4IKFA

Pfv intasome with inhibitor mb-76
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2-Hydroxyisoquinoline-1,3(2H,4H)-diones (HIDs), novel inhibitors of HIV integrase with a high barrier to resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein/dna/inhibitor
molecule keywords Integrase
total genus 101
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ikfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ikfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ikfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ikfA03
4QW2A 3QJ6A 4CEFA 3HPHA 4W5RA 4J2BA 2OZMA 1HYZA 3P1GA 2KFZA 4HUFA 4JS4A 3KLEA 1NJYA 1NOYA 2PY5A 5KI6A 1RT3A 2P5GA 3ZT0A 4F4KA 4FJHA 3LANA 5J2PA 4B3OA 1HQUA 1ZBUA 3AA4A 3OYGA 4CJFA 3NCIA 1ZBIA 2X78A 1T03A 4KREA 4CJ4A 3SV3A 3ZSZA 3I0SA 5CYMA 5KGWA 3EZ5A 2FBTA 3C94A 4B08A 3Q1JA 2GFAA 1RT4A 4HCBA 4FK2A 4E7IA 1BQNA 1FK9A 3LZJA 4M3YA 2HHVA 2R5AA 1WSEA 5JS1A 3QINA 2G8VA 4OLAA 1S5JA 5FRNA 3M8PA 1YTUA 1LW0A 3RR8A 4HCCA 4CESA 2XY7A 1G5VA 4DTSA 4FJ8A 3O3HA 4O55A 2YKMA 1S6PA 4AHSA 1QSLA 4F8RA 3O4NA 1H3ZA 4PY5A 4N41A 4ZTJA 5C25A 4B9SA 4M3ZA 1WSGA 3TAPA 1KSPA 4FJLA 4E19A 4GY5A 3NGZA 3S9HA 3ZSYA 1JL2A 1KFDA 3SQ0A 3HSTB 2PQWA 4CGFA 2IG0A 2M16A 2QQSA 2DFEA 3CG7A 3QLHA 5HRNA 3KD5E 2X4YA 4JRPA 3V81A 1VSDA 3L3UA 3AO3A 3KLHA 4PUOA 3SZ2A 3HP9A 3LPUA 2B8AA 3OY9A 3V4IA 5FROA 3DLMA 5HRRA 2E5QA 1U04A 1WN7A 3LLRA 2XHBA 3OS0A 2X35A 3DB4A 2BANA 3LAKA 3OYNA 4CGHA 4E7HA 1TL1A 2O4IA 4H4OA 1S9GA 4OKEA 4BE1A 2RHUA 1LAVA 4B8AB 2K3YA 3ME9A 3HVTA 3KK1A 4KI6A 3DB3A 2R58A 4AHCA 3F70A 4CRIA 3AO2A 3D45A 1BIUA 2YRVA 4Q5VA 4L59A 3HXMA 4FLUA 1NKEA 2E6LA 4DG1A 4FJNA 2E6NA 2YNIA 4KO0A 1NJWA 3MEWA 2WOMA 4IUTA 2YNHA 4CJRA 3CFRA 1R0AA 2YKNA 3V1RA 3NF9A 2AJQA 1CZ9A 4HUEA 3TI0A 4CF9A 3OQ5A 1BGXT 1HRHA 1NOZA 2YHBA 4GVMA 3HVRA 4FYDA 1QQCA 1WJQA 1N5YA 3TWHA 2BIVA 1FKOA 2FBYA 4N47A 3AO5A 3G10A 4CE9A 4O0IA 3HP6A 1NJZA 1RDCA 2MWOA 1KVAA 1SL1A 4CGIA 2JZ2A 4PLIA 5J26A 3AVHA 4CJLA 3AV9A 4FJJA 4DWIA 3IRXA 1GOCA 1VK0A 3DOLA 3VQ7A 3IAYA 1S1WA 3KK2A 2BKDN 3ZT2A 1S1UA 2KQ2A 3QO9A 2D0AA 4NCGA 3MEGA 1RBRA 3ASMA 2RHZA 4C8NA 3NTKA 4IFVA 4N4HA 2RJDA 4OPKA 4KPYA 4DSIA 4CF2A 3RMCA 3OYMA 2F96A 2G8KA 4N4IA 4F2SA 1A5VA 3OYCA 1BQMA 4CJ5A 5KRTA 4HVJA 1XHZA 1N6QA 3AA3A 4MFBA 3G0ZA 4UC4A 4BDPA 5HRSA 3OYLA 5C6SA 2IGIA 4FM1A 2RPIA 1HYVA 1TAUA 1BISA 1JLEA 2O4XB 1RCHA 4E1MA 4QCLA 3HT3A 2JTFA 4FM2A 4HTUA 3FC3A 3OYBA 4QQDA 1MHNA 4L8RB 4W5TA 3T3FA 3OYJA 1LW2A 4IUQA 3SV4A 4E7JA 4BD3A 4EDUA 4CJVA 5KTQA 4KHNA 1NJXA 2HQXA 4CEBA 4BE0A 3SNNA 1LWCA 4FZZA 2QK9A 4DLGA 1JLQA 1VSJA 3LWLA 4CJSA 4ZTFA 3O3GA 1BCOA 3NAEA 3AVGA 4F3TA 4CJ3A 1CLQA 3KKRA 4JLHA 4DSEA 4KHSA 2ETJA 4CHPA 1BHLA 3LH0A 1ASWA 4KKOA 1VSMA 4Z0UA 3QIPA 1SSFA 5JS2A 1TL3A 1TKDA 1L3UA 1YVUA 1RBSA 5HBMA 4DS4A 4DS5A 1KHCA 4H4MA 2RI2A 1QS4A 3ZSOA 2JGUA 4AHUA 5KCOA 2BE2A 1UWBA 5I42A 4Y1CA 3NF6A 2G8WA 2DY4A 3LPTA 4CJTA 2E4LA 1WAFA 3V6DA 3SQ4A 4FJXA 1NKBA 3TARA 1Q8IA 1WSHA 4Z4FA 1HPZA 3ZCMA 3NDKA 2X4WA 2XDPA 3H6ZA 5SZTA 5KE3A 2RHYA 3WNFA 1L3VA 3VQ8A 1WSIA 1YTAA 2HMIA 3OJSA 1JKHA 4DF4A 1JLGA 3OYKA 2NLUA 2I5JA 4CIGA 1RDDA 2Z1GA 1JLAA 4ZHRA 1IKYA 4FCYA 4F2RA 1LV5A 4DFJA 5CZ2A 4BACA 1HJRA 3ITHA 4CFAA 4HCZA 1S9EA 1WJRA 2RKIA 2RHXA 1DLOA 1RBTA 2EQJA 1Y97A 3IG1A 3TAMA 3MXMA 1SKRA 1Q9XA 2RO0A 4Q0BA 1WNSA 4FJMA 3PMIA 1S1TA 2A1SA 4UQGA 1UA1A 3H08A 2QQRA 3PO4A 4B9UA 3KLFA 1XI1A 2KZMA 3ZSWA 3ALYA 1TAQA 3PY8A 2VYTA 2XY6A 2Y1IA 4FXDA 3AVJA 4QVZA 4TSXA 3RRGA 3WNEA 3ZSVA 3AO4A 3LP2A 3NHGA 4DFMA 2G8HA 1IKWA 1LWFA 1QHTA 3C6UA 3QEWA 3KTQA 3AO1A 2HHXA 1D5AA 2GF7A 3LGLA 2QXFA 4I2PA 4CF1A 3OYFA 1MU2A 3META 1RT7A 4CHYA 4OPJA 1NK7A 1D9DA 3AVIA 1XWLA 2RN2A 3QETA 4X34A 2FHDA 3AVMA 4FW2A 3EY1A 3RRHA 4K8XA 1RT1A 4PLLA 1EP4A 2LRQA 3NH1A 2IAJA 3KIOA 4DTXA 1B9DA 3VQPA 3SYZA 3QEXA 5KCHA 3MAQA 1OYXA 3NFAA 4DU3A 4Q5WA 3SPZA 2ATQA 3K5OA 4M3WA 4KRFA 3QBYA 3RMAA 3FLGA 1KVCA 4N4GA 4GMJB 4DSLA 3SI6A 4KAZA 4CHZA 4KHWA 3OVNA 3PFSA 1TVRA 2IOCA 2F8TA 1VSKA 4ID1A 4CJUA 2EKOA 5FDLA 3MEVA 2DIQA 3NTHA 1IG9A 4DQPA 3BDPA 1KVBA 4C5EA 4FJ5A 4I7FA 3VQQA 1BIZA 5HLFA 1ZYQA 4EP5A 2BDPA 1S1XA 2P0KA 4WE1A 2BUDA 5DK5A 4N76A 2QKBA 1TKTA 3I0RA 4C5IA 4N5SA 1QTMA 1VSEA 2QKKA 2WONA 4M3RA 2YNGA 3MEUA 1C1CA 4LH5A 1B92A 5KH6A 3LZIA 3SUQA 3ZSRA 1HQEA 1C0MA 3L8BA 3LYIA 3P5JA 1RBVA 5KGXA 1L3SA 2OZSA 2KZZA 5D6YA 1S6QA 4DQQA 2WACA 5C42A 4CEQA 1KRPA 3RR7A 1VRTA 3C95A 3LAMA 4LSNA 5T7BA 3KJVA 4FLTA 3VQAA 5J39A 4FLWA 4LD6A 1WSFA 2HQEA 2R5MA 1EXQA 4IUPA 1WSJA 5J2NA 3PO5A 2GBZA 2OPRA 3UIQA 3P8HA 2P1JA 4DLEA 1VSHA 3RMBA 3KLIA 3HJFA 3LP0A 4B9TA 4DF8A 4ELVA 3H8ZA 4DTOA 2R57A 4DTJA 4CK3A 3CEYA 1RI0A 3L2QA 3DI6A 3V9XA 4DU1A 3HK2A 4DSJA 3HL8A 4CEOA 4FLYA 4NYFA 1JXEA 3NH0A 3BGRA 3SQ1A 3AVFA 4Z4EA 2RI3A 4Z4CA 4CHNA 3CFOA 1Z26A 4RW7A 3NE6A 2ZQBA 1U49A 1KLMA 4DFKA 3DLBA 4FZXC 4Z4IA 2HVHA 1WJSA 2VG6A 3V9WA 3OYIA 4CGJA 3WNHA 3QEIA 4DU4A 4CK2A 1VSFA 3ASKA 2PYLA 4DSKA 3NNQA 2D5RA 5IAYA 1C0UA 1JLBA 2M0OA 1WLJA 2IC3A 3ISNC 3MXJA 3K58A 4B9WA 1D9FA 4QQGA 2XK0A 4LY7A 4A4FA 3QERA 3NH2A 4CJEA 3FDRA 2EHGA 1NK5A 1T7PA 