4IKFA

Pfv intasome with inhibitor mb-76
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2-Hydroxyisoquinoline-1,3(2H,4H)-diones (HIDs), novel inhibitors of HIV integrase with a high barrier to resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein/dna/inhibitor
molecule keywords Integrase
total genus 101
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ikfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ikfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ikfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ikfA03
3DLMA 4CHQA 2GFUA 1RT3A 1KVCA 4XIUA 5HROA 4CEZA 3AA4A 3IAYA 2KZZA 5C25A 1HYSA 4OLAA 3C94A 3SUNA 2RJDA 4LSLA 4N56A 4C5HA 3M8QA 3PX6A 3PFSA 1X9MA 3NHGA 2IOCA 1QSYA 2QKBA 1VSJA 4CK3A 2XY6A 3G10A 1CZ9A 4CEAA 3K2PA 3OYAA 2RHYA 3S9HA 4I9QA 1HMVA 3LALA 4H8KA 5J1EA 4W5RA 1QQCA 4KHSA 3U6FA 4CHPA 2F5KA 3NDKA 4L8RB 2EQMA 4FL6A 1DLOA 3VN5A 3LYIA 1QHTA 4DU3A 3DM2A 4CGJA 1X9WA 2G8VA 1KCFA 4F3TA 1MU2A 4FM0A 4DQSA 2VYTA 4CJQA 3LX7A 4CJTA 3LGLA 1TL1A 1BQNA 2HB5A 3QJ6A 4H4MA 5DK5A 4FJ8A 1VRTA 1C0TA 1CLQA 4N41A 2LVMA 3JYTA 3ZSXA 2YHBA 4I7FA 2L3RA 3SUQA 1SL0A 2RHZA 3FDRA 2G8FA 4CCHA 2G8IA 2KW4A 4Z0UA 4QCLA 2HHXA 2DFFA 3SQ2A 5I42A 1UAXA 3LPUA 1S6QA 1EXQA 1FK9A 3WNEA 3M8SA 1HQUA 4KV8A 2QKKA 3MP8A 3KD5E 5IN1A 3OYNA 3ZSWA 4FK4A 2DY4A 4IKFA 3DOLA 1IKXA 3QINA 2XY5A 2Z1IA 4DSIA 3ME9A 3KKRA 4KHWA 3MP1A 3HVRA 3LDSA 5HRRA 3LZJA 1LV5A 1ZBLA 4DTMA 3ZT0A 4NYNA 3L2RA 1UOCA 2VG7A 2VWJA 3SZ2A 1BIUA 3DYAA 1TAQA 3HPGA 4CGDA 4ZHRA 1B9DA 3KK3A 1T7PA 4FJGA 1NJZA 4DU1A 3OYLA 3KTQA 5SZTA 1SKRA 3TAGA 2QK9A 2OPSA 3MEGA 4J2EA 1HRHA 1QE1A 4CGIA 4F2SA 5JS1A 4AILC 5HLFA 3QEWA 3L42A 2HHSA 3K58A 2B5JA 2OPQA 3HSTB 3MECA 2HHUA 1HYZA 4Y1CA 2KFNA 2P51A 4O55A 4UC4A 2ITGA 3NGIA 2R7YA 3ZSOA 1JKHA 5KE3A 4OKEA 3K5MA 4FJIA 4KB1A 1HYVA 4JS5A 1NK5A 3MEWA 1L3VA 2X6SA 3CG7A 4N76A 4OKKA 1D5AA 3LZIA 2XY7A 4KI4A 2LRQA 4LH4A 4DTJA 3E9FA 4OKJA 5C24A 4FM2A 4IUVA 4Z4CA 1WSHA 4FZXC 1NJXA 3TARA 3K5NA 1YTUA 2X35A 1HNIA 4AHTA 3EZ5A 4DTUA 4E7JA 4KREA 3TANA 1S9GA 1WN7A 1G15A 5IAYA 3VQ5A 4RW4A 3SQ4A 3QIIA 2M0OA 4DQRA 3L2WA 4CJSA 2HHVA 2P1JA 3V9XA 2E5QA 4DTPA 2Z1JA 3TR8A 4YFUA 4Q0BA 5D6XA 3C6TA 3OYEA 3H8ZA 1IKWA 1CXUA 1RILA 3I0RA 3OYGA 1S5JA 3OMGA 4W5NA 4DLEA 3UIQA 