3L2VA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with manganese and mk0518 (raltegravir)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
365
structure length
365
Chain Sequence
b'AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 97
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2vA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2vA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2vA03
3IG1A 2RI5A 1NJWA 1RTIA 2JGUA 4LSNA 1C1BA 1HQEA 3TABA 1KVAA 3RMCA 3OYKA 3DLMA 1LAVA 3SUPA 1X9SA 3MEUA 5CIUA 3JSMA 4PWDA 2YRVA 1VSDA 4HCCA 1HYSA 1XI1A 3O3GA 2M0OA 3ZT0A 3UT1A 5HRNA 3KK2A 4E1MA 2ZE2A 4I2PA 4L59A 1C1CA 5HP1A 3KTQA 3KKRA 4C8LA 2K3YA 4CK1A 2YNHA 2XDPA 2QXFA 2HQXA 1TKDA 4N47A 3KUFA 4CJQA 3NGIA 3RRGA 1N5YA 1EP4A 2KZZA 2FBVA 1JLQA 2IGIA 1RNHA 4DS4A 1ZYQA 1NK4A 4FJKA 4B9WA 5JS2A 4FLYA 4DF8A 4PY5A 4DU4A 1SUQA 2RJDA 3LP3A 2R57A 3LWLA 4QQGA 2HW3A 4X34A 4FM1A 4M3UA 4DTJA 4DU3A 5FRNA 4L8RB 3DMJA 2X4WA 3KD5E 2PY5A 4DTXA 1ASVA 4C5IA 3BDLA 2B8AA 3U6FA 2HVIA 2CKKA 1T7PA 4CGIA 3H8ZA 2WOMA 4DSKA 3OS0A 3VQ7A 1L3SA 4M3XA 3LH0A 5J2MA 3F70A 3QNNA 2RJCA 4TSXA 1D9DA 2ETJA 3DLHA 4BDPA 1T03A 4N76A 1LAWA 5KGWA 1KLNA 5J2QA 1JKHA 4W5NA 1N27A 1NK7A 1TK5A 3LALA 3FFIA 4NS5A 1J9AA 4IG3A 3DRSA 1RTHA 3DB4A 3OYAA 4CHYA 1VSFA 1NK9A 2HHTA 2G8FA 3OYHA 1BQMA 3QJ6A 1NK0A 3M9QA 4C8OA 5CZ2A 3T3FA 3QIIA 3V9XA 1XHZA 4E19A 4DFPA 4FLXA 5KGXA 1ZBLA 3SQ0A 4AHSA 1SL1A 2EQMA 4DSLA 4CJRA 4A4FA 3AO5A 3MEAA 4FJ7A 1T8EA 3A2FA 3LZJA 2X78A 2X4XA 5KRSA 4JS5A 3SI6A 1BISA 3E9GA 3EY1A 3LP0A 1VSJA 5HBMA 1G15A 5D6WA 1C1AA 2IS3A 4N4GA 3K2PA 4AH9A 1TV6A 4CHPA 4B9NA 4HCBA 5J2PA 2XY8A 3OS1A 2ATQA 1KVCA 3MO8A 4Y1CA 1NOYA 4PLIA 4FLWA 3C95A 4CJEA 3I8DA 3OJSA 4RG2A 1J5OA 2B6AA 4CEAA 4O0JA 3CQ8A 1WAFA 4GY5A 2RHXA 3K5LA 4ZTJA 4LD0A 3SPZA 2QKKA 1KVBA 3U3GA 3FLGA 1WSFA 4OKJA 3KJVA 3EZ5A 3ULDA 2XK0A 1SV5A 4I7FA 5KRTA 4CGHA 2VYTA 4NYNA 3PMIA 1BHLA 3S9HA 3LP2A 3HYFA 4II1A 1J54A 1HQUA 4CJPA 1QSYA 4GVMA 2RHIA 2K3XA 5K14A 5HRRA 3VA0A 1VSLA 3BGRA 3ZSOA 4FJNA 3RRHA 1NKBA 2EHGA 3TAFA 1XNIA 3VQDA 2G8UA 2D0BA 3V6DA 5HRSA 3OA6A 4NCGA 2RI3A 4C5EA 2FC0A 4RW9A 1XHXA 1D8YA 3AVBA 1RTJA 3AO4A 1IO2A 4CJLA 3HO1A 4ELUA 4DTMA 5M9OA 3NHGA 1U48A 1IH7A 2P0KA 2XY6A 3QIPA 3LAMA 4N4HA 3KLIA 4FJHA 3ALYA 3QO9A 4FJIA 1X9WA 4B9UA 4YFUA 4E3SA 1QSSA 1ZBUA 1B92A 4BACA 3QEXA 2QQSA 3DLGA 1SKWA 1EETA 3C6UA 3WNFA 2PYJA 4KHUA 2OPRA 4JS4A 1BIZA 1RT7A 5FDLA 4OKEA 3NTKA 1WGSA 3QEWA 1WSHA 4A4GA 2GBZA 4JRPA 2XHBA 1KFSA 4J2BA 3AA4A 2XO7A 3I0SA 3HJFA 2EQKA 4DFJA 5KTQA 5HRPA 5SWMA 2LDMA 2DFHA 4FCYA 3L3UA 1JLCA 1N6QA 1UA1A 5I42A 4FYDA 4DWIA 5FROA 1KLMA 2Y1JA 2FBYA 2YKNA 3LGLA 3L2RA 1ITGA 3ISNC 2OA8A 1XWLA 1L3TA 1C0MA 3IRXA 3NF6A 3U3YA 2DY4A 4CGDA 1YTUA 4FU6A 1FKPA 1TKTA 4DMNA 1JLBA 4QW2A 2JLEA 2B4JA 1WAJA 3AVKA 3O4NA 1S6PA 4Z4FA 3VQQA 2YNGA 4UQGA 5D6XA 5C42A 4MFBA 2M1HA 3OY9A 3MXJA 3TWHA 1WNSA 4C8KA 4F3TA 4LH4A 4CJKA 1X9MA 4B9VA 5IN1A 4F2SA 1BQNA 4DFKA 1ASUA 4IG0A 2VG7A 4DSJA 1NJZA 3KKSA 1RDBA 5D3GA 3HPOA 1BCOA 3OYCA 2QKBA 4NCBA 3QKJA 3ZSQA 1NJXA 2RPIA 2ZQBA 1RCHA 4Y1DA 4FW2A 1OZ3A 1NK6A 5CYMA 1LV5A 3SD4A 3S6WA 4NCAA 2GV9A 1MHNA 4CJTA 3NE6A 2OPPA 4KFBA 4CEBA 4B8AB 1NK5A 3VQPA 4YNQA 3B6PA 1TVRA 1HMVA 2BE2A 3OMGA 3ZSYA 2PQWA 3ME9A 4KTZA 2KZMA 1I39A 1QS4A 5HROA 2RHYA 3QINA 4CEOA 3AVNA 4OGEA 4IUQA 2QQRA 4FVMA 4E89A 4HUGA 2P5OA 4C5GA 4CJVA 4KI4A 3MP6A 3H08A 3META 1RT3A 3AO1A 4OLAA 1Z26A 4CF2A 2IC3A 3OYGA 2B5JA 5DMRA 3RTVA 1LWCA 2X35A 2F96A 4IBNA 4DTOA 1TK8A 2HHXA 3QBYA 1QTMA 4FL6A 1A5XA 2OZMA 2P51A 3RMBA 1SKSA 4DF4A 2QK9A 5KE3A 4FJXA 4A4EA 4BD3A 2HNDA 3TANA 3VQEA 3JYTA 1K6YA 5EU7A 1D5AA 5FRMA 1HRHA 3TAPA 3LPTA 3AA5X 1Y97A 3MP8A 4DS5A 4B9TA 4IUVA 2XY5A 2YKMA 2Z1IA 3HM9A 4DU1A 1TAQA 2IOCA 4IUUA 3S3OA 3QEIA 3QNOA 3F73A 3TAGA 1KRPA 3OYBA 3S3MA 3E01A 4DLEA 1ZBIA 1VSKA 3KK3A 1RTDA 1LW0A 1UAXA 4ID5A 3O4QA 2A1SA 4FK2A 1RDDA 4I9QA 4HUFA 3CM5A 2G8WA 1RDCA 3DRRA 3NH1A 3D0PA 3MAQA 3PX0A 4HHTA 3VA3A 3MXMA 3ZT1A 4BDYA 3AA3A 3AVIA 2HHVA 4H8KA 4CJ5A 4LY7A 1VRUA 4C8MA 4EP4A 3V1QA 4RW8A 2FBXA 4N56A 4CGGA 2F8TA 2RKIA 1IKWA 4EP5A 3SQ1A 3MEDA 3OS2A 4CERA 4J2DA 3K5OA 4CJFA 2R5MA 4PL6A 3QETA 4B8CA 4K8ZA 1NJYA 4DSIA 4DTUA 2PYLA 1R0AA 4BE1A 4I9LA 4WE1A 3VQ4A 1FK9A 3DLRA 5IAYA 3HPGA 3L3VA 2OZSA 3MEEA 4F4KA 1XC9A 3PUFA 3O3FA 3OVNA 4XIUA 4AILC 1G5VA 3AO2A 3ITHA 1YT3A 5KCHA 1S9GA 4DQPA 4J2EA 3LAKA 3TAQA 1B9FA 4CHQA 1CXQA 4FLTA 4MQ3A 1H3ZA 1S5JA 2X6SA 1BL3A 3UIQA 3AA2A 3M8QA 2GUIA 1TL3A 4BWJA 3NH0A 2EQJA 2FHDA 2GFUA 1C0TA 3ZT4A 3NTIA 5J39A 2X6NA 4HTUA 3OYIA 4M3TA 1RDAA 4KRFA 3AVGA 3HP9A 3ZT3A 2I5JA 4ELTA 3K58A 1CZ9A 5C25A 4CJUA 3L2WA 3RR8A 2RHUA 2BKDN 4CESA 3V9ZA 3P5JA 2GF7A 3OYEA 1IKYA 2HHWA 2BUDA 1KFDA 3Q1JA 3VQ8A 3V81A 4CHOA 3DLEA 2HHSA 4FLUA 3NCIA 3MXIA 4CGJA 3L8BA 2E6LA 1DLOA 4M3YA 1VSIA 2Y1IA 3PX6A 4KHWA 1RBUA 3AV9A 4AHUA 3P8HA 1GOAA 4DQIA 3ZSVA 1BIUA 4KHSA 2G8IA 1TKZA 1S1TA 1SKRA 3QIOA 1CZBA 2D5RA 2JZ2A 1JLFA 2A1RA 2MWOA 1TAUA 4KPYA 4BE0A 2HB5A 4CIFA 4E7KA 4PLLA 4HUEA 4FZYA 1WJRA 1L5UA 4DSEA 4FZXC 3V9SA 3ZCMA 4C5HA 4W5TA 