4RG8A 4YNQA 1G15A 1SV5A 4OGEA 3L2WA 3O8VA 4B9XA 3AA2A 5EU7A 3V9UA 3SCXA 4C5HA 3E01A 4CJPA 4E0DA 1QSSA 2F8SA 4CIFA 2OPPA 4ID5A 4B9MA 1U4BA 1TK5A 4KTZA 3S3MA 4E1NA 2YHAA 2EX3A 3AVLA 3OYAA 4F3OA 4I9LA 1RBUA 3SPYA 3DOKA 1RT2A 1A5XA 4DMNA 5CYQA 3RMDA 2MWPA 4E3SA 2O4GA 4FK4A 5K14A 2IDOA 4KHQA 3FEOA 2X4XA 4I2QA 4CEDA 4ELUA 5CZ1A 1DTQA 5CY4A 3KD1E 4OJRA 2B6AA 2L3RA 4BDZA 2EQKA 1C0TA 3DLGA 4H8KA 4IFYA 3E9FA 1L3TA 1L5UA 3TANA 4PL6A 1RDAA 1NKCA 4KTQA 3NTIA 3S3NA 5KRSA 3ZSQA 1X9WA 4M3TA 1W0HA 2OA8A 4A4HA 1Z25A 5IN1A 1KTQA 2X6NA 3DYAA 3NGYA 3TR8A 3ZT3A 3LDSA 2X6SA 3U3YA 4CJWA 5I3UA 4J2DA 3C6TA 4W5QA 2RJEA 1VSIA 1IKVA 2FC0A 4OKJA 3O4QA 3QEPA 3EYZA 1JLCA 3CFPA 4FLVA 4KHUA 3SUOA 3DRPA 1D8YA 1RT5A 4KFBA 3AVBA 1CZBA 3OMGA 1EKEA 2K3XA 3VQDA 1DTTA 4CF0A 3M8SA 3B6OA 4ICLA 4AH9A 2A1RA 3HPOA 1RT6A 4CF8A 5DMRA 3PX6A 5SWMA 4NS5A 3UT1A 2OPQA 3L2VA 4IG3A 4FZYA 4Z4HA 4KI4A 4KHYA 4C8KA 2D0BA 2FBXA 4FJIA 3QEVA 1K6YA 4O44A 2EQUA 4FW1A 4Y1DA 2LTOA 2G8UA 4RW4A 3OYEA 1HYSA 3HO1A 4BDYA 1EX4A 2ZE2A 4M41A 3DLRA 4OLBA 3I8DA 1OI1A 4FL6A 3NF8A 4OVLA 3WNGA 3MXIA 2Z1IA 3DRRA 2XO7A 3TAQA 1N27A 2NUBA 3AA5X 2M1HA 4A4GA 2YNFA 3HM9A 4DTNA 5J2MA 3QNNA 3HYFA 4ELTA 3F73A 4EZ6A 2KW4A 1Q9YA 3C4SA 3ZSXA 3SD4A 4LSLA 5D6WA 4IG0A 5D6XA 2DIGA 3MP6A 1REVA 3PMTA 3TAGA 1B9FA 3PUFA 1NK9A 4Z02A 4KB0A 3V9ZA 4FJKA 3IS9A 1T8EA 3NF7A 3M8RA 1CXUA 1KCFA 4AHTA 4JS5A 3ULDA 3L42A 3SJJA 1GOAA 2P51A 4CHOA 3LWMA 1SUQA 1XNIA 3OJUA 2F5KA 1TGOA 2G8FA 2VG7A 3B6PA 2RI5A 3VA3A 2HNDA 3V9SA 2PYJA 4LH4A 4DFPA 1C1AA 2VWKA 3OMCA 1S1VA 2LDMA 1NK8A 1NK4A 2L8DA 3BDLA 4RW6A 1FXXA 4C5GA 2LCCA 1IH7A 4IUVA 2XY8A 1X9MA 1J53A 3PNWC 5C24A 4EP4A 3NBPA 4FJGA 4M3XA 4PWDA 2HHQA 3DLEA 1UAXA 4CJQA 4DTPA 4CGGA 4HHTA 1T05A 4Z4GA 3ZT1A 2HHTA 3SUNA 1RTDA 4FVMA 1QE1A 3T19A 2G3RA 2RJCA 1EETA 3PX4A 4J2EA 2HW3A 3QIOA 4OVAA 3OA6A 3A2FA 4AILC 1XC9A 2YV0X 4DQSA 3M9QA 3AVNA 4C8MA 1FKPA 2OPSA 1J9AA 1F21A 1QSYA 3DLKA 1IKXA 4IKFA 1SL0A 3NGIA 3TABA 1WAJA 4RW8A 3OYDA 1OZ2A 4IURA 2L89A 1OZ3A 3EAEA 1I39A 3LP1A 1X1PA 2Y1JA 3PV8A 3MEAA 4B9LA 3DMJA 4QOZB 4FLZA 3JSMA 3V1QA 1ZBLA 3MP1A 3QIIA 2RJFA 2IS3A 3MEDA 4R5PA 5C0MA 3K5MA 2RHIA 4XIUA 3L2RA 3RWUA 3DRSA 1CXQA 1IO2A 3KUFA 1RDBA 1NK0A 2GFUA 5HROA 1BI4A 4CCHA 4CIEA 3ZEHA 1ASUA 2D0CA 4RW9A 4DTUA 2W42A 3LALA 3S6WA 3E9GA 1ITGA 2ZD1A 2Q3SA 3CM5A 4CEEA 4DTMA 4PQUA 4FU6A 3CQ8A 4YFUA 1UOCA 3AVCA 3AVKA 4W5OA 3GOXA 3KK3A 4E7KA 3THVA 2X74A 4DTRA 3UWNA 3FFIA 3P8DA 4C8OA 5KE2A 4B8CA 2G8IA 3LGFA 3F9KA 2HNZA 3M8QA 5CIUA 2Z1JA 4MQ3A 3JYTA 1SKWA 3LX7A 1BI4B 2EFIA 4DQRA 1C1BA 2LVMA 4BWJA 3U6FA 1C6VA 1RTIA 4AHRA 2OYQA 4J2AA 1HNVA 2HHUA 3K5LA 1SKSA 5FRMA 1U47A 2HHSA 1RNHA 3MEEA 4CFBA 1J54A 1I3AA 1O1WA 1W9HA 4CHQA 3AVAA 3TAFA 4B9NA 5D3GA 3VQ4A 3O3FA 3MO8A 2EQMA 4G1QA 4KTWA 5J1EA 3QESA 4I9QA 4NZGA 1RILA 4CECA 1TK0A 3VQBA 4CEAA 4FK0A 4OKKA 2E6MA 3K59A 1U45A 1JL1A 4FJ9A 3RTVA 2XY5A 1HNIA 1TKZA 4II1A 1VRUA 2DAQA 1XHXA 1ZBFA 3K2PA 4M45A 3VQ9A 3VQCA 4W5NA 3KLGA 1ASVA 3T1AA 3QKJA 4BE2A 3CM6A 1SL2A 3VQ5A 4FLXA 1RTJA 3MP8A 1LAWA 2GV9A 4IDKA 1KLNA 3OYHA 1TKXA 3V1OA 4CGDA 4FM0A 2KFNA 4CFDA 3TAEA 3ZT4A 3MECA 4E7LA 2KTQA 2Z1HA 4NCAA 3L3VA 1WGSA 2O4XA 2B4JA 4O4GA 4E89A 4KV8A 4B9VA 3P83D 2HVIA 4EZ9A 2VWJA 4M3UA 1LWEA 3LP3A 3K57A 1NK6A 1YT3A 3OS1A 1GOBA 3DLHA 1TK8A 1X9SA 2P5OA 1JXBA 2LSNA 3K5NA 3QNOA 2JLEA 5HRPA 4O5BA 4RG2A 1BCMA 2XRIA 4LD0A 3U3GA 2R7YA 4A4EA 4FJ7A 4NCBA 4M42A 3DM2A 2DFFA 4CEZA 3OS2A 4DSFA 4DQIA 1BL3A 2D9TA 1U48A 4QAGA 2RF2A 4CFCA 4O0JA 3OB9A 5HP1A 1JLFA 2VG5A 3VA0A 5J2QA 1UA0A 4NYNA 4KB1A 3VN5A 2DFHA 2PZSA 4OGCA 4C8LA 2GUIA 4JRQA 4IUUA 4AHVA 2CKKA 1TV6A 1HMVA 4CK1A 4HUGA 3KKSA 2BGGA 3SUPA 5E41A 1KFSA 2DTUA 2HB5A 4BWMA 2FBVA 2HNYA 4N56A 3SQ2A 3CYMA 1VSLA 1A5WA 3VQ6A 2HHWA 3D0PA 4IBNA 4CERA 3PX0A 2ITGA 3VQEA 1ZBHA 4CJKA 4QQ6A 1RTHA 3S3OA 2B5JA 3HPGA 1J5OA 4GW6A 4K8ZA 3L2UA 4PA1A 5M9OA
chains in the Genus database with same CATH superfamily
2EAYA 3ABLH 3CMEQ 3P1GA 1XX5A 4EEFG 1I5ZA 3ZMDA 3AA4A 3CCVT 3QU6A 1BU6O 4ZGEB 2EFQA 4BQNA 3MCPA 4C0GA 3RYRA 5TKWA 2FSWA 1TZLA 3LZJA 2NNYA 4BRQA 4OIQF 3IH2A 1KC8U 4FJ8A 1X6BA 1KQ2A 4BUGA 5HLHA 1KA8A 4ZTJA 1AOYA 3JCMd 1KSPA 1ZR4A 4G7ZF 1YG2A 4A62A 2MK5A 2JJ7A 1DGWY 3KZBA 1X3UA 2DW4A 4XR6A 3AO3A 2FL7A 3LSGA 1WN7A 4PNOA 3CCJA 4X62K 4CCOA 3QJYA 5GANj 4H4OA 4B8AB 1WJEA 3WU1B 3RVCA 2QASA 3AO2A 1BIUA 5M3MJ 2DK5A 4DG1A 2NVTJ 4FJNA 4QS8A 1HJDA 1VQKQ 1XUPO 2ZXWH 2JTVA 1TNSA 4K0KK 5LJ5g 3TI0A 3K2ZA 3CC2T 1Y1VJ 3EN9A 3TWHA 2EWNA 1NJZA 3FKJA 2JZ2A 5J26A 4JEPA 3JRAA 3BG9A 4C23A 2QWOA 4LF8K 4C3JJ 3KK2A 1K78B 4B1VA 3EG3A 1PU7A 2QYOA 2ROLA 4H4KC 4BRIA 3ZQQA 1KXPA 5L3EA 1T0FA 1FYLA 5M5XJ 4LMYA 1RPWA 3BQZA 4AC0A 2O4XB 1JLEA 3WUHA 2EK5A 3CC2N 4PKCC 1EH8A 3NWSA 2KY9A 4OO1J 5EG0A 5AQFA 4RGUA 4DUZK 3NVKA 1GXPA 1EJ9A 2QWLA 2ZPBB 2ZF5O 2P7CB 2ETJA 1M1KR 4A3DJ 1TL3A 1KONA 4ZYDA 3QPSA 1UZCA 1LOTB 4P9UA 1WX6A 1F4KA 2QQ8A 1WSIA 1YTAA 3OJSA 5FU6B 2HAXA 3CF5F 4DBRA 4Q0BA 1WEIA 3PO4A 4B9UA 2E1CA 4YFXF 4XTVA 3C6HA 2CQNA 1BK2A 2G8HA 2E19A 4XORA 5E26A 1TTHB 5CVJA 2QEXA 2HHXA 1NLPC 3PTAA 2K7AA 2EINH 2VUMJ 