4IKFA

Pfv intasome with inhibitor mb-76
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2-Hydroxyisoquinoline-1,3(2H,4H)-diones (HIDs), novel inhibitors of HIV integrase with a high barrier to resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein/dna/inhibitor
molecule keywords Integrase
total genus 101
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ikfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ikfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ikfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ikfA03
3NFAA 3NH0A 3SZ2A 4B08A 3V81A 4GVMA 1J53A 2QKKA 4CHQA 3FFIA 3LAKA 1OYXA 3QEPA 3SPYA 4FJGA 4OKKA 3M8SA 4GW6A 2X4WA 1NK8A 2F96A 1KCFA 5FRNA 4UC4A 1RBRA 5HRNA 1C1BA 4R5PA 3V9XA 3QESA 3CFPA 2BKDN 4E7KA 2KQ2A 4OLBA 3CM5A 1NK7A 2BUDA 3NGYA 5SZTA 3DLGA 4B9MA 4FLXA 3I0SA 3LP2A 3ZT4A 3ISNC 1LWEA 3PY8A 3S9HA 3MO8A 3SQ0A 2DAQA 3NF8A 2Z1GA 3HPHA 2HHVA 2XRIA 1RTIA 4EZ6A 3CQ8A 1RT3A 1OZ2A 2RI5A 4CEDA 4B9TA 4CIEA 3K5OA 4FJNA 4L59A 3AA3A 4LY7A 4A4GA 4RW6A 3VN5A 1WAJA 4KV8A 4CEQA 3QEXA 3CEYA 1T8EA 1NKBA 4PQUA 3MEWA 3D45A 3H6ZA 3CFOA 4DU4A 4RW4A 5CYMA 1N27A 3OMGA 4HUFA 3PX6A 2HVHA 4KRFA 4CF9A 4JRPA 4J2BA 5HBMA 1Q8IA 4PLIA 3VQEA 4A4EA 1XNIA 2WACA 1WSEA 1VSJA 5KI6A 3VA3A 3OY9A 4N56A 3QNNA 3I8DA 1BISA 4W5QA 1S1XA 1ASVA 5IAYA 4FM2A 2IG0A 4E7HA 1NK0A 2FC0A 4F2SA 3QETA 2FBVA 1U04A 5K14A 3VA0A 1SUQA 3DM2A 4FLVA 5KCOA 2JGUA 3A2FA 2IAJA 4ID1A 3OYNA 3FEOA 3OQ5A 3L3VA 2EHGA 3NGIA 3BDPA 4E7LA 1WSGA 2O4IA 4ELUA 4KI4A 1C6VA 1Z26A 2FBTA 3D0PA 3K5LA 1JLGA 3KLFA 1T7PA 2D9TA 4TSXA 1RTDA 5JS1A 4Y1CA 4Z4HA 2HW3A 3AVFA 3QLHA 1HJRA 4Z4CA 4IDKA 4KB1A 4QQDA 1OI1A 3PV8A 1NK5A 1RI0A 1RT5A 2YKNA 5CZ1A 3OJUA 3FC3A 3JSMA 3OS2A 3U3YA 2XY5A 2F5KA 1K6YA 1SKWA 3CFRA 1ITGA 3S3NA 4FM0A 1IG9A 3OA6A 3LP0A 4I9LA 2Y1JA 3L2QA 1RDAA 1EP4A 3TAQA 5I42A 1QSSA 1IO2A 2DIGA 3HYFA 3OVNA 4G1QA 3TAGA 4B3OA 2HHSA 4CEEA 3SUOA 4M3TA 2KTQA 4II1A 1EKEA 3OYBA 3MEAA 3V1QA 1ZBHA 4AHCA 3DLKA 4KKOA 4EP4A 3QBYA 4WE1A 4JLHA 4HTUA 1SL2A 1EX4A 4J2DA 3EZ5A 4DWIA 2RJEA 1C0UA 2LTOA 3K58A 2E5QA 2G8KA 1D9FA 3MEEA 4DTNA 3VQBA 4ICLA 1X1PA 2NLUA 2IDOA 2EQJA 4AHTA 3HM9A 3AA5X 3LDSA 2QQRA 3O3HA 1D5AA 2HB5A 1GOBA 1HYZA 3SPZA 4Q0BA 4PWDA 1HRHA 5SWMA 2G3RA 3NGZA 4KREA 3NNQA 1KHCA 4N5SA 1BIUA 3OYHA 1WN7A 4N76A 4PY5A 4Z02A 2GV9A 3KTQA 1FKPA 2LSNA 4E7IA 3E9FA 3VQQA 4CJSA 4DF8A 1U45A 5J26A 3CG7A 1WJRA 4DQIA 4FJHA 1S1TA 1EETA 4CEAA 1A5VA 1D9DA 3DRPA 3AA4A 3V9WA 3KKRA 3MP8A 3MEUA 4DS4A 4CF1A 3QIPA 4H4OA 4BDPA 2VYTA 2YNFA 5J2MA 1HQEA 2XY8A 4KTQA 3PMIA 4IUVA 4Z4FA 3BDLA 5KCHA 3M8PA 4M42A 2HNDA 4HHTA 4F3OA 1HNVA 1DLOA 1KFDA 2JLEA 4CJPA 1VSFA 3ZT0A 1VK0A 4CEBA 3O3GA 4DLGA 5E41A 3DOLA 4DQSA 1HYSA 4C5GA 3SQ2A 3V6DA 4C5IA 1DTQA 4CJKA 3AVAA 3HPOA 2I5JA 2IGIA 3AVKA 4AHSA 1Q9XA 1QSYA 2PZSA 1HYVA 1BGXT 3OYDA 3ZSOA 1BI4B 3O3FA 3L8BA 1WSFA 1NOZA 3OYFA 2ZQBA 1A5WA 2XO7A 1RBVA 4FLTA 1IKXA 5KGXA 2P5GA 1L3SA 4RW7A 1CZBA 1Z25A 4FU6A 4E1NA 4FLZA 4E89A 1KLMA 4DSEA 1KRPA 4DSJA 3QO9A 3AO1A 1JXBA 4CJ5A 2JTFA 3V9ZA 2VWJA 2E6NA 3QEIA 3QJ6A 3IS9A 4IUTA 1NOYA 1RT2A 1FK9A 4KHYA 4FJLA 4CJUA 2OPPA 1JLQA 4B9UA 1ZBFA 3VQ5A 1BL3A 4M45A 2RJFA 2X35A 4BWMA 5KRTA 4DTOA 4LD0A 1YTAA 4CK2A 2GBZA 4DU3A 4DQPA 2P51A 4M3XA 3WNFA 3ASKA 1X9SA 3OS0A 5FROA 1MU2A 1IH7A 1XHXA 4FVMA 4AHUA 4B8CA 3DMJA 2KFZA 4AILC 4CFBA 4UQGA 5KH6A 2M16A 4DQRA 1SKRA 4KHNA 1G15A 3RRHA 4NYNA 2BIVA 4FL6A 1SV5A 2HVIA 2HHWA 4A4FA 1RBUA 1VSMA 3QERA 3PO5A 1CXQA 4W5RA 3SCXA 3KD1E 4HCCA 3RTVA 2OPSA 4L8RB 5JS2A 4CF8A 3TR8A 2B8AA 2X6SA 2K3YA 4B9VA 2GFAA 1YTUA 2F8SA 1WGSA 2IOCA 1LW2A 2G8UA 4B9SA 1IKVA 4CHZA 4CHOA 4CEZA 3L2VA 4FJMA 3K5NA 2X4YA 2VG6A 2ZD1A 4CFAA 3U6FA 3TARA 4CCHA 4KHSA 3QEVA 1LV5A 1L3UA 4J2AA 4W5NA 2HNZA 3M8RA 4FJXA 2FBYA 4CGIA 4M3ZA 4CEFA 5C0MA 4NZGA 3RMCA 3C4SA 1WSHA 1J5OA 4DFPA 5J1EA 2HQEA 4QCLA 4CJFA 4FLYA 2QXFA 4NCGA 4FCYA 1RNHA 3CM6A 1ZBUA 3E9GA 2RHYA 1X9MA 3P8DA 5D6XA 4CHPA 3SYZA 2RHIA 2VG7A 2RJDA 4IG3A 3NBPA 4BDYA 2EQMA 2B5JA 3ZSZA 3VQAA 1Y97A 4CF0A 2L8DA 3ZEHA 4EP5A 3NH2A 3QNOA 3KK1A 3V4IA 4FK0A 1X9WA 5HRPA 2DFEA 5D6WA 5J2QA 1SL1A 4B9XA 1WSIA 3SV3A 3IRXA 3HJFA 5D3GA 2XHBA 1RBSA 3UIQA 2R57A 3LZIA 3SD4A 2RPIA 3C6UA 3TANA 1JL2A 1NJZA 1TAUA 3META 4OVLA 1WJSA 5EU7A 4CFDA 1TK0A 3DB3A 2RF2A 5J2NA 1NK9A 1U49A 5HROA 4QVZA 2R5MA 5D6YA 3LANA 4QAGA 3LYIA 3HT3A 3HXMA 2ZE2A 4N41A 3AO5A 3UT1A 3LZJA 5KE3A 1SKSA 2P5OA 4HCZA 3OYMA 3NTKA 1KVCA 3K57A 3F73A 1JXEA 2HMIA 3C95A 3RMAA 1FKOA 4W5OA 4JRQA 1N5YA 4CJTA 1JL1A 4BE2A 4DQQA 4FM1A 4DTUA 2P0KA 3RR7A 5HRSA 2JZ2A 2O4GA 3TABA 4GMJB 4C8LA 1G5VA 2VG5A 4DTXA 3LGLA 4C8KA 2RHXA 1LWCA 1NJYA 4NCAA 4OGCA 3ZSXA 3FLGA 1XWLA 1QTMA 4EDUA 4DS5A 2HHTA 3OYIA 4DSFA 1ZYQA 3P8HA 1BCOA 4FLUA 3HP9A 1TK8A 3KKSA 2CKKA 1S1VA 2PY5A 3SUNA 4CGJA 1ASUA 3F70A 1BIZA 1CZ9A 3HP6A 3SUPA 5IN1A 1NKEA 3AO4A 3EY1A 3QIOA 4FJ7A 3MP1A 4KHWA 1BQNA 4ZHRA 4Z4IA 3NCIA 1JLEA 5KTQA 3RRGA 3DLHA 1RILA 3PNWC 3NH1A 3MEGA 1WAFA 3U3GA 3VQ6A 3OYKA 1TGOA 4OPKA 3RWUA 3TWHA 1L3TA 3NF6A 2RJCA 3M9QA 1VSKA 4QQ6A 1VSEA 3ULDA 4BE0A 4RG2A 3DLRA 4DMNA 3MP6A 3KIOA 3RMBA 