4AHCA 1LWEA 1OZ2A 4DLGA 2YHAA 3EAEA 4CFCA 4OPJA 4M3ZA 3VN5A 5J26A 3NNQA 2KQ2A 3P1GA 4CECA 2VWJA 2EQUA 2RJEA 4R5PA 3OYFA 1JLEA 2VG6A 4E7IA 2LVMA 4FK4A 2MWPA 5J2NA 2G8KA 1S9EA 4QOZB 4Q5WA 4B9MA 3K59A 4CK2A 5T7BA 4B08A 3PFSA 3HVTA 3L2UA 3NBPA 4DQRA 3OYJA 1EX4A 3TAMA 2X74A 3RMAA 4KHNA 2HHQA 4CE9A 4CFBA 4FJ8A 1Q9YA 4KTWA 1BCMA 2Z1HA 3V9UA 2AJQA 4CIGA 3RR7A 3AVMA 3MEGA 1X1PA 4W5RA 1WN7A 4HCZA 2HNYA 1WJQA 3ZSWA 3AVCA 3KD1E 4CRIA 1L3UA 2EX3A 3KIOA 4CJ4A 4QVZA 1ZBHA 2W42A 1WJSA 3HT3A 2OYQA 2L89A 2EFIA 3AVHA 3LANA 4UC4A 4I2QA 4AHVA 3NH2A 4EZ9A 4FLVA 3QESA 1IKXA 3OJUA 3HP6A 1ZBFA 3NFAA 4DTPA 1OYXA 2LRQA 4FLZA 2RI2A 1LWFA 1SL2A 3KLEA 1UWBA 4LSLA 1CXUA 3TAEA 2DFFA 3WNHA 3OYLA 1S6QA 4CEQA 3C4SA 1T05A 5DK5A 4E7HA 5SZTA 3B6OA 1S1WA 1BI4A 2D0AA 4IDKA 3CYMA 5C0MA 4OJRA 1O1WA 3OQ5A 2OPSA 1U45A 2L8DA 2IDOA 4O55A 2BGGA 4B3OA 3VQBA 4Z4GA 1HYZA 4FXDA 4KB1A 3V1OA 3K57A 1UA0A 2DTUA 4IURA 3S3NA 2L3RA 3SQ2A 3F9KA 2WACA 5I3UA 3ZEHA 2VG5A 5CYQA 4Z4CA 3QLHA 3RMDA 1OI1A 4NYFA 3C94A 2DAQA 1DTQA 4RG8A 3VQ6A 3VQCA 3WNEA 4W5OA 3L42A 4FZZA 2R7YA 4B9SA 2O4GA 3HPHA 4PUOA 1QQCA 5HLFA 4CFAA 1C0UA 4JLHA 1HPZA 3KLGA 1EXQA 1RBTA 4IFYA 3SV3A 2RHZA 4ID1A 1U4BA 3NDKA 2RF2A 1RT2A 4DQQA 3LP1A 3NF7A 3AVLA 4CF0A 1L3VA 3KLFA 4F2RA 4DTNA 4RW6A 1JL2A 4Q5VA 1RILA 2E6MA 3I0RA 1Q8IA 4CEFA 3CG7A 2G8VA 3OMCA 4AHTA 4KB0A 1RT1A 4O5BA 2LTOA 3AVAA 3K5NA 1U47A 2Q3SA 3ZSRA 4E7JA 1S1VA 4B9LA 4E0DA 4K8XA 1JXEA 1VK0A 2RO0A 2E6NA 2DFEA 2YHBA 1BGXT 3IAYA 2Z1GA 2IAJA 4KHQA 4CJWA 2DIQA 1BI4B 4QCLA 4H4MA 3PO5A 3HXMA 1NKCA 3RWUA 4Z4HA 3KLHA 4CF1A 4A4HA 2HNZA 1CLQA 3MEVA 3HK2A 3KK1A 4EZ6A 4CHNA 1B9DA 3MECA 4Z4IA 1DTTA 3ZSXA 2BANA 3LLRA 1TK0A 1KTQA 3LWMA 2NUBA 2YNFA 4DTSA 3T1AA 5D6YA 2G8HA 4CFDA 3LGFA 1QE1A 5CY4A 2O4XA 3AVFA 3DOLA 2KFZA 2ITGA 3VQ5A 2FBTA 4RW7A 4JRQA 3MP1A 3OYNA 5J1EA 3UWNA 1RI0A 2KW4A 3PO4A 4F8RA 4O0IA 4DFMA 4KO0A 3LPUA 4N4IA 3QEVA 2Z1JA 1HNVA 4IFVA 3SUQA 4W5QA 1TL1A 1YTAA 4N41A 2YNIA 3DOKA 2DIGA 4DG1A 3P8DA 2P5GA 1JL1A 4QQ6A 4CK3A 1QSLA 4DQSA 2D9TA 1ASWA 4M41A 4FJ5A 2LSNA 4M3WA 3LZIA 1KSPA 1U49A 2RN2A 3SV4A 3NF8A 3LYIA 3V4IA 4CF8A 1UOCA 1SSFA 3SUOA 2BDPA 4ICLA 3IS9A 3NAEA 3M8RA 3P83D 2OPQA 1HYVA 3PY8A 3MEWA 4OGCA 3DLKA 3CFRA 4N5SA 3D45A 4PA1A 5C6SA 1F21A 2XRIA 4CHZA 3G0ZA 4AHRA 3NGZA 2F5KA 1D9FA 3HL8A 2HHUA 2XY7A 1A5VA 1RT5A 4NZGA 3SZ2A 2BIVA 2NLUA 2HMIA 2JTFA 3NF9A 4OKKA 1U04A 4FJMA 3CFOA 4CEZA 2YV0X 2O4XB 1JLGA 2R58A 1WSGA 3DB3A 3CM6A 1J53A 3FC3A 1SL0A 4LH5A 4KI6A 2KTQA 1NK8A 1HJRA 1S1XA 4ELVA 4RW4A 4KAZA 3CEYA 4CJ3A 1HNIA 4KTQA 3OYMA 4FK0A 3K5MA 3SQ4A 1C6VA 1JLAA 4Z02A 4Z0UA 3O3HA 3ZT2A 4KKOA 3V1RA 4CJSA 3WNGA 3QEPA 4QAGA 4CCHA 1WLJA 2D0CA 3T19A 4FW1A 3L2VA 3O8VA 4IUTA 4DSFA 5C24A 4FJLA 1KHCA 1REVA 1VRTA 2E4LA 1WSEA 3TR8A 3PX4A 1IG9A 4F3OA 4BE2A 3DYAA 2LCCA 3PV8A 4Q0BA 4E7LA 3SCXA 2G3RA 1S1UA 4IUPA 1RBVA 1MU2A 4ZHRA 3NTHA 3AO3A 2R5AA 1VSHA 1Z25A 4EDUA 5KI6A 4M42A 1I3AA 4OPKA 3HSTB 1KCFA 1VSEA 4E1NA 3M8PA 3OB9A 4OVAA 1Q9XA 3V9WA 2VWKA 3OYDA 1FXXA 4CIEA 4HVJA 4M3RA 4O4GA 2WONA 3QERA 2O4IA 4CEEA 2ZD1A 4CGFA 3ASKA 3SUNA 3FDRA 3ASMA 3AVJA 3SNNA 3M8SA 2P1JA 2EKOA 1W0HA 4PQUA 4FM2A 3FEOA 4BWMA 1FKOA 4DTRA 3NGYA 2X4YA 1GOCA 3PNWC 2IG0A 5CZ1A 3CFPA 3LX7A 3H6ZA 4FJGA 3VQ9A 2PZSA 4CEDA 4KHYA 5KCOA 4BDZA 1IKVA 1RBRA 2HVHA 1A5WA 3G10A 1WSJA 3THVA 3BDPA 5KE2A 4OVLA 4LD6A 1YVUA 1RT6A 1NKEA 2M16A 3DI6A 5E41A 3HVRA 4C8NA 3EYZA 3SJJA 2KFNA 3DM2A 4OLBA 4O44A 1NOZA 3SYZA 4B9XA 1WSIA 3DRPA 3VQAA 2RJFA 4FJJA 4ZTFA 2GFAA 3DLBA 3GOXA 4G1QA 4Z4EA 4M45A 1TKXA 1W9HA 3L2QA 1QHTA 4IKFA 3E9FA 2F8SA 2HQEA 4GMJB 3TARA 4H4OA 4FJ9A 1EKEA 4CF9A 3TI0A 4KREA 1JXBA 4GW6A 3LDSA 1RT4A 4FM0A 2E5QA 3ZSZA 4QQDA 1RBSA 4KV8A 3PMTA 1GOBA 1TGOA 3SPYA 4J2AA 5JS1A 1LW2A 1VSMA 5KH6A 3C6TA
chains in the Genus database with same CATH superfamily
1Q82R 2LH9A 2RI5A 3ZFJA 4MZMA 2AHQA 2EKHA 1C1BA 3TABA 1KVAA 3RMCA 4Y0WA 5DY9A 3HG9A 3OYKA 5TGTA 1C0FA 3MEUA 4DZPA 2DRMA 1VQKA 1P7JA 2XHKA 3JCMJ 1PRMC 2YRVA 4FYWB 1BIBA 4YPHA 1VSDA 4HCCA 1G3SA 4FPAA 3G6ET 1HYSA 1IXRC 3O3GA 2EZIA 3T1HK 4I2PA 2V1RA 1C1CA 3SHWA 2A37A 3JCMf 2K3YA 4IRHA 4OMNA 1UHWA 2IA2A 4CK1A 4D0PA 2XDPA 1VYTA 3IAS2 1UMQA 1TKDA 4KH4A 1OX8A 3JCMc 4N47A 3GTPJ 1VQ4T 2VUBA 1VQ6A 2KZZA 3CCSN 2GA1A 2Q8KA 1OYIA 3P9KA 3CPWA 2HKNA 1JLQA 2Q2RA 4JD2B 2L7MP 3BF3A 5KYWA 1ZYQA 2AQFA 1NK4A 3IRQA 5DCMB 1YS6A 4DF8A 1WH5A 5F6FA 4FSSA 2QI2A 3CC4A 5GMKl 4FM1A 2CGHA 4J9BA 2FB7A 3QP5A 3DMJA 4J6WA 1NGHA 1MMDA 2TCTA 3U21A 3ZETB 3KD5E 1NGFA 4DTXA 1WBBA 1UG0A 1RAGB 2KT8A 5CKFA 2KFDA 3KP7A 5LGNA 2EYQA 2P9SA 3U6FA 2E5KA 2HVIA 1UFMA 1U2WA 2STTA 4XKCA 5FW9A 9ANTA 2CKKA 1GXPA 1T0HA 2Q1NA 4CGIA 1GLBG 3OS0A 3VQ7A 3BR2A 2KKOA 4BI8B 3LH0A 1M3HA 4YOVA 3IHOA 3F70A 4M7AD 2LQNA 3G71A 5IT9K 4BI3A 4JI6K 2XF7A 3QNNA 4LF8K 2CV2A 2RJCA 4U0YA 4ESRA 1IF1A 4BRCA 3QYFA 1S1NA 1Q81R 4PJMA 3RPUD 1AD5A 3EPZA 1A35A 4X65K 2KYBA 4AT1B 1M90O 4LE9A 1KLNA 3RPUA 3O2PE 1VQ7A 4W5NA 3E6DA 1UHCA 3SZTA 2Z0WA 1YJNT 2JK3A 2LD5A 3LALA 4XLCA 3FFIA 5IY5H 4NS5A 2DVJA 4GKJK 4KA4A 3KXTA 1RTHA 1QZ5A 3HOYJ 4CHYA 1UEBA 4DOVA 