1JXMA 4C92B 2YPRA 2LBFB 2XV4S 4EGZA 4X9CA 3JSOA 4MEXF 4ZC3A 3Q7CA 5DV5A 4DV5K 2HF4A 3BROA 4M63C 4C0DC 1S1XA 5DK5A 2CQ7A 1YF5L 2WONA 4LH5A 3GUDA 1C0MA 3EGXB 1RBVA 4JBAA 2OZSA 2KZZA 5EJCA 1HKGA 4M7AG 1SKRA 3LAMA 1EXQA 2PAVA 4Y52J 3DXMB 2KVQG 3L2QA 3F9MA 4DU1A 1V1CA 5A0LA 2C6YA 3TMOA 4RW7A 3DLBA 2RB6A 5KYUA 2O2OA 4LIVA 3S8PA 4RLFA 2F2EA 2XPVA 3GTLJ 1D3YA 5CVRA 2XK0A 4DR7K 3G6EA 4YNQA 1X3WB 4B9XA 4RGSA 4B9MA 2GNCA 3BCAA 2WWYA 1ZBXA 4H5WA 4DMNA 2KZVA 2JTEA 3H5AA 2V1RA 3FEOA 4JD2A 2CMPA 1VQ7I 1RUNA 5EF6A 1JCGA 3TANA 4HVUA 2ZXJA 4K2EA 3LH5A 2O8CA 3I55T 1ZYRF 1EIFA 3HM8A 1MH4A 4XSXF 3SDBA 3EH1A 3CBMA 2L7MP 3JCMX 2LOOA 1T56A 3RIRA 3WXIA 3BR1A 4DV0K 4M7DB 2Y0SA 2G7HA 1ETVA 4EATA 5AIPA 1RETA 1W5CC 5IYDJ 1PYVA 3D7SB 4KMUX 4HSTA 2EJFA 3ROUA 1JO8A 1Z6TA 2ISZA 4P55A 2MMPA 1BW5A 1PJRA 5J4VA 3L42A 2BXZA 3J7YJ 4OFHA 1FT9A 4LH4A 3GTGJ 1DJ7B 3V8KA 3DLEA 2IS2A 3GBQA 4DTPA 1OVYA 2NRXA 3T19A 1ZSGA 2DD4A 2HBMA 1XC9A 2YV0X 4DQSA 2E20A 1J9AA 1F21A 3SJHA 2ESNA 5HDGA 1WAJA 5TGTA 1IZ6A 2EZIA 2F2WA 4NC6A 2KMTA 1IV0A 5DD8A 2H09A 3CMAQ 1K9MU 2H8RA 5EZGA 3VUBA 4DTUA 3GZ6A 4A69C 3S1NJ 4E6RA 1VQMA 3HG9A 1RAFB 3H41A 1UOCA 4BC5A 3J7ZO 2TDXA 1MDUB 3CC7Q 3N97A 1K4TA 2OYQA 1EA3A 2PN6A 1NGCA 4GLKA 3VQ4A 3O3FA 2FF3B 2WUSA 4IOAL 3KLGA 3OIOA 5GAHJ 4HKEA 4DV1K 4A3MJ 1YI2T 4KULA 3E5QA 4FE7A 5FKOA 2LG4A 4O4GA 4AYBA 4HCKA 5HS9A 5D5WB 3ISPA 2YLCA 4NCBA 4IXAA 2L2OA 1OV3A 2QDYB 1U2VB 4FSXA 3RTRA 1MBGA 3EDPA 3CTAA 2LCSA 5GAMh 3IAS2 4YORA 5K7ZA 4MZMA 5GMKi 1FYNA 4NHJA 2CGJA 4KISA 3RPUA 3ASOH 2FBVA 2ENMA 3T8TA 2VQGA 2COYA 2DTIA 3CCJT 3VEWA 2CV0A 3CC2I 3SHFA 3BW1A 1OFCX 2RC4A 2W6KA 4AG2C 4BYYA 4BRGA 4UUSB 3GTKJ 2DBMA 3G6EN 3GG4A 2I0NA 1ACMB 4CJFA 3NQOA 3VGLA 3RDVA 1WHGA 3Q1JA 1KD1U 1YJ9Q 1G5VA 5EGOA 4O55A 4N9IA 1UDLA 1S72A 3MZHA 5D8KB 2LQWA 1G59A 3R4KA 4EZ9A 4IEIA 3QMLA 3C2BA 1EO1A 4A3KJ 3V81A 2Q0RA 1I5LA 3A01B 1WJCA 3F5TA 4PUOA 2ZJ2A 3SZ2A 1QP2A 2VBYA 2E3HA 4CDGA 2QWPA 1YIOA 2JWLA 1IGUA 3QWYA 2EGEA 2CV2A 2IEKA 2K9LA 3H9QA 3M56A 1X58A 2L9RA 3C18A 1BYMA 4C0DB 2E6LA 4HW0A 3E5UA 3MEWA 4M9SA 2AK5A 5GADJ 1OPKA 1GUUA 4F16A 1WJQA 3WTTC 5GAOq 3AO5A 4WXHA 4PLIA 5GAGJ 5BS6A 1KU7A 3MZYA 1HNWK 1RIOH 1FYKA 2NRRA 3RKYA 3Q5FA 3CWSA 3CLOA 2Y30A 4DB3A 1GT0C 1M1KU 3OMYA 4E9HA 5JVTA 3RMCA 3OYMA 2X0LA 2VOOA 3OYCA 4YRVA 4U7BA 2D0OA 2IGIA 1PU6A 4M3GA 1LEBA 3P9CA 2ISYA 3BPVA 4BKXA 3AGRA 5DCMA 3N0UA 1YQMA 1U9NA 2YUSA 4CJSA 1WZ2A 2DMQA 2QWMA 1GXIE 3LH0A 2UU9K 1SSHA 3LSKA 2GTOA 4RTZA 4DS4A 3ABMH 3CLQA 2AXTC 3F23A 3ZXSA 3GTMJ 5KE3A 2QYZA 2J6KA 3VQ8A 4DHYA 2GQIA 4OMNA 4OB0B 4KFCA 2XAJA 3GP8A 4XIDA 4LFBK 2WAQA 1DLOA 4M78A 1S1TA 2LMJA 2QQRA 3VEXA 2KZMA 1VQ9A 2GZWA 4TSXA 2PTKA 3DP7A 4E9EA 2H6CA 2FHDA 1RT1A 2CP7A 1VQ8N 3NH1A 1YJ9N 4EVIA 4E6KG 3LWHA 1BC7C 3NMUA 4KAZA 3JCMP 3EG2A 4DQPA 1LDKB 3G6ET 1BIZA 1SEUA 1JJ2M 5KHDA 5CQXA 4JJCA 5CE3A 2PQ8A 3GX4X 2QDLA 2YNGA 5HK0A 4KH0B 4MLHA 4BHBA 2KQWA 3HOWJ 1RUWA 3TEDA 3C12A 5GAMf 3VQAA 4LD6A 4IF4A 4M73A 3CO6C 2HQEA 2R5MA 2OPRA 3VODA 3D2EA 4DLEA 2A61A 1KC8R 4RTUA 2DKGA 3HL8A 2VWFA 4RTYA 1SFEA 4JHDA 4Z4EA 4Z4CA 3S17J 3OBYA 2DODA 3OYIA 4DU4A 2NOLA 5CQGA 3CC2A 1QHHD 5IT9O 4DUYK 1WBBA 1UJYA 5HCKA 1U4BA 2CP5A 1QRYA 2YHAA 1RBUA 3KXTA 2IVMA 1AZGB 3EQLF 1JGGA 3BR3A 3ERED 2DLPA 5CY4A 5FLXO 1L5UA 3CERA 4A5AA 2ITMA 1W2BP 1QGPA 2RJEA 1QKWA 1OISA 1ESVA 5CVVA 1JLCA 2LY1A 4L6V5 4MDXA 2K3XA 1VQNI 1UTIA 4NS5A 3ZEUA 3O6BB 4L0ZB 1VQPI 4RW4A 4OMPA 2KLAA 4HWIA 1WQ7A 3M57A 3U1DA 4LDUA 4DV6K 1D1AA 3HDDA 3U9ZA 1MBJA 4C92G 5D5UB 1OCOH 3J81O 2ZPHB 5GAOp 4DOZA 2DA5A 1SFOJ 3C7JA 5GP9A 3M8RA 4UY8O 3CJBA 4NNJA 4ZZLA 4ESJA 1GOAA 1XNIA 3C0CA 2XRLA 1ATRA 3VFZA 1IH7A 2MC3A 3O8GA 4F7ZA 2XF5A 2W0ZA 2RJCA 3VETA 1UGRB 2OAWA 5EGOB 4CCJA 3M9QA 3TSPA 4LJZF 4XU2A 3TABA 5H1SQ 2L89A 1OCTC 2W00A 2M1BA 3JSMA 3MP1A 5LHIA 3SB2A 2XICA 3JSCA 1VQOT 4QS9A 5IYCJ 3X2QH 3VS2A 2ZD1A 2K9MA 4P5NA 5EC7A 1M3HA 4B8CA 3F9KA 5FLXZ 2I7NA 1BM9A 3U6FA 1TQMA 3SMPA 3V7SA 2KR3A 2W03A 2Q36A 4LFAK 2FSJA 3FJPA 1XCBA 3G7ZA 1HNIA 1OYWA 3VQ9A 1YI2N 2LH9A 4A3JJ 3JRFA 4XSZF 1TKXA 2HXIA 3M55A 3BC8A 4BY6C 2EGCA 5LJ5h 2B4JA 3FLCO 1VQOQ 4RBOA 2VWJA 2IS4A 3VS4A 3FXQA 4RG2A 1HX1A 2JT1A 3K69A 1YQAA 4DQIA 3WTXC 5LMNK 3FMRA 4O8UA 2VG5A 2P4RA 3VGKA 2JMAA 3P39A 3THXA 4LDVA 2JM8A 3PVQA 3VQ6A 3LDLA 1WH5A 4L0YB 5AQKA 3O6WA 1EWRA 2ADUA 1MWKA 4NC8A 2BV6A 5M9OA 4M4ZA 1ON2A 2KFZA 3TTDA 4BRDA 2E2QA 2AP1A 3IWZA 3E1YA 9ATCB 2PMHA 2XASA 1R5GA 4FYVB 2P9IB 4J7IA 2YRDA 1I07A 1JKRC 2BUPA 2XY7A 4RAFA 3P8BB 2XKOC 1FZPB 1JI8A 2GIVA 3KEQA 1TC3C 2K7LA 3UA6A 4H0TB 4DJAA 4JRPA 1Y07A 3QSUA 4M77B 4V2SA 3ZQIA 2FBIA 1C0FA 3V4IA 2YLBA 3G71N 3M0QA 3GZ5A 3MZ8A 2XROA 1MGTA 1JTXA 3MD2A 1AWCA 1E7OA 5KYNA 4HDVA 3L2ZA 1BR1A 3DB3A 2CS7A 3FZKA 2K9GA 1JKOC 1Q7YO 2A5WA 5LJ5j 3VV0A 3D2FB 3FMSA 5K7HA 1Z1DA 1MBEA 3PIPA 1O3QA 4YG2F 1LPLA 3CJCA 1TP4A 1MIJA 2GTJA 4FHTA 4ELYC 2W25A 3DOLA 4EM0B 3DLLL 4BR4A 3CCMT 1D8JA 3S16J 3QPTA 2VGMA 3CJAA 2EYWA 4DSIA 1HCRA 4CJ5A 5KRTA 3ZLJA 2DXIA 3G0ZA 3OBWA 4M7AC 4M7YA 1CQTA 2QI2A 2A07F 2QGUA 5C12A 1R4NB 4CCLA 2Y2ZA 1CKAA 4W5TA 4AFZC 3JRIA 1QA6A 4FT4A 2W85A 