3M8QA 4E19A 3DRRA 4W5TA 3LH0A 1WLJA 4I2QA 3SQ4A 1W0HA 5KE2A 4A4HA 1HNIA 2YV0X 4IBNA 4O55A 3ZSWA 1LAVA 3K5MA 3IAYA 1TVRA 4FJIA 3VQDA 4Q5WA 1C1CA 3L2UA 3WNEA 1WSJA 4CJQA 3B6OA 1VSIA 1J9AA 1NKCA 2RI2A 3TAEA 2RN2A 1TV6A 4KO0A 2L89A 1QE1A 1U48A 3RR8A 1VSDA 4PLLA 3DI6A 3AVHA 1RDCA 4CESA 2HHQA 2EQUA 1VSLA 3ZT2A 1C1AA 4OKJA 4Z0UA 4IFYA 4DF4A 1KSPA 3HO1A 5KRSA 4FZXC 3VQ8A 4CFCA 2KZMA 4O5BA 4J2EA 1TKZA 1UAXA 3AA2A 1TL3A 4CEOA 1JLCA 2IC3A 1WNSA 3LAMA 4F4KA 3OMCA 4CIFA 3LWLA 3EYZA 1WJQA 4KB0A 1XI1A 4O44A 4PUOA 3NF9A 1S9EA 1BI4A 4MFBA 3NTHA 1YVUA 2MWPA 3LALA 5FDLA 2DY4A 3LPUA 2D0CA 3KUFA 4K8XA 1QHTA 3O8VA 4B9WA 1S1UA 3KLIA 3NF7A 1LAWA 4OGEA 3ZSYA 3PX0A 4Q5VA 4IUPA 1ZBLA 1XC9A 2BDPA 4B9LA 3SJJA 4OPJA 2ETJA 1GOAA 2GF7A 4F3TA 4BDZA 4MQ3A 1YT3A 3MECA 3L3UA 3ASMA 4X34A 4E7JA 4C5HA 3DLEA 1TKDA 3MXMA 2YNIA 1D8YA 2PYLA 1VSHA 3HPGA 4CHYA 1UA1A 1RCHA 2MWOA 4KI6A 1KLNA 4CRIA 1SSFA 4O4GA 4DSIA 2Y1IA 4NS5A 4QW2A 2B4JA 3OYEA 4YFUA 2X6NA 3TI0A 4RW8A 4LH5A 2EFIA 1N6QA 4BACA 4IUUA 1VRTA 2BE2A 4LSLA 1UOCA 3P1GA 3DLBA 3OJSA 3K59A 3VQPA 3OYLA 3PX4A 2LVMA 4ZTFA 1VRUA 1UA0A 2P1JA 4OJRA 4C8NA 3LX7A 1NK6A 3DOKA 1TAQA 2DFHA 5DMRA 2L3RA 1KTQA 1SL0A 2G8WA 2EX3A 4C8MA 3ZT1A 4ELTA 4K8ZA 5J2PA 3AO3A 2YHAA 2KFNA 4IG0A 2NUBA 2X74A 3O4NA 2A1RA 4CHNA 4OKEA 1J54A 1C0MA 3AVLA 2BGGA 3HL8A 4BWJA 3S3MA 3SQ1A 3LP1A 3PO4A 3T3FA 3L42A 1HQUA 4RW9A 4I9QA 4DTRA 3SV4A 2ATQA 4KPYA 2AJQA 3G10A 3Q1JA 1CLQA 4QQGA 3E01A 3UWNA 1MHNA 4H8KA 4E1MA 4E3SA 5CIUA 1QQCA 5HRRA 2QK9A 2D0AA 3NE6A 3ZSVA 1TKXA 3TAFA 4C8OA 5HLFA 2B6AA 4DG1A 4FK2A 4M3UA 2E4LA 1S5JA 4PA1A 2G8VA 4KHQA 2F8TA 4CJEA 3DLMA 2RHUA 3MXJA 3MAQA 2RHZA 3DYAA 4ID5A 2YKMA 3BGRA 4JS5A 3GOXA 4DU1A 1KVBA 3AO2A 3AVCA 1T03A 2O4XB 2DFFA 3NTIA 3LPTA 4I7FA 5KGWA 4DTJA 3QEWA 5I3UA 4FK4A 3P83D 2KZZA 1EXQA 3MEDA 2GFUA 2M0OA 3SNNA 4F8RA 3ME9A 1LWFA 4FJJA 1UWBA 2Q3SA 1KFSA 2QKBA 4B8AB 4LD6A 4Z4EA 3C6TA 4JS4A 2K3XA 4DSLA 1S1WA 3CYMA 1JLFA 2IS3A 4CGFA 4CJLA 2G8HA 2YNGA 4EZ9A 2ITGA 2D5RA 1TKTA 2YRVA 1JLBA 4FJ9A 1HMVA 2XK0A 4HUGA 4FW2A 1TK5A 4DSKA 3AV9A 3AVBA 1OZ3A 2OZMA 3KLEA 4KHUA 3HK2A 2EKOA 4YNQA 1RBTA 4DTMA 4FYDA 3OYCA 1RT1A 4N47A 4DLEA 4DTSA 2HHUA 1I3AA 3THVA 4FZYA 2OYQA 3OB9A 5M9OA 3VQ9A 3LGFA 4CERA 3RMDA 1U47A 5J39A 4DFMA 1ZBIA 1RDDA 4DFJA 1T05A 4Z4GA 2OZSA 3OYAA 2RO0A 4FW1A 1NJXA 5DK5A 3SUQA 2LCCA 1C0TA 3G0ZA 3AVJA 4KFBA 5CY4A 2Z1IA 3V1OA 1H3ZA 4CF2A 1ASWA 1F21A 1RTJA 1RT7A 4LH4A 4CECA 3VQ4A 2R7YA 1NJWA 1HPZA 3TAMA 3KK3A 2X78A 3H08A 4FXDA 3WNHA 1GOCA 1S9GA 3AVGA 2QQSA 2R5AA 3AVIA 1NK4A 1L5UA 4ZTJA 4DFKA 4AHVA 3KJVA 2GUIA 3V9SA 5HP1A 1IKYA 3HVTA 3AVNA 4M3RA 4AHRA 4CJVA 3KLGA 4M3YA 4IKFA 4KAZA 4CE9A 4GY5A 1B9DA 1S6PA 3T1AA 2XY6A 3SI6A 3ZSQA 1BHLA 4FJKA 2RI3A 4LSNA 4H4MA 3PUFA 2FBXA 2D0BA 5CYQA 3S3OA 5T7BA 3L2WA 2KW4A 3KK2A 3L2RA 3QKJA 1JLAA 2Z1HA 2X4XA 4CJ3A 4O0JA 2O4XA 5C25A 1L3VA 4DTPA 1CXUA 3LLRA 3KD5E 4O0IA 3LWMA 3ZCMA 4E0DA 3F9KA 3AVMA 4CGHA 1RT4A 4CGGA 2RKIA 3IG1A 2R58A 3FDRA 1S6QA 2BANA 2FHDA 2E6LA 2DTUA 3QINA 4CJ4A 1QSLA 4FJ5A 1W9HA 4OLAA 1B9FA 3QIIA 2YHBA 4M41A 1R0AA 1O1WA 3LP3A 2LDMA 4OVAA 4CGDA 1U4BA 3ITHA 3NAEA 3PMTA 2E6MA 4IURA 2DIQA 2XDPA 4N4IA 3DRSA 3V1RA 3OYGA 3C94A 2OA8A 4QOZB 2OPRA 2HQXA 1LW0A 4ELVA 4M3WA 5C24A 3MXIA 3VQ7A 3JYTA 3VQCA 4AH9A 4HVJA 1I39A 3PFSA 3HSTB 5C6SA 3ALYA 4F2RA 2G8IA 4FZZA 2WOMA 1KVAA 3HVRA 4HCBA 3O4QA 1JKHA 4CJRA 1XHZA 4Y1DA 4IUQA 3OYJA 3EAEA 4BD3A 2HHXA 2WONA 1RT6A 2OPQA 3I0RA 4RG8A 2PYJA 5FRMA 3ZT3A 3V9UA 4CIGA 3TAPA 2EQKA 2Z1JA 3K2PA 4BE1A 2G8FA 4NCBA 2PQWA 4FLWA 4N4GA 4CJWA 2LRQA 2A1SA 4C5EA 3S6WA 1BCMA 1REVA 4CK1A 2W42A 4FJ8A 1DTTA 3T19A 3ZSRA 1QS4A 3P5JA 4HUEA 1RDBA 4XIUA 2XY7A 2YNHA 4IFVA 4NYFA 5C42A 4CK3A 3NHGA 1BQMA 1IKWA 3H8ZA 1A5XA 1B92A 1TL1A 4N4HA 4PL6A 1FXXA 2VWKA 3B6PA 4KTWA 5CZ2A 3WNGA 3KLHA 3NDKA 2M1HA 3MEVA 2HNYA 3OS1A 4I2PA 4B9NA 3DB4A 1Q9YA 4KTZA 1RTHA
chains in the Genus database with same CATH superfamily
3L4QA 4N4OB 1J53A 2W82A 2XPUA 1YHQT 3LAKA 5J1RA 4LF5K 4H4KC 4UC4A 1V4SA 3E5QA 3FLCO 1QU3A 4BHBA 2XAHA 3MO8A 4RA2A 5KQ8A 1RT3A 1X1DA 3CC4N 1F1ZA 2NNYA 3D45A 3J81K 2YLCA 3EZWA 3MKDA 3LDPA 1M3BA 5FLXE 4LF7K 2A36A 4N56A 3JRBA 4A3FJ 2D0PA 1TL8A 5JVGL 3G4SI 2JPCA 1BU6O 1DGRM 4I0BA 1U9NA 3T0YA 1Q82R 2JT4A 5GP9A 4ELUA 2FBTA 1TQMA 2CV0A 3TSWA 2KVQG 3AVFA 1QCNA 1D8KA 3J7AP 1NLOC 3Q9VA 2FSKA 2EFOA 2E2JJ 5GAMf 3QYBA 1ZBJA 2K02A 3OVNA 1GXQA 5FD5A 2HHSA 4CEEA 1EKEA 4UB6C 2X4HA 4XRMA 2RJEA 3S16J 4LB6B 4DZPA 2UV1A 2YUSA 1FMWA 4A57A 4PWDA 3CXCS 1RLQC 3WTZA 4ESBA 4HNUA 1W2BP 3KTQA 3E9FA 4PJOC 3JREA 1U45A 3K70C 2GIVA 4O5VA 3BG3A 1EH8A 3DRPA 4IO9F 3OWTA 2UXXA 4B1WB 2QWOA 2Y2ZA 1TUGB 1MBEA 2CQQA 2HD0A 4XKWA 2JLEA 5GPCA 1E3HA 2WAQN 4EGZA 3OYDA 2F4VK 2IVWA 3FRNA 4PJOA 2G7HA 3I59A 3OW2M 2O8KA 1F36A 2P5GA 3DLLL 3ZXSA 4KHWA 2Z1DA 4E1NA 5AQSA 4BY9C 3WEEA 3A0IX 5D5VB 1U06A 3IL2A 1KD1U 3QEIA 3QJ6A 3OIQA 3VS2A 2YRCA 1BOAA 2QA4T 4BWMA 1T3LA 3CJRB 3WNFA 4C8QD 4AHUA 1ORKA 3I4NJ 2KFZA 4AILC 3RMSA 3OL3A 2ZZDA 4AFZC 3OTOK 3HKZA 2NS0A 4EIKA 1KG3A 2X6SA 5EZGA 1OPKA 4YOXA 2HVSA 4R8HA 2X4YA 4CFAA 2NOFA 2NXNB 