2CQNA 4Y13A 1NK9A 4EJOA 2AS5F 2VB6A 3ZR8X 2DOEA 4DR7K 3QYGB 5KYYA 3MFKA 4BRPA 2DMTA 2QZ8A 1SFXA 1T08B 3V9XA 5AZIB 3ONQA 4FLXA 1X3WB 4JBAA 2NVQJ 3SQ0A 4IZZA 1PVEA 2H6CA 4A4FA 3MEAA 1JJ8C 1VI0A 1YW7A 2GAUA 4B21A 5J1UA 1IRFA 5ICEA 2X78A 2OI3A 3PIPF 4CYCB 2FXAA 2JQ7A 3E9GA 1VQ5Q 5D5VB 1VQ5I 1MW7A 2XV4S 5HBMA 1LNXA 1C1AA 5A2QE 1I1JA 4M7DB 5HKCA 1LJOA 2X85A 2XAHA 4OU0A 3PNVA 4AH9A 1TV6A 1AWCA 4A69C 3R60A 2KYMA 2K5IA 4G6DA 2RE2A 3QG1A 2VL8A 3ID6A 1Y39A 3OS1A 4PFZA 1NGGA 2VQEK 4BUGA 4Y1CA 4BG8A 1U5TC 3O1WA 4PL8A 2LKPA 3KNTA 4RG2A 3TP0A 3F6VA 3KWIA 2IGOA 3CDHA 1IW7F 4CEAA 3CQ8A 2Y9ZA 4RTFD 1YIOA 1XQSC 2KMUA 3CCEQ 2JPCA 3A0HC 3CCEI 5FU7B 3LM2A 3TSQA 1KVBA 3FLGA 3EZ5A 2XUBA 3ZCOA 4ZH4F 3BG9A 3ULDA 3WTUC 3CUQA 3SFZA 2O8BA 4PJJA 4HBLA 2JVVA 2R93J 4I7FA 2NOZA 2FF4A 2JSCA 3CD6A 1WQ2A 4CGHA 1WJFA 3HTUA 1IHVA 3CC2T 5JVTA 2NS8A 2RC4A 4A3KJ 2RK1A 2E36A 4HX8A 3OW2S 3AG1H 2HL5C 1QSYA 3VA0A 3QDRB 3H6EA 3H0DA 3BGRA 3UE5A 2IRFG 2VASA 1QRYA 3TAFA 3GG4A 1R6RA 2G8UA 1STZA 3OA6A 1YAGA 3BROA 3PIOA 2FC0A 2H27A 1WHMA 1R4MB 5EGOA 3JB9I 2Z2SB 1YO5C 5LRRA 1Q95G 1O7LA 2XKOC 4CJLA 4DTMA 2QAZA 2M51A 3HOVJ 2KK4A 2WV0A 2L0AA 3EDPA 2XY6A 1IUFA 2OZ6A 4OIPF 2KDZA 4N4HA 2GQQA 3KLIA 3NMUA 3ALYA 2F5TX 4DR5K 4FJIA 2P5VA 3TW6A 2WB1N 4NO7A 3G1OA 2M02A 4E3SA 1C0WA 1QSSA 1B92A 3SXYA 3J8AA 4IXAA 3MKZA 2K9MA 4HZFA 3WNFA 3THKA 3KLOA 2D5VA 1RT7A 3M54A 1B9NA 4J7FA 4OKEA 3EG9B 3TU5A 4JRPA 2DXUA 1M3QA 4HT9A 1BR2A 4DEYA 2A3SA 3LFKA 1JUMA 4AYBA 1DP7P 2EQKA 4DFJA 2GTOA 3F9MA 5K1YA 2NS0A 2LDMA 4UVBA 4P1WA 3FZFA 3RKYA 1QZ6A 5FLXK 3L3UA 3SZGA 5I42A 1TLHB 2Q0OA 1YS7A 2QSFX 2DJIA 1S6LA 1TTYA 2YKNA 1VQPN 1X01A 3K7AJ 5LHHA 4HAMA 1BR4A 1ZR4A 4NL2A 4H0YB 3IRXA 4JKAA 1WFXA 3PNYA 2YPRA 3H1VX 4KNYA 4CGDA 1VQKT 1YTUA 5CK9A 3JB9G 1F36A 4DMNA 3AVKA 2YX7A 2D6FA 4Z4FA 2YNGA 5D6XA 4HXJA 5C42A 3TWHA 3M59A 2FRWA 4CSWA 4MTDA 4A3MJ 4NB5A 4Y4RA 4F3TA 1YX5A 1KD1C 1UJYA 1X9MA 4B9VA 4B3SK 4F2SA 5HLHA 4PK4A 4DFKA 1HDDC 3WGGA 1OV3A 2E10A 4IG0A 2VG7A 4OO1J 2X6WA 4IXCA 4PKCC 2UYTA 3KKSA 2E1MB 3D7EO 2CGPA 3HPOA 1BCOA 3UKUB 2JS2A 2YXYA 2RN8A 2CUZA 2VODA 2ZQBA 3M0RA 1RCHA 4E7SA 1P7IA 1BL0A 3MAJA 3UNGC 3AG4H 3CETA 3LDQA 1NK6A 1GLDG 1LV5A 2M3AA 5AQTA 2EIJH 4DV3K 2CQQA 2QTXA 2ACJA 1SANA 3DPTA 1SVMA 3D2EB 4B8AB 2W25A 1GBQA 2BEOA 1LE8A 3LDPA 3BDDA 3I8BA 2MLKA 1HD3A 3B6PA 1T0JA 1MBHA 4M7DE 2EJFA 2BE2A 1QW1A 1FJGK 3ZSYA 4W97A 5EY4A 3ME9A 2L3QA 1KU2A 4DNCA 2DPDA 3ZPLA 2QLZA 3QBWA 1PU6A 1QS4A 2F2WA 3QINA 3CCRA 4CBXA 4CEOA 1LCKA 5LMNK 2LT4A 3IL2A 2HQAA 2F4OB 4KI4A 2DA5A 1NGJA 3DPLC 1YW9A 2A6TA 2DTHA 1RT3A 1GDTA 3QB0A 1LQ1A 3G71T 2V8IA 3AO1A 4B24A 2K5LA 1DUXC 2CS3A 5IPAA 3SFMA 1P4WA 3COAC 4WFNL 2NRTA 1W4SA 2HVRA 2IC3A 3RTVA 2B5JA 3L2CA 1LWCA 4Q48A 2X35A 4JJDA 4IBNA 5DS9A 4JYAK 1XCBA 3U1DA 4NC6A 1QTMA 4FL6A 4M9XA 3WG7H 5GMKh 2OZMA 4O6JA 3JSOA 2V7YA 1N8RC 1SKSA 1WHJA 3NWTA 1PSEA 3CC7A 4FJXA 3SZPA 4BD3A 2ZC2A 3TANA 2ELJA 1T38A 4LOCA 3JYTA 3ZBDA 4CGZA 1K6YA 1IZ1A 2GOXB 1D5AA 4KGVB 1YF5L 1HRHA 1ZHIA 2DMOA 3OOUA 2GZWA 2WADA 2IS4A 4WFAL 2B7EA 3D1NI 5FKMA 1ZC6A 2HOAA 2QCOA 4JKGA 3R0JA 2YX6A 3QRFF 4IUVA 2XY5A 2FG0A 3HM9A 4H5WA 3ULEA 1G4DA 1JKQC 1ZSZB 4M75F 4MO5A 4Y15A 2EBPA 5AQWA 3CCQN 4PZJA 1VQ8T 3MN7A 2XIGA 1HSQA 2DT6A 2VLAA 3ZMZA 5E79C 1IDYA 1XMKA 3OIQA 5GAEJ 2BHZA 2UXNA 2DT7B 3FISA 3KEQA 3GFMA 4M78D 4EPCA 1ZRDA 2PUOB 2NRHA 4FSVA 4FK2A 2QA4Q 1I6HJ 2QA4I 2CP6A 1Y64A 2PBIA 2DT5A 4HUFA 4K0KK 2COBA 1WVRA 1ZG5A 5I2MA 2F6CA 5M1PA 4HHTA 3CXCS 3H9GA 2HHVA 3V7SA 4G7ZF 5HDGA 4J01A 5IYBJ 1S7AA 4L9VA 1QCOA 4DCHA 2HBWA 4CZFA 2M7AA 4C8QD 4C8MA 1LDKB 4EP4A 5KQDA 4G8XA 5H6RA 3SDZA 2CQXA 2Z5UA 2IT0A 1VTNC 4YORA 3RSNA 2JRMA 2CW0F 1PU7A 4ISEA 3LSRA 2MYSA 3SAHA 3OA9A 4F14A 3QQAA 4FM4B 4NL3A 2GIZA 4CERA 5IXFA 3K5OA 4PL6A 3QETA 4K8ZA 3LNQA 5HLTA 4C92A 4DSIA 3RBBB 1RAHB 3G7ZA 3ZQQA 4WE1A 3I0WA 4YDUA 3THXA 3HOSA 5IAYA 5C3EJ 3F72A 4BRNA 1XC9A 1CKBA 1BA5A 3OVNA 1NJIR 1MBGA 1YJWN 1G5VA 4IPAA 4HOBA 3D5SC 1DU0A 4X9CA 3QICA 1S9GA 1J5EK 3FXLA 3BJOA 3JRGA 4KIGA 2J6OA 1NU0A 2K4BA 5LD2C 3TAQA 4FIBA 4MQ3A 1H89C 1W2BP 1TT5B 4KUMA 3R6OA 1S5JA 2P5KA 2X6SA 1BL3A 1MIJA 4UUVA 1NHAA 5D8LB 3AA2A 3M8QA 2KDSA 4F7ZA 1W36D 1NLOC 1TL3A 2CH5A 2E88A 3RDIA 2FNPA 2ZB9A 3URGA 4EJYA 1DJ7B 1ZXOA 1MDMB 4HTUA 1I1SA 2V1NA 3UA7A 1LNWA 3D5LA 2R92J 4BKXA 4JKHA 2COWA 3QDFA 4ELTA 2KXCA 2MGQA 5GADP 1CZ9A 5JLXA 3AGRA 3J81O 2Y90A 4BC3A 2QYOA 1XC3A 1UAAA 4DBQA 3ZLJA 5AZJB 2MD5A 1N3AA 3SEZA 4JI4K 2L3PA 3RR8A 3VS5A 2K7LA 3KYLA 4FYXB 6AT1B 3DXKA 4XBFA 4QPOA 2OFKA 2XC7A 2GF7A 3OYEA 2HF4A 1Y71A 2HHWA 4XL9A 1VQNQ 1T44A 4A57A 3WTXC 3V81A 1VQNI 2NOGA 2KAFA 4CHOA 3DLEA 3S14J 3FZVA 2I7PA 3MXIA 4CGJA 4CD1A 1UE9A 2UUZA 1YJ9N 1WRJA 3K69A 2EWNA 2Y1IA 4HSBA 3CJBA 3K4LA 3B6AA 3HBTA 2RGVA 3REBB 2ZJRL 1K4TA 5CPRB 1PKSA 1HX1A 2QWWA 3K4BA 3ZSVA 3CPWS 4A6EA 1BIUA 1WJEA 1TKZA 4MEYF 3EUAA 4ZGJB 4CC2A 2K4YA 1JLFA 1SFEA 2PEXA 3VEWA 2A1RA 4J00A 3Q0VA 1W2BM 1MPGA 2P7CB 5KHDA 4PLLA 2KROA 4HUEA 3RDVA 3VYGA 2DTZA 1L5UA 4DSEA 2DFIA 1BR1A 3P4IA 1GV2A 1O13A 4PCQA 1N77A 5AYFA 3CCLQ 5GIPA 3U4LA 1VQ5T 3CCLI 