4FYWB 3RNJA 4GVEA 3NAEA 1NNEA 3GMEA 3BF3A 4NC7A 3K9JA 2IGNA 1UHFA 3QIPA 4EHUA 3G4SI 3WG7H 4AIHA 1WAFA 3TARA 2X4WA 1FWZA 2RHYA 2HL3A 1L3VA 3A8HB 1JCFA 2FD5A 2FEIA 1ZQ1A 2RK2A 3X24B 2QUFA 3VEYA 3BDDA 4GYGA 3CP8A 1WEGA 5BRHA 1V4TA 5HNHA 3RRGA 5IWAK 3WNEA 2VYPA 3MWMA 4JI8K 4YPHA 2JOYA 5FLXK 3AO1A 2F4OB 2O31A 2CQKA 4BI4A 1GCQC 1F1BB 1M4ZA 2FZKB 2OV7A 2DPNA 3ELKA 3P7NA 2E1YA 1M1KC 5AQHA 3KIOA 5KYXA 2ZSIB 4L9JA 5BRFA 1ZK8A 1MMAA 1QVTA 1H9GA 2YHTA 4KYWA 1M2OA 1FBQA 2ZMEB 1BOTO 3V8JA 2GQVA 3MEUA 1N32K 1B92A 3K1MA 3H3ZA 2ZJQL 4CEQA 3VPRA 2M2EA 1YHQQ 3IP4B 1DIZA 5GAMj 1WSJA 4IUPA 2EFWA 5J2NA 3KLNA 1GLFO 3EGUA 1J09A 2HVRA 3K9KA 1TW3A 3LP0A 3RI4A 1HKCA 2UUZA 2YU3A 3HSBA 2JWTA 2VXDA 5DCMB 3PT9A 3CC7I 1NKUA 1MV0B 2FA5A 1H3HA 4CHNA 4Z4IA 4C8QA 4AMCA 2CZ1B 3KFWX 2BVMA 2VCPA 1WI3A 5DTDA 4WQ5A 1C0UA 2DPDA 4KH4A 4A4FA 2BHYA 4WQ5C 5BOXA 2V1QA 5AR0A 4E0DA 2YSRA 3B02A 4XH4A 3I8BA 1VQPN 1LMZA 1YUWA 1OH8A 2DMTA 4JK8A 4F3OA 1MUYA 3IKTA 2O4GA 1X1AA 2IDOA 3FZHA 1M30A 1MBHA 4M75B 2HMPA 4OJRA 4DQ8A 3E9FA 2JMWA 2Z2SB 3URGA 4FX0A 3ZSQA 2OQGA 5DM7R 1OKRA 1W0HA 3DYAA 3BY7A 3DBLB 4C0ZA 1XNQK 5J4YA 2HKNA 2JT4A 1VQLT 3FM3A 4C8KA 1IN7A 3BTCA 4DZJA 3PIOL 1HW5A 3JV3A 3EGXA 1OI1A 2QEXN 1S7EA 3BF1A 2XO7A 2YJFA 3ZMUA 4ELTA 2HVSA 4HF1A 3CVSA 5AT1B 3HYFA 1RKWA 3PMTA 4KB0A 2KJBA 2LKPA 4CBUA 4XKCA 3HGGA 2JUCA 4XLPF 3CC7N 1LUJB 5LMUK 2MI6A 2DOEA 3DWLE 1SMTA 2J5OA 1P92A 4EFHA 2JUGA 3AAFA 5BPDA 1QQJA 1J53A 4M3XA 5KVRA 3N05A 2GX9A 2HHTA 3VB2A 2ELKA 5KAFC 5AQOA 3OA6A 1P59A 5D4SA 2OPSA 5AQQA 2H56A 3K4LA 2AZVA 5BN8A 3AHUA 4F52A 3LP1A 3JCMc 1IJJA 4RTFD 2LMDA 3ASNH 1ATNA 3VESA 2QXLA 4R5PA 2FVUA 5K7FA 2LBFA 1M9SA 1BUPA 2GFUA 2IGOA 4DTMA 3AAQA 4IHWA 1P4XA 3L9FA 2DL8A 2K2MA 3M0PA 1KG3A 1N3CA 2Z1JA 2QSHX 1AT1B 4CC2A 3O9SA 4RWTA 3WGIA 1W9HA 1XQHA 4B9NA 1WIEA 2FLOA 4MDBA 3LDQA 3CJ1A 3L1AA 4C8QC 3VQBA 4FK0A 3NGPA 1XHXA 3PIPL 1UG1A 1R49A 2E1ZA 3JAMK 3QKJA 1M3AA 1O9SA 2E64A 3VTHA 2FBHA 2EILH 2GV9A 3OH9A 3ID8A 3T5XA 2OTJA 3ZT4A 4JKGA 4C3IJ 2ID6A 5E8GA 4EIKA 1WGSA 1V29B 2O61A 3CCLN 1ZHIA 2V4JC 3D5SC 2P5OA 1FYMA 1W97L 5B66C 3Q9VA 1JT0A 2EYXA 3FHNA 2PVOB 3KK7A 2WY8Q 1VYUA 1VF9A 4CFCA 5AQXA 2CP0A 3VA0A 4GV9A 1I0CA 1S72I 1VQPT 2CKKA 2IIRA 4X1EA 1SD7A 2IGKA 2K9NA 2E2NA 4LB6B 2YRCA 1LE8A 4JD2B 3K70D 1KAZA 1NJYA 3OIQA 4JYKA 4HVWA 5L3FA 1F9NA 4PHTX 1FK9A 3LDPA 5JS1A 3HFOA 2X51A 4Y28E 4M74A 2O88A 1U3EM 3F0CA 4CBXA 3NGZA 1GLDG 3F6OA 2R0QC 2IG0A 3PNTA 2DN0A 5F1RA 1E17A 5C44J 2DI3A 4PJ0C 3FRNA 1ZN2A 3I56I 2DF6A 5J6XA 3RYPA 2DA9A 2RD1A 1YQLA 1SFXA 2DT5A 5FPEA 5F1JA 3CFRA 3NF9A 2R7FA 2YHBA 4YIFA 3HVRA 2VKHA 1N5YA 2V75A 2G9WA 5JLWA 1RDCA 2CW0F 4EV0A 4N0AC 4II3A 4NQWA 2JN6A 2DJQA 3BTLA 2HSTA 1VQOA 5TISC 3VQ7A 2ASMA 1OCCH 4J00A 2Q0OA 1YWOA 3J80E 2NRHA 4FPBA 2HBPA 2M8GX 3GFIA 4N4HA 3LDOA 3NMZC 1GV5A 2CZ0B 1A5VA 3FZMA 4HTLA 1LFPA 1SAXA 3THXB 2RPIA 1BWFO 2R7VA 2K85A 4HTUA 3FC3A 2Y0SN 5CVUA 1GCPA 3TDUC 3OYJA 2DJNA 5KTQA 3HL2A 1JJ2A 1LWCA 5F0CA 3ECOA 3QP6A 3LWLA 4LF4K 2DXCA 5GMKh 2P9PB 1F43A 1RBSA 4DS5A 1UCRA 1ZRCA 4J9BA 1QS4A 4FX4A 2LCLA 3GCMA 1RI9A 2V79A 4C8QF 2EQIA 3IH4A 3RKQA 3HKZN 1IKYA 3IUOA 2E4HA 2BHZA 2P5VA 4LLGF 2PUOB 2RO0A 1SVLA 2P4TA 2PMZA 4JZ4A 3ZSVA 3TW6A 5LHHA 1E3HA 3SAFA 3IH3A 3I59B 3EG9B 2HD0A 2RQVA 1ETKA 3AVIA 3KPHA 1H89C 1EBMA 4A0ZA 2JA5J 1VQ5I 2LRQA 3HOVJ 5DCFA 2LY2A 4AVPA 3SI6A 4ZH4F 1XQOA 4B1UB 2J5PA 2NAZA 2W57A 1T98A 4Q48A 5BN9A 1YHQI 5HLFA 3VQQA 4EP5A 1U5TC 2LQKA 3OSSC 3I0RA 2FXUA 1IXSB 1R4MB 2CUZA 3DKMA 2PFUA 4M3RA 1R36A 1KQSA 4GV3A 1VQ6A 5GAOr 3B8AX 4I7HA 1VQMT 4V2FA 3VKIA 2XAHA 1VQLQ 2A0FB 5HS7A 1ABOA 4DIQA 1W4MA 1Q81U 3O1BA 4YFKF 1R22A 2ELJA 4FETA 4U0YA 2QBYB 5JVHL 1Y0MA 4CK3A 2P6SA 3L00A 1Z7LA 1WHHA 1JXEA 2FU4A 3CC4T 2HEQA 3KEOA 2FE3A 3V4GA 2HWVA 4N0AA 4LF6K 3OH6A 1OU8A 3ZX3A 1MMDA 4XK4A 3O8VA 1BI3A 2KMUA 3ZQCA 3CVTA 3L09A 3AVLA 3DKYA 3HTUA 1X43A 3QWLA 3WTZA 3BR6A 4RMNA 1X69A 3WTYC 5M1FA 5KRSA 1N36K 3LDSA 2X6NA 2HCKA 3TR8A 4WXDA 2NZTA 1NGNA 3ZEUB 1VZ0A 4E7ZA 2C06A 1HKSA 4UV9A 4H5TA 3WVEB 3B6OA 3T7ZA 1ZSZC 3CPWS 4E4HA 2D0BA 5GADP 4BC3A 3TVTA 3QDRB 2QVOA 2R7ZJ 2ZE2A 2O8EA 2P9LB 2LQ8A 4OLBA 3MKYB 1SVMA 5AYFA 2MF2A 4D5CA 4CZZA 2M7BA 4LIUA 3AA5X 4CA0A 4BBRJ 3KFVA 3B6AA 3ENBA 3M58A 2KJCA 1JXOA 1KSWA 5GAN6 1MZBA 2VQHA 2M4GA 4BR0A 3P38A 1T8IA 3P4IA 1TNTA 5GAN4 2YUPA 3D6RA 1X9MA 1RAEB 3CCLA 1Z3XA 5E3LA 2Z0WA 3ZQGA 3CC4N 1QE1A 2G3RA 1IN6A 3A2FA 1VUBA 4C8MA 1FKPA 2J06A 3DEUA 4JI7K 4LF7K 3D4VA 1DPUA 4LLNA 3HFNA 4IURA 3PV8A 2Y1JA 4B9LA 3D2EB 1K73O 3I56N 1T08B 3TKYA 3KUFA 2K5FA 2D0CA 3EZWA 4M78G 5M1PA 2GOMA 2A6EF 3GEZA 5J1RA 1WJDA 3WGGA 4G7OF 4G9YA 3BOQA 1NHAA 3M5RA 2D0NA 3S2HJ 1HNVA 4WF9L 4DV4K 4GYIA 2W41A 1VA7A 4KBMB 2RMOA 4CEAA 4LITA 4ILHA 4G7HF 3KCCA 4L5JA 4JKCA 1UHSA 3WXJA 4CGDA 8AT1B 5C2FA 1ITYA 3MK6A 5AQYA 2RNJA 3Q3SA 2FZGB 4JHDB 4FPAA 3K57A 4XTXA 2ZJPF 3C2HA 4EW0A 1Q7YR 4RB3C 3KP7A 3A5MC 3E66A 3QRFF 2R93J 3VN5A 4OGCA 4C8LA 1A35A 1VQ4I 2KIUA 3BR0A 5E41A 2OX7A 5ILVA 3SQ2A 4M75E 3PX0A 1TOVA 2EZLA 2VBZA 3W3DA 1CZAN 2YUQA 2OTJQ 2B7EA 1Z7UA 1ZSZA 5J2PA 3C7NB 1HQUA 1ZBUA 4F7UA 2BZ8A 2PEXA 