3WXIA 1JGSA 1IUYA 1WSHA 1HLVA 1Y0MA 5ICEA 5IXFA 4WXHA 2DTHA 1W4SA 5LJ5f 1VQKN 4FSVA 3IQLA 2HBLA 1YLFA 2V1DA 1RBSA 3TANA 2DL7A 4D8KA 5AQVA 2QGFB 4N41A 1VQ9T 2CQKA 3QDRB 3LZJA 1FWZA 4H0EA 2XRLA 3C95A 4BEHA 2VQHA 4RM2A 1UHSA 4HX4A 1JEGA 2O4GA 2F7TA 4XU0A 3LGLA 4OB1B 5GAGP 4DS5A 5AJ3K 1EO1A 2NRAC 4FLUA 3KKSA 3SUNA 2SEMA 3RESA 4M7AC 3WT0A 3VS6A 3SWNC 4CJ7A 5C12A 3NF6A 5IXBA 2QM1A 3KIOA 3RMBA 3RMQA 3ZQQA 1RI7A 1NMNA 2W40A 2XGDA 3HB9A 3RPQA 4CZKA 3GUDA 2XUBA 1IO6A 1LEBA 2KNBB 2XC7A 3QFPA 3RR8A 1HNWK 2HHQA 3SDBA 3AGRA 5LHIA 2W0ZA 1PD1A 5BR8K 5HOOA 3GXOA 5F6FA 2V26A 2KQWA 4B48A 4ILGB 3PX0A 1XC3A 2F6CA 2Z0WA 1VQOI 1LWYA 1MSEC 5AR0A 1YJWI 1UMQA 4M3EA 3FXJA 3HPGA 4EJYA 1LWVA 1VYTA 5I11A 1VQ8N 2F69A 1S5LC 3OYYA 1WHJA 1E6GA 2OPTA 4B1ZA 3U4LA 1NK6A 2EWSA 4M7AB 5LJ3d 2KFNA 2A1RA 4LK0F 2L0AA 2BGGA 3HL8A 3CCSQ 2V7FA 1NG6A 4DTRA 4FPAA 2ATQA 3HRSA 2KJBA 3HL2A 2ZXWH 3WU1B 1UGVA 3HTSB 3FZFA 3MDQA 3TAFA 1Q81R 1T38A 1SFEA 3CMAA 1DPRA 1BO5O 3A5LC 3BGRA 4JKEA 3NTIA 5J8FA 2RQQA 2KZZA 3FM3A 3C1DA 2ZAEA 2P0PA 1LPLA 1K8KB 2QKBA 1KG4A 4FYYB 1FJLA 1M90O 2STTA 2EZKA 3PTAA 5HODA 2XAJA 3BTIA 1TKTA 1QMCA 5CJ9A 1GBRA 1RT1A 1G3TA 2YJFA 3MAJA 3THVA 1YRNA 4FW1A 1ZELA 4CF2A 1KQSM 4IZZA 4DV6K 3CJTB 3CC2N 3JRGA 4U88A 1S9GA 2H6BA 2HVQA 4GYIA 2E8AA 2QVOA 2YG8A 3SAFA 4M3YA 2HOAA 2LX9A 2A0FB 4H5VA 2F4MB 4LJZF 2DL3A 3L2WA 5C25A 1CXUA 3ZCMA 3DEWA 4F52A 1SFUA 1IW7F 1YN8A 3HUGA 2D8HA 2G6FX 1WBBA 3BZCA 1PVSA 4TV7A 3JAMK 1FZPB 3HIFA 3FFKB 3E7LA 3OYGA 1ZGJA 1RAIB 2JPBA 2JG6A 1JKHA 1X43A 4JAXA 2FRHA 4IIOA 1BJAA 2WONA 2NUTB 3MHXA 3V9UA 3K2PA 2ZB9A 3MKZA 2LRQA 2ETHA 2B0LA 3WEEB 5M1PA 3KLHA 1YP5A 2LH9A 3NDKA 4DV2K 3CD6Q 4AD9A 5M1OA 1HOMA 3MN6A 4OMYA 2K9LA 2I7NA 5DLQE 3MN7A 2BUDA 3JCMe 1IBKK 4UNFA 1MBGA 1LWEA 2HQNA 4PQUA 4FHTA 4NC7A 2VOPA 1X3ZB 2HVHA 1GLBG 1U6ZA 2WACA 3I0XA 2OTLQ 3I8DA 2YI1A 3INZA 3DBHB 2XD0A 3HKZN 2QGUA 4UOBA 5KCOA 5C15A 2EYXA 3NGIA 1WSGA 3M4GA 4DV7K 5GADP 1QVGA 2HW3A 1IJJA 1CF7B 3JCMh 2KSSA 1OI1A 2HBPA 1AVZC 4M75F 2BTFA 4BC3A 2O0YA 4ASNA 3FC3A 1AU7A 3HYFA 4NL2A 4JLIA 3DLKA 1VHXA 2EQJA 2CO5A 3LDSA 2RREA 1NJIU 2J5OA 1P8ZA 5FU6B 3OR2C 1VQ5Q 1QVFA 1FKPA 2ABKA 2GTOA 4G9ZA 5ICFA 1EETA 1YJNA 3BJOA 1DP3A 4FT4A 3CCVA 4J9BA 2ZXHA 1Q95G 1SANA 3KP2A 4C8QA 2A40A 3RZOJ 2PZSA 1I5LA 4K25A 5IYCJ 3OYFA 3TP0A 4YPRA 3J7YJ 1U8BA 3BF3A 1CZBA 4ENKA 1ZGAA 1X6OA 3QO9A 2E6NA 4GBQA 3NGPA 2RM4A 4JKCA 3VODA 2RH2A 2QEXA 1IREB 1XHXA 4EM0B 3ENBA 4NC6A 3ISPA 2I10A 1I0CA 3VTIA 3H3ZA 5GIOA 1TWCJ 2HHWA 4ZDPA 1VSMA 2M9UA 3SCXA 4XMYA 4DR3K 1IBLK 2F8SA 4CDGA 2XKOA 4FJMA 3CW7A 4BRDA 2M5WA 4I2OA 5EOYA 2HQEA 4CJFA 1X9MA 2KMUA 5AQGA 2CZ0B 2H1KA 3SJJA 2F5EA 2XDDA 3C12A 3C6HA 5IY5H 4R56A 4C0ZA 2GBQA 2K2MA 4XM3A 5HS8A 1UHWA 4DBRA 3LYIA 3O3KA 4M3BA 1SD6A 3UKRA 2G7UA 5M5WJ 1JXEA 1FKOA 5LJWA 4JRQA 5J3BA 3E2UA 1W2BS 1NJIR 5AQLA 2DXBA 3ER0A 3KVGA 2HBJA 4NBQA 4EMSA 2QWRA 2KBTA 3RKYA 1QZ5A 5GAMj 2M0MA 1WFWA 5KTQA 1T44A 3VQ6A 4FT8A 3I33A 2R0QC 3SQ4A 3R6NA 3K1MA 2PVGB 2EPFA 1C1CA 2RI2A 2K9QA 3E9OA 2QASA 2YU9J 4O8UA 2VYPA 1KQ2A 2RQPA 3GTGJ 2ESHA 1FNNA 4A2UA 4J83A 3CCEA 2KL4A 2XAGA 1XI1A 1W5SA 2NOJB 3ZX2A 1QW1A 1HNXK 3UATA 4DW6A 4JKFA 5JS1A 3VMFB 3CI5A 1HUXA 1D4XA 1GOAA 1ORPA 1M8VA 3DLLA 2LSOA 3TL4X 2L2PA 2EFQA 4BR7A 2Y1IA 4EVIA 4P1WA 3P1GA 1ZYRF 2HZTA 3IHUA 1RAEB 2DETA 2L3RA 3FIWA 1K9MC 2EX3A 4RTYA 1WXTA 3IDHA 1FOXA 3MZHA 4I9QA 3PE0A 4X64K 4BBRJ 5LJ3e 1MHNA 5M5XJ 2VWBA 2DK3A 5DTDA 2D0AA 3NE6A 2COMA 2IP2A 2JA7J 4DG1A 2EGEA 1S5JA 4PA1A 3CCMI 4F3QA 2BZTA 2DYSH 2W04A 5I3UA 2DFFA 2QA4N 3QEWA 4OFHA 2XB5A 2DDAA 2DO7A 3SNNA 3F6OA 5ECAA 3ZFJA 3Q3SA 4CJLA 2NUTA 4XR6A 1PVEA 4C0FA 3F8BA 3JSPA 2SRCA 3HK2A 2W10A 2QA4A 5LL6Z 4QKUA 1PRMC 4N47A 4DTSA 3CPFA 4A0YA 3RMDA 5FO5A 2R7VA 4Z4GA 3D7SB 3OYAA 3R0AA 4JKBA 1GLCG 2VC8A 4IOAF 5LGUA 1ZRCA 3AKZA 2Z2SB 4AHVA 5HP1A 3LSIA 1YJWA 3P7NA 1B8IB 4GCVA 3PUFA 2D0BA 3L2RA 1S6LA 3RPUD 5LY3A 3I56N 1LUJB 3CERA 1EH6A 2E1CA 1W1WE 3AVMA 1G3YA 4PJLA 1KD1O 2BANA 4KMFA 4F7UG 1QSLA 3CPWA 4M41A 2M51A 3SFIA 3A01A 3PMTA 4N4IA 4ESFA 4LLGF 3VDXA 5CVJA 4M3WA 4H03B 1Q82C 3MXIA 2EV0A 4F2RA 2ZCWA 1YI2Q 2M1BA 1REPC 5J6XA 4H5RA 4RTWA 3AARA 1ZHIA 4PKGA 2OPQA 3F9MA 2E3HA 2HBMA 4C5EA 2W42A 4JEPA 1JE8A 1IB8A 4CK3A 2BVLA 5GAHP 3H8ZA 4XU1A 4Q48A 3CZ6A 3VYHB 5EEHA 2O5RA 3V81A 3P38A 1OYXA 4DBFA 4XKCA 2DRMA 2CFOA 2XHKA 4J00A 3CCLT 4FYXB 3AAPA 4JD2B 3KEYA 1BOBA 2BKDN 2E1NA 1QZ6A 4ZN3A 1H9GA 2P9PA 4HDUA 1EWQA 2CH6A 3O9RA 2O31A 4JRKA 3SMPA 2YT6A 1IDYA 4N9IA 1T8EA 1MNEA 2NVUB 3OHRA 4EFHA 4RMNA 2P9IA 3PX6A 2TDXA 3LL7A 1K61A 2EFPA 5KI6A 4FISA 5LLQA 2CW0F 1WI3A 2IG0A 2E5KA 3GMEA 3RTRA 3OW2S 2HKQB 3WODF 3BR1A 2HZDA 3GP8A 3CCET 5CK9A 2JGUA 1JBMA 1VNDA 3BDUA 1WEGA 4OIRF 2ITMA 3QPLA 1CGPA 1VQ5N 1K4SA 4LD9K 3FBNB 3UKRB 3BQZA 3JB9J 4E4HA 1YFHA 3CCEN 2XY5A 5FKOA 3OS2A 4C0DB 4J6WA 3LP0A 4DR5K 5TKYA 3SBGA 2H3JA 3ZYYX 3FZVA 5BPDA 1WZOA 1CZAN 3CETA 2NLUA 2OBPA 3KYLA 1GOBA 4N5SA 4IHXA 1SAXA 2PUKB 5KYYB 1J0RA 4ZYHA 4DUZK 3KKRA 4CF1A 1B34A 4DHYA 4XRSA 4Z4FA 2DNUA 2QWWA 1VQMI 2LRDA 2DMQA 3JR9A 1MNMC 3H6EA 3AVKA 2C6YA 1PKTA 1Q86O 2E5ZA 1XSVA 