3I33A 4KHPK 2ESWA 1LWEA 1HNXK 5LJVA 2L9RA 3EAEA 3KP5A 4E9EA 4HNVA 2KQ2A 4CECA 3WQTA 2VJIA 2NYSA 7AT1B 3OYFA 2VG6A 2LTPA 1U2VA 2LVMA 2NVYJ 4AFQC 4FK4A 2Y31A 2MWPA 2JM9A 5L3CA 1S9EA 1KYWA 3ROUA 3KWGA 3G6EN 3N4PA 1ZGJA 2D8JA 4B9MA 4BBSJ 2JW4A 3KYCB 4LFUA 3CWTA 3P9CA 5T7BA 1MJ9A 3UPUA 3DV8A 5C44J 2H8RA 3HVTA 2IS2A 1QWFA 4PKHA 3OIPA 3GZNB 3L2UA 1I1GA 1X2KA 3OYJA 2G9WA 4M7AF 3IH4A 2MD0A 4FJ8A 3JTHA 2QK0A 4KTWA 2V75A 4EJZA 3V9UA 2AJQA 2CZ1B 1WBDA 1VQ4N 5CVVA 3AVMA 1X1PA 5EG2A 1TC3C 4HCZA 2HNYA 1PVSA 1WJDA 4BJ6C 3ZSWA 4BREA 3AY9A 4CRIA 1L3UA 2EX3A 4CJ4A 1QHGA 1M90R 5J3LA 3HT3A 4CZZA 1NGNA 2PJRA 2L89A 2WAQN 4HQEA 4EMGA 4DR3K 1M27C 3N5NX 3JW4A 1QZYA 4FLVA 1L0OC 3EETA 2NVXJ 3U23A 2D1KA 4H0PA 3OJUA 2RHKA 1DGWY 1YG2A 3QUIA 1NK2P 2DPUA 1RDUA 4B1WB 3CF5L 1NNEA 2HQNA 3H35A 2GBQA 3HYIA 1X1AA 3MKLA 2RI2A 4CJ7A 1SL2A 3HM5A 2WBMA 2JUGA 4LSLA 1TNTA 1FZPB 4BVOA 4A2BA 4FO0A 2V1DA 3C18A 2LBFB 2L9SA 3GDQA 2E1CA 3CCUA 2Y48A 4L9TA 3JRDA 2KZVA 3MCPA 1FP1D 1Y6IA 3B73A 4CI0C 3FBIB 3QBXA 2QWLA 5DK5A 3HKZA 3HM8A 2JTVA 4N9HA 2AO9A 4RTTA 2E4HA 1MMGA 4IDKA 2WTEA 4B09A 1MGQA 1NK3P 1KXPA 5FU6C 1UECA 1OPLA 2LFBA 1O1WA 1V4SA 4M75C 2E2QA 3W2VA 1G2BA 3CLOA 3PQKA 3CTAA 1MV0B 1D1AA 4U0VA 1V5EA 4HDUA 2E7WA 1YJNN 1GUUA 2W10A 4J6YA 2HXOA 2OTLA 4FXDA 2EWSA 3K57A 1UA0A 2BY2A 2ELKA 2HVQA 3BWGA 3S3NA 3FZKA 4DEXA 4NB4A 3WXIA 3FM3A 3EN9A 1NZ9A 2HI3A 5CYQA 3M5AA 2DYBA 1OI1A 3C94A 3DEEA 2DAQA 1GXIE 4RG8A 3CJRB 2Y0SN 3VQCA 4BHBA 4FZZA 3M0UA 5HS9A 2R7YA 3ECHA 3D2FB 3O9SA 2MPXC 1MNEA 5LJWA 3QJYA 4XM3A 4PUOA 1QQCA 5HLFA 4CFAA 3BTJA 3CJQB 4CZJA 1EXQA 4HF2A 3FMQA 2RF2A 1PD1A 1P90A 3LP1A 1OYYA 3NF7A 4CF0A 3SWNC 3JB9J 1X3NA 3W2WA 4F2RA 1JL2A 1RILA 3THWA 4AWXB 1N6AA 2M7BA 1OCTC 3QWYA 4KB0A 1X58A 1DP3A 3K5NA 2GQIA 3WTSC 4JLIA 2ZPBB 2Y75A 1K78A 4E0DA 3P39A 4K8XA 2IEKA 1W6XA 2W04A 1GFCA 1D8KA 1B72A 4LG0B 5D5UB 1FYKA 3M0QA 3GNGA 2YHBA 1BGXT 1FMWA 4YPRA 4FPBA 3U9DA 3TQNA 1DT9A 3ABMH 4OPAA 2HBPA 4ILJA 4EIAA 2O8EB 1PJRA 1NKCA 3RWUA 1HSJA 1SEUA 3AAFA 1KG1A 4CF1A 3DCFA 1KGSA 4KBOA 1JKRC 4C3IJ 2P9NA 2PZ1A 1CLQA 1S29A 3KK1A 2X4HA 3C2HA 4H0TB 4CHNA 1B9DA 1DTTA 4BHPA 2KRMA 2A42A 4U7DA 2YLBA 2BANA 3UF4A 1YYVA 4JZ4A 2EB7A 1WFWA 1TBXA 1O3RA 4XLHA 4NLBA 4DYRA 1KTQA 4BY6B 4BQLA 1LDDA 3KZIC 3LWMA 1OVYA 1X6OA 2LR8A 3LGFA 1USTA 1UHMA 1FX7A 5CY4A 2G7UA 2O4XA 1VYVA 2ITGA 2XDDA 2O8FB 2CP2A 4JI0K 2IP2A 2COMA 3TVTA 3D6RA 2HPMA 1OISA 1K8AO 2J6KA 1LPQA 4KO0A 4N4IA 5AJ3K 4FYVB 3GTLJ 2NOHA 1GRIA 1Z0XA 2ENMA 3SUQA 4PNOA 4W5QA 4ME7A 1TL1A 2WY7Q 1XCVA 2VYPA 4DG1A 3P8DA 3HPWA 4OB2B 2VBXA 1JL1A 2H1LA 4GVEA 4QQ6A 3HEFA 2D9TA 4XOPA 4OAYA 3EFOB 1SQKA 4DYQA 4ON0A 1PKTA 5L3FA 2X0LA 4Q5SF 3QHSA 4M3WA 3DTEA 3KTUA 2ZMEA 5AFUH 1POGA 2RN2A 4DZJA 1NEBA 3NF8A 4D7NA 3M58A 5KYWB 3LYIA 1SAZA 3EHRA 4ZDOA 4ZYDA 2MIOA 4ICLA 1FIAA 3P9IA 5ILSA 4M72A 1KD1U 1VA7A 4M77F 1QO0D 1O3SA 3GEZA 2AT1B 3PY8A 4RAGA 4BRMA 1PC0A 1E6GA 3M5RA 2YU3A 3VDXA 5GMKe 5BPIA 2PFUA 4CZIA 1ZQ3P 2CT3A 2W24A 4KH0B 3HL8A 2HWVA 2F4IA 3NEUA 2ZJQF 1YIJA 1KQ8A 2IA0A 2K79A 2M34A 4BXXJ 2P9SB 3Q0UA 2BIVA 1YI2N 2NLUA 5M5WJ 5F1XA 3H9QA 2CSQA 4N4NB 2JTFA 4IRIA 3MN5A 3CWUA 3OSFA 4M7AC 2YSRA 3NF9A 1U04A 3CFOA 3K6GA 5M1NA 3VEPA 1I8FA 3FC3A 1Q7YO 1VQLQ 2A36A 1VQLI 3CJ7A 2HVSA 2ABKA 4Z6YA 4CZLA 1NG9A 2ZCWA 4DK9A 2BE5F 4NQWA 2LJ0A 3CWAA 3TEDA 4KTQA 4NNJA 4IHTA 1AOYA 5LHGA 1ZRCA 5AQPA 4FK0A 1U5SA 3M7GA 3SQ4A 2MG4A 1T6DA 3KP2A 3OH6A 1W97L 2JVHA 3BZCA 1WHHA 5F27A 1HKTA 1K9MC 3OW2P 3GVAA 1E2XA 2KP6A 4PKGA 2R7WA 2DEUA 5GAGP 2FBIA 2YR2A 1BBZA 1PWTA 3M9AA 3CCMQ 3T19A 3CCMI 3C2BA 5KN9A 3O8VA 4KH1B 4C23A 2JT1A 3DFGA 3H9JA 5KYYB 3S1RJ 1R5GA 1S72Q 1RRSA 3MD2A 1S72I 3DU5A 1REVA 2Y4YA 4C30A 2X6YA 5D5WB 1U3OA 2EAYA 4A0XA 2K2MA 3CJNA 3JV3A 4ENJA 1W5CC 4F9OA 3MZ8A 1NM7A 2ZXJA 3AL0B 1ORNA 1RLQC 4KN7X 1N8RU 3PV8A 3J81E 2DA2A 1S1UA 4IUPA 4XQFA 1RBVA 3BG3A 4BRGA 5CCAA 3FHGA 3CMEQ 3BPVA 3CMEI 4KH5A 1UB4A 3RESA 3NTHA 4UVCA 4IJNA 3ENHA 3WUHA 1Z25A 3HRTA 1YUWA 4OPKA 2ZO4A 5CQGA 4M78F 5DM6L 2W6LA 3K4JA 4HVWA 5DLQE 4E1NA 3JXUA 2R5ZA 4C0DC 1IGUA 4JHDA 3VODA 4HVJA 5H20A 4ABZA 2JN0A 4O4GA 4M3RA 2A5YB 1NYFA 3T69A 3HUGA 5EZGA 1OH5A 4DR4K 3ASKA 2YUNA 1LUJB 3SUNA 3GOIA 3SNNA 2P9PB 1QVUA 3G1JA 1M9SA 2P1JA 5KAFC 3DEWA 2EKOA 3J7AO 1HQCA 3ZMVA 1VIFA 4KN4X 1VQNT 4C8QF 3FMSA 1S3XA 4CCJA 2CW7A 1GOCA 4JX5A 3CUQB 2O8BB 3OW2M 3TW7A 3QODA 1MV3A 3W3CA 3VETA 3K2AA 2J5PA 2XGCA 3LA7A 5FD5A 4DUZK 4CD3A 5F1RA 1R49A 5GAN8 4A63B 2V51B 1VQ8N 1VQOQ 5LEJA 1VQOI 1T0FC 3MJXA 2EH3A 2FRYA 3G10A 3THVA 4YOTA 4KGZB 1EWQA 3A8GB 3INZA 2F2XA 4L5IA 1RT6A 1UFFA 1NKEA 1TG0A 1VOMA 1HKSA 2J5OA 4IOCF 1SMTA 4J7IA 1HW2A 3EYZA 2KFNA 3H3OB 1REPC 3DM2A 1I4K1 4OLBA 2XAFA 4AG2C 1FMVA 2O03A 3H3NO 5A2QK 1XMAA 3CCLT 2G6FX 4F17A 1MBEA 5J1YA 4YHHK 1U8RA 4M7DG 1SAUA 3MK6A 1WSIA 4BHCA 2XIDA 2X1EA 1FBUA 2FPDA 3TPQA 1JCFA 3PM1A 3EH1A 4IRGA 2GFAA 3DLBA 3VV0A 3M0TA 1NLVA 3L2QA 2K57A 2P9KA 3S6IA 2EQIA 2F8SA 1Z1DA 2HQEA 3TARA 4LXCA 4H4OA 4FJ9A 3HBLA 3OH9A 1OU9A 3TI0A 4FM0A 2EZKA 5KVRA 2PVGB 4B1ZA 4ITVA 1TGOA 3SPYA 4H5TA 5KH6A 2XMFA 3C6TA 3MZYA 3S16J 