4A4HA 1U49A 1J53A 3RTVA 2DIQA 1SL1A 1H3ZA 2F96A 2RN2A 3EY1A 4QQGA 2GUIA 4IFVA 5FRNA 3ZT2A 1D9DA 1L5UA 3PO5A 4C8MA 1VSEA 3DB3A 4J2BA 3DRSA 2R5AA 2GV9A 4HUFA 4J2AA 4DTSA 3TAPA 2FBXA 5FDLA 2XO7A 3DLEA 3M8RA 3O3HA 3QEXA 3RWUA 1ASWA 3V1RA 3HPOA 1WSEA 4M41A 3QIPA 5D6WA 4HVJA 1D8YA 3MP6A 3MEVA 3HPHA 3LANA 1RDDA 4HUEA 3FEOA 4A4EA 3OYBA 4DSJA 1RDAA 4C5EA 3CQ8A 3AO3A 4O44A 1L3TA 4N4GA 3DLGA 3RRHA 2VG5A 3AVNA 4DS5A 3HYFA 1RI0A 4NCGA 1SV5A 1LWEA 3CYMA 4CGHA 2DFHA 4Z4HA 4FLWA 3V9ZA 4B9WA 2M1HA 1XI1A 4CEQA 2QQSA 4HCZA 3OYJA 1C6VA 3B6PA 2BKDN 1SKSA 4FJKA 5FRMA 1LW2A 4AHSA 4W5QA 4OLBA 1S1WA 1J54A 3S3OA 1LWFA 2F8TA 4CFCA 1Y97A 1BHLA 2EHGA 3M8PA 3TAQA 1NOZA 3PNWC 2HNZA 4BWMA 4E89A 4DSLA 3OVNA 4CK2A 1BCMA 1D9FA 3F9KA 2D5RA 4AHRA 4II1A 4DFJA 3RMDA 3PUFA 2RHIA 4OGCA 2HHQA 4N4IA 2Y1JA 1RBSA 4I2PA 2PY5A 2PYJA 3RMBA 4FK0A 2M16A 4JLHA 3QO9A 3RRGA 4M3TA 4Z4IA 3HP9A 4L59A 3FLGA 5C0MA 4M45A 1XC9A 2O4GA 5K14A 3VQEA 4DTNA 3SPYA 1NK7A 2LSNA 3ZT1A 3QEIA 3AA5X 4BDZA 1TK0A 3AA2A 2RF2A 3ZT4A 3MAQA 2ATQA 5FROA 3LWLA 3ZEHA 1NKCA 3M9QA 1LAVA 3JSMA 1IG9A 1GOBA 3OYHA 4QVZA 3CM6A 3LLRA 4JS4A 1KRPA 4F3OA 4FJXA 1W9HA 4EZ6A 2E6MA 4HUGA 4CE9A 3TWHA 3OS1A 2EFIA 2A1SA 1VSIA 3OYIA 4E0DA 4IUUA 2KZMA 2K3YA 1BIZA 2MWPA 4E19A 4CIFA 3F73A 1IH7A 4CRIA 3BDLA 1S1XA 4CJ4A 3V9SA 4AHVA 2NUBA 4CJPA 4DFKA 3T3FA 2A1RA 3HL8A 4B9TA 2NLUA 1BL3A 4BDYA 1WGSA 1JLQA 2B6AA 4RG2A 2HNYA 4FVMA 1A5VA 3SUPA 3SPZA 2JZ2A 3OA6A 4GMJB 4O5BA 4OPKA 4CESA 4B9UA 4BD3A 4M3YA 3K57A 1C1AA 1Q9XA 2RI5A 5HRSA 1A5WA 4C8KA 2KTQA 4FLZA 3O8VA 2BE2A 1VSKA 5CYMA 1X9SA 2BIVA 5HBMA 1HQEA 4CJ5A 1T03A 4KHYA 2HQEA 1HPZA 4W5OA 3K59A 3V9WA 4OVLA 3OJUA 2KQ2A 4DLGA 4DF8A 1IKVA 2IS3A 3DB4A 4OGEA 4FJNA 4C8NA 3VQCA 3D45A 4KTWA 4CGFA 1C1CA 4CEBA 1S6PA 3NF7A 5KI6A 1IO2A 1U47A 2BUDA 1Z26A 4CJ3A 3SQ0A 3V4IA 5HP1A 3MEEA 2Z1GA 3S3MA 1EP4A 1WNSA 1KFDA 3I8DA 3L2UA 2MWOA 4A4FA 1ITGA 2YRVA 1CZBA 3ZSZA 1WSFA 2WACA 4RW9A 4CF9A 3TAFA 1SUQA 3MXIA 3NH0A 3NCIA 1QTMA 2G8HA 3L2VA 1N27A 4FW2A 3DLHA 4KAZA 2BGGA 2D9TA 2LCCA 3C95A 2B8AA 2GBZA 1SL2A 4Z02A 3DI6A 3VQQA 1Q8IA 2FHDA 3PMTA 4E3SA 4B9NA 3PY8A 4HCBA 3AVMA 3HVTA 4PA1A 3KLHA 1RBRA 1RTJA 1FXXA 1JXEA 1RT5A 2VG6A 4KO0A 3VQBA 3VQDA 2P0KA 1WJRA 3WNFA 1JLEA 2YNFA 2I5JA 3HT3A 5J2PA 3NBPA 3O4NA 1TK8A 