1HKGA 1VIEA 1F9NA 1VQ4I 2KIQA 1VQ7T 2NOBA 2AHQA 5JVTA 4KGXB 2ROLA 3CDHA 3MQ0A 4CZZA 4CK2A 4DQPA 3I55T 1OH8A 3JCMg 2DJQA 2D6FA 5GMKm 2DZ9A 5KPTA 2WTUA 4PSWA 1YCYA 4FL6A 2OI3A 2X9DA 2I2LA 3RTVA 4B8XA 1UELB 2IOCA 1IKVA 4HG2A 3EUAA 2ZJRL 4H0OA 2FBYA 1GLEG 2VJIA 1MMNA 1QVPA 4Z94A 1OJLA 1S29A 1JXMA 1DGKN 2RHIA 2B5JA 2AKKA 1XNQK 2RC4A 1JUPA 1T0FA 1Z1DA 1I8FA 3IC7A 2IIRA 3HJFA 1KQJA 3WTTC 3HZJA 1NJZA 1D3BA 3PNVA 4YIFA 2LNVA 4GGGA 1W36C 3LA2A 3CCRI 3CPEA 1Y8QB 2DILA 5C0YA 3CLQA 5E8IA 4M7DE 1N5YA 1JL1A 2QK0A 4DV0K 3H0IA 4ATOA 3DXKB 5AQNA 2O8BA 2ZMEA 3W6KB 1TK8A 1BCOA 3P8HA 2RQTA 2QWMA 1VQ5T 1NKEA 3K4NA 3BR0A 4M78C 2KR3A 5IOYA 2RD1A 4G6DA 2XU8A 4OPHA 3D5LA 4XLEA 5EDNA 2CYYA 4MTEA 2HAXA 4I7HA 3H5NA 3RSEB 4OIPF 2H3EB 3CVTA 1SRMA 1UGQB 5LFAA 5EXWA 3ZSWA 1IF1A 3VF2A 2Y4YA 2DO3A 3KZBA 4MGRA 3E6MA 3FKIJ 1B07A 2NRXA 4KO0A 2BZXA 5GADJ 4PLLA 2OTJA 1AA7A 3TO7A 5BREA 2DKGA 3R1XA 1ZSZC 3VQ8A 2ZFUA 2DJIA 2IS4A 2VQCA 2HXOA 3L09A 1JCGA 4F7UB 1WPYA 1YVUA 3LALA 1U3OA 3S1QJ 2ID6A 3O6WA 3W3DA 1M3HA 4ISFA 4JK9A 3ZEUA 3G6EQ 3O8MA 2QUFA 1NEBA 3DCFA 2HNIA 3MKYB 5LJ3h 2KZVA 2JA6J 3LQQA 3CJBA 4H0XB 4C8NA 3DOKA 3KNTA 2JN0A 3EEQA 5LMUK 2DXIA 3TW7A 2ZC2A 2DA6A 2K27A 3QFUA 1YF5L 4BWJA 2VQGA 2IJLA 5GAOn 1OCZH 1VI0A 1C0FA 3K9TA 5TGTA 3SV4A 5DUIA 1KK7A 2C0TA 4XU3A 4FPBA 4GFBA 3CCQI 2N8GA 1T0HA 2RA2A 4B1UB 4CJEA 1V5GA 3I54A 3S41A 4HCKA 2J6OA 3AO2A 4BJTA 3CWAA 2AHJB 4F8RA 1P6RA 2P5LC 2ZPFB 5AT1B 1QCOA 2H1LA 4B8AB 2Q31A 2KZGA 4LXCA 3BF1A 2W24A 2G8HA 4PGHA 3TU5A 4IHYA 2QM3A 2PJPA 1JLBA 2XK0A 3E6DA 2FG0A 2K3PA 1LPQA 1OZ3A 3LDOA 1N34K 4D7MA 4AQYK 2DMPA 2CFXA 5AQRA 4J8OA 5J39A 2JWLA 2LNBA 2K7AA 2RO0A 4KFBA 2DEUA 2ZGYA 4M63C 1JJ2A 1Y0NA 1NK4A 1PD0A 1PCXA 1MUNA 3M3ZA 4AHRA 4ENJA 4Y91A 4AU7A 3T1AA 1NNEA 4DB3A 3H9QA 1X69A 1BW5A 2EQIA 4ZNXA 2V9PA 1HKCA 4BB7A 5GINA 4CGHA 2KI7A 2CG4A 3M4YA 2F5TX 2EW3A 4OLAA 2HL5C 3T8RA 2X1CA 2LJ1A 1QP3A 5GANf 4GV9A 1CSKA 5BN8A 3BLYA 1RGIA 3V1RA 3CMEI 1KU2A 2HQXA 3VQCA 4LD5A 2P6SA 3QUIA 4BGBA 4I98B 1XHZA 2E3IA 3JB9G 4UXNA 1KG6A 1LJ9A 5FRMA 1HLUA 2MD5A 2EQKA 2DJZA 5GAEJ 1VF9A 4BHCA 3CD6I 1BCMA 2EIMH 2XY7A 3ENHA 1RDBA 1TUYA 2DPPB 3DPLC 2DAOA 3RDIA 1KSPA 1T6DA 3CMAN 2JT1A 1YW8A 4HT9A 3NH0A 3SZ2A 1O3QA 2QKKA 5EX5A 5KNLA 1W5TA 4FJGA 4GW6A 2F96A 1KCFA 4R5PA 4IPAA 2PFBA 3NGYA 1A6IA 3M8JA 3I0SA 3VW4A 2HS5A 4UVCA 3GNGA 1VQPN 2NUPB 3MK6A 2NS7A 4D9JA 1YOVB 1W2BA 2MCNA 1N27A 4BI3A 1Z7UA 3K0SA 2BY2A 1OKRA 2KYBA 1PC0A 4FM2A 3A0BC 2NOLA 2DBMA 4IHWA 2E5LK 3F22A 3BDPA 2KT0A 4Q4ZF 4J9HA 4HAMA 4EPCA 1X2KA 4AM3A 5CZ1A 3SYTA 2C06A 3L2QA 1VQ9N 4HNTA 4I6ZA 4II1A 1FOKA 2EA2A 3OS5A 4JLHA 3CCVT 1RLPC 4XTWA 3K58A 2E5QA 3K4LA 2CU7A 2KY9A 1KQSP 3VOVA 4YG2F 4D5CA 3A98A 4YHHK 4JZ4A 1XD7A 1SAZA 5GAOm 3A5NC 3RNJA 3M0RA 4DQIA 2QTDA 2R5ZA 4R1HA 3SWNB 1A31A 4YEJA 1W4MA 2OC6A 3CJ7A 2YNFA 4NQWB 2VCPA 1WJ5A 1YHQI 4YRVA 3X26B 3DOLA 3HPOA 4F7UE 3J7AY 3KEQA 3DXJF 3B6AA 3O3FA 2DOFA 2JVVA 1OISA 2H27A 3DF8A 3QQAA 1JXBA 3BOQA 1USTA 1YI2T 2HKXA 3HOZJ 1K6OA 3DKMA 4KHYA 3A5ZB 4M45A 3HC7A 2L2OA 2EJ9A 1LFBA 2DN0A 5M1NA 1GCQC 3I56T 2K3BA 1BIBA 4BREA 1N5ZA 4D8DA 4BRPA 1P4AA 1R23A 5AIPA 2GX9A 2PMUA 1N78A 4OP0A 3I64A 1WGSA 1WHGA 3ZBDA 5B1BH 5GAOr 2HI3A 4J7IA 1BI0A 1DEJA 5C0MA 4HBLA 3CCUA 1MH4A 1RNHA 3CM6A 2DE0X 3ZSZA 2EQMA 2JSPA 4M7XA 1A35A 2CV1A 3H1QA 2H8HA 2WBMA 2IW5A 2HQRA 3LWIA 4OVLA 4WCIA 2DA4A 3DB3A 5FU7C 2CUEA 1WQ7A 2YU3A 3K57A 9ATCB 3VPRA 3PM1A 2PG4A 3QSUA 3LSKA 2A07F 1IN8A 4KH4A 4FM4B 1PKSA 1YE9A 4HX7A 4J6XA 3OIPA 3CO6C 2P0WA 1HX1A 1T56A 3NMZC 2LLKA 4LOCA 3FXLA 1VSKA 4XKVA 4B3RK 2GLOA 4DBQA 5EEAA 1WLJA 2RK2A 2KEAA 2E7WA 3EG0A 4IBNA 5CVIA 3L2UA 2H09A 2H8WA 1JUMA 4B22A 2M34A 2EK5A 1TV6A 1QE1A 2C0IA 3ZT2A 2JTVA 4NO7A 3CTAA 2FYKA 1DQUA 1YJNN 1FEXA 4L5IA 4KT0E 1S9EA 2O8CB 3G71N 4B9WA 4C0GA 2D1XA 3A5MC 2HVRA 3THWA 2VASA 1ZREA 3MECA 5GAOp 2ZPBB 2PYLA 1I6XA 2HEOA 2MWOA 2X9HA 4H0YB 2VJJA 2YLBA 3KETA 2K9GA 4BACA 2COYA 1NG9A 3VQPA 3R4KA 4HF2A 3GEZA 2VT2A 2EYZA 2G8WA 3K4BA 2QEXQ 2VB6A 2L3SA 1T8IA 1C0MA 2W6KA 4H0VB 1IGQA 3JS6A 1ATSA 1TT0A 2FJ1A 2FZKB 4KMUX 4QT7A 4AIJA 3E01A 4H8KA 2R7UA 1WSUA 4KHPK 2ZGWA 2FF6A 2PZ1A 2XF7A 2F8TA 3DLMA 3MAQA 3MXJA 1WZ2A 5L8RE 1LKXA 1T03A 1KVBA 1BUPA 1YW9A 2XPWA 4RWTA 3P83D 4XQFA 1XTAA 5I2SA 2O8FA 2BXZA 1JB0E 2KYMA 3IWZA 3QAHA 4CI6A 2R7SA 1SD4A 2HPIA 4C0DC 1BDGA 2KKZA 5ILVA 4R55A 4YNQA 3NFCA 1R00A 4BR5A 5JLXA 4XNFA 3GBTA 4K0KK 3E1YA 3OH9A 1QVFP 2V7ZA 3G0ZA 4YOTA 2DLPA 2VKDA 3JTHA 2OFKA 3J7ZI 3MCPA 3HOWJ 4DFKA 2KE9A 1H3HA 5F08A 1TSFA 4CE9A 2F4OB 1S6PA 4DR1K 3SI6A 3ZSQA 4L9JA 2RI3A 1SS6A 2FBXA 1BW6A 3VU3C 3FMSA 3HDDA 2X1EA 4IJNA 4O0IA 3CESA 3FDRA 2DTUA 2YSRA 3L00A 2EGCA 3CCRT 4C1NI 4MZMA 1X9JA 1QVGM 3TTFA 1UECA 1OMIA 5GAN4 4Z2YA 2XROA 2DRKA 2QAZA 4RUGA 1WEFA 2KROA 3PIPL 4CJRA 1OH5A 1UZCA 1VQNT 3G3ZA 2YX7A 2VBWA 2K2VA 3JRAA 2IS2A 3J81Z 3CJCA 1REVA 3O1WA 2D4WA 4XORA 1WJDA 4B9MA 1M8MA 5C42A 5AQOA 3COAC 1TL1A 3HI0A 3WNGA 4B9NA 1ABOA 3GTMJ 2MWPA 4CD1A 2NRWA 1MSFC 2CDTA 2LNHB 1K8AO 1KAYA 2NVTJ 4OKKA 2D1VA 1KC8O 3GZ6A 3HXLA 1OCPA 2E34A 2A5YB 5SZTA 3DLGA 3KE2A 3LP2A 2Z3YA 1T08B 