4CJ4A 3GO5A 1JQQA 2HSEB 4I01A 4DW6A 1LW0A 1NJIU 4DTSA 2HBWA 2WB1A 3CBOA 3L2CA 2HZDA 3O8HA 3L4QA 3I56T 2FMLA 2FF4A 3SQ0A 3I4PA 2DFEA 3KD5E 3DXJF 4I6MA 2EIJH 1KU3A 2YX6A 4KICA 3LPUA 2GBYA 3NHNA 1JCEA 1AKHB 2RE2A 1U04A 3K0SA 1NJIO 1PUFB 1UFFA 1ACIA 3ENHA 2BW3B 4RA2A 3L0QA 5IT3A 2CJJA 1S9GA 3OOUA 4FLUA 3F8CA 4ABZA 1BA0A 5JR3A 2F69A 5JLFA 3CCYA 2ZB9A 4CZJA 2DJZA 2NRVA 1HRHA 1W7PA 4HNUA 2G6FX 1FKOA 5AQUA 4AFSC 4XRFA 4C92A 3BT9A 3OW2S 4KDPA 2J05A 2BKDN 4HZFA 1AOJA 4C8NA 2G8KA 1SHFA 5E8IA 4HVJA 1I50J 3UKUA 1T0JA 3CCRA 1HYVA 2X6OA 1I94K 3TCJA 3RPUD 4QQDA 2ASPA 3T3FA 3P9IA 3ZMTA 2QK9A 1IO6A 1MSEC 2DA1A 2JVVA 1NU0A 3AL0B 5LLQA 4Y4RA 1M3QA 1GV2A 1DQUA 3I64A 5JS2A 3VDXA 4M3BA 2ZPGB 3ZSOA 4KIBA 1XMXA 4P96A 1R59O 1YW9A 2ZJQF 1KAXA 3EKSA 2QM1A 4Q47A 1LVAA 4P9FA 2DRKA 1YJNQ 1RDDA 3BP8A 1Q86C 5FD5A 2ZKZA 2P0QA 2WA0A 2PJRA 1ON1A 5EEGA 1D09B 3ZN1A 2W84A 1KU9A 1ZG1A 2ELHA 1ZC6A 2K9QA 2Y1IA 2A08A 4FXDA 4A5BA 3C6UA 1R5HA 5EOYA 4DBQA 1D5AA 4GFBA 4F4KA 3META 3CC4A 4UNFA 3A0IX 2L54A 2VODA 2NRAC 3DBRB 2P0WA 3VQPA 2L3SA 4M3WA 1YJNA 4N4GA 2H27A 1ULYA 4J83A 5J40A 2KDOA 1Z21A 1QVUA 2VI6A 4H5NA 5AFUH 4BHCA 5FPMA 5L3BA 3UR3C 1S72N 2TCTA 5H6RA 2HKQB 1FP2A 4GNIA 2BZYA 3P8HA 4AD9A 1UECA 3CCJQ 3H8ZA 3HK2A 1WRJA 3ULRB 2VASA 4BH9A 1Z26A 3BLYA 2HVHA 4CGJA 1E3MA 1VQ8I 1IB8A 4WFNL 3GBGA 5A2QK 3A5ZB 4PCQA 4B9WA 2R7UA 3QERA 1IN8A 4UV8A 2AXLA 3H6EA 3FDRA 2D0PA 1SPKA 3KYCB 3GFLA 2P84A 1TK5A 4KTZA 3VYTB 1KG6A 3BR5A 3FSPA 1ZBSA 3CCUN 1USTA 2GCXA 5AZJB 5DUKA 3QG1A 4HX4A 4CEDA 1V4RA 4QIWN 3M59A 2OAUA 3GZNB 1S5LC 4YHHK 1LCKA 1RADB 1TWAJ 1OR7A 2L4MA 3VSLA 4A4HA 1X2QA 2QWQA 4Y17A 1VQNQ 4J2DA 1JE8A 3O2PE 4OKJA 4LF5K 3K10A 1FJGK 5F0FA 4BEHB 1VQKT 4CF8A 3GTJJ 1YJWA 2OPQA 2KAFA 4FJIA 4BG9A 1V76A 3DLRA 2V9PA 2QCOA 3CP2A 3NF8A 5FFXA 3MFKA 1NMNA 1CF7A 2XMFA 4XLNF 1JJ2S 1XGOA 2GQQA 2KLOA 1RI7A 1NMDA 4I02A 5AQGA 5CAIA 1BL0A 5GJVB 3FXOA 4M7DC 4WCEL 2DFUA 4M7AA 2HEOA 2HKOA 5FKKA 2VJ5A 1P9QC 5ICFA 3G1JA 1YITN 4DEXA 2BXYA 4KBOA 2VWKA 3KX2A 1G2HA 4YTLA 4PL8A 2L8DA 1NK4A 3H3NO 4C5GA 2LCCA 2HHQA 1USSA 4GO1A 4O5FA 4JI3K 1N9SA 1RTDA 1HXDA 2R92J 5A0GA 1VQNN 1LJOA 4A2BA 1WQWA 2FRHA 2E34A 4PGHA 1A36A 4J5YA 1QSYA 1LPQA 2W6LA 3MN9A 2F48A 3KWGA 4CZFA 1C0GA 4DV2K 1CSKA 2ME0A 3QIIA 5M1OA 3RWUA 4C8QE 1X9JA 2E2OA 1AWOA 1IO2A 1NK0A 3IKMA 4F92B 2BZTA 4CCKA 4QVCA 4PQUA 2E65A 1ZBJA 4FU6A 1ZLMA 2NUPA 2X74A 5KE2A 3T8RA 3JYTA 1X2MA 1WPKA 3E6BA 1TWCJ 3J8AA 2LVMA 1W5TA 1FLIA 4J2AA 4B24A 3GTQJ 3GWZA 1U47A 1RNHA 1O1WA 3GXOA 4KTWA 2Z16A 2Z3YA 2CP6A 2E6MA 3CC2Q 5I21A 4FJ9A 4IX7A 3T1AA 3H5RA 4DK9A 1KLNA 4C0FA 3MECA 2M34A 4YOQA 2EIMH 2XGEA 2LTPA 2NOBA 2BW3A 2UUCK 4ZYHA 4RTVA 4DNCA 3U3GA 1BL3A 1U48A 4A5MA 3CCSN 5IYBJ 2ABKA 3OB9A 5J2QA 1UAAA 4U0WA 2DD5A 5L3DA 1W7PD 3CCLQ 4FIBA 3HTRA 2BGGA 1K73U 2FQ4A 2LJ1A 4P1WA 3WQTA 2I7PA 4WFBL 2A3ZA 2CQQA 2OZMA 3M7GA 5AONA 3ZT0A 3QOPA 1TXQA 2MH9A 3OSGA 4F7UE 4XQ3A 5FU6C 1JKQC 4XTUA 4X9DA 3AGKA 3TBIA 5AQJA 4CESA 4MQVA 2NXNB 1L3LA 1H3ZA 4M3ZA 4I6ZA 3RERA 4M6VA 2DK3A 5F2RA 5TJJA 1UB9A 2K4JA 1PRMC 3HP9A 3JCMQ 1WLPB 4HV5A 5FROA 1PVSA 3GLXA 2R7WA 2WBMA 4WF2A 1E4GT 4E7HA 2O4IA 1NJIR 4BE1A 2F4VK 2LNVA 5CHIA 3CJQB 1VQ4Q 4KIGA 2YNIA 3RSEB 3VS5A 2VIXA 4CJRA 4I0BA 4BRMA 4HUEA 4MO4A 2L7FP 3IV5A 3C3WA 4U87A 3NAUA 3REBB 4NUBA 1KVAA 2E6ZA 4CJLA 4FJJA 1GDTA 2HOAA 3G0QA 3CPWP 2QKMB 2A41A 2A3SA 1ZH5A 2EJ9A 4A53A 5LJ3f 4B3XA 2CW7A 2L9VA 2R3SA 4OINF 2IVOA 1JUSA 2WSEE 3PL8A 3QYGB 1SD5A 1K7AA 4A54A 3WXKA 3AA3A 2IJLA 4EJUA 2RQPA 4E1MA 1WJFA 4EM1A 2DXBA 4XKBA 4FASD 4KGZB 4LDWA 1VQLA 1WFWA 4EHTA 1WH7A 1CLQA 3TW7A 4DSEA 2E1NA 2XB5A 1ASWA 1YAGA 3THYB 3H9GA 2HPIA 4RGXA 3RZOJ 2EYZA 3CDHA 4C92C 3ATUA 2QTVA 3ABUA 2I5JA 4ZHRA 1RRJA 4XICA 1YXQA 1SS6A 4I6MB 3PMIA 3BTIA 3QYBA 2VYTA 4S04A 5ECAA 3R0AA 1ZREA 4CF1A 5KYWB 4TVRA 2W82A 1NLOC 4WTOB 4ZDOA 4MTDA 3AG3H 1B9DA 3QEXA 4DU3A 3I56Q 3PFSA 4AIAA 1X2NA 2P5LC 4M77E 1W7PB 5DLOA 2DIQA 1S29A 1QVFM 1MNMC 3TO9A 4QLCU 2ZGZA 3TO6A 1W4SA 4IIMA 1KO9A 4UHTA 3JCMf 3WQUA 1RAAB 3I0WA 1F5TA 4EW4A 4YFNF 1IF1A 4ASNA 3IUCA 2IP2A 3VF2A 3SEMA 3WEEB 4XU0A 1I4K1 2GBZA 2P1JA 2VE9A 3J80Z 1B07A 3HKZA 3KWIA 2QEXT 2D45A 4CEOA 3PNYA 4NYFA 3NH0A 1OOTA 4HQMA 2RI3A 3FXJA 3TOBA 1XQSC 2BE5F 1VSFA 1R0CB 4JKBA 4DSKA 1WDXA 5HOOA 1JLBA 2M87A 4ILGB 2D2WA 4PGGA 2O3FA 2DJIA 3DLLF 2EHGA 2K6DA 2UWMA 1VRLA 3EL2A 2OPPA 2CH5A 3AG1H 1QZEA 1C0WA 2E7XA 4OAYA 3F72A 4CCNA 4Y13A 4KGXB 1WI9A 2HQ5A 2DVEA 1Q1HA 2A69F 3ECHA 3CMAA 2UYTA 2UZKA 4W5QA 1R00A 4RB0A 5FU7B 3AKZA 3O3KA 2KRCA 3J7YP 4FLVA 2L02A 3DRPA 1D8YA 3I35A 3M8SA 3S2DJ 4CD1A 4ICLA 5LBQA 1AHDP 2DLLA 5GINA 3K7AJ 3CCQA 4PJOG 4BDYA 2D8HA 3SEZA 2HZTA 4CXFA 4DR1K 1PSEA 1NG6A 2JHNA 2KP6A 3F73A 2FZCB 4FYYB 2E2HJ 3MKWB 1WJBA 1NK9A 2QBYA 1IDYA 2A6AA 4BEHA 1AVZC 4B1XB 2P51A 3PJRA 2VG7A 2E12A 1C1AA 2MIOA 7AT1B 1NK8A 1OYYA 1Q95G 3JCMW 4KT6A 2IAIA 4CJQA 4Z4GA 1WCMJ 5CKFA 5AQSA 2O8XA 2XB0X 2KRMA 4F91B 4AILC 2PMZN 3Q0VA 1AHJB 4WCIA 4IL6C 4ZYGA 4C2MJ 1KQ1A 2VJIA 2XG8D 3MEAA 2P9UB 1UGQB 4DZPA 3DLLA 2ZSHB 4ESBA 1YHQN 1B6AA 1I27A 2E2JJ 1UEBA 3R3LA 4PIIA 3RR6A 2HHHK 4GDFA 2DT7B 