3DLBA 2DTUA 4DG1A 3OJSA 3UT1A 4E1NA 3MXJA 4M3WA 4CEEA 2FBYA 4CJEA 4CFDA 3PMIA 3QERA 4E7KA 1VSDA 3VQ7A 1YVUA 4BACA 3MO8A 3K5OA 4EP5A 1BQMA 1JLCA 3QNNA 3C4SA 5I3UA 1KVAA 2JLEA 3ALYA 4NYFA 5J26A 1OZ3A 3HXMA 1ASVA 4HHTA 3AVHA 2O4XB 3FFIA 4PLIA 4RW6A 2RJFA 1J9AA 1TVRA 4CJRA 3NAEA 4FU6A 4QOZB 2Z1HA 3OB9A 3ITHA 3AO5A 4PL6A 3VQ6A 4DQQA 3VQ9A 3Q1JA 5C6SA 3FC3A 1JLBA 2E4LA 3AA3A 4QAGA 3LWMA 4DFPA 3TABA 4KHQA 1JLAA 1RT1A 5CZ2A 1NK0A 2PQWA 4C5GA 3T1AA 4CEDA 1ZYQA 4DWIA 1BCOA 3ZT3A 4H4OA 1T8EA 3ASKA 4NCBA 4CGGA 2F8SA 5EU7A 3K5LA 2BDPA 1NK9A 1KHCA 1DTTA 1RCHA 2EQUA 2X4XA 1MHNA 2IGIA 4O0IA 4LD0A 3SNNA 4I2QA 3OYFA 3P5JA 3IS9A 4R5PA 1KLNA 4F4KA 4F8RA 3LH0A 2HMIA 4FZYA 3AVCA 2GF7A 3AVFA 1G5VA 5D6YA 4RG8A 5CY4A 1TKDA 4RW7A 3SV4A 1C0UA 2QXFA 1RDBA 2IG0A 3ZSVA 3OMCA 3KLEA 4KI6A 1LWCA 4M3UA 3ASMA 3L8BA 2RHXA 2IC3A 2PZSA 3IRXA 4QW2A 3META 2OPPA 3HK2A 3EAEA 3OYDA 1CXQA 4I9LA 4CJVA 3NH1A 3MXMA 4Q5VA 1TKZA 4DSFA 4PUOA 4HCCA 3O3FA 3QLHA 2R5MA 3MEDA 1GOCA 4CEOA 4CJWA 2YKNA 1BI4B 4QQ6A 3VQAA 2BANA 3T19A 3DOKA 4CIGA 3KK2A 4FLTA 3H08A 3PV8A 2ZQBA 3KKSA 2WONA 3C6UA 4KTZA 4DTRA 2RJCA 3OYCA 3BDPA 4DTOA 4EP4A 1UA0A 5HRNA 4MQ3A 1RT7A 3L3VA 1XWLA 2XK0A 3PO4A 2EKOA 4M3RA 3VA3A 3V6DA 4E1MA 4C8OA 2Q3SA 3I0SA 1WSIA 3ULDA 4QQDA 3AO1A 4LY7A 3KLGA 4FLYA 3P1GA 5C42A 1EX4A 1OYXA 1GOAA 3F70A 4DTXA 3THVA 3TAEA 4DQIA 1KTQA 4ID1A 2O4IA 3NTKA 3LP2A 2LTOA 1U48A 1TL3A 4UQGA 1VSFA 3H6ZA 1RTDA 4FLVA 4IDKA 4Q5WA 4W5TA 4CHYA 3LGFA 5KCOA 1RT2A 2RO0A 1JLGA 1NKBA 5J39A 4CF8A 3CM5A 2XDPA 4A4GA 4DQPA 3QKJA 1QSSA 4ELUA 4LH5A 4GVMA 1X1PA 1UWBA 2D0CA 4GW6A 1N5YA 2VWKA 3O4QA 3IG1A 4B8AB 1DTQA 3NFAA 2Y1IA 4N5SA 1JLFA 4ICLA 3QEPA 4FLXA 2OZSA 2K3XA 2LDMA 3NTIA 4LSNA 4B9MA 3B6OA 2RPIA 3HJFA 1K6YA 1U4BA 4PWDA 4CIEA 3L3UA 4CF1A 3V1QA 4PY5A 3BGRA 3QEVA 3AVJA 1T05A 4ZTFA 4OJRA 2FBTA 2X6NA 1Q9YA 4B9XA 4X34A 3LP0A 3CFPA 3KD1E 4C8LA 4FJ5A 1S1VA 3U3GA 2YV0X 3S6WA 1C0MA 2CKKA 3V1OA 4DF4A 1TV6A 3QESA 4BE0A 3LAMA 1N6QA 4BWJA 4FZZA 1XHZA 3WNHA 1YT3A 4B9LA 4WE1A 1JL1A 3LP1A 5J2QA 5CIUA 3CEYA 4NCAA 1FKPA 2RI3A 3KUFA 1VSMA 1UA1A 3AVAA 3SQ1A 2RKIA 4DFMA 1I39A 1C1BA 4OVAA 4O4GA 5E41A 4JRPA 1U45A 4B9SA 4ID5A 4K8XA 1RTHA 2L89A 2RHUA 3WNGA 1RBTA 3O3GA 2W42A 2JTFA 3VQ8A 4MFBA 1J5OA 2G8KA 4FLUA 2YHAA 2ZD1A 3DRRA 