2OX7A 5CKDA 2HR3A 2D1XA 2EV5A 2E1YA 2BUPA 3BT9A 1RTIA 2XB5A 1XN7A 1WXUA 4JRKA 5E3NA 3PNTA 4NBQA 5FO5A 2K9NA 2VJ4A 4LF5K 1LAVA 3S8PA 1X9SA 5M1QA 1AZEA 4PWDA 2YS9A 4CC3A 5GAN4 2OTJA 3JB9D 2M0OA 4I2OA 3UT1A 5HRNA 1LPLA 2ZM6K 2JA6J 1N5ZA 4L59A 1MDUB 2V6EA 2P7VB 4IQJA 4YELA 1GCPA 5DCFA 4F7UA 3KETA 3KTQA 2HCKA 2DETA 5C10A 1HOMA 1HSTA 1YITQ 2HGCA 3HSFA 5J4YA 1YITI 4UXNA 4XSXF 1OPCA 3UDCA 2HQ5A 3RIRA 3J7YP 3RKQA 5AZIA 3KUFA 4PJOF 2AHJB 5HCKA 3L4QA 4LN2A 2IGIA 4E47A 4B47A 5HDKA 4FJKA 2OUMA 2DJZA 2PLYA 3R3LA 1ERDA 1IN7A 4YFKF 4AVPA 4CYCA 4HW0A 2HMPA 2M1BA 2O8DB 1KAYA 2HBKA 3A03A 3N0UA 2EGAA 4IZ9A 4IO9F 4X34A 5GAMh 2DL5A 1OOTA 5FLVA 4DTJA 5FRNA 4L8RB 1Z77A 2KQWA 2LX9A 2KIUA 2XKPA 4M77C 1ASVA 2FBKA 3S1QJ 5CAIA 2Y0MA 3BDLA 2NNYA 2CP7A 3ZOBA 1D1CA 1ABOA 5LJ3g 3H8ZA 1LE8B 1Q18A 4HF0A 3C6HA 3CCVA 4HCKA 1MWMA 1JHHA 4KIBA 3WTTC 2KRHA 3JCUC 2BY1A 5GAOn 1IBKK 2XGEA 4PUSA 4TSXA 1D9DA 5F0CA 2DN0A 1Z6TA 1OU8A 1G83A 2GELA 4BDPA 4YIFA 2M5WA 2ISYA 2V79A 2VJJA 2CFXA 2QWOA 4AIHA 5J2QA 2K3PA 1MJAA 1X43A 1OKJA 3AGKA 3FF5A 1D0XA 1E4FT 1NK7A 1VQ5N 4EHUA 4BY9C 2KVQG 4XICA 1QQJA 4IG3A 3VS0A 2ZGZA 3O8GA 3BY7A 4J9GA 1JB0E 1XMXA 1O4XA 1VSFA 2E6ZA 3V7CA 1Z9ZA 3QJ6A 3TTCA 3JCMh 5DYMA 1E0EA 3MZHA 3M9QA 5CZ2A 4B1XB 3RNJA 4E19A 4KMUX 2E34A 3HXLA 4AHSA 1SL1A 1YHQA 2LQKA 5KYXA 3DBRB 3SFIA 4RWTA 4DSLA 2K3FA 3M8FA 4FJ7A 2OV7A 3W0LA 3EGXA 4ZN1A 4RS8A 3H46O 4DQ8A 2X4XA 1JUPA 1RKWA 5KRSA 4YOWA 2JPBA 4FETA 3CCEN 1BISA 3FWEA 4Z89A 2XKOA 3E9LA 4BR5A 1WZOA 1H88C 2E2JJ 1QHHD 3CESA 3CBMA 4N4GA 4DV5K 2ZZDA 2YG8A 5D5XB 1QVFA 3G4SQ 3S1MJ 3G4SI 4CHPA 2FQ3A 1EQYA 1LWYA 1KEAA 2XY8A 2RQUA 3VUZA 2FNAA 3JCMV 3FXKA 3HZ6A 2HXIA 4M78C 4WF9L 2W40A 1NOYA 1PM3A 3C95A 1BWFO 3KP3A 4RTYA 3OJSA 4BR0A 5F1JA 3GTOJ 4R79A 2A5XA 3KFWX 5EG0A 2E2HJ 2WAFA 2BGCA 4K25A 4LC9B 2CYYA 1WAFA 1WPKA 2WWYA 5DUKA 1JEGA 3A2KA 3SPZA 2EYZA 3U3GA 1WSFA 5GAHP 3EGDA 4M9SA 3I55Q 3D0SA 2Q36A 3FIFA 3I55I 2XK0A 2IIMA 4C8QC 1GFDA 1WH7A 3REAB 5LJ5g 3MX2A 2BOLA 1HLVA 4XLAA 3RR6A 2VUMJ 1BHLA 3LP2A 3HYFA 4II1A 1J54A 5CO7A 1RI7A 1HQUA 1GVJA 3R6MA 3CMYA 4ZDLA 4GVMA 2RHIA 2DLPA 3MN6A 3R6SA 4RMNA 3IH3A 3K70C 4CO8A 2EHGA 1MNDA 3CPWP 1IXSB 5A0DA 3NMZC 2K02A 4C92B 3K0SA 1U8BA 5E84A 5AQVA 1W7AA 4L3QA 4WXDA 2YHYA 1Y1WJ 1JGSA 1XHXA 1RRJA 3I4MJ 2KR3A 3AVBA 2JZYA 4N0AC 1IO2A 2M8EA 1KA8A 1ETVA 4ELUA 3K0LA 1DPRA 2HS5A 1UJ8A 5M9OA 2KIFA 3DPUA 2Y2ZA 4YFXF 3LDNA 4WWCA 1QGPA 3M3YJ 2OJED 3MQ0A 1FTZA 1IGNA 3TDZC 1T6CA 5GAN7 4H5NA 3QO9A 1NBEB 3F2KA 4ZYEA 1X9WA 4YFUA 4J9EA 2V1UA 1PP7U 1K0SA 2ESHA 2DTIA 3C65A 5FWBA 1RLPC 3DLGA 3QYHB 3ZX2A 3CMAA 1EETA 4YIIA 1RC9A 2JWLA 4XONA 2OPRA 1V3FA 4M6VA 3F0ZA 4LUDA 1W7PD 1UGRB 1QQMA 1A31A 3EKUA 4HLYA 2EPDA 3QEWA 2KKZA 2GBZA 1HNWK 1VQMN 1W7PA 3CQZJ 2YSQA 4JKFA 2XHBA 2HSTA 1KFSA 2E71A 3MKYB 3CIPA 3AA4A 3L1PA 3I0SA 4CCNA 5KTQA 5SWMA 4C0GA 3ML6A 2FJ1A 4HVUA 1N6QA 1UA1A 3SMPA 4FYDA 1WXTA 1SFUA 1VQLT 4HX7A 3DXKB 5FROA 2VIXA 1ZA2B 2Y1JA 4AF1A 3ZXSA 3E5XA 2R7UA 1ITGA 3ISNC 2P9IA 1M1KC 2Z33A 2DA7A 1C0MA 1K8AR 2RV8A 2Q2EA 2DY4A 3CPWM 1ATSA 1ZHFA 4NXNK 4FU6A 1YW8A 1FKPA 2CREA 3T8TA 1IDZA 1W5SA 1WB9A 3WTVC 4XH5A 3O4NA 2PVOB 3VQQA 1Y56A 2EQRA 3F8FA 3D4VA 4MFBA 3MXJA 3CCMT 1WNSA 4J9FA 2CV0A 1K6OA 1NMNA 1XGMA 1BQNA 1S72T 1D3YA 2OA4A 2DBBA 2E2NA 1ASUA 4O8UA 3M0PA 2GBYA 2UV1A 4PJOC 3CJ9A 3EUHA 5EC7A 2E70A 3F5TA 4GV9A 2CFOA 4NHJA 2WSEE 5AQQA 2E5NA 2HQRA 4RGRA 4Y1DA 1G99A 2RNAA 3QAHA 4FW2A 4XU0A 3CMET 5CYMA 5JI6A 3QOPA 1YQMA 4NCAA 4RKUE 2BY0A 4FVUA 4CJTA 3FHNA 2HDAA 3NE6A 4ESFA 4KFBA 4QKUA 1U2VB 2NVTJ 3VB2A 4QS7A 1SD5A 3E9OA 4LMYA 2DRKA 4LDYA 5B1BH 2EIMH 5FWCA 3FJ5A 2D45A 1I39A 4EMKC 2RHYA 2MLGA 3S15J 1QPMA 2GXGA 4FX0A 4IUQA 1JJ2S 5GADJ 2ID6A 1QPIA 3TP3A 2ECBA 2FF3B 4CJVA 1ZBSA 3N4MA 3CCJQ 3MP6A 3CCJI 1DGKN 1ZR2A 4MQVA 3META 3LSPA 2P8TA 2PJPA 4MDAA 4OLAA 5CHIA 3K4NA 3SJHA 2L9VA 1VQ9Q 1VQ9I 1SEMA 3VS6A 4XRSG 1KQ2A 4B1UB 2UXBK 3EH2A 3ERMA 5GANd 2HL3A 4IVNA 2F96A 2PJRB 5F04A 2DYRH 3QBYA 4O5VA 2DXTA 4DOWA 1EIFA 4A5NA 3TO9A 2XDVA 1VQOT 1ZG3A 5BR8K 3RMBA 3DEUA 4X9DA 2DNUA 2K9GA 1QKWA 2QK9A 1ILYA 3OHRA 5K7ZA 4AM6A 3VQEA 2DD4A 2DMNA 4LIUA 1XDUA 2QA4N 1MBJA 2CH0A 1S3JA 1BDGA 2NOJB 1KQSS 3LPTA 4Y7NJ 3GTGJ 3BZ6A 3ULRB 3S2HJ 3O1BA 2JG6A 4C92E 4CICA 4LB5A 1P92A 1YHQT 2CP3A 1K9MU 3VEOA 4B9TA 1X2QA 1RR8C 2A69F 2Z1IA 4OIQF 2QSGX 3WU1B 4A3JJ 1EA3A 4KULA 1MBFA 4IUUA 3S3OA 3QEIA 1SMYF 1J7KA 3BJAA 2Z99A 3I58A 1KU7A 1WI3A 2LQ8A 1GLCG 3E01A 3EE8A 2DEQA 5DD8A 3CCSQ 3KK3A 1RTDA 3CCSI 1LW0A 3TGNA 2RA2A 4OMZA 3O4QA 3O5BA 2FZGB 3EYYA 3O3KA 1ORKA 1RUOA 1WGXA 1LKXA 4RB3C 4EA4A 2CGKA 5C2DA 3CM5A 3TTFA 2G8WA 2HSEB 3HOXJ 4ANJA 1QQNA 2ZF5O 2GX9A 3MAQA 3D0PA 3UB5A 4IEJA 2E3IA 1Y0MA 4A59A 3BTLA 3VA3A 5J1RA 2GWJA 1AU7A 3AA3A 1MUZA 5LJ3d 1FOWA 3A1YA 4PDKA 3X20B 2XAUA 1WI9A 1D5VA 5GANe 4CJ5A 4F92B 4Y92A 1F9NA 3RI4A 3DJCA 1B34A 1VRUA 3FZHA 2EW3A 5AQFA 2DERA 4V2GA 2FSNA 4N56A 4F3QA 2E7XA 4ATOA 1I5ZA 2F2EA 3WTZA 5ICCA 4RTWA 1QVTA 1WJAA 4JQFA 2LMJA 2O0YA 2M87A 5EYRA 4J2DA 1YITT 4CJFA 2R5MA 1HNZK 2CZ0B 4B8CA 1JTYA 3U9ZA 4XKWA 2HFHA 2KLAA 1R0AA 1Z7UA 