2DK5A 2P9NA 3X28B 3SQ0A 3THKA 2E1MB 2PJRA 4CEDA 3RPUA 5CHZA 3S2HJ 1FMVA 4BRMA 4HUFA 3DKYA 4NXNK 1T39A 2BEOA 1FPQA 5HKCA 4II2A 3CCQA 3DM2A 4ZN1A 3I0TA 4ID1A 3FEOA 1R1UA 2VQEK 1M5Q1 3GTPJ 3H0GJ 4PIIA 1JKOC 5CAIA 4JLGA 1XMQK 3NVMA 3QLHA 2FL7A 4IDKA 4QQDA 3SXYA 2HTJA 2YKNA 4BRHA 1ITGA 4OMLA 3TAQA 4CD3A 2ZF5O 1NJIC 2HDWA 1TTYA 2Y0SA 3L7WA 2Q0RA 2VXDA 1SL2A 4AMCA 2HKNA 3EUKL 5FKKA 4RM3A 1NGNA 1D5AA 2HB5A 2ASMA 5TKWA 2G3RA 4MHGA 2V6EA 3M59A 4CJSA 3VS4A 3ZOBA 1VQ4N 1WJRA 3KP3A 5GAGJ 4B9QA 4XAXB 1A0NB 4DS4A 1W70A 3QIPA 4H4OA 4BDPA 1R58A 4OWRB 1N25A 3V6DA 3ABUA 3ZMTA 2DD5A 1Q9XA 1PM3A 1AWCA 1HYVA 5I22A 1XQSC 3CQXA 3G6EA 2ZQBA 1LE8A 4M73A 1RBVA 2VI6A 3C2HA 4KGZB 2O01E 2VJ4A 2I5UA 2P0QA 2VLAA 2DBBA 4U7DA 3FSPA 4EM2A 4J9GA 1Z91A 4J01A 3JCMQ 2OJ2A 2RJFA 4DTOA 1WGXA 2HSPA 2GBZA 2YX6A 1NGGA 5FROA 1MU2A 2Q1NA 2LG4A 2M16A 4HQMA 5FKNA 4DQRA 2DERA 2HEQA 1RBUA 2RVCA 1X58A 2CZ7B 3OBYA 3OSVA 2OPSA 2D1KA 5ILSA 2EPDA 1QVFM 1YJNI 4CO8A 4CHOA 3TARA 2HNZA 3EO3A 2B9SA 2K86A 4YPHA 1J5OA 2WC2A 2RNGA 3P9IA 5LEKA 4A3EJ 3M58A 5DCFA 2L8DA 4EP5A 3NH2A 3KK1A 3BROA 2E5NA 1ITYA 3IH7A 3PT9A 2LCLA 2XHBA 3LZIA 2RPIA 1K1ZA 4HDVA 2P7VB 2CUJA 3HT3A 3PLAA 2YWWA 3GTOJ 1DU0A 2DMOA 3L6QA 4BRLA 1J09A 2WAQA 4AFSC 4C8LA 1QRYA 2FBKA 4PFPA 3G1JA 1E0EA 1QTMA 1C6VX 4BJ5C 1B72A 1S1VA 2PY5A 3HP6A 3GZ5A 5IT9K 3EY1A 1NHAA 2QF7A 1ACMB 1U5SA 3ZMSA 1B6AA 4WFNL 4IXCA 4HXJA 3PNWC 2DL8A 1RILA 3U3GA 2ZXJA 3SDZA 5AZIB 2R7WA 1RRJA 2EGAA 3CLOA 1LEAA 1N77A 3LDQA 1MPGA 4MNUA 4UB8C 2LT1A 2NOEA 3P39A 4HVUA 4K41A 2A5XA 2RDPA 3G25A 1WYXA 1B3QA 4V2FA 2BYVE 3I55I 1N3CA 1UJ8A 2CZ6B 1TKZA 1UAXA 1TL3A 1QVGP 3LAMA 1XCVA 4IF4A 2HTSA 5J8CA 2AXLA 3CC4T 4C23A 5KPRA 3FZKA 2DY4A 2MFZA 1R8OB 4G8XA 2LKPA 3NF7A 4X9DA 3M0PA 2FUG2 1NJIO 1IV6A 4A3MJ 4A3JJ 3OSGA 4ON0A 3M57A 3HHGA 4X34A 3CD6A 4DSIA 2MA3A 1SSFA 5FJ8J 1X1CA 2A6EF 3RUXA 3GE1A 1G3SA 1V4TA 3CUQA 1J7KA 3JSOA 4BXUA 1UJ0A 5LJ3j 2LVMA 2KRFA 5FWCA 1NG7A 2QWPA 2YHAA 2GIZA 2QCOA 3O4NA 2BUPA 2WY8Q 3SQ1A 4B1VA 4XICA 1Z9QA 1HW1A 3WTWC 4CW7B 4QQGA 2OQGA 4X0GA 1TTHB 2CUBA 2Y4XA 3KX2A 1A36A 5EZHA 1VQ6I 2PVOB 4ID5A 3S17J 1I3QJ 2O4XB 2P9LB 3EFRA 4FE4A 5AQTA 3VEVA 1BU1A 2D45A 2R4GA 1FYMA 3QXEB 2CGKA 2XRNA 4CGFA 4C2UA 4BH9A 3ZMDA 4BHPA 2VKEA 1PU8A 4GDFA 3AV9A 1QNTA 4S0HB 4DLEA 2Y90A 3OB9A 2A05A 1JXSA 2P9UA 4A5BA 4DFJA 4MFEA 5EC7A 3HRMA 3A8MB 3TO6A 4QPOA 1MUZA 4MQVA 4K11A 1LDDA 4LLLA 2R5AA 4KBOA 1OFCX 2BW3A 2UUAK 3HOVJ 3KLGA 4LFBK 3CMEN 2VVKA 2JS2A 1NGCA 4CJ3A 2D2WA 3TSZA 2K4YA 3IG1A 2DLLA 4YFKF 1KC8C 3CCVQ 4A62A 4JJCA 5FLXO 3MEXA 3GLLA 2LFBA 4L9VA 2F5FA 2E6MA 1RZ4A 4OMMA 5DCMA 1O13A 4MEYF 4Y7NJ 1RAFB 4HVJA 3PFSA 4FWNA 5FPNA 1WB9A 4Z8AA 1WBDA 4DR2K 4HV6A 4BD3A 3RKWA 1X2QA 3ZLJA 5ERIA 2FLOA 2KIUA 1D3YA 2G8FA 2QSHX 2XASA 4CJWA 1YI2I 2HHVA 3P5JA 3HO1A 1B92A 5FWBA 4KTWA 1FJGK 1GXPA 5M1QA 5AQXA 1PUFB 4JX4A 2YX4A 4KT5C 4FWRA 3F10A 4Z89A 2VONA 3TW6A 3JW4A 4O5FA 5FRNA 2P9IB 2HU9A 4F9OA 4GV6A 3CO7C 1I81A 2I0NA 3QP5A 2LC4A 2Z1GA 3T1HK 1UEBA 4FJNA 3H1CA 3CMEA 4QS9A 4DU4A 4WX9A 2QQAA 4C9YA 4NLBA 5FPMA 2MBFA 1Q8IA 1Y1VJ 4JI7K 1WJCA 3MD2A 2DXUA 3G4ST 1Z3YA 2O3FA 1V55H 3A2FA 4YTLA 5J40A 4IQ4A 1WHMA 1FYLA 1NTCA 1C6VA 1ZTRA 2LVSA 4M77E 3ULEA 2Y0MA 5E20A 1AD5A 4ZJZA 1XQHA 4L0YB 2O7OA 1RDAA 1XTDA 1VIFA 1LOJA 4AVZA 3SUOA 3V1QA 3MEAA 1IGUA 4PFOA 1UFMA 1NPRA 5DD4A 3ROUA 1B34B 2IA0A 4B23A 3CWSA 2QQRA 1YW7A 1QZYA 3A1YA 2DF6A 1D1BA 2W6LA 4KREA 3GFJA 2LD5A 5I21A 1JU5C 4DF8A 4AG2C 3UA6A 3DPUA 3KYCB 3BTJA 3PIPF 5TISC 3AA4A 3V9WA 3MEUA 2VYTA 4PZJA 1HNVA 1DLOA 2ME6A 3CMAT 5EG2A 3NQOA 1QSYA 3H92A 1WWXA 2QI2A 4LFUA 3ZP5A 2JWKA 4FLZA 1NE8A 4YOYA 2R7DA 1BBZA 4XH5A 4HV5A 4BS9A 1S72I 3R8EA 1FTTA 2L3PA 4BQQA 2OA4A 4I76A 3ASKA 2VQFK 5C4XJ 4B8CA 4KULA 3PIOF 4UQGA 1LOTB 4KHNA 2BIVA 4I6MA 3R3LA 4A4FA 3F0CA 2EB7A 4L5JA 3VRYA 5CKBA 3K1PA 3BY6A 3EGXB 2QEXN 1KD1R 1A6QA 4IL6C 1AOJA 1U1SA 1NWKA 3P8DA 3DQVC 3VS3A 1K73O 1SL1A 1C0GA 3UIQA 2R57A 1K83J 2DFUA 3QG1A 4LG0A 1MBFA 2QA4Q 3LANA 4QAGA 1M2VA 4ZYEA 4A3BJ 3KP5A 3F73A 4KNYA 8ATCB 3GX4X 2EINH 1XN7A 2OAUA 1RACB 1IC8A 3S1RJ 3THXA 1E3PA 1MUYA 1ETOA 1HKQA 3H5AA 3RSNA 5L3EA 3KLOA 4Z4IA 2XG8D 2EZHA 3RRGA 3BQYA 1SZ2A 1VQ7Q 3MEGA 3KP4A 3ATUA 2DVEA 2A41A 4DMNA 3HSBA 4MLEA 5BRFA 3DRRA 2R7FA 4O55A 2YV0X 1JGGA 1G6NA 4P5NA 5C4JJ 1YITA 1YJ9A 3JCMP 1WSJA 1J9AA 2W25A 3RZDJ 3DI6A 1JJ6C 3WXJA 5J47A 1RDCA 2VBXA 2LF8A 4RAFA 3C2BA 3WVEB 4O44A 1VAZA 2AS5F 5FDLA 2GWKA 3G4SA 4Q5VA 3U9ZA 2EV5A 2DOAA 2XIGA 4ZYAA 3S14J 3ASMA 2DVJA 1PUFA 2Z99A 5HLTA 5GAN7 2F2EA 1KLNA 2WV0A 2E2IJ 3G1OA 4LSLA 1B9NA 3OJSA 3UB5A 1SVLA 4GKJK 1VRUA 1OR7A 1Y0UA 5CVRA 3KLNA 1WI7A 2KGTA 3MJXA 1K9MR 3VB2A 1TOVA 1JUSA 2UXNA 3CCSI 4XU2A 3ZSVA 1BIAA 4IOCF 3CXCP 2P4RA 4NNJA 2JMAA 2P9KB 4PK4A 2X1DA 4E9EA 1KA8A 2HQHA 2FNAA 3C0BA 5A2QK 1IZ6A 5KVRA 2NYSA 2ACJA 3ZEUB 4LD6A 1K0SA 3C6TA 2HYJA 2X6OA 3CYMA 1X1AA 3ZETB 1T0FC 2D5RA 1MBKA 1HMVA 1BI1A 4HUGA 4DSKA 4YFNF 2P4WA 1SFKA 4CI0C 1ZR4A 2UXDK 1N8RC 2LBFB 1K9MU 5DK5A 3K4JA 5KYXA 5EGOA 3ASNH 3AHUA 1GLFO 4HEA2 4LK1F 1TU0B 3RR6A 3WNHA 4HT8A 1DDNA 3V9SA 3KJVA 1K9MO 1IXSB 5EG0A 4X9CA 