1TKXA 1TK5A 4FK2A 1NK4A 1B92A 4KTQA 4M3XA 5KRSA 3OQ5A 3NNQA 1QSLA 3KK1A 4CJLA 4M3ZA 1LAWA 4CJFA 2HQXA 1RBVA 4B9VA 4DU4A 4IUPA 2L8DA 5KGXA 3RR7A 1RDCA 2YNGA 3P8HA 1VSLA 2G8WA 4O0JA 3QIOA 1WSGA 4CJUA 2EQJA 3RR8A 4FW1A 4YNQA 1KLMA 3HM9A 2R57A 4IBNA 1TAUA 5KE2A 1BISA 1XNIA 2X78A 1L3SA 1NOYA 2GFAA 1S1TA 3RMCA 1NK6A 4IG3A 4PLLA 3AO4A 2O4XA 1RNHA 3S3NA 3VQPA 2X4WA 2QQRA 3QETA 3ZSQA 3HP6A 3MEAA 1NJYA 4DSEA 3EYZA 4FJLA 2YNIA 3NGZA 4JRQA 3LPTA 1WAFA 2KFZA 4CF2A 2G8UA 1RT6A 1S9EA 3NGYA 4HTUA 3AO2A 4FYDA 3DLRA 2OA8A 1BGXT 1KVBA 4J2DA 1VK0A 3DRPA 3P83D 3ZCMA 2B4JA 3CFOA 4PQUA 5J2MA 3KIOA 1ASUA 1EKEA 4DS4A 4KRFA 2D0BA 2FC0A 1LW0A 2X74A 4F2RA 4ZTJA 4CHZA 4NZGA 4NS5A 4EDUA 1REVA 1NJWA 3AV9A 2XRIA 4CECA 3D0PA 4EZ9A 1A5XA 1ZBUA 2WOMA 4KFBA 2DFEA 3TAMA 1VRUA 3A2FA 3DLKA 4KKOA 5CZ1A 1L3UA 2IDOA 4CK1A 5KTQA 2P5OA 5KCHA 2XY8A 4BDPA 4BE1A 4N47A 3NTHA 5M9OA 1RT4A 4IUTA 4CJKA 2D0AA 3L2QA 3SD4A 1BI4A 2YKMA 3NF9A 3KLIA 3NF6A 1ZBIA 2HHWA 4DMNA 2DIGA 4FJHA 1JXBA 3AVLA 4C5IA 1WAJA 1VSHA 1KFSA 4FM1A 4FJMA 1OI1A 2AJQA 2E6NA 3PX4A 1R0AA 3KJVA 4IURA 4Y1DA 3KLFA 2G3RA 4CERA 1TGOA 4IG0A 5JS2A 3AVIA 3CFRA 3AVBA 4ELVA 1ZBFA 4FJ9A 1RTIA 1HJRA 4E7HA 2EQKA 2R58A 2OPRA 3ISNC 4E7IA 2HNDA 3LP3A 3VA0A 5J2NA 3TI0A 3E01A 3G0ZA 1NK8A 4BE2A 4N4HA 2ZE2A 1JL2A 3SV3A 4CHNA 4G1QA 1W0HA 1O1WA 3RMAA 2X4YA 2OZMA 4FXDA 1S1UA 1WJQA 4RW8A 4OPJA 4KB0A 2RJEA 4LD6A 1B9FA 2E6LA 1XHXA 1QS4A 5KGWA 4CF0A 2P5GA 2HVHA 1YTAA 2FBVA 5DMRA 2RI2A 1OZ2A 3OS0A 1I3AA 1TKTA 2IAJA 1IKYA 4B08A 2YNHA 3UWNA 3AVKA 4AHCA 4CFBA 4ELTA 4IUQA 3U3YA 4FJ7A 5KRTA 4Z4EA 3OYMA 3ZSYA 4CFAA 3SCXA 4DSKA 4KHUA 4AH9A 1KSPA 4Z4GA 3DMJA 4M42A 1HNVA 4FJJA 3OYKA 3P8DA 4FCYA 4K8ZA 1SSFA 3LAKA 4KHNA 1Z25A 3PX0A 3MEUA 1F21A 5T7BA 3SJJA 3OY9A 3SI6A 5CYQA 5SWMA 2OYQA 2JGUA 2HW3A 3V81A 2PYLA 1EETA 3HO1A 3NH2A 3VQ4A 4Z4FA 4CHOA 1WLJA 4B3OA 3NF8A 3ZSRA 2XHBA 1RBUA 4GY5A 2ETJA 3V9UA 2EX3A 4CEFA 5D3GA 1NKEA 5HRPA 1WJSA 2HHTA 5KH6A 1ZBHA 1SKWA 4B8CA 3QNOA 1FKOA 3AVGA 4AHUA 4E7LA 3E9GA 1WSJA 3OS2A 3SYZA 3GOXA 4TSXA 3NE6A 3SUOA 4KPYA 2DAQA 3QBYA 2HVIA 4IFYA 1U04A
chains in the Genus database with same CATH superfamily