5JLWA 5I2SA 4DUYK 1EF4A 3T7ZA 3THWB 4RCBA 3RYPA 3GTQJ 3PUFA 5H6QA 1B3QA 3SAGA 1KQ0A 4XIUA 2R7SA 4AILC 3AO2A 1OEBA 1CZAN 5KCHA 3QMLA 2JMAA 4A54A 1Y96A 3R9PA 4F52A 2DBKA 1K78B 3WT0A 1BU1A 2AXLA 4WX9A 1B9FA 1U3EM 3H5RA 1H3ZA 1B72B 2NYXA 2KSSA 2P0QA 1QP3A 2L2OA 2EZLA 1Q86C 3UIQA 4OMYA 4G6TB 3A8MB 3ABUA 2YHWA 4BWJA 4M4ZA 1VQNN 1WHUA 1C0TA 2P4RA 3Q9VA 2EPFA 2M8GX 4FSXA 3U8XA 5M1KA 2V26A 1OVQA 3OYIA 4IHVA 2DAOA 2SEMA 4K43A 4AD9A 1AZGB 1EZZB 4B9QA 4XRMA 4PFOA 3BR1A 2P9NB 1BI0A 1N33K 1R5HA 2EK5A 3I59A 3I56Q 3I56I 2XF6A 1EJ9A 5JLHA 4LF4K 3FKIJ 4AC0A 4CJUA 3OMYA 4L18B 2SRCA 3L2WA 2VQGA 2H3GX 4EIKA 1A0NB 2BKDN 1KAZA 3OL4A 1R59O 2O6GE 3PT9A 5GAMe 2IIRA 5CKHA 4FE4A 1H8KA 3BC8A 5GAOm 2PVDB 1IKYA 3AAPA 2D1VA 4IO8A 2BUDA 1NM1A 1KFDA 2HYJA 5DTDA 3JB9F 3GBGA 4A3BJ 3CCLN 3DLAA 2E6LA 5EF6A 1DLOA 4M3YA 2J6FA 1VFCA 5E3LA 1VSIA 3PX6A 2RNGA 3WXKA 5C4XJ 4AHUA 1GOAA 1XSDA 4KHSA 2G8IA 4O5FA 5AQLA 2D5RA 4CYDA 2JZ2A 5LJ5d 4HWIA 4K2EA 1AEYA 1JKOC 4CIFA 4B23A 2WA0A 4GCVA 4BUPA 2EFNA 1BA0A 1TU0B 4OMOA 1LEAA 1FC3A 1M1FA 4JKBA 2YT6A 5GAOr 3V9SA 4BROA 4C5HA 2W03A 2ZMEB 4BQAA 2XDBA 4CFCA 1VQ6Q 5J26A 1VQ6I 3P1GA 4EQQA 2EQUA 5D4RA 2ABLA 2BZXA 1UG2A 2RJEA 1A36A 2QVOA 4E7IA 4BBRJ 3G4ST 4B44A 2G8KA 1FLIA 3KZYA 3MCZA 3CO7C 4M75A 3CC4Q 4BXUA 3CC4I 1M3AA 3WVDB 2HTJA 3DKXA 2NRRA 3KCCA 3I35A 2A28A 3TAMA 3MX5A 4F04B 3RMAA 3E9PA 4CE9A 1Q9YA 3A8YA 2NS7A 5HVQC 2J7IA 4I99C 3F8NA 3RR7A 1JXMA 2FA5A 3MEGA 3JRBA 2JS0A 2X51A 2PFBA 4GRIA 1WN7A 3FE1A 2RQWA 4ILGB 3I55T 1WJQA 3VESA 4HF1A 3AVCA 3KD1E 3HIFA 2XF5A 1CF7A 4K42A 1UUEA 4IJAA 1WJSA 4LDXA 3A5NC 3F8BA 2XGDA 4WF2A 1NG6A 5B66C 1MMSA 5H2FC 2PMZN 2DO7A 3E6MA 3CI5A 1SC7A 4I2QA 4UUTA 1SVLA 4EZ9A 8AT1B 3QU3A 2WY8Q 3QESA 2ZJ2A 2YRDA 1JT6A 1ZBFA 4KICA 2W84A 1OCPA 2XROA 1XMQK 1VQ7Q 5JICA 1VQ7I 2UUCK 1ZSGA 4V19S 3KLEA 1IB8A 2VC8A 3E1YA 2JMCA 2HBMA 1NJIO 4M6YA 3JRFA 4OIOF 2E8AA 1X27A 2A6AA 4YG2F 4A3DJ 1Y7XA 2JTEA 3LOCA 4EJWA 3OSGA 1N3CA 2EJRA 4NUBA 1QVFS 1BC7C 1W2BA 1YWOA 4A0YA 1R00A 3SDBA 4D8KA 2QQAA 1Z7LA 2L2PA 4AM7A 5LMUK 3FK7A 3EKSA 2FEIA 3OQ5A 2XSDC 1LFPA 1XB4A 3PSIA 5K5RA 4LNPA 1U45A 4Z8AA 2L8DA 4PSXA 4O55A 3BW1A 3MVPA 1U6GA 1G6NA 2E2IJ 1ORPA 3VEYA 4MDXA 2DMPA 1HYZA 2NNWA 3L2ZA 2L3DA 2O31A 1NPRA 3KPHA 5FGMA 2R5ZB 4ZGEB 1KC8C 3CHWA 4A3GJ 4W1UA 3OYYA 2BXYA 4I98B 3RMDA 5BRFA 4NYFA 3H92A 4AIDA 1ZN2A 1VNDA 3DKWA 5FFZA 3WNEA 2O8FA 4W5OA 1X2NA 1NG7A 2L5QA 3Q7BA 3O9QA 1HR0K 3GW2A 4CI6A 4JPBW 1C0UA 4B1VA 5C0YA 4JI7K 4OB0B 4RMOA 3E6BA 2HU9A 1RUWA 3IUCA 3T1YK 1FMKA 4IFYA 1U4BA 3NDKA 2Z3YA 3AVLA 2CUFA 3PUBA 3KLFA 4S05A 3C6AA 1TWGJ 2E6MA 1BJAA 4X1EA 3H3ZA 3CG7A 2EFOA 4AHTA 3CD6Q 3CD6I 3EFOA 5AIQA 3EL2A 1U47A 3BFMA 2LLKA 3QSUA 2Q3SA 1Q7YC 3TMOA 2GTDA 5GAGJ 4E7JA 2X9DA 1S1VA 3VGMA 4BRIA 3J81K 1J09A 1JXEA 1N9SA 4E9FA 1GXQA 2RO0A 1WEFA 4JZ3A 2E6NA 4I0BA 3O8HA 3SAFA 2DFEA 3A98A 3L0QA 1LWVA 3CPFA 5IHNA 3I9V2 4X66K 3HOWJ 1AKHA 4D8DA 4CJWA 3H36A 2P6TA 1BI4B 4R0KA 4G7OF 3PO5A 1LMZA 1AWJA 3HXMA 4A4HA 2DW4A 4JN4A 3H1CA 2KISA 5KYNA 1NKUA 4AM3A 4UY8I 3E1SA 4EZ6A 2HDWA 3VOVA 3WTYC 3ZQLA 2P9KB 3MECA 4A93J 3NARA 4EM0B 2IAIA 4HPQA 3LLRA 1WJCA 4D5FA 5ADXH 3PGGA 3H3UA 3R1XA 3DBLB 4ILHA 2FUG2 4ZZLA 2WB1A 3A5LC 3CDIA 4DTSA 3LWHA 1KD1O 1EH7A 3CCJT 2YUOA 2VPRA 1YP5A 1Q1HA 4AIJA 2KFZA 3VQ5A 2FBTA 4RW7A 3CCQQ 3OYNA 4M7AA 3CCQI 4V2SA 3JRCA 1FBQA 1J5YA 3UWNA 1X3ZB 1RI0A 3VF6A 4ORZA 1VQ9T 2J06A 3PO4A 2DL4A 4GLMA 5KAIC 3BR0A 1WQ7A 4DFMA 4PJLA 5TKWA 1R1UA 2DXCA 4ISGA 4IFVA 5LLQA 3J7ZO 4CDGA 1XX5A 1YTAA 1IC8A 2BZ8A 2OAUA 4B43A 1CGPA 5BMZA 4Y17A 4F7UB 3I4PA 3BJ6A 1VQPA 4HKEA 1QSLA 5IH2A 3CZ6A 3BY5A 2QUFA 4LF9K 1UHFA 4YY3K 3EE9A 2Q97A 1M1KU 4BRKA 5HNHA 3LZIA 2OCEA 1RABB 3QPHA 3HB9A 4Q4ZF 3CQYA 1PG5B 3VMFB 2VT2A 1CSKA 2QBYA 4UV8A 2EYYA 1UOCA 1ATNA 2DU9A 1G59A 2CP5A 2O9SA 2OQGA 4ELZC 4A3IJ 3OOPA 2ZPEB 3MCAB 3IS9A 3NAEA 1TW2A 4IF4A 4V2FA 3M8RA 3I3LA 3P83D 4MMKA 1HYVA 3VPZA 1VQLN 2VGMA 3MEWA 2CV1A 3DLKA 4E6RA 3CFRA 4N5SA 1UTIA 2WAEA 5C6SA 1F21A 4GO1A 2BW3B 4ISFA 5AQOA 4ENKA 2EIKH 2QGUA 5LBQA 3N05A 3CCST 2HHUA 2XY7A 5CHZA 1A5VA 1ZUYA 4NZGA 4PIIA 3TOBA 1R1TA 2W6KA 2VQCA 4HSTA 4ELYC 2Y69H 2H1KA 1I6XA 1N8RO 4M7YA 4ZNXA 1H9TA 3CCMN 3M3ZA 4E9HA 1SHGA 2P9PA 3VYUB 4FJMA 1U5TB 1JLGA 1S72N 4BGDA 4A2AA 2KZGA 2R58A 1JRIA 3JSCA 1J53A 2NOEA 2Z16A 1SL0A 3VS3A 5L3GA 4FE7A 1FT9A 1ULYA 2L54A 2HYGD 2VKDA 2KTQA 1HJRA 3BP8A 3CCRQ 4XK4A 5BRDA 3CCRI 4KAZA 4DB3A 2K6DA 2HNHA 2IXSA 1ZK8A 4E9GA 1QKXA 4IOAL 2EA4A 4BXFA 2GNCA 4QLCU 3OYMA 4YDUC 2DILA 5IT9Z 3CMEN 3OGDA 4Z02A 3JCMQ 4YOYA 3ZT2A 4U67L 3V1RA 2AZSA 1E3HA 3RSEA 3QEPA 4B22A 4QAGA 4CCHA 1WLJA 2B9SA 1ZYRF 3GL1A 1GT0C 1EFNA 1BM9A 1T0FA 4ZN3A 1QA6A 2O9LA 1VRTA 3JTGA 1XGSA 4OAZA 4RTVA 4JJBA 4DV0K 2MW8A 3J7YJ 4CXFA 5KYXB 1JXSA 3DXJF 4BE2A 2BZYA 1YJ9Q 3UKRA 2V1QA 4UNOA 1YJ9I 1YQKA 2LCCA 3CBOA 3EGXB 3AHUA 3CC7Q 3ZMUA 3CC7I 1WNLA 1B9MA 3GBQA 1N36K 1O57A 3RYRA 4E7LA 3HFNA 2VKHA 2ZJRF 3SCXA 4OMLA 1SPKA 1MU2A 3C3WA 3BOQA 2FRHA 4EVIA 2HOEA 4LF6K 1X6BA 2M4KA 2NXNB 3M1CA 5KI6A 3LAJA 1BI3A 1K83J 5AQMA 1FWZA 3ZQGA 4IWVA 4X0GA 5DM7F 1QVGA 3ZEUB 