3ZL7C 2AK5A 3G71A 3NARA 2HL3A 2VJ5A 4GY5A 2XY6A 5BQTA 1BHLA 1AOYA 4H4MA 4M7AD 1T6CA 4DR4K 3CC7A 3CCSA 3FM5A 4A63B 1ZRFA 4EMKB 3LP3A 4PKIA 4PJOE 2DDBA 4KUIA 1X6GA 4I02A 2DIQA 4AIHA 1AWJA 2CGHA 4AH9A 1I39A 1H8AC 2LQ8A 4JBAA 5HK3A 5CE3A 2RN7A 1SMYF 4RTVA 3DLLF 3CC4Q 4CZGA 3S6WA 1BWFO 4J2EA 4HUEA 4IFVA 4NYFA 3NHGA 5B5EC 2JQ7A 2R93J 3QJYA 3JCUC 2J06A 5DV5A 3FFIA 2LQWA 2X4WA 1IRZA 1C0WA 1ZKGA 4OB3B 1OCOH 5M1KA 1PRLC 1TQIA 2KKOA 1WVRA 3ABLH 4GRIA 4L59A 1YJ9I 4RW6A 1R4MB 1WAJA 3CVSA 1BOTO 3CCJN 2E64A 3OMGA 4LUDA 2ZFWA 4M74A 1M2OA 3N05A 3VA3A 3V7SA 2FSJA 1S9HA 1QO0D 2JA2A 1RETA 4BBSJ 5A0GA 3WQUA 2FO0A 4ESRA 5HNFA 1WQWA 1SF9A 3B8AX 3K5LA 3EGDB 3M0UA 4E6RA 5E3MA 1TH7A 2PTKA 3PV8A 4JK1X 3LL3A 1RI0A 1RT5A 2XSJC 2QW9A 1SKWA 5D6EA 4BROA 1KEAA 4I9LA 4CXFA 1FW6A 4BRKA 3PIOA 1Q7YO 3G1LA 4RDUA 2LP5A 2OJED 2L7FP 1M1EB 4WXDA 3V4GA 4HWIA 4C2TA 2O8EA 2IDOA 2DT5A 2E7XA 3O5BA 5AQHA 2O8EB 2GNCA 1RDUA 4L5EA 1KHCA 2BVMA 2W7NA 1U5TB 4C92D 2LSNA 1Q1HA 4EVVA 1E17A 1S1TA 4KIBA 4CEAA 2BZYA 3LFUA 1NH3A 2E2HJ 3E66A 3GFIA 2XF6A 4M42A 1F5TA 1KFDA 2R7QA 1KYWA 1VK0A 1NBEB 4DCHA 3GTQJ 4M7DC 2MGQA 1NGDA 3AVAA 3VPZA 3CCYA 1SQKA 3IUCA 3F8MA 3L4IA 3M5RA 4NXMK 4RW7A 4DSJA 2KDSA 4BU2A 2EV6A 4FWKA 2JTFA 2F2WA 3IS9A 2E20A 4BC4A 4RGUA 4B9UA 4FL9A 3HSFA 2VKHA 4RCCA 2MLKA 2CUFA 3F72A 1LMZA 3OS0A 1VQOT 1X75C 1WXUA 4X1VA 1YIJI 1R22A 3EPZA 4W5RA 4HA8A 4HCCA 3OGDA 4CH7A 3CBMA 2EIKH 3BR2A 4XLPF 4XTXA 4L8RB 4B9VA 4V19S 1LW2A 3CCRA 3D2EB 6AT1B 2DU9A 4M3ZA 2OUMA 3S15J 2AKLA 3FXMA 4QCLA 1FN7A 1XGNA 3QU3A 1T3SA 1ZBUA 2V8JA 2BY3A 4FK0A 2LF7A 4X62K 2DPNA 5D6WA 1MA9B 1IJWC 4II3A 4C8QF 4JK7A 1D1CA 4XTUA 1NK9A 2CP5A 5H20A 1TWBA 2ZE2A 2UUBK 3OYMA 1K73U 3RMAA 1N36K 1HXDA 5FFXA 2A28A 4GMJB 2ZPGB 3QWYA 4N9HA 4I01A 2FPDA 4NC8A 2CKKA 3TTDA 1H88C 2YJEA 4GVEA 3I4MJ 1S7OA 2K3FA 2E1MC 2QQBA 3NH1A 3ABTA 2DPUA 3FHFA 3GTJJ 4JYAK 3MP6A 3WTYC 3Q0WA 2OTLN 2DTOA 1W0HA 3PO3J 4M7DA 2K79A 3H3VK 5IT3A 2IGNA 1K78A 4Q5WA 3MPUB 1XSXA 3B6OA 4PJOG 3H5RA 2KJCA 4M9SA 3GVAA 1VSDA 3DEUA 2EQUA 3CCRN 1YQMA 3AA2A 4RTUA 4H5TA 2L3DA 1R6RA 2KT1A 3CCUQ 4KIGA 5E1ZB 4DR7K 4ITVA 1UDLA 3LPUA 1AZGB 1QHTA 1ZBLA 1NYFA 1T3VA 3CC2T 2A3ZA 5CPRB 2V7YA 4E7JA 3DXMA 2EFNA 1UA1A 5H1SQ 1P9QC 4F16A 3H36A 2HF4A 4MLOA 2EFIA 1FBUA 4DGWB 2EAYA 3VV0A 3DLBA 1P7IA 1RAGB 1SC7A 3OSFA 1PU7A 1YVNA 5EG0B 4C8MA 3ZT1A 5HY6A 4M7AE 2OQRA 1MDUB 1KGSA 2IIMA 3B6CA 3A1PA 1I07A 3VS5A 3PUBA 3F3XA 4LN2A 3G10A 1WHHA 2IPOB 4O8KA 4E3SA 1ETYA 1G4DA 4M75C 2O8CA 1YI2A 2YKMA 4J9EA 3KP7A 5GANh 3LPTA 4RTFD 1FIAA 4KICA 1AEYA 3BR3A 4FJJA 1UWBA 2EIFA 4DA4A 3QBXA 1Y57A 4M77D 1I1SA 3VESA 1MW7A 3AG2H 1QGPA 4FW2A 5BRDA 3G2BA 1DUXC 3HHTB 1TNSA 3EE8A 1K0XA 3EGDA 3H3NO 4LNPA 4EHTA 2DYIA 1UB4A 2XKOC 1RT7A 2FQ3A 1IXRC 2ECZA 3H9JA 1IKYA 5E8GA 4CJVA 1X27A 2KISA 1B9DA 5L3CA 2FMLA 1B4AA 4B4CA 4IHSA 5LJ3f 3F9KA 5TRDA 1RT4A 2RKIA 3AY9A 1CQTA 2FZGB 4WFBL 1XPXA 1KQSA 1B9FA 2YHBA 3ITHA 1QKWA 3JRDA 3QICA 2J4RA 3KTUA 3QRFF 1HBXG 4QOZB 2LZ6B 3HTUA 3VQ7A 3KZIC 4O6JA 3Q5FA 1OCRH 3FGUA 1BG3A 3A8OB 5DM6F 2FQ4A 4GYGA 3BE3A 2Z1JA 3I56Q 1G3WA 4A4KA 4IO9L 5GMKe 1SSHA 2G9WA 2YNHA 4KI6A 2AQFA 1W5CC 4KUDK 4ILJA 2QZ8A 5CVUA 3IFRA 2JVHA 2W1OA 3SHWA 2P9NB 2M1HA 3EFSA 1Q9YA 1RTHA 1MZBA 4B08A 2ISZA 2O03A 3V9XA 4E7ZA 2EILH 2Q2EA 4E7KA 4K43A 3JCMV 2K5CA 1H1VA 2ZM6K 1IZ1A 2FX0A 2VE9A 4EGYA 3LDLA 3NF8A 3V8JA 4B3AA 4B9TA 3AA3A 4LY7A 4JX5A 3CP8A 3BUZB 1VQ4Q 3N0UA 4CF9A 5HBMA 4WYBA 4LLNA 1KU9A 2MC4A 2LX7A 4W5QA 3GW2A 2PMZN 4BRCA 3O9QA 5HVQC 2FC0A 2FEIA 5HLGA 1SUQA 2MK5A 1QPIA 1K4TA 2O9VA 2W48A 1QZZA 3D5SC 4B3MK 1HA8A 3D0PA 3CMET 1QWEA 1YIJN 1WJFA 3I5SA 1RTDA 1T7PA 4Y1CA 2XGEA 4PJNA 4DV3K 1OV3A 4IXAA 1M90C 3U9DA 5E84A 1NK5A 3J80K 3JSMA 2IAIA 3SLCA 3DJCA 3UF4A 4FM0A 1B7TA 2WSFE 5HDGA 3L1PA 2VE8A 4M7AG 3PSIA 2CYZB 2A42A 3KHYA 1VQ9Q 5A2QZ 3DTEA 1HF0A 2M7AA 3QBYA 1KHIA 2OU2A 2KAFA 2AIRB 2PLYA 4J19A 1X1PA 4QVDA 1S72T 1FTZA 3LMMA 4M77A 4H0TB 1AKHB 5CR2A 2YSQA 2EVRA 4Z02A 5D6FA 4E7IA 2DA1A 1OKJA 3EFOA 2KIMA 3CCEQ 4ZGJB 2FOKA 3BJAA 5LGTA 5EY4A 2XY8A 3PMIA 4IUVA 2A37A 3WVDB 4F3OA 1U2WA 2E88A 1POGA 2Z9OA 2WSCE 3O3GA 5AQMA 3DU5A 2KFDA 3A01B 1XOVA 3X25B 3P9KA 4MDXA 3K4KA 3T7ZA 1V29B 4DSEA 5K7HA 4WF2A 3DXMB 1FK9A 3DPTA 1BL3A 4Z88A 3O4WA 4M3XA 2DX1A 1VQLT 3G6EN 4XSZF 1LE8B 3T1BA 3MKWB 4WWCA 1IRXA 3C65A 1P59A 1BL0A 1XG1A 1Z21A 1NGHA 2ZPHB 1GCPA 2QYOA 4M7AF 4JX6A 2G8UA 4B9SA 2QBYB 3L2VA 1TS9A 2YHXA 3PGGA 2X0LA 4PFZA 4FCYA 5LD2C 3VYRB 4YIIA 1G83A 1NLPC 1EIFA 1ON1A 4CBUA 3V4IA 3WTUC 2WWYA 4CCNA 4A3GJ 4KITB 3SV3A 3HOXJ 3O8HA 1TAUA 2EBIA 3META 2VUBA 2VIXA 4V19K 3CCLA 1M3QA 3DKWA 2H6CA 2FSWA 3HXMA 1KQSS 3UT1A 3GIBA 1UAAA 3I55Q 2Y31A 4CZEA 4W5OA 4OMOA 1M1KR 2ZJQF 4M75A 4DTUA 3TKYA 2MF2A 4EDUA 2XICA 4DSFA 1E7OA 4BVOA 3AO4A 4NL3A 3VEWA 1NEGA 4YIRX 3QDKA 2HKOA 3WUHA 1J2XA 1DT9A 4OO1J 3O5ZA 4OPKA 3E97A 1TGOA 3RWUA 3M9QA 4XH4A 1ENHA 3FXRA 4E19A 5GJVB 2YHWA 2Z5UA 3K1NA 2OTJI 2B7EA 3M1EA 3R0JA 1LAVA 3WNEA 2HDDA 4C2MJ 2K9SA 3LSPA 2GBYA 1J3TA 1E3MA 3UA7A 1ZA2B 1VSLA 4OKJA 4EJTA 1MH3A 3VS7A 4Y0WA 3LCNA 1JLCA 2YHYA 3OMCA 2X51A 2DOEA 1BI4A 3NTHA 