2DX1A 4DSFA 4FJIA 3KZYA 3DJCA 5EEGA 2B5JA 4B1YB 2HEOA 4HNUA 1RAHB 3VF2A 4DFKA 2PVDB 1IDZA 1KQ1A 3PIOA 5GAMg 1VQLI 5FDLA 1ZSGA 3T7ZA 4M3YA 3KXTA 3E1YA 1M30A 3WTWC 3J81Z 2E1CA 4XRSG 4QT7A 2E2NA 5CVJA 1ETWA 4Z94A 1E2XA 4RM2A 4MDBA 3SPZA 1BCMA 4FYWB 4XIUA 1RZ4A 1H641 3VS4A 3FZFA 3SZPA 2QQSA 1R6RA 3AG4H 2K3PA 4OWRB 4BEHB 2RHZA 4HEA2 2DOAA 2DLPA 2EBPA 1NMNA 1XI1A