4DBFA 3N5NX 5CIUA 4H0OA 2O8BA 1Q81O 2DPPB 2HHUA 2OUMA 4PKGA 1WHMA 3PVLA 1J54A 4RAYA 3AVAA 1FP1D 1ZLJA 5GPAA 1RILA 1TK0A 1W2BM 4BI8B 1RAIB 3VYUB 5C4JJ 4EGYA 1T2KA 2K5CA 1ARKA 1RTJA 3ER0A 1D1CA 2XPUA 2FB7A 4B48A 1VQ5A 1STZA 3HOZJ 4BI3A 1KC8C 3P83D 2HVIA 4PFPA 1MGQA 4C8OA 2RDPA 2A36A 1NEGA 5F0HA 2JLEA 4LD0A 4KN7X 2JS0A 5AQVA 4EJOA 4DR3K 2BTFA 3CCEQ 3NVMA 1HF0A 2PZSA 2L0KA 4D5FA 4A12A 4YOYA 3L4IA 3CYMA 2HHWA 3BFMA 1KGSA 2MLGA 2IVWA 3HPGA 3MN2A 3M6GA 2Z1IA 4QW2A 3EKUA 3HSCA 4MDAA 5GANh 2IBDA 4JS4A 3KLEA 2P5GA 4FWKA 2HSPA 1YJ9I 1OCZH 1T03A 4MIMA 1BIAA 5DYMA 2DO7A 5CKTA 2KDSA 4HCBA 3KYLA 2NRZA 1Z77A 2L4AA 3N4PA 1ZR2A 4BY1J 3LFKA 4E2FB 3OW2M 3JB9J 1O3TA 3M1FA 4E19A 5GMKj 3ZSYA 2O8EB 1O75A 4B6MA 2X4YA 4HSRA 1QMCA 1MH3A 3CCQI 4B4CA 1K79A 4CO8A 1QQMA 5H2FC 2RQTA 2LK2A 2XGDA 4BR7A 4AIJA 4OKEA 2OFKA 4D0PA 1VQ7Q 2X3XD 1ZUUA 4L59A 2RQRA 4C92D 1Z67A 2E6NA 3QQAA 1MUDA 2V6CA 3CD6I 2QWNA 2AHJB 4A0YA 4CGZA 5A2QZ 1NOZA 1UMQA 1N25A 1KG5A 4C1NK 3JB9H 3LSMA 1MKMA 2PJRB 4DBHA 3AVHA 4IXCA 4DCHA 1QPMA 4W97A 5HS8A 2EBPA 1VK0A 3LSJA 2FG0A 1YITI 2D0AA 3VERA 3VF4A 3WEEA 2MC4A 5FD6A 2QK0A 3H1QA 4ITVA 3M1CA 2GGRA 3FR0A 1TYQB 5C6SA 1X01A 4V19S 2K79A 3J7AY 2V8JA 4CJVA 3CD6T 4YOVA 4BE0A 4LG0A 5E1WA 3O3GA 2OF7A 4J19A 1Q18A 1VQ8A 2CH4A 4NBQA 1S9HA 1SSFA 3CCQT 3PO3J 2OBPA 1KHCA 2RI2A 1YWPA 5KCOA 2DY4A 3FXMA 1FC3A 2RNAA 4Z4FA 1HPZA 2QW9A 1HPMA 2IA1A 2LKSA 2CH4W 2NOEA 3BPXA 1U06A 4BREA 4BACA 1HJRA 1AD5A 4M75D 1HKQA 1U9OA 2LT4A 2A1SA 4U0VA 1YRNA 4A3BJ 2A5XA 1Q1VA 3KZZA 3AO4A 2H3GX 2L3PA 4Y92A 4OPJA 2V1DA 3AVMA 2K40A 4PLLA 2QQAA 3SYZA 4AG1C 3HHTB 3H36A 2Y9YA 4Q5WA 1IBMK 1YJNI 3FLGA 4GMJB 1T6SA 4IO8A 1VSKA 4KUMA 1KZHA 2F9TA 4OPHA 3BDPA 4AM7A 3E97A 5KN8A 3GDQA 1IN5A 3VYGA 5LGUA 3SDGA 2MA3A 1S3XA 5T7BA 1Z0XA 5J39A 5I2MA 3VEZA 3LSIA 2Y0MA 3RMBA 2GEMA 2J6OA 1X3ZB 3LM9A 3ZMVA 4EPCA 1X6GA 1H1VA 3AVFA 4BJ5C 1W36C 4LD9K 1I1GA 3P9KA 1IUYA 3V9WA 1D0ZA 1FOXA 2KRFA 2HGCA 1VQ5N 2IC3A 1WLJA 3TSZA 2QEXQ 3CXCS 3VSKA 1T7PA 3V9UA 3W2WA 4C5HA 4CIFA 4ID5A 1LKXA 2W48A 3OWTA 4H0XB 3S1MJ 2XPWA 3CCMA 2L7KA 5LJWA 3I5UA 3WT0A 4OFAA 2O9LA 1RNLA 4XLAA 2V7YA 2ZXIA 5LJ3h 4M3TA 2XF6A 2OA8A 5I3UA 3IAM2 2X6SA 3C6TA 1TUCA 1K1ZA 2JG6A 2EBIA 1BOBA 2E1OA 2YXYA 1YYVA 2RQUA 4CF0A 2E5ZA 3R61A 1RT6A 4KI4A 3MKZA 2IPQX 2JSPA 1QZZA 1JT6A 1BJAA 2LC2A 3Q9SA 1PKSA 3CQYA 3LQRA 4KHPK 2AIRB 3I8DA 2QGGA 4DTNA 3HM9A 4Y0WA 4EZ6A 3ZSXA 2V1XA 3X28B 5D6XA 1U1SA 3PUFA 1U0JA 2O03A 4H5VA 1CXUA 3I53A 3OW2P 4BRFA 3LWMA 1SUQA 3I4MJ 2G8FA 2F5KA 2RI5A 3VA3A 1B72B 5K5RA 2E3IA 3OSFA 3CW7A 5I11A 3DF8A 4PJOA 3NBPA 2P9PA 3F22A 4C92F 3DTKA 4M77G 4FVMA 1PP8F 1SFUA 3QAHA 4OVAA 2CP2A 3CCJN 1D5YA 3AVNA 4DV7K 4PJOF 1QVFS 2FSNA 3NGIA 5KPZA 2OTLT 3COAC 3DMJA 4FLZA 4MTEA 3CF5L 4UB6C 1CXQA 5HROA 3LALA 1VQ8Q 4LLLA 3AVKA 4B9QA 3M53A 2G8IA 4BRLA 5E18F 1G99A 2KRNA 4BWJA 2EB7A 4NXNK 3K5LA 1DU0A 1I3AA 3J80O 5D3GA 5KYYB 1A6QA 2V9VA 2L9SA 3T1BA 1K8KB 4B1RA 1XTAA 1ASVA 4LUEA 4U67L 2HYGD 3H46O 4L5IA 1LWYA 2KTQA 3OR1C 2EZKA 4BU2A 3QFUA 4MZTA 3U21A 1MPGA 3NRVA 4LNPA 2M4KA 1M1KO 4B3TK 1JXSA 2HQRA 1FTTA 3LNQA 3K4MA 4AHVA 2ZFWA 3KP4A 1GFDA 3A8YA 1SANA 1ZX6A 1R5ID 4OOIA 1H9TA 4CJKA 2DL3A 5AQWA 4J2BA 3E9LA 4AT1B 4XOPA 5AIQA 2DEQA 3GPLA 4G8XA 1NEBA 3QWXX 1NOYA 4L9TA 3QO3A 4M3EA 4OF1A 3EZ5A 3U23A 1RT4A 4E7IA 2ZCFB 2BBYA 3R8EA 1Y64A 5DY9A 1RDUA 1S8NA 2I8DA 2XF7A 2LF7A 3E6CC 3SDZA 4C30A 1YITA 2O8FB 3BR2A 1WBDA 2RPNA 1YRNB 4EA5A 1BI2A 4M7DG 3MQ0A 3B6CA 1W0UA 5AQZA 3I4NJ 3KLHA 1VQ6Q 3CPEA 1OR7C 1Q7YC 3AFHA 2QA4Q 5DD4A 3SZGA 3RMSA 1SRLA 3QOEA 3SFIA 2E35A 1M2VB 1QZYA 4AHCA 2R58A 3E19A 2IIMA 4K11A 4M77D 5AQMA 5CR4A 2VC1A 1NBWA 3GW2A 4KRTA 4GVMA 1HD3A 1B8IA 3HP6A 4LG3A 3G10A 1SL1A 1IRGA 5FW9A 1AA7A 3NFCA 1Y0NA 1YNZA 2P4WA 1OJLA 2FMYA 1W1WE 3ZT2A 2PFBA 3FMQA 1I3QJ 3PO2J 1NGGA 2VC8A 2RJDA 2F96A 3LSRA 3E1SA 1DUXC 4EMKA 1SD4A 2CWEA 1K8KA 2M45A 2FNAA 2DX1A 1XTDA 2W40A 3NARA 1MSFC 2M7AA 3HRSA 3LMMA 4CD3A 4BHPA 2CFOA 4DLGA 3SEQA 2HNIA 5F64A 4OPAA 1T44A 3ZX0A 1YOVB 1G4DA 4PSWA 4XN0A 5I42A 3QBWA 2W1OA 1MMNA 2HBKA 2BTTA 1N75A 6PAXA 1JKHA 2Y90A 1SAUA 5HK3A 3H3OB 1N6AA 1FOYA 5JHUA 4C8QD 2JA8J 2X1DA 1QVGS 4M75F 1RBTA 1K9MO 4JN4A 4N4OB 4IOAF 2H3EB 3CO7C 3AVJA 2CS3A 3ZQHA 3KTQA 2K9SA 3R6NA 2Y48A 2RN2A 3I71A 2ESWA 3OW2A 1TW2A 2X48A 2ATQA 3Q7BA 1VQ4T 3KYDB 2MOXA 3TSUA 2C0IA 1F1ZA 4PKHA 4FJ5A 4WE1A 2P0KA 4MLEA 4GGGA 2GXGA 1RR8C 3CC7T 1YITT 5E1XA 4RAZA 4DQQA 2WACA 3K4NA 3JB9D 4PJOB 4UNOA 4M7DE 2R4GA 5FWCA 3UIQA 2W10A 4M71A 1XGMA 3CEYA 2WADA 2KBTA 4CZGA 4A59A 3R6SA 3BGRA 2LNBA 4FWOA 1WHJA 2KFDA 3SXYA 1U49A 2Q1NA 1YJNT 3ASKA 1BU1A 3FE1A 3IFRA 1D9FA 1NK5A 4XLFA 2UV1A 1UGPB 4BGAA 4CJPA 4FWLA 2D5VA 4JKDA 3SPYA 1RT2A 1JB0E 4FK4A 3SAHA 2R7SA 3H0IA 4ELUA 2C0OA 1L3TA 2MD0A 4IFYA 1PRLC 2JA7J 5EEHA 3TO7A 3LAJA 3CWAA 1DGRM 2RN8A 1IKVA 1I6HJ 2GA2A 2YDLA 1JJ6C 3EYZA 2HPMA 3CQXA 3R6OA 3SUOA 3K1NA 3AVBA 3VQDA 1EKEA 1DTTA 3CMAI 4M3DA 4M7DF 4DKWA 4IG3A 4A57A 4Z4HA 4M72A 5DM6F 4JUVA 4HNTA 4J6YA 4G9ZA 1I1JA 1WFXA 3PQJA 1Y96B 1BR4A 4M41A 2VOPA 2UXCK 5TKYA 3CCVI 2JUFA 4HLYA 4Y3OA 1N27A 5J2MA 1K9MC 2JJ9A 