4JYKA 4E9GA 2KXDA 2JXBA 4K8XA 4PJ0C 3CUOA 4CYDA 3OW2P 4DV4K 4F3TA 1R77A 5A0DA 1YJ9T 2DA3A 4ILHA 4XQ3A 1Y71A 1Z67A 2ZSIB 4LF8K 1DPUA 4CRIA 2I5WA 1RRQA 1K8AR 2B4JA 1Q1VA 1VRTA 2M2EA 1YITN 3ULQB 1W2BM 2DQRA 1OQYA 3K7AJ 2DFHA 2STWA 3KWIA 4ELTA 3H9GA 5J2PA 2NUBA 1RUOA 1J54A 4M7AA 4C92B 4RW9A 2X3WD 1SMTA 3Q1JA 2E41A 2OTLT 3D2FB 4U0VA 2EFWA 2NOIA 5CIUA 2XAUA 1SEMA 5CO7A 3A8HB 3D2FA 4CICA 5B1AH 2JRTA 1FOYA 1JT6A 5HNHA 4WQ4A 3UKGA 1JKQC 4UUSA 3QZ5B 4DTJA 5KAFC 4N0AA 1QQOA 1ZQ1A 5C10A 2Q3SA 2AA4A 1HR0K 2ZJ2A 1K4US 4X6AJ 4JI8K 3JRFA 2MIOA 3CCSN 4EW0A 5L23A 5IP9J 4EZ9A 4BR4A 2E2OA 5JFRA 1JHFA 4GKKK 1JJ2P 3V7CA 5BOXA 2XHCA 2PI0A 3VUBA 2HFHA 1U47A 1B8IA 2CUZA 1RUNA 1F43A 2P7CB 4QLCU 4EJWA 5LBQA 3SUQA 2LCCA 3V1OA 1EQYA 1ASWA 2EWNA 4LH4A 1HPZA 2TRTA 2R5YB 3H08A 2X6XA 1VQ8A 4ZGDB 3T69A 2O8BB 1BJZA 2X4JA 1FMKA 5GANg 1M1KO 4ZH4F 1OLTA 1AT1B 5B66C 4X1EA 3ZN0A 2E19A 1TXQA 3HRGA 2GOXB 3E6BA 3T1YK 2L9SA 3A4CA 1O1WA 2QWQA 3C94A 2MMPA 1RABB 2DA2A 2FD5A 2WOMA 4HCBA 1KVAA 3HVRA 1Z9ZA 2MOXA 2CQ7A 1WHLA 1ZUUA 4OPAA 1V3FA 3SBTA 3KP6A 1E2XA 1N9SA 1ONVA 3THYA 4NCBA 3FXOA 3G4SQ 4FLWA 3K4CA 1WLPB 3DP7A 1KU3A 3ZSRA 3ASOH 2NZTA 3AG4H 5FLXK 1J9IA 1NMDA 3REBB 1YJ9N 4WCGA 2KQRA 3O9TA 2IS6A 2NNWA 3HTVA 2WY7Q 4M78A 1CF7A 1TWGJ 3VF4A 2KDZA 4OIQF 3SAHA 1YIJT 2RQVA 2AQEA 1QP2A 3CFPA 3IH2A 1VQPT 1YITT 4OMZA 4J7FA 2JMCA 1FSHA 1XCBA 4DEXA 1HJDA 4FLXA 2BXYA 1YX3A 1BN5A 3WXKA 3GG4A 2LYCA 1WNLA 2XSDC 2JA5J 2OTJT 2CUDA 4WXCA 4CIEA 5C2DA 1UFFA 2WAEA 3VN5A 4CEQA 2M0YA 2CW7A 2JW4A 3FF5A 3J81O 1R1VA 4RW4A 3X20B 5GAN2 4JRPA 5K5OA 5CQGA 2RHKA 4P9FA 2HDAA 3CJNA 4FX0A 2KMTA 3QETA 1KAZA 3TMOA 1SEUA 3I8BA 3VEYA 5LJ5h 1KG2A 4TSXA 1T33A 4Z4HA 5GAEP 1HJRA 3BY5A 4BRIA 2VXFA 1L3TA 3CPWP 1QWFA 5I42A 1QSSA 3BZKA 3KPHA 2E71A 1QQMA 2NRVA 2VQLA 1HDPA 1ZBHA 2P84A 1GV2A 3DWLE 4IEIA 2CZ1B 4J2DA 4BG8A 4XK4A 2A68F 3NEUA 3M7GA 2EKHA 3VEZA 3AA5X 2M87A 1XGMA 3J8AA 3S93A 1HYZA 5DS9A 1YYVA 2NAZA 1ZC6A 1ZX6A 2V1NA 3OYHA 4HKEA 2Y0SN 5CKFA 3CCJQ 2FRWA 4CZCA 1VQMA 4FWOA 3MP8A 1RC9A 4RAZA 1TG0A 4ZZDA 1X3WB 4XLFA 4HHTA 1W0TA 4IDHA 1WQ2A 5DDGA 4CEBA 3RYRA 4C5GA 3BG6A 4CJKA 1AWXA 2FA5A 1IRFA 1OU8A 1BGXT 3HTRA 2ZPIB 1IKXA 2FSNA 1L3SA 4EHUA 2L01A 4J9CA 2QLZA 3AO1A 5L3FA 1X01A 2L7MP 1QQNA 4EM1A 3G7ZA 1VQ7A 1YIOA 2VUMJ 2X35A 3ZETA 5KYNA 2K4JA 1WCMJ 2EYYA 1I27A 3DMJA 2Y69H 1U0JA 3H41A 1S22A 4Y28E 1SV5A 4MDAA 1HK9A 3EKSA 4FYWB 3URGA 1RL2A 4JJBA 3JCMX 4JOMA 2F4IA 5IT9O 1VTNC 2VG6A 5FB2A 5DY9A 4LG0B 4CGIA 3O9UA 1SVMA 3E6CC 3OSSC 1GV5A 3VGLA 3AL0C 5GIPA 2P9SB 3SMSA 4M75D 2A5WA 4FX4A 1TP4A 4OFAA 4JQFA 4IG3A 2GELA 3VQAA 2FBIA 3VYTB 2MLGA 1LQ1A 5BPNA 1BI2A 3JXUA 4B1RA 1VQ4T 1O57A 2DL4A 5EU7A 4CFDA 2JSCA 2ASPA 5HROA 1U49A 3VETA 3DAWA 4A5NA 2DTZA 4DIQA 1W6XA 2MPXC 2P0KA 4Y33A 2OTLI 4DTXA 2BHZA 5F1JA 5DM7R 4CGJA 3F8CA 1IHWA 2PBDA 3GBQA 4AM7A 1U1TA 2M8EA 2HSTA 3HRTA 3IAS2 2R5YA 4CCKA 3WXLA 1UB9A 2ESNA 4BE0A 2DXTA 4D5FA 1OR7C 2DK8A 5AQJA 4M78E 4I2QA 2ENMA 1NLVA 4BUPA 4Y17A 2GCXA 1IGNA 4CUGA 3MKLA 5GANj 2RN2A 1U48A 3VSLA 4CESA 2CQNA 5F0HA 4EIAA 2P9LA 2KZMA 4CFCA 3CXCM 4E6KG 4FWPA 2XIDA 4I6MB 3EYZA 3WHBA 1EH7A 1KQ0A 1MDMB 4LGWA 3GF5A 2D0CA 2J6KA 1RKWA 1S1UA 4IUPA 2E6ZA 3NVKA 4BDZA 1SHFA 1Q86C 2M02A 4CHYA 1HCRA 5I9EB 2CQXA 3FKJA 4OIOF 3TI0A 4RW8A 3VENA 3CCLI 3RSEA 3LSTA 1UA0A 4M3GA 2KLAA 1TAQA 4K2EA 1P4WA 2ED1A 3ZX0A 2JPSA 4JHDB 4MZTA 2X74A 2VPRA 1FP2A 1VYVA 2O8XA 4YOUA 3S3MA 1BYMA 3I55N 2HOTA 1STZA 1CLQA 1WPKA 3R61A 1G2BA 4Y4RA 5HLFA 4QWQA 4BKXA 4P5OA 1VUBA 5JICA 4JRIA 4V2GA 5CKTA 2NWMA 3EE9A 5DCMB 1Q7YU 4EA5A 1EXQA 2BBYA 1ORNA 2VGNA 2UXCK 1TWAJ 4WQ4C 3NPFA 3DEEA 4CZJA 1IV8A 1HQCA 1YJWT 3AL0B 4CC2A 3ZMVA 2YRVA 5B3SH 4KHUA 1RBTA 3QU6A 1Z6TA 4OMPA 4D7NA 2ABLA 1KU7A 3JTGA 2LR8A 4PCQA 3CPWM 2OZ6A 3CBOA 1V5EA 1RTJA 2R7YA 2QQSA 1NZ9A 1QVGS 1JXOA 4EMGA 4HF1A 1XG7A 1M4ZA 1X6BA 5MLCQ 1VQ6N 3CC7T 1W7PA 5FLXZ 2OCCH 1NG2A 1K78B 2LKSA 1LJOA 3BEXA 3L1AA 2R58A 3C7JA 4BR9A 2VOOA 3WTXC 3FZLA 1U4BA 4JKAA 5AQUA 4FWMA 1ZAOA 3A03A 2OPRA 1LW0A 1AWWA 3LW5E 4M72A 2V1UA 3CC7N 2E4HA 1VQ6Q 2CGLA 1XDSA 1WA7A 3I0RA 1EJ9A 3CC2I 3LSHA 1SFOJ 1N32K 3CJAA 4OB2B 2A1SA 3FHGA 4FJ8A 4G12A 1KC8U 1BBYA 3W6VA 1A5XA 2Z16A 4N76A 4E1JA 4ISGA 1D09B 3NFAA 4IRHA 5IP7J 3SPYA 3SZTA 3CHWA 3N4PA 2EYWA 3IP4B 1RBRA 3WGGA 3OV8A 4BNCA 1NK7A 3C0CA 3SK3A 2UYTA 1NGIA 1HKTA 4NHJA 3HPHA 1RTIA 3QODA 2ATCB 5F1RA 4KT6A 4RTTA 1JJ2S 3SQNA 1TZLA 1P90A 3M8FA 5CYMA 1V5FA 4ABZA 2WV1A 2PFUA 1LNWA 1VSJA 2P9SA 3QNNA 3CC7Q 2EYQA 1ASVA 1GT0C 1YI2N 5E79C 5K14A 2E36A 3VA0A 3VWBA 3QO3A 4RLFA 2NOHA 3JB9F 3RJPA 1BA5A 3QWLA 3J81E 4KI4A 2ELJA 4XBFA 5FU7B 1JLGA 2A6AA 1KO9A 4OAYA 1XUPO 1KQ1A 1R5ID 5LJ3g 2Y1JA 3EGUA 1EP4A 2KRNA 3GDQA 3VFZA 3GBGA 3O8GA 3K4MA 2D0QB 4U67L 2CSOA 5JR3A 4NDLA 2IVOA 4IFEA 3EG1A 4BRAA 3JRCA 1ZSGA 2A6HF 4ZGEB 3O3HA 4Q0BA 1ZK8A 3GFLA 4A3LJ 1HRHA 5SWMA 3BPVA 4FWSA 4EMKC 2GOMA 3CF2A 1XGSA 1M1FA 2JRMA 3C3WA 2H94A 1I50J 2X85A 2W4SA 2ZMEB 1ILYA 1JHHA 1M9SA 1PWTA 4DQ2A 2L54A 2FZCB 4XLCA 1KIKA 3FJ5A 1U5TA 5FW9A 1MDMA 2XO7A 2WSEE 1A5WA 4HSTA 1YIJQ 1YX5A 4UVBA 3CWTA 5GTIC 4B3TK 5AQYA 