5FPEA 4UB6C 1RT3A 2KRHA 3HI0A 2YHXA 1VIEA 4HW0A 1ZBJA 3IFRA 2XY6A 1Z9QA 3VEWA 1UG2A 2RHYA 3RTRA 2P9PA 5K7HA 3CCRA 3X20B 2OA4A 1X9WA 2AXTC 4WQ4C 1MU2A 1MBKA 2R93J 3OBWA 1BQNA 1IXDA 2Y75A 5DK5A 5GMKl 3O1WA 1ZN2A 3ZCOA 5I42A 4YFXF 3M1CA 2RMOA 3M8SA 3OYNA 5HLHA 3THXB 4FWOA 1SFEA 3PNVA 1SMYF 1VQ6N 2IGMA 4U0WA 1RIOH 2ZMEC 2HBJA 3HSFA 1QW1A 4DBQA 2DI3A 3QSUA 1FOWA 2VV5A 2A5XA 1L3VA 4E47A 4GV9A 3LM9A 3G6EA 1ACIA 3N5BB 1LFUP 4X1EA 5D8KB 1YOVB 5KN9A 3LDNA 5BRHA 1NJXA 1QVTA 1JUSA 2QQAA 4I02A 1VQ9I 4C2UA 4RW4A 3TR8A 1IKWA 1QRYA 4ZDPA 5E79C 1TWBA 1F9NA 2JW4A 3DU5A 2C06A 1SL1A 2HF3A 5GAEP 5GANg 3PO5A 1QHGA 2XASA 3DB3A 4EM2A 1YHQT 3GYHX 5FDLA 3ASOH 3O9SA 4M41A 5D6WA 3KTQA 4BQZA 2BTFA 2BW3B 1L3TA 3DLGA 3BR6A 1MBJA 5H2FC 1R7JA 2XF6A 2VQEK 2ID6A 5ILUA 3OVNA 2HI3A 4II3A 1ULYA 4DNCA 2Y1JA 1PJRA 1Y0UA 2JN6A 3DTEA 1QWFA 4NOYA 2LSNA 4KBMB 2BY1A 4UNFA 1TK0A 3L4IA 1VQ8N 3BY7A 1H3HA 4BXUA 5ELZA 3OS1A 1WZOA 3Q0UA 2O88A 1IHWA 2WTUA 4JI7K 3H3OB 2A1SA 3MWPA 4CZZA 5FKMA 1R77A 4B47A 2HBKA 2A1RA 1QNTA 4FVMA 2JZ2A 1NKUA 2E1NA 3MVPA 1VSKA 2CZ1B 3FHNA 1NU0A 3OJUA 1DPRA 5E18F 8ATCB 2LRDA 2VKVA 1Q81C 2HFHA 3AY9A 2K5FA 4KHWA 4I7HA 1OFCX 1AU7A 2V1RA 3K10A 1K0SA 1LVAA 4YFKF 4RGXA 2ASOA 2GBZA 2DA4A 3PY8A 1W4SA 2PTKA 3HT3A 3W6KB 2YNFA 4E9HA 2JZYA 2JPBA 1J7KA 1PU6A 3VQ7A 4BACA 3MO8A 1RDUA 1YW7A 1ASVA 2V7YA 4CJRA 4FU6A 2LX9A 2KMTA 4CEDA 2DZCA 2QDYB 4DQPA 2P0WA 2YSRA 5HCKA 1P2FA 5IYCJ 3SV4A 1RDBA 4EMSA 2BXYA 4LK0F 2QW9A 3META 5JMVA 1QA6A 2H3GX 4HAMA 3K1MA 2YKNA 3J7YJ 2ZXIA 2GLOA 3EFSA 2KK4A 3BDPA 4P9UA 3TQNA 2KVQG 2WBNA 2B7EA 1TZLA 1GOAA 3F70A 4ID1A 4CBXA 3H6ZA 1GCQC 4Q5WA 3EN9A 3Q7BA 5AFUA 2I10A 1UDLA 5LHIA 1X1PA 3PUBA 1SAZA 1FZPB 1ETYA 1IN5A 1KQ8A 2UUCK 4NUBA 2LT4A 1XSVA 3S17J 2IVNA 2EV0A 3ISPA 1T6DA 4XTWA 5ECAA 4PY5A 2QYZA 1QVFS 9ATCB 3CCQQ 2CV0A 2WA0A 3M4YA 1YF5L 4O8UA 3A5ZB 1NJIR 5M1PA 2L3QA 5EZHA 1KU7A 3G6EQ 3WNGA 2ZD1A 2ZWHA 1B92A 5ILSA 2HQXA 1RBVA 2L9RA 3RR7A 3P8HA 1HXDA 1GLCG 1TUGB 2ID3A 5IYBJ 3IKMA 2HTSA 2GFAA 2HYFA 1PYVA 2CQ7A 2CW8A 2RF0A 4MMLA 1HSJA 4DGWB 2VOOA 2EV6A 3AG2H 3THKA 1E4FT 3DRPA 1I4K1 1OCCH 5BPMA 2LY9A 2ZNZA 2NYXA 2Z0WA 3TAMA 4EV0A 4KKOA 1B59A 2XRNA 1XMXA 3GVAA 4UB8C 2D0AA 1VQ7I 1BI4A 1Y7XA 2VXZA 3CCVA 3IH2A 1WPYA 3TW7A 5GAMj 1YIOA 4PIIA 1N5ZA 3PX4A 2JMWA 3BG3A 4DUYK 5JS2A 2EQKA 2RN8A 3LSIA 4BR2A 3V8LA 4E7IA 2P9SA 3CCRN 2UXCK 1A04A 3BTLA 1YHQQ 2X6WA 1K0XA 