2CUEA 1ETWA 3I56T 4OVAA 2LDUA 3V9WA 3OYDA 4CIEA 4BU2A 1K73C 3VGKA 2W00A 1QVPA 1VQON 3CCQA 2L01A 4BQQA 4CEEA 2ZD1A 4CGFA 3KEOA 3PQJA 1HU0A 1FNNA 2ZGWA 3I0TA 2IGKA 3U1KA 2KT0A 3V8LA 5EEAA 1KSWA 3ASMA 4DGWB 1KG4A 3M8SA 1HYOA 5EG0B 1N9RA 3M07A 2F1LA 4FM2A 3FEOA 1S5LC 3MMYB 1QCNA 2UU9K 1FKOA 2F7TA 1EWRA 4DTRA 4LJZF 3W2AA 1T3SA 2DDAA 3EGDB 1O7FA 2J4RA 4MDBA 5D4SA 2IS1A 3IKMA 1EV7A 3TCJA 2IG0A 4FQGA 1LVKA 4N4OB 3K9JA 2RQVA 3H6ZA 3GBTA 3THYB 2VCPA 1WXBA 2F5VA 2PZSA 5AQXA 1XG1A 3ZQCA 3A8OB 3EG2A 1SS6A 4DBFA 5KCOA 4BDZA 2NUTA 1IKVA 3K1MA 1RBRA 2A68F 1BW5A 2RB6A 3BDPA 2XB0X 5KE2A 2QYZA 4PHTX 1LFUP 1I5OB 2JWTA 2M16A 3FJPA 2XD0A 4OX9K 2BE9B 3DI6A 4F7UE 2Q0UA 1N78A 5I9EB 1K76A 3H41A 2X4JA 4RLFA 1NOZA 3K9TA 2O8DA 4ENMA 1V1CA 2XGXA 2IVOA 1VQ6T 3SLCA 2F4MB 1HPMA 1VAZA 1R5ID 2D0QB 2E1ZA 1YJWA 4IQ4A 1YQAA 4G1QA 4Z4EA 2GQVA 4UB6C 1I81A 3CF5F 2ED1A 4I02A 4M77D 1GBRA 1VIEA 1G3WA 3CC4T 5CVJA 5B1AH 1R77A 4M77A 4GMJB 5EXWA 3I71A 1Y0NA 1VUBA 4CF9A 4M3GA 1D5YA 1JXBA 4GW6A 4FOEA 2CH4A 5BQTA 2RAEA 2E5QA 4FT4A 1RBSA 2GCXA 4KV8A 5AQUA 1Q86U 3PMTA 3QDKA 2D0NA 5JS1A 3JSPA 5F0XA 1VSMA 3SBGA 1W7PB 3PL8A 3JCMX 2EYXA 1P4AA 1FSEA 2NRXA 1NJWA 2JGUA 2DA6A 4JP0A 1LEBA 1JJ2P 1X69A 3FIWA 3JSMA 1IGQA 2ZPFB 5E26A 3RJPA 2BTFA 3ZT0A 5GAHJ 5EOYA 3RQ4A 3KK2A 2ZE2A 2P9IB 3E5QA 1XDSA 2BY3A 2L9NA 4Y33A 2Q2EB 5FLXZ 4C8LA 3QWXX 2HQHA 4C92G 3NPFA 4RAFA 2E2OA 1VQ7T 1Z67A 3MHXA 2C06A 4QTRA 3ENBA 3LQQA 2QEXN 1Q82C 2QXFA 2HQXA 4D6WA 3Q7CA 3TSZA 4CJQA 1YJ9A 3RRGA 5IXBA 5BRHA 3EG0A 1EP4A 4F55A 1AWXA 4WFBL 4DS4A 5ECAA 1YQRA 2CQKA 3NRVA 4B9WA 4PY5A 4MO7A 4B3RK 4DU4A 1SUQA 1J2XA 2BE7D 3R4KA 1KQSP 4DV4K 5IYDJ 3LWLA 1QBJA 4QQGA 2DTOA 2PMUA 2X48A 1JBMA 3A5OC 4DU3A 2X4WA 4C9YA 4XTVA 1WJ5A 4P9FA 1MH4A 2ZXIA 2PY5A 2YUQA 3VYSB 3MDQA 2BVMA 3ZQHA 1O3QA 1BJZA 4EJTA 1I0CA 4ZYGA 3TREA 2UXDK 2JUCA 5CVRA 2B8AA 2RM4A 5F2RA 4UUSB 3ZYYX 2CG4A 1KQ1A 2MAMA 1GLAG 4LF7K 1NH3A 2DK3A 3ENOA 1TYQA 1MSEC 2JNGA 3VEXA 3F10A 2WOMA 5DUIA 5C4JJ 1L3SA 3ZX0A 2Y9YA 1JJ2M 1G2HA 4FISA 1WCMJ 4M78A 2F5DA 1WUAA 1UCRA 1FYLA 2GWKA 4L9NA 1S22A 2KJBA 3G6EA 4PGHA 3EG3A 3S93A 1ZBXA 1HKQA 3TQ7P 3FDYA 5M3MJ 1OULA 4RB2C 1WSUA 4A4KA 3DLHA 1TW3A 1T03A 4N76A 2A40A 5KGWA 1JKHA 1N27A 3C12A 4XH4A 2C0TA 1TK5A 2LJ1A 2GGRA 1GLNA 4LB6B 2WC9A 2F69A 4C8QA 1VQ4A 4GNIA 4ASNA 1IUYA 1J9AA 4BS9A 3DAWA 4F93B 3DB4A 3OYAA 1SFKA 5BPLA 1NGCA 2K2VA 1RPWA 5C12A 2HKQB 2QW9A 4XAXB 3K70D 2XVCA 1BQMA 3G4SN 2X1DA 5DPKA 3CD6T 1H0MA 2VQFK 4C8OA 4I01A 3FXRA 1ZRFA 4L5JA 1HC8A 3QIIA 1NYGA 2WAQA 3BY6A 3KVGA 1KQSM 5KGXA 1Q81C 2A05A 2EQMA 3LAPA 4CJRA 4CCKA 3AO5A 2KT1A 2NUZA 1T8EA 2IPQX 3J7AY 3A2FA 4EJUA 2BXZA 1RNLA 1APLC 3LL3A 5CVIA 4JS5A 5GMKi 3LSGA 2GWRA 3FLCO 3DTIA 2EYWA 3UKGA 1VSJA 2DYSH 1G15A 3K10A 3I55N 1PP8F 2IS3A 4GKKK 4QWQA 4GFBA 4RM3A 1N32K 2F2VA 1C0GA 2R7ZJ 3CCUQ 4B9NA 4UVAA 3CCUI 4HCBA 5J2PA 4XNFA 4HYEA 3WXMB 4OMQA 5KQ8A 1B4AA 1KVCA 2QTDA 3MO8A 4J19A 1MKMA 2JTMA 5K7HA 2EVRA 2K5CA 1HKGA 4FLWA 3I8DA 4MZPA 2NAZA 1XC5A 3V42A 1J5OA 3LWFA 2B6AA 2EFWA 5AQKA 3LDLA 2E64A 5GTHC 1R58A 2XICA 3HKSA 2PBDA 4GY5A 1Y8RB 1YJNA 4EHTA 1IV8A 2OTLQ 3GFIA 4L6V5 3CCQT 1QU3A 2OTLI 2QKKA 5C2FA 4OKJA 2XAJA 2M30A 3KJVA 1JO8A 4WCIA 3MN2A 4AFZC 2DDBA 5KRTA 3PE0A 2VYTA 1ZLJA 1B34B 3G0QA 1KC8U 4NYNA 3S9HA 3GPLA 1QWEA 3GTKJ 2I2LA 5AN4A 4A2UA 4CJPA 1TUUA 1NMDA 2Y0SA 2YI1A 2K3XA 3X25B 3VS1A 1YI2Q 1VSLA 1YI2I 4OMPA 3IKTA 2TRTA 4IOXA 1OQKA 1KQJA 4GYIA 2EFPA 2M45A 4WXHA 4A0ZA 4FJNA 2P0WA 4H03B 1XNIA 3VQDA 4CBUA 3X28B 1J0RA 2ADUA 2VN2A 1XD7A 1J3TA 3OTOK 4C5EA 3D5RC 1QCFA 1PD0A 5L23A 4HX4A 1RRQA 4M7DF 1OH7A 1D8YA 1RTJA 4PJOD 3AO4A 5FFXA 1OJLA 2DJQA 3HO1A 2EV0A 2FZCB 3M1EA 4PJOA 3NHGA 3BZKA 1Y96B 1U48A 2UUBK 1YOVB 3F8CA 1OYWA 1WIEA 1J75A 2P0KA 4ZJZA 2A6HF 5EVZA 1R0CB 3LAMA 2XHCA 2QENA 1ZLKA 4FJHA 3GMEA 1RR7A 3RZOJ 1Q7YU 2RREA 4J83A 1ZBUA 5LRSA 1MZBA 1SKWA 2FOKA 3N5BB 3RMQA 1YJWT 5GAN3 1YBYA 4WQ5C 5FDLA 3NTKA 5LJ3j 2O01E 1WSHA 2DFUA 4D5CA 4A4GA 4I7HA 2LT1A 1M3BA 3IC7A 1K4US 4J2BA 2XO7A 3I59B 3HJFA 3E19A 1QP2A 4LD5A 2EGEA 5B8HA 5BPNA 1KD1R 1X3UA 2DFHA 3WVEB 2LQWA 4H5VA 3DKMA 4FCYA 4EMKA 4HSRA 3FX3A 4WQ4C 3SK3A 3VYHB 4D1QA 1XNRK 4CHUA 4PJ0C 4DWIA 2I0NA 1YNZA 1KLMA 3EG1A 1HLUA 1OR7C 1IV0A 1NG2A 3L2RA 3CCRT 2OC6A 3HC7A 4JUVA 5AFUA 2OA8A 2AK5A 2VKEA 5LY3A 5DM6F 2GXBA 1L3TA 1TUGB 1IHWA 1PYVA 4BY7J 4CA0A 3NF6A 2GLOA 1LJ9A 3H0HA 4CW7B 2QM1A 1UHSA 5GAN6 4BC5A 2CS7A 8ATCB 1JLBA 1LOTB 1ZAOA 4QW2A 2PNIA 2B4JA 1V5GA 1M2VA 3OBWA 4PSWA 1S6PA 2HZYA 4UQGA 3QFUA 2V1XA 3R8EA 3CQXA 4BVPA 3RPQA 2KRFA 4CJKA 5LFAA 2A07F 3DU6A 5IN1A 2HMAA 1OPKA 2F48A 5LJ3f 3AFHA 2W1OA 3ZN1A 1NWKA 2F9WA 2DL7A 5HK3A 4DV7K 1ZQ1A 2DI3A 1NJZA 1GLFO 3I0XA 1RDBA 5D3GA 5HNFA 5FLMJ 2A3ZA 1YJ9T 4GGGA 4EVVA 4Z88A 3VSKA 3CC7T 3QKJA 3ZSQA 2RPIA 3ABKH 2F5CA 3IAM2 3CCJN 5GINA 2Y4XA 4HVVA 3OBYA 1NLPC 4EATA 2KJCA 4E7ZA 1IBMK 3FB9A 3SD4A 3S6WA 3LQRA 3E66A 2GV9A 3AG2H 3MEXA 1XQPA 2ASOA 1LOJA 1VQ9N 5J8CA 3KFVA 2P9LB 2OPPA 4CEBA 3GNFB 2QG9B 2FSKA 1F4KA 4HEA2 3JS6A 1UGSB 4C1NK 4YIRX 2DODA 4YNQA 1RETA 3C7NA 1TVRA 5FU6B 4G12A 3OR1C 1R23A 2Z9OA 