4LDUA 1ZLMA 2IGMA 1UGSB 5K5QA 3VQ5A 2BE5F 3ERMA 1I5ZA 1XDUA 5BN9A 5JHFA 2Z33A 3HGYA 2HVIA 1MMDA 3PO5A 4XTZA 3QPSA 2V79A 5JS2A 3IKVA 4JJDA 4XONA 4F04B 1V4RA 4WQ5C 3UDCA 4CZFA 3HOUJ 2E1YA 2ZD1A 4CCHA 2JMWA 4JUVA 4CEFA 1S7EA 2RB6A 5CHIA 2MYSA 3E9GA 3OA9A 2GXGA 1LV5A 1M27C 1Y97A 3ZEHA 1W97L 1K8AU 4FETA 2PQ8A 5IHIA 2FOWA 3ZGKA 1UJYA 3P4IA 1S72N 1I1JA 2MG4A 2GQIA 5AQIA 3LM9A 4PNOA 5D6YA 5AFUH 1QVUA 5HS9A 3HOSA 2NOZA 1GHCA 1HD3A 4CC7A 2DA5A 1LWCA 4XOPA 4KA4A 2JM9A 2R7OA 4M7DB 2OCEA 1ASUA 1BQNA 2QEXI 3G0QA 3R2XC 5CKEA 4HVWA 3DU6A 4JKHA 4BQNA 4AC0A 3M55A 2JJ7A 1IG8A 1HC8A 3GF2A 2NS8A 1U5TC 5IT9Z 4EA4A 1XMOK 1R4NB 3GYHX 1ZSZB 3AAQA 3JCMc 1WHKA 4BJ6C 1N9RA 2L89A 3CJ1A 4YOWA 4DYCA 4O5BA 4EMKA 2KHMA 3JV3A 4OFEA 3BR5A 5FKLA 3C18A 1TT5B 2RQWA 3TEEA 1JCEA 1R59O 1TW3A 1MV0B 4PSXA 3I58A 3O8VA 1LAWA 1IN4A 2VBYA 2OD5A 1GFCA 3ZSYA 3BWGA 3WHCA 4MQ3A 3I4PA 2I8DA 2R92J 4BUGA 3DLEA 4XK8E 3HSEA 1OVQA 3ERED 4MMLA 1YQLA 4IWVA 4QW2A 2XPVA 3WG9A 2MD0A 7AT1B 2KIFA 4HSBA 1YJWN 3TDZC 2YCHA 2P1JA 1TYQB 1KTQA 4XL9A 3WE2A 1SL0A 4K8ZA 2A7YA 1BA0A 3QMLA 4Y13A 1KG5A 2GZWA 3T3FA 5DEQA 4CSWA 3B73A 1FT9A 3F0ZA 1Y64A 4KFCA 3M4OJ 1MUDA 3CDLA 5F27A 1KZHA 4C8OA 3CC7I 2IVPA 2B6AA 1ZBSA 4M3DA 2NLXA 3QBWA 3GTLJ 4EJOA 1VQPQ 4I7FA 4OINF 4E2FB 1PUEE 2QKLB 2ZSHB 1EBMA 1OCTC 3U9GA 1LNXA 3IV5A 2OTJQ 1JLFA 3UKUB 3ZMZA 2X48A 1UG2A 1UGRB 1YQAA 3CCLQ 5AQZA 5H6RA 2DTRA 3R6OA 3MCZA 3HZ6A 1WRJA 2RKHA 2OYQA 4RCHA 4DFMA 4RS8A 3RDVA 2ZO4A 2KRMA 2CRGA 2YS9A 1H3ZA 2XVCA 2COZA 3M0QA 3VQ4A 4CECA 3EG2A 1WJEA 3TAMA 4A6EA 4G7HF 4JKGA 1ZA1B 3D1NI 2AP1A 3PQJA 2LP0A 4YORA 3J7AF 2XHIA 1X19A 1ETKA 5KYWB 3VEXA 2R7ZJ 2CT4A 4LSNA 2KW4A 4E0DA 3J80Z 2H56A 3F23A 3CPWS 1Q82U 4JKGB 2NRRA 2FHDA 3FBIB 1ZUYA 3J7AO 4RAYA 2XDVA 5C3EJ 3EHRA 2L7KA 1OPLA 4RTZA 2XB0X 1P4XA 4KISA 5C24A 4C3JJ 5FU6C 1BK2A 5GAMe 2O8FB 3HSTB 2QTXA 4IUQA 3OYJA 2IVMA 2BE9B 2HHXA 3LOCA 2OFIA 4CIGA 2QKMB 2PQWA 4N4GA 3EG3A 4OX9K 2NVYJ 4EEFG 1XMKA 5KQDA 5FD6A 5K7FA 2X3XD 1YUWA 4I99C 1HYOA 4A5AA 2HMAA 2IA2A 4KN4X 1NK8A 4A0ZA 1VQPI 2AZSA 1C1BA 2LJ3A 5M5YJ 3A8LB 3CIPA 3CF5F 1JI8A 1ZG5A 4JP0A 3ISNC 5K7ZA 2MSYA 1YWOA 3LH5A 3NMUA 4L0ZB 2P4TA 4M3FA 1QQIA 3CEYA 3A8YA 2WUSA 5HL7L 2KHOA 5D7UA 3H0FA 4FSSA 4NQWA 4DYRA 2V9KA 1OX8A 1MGTA 5KCMA 3VGKA 5IAYA 1VQPA 3BZ6A 2CJJA 2M4KA 1IAWA 2O6GE 1N8RO 1UE9A 2V6CA 1LDKB 2YRDA 5KK1A 3BW1A 2K9MA 2B86A 4IHVA 1VQ9I 5EF6A 2ISYA 2QWNA 4IZ9A 4B1YB 4JZ3A 3U3YA 4D1QA 3EYIA 1IG9A 1PG5B 2IT0A 4B3SK 4BC2A 2DIGA 3TAGA 3IWFA 5LJ5e 2D0OA 4EP4A 4HTUA 1OPCA 3KCCA 5JLHA 4M78D 5GAN8 2LTOA 5TJJA 4LDYA 2LY2A 1ZARA 5BRHA 1XJWB 1IG7A 5KPZA 1BI3A 3NGZA 3QYFA 2ECCA 4IQJA 1BIUA 2ZGZA 2R7TA 1QQJA 3IRQA 3OR1C 1D9DA 4AT1B 1OYIA 1HQEA 3BDLA 3M8PA 5HLIA 2VBZA 3DTIA 1ZGWA 4WK8F 3K9JA 3I55A 4ENNA 2Q2EB 1VSFA 4CJPA 4LIUA 3I0WA 1D5VA 3BG7A 2Q2RA 2YXYA 2E2NA 4ESJA 5LHHA 3O08A 3HHHA 4FLTA 1QZEA 3EQLF 2V4JC 4QIWN 1Z9CA 3ZPLA 2FRYA 4IIMA 4PJOB 2FXUA 1UHCA 1V76A 3BR6A 4A3KJ 3MCAB 1VQ6T 3QOEA 5KRTA 2ASOA 5AONA 1YTAA 4LD0A 3FE1A 3HG9A 1HNZK 1T98A 5DLOA 4HW0A 4CFBA 5KH6A 2DT6A 5IP6A 1A5JA 2RGVA 2K57A 1F1BB 4AF1A 4ZYGA 3UR3C 4E7SA 3FK7A 5ICGA 3A0HC 5E17F 2B8AA 3S2DJ 5IH2A 4H5WA 4OMFB 4J9DA 3CMAQ 3M1CA 1IN7A 2LK2A 4NZGA 3M5AA 2DT7B 5D8LB 3WTSC 4FLYA 2Y9YA 1HKSA 4BXFA 4ENMA 4YDUA 2F48A 3GOIA 5F0FA 1WSIA 2LT4A 3WU0A 1GVJA 2IGOA 4DBHA 4EV0A 1P2FA 5J2NA 1X3NA 5LL6S 3AO5A 5EVZA 2P5OA 5KE3A 1SKSA 1RRSA 3CCQQ 4RKUE 5F64A 2VG5A 4L3QA 1G8XA 3OYIA 3MVPA 3FZMA 5ILUA 1OH7A 4U0YA 4L5GA 3QIOA 2QDYB 4GNIA 4ISEA 3THYB 2CGPA 4LFCK 3JCMb 4BRQA 4JJNK 3M1FA 2RJCA 3H0DA 3BTLA 1VSEA 3ULDA 2O88A 1NU0A 5F04A 3WE3A 5BMZA 4BQAA 3C7NB 3G6EI 3R6MA 4CJQA 2HYFA 1NKCA 4CCJA 4OF1A 1J59A 2JZYA 1LCUA 3TGNA 3FK6A 4FZXC 2JVGA 3EUHA 4CIFA 4CBXA 1QA6A 2IS1A 1YO5C 3VYGA 2FVUA 3CCQN 3ZMUA 4M75B 1AZEA 3JB9D 1R49A 3GZNB 3KLIA 3KFVA 2BDPA 1Q7YC 2GF7A 1S3XA 5JI6A 3L3UA 4N4NB 1D8YA 2G0EA 1TUDA 3PJRA 3ABMH 2ZNYA 1VQ8Q 3HYIA 4E47A 4YFUA 4M6VA 4LH5A 4K42A 1FBQA 4LMYA 1VQNQ 2BV6A 4JK8A 1IDZA 1ZR2A 5HDKA 1S8NA 4CHNA 2QQ8A 1UGPB 3I9V2 3BT9A 3CCUI 5HLHA 4E1MA 5GMKi 2QK9A 5HRRA 1RNLA 3MN9A 3QDFA 5M3MJ 4C8QE 2JHJA 3ATVA 2OTLA 2P6TA 3X2QH 4DU1A 4FK4A 3KZZA 2OTJN 3HJEA 4AI4A 2BTTA 3QYGB 2YNGA 1QCFA 2CT3A 3UPUA 2JJ9A 3ESWB 2OZSA 1OYYA 1S72Q 2QGGA 1F21A 4LDVA 3CUQB 2UUCK 3JCMd 3S1MJ 1UHFA 3DBLB 1R71A 4OAZA 3M53A 3LM2A 3E5XA 1VQ8T 3IH3A 3CMAI 4FJKA 4G6QA 2O4XA 2VL8A 3HKSA 4KRTA 5HS7A 2JOYA 2E65A 2E6LA 3QINA 1KAXA 4BEHB 2XDPA 1MMAA 2CW8A 1H0MA 3PVQA 2A6TA 2NRHA 1N75A 1U2VB 2W84A 3GNFB 4GY2B 4U87A 4EJVA 4XSXF 1F4KA 1K7AA 1XC5A 5F0XA 2X6YA 2CH4W 1P7MA 3U1DA 4UUSB 5GANe 3Q7CA 1U2VA 3CC2Q 1MBJA 2Q1ZB 4J8FA 1YFNA 3O2PE 4EJZA 4KN7X 4A5MA 3L2ZA 3CM5A 5KHDA 3VRZA 3ZN1A 5B8HA 4ZDLA 3ZT4A 3ABKH 2RI5A 1NGAA 4L18B 3G71Q 4A4GA 3WGIA 4N0AC 4ANJA 4KV8A 4C3HJ 3H6ZA 3CFOA 1JKRC 1K79A 1BKBA 4UY8I 4J2BA 3O6BB 5CLSA 4M77B 2EJGA 1AWOA 1FY7A 3ZQIA 3HOYJ 2R3SA 4Q47A 3EFOB 4C3IJ 2F9TA 3TO9A 2IAJA 3N97A 2ZCFB 1LDJA 3OYNA 3FMQA 3OQ5A 1GVDA 4F91B 2KK4A 3HSCA 2DYBA 2FXAA 1K73R 4C8QB 3FB9A 1YHQN 3RBBB 3KK7A 1K6YA 3VTHA 3OA6A 2O9LA 5I2MA <