4QKUA 3I56A 3LW5E 4JS5A 3NF7A 1KCFA 2RGVA 4BNCA 3I3LA 2BEOA 4CHOA 3X20B 3CIPA 3B6PA 4E7SA 5IT9E 2FO0A 4GKKK 5GMKe 3RBBB 1C6VX 3KP5A 4PSXA 2ICWG 5C24A 3DBHB 3T1YK 1MA9B 1IDZA 3A8GB 3BG6A 3JRDA 4A3EJ 3ZT1A 3JRCA 4JX6A 5KYUB 5EX5A 1FJLA 5C15A 2BVLA 5GAEJ 3J7ZI 5F1XA 1T95A 3OYDA 2KXDA 5KQDA 3ZX2A 2K27A 3CCSA 1ZKGA 2IS3A 4I99C 2RHIA 4F04B 1RDBA 3J81K 4CCHA 1ASUA 4IRHA 1EV7A 2W42A 2XC7A 1WSUA 1DU6A 4NL2A 4KUIA 4E7KA 3P8DA 4X64K 2HNZA 4MQ3A 1M2VA 3CCMQ 3OV8A 3E6MA 3MEXA 3QESA 2EFPA 1FW6A 3H35A 1TKZA 4K25A 3VS3A 3VQCA 3K2PA 4AYBN 4P5OA 2VKEA 5JFRA 3JRZA 1Q82R 3L3VA 2GIZA 2O4XA 1Y96A 2PI0A 2RNGA 3LP3A 3OS1A 1KJWA 2LSNA 5HRPA 4LD5A 4CEZA 4UVAA 2Q0UA 2E41A 2MGQA 2CSOA 2DFHA 1GXQA 2XRNA 4IUUA 4L18B 2LD5A 3W6VA 2JPBA 5J8FA 4A2AA 2ITGA 2EJRA 3R2XC 3VQEA 1VQMN 2QZ8A 1ZRFA 4QQ6A 1JUMA 4IOXA 1VQLI 4PA1A 1OULA 3CCLI 1SRMA 4RM2A 1IC8A 2VT2A 2J7IA 3CPFA 1VTNC 3Q0UA 5LEJA 1X2KA 5AQLA 1VYTA 2W4SA 4MEYF 2Q97A 1B9NA 3QINA 5C3EJ 1S6PA 4YIIA 4AHSA 2UXDK 2Q31A 2EW3A 2NRTA 3TAPA 4ENKA 1ZRDA 1KFDA 3QUIA 3CG7A 4B21A 1VSDA 4ME7A 4ZDPA 5ADXH 4LG0B 1KG4A 1KG1A 2CGHA 1JRIA 3TU5A 1DP7P 2D1VA 2P9SA 1VQKN 4AM6A 2ED1A 3HTVA 1NKEA 3RSEA 4KMFA 2QM3A 1ZUKA 3CPWA 2YNHA 1VAZA 1Z6RA 3VJPA 1GRIA 2ZNZA 3CPWM 4F9OA 1ERDA 3CZ6A 1SG5A 4O0IA 4JV5K 3K9TA 2MWOA 1WKMA 2L2PA 4DWIA 5LJ3g 3CCUA 4C92E 5FGMA 4FSSA 4HNVA 5HY6A 5GPCA 4N4IA 4A3IJ 3F8MA 4MFBA 1HC8A 2ZC2A 5HRSA 2DYBA 5LJ3d 3CC4Q 2YSQA 2Q2RA 4EMSA 4ZYEA 3H0HA 5LHGA 1VQ4N 1XPXA 1V5GA 4FISA 1N3AA 3CF2A 5LEKA 4M75G 1JTYA 3BWGA 1LDDA 1P4WA 4CJ3A 3CCSI 2ZAEA 3E2UA 3PSIA 1VSMA 3NPFA 4BRKA 2CU7A 2ZM6K 2DOFA 4H4MA 4AFUC 2JGUA 3JREA 3NDKA 2XDPA 1IGNA 4HQEA 2M51A 2LRDA 4BXUA 3DXMA 1DP3A 4B3RK 3UKRB 3SZPA 4CFAA 1YHQA 1EZZB 4IPAA 2RKIA 4MHGA 1XSVA 2XIDA 5E20A 3H08A 1KQSS 5A2QO 2XUBA 2CYZB 1IBLK 4LFCK 1UJ8A 2Q2EB 3J81E 2EV0A 2GF7A 2TRTA 3EFOB 2A42A 3UKGA 3MMYB 1K4SA 3IHOA 1WJAA 1M90U 5KCHA 1OYXA 1NLVA 1QVFP 3K5OA 3RMAA 2KGTA 1D8KA 2WBNA 1IZ1A 5FLVA 4A63B 3MAJA 3ZRGA 5GAN2 5D7UA 3CCST 1D1BA 1K0SA 3VU3C 2VC0A 3EETA 5D6YA 2QTDA 1CF7B 4IOCL 1NK2P 1D4XA 2P9IA 4XBFA 5IHIA 2PBIA 2ECCA 2GELA 3X26B 2SEMA 1NGEA 2DL4A 1XB4A 2R57A 1KD1R 1QO0D 1QQOA 4DSJA 5IXFA 3G4SA 3K1PA 3NE6A 1WJSA 2VG6A 1RRQA 1YJNN 1KAYA 1N77A 3CCET 3WNHA 2DRMA 4IZZA 2X4HA 2KISA 2NOZA 4AWXB 3LWFA 5KQ8A 3K5NA 3K58A 4QTRA 2DXUA 2P8TA 1WEFA 3LCNA 2FSKA 3I9QA 2PMUA 5ERIA 4EJYA 3DXKA 4H03B 2F5CA 1QHAA 1OCRH 1L0OC 2EPFA 3UKRA 1MW7A 2DMOA 4X6AJ 3GVAA 3HRTA 5CYQA 4OMYA 4A3LJ 5K14A 5LJ5d 4I2QA 1I81A 1XQPA 4BDZA 1C0TA 4H8KA 3SFZA 3ZT3A 2SRCA 5ELZA 2EIKH 4LGWA 2QTXA 3L7WA 3W0LA 1W6XA 2ETHA 4J9EA 3QEPA 1FMKA 4KHUA 2L3DA 3ZMSA 2XIGA 3GE1A 5GAGP 5SWMA 4MMKA 3SQNA 1O13A 2LTOA 2G8UA 5GAHP 3D2FA 5AQIA 2CW8A 3TAQA 2JM9A 4A4GA 3KEYA 3H92A 1VQPQ 1HLVA 2O9VA 3IS9A 3QICA 1TT0A 2HI3A 5AZIA 3FK7A 3G1LA 3SJJA 1E6GA 3CXCA 1UUEA 3FIFA 3HIFA 2UUAK 3QZ5B 3CJRB 4EMKC 1E3PA 3GFMA 4R8HA 5M1NA 4KREA 4XLHA 3PNWC 2AT1B 2CG4A 4UOBA 4WWCA 4JAXA 4YOWA 4BBSJ 3SUNA 3H1VX 1NM1A 5GTHC 1NBEB 3HRGA 1MBKA 5HODA 4JI0K 4LC9B 4J9FA 2MH2A 3MEDA 2ZWHA 2JK3A 3L2RA 5LRRA 4DTXA 1AWJA 4DOWA 3CQ8A 3AVCA 3BZ6A 3GOXA 1I6XA 4FWQA 1I1SA 2V8IA 3FJ5A 1NWKA 2WC9A 3M9AA 3MEEA 2EQRA 3CCRQ 4NZGA 4OKKA 2XGXA 5TRDA 4U7DA 1ZBFA 3ONQA 1XMOK 3V1OA 3V7RA 5L3CA 1QWEA 4KV8A 3EGDB 4RUGA 1PM3A 4M78D 4N76A 2YS9A 3CBPA 2E1MC 4GCVA 2XRIA 3WHCA 4JI6K 1OEBA 1EH6A 3DM2A 4DSFA 4FWMA 4ISFA 4XTWA 2EIFA 4BQLA 4XQFA 5EG2A 3D5RC 3REAB 1KU2A 3A8LB 2LDUA 1TV6A 1KFSA 4EQQA 1VQ9T 2QGFB 2VXEA 3QJ6A 1Y1WJ 4HUFA 1X19A 2OAZA 4XMYA 3JTGA 3ZSZA 3A5LC 4C2TA 1Y71A 1KQ9A 2E71A 3LOCA 1WNLA 4HCCA 1NE8A 3O3HA 5DUIA 2H1KA 1VIEA 2KHOA 2ATCB 4N41A 3TDZC 1YBYA 1VQ6T 3S9HA 4JLGA 3HSTB 4B43A 2NOJB 2M16A 2E60A 3QLHA 5IY5H 2Q2EA 4I0AA 3TEEA 2B8AA 4JKEA 1FNNA 1YCSB 5IPAA 1OQYA 1AWWA 2RHUA 2K3YA 5BPNA 1W2BS 4O5VA 2ME6A 1DT9A 2ZCWA 4IVNA 5J3BA 4JK1X 2GWKA 3V1RA 2AJQA 3PFIA 4CF9A 3AL0C 2I2LA 4I76A 1RDWX 3FKIJ 4MMLA 4CSWA 3WTWC 1YTYA 2EH3A 3DCFA 2WV0A 1QQIA 3M3ZA 3S1QJ 4UUSA 2KRHA 2CH6A 4I09A 3VS7A 5BNGA 4XL9A 5KYYA 5C10A 3IAYA 1HA8A 1V5FA 3BG5A 5ADXA 4BRAA 3D0SA 3ASMA 5GAN3 2STWA 4UXNA 2PU9B 3C0BA 1BR2A 2NOHA 4OPKA 3BE3A 1G83A 2K5IA 4UC4A 3MX5A 1UHCA 3JAME 3QBXA 1OPCA 4ZGDB 2PG4A 3A1YA 3KLOA 3L1PA 4DYCA 1SAZA 4CEBA 2YHWA 4I2OA 4LDYA 1FIAA 4KA4A 1U2VA 4ZTFA 4JLHA 2HKXA 2GUPA 2F1LA 1VQ4A 1NGFA 1Z9ZA 1UWBA 3NF6A 3WNFA 4BVPA 2HMIA 2F5TX 1QZ5A 1JLGA 4CIGA 2XAUA 3DV8A 3CUOA 2BE9B 2O5RA 3MXMA 1O3SA 5EG0B 1VIFA 4DA4A 3ZSWA 4ORZA 2XY6A 1WVRA 2O8CB 2JXBA 2JPCA 1X27A 3QEWA 1F36A 1SVOA 2QXFA 1D9DA 4B3AA 2A6HF 1NPPA 2BH1A 1B7TA 2NRWA 2KL4A 3CXCP 2K4BA 2ID3A 3QXEB 5CO7A 2KRSA 4EJWA 4KRFA 2KQRA 1KVCA 2PLYA 5E84A 1NPRA 1LOJA 3RZDJ 3LM2A 1IG9A 4PK4A 2JN0A 3DTIA 3FDYA 1ZYQA 1PG5B 1LE8B 1EH7A 3EFSA 1YIJN 5ILUA 2ECBA 1ETWA 2ZMEA 4EMKB 3SUQA 3LYIA 2O9SA 3UE5A 3LA2A 1JEGA 5C42A 3RR7A 4NXMK 1N78A 1A5JA 4AU7A 4R56A 4Y91A 1VSHA 1JJ8C 4DTOA 3PNVA 3A01A 3WHBA 3HKSA 1IUFA 3VS6A 3MJXA 3FM5A 3CCMI 5DM6L 4O3MA 1RR7A 4FZXC 2ZQBA 4A3GJ 1KLMA 1BC8C 4GBQA 5HVQC 2KT1A 1OMIA 1K61A 1IAWA 3K2AA 1MMGA 5GAMd 3EUHA 