3HTRA 1B9FA 1V76A 1OCTC 3M4OJ 2RQUA 2BXZA 1SC7A 2CRGA 5IOZA 3UWNA 2E8AA 4AU7A 4AH9A 4FJJA 4BAYA 2Q1ZB 3VERA 2ENMA 3VF4A 2DA6A 3HO1A 3KX2A 3HRSA 3H9QA 1RAIB 3C2GA 3VGKA 3DPLC 3E6BA 3JCMP 3UB5A 5JVHL 2GIVA 1NH3A 4KPYA 1KC8R 1QMCA 4KH6A 4CEZA 1N25A 3H36A 4EGZA 4LDVA 4N56A 3PFSA 3DKXA 3ZFJA 3G10A 3CCJI 2BE9B 3CTAA 5BN9A 3URGA 3CMAA 3LALA 1ZREA 1OPLA 3EHRA 4DU3A 1P4WA 4M7AE 1TWAJ 5LJ5h 1Q86O 1IUFA 4DQSA 2LC4A 2VYTA 3MQ0A 2HOEA 2P9NB 3JCUC 4C92E 1BWFO 2EAYA 2RVCA 3EQLF 2KY9A 4QCLA 2XU8A 3Q9VA 1HKSA 3WG7H 3SJMA 2LREA 3SJHA 2IGKA 3ZR8X 1JXOA 4MLOA 4IKFA 5D5VB 5KYXA 3J80O 2H6BA 3C18A 1SFXA 3GFJA 4PKGA 4M6YA 3KK3A 2V1QA 3UA7A 3LW5E 4CGIA 4F2SA 5JS1A 1RAEB 5E84A 4MO7A 2P51A 5EZGA 3ZSOA 2E1MB 1M90R 3QPSA 1EQYA 3HOSA 1GXPA 4N76A 2H56A 2W85A 2LRQA 4C8QD 3CESA 1YTUA 1WEGA 3E19A 3I56A 2XAFA 3MCPA 3G71N 2JOYA 2Y0MA 2KFDA 1XGOA 3VPRA 3ZQGA 1IBMK 1XMAA 5IXFA 1MMDA 1L0OC 1RILA 3I56Q 4CCJA 1GV5A 3HZ6A 3EY1A 1YFNA 5FRNA 4B1YB 4KT0E 4Y28E 5AQUA 2XV4S 1F36A 2JSCA 1Q82U 2GA2A 4FWRA 3FXOA 4A4EA 2V9PA 3CC7A 4OPAA 3CCLA 3D4VA 4ASNA 1QWEA 4M78A 2RN7A 1LWEA 1XI1A 2K2VA 4YOYA 3WEEA 2HEOA 4IQ4A 2F8TA 4HOBA 5BS6A 1IC8A 3PNWC 4ESBA 3GG4A 4BWMA 4DSLA 2CUEA 3EGDA 1GV2A 3ID6A 1VQOT 4I2PA 3RMBA 3LL7A 4A54A 3QO9A 1LFPA 2P84A 2OD5A 2OFKA 3CXCP 1U0JA 5AR0A 2VPLA 4EHTA 1JGGA 4RAYA 4RBOA 2OJED 1HYOA 4F3OA 3JB9F 4HUGA 3ZMSA 4Q47A 4JLGA 1W6XA 4C92G 1K83J 4R8HA 5LJ5d 3F73A 1S1XA 1PUEE 5EDNA 4KH5A 3SPZA 5ICGA 4M3YA 3WE3A 3JREA 2CP5A 3O8VA 2P8TA 3O8MA 3E6MA 1N9RA 4F17A 2BH1A 3H41A 3M56A 3GPLA 4QS7A 3LDLA 4CCKA 3IP4B 3JR9A 2BY3A 3A01A 3DPTA 5GAMh 1NEBA 1NG6A 1Y57A 1CZBA 2F5EA 4XTZA 2PVDB 2M0MA 4M71A 4S0HB 4O6JA 3OW2S 3VQQA 1X6BA 4C92D 4M7DC 4RM2A 4DBHA 1UELB 3E5UA 3GOIA 4ESRA 2VG6A 3VQBA 1SVLA 2E1MC 2DTUA 4XTYA 4U67L 1QKXA 4J9GA 2GEMA 2H8HA 2F5FA 3J8AA 1UHFA 2KNBB 2IAIA 4NYFA 3HXMA 4DR7K 4YELA 2COBA 4J83A 3TABA 1XMOK 1X75C 3K5LA 3QWXX 1Q82C 3QUIA 2JNGA 1MHNA 4BROA 2KROA 1VQMT 1KLNA 2GXGA 4G6QA 1S1NA 1R4NB 3CI5A 1Z77A 4HF1A 3AVFA 1KQ9A 2XAUA 3OMCA 3ASMA 2QKMB 1NGJA 2WADA 3RZOJ 3CCYA 3WODF 1ZQ3P 4Q5VA 3K4CA 3M54A 3CCMI 4OIPF 1D5VA 1HKCA 1X1AA 3KZBA 3HL2A 1WUAA 2VJJA 5BR9A 1U1SA 1W2BS 2R4GA 1U3OA 4E1MA 1WSIA 2FLOA 2ZPIB 1B8IB 4DQIA 5M5YJ 2QWOA 5CE3A 2WC2A 1RT2A 3G1LA 3QXEB 