1RGIA 4M75B 2LJ3A 1Y8QB 4KTZA 4BEHB 1K9MO 1UGVA 1U78A 2KZMA 5ERIA 3IUOA 3SBTA 1Z21A 1N8RR 2E1HA 3HSBA 2QQRA 5C15A 3GE1A 4HUGA 2DZ9A 2P5OA 3QYBA 3IH7A 3MPUB 1OH6A 2IJLA 1YIJQ 4LITA 3H0IA 1YIJI 3SQNA 1VF9A 1X1BA 3CMMA 4DKWA 3HTRA 1BIAA 1YI2A 3CJ1A 1TSFA 1K7AA 4XSZF 4DBRA 4JYKA 4C2UA 4BQZA 5LJ5j 1CF7B 3VEZA 3TKYA 3OYGA 1BW6A 3HGYA 3DLLL 3NFCA 1TWBA 1IO6A 4LIVA 3P7NA 3K4MA 4WXCA 2KE9A 2JA5J 3AG3H 2V8KA 1PRLC 3HFOA 2HHXA 2JUFA 3VU3C 3SYTA 1XOVA 4AU7A 1YVNA 1A5XA 1ACMB 5IYCJ 1ITYA 2L3SA 2R5YA 2CZ7B 4LG3A 3Q0WA 5KE3A 4A4EA 5FKOA 4HV5A 3LFUA 3SWNB 4RTZA 5EU7A 2LY9A 4D7MA 5FRMA 3AA5X 1LFBA 1QVFM 2MH2A 4XTWA 3KYDB 4X6AJ 3ZMDA 3GYHX 1Y97A 4BGAA 1Q1VA 3MP8A 5E1ZB 4KMFA 5L3BA 2QWRA 1SD7A 1M4ZA 2ASPA 2YKMA 2K5FA 3HRSA 4BB7A 3BEXA 1QVGS 4CZGA 4X62K 2IOCA 1A5JA 4S0HB 2KL4A 2RVCA 2CUDA 3QNOA 2O61A 3VENA 5LJ5f 3G25A 2ECCA 5BNGA 1KRPA 3OYBA 3DTKA 3S3MA 1GL5A 3T5XA 1S7EA 4HLXA 5J40A 4DLEA 4OOIA 1ZBIA 1VSKA 5DDGA 4D9JA 4ID5A 1WEGA 2JJ7A 4CZMA 2A1SA 3CC2N 1OFCX 2QQBA 2NUPA 1RDDA 4I9QA 2JPSA 1T2KA 1B8IA 2W7NA 2PAVA 3QP6A 2HOSA 1XQHA 4GBQA 4YEJA 5BN8A 3MXMA 3PVLA 3GFLA 2UWMA 4H8KA 2DBMA 3NAUA 4G6QA 1T95A 2DCEA 2KDOA 1K73U 4M9ZA 3JAMO 2FBXA 4DOZA 4FHTA 2O2OA 4KUDK 4M3EA 2RKIA 1YCYA 1IKWA 3KEYA 4EP5A 1W0UA 1FOXA 5JVGL 1TH7A 2P5LC 4OFAA 4B3AA 1R9TJ 3QOEA 2LY1A 3R2XC 5HLIA 1P7MA 2PYLA 3KLNA 4BE1A 4I9LA 3VQ4A 3WU0A 1FK9A 2RQQA 3DLRA 3HPGA 3FXUA 4F4KA 4BRFA 2DM1A 3O3FA 5AQNA 2DK5A 1JT0A 4RGUA 5DM7R 3I56N 3ITHA 2DL8A 5DEQA 5EEGA 2VQHA 3ZL7C 1E3PA 2VXZA 4M7DC 4RCHA 5IOYA 4J2EA 3LAKA 3F22A 4FLTA 1N34K 1VQ8A 5AQIA 2K9LA 1ZUUA 3J80O 2K3BA 5HDNA 2H09A 2M4GA 4XTXA 3GUDA 2KHOA 1AKHB 3NH0A 3PLAA 3LM9A 4J9HA 4DR1K 2FHDA 3I64A 3ZT4A 3FK6A 2CH4W 2RKHA 2X6NA 3FR0A 2V8JA 4M3TA 4BRQA 4KRFA 3AVGA 1NJIC 3HP9A 2CQ7A 4N9IA 4OINF 1ATRA 4JI5K 1MUYA 2I5JA 5FU7C 1PUFB 3K9KA 4DV1K 1VQKN 4U0WA 1DQUA 3FZMA 2M2EA 3SMSA 1DGRM 4KT6A 1W70A 4R56A 2P9UA 3BTCA 3JCMW 2XSJC 4GV6A 1XPXA 2H94A 4M75E 3O08A 2BVLA 5TJJA 5D7UA 1IN5A 3QZ9B 2W4SA 2COZA 5FPMA 3GLLA 3GWZA 3MWPA 3S17J 4M7AB 2K85A 4FLUA 5AQRA 3O4WA 2DA3A 4BJ5C 4I6ZA 3VGLA 1VQ6N 4OIRF 4KHWA 3OIOA 2ZFUA 3AV9A 2DMQA 3GX4X 3HSCA 3P8HA 2R7RA 4MQ9F 1E3OC 3BR6A 2W85A 3KZZA 3EEQA 3CP2A 1SKRA 4CC4B 3EYIA 2CU7A 1CZBA 2STWA 2P6SA 4KT0E 2OTJQ 5E1XA 2OTJI 3W6JB 2ZKZA 4MGRA 4NXMK 2WSFE 3CC4N 1NTCA 4DJAA 3ERED 5B5EC 2I10A 4E7KA 2C6YA 3O5ZA 3CJTB 1WJRA 4CZEA 2L4MA 2MH9A 4M74A 1JQQA 2ZPGB 3P8BB 3ZCMA 5EX5A 2ROTA 1TNSA 1OZ2A 4DLGA 2QBYB 5EJCA 1E7OA 1X75C 3I5UA 4OPJA 4M3ZA 3VN5A 1Q82U 3NNQA 2VWJA 2BBYA 4B1RA 1R7JA 1JLEA 5GPCA 5ILVA 1U06A 5J2NA 2K9SA 4FT8A 3CCUT 3IWZA 2IW5A 3G71N 2CWEA 2OBPA 4UNFA 2VC1A 3GLXA 2EINH 3UA6A 5E20A 3EZWA 3DLLA 3K59A 4DV2K 4BJTA 4ZYHA 2MSYA 1ZH5A 4CK2A 1HJOA 2DMUA 4ESJA 3CPEA 4UV9A 2DPNA 3CUOA 1IZ6A 3G73A 4DQRA 2H8HA 1EX4A 1RAFB 2KRCA 3EGUA 1F1ZA 1VQ7N 4KHNA 3C0BA 3VFZA 4CFBA 5AQJA 3QFPA 3ZQFA 4C0DB 5BPMA 2OTLT 4TV7A 1ETKA 4KRTA 4W5RA 1U0JA 1UGPB 4M3FA 2MCNA 3CCVQ 1OMIA 3CCVI 1ZBHA 4QVZA 2W42A 5GJVB 1TS9A 2HSPA 4RAZA 4HNUA 1YN8A 5DD4A 3GXOA 4ZGDB 1VQMQ 1YI2T 4DW6A 1VQMI 3NH2A 3G2BA 4F7UG 4MTEA 2E60A 3FKJA 4JDSA 4M7XA 1YWPA 5I21A 2VBYA 2Q31A 2E1MC 4QS8A 4DTPA 3A8HB 5FPEA 4YOUA 2LRQA 2VPLA 1IRZA 4FLZA 1VQ5A 2OZUA 3RSEB 4RBOA 2VT3A 1F5TA 5AONA 2D8HA 1X3MA 3WNHA 4DA4A 4CEQA 1M90C 2P0PA 2ZJPF 4C0ZA 3C4SA 4BQNA 3VS2A 3VKIA 5IHKA 4E7HA 3UKRB 3B8AX 5SZTA 1WHKA 2YG9A 3B6OA 9ATCB 5LL6Z 1YHQQ 1BI4A 1S1WA 2D0AA 3BR5A 1YHQI 4H0EA 1NE8A 1I5LA 3ULQB 1G3TA 3PO2J 1S8NA 4OJRA 5KPTA 1Q81U 2LNBA 2V7FA 1HCRA 3WGHA 1M5Q1 2IDOA 2W41A 4GY2B 2NRVA 3CLQA 2RDPA 3CCEA 3AKZA 4NOYA 1BBYA 3HSRA 2HF3A 4Z4GA 3NVKA 1DEJA 4KB1A 3V1OA 4JK9A 2DTUA 5FD6A 2OAWA 2CYZB 2WACA 3LSHA 3ZEHA 4X1VA 4O8KA 2RH2A 3CD6N 3QLHA 2OQRA 3ID8A 4P5OA 1DTQA 2L7FP 3FXMA 2ATCB 3QO3A 2HEQA 2O4GA 5GANg 1V4TA 3HPHA 4KITB 1P59A 2P4WA 1FYMA 1HPZA 4XKBA 4RB0A 4K41A 1RBTA 3SV3A 5IHIA 2RHZA 1QMCA 4ID1A 4U7BA 3DWLE 3PFIA 5EZHA 1MH3A 2MK5A 1L3VA 3Q3SA 4M7AE 3G3ZA 3RZDJ 4BC4A 3JRZA 1XSXA 4BL0B 1YXQA 4EFHA 3I0RA 2LNVA 3EUHC 2KBTA 3HGGA 4CEFA 2EIFA 3OMCA 4L0ZB 2WBNA 1KQ9A 1RT1A 1XNQK 4XR6A 2LTOA 1SF9A 1OQYA 1N39A 2NUTB 1TWCJ 2PN6A 1Y0UA 2YRCA 4A3FJ 3M8JA 3M8EA 3ZSRA 3H1QA 1BK2A 2AQEA 2KLOA 1ZSZC 4OP0A 5FB2A 1VK0A 2BYVE 4A3CJ 2KRNA 3GO5A 4I0AA 5HL7L 3E7LA 3ELKA 3IAYA 5HLGA 2M9UA 3TU4K 2Z1GA 2DIQA 5GAN2 2PUKB 1K79A 3M4YA 3LSJA 4K11A 4QCLA 2JSPA 2CW8A 4H4MA 4I09A 5EEHA 3M56A 4Z4HA 2XPWA 4AYBN 3KLHA 2BW3A 1M1KO 4KBMB 3MEVA 3HK2A 1HW5A 5A2QZ 4IHWA 3HOUJ 4CBWA 3O9UA 4G9YA 2ETHA 3WTWC 5F0HA 3CW7A 2FOWA 3JCMb 3N4QA 1U84A 4M77B 1R8OB 2VXDA 3DQVC 2M0YA 2NUBA 4EMSA 5M3FJ 1WHGA 2YNFA 3J7ZI 4CFDA 2K27A 3CMAQ 3ER0A 2V7ZA 1U5TA 3CMAI 4JKDA 3KX2A 4EV0A 1YIJT 3F23A 5GAMg 1BOTO 3MP1A 1YRNB 1XTAA 4I6MA 5J1EA 3QWLA 3A02A 4NC7A 3BQYA 1VQMA 3TEEA 2NWMA 2KW4A 1D1BA 1LWWA 1O9SA 4FTHA 4O0IA 3CXCP 3PIPL 3P31A 3WXJA 3LPUA 4C92D 2BZTA 3WE3A 3TO7A 3QEVA 1SAXA 1ZA1B 2MABA 2W57A 4E4HA 5M1FA 4N41A 4B8XA 1V76A 3HRUA 1SRLA 3CQTA 2LKSA 1JU5C 3OV8A 2YJEA 4QIWN 2YWWA 4JX4A 4DQSA 5JHFA 2E1NA 4M41A 2DXBA 3UR3C