1NJIC 2YX4A 4CZKA 4H5RA 3BEXA 1AWXA 3CMAN 5EY4A 3RESA 1KD1O 2FXAA 2CDTA 4XU1A 3WGHA 1ZG3A 1GLJO 5J8CA 4FJXA 3CJ9A 4M75A 4PL6A 1NKCA 4R0KA 1H88C 2GOXB 2NUZA 2QA4A 3DPLC 5GANg 5KAIC 2XDDA 4BR9A 1XDSA 4PZJA 1TWBA 4KFBA 2DFIA 1TH7A 3ZETA 4OIRF 2FBXA 1K6YA 2MYSA 4G6TB 5GMKl 5ED4A 3WTUC 5E1ZB 3DRRA 4KJZA 4KN4X 1T3VA 2IT0A 4IDHA 4FE4A 1HNZK 2KW4A 1YS7A 5JLHA 2FRWA 1XGNA 1LWWA 2K57A 2DIGA 1REVA 2NS8A 4AHTA 1X1DA 2PJPA 1O3RA 2DTOA 5ICCA 2HNDA 3V9SA 3TTFA 1X4PA 3CETA 4RW6A 1FXXA 3MN5A 1R1UA 2YG8A 4EP4A 5D6EA 1UAXA 1T05A 3RKWA 3H9JA 1GBQA 2NUPB 1GFCA 3H5NA 5HDNA 4C8QB 2VE8A 3Q0WA 2VPLA 5CKDA 4LF9K 2R7TA 2KZGA 4AIDA 2CSIA 4OP0A 3R9PA 3EAEA 2ZFUA 2EGAA 1T39A 4J8FA 2NVQJ 4WFAL 4CUGA 1Z9CA 3PE0A 4RW9A 4EJZA 1K76A 2E5NA 1TUGB 4XH1A 4M7DA 4GLMA 3TPQA 4DR4K 1SMYF 3LX7A 2EFIA 5GIOA 1C1BA 1K78A 2F6CA 1RTIA 1QVPA 3IRQA 5DM7F 1QBJA 1TWHJ 1SKSA 3FXUA 3U4LA 2V6EA 2L9NA 3WE2A 4KH6A 1YX5A 3CCVA 4BE2A 2ZGWA 2GXAA 2V1UA 1LAWA 3C6AA 3N4MA 5J1YA 4RCCA 1VQLN 5DLQE 2FBKA 1HKTA 2CT4A 2NVYJ 2R7YA 4FJ7A 4M42A 1YI2Q 3OS2A 2WAQN 3ENOA 2GM4A 4JZ3A 1BW6A 2V52B 2DMNA 3IKVA 2DTHA 3VYRB 3GFJA 2EYQA 4CK1A 2DZ9A 3KKSA 3DU6A 2K4YA 2MBFA 4OMMA 2NUTB 3QU3A 5LGNA 4CEFA 1FIPA 3T69A 3IQLA 1UG2A 1SD6A 2AS5F 1LFBA 1RT3A 1JHFA 5AN4A 3OYGA 2VUBA 2X78A 3PLAA 1YJWT 2OTJT 2FBTA 1XS9A 4NO7A 4AVZA 1PSFA 3VS1A 3ZQFA 2B63J 3CXCM 1J75A 4JI4K 4PY5A 3MCAB 4A6DA 5C25A 3DPTA 2COWA 3ZETB 3GNFB 2P9SB 2OA4A 2BY1A 2EZHA 1VQPA 1BB9A 4O8KA 1HDPA 3A02A 5HRRA 2E5QA 4AI4A 4Z88A 3OS0A 3VRZA 1Y56A 3FF5A 2RQQA 1ETYA 1FSHA 1MNDA 2ZBKA 1LCUA 1LQ1A 4W1UA 3QODA 1BBZA 4D1QA 3HOUJ 3TP0A 4KO0A 5LFAA 4M77F 2W7NA 1PC0A 2IVNA 3HSEA 2FBYA 2OTLA 2VONA 4XK8E 2AQFA 3IRXA 4ESFA 4JX4A 2CZ6B 1GOCA 3CUQC 3WE3A 2Y4YA 4NCGA 2V9KA 2K3BA 3IL2A 3ZBDA 3I55N 4IEEA 3KVGA 3ZOBA 1MJAA 2NOGA 3FHZA 1A04A 4HF2A 2VT3A 3FXLA 2GWJA 3E9OA 5AQRA 1KQJA 3G6EQ 3CQTA 1ZQ3P 2FPDA 2N8GA 4E9FA 1VSJA 2FF6A 4Z94A 3A0BC 1YCYA 2STTA 3JCMg 5LRSA 2FYKA 3RDIA 4ENMA 1WWXA 2OI3A 3KBGA 2V51B 4Y15A 4J9HA 1PHTA 2G8WA 2A3LA 3BY6A 4BRHA 1FSEA 3SQ4A 5E79C 2HTSA 2Z1DA 1M90O 1Y0UA 3O9RA 2A37A 2NLUA 4F55A 4CW7B 4F2RA 1LV5A 3ITHA 5GAMg 3TAMA 3QYEA 3CCUI 5IXBA 2OTJI 4ISGA 2CRGA 4LK0F 4Q5SF 2DBKA 4DR6K 3DWLA 3ZL7C 3M4YA 4DFMA 1ETOA 5LJ5f 1IKWA 4B09A 4IHXA 1BI0A 1XWLA 3SLCA 2QQ9A 2LJ3A 4RTWA 4PJOC 4FW2A 4V2GA 3EY1A 4K8XA 5FKLA 1UHWA 1UELB 3PM1A 1VQ8T 4DSLA 4KHWA 1XN7A 4M77A 5I22A 2H8HA 2QA4I 1G6NA 1U6ZA 2F7TA 1HOMA 1QVGP 4OIOF 1KVBA 3EYYA 3BQYA 4HPQA 1E0EA 2QKBA 2QEXI 2P7VB 5CK9A 5FPDA 4LFUA 2HBLA 2CUFA 1N39A 1C1CA 4HG2A 3P5JA 4DYQA 4UY8I 4BQOA 3C95A 5BMZA 1KQ0A 5IH2A 3AY9A 1H8KA 2EA4A 4H0PA 3I54A 4ELVA 4BRNA 3DI6A 5BREA 1OLTA 4W5NA 3CFOA 2EVRA 4QSHA 3FK6A 3BDUA 1JGSA 5CHZA 1IRFA 3ISNC 1YJWN 3BCBA 3CQZJ 4CJEA 2VJJA 5CKBA 3T1HK 3L2WA 2DNUA 3K4KA 1MNEA 1KIKA 5D8LB 1LFUP 1Q86U 4Z8AA 4UUTA 1PVEA 2ZMEC 4JI1K 1KC8O 1LNWA 4CZMA 5CZ1A 5L8RE 3KD1E 3DLGA 2KT0A 1ZTRA 5FKNA 3NGYA 1T33A 3H0DA 1WHLA 2H6BA 1VSIA 1Q81R 1NGJA 3G4ST 2E7WA 1PUFA 4AH9A 1S7AA 3PX6A 4KHYA 2JNGA 4FZYA 4M7DD 3VF6A 4HX8A 2JRTA 2EQUA 4JJBA 3IHUA 1P90A 1YP5A 2NOIA 3WNGA 4MDWA 3MXIA 3EUHC 2WTUA 2HDWA 5HLIA 3QNNA 2XGCA 3QDFA 4BROA 2DK8A 4LSLA 1B9FA 4RS8A 3CMEN 1GBRA 1XCVA 4Z89A 4OWRB 2E8AA 1ZG5A 2JVGA 2DMPA 4DFPA 3OMCA 4YY3K 5D5VB 3BDLA 2DA6A 4MLOA 4IUVA 4R55A 3R0JA 2JMCA 3A5OC 3S41A 2FPFA 2MSYA 4A2UA 1IG7A 4BG8A 1QCFA 8ATCB 4YDUA 1QCOA 3HOXJ 4YOTA 4UVCA 5HKCA 1FPQA 4XNFA 1TWGJ 3FZLA 3PQKA 3U2RA 3CMEA 4S0HB 1X1PA 3HB9A 3M3YJ 3VEPA 1MUZA 3K5MA 2XI9A 3ZFJA 3G71T 2BE7D 4K43A 1VQ5Q 4CIEA 2DCEA 4Y7NJ 1UHMA 2K86A 4DTRA 4B8XA 1XGSA 4BS9A 1SKWA 1DGKN 3CCRT 1C6VA 4BJTA 4XOTA 3ZQLA 1FX7A 3TAFA 3MPUB 3D7EO 5J1EA 3FBNB 3H1CA 4L9NA 4QS7A 3MP8A 1O7FA 4CFDA 1QP3A 2Z1HA 4F93B 3I0XA 1KD1C 4EM2A 5AZJA 4BGDA 2HYFA 1LWEA 4DOVA 1VQMI 5KK1A 3BG7A 3ERMA 1PKTA 2R5YB 4XM3A 4IEJA 4FYXB 4QAGA 3M8EA 2ZPEB 3OYYA 2GUIA 2F5DA 3I33A 4M6XA 5GJWB 1J3TA 3WTSC 1U5SA 4HUGA 2M5WA 2HB5A 4BWMA 2RV8A 4N56A 1VSLA 1N8RU 3LSHA 4HDUA 2HU9A 1ZBHA 5LL6Z 3EHQA 3CCSQ 1Y8QB 2O01E 2QLZA 1K0XA 3KK3A 1ZAOA 2E2PA 4W5RA 1D3BA 2IA0A 4CICA 1ZUYA 3MWTA 1TTYA 3CCQN 1IBKK 2JVHA 2F5EA 3MHXA 1ZBIA 2DEUA 4JI5K 5CYMA 5KGWA 4RTTA 3C94A 1IXCA 1BQNA 4OLAA 1YTUA 1K83J 3OL3A 1ETXA 1YQKA 1U2WA 2YKMA 3TQ7P 3A8OB 4F8RA 1AU7A 2OJ2A 4BJ6C 3O4NA 2WAFA 4PUSA 5IT9K 2OJED 3CCRN 2J6FA 4RB2C 1JL2A 4MO5A 4CGFA 5HRNA 1WYXA 3TSWA 2BYVE 4C9YA 2ZJRF 4J9CA 1HKBA 5JVGF 2X35A 4M75C 3C65A 3RKXA 5J3LA 4LN2A 4YDUC 3HXMA 4BY9C 2L0AA 1ZARA 2BGCA 5EZHA 1QCNA 1QWFA 2WOMA 2QENA 5GTIC 1R0AA 1HUXA 3LSPA 1ZGAA 2HQAA 1CZ9A 3DFGA 3MN6A 1CGPA 2EYYA 4CE9A 1DKGD 1GLNA 1XJWB 3ZMZA 4EIAA 1S1UA 3QO9A 1X3MA 5D6FA 1QPIA 3LSTA 2VWBA 5B3SH 3G6EI 6AT1B 3S93A 3EG9A 1BA5A 4HA8A 2OFIA 1G2BA 1UGSB 3QYFA 1GHCA 1TAUA 3NWTA 1TUYA 2WV1A 4BC4A 4CZLA 3VYSB 4FM2A 2OPTA 2ZO4A 3OYBA 2PVDB 4IQJA 1VQ9Q 4IUQA 4BD3A 1NJXA 4OMLA 2CFXA 3P31A 3W3CA 1BCOA 3JXUA 3QB0A 4OMFB 3AG4H 2LVSA 1X3NA 4F3TA 1YVUA 4OX9K 2L5QA 4IO9L 5L23A 2NLXA 3LPTA 2E4LA 1YW8A 2E70A 2RREA 2VKDA 1Q8IA 2MAMA 4ZGJB 4FCYA 2Z1GA 4HOBA 4V19K 2JZYA 1S9EA 4IHTA 3HBLA <