4E4HA 4B8AB 3IG1A 2K79A 2DQRA 1GCPA 3QEPA 5LGNA 2K3XA 4I6MA 2QQ8A 4Z89A 2XGCA 1YN8A 3I59B 2J5PA 2KZGA 2O8CA 4B9XA 4IF4A 1XG1A 4A63B 2HQRA 3S6WA 1OLTA 4C92A 4BE0A 1VQ8T 5EF6A 4FASD 3BPVA 1BO5O 1RUOA 3FIFA 5MLCQ 2FO0A 3CO6C 4B9LA 3OW2M 2HU9A 2H09A 5A0DA 3SQ1A 4O4GA 1I81A 1VQLN 2PUKB 2W82A 2RHUA 5HK3A 1BJZA 1J5OA 2G8KA 4FLUA 3J7ZO 4FK2A 1NK4A 1QSLA 3C7NB 4IUPA 3SZPA 1VQOI 4OO1J 3VMFB 3QWYA 1X9JA 3M53A 4L9VA 1VQMN 5HNFA 4N4NB 2FSKA 4ETSA 3UA6A 4BQAA 2G7UA 3BG7A 3GZNB 5HK0A 1S1TA 1LCKA 1LNWA 4I0BA 4DSEA 2RQTA 1AT1B 3CC4A 3QMLA 2VGNA 3OMYA 3CCMT 3ELKA 4JZ4A 3IUCA 1S9EA 3TDUC 2CWEA 1M2VB 5EEHA 3TTFA 3MZ8A 5F0CA 1Y39A 1V4TA 3P83D 3DXKB 3JCMb 1D4XA 4L3QA 4Y92A 4G7OF 4M77C 2HVQA 3PIOF 5F1JA 1ESVA 2LF7A 4RAZA 4HKEA 1GXIE 4ZTJA 1FYKA 3THYA 1KHIA 4Q4ZF 1ZRCA 2VC0A 3GBTA 1TW2A 3H9JA 3DF8A 4JDSA 2P5OA 4BY6B 4DV5K 5DY9A 4BE1A 3NTHA 3A8GB 2X48A 3A03A 3E97A 4C3IJ 2UV1A 1QHHD 2O31A 1NK3P 1P6RA 2ZC2A 1RTIA 4E7HA 4M7YA 4PFOA 3FJPA 3F3XA 1KQ0A 4FXDA 3SHWA 1YS7A 1S1UA 2X6YA 4YPRA 2E19A 4M3DA 2M30A 5CQEA 1GLDG 2BHZA 2HYGD 3F5TA 2GTJA 1LFBA 3HKZA 3OOUA 2ECBA 4XEIA 5AQRA 1HNVA 4ISFA 5C2FA 1M3AA 3A8LB 3VYSB 1M1KR 4PL7A 5SWMA 2X0LA 1K79A 2JGUA 5FKLA 4KIGA 3OIQA 5B8HA 1WLJA 3NF8A 1XQOA 1NKEA 3FKIJ 2ELKA 3A5LC 1ZC6A 1DP7P 2GTDA 1IZ1A 3MPUB 2F9TA 5GAOr 3JAMO 1LEAA 4PJOF 1HDPA 2H3EB 3ZQCA 3LA7A 4WCGA 1YJWQ 4F92B 1FJGK 2GQQA 3H46O 2YWWA 2EQMA 5DM7R 4CJQA 4HA8A 4D5CA 3PQKA 2EYZA 1NGGA 2HHXA 5FD5A 1FEXA 1UAXA 1RNLA 4KIBA 1W4MA 1HKBA 4HBLA 1LOTB 2ABKA 2BOLA 5CPRB 1ZBLA 3BF3A 3EH1A 1JJ2A 4FK4A 3HPGA 4FJGA 4UOBA 5SZTA 2QSGX 1X3ZB 1WJDA 3GIBA 1FSHA 2O8KA 4FX4A 4OOIA 4JKEA 4H5VA 1ZARA 3S16J 2YHYA 3CC7Q 2P9SB 4CJSA 4GCVA 3V9XA 2JHJA 4DTPA 4V2GA 2Z1JA 3Q9SA 4W5NA 4J9IA 3UIQA 4A4HA 5GAMg 4AWXB 2X51A 3K2ZA 1BN5A 1MJAA 3DRSA 1R71A 2R5AA 2D1HA 1YJWT 1LDKB 3DLEA 3D0SA 4FOEA 2E36A 4XRSA 4HVJA 3H0GJ 3HPHA 4C5EA 5AQXA 2XVCA 2UYTA 4K0KK 3PVLA 3KBGA 3GF5A 4AHSA 2FBKA 1VQNT 1Y97A 3SAFA 3M0PA 1NOZA 2HNZA 4E89A 4JI0K 2EWSA 1JGSA 1SVMA 4W1UA 4OIQF 2R7SA 4JLHA 3EO3A 2HXOA 4L59A 4GRIA 5GAOq 2QVOA 1XGNA 2P9KB 2HKXA 2YXYA 3UR3C 2KBTA 1I07A 3JSMA 4DV3K 3PFYA 4QVZA 2K5CA 1YBYA 3X28B 4Y17A 3CERA 5C2DA 4I0AA 1T95A 4PJJA 4KH1B 4JKDA 1B9MA 2KZMA 1BIZA 3FR0A 2NLUA 1E3HA 2YLBA 3QG1A 3HHHA 4C1NI 4J9HA 2BIVA 2AT1B 3UATA 2KL4A 3TOAA 4PL8A 2QWRA 2IVPA 2E5LK 2EFOA 4KT6A 2GA1A 1BOBA 2DOEA 2P6TA 1IN8A 3CDLA 2E71A 5DV5A 2XI9A 2FXAA 3GBGA 1SUQA 1N27A 4RTYA 2EILH 5AQSA 2DJQA 1K4SA 5BN8A 3N97A 1W36C 2X3WD 1Q8IA 1LPQA 1UHMA 3H1CA 3F21A 1RTJA 5M1NA 4DV2K 1WIEA 1RT5A 3VS3A 3GE1A 1VSDA 3ABTA 1CZAN 1C6VX 1AWCA 3G4ST 3QNNA 4L9JA 1ZYQA 4G7ZF 1V5EA 3ITHA 3VQ9A 4KHQA 4DR1K 2ZSHB 3ZT3A 3ER0A 1N36K 2VKDA 1B4AA 3JB9I 4I2QA 1ZGJA 5EXWA 1G5VA 3LQQA 2H1KA 2IIMA 1C0UA 2H3JA 1KD1C 3IRXA 4NQWA 1APLC 1MNDA 1QCNA 1GLFO 4OAYA 4CEOA 3TREA 1QVUA 5L3FA 2CUDA 2DXCA 3H08A 5TKWA 5ILVA 1R5HA 4FPBA 1KYWA 2GCXA 4A3MJ 4LJZF 2R7FA 4O3MA 2A5YB 4AM7A 4XSZF 1YYVA 1CGPA 2OC6A 4OFEA 4BRIA 1X3NA 4WK8F 1Z0XA 2CO5A 4ICLA 4BRNA 4FLXA 3CJ9A 4L0ZB 5BNGA 4BJ6C 3WHBA 4DCHA 1T3VA 2JG6A 3CHWA 3MCAB 3DLLL 1Y71A 1VRLA 1IRZA 2QGFB 5FD6A 3SWNC 3W3DA 2L4MA 1FKPA 4C92C 4RTWA 5GAMf 1D0XA 2HD0A 1YRNA 1FOXA 4G7HF 5K1YA 2HCKA 3BFMA 4XMYA 4ZYEA 1TAUA 1YJNN 1NMDA 3EUHC 1PWTA 4H0TB 5DD4A 1NK6A 3JRCA 3IKVA 4PLLA 4XOPA 3L7WA 2QQRA 3CD6N 4OB3B 2R7DA 3WGIA 3BT9A 1YQKA 2DW4A 3SEQA 4UXNA 4BJTA 5DUKA 1BGXT 1RESA 1I6XA 2P9NA 2P9LB 2R5YA 2MLKA 3O08A 1RAAB 5L3CA 3QICA 5FFZA 2HF4A 4JK1X 1ZSZB 4ZYGA 2XY8A 5AIQA 2E12A 1J3TA 3NF9A 1ZBIA 1U84A 3D2EA 1JXBA 4BKXA 1MA9B 3R0JA 1S72Q 3J80K 2G3RA 2J06A 2ITMA 1ZRDA 1OCRH 3JCMJ 1NLPC 2ETHA 3ERED 3G0ZA 4N4HA 1IXCA 3CCEN 4O5FA 2YSQA 1IN6A 1K4US 2X3XD 2OZMA 1P7JA 3HRTA 1O9SA 5KGWA 4A5BA 3VJPA 3TQ7P 2EIKH 2F1LA 3QWLA 5BPNA 2BZTA 2X9HA 5D6FA 2FU4A 3AVKA 3H1QA 2IVMA 3U4LA 1GHCA 3WTWC 2V9KA 2LDUA 3VSLA 1SSFA 1K8AR 2PJRB 4L5IA 5BPLA 5EY4A 2IS2A 1EETA 2LT1A 1MBGA 1T39A 3ZSRA 4HV6A 3CC4I 4YRVA 1WOQA 2HPIA 2PN6A 1B34B 4QTRA 2W10A 4CHQA 3CD6T 4OLAA 2RJDA 4C5HA 3M8QA 4P9FA 2F2VA 1SMTA 5AQYA 3DU6A 5DLOA 5E1ZB 1T8IA 2VBYA 2NVQJ 2ROTA 3TMOA 5F0HA 5LY3A 2ZFWA 3I0TA 1ZTRA 1UGVA 3FDRA 1X4OA 3PFIA 1M4ZA 3WNEA 5JHUA 1D09B 2DY4A 2EQRA 5AZJB 2CUJA 2Z1IA 4I01A 1Y0NA 3ME9A 4BVPA 3W6JB 3CJRB 2X1DA 3WG9A 3LAJA 2VG7A 2VWJA 1XPXA 1NGBA 3PTAA 2JVGA 2VC8A 4JBAA 1MDMB 2OPSA 2CP6A 1FW6A 3K58A 3HSTB 1QP2A 3ZEUA 1K9MU 5I2MA 1HYVA 3L09A 2X6SA 4WXCA 3OGDA 1Y96B 2W57A 3I56N 4OU0A 4JQFA 4GFBA 1FN7A 1ZG5A 1HKGA 2DYRH 5CHIA 3LAPA 2NRTA 4LF4K 3RQ4A 2EQIA 2ZO4A 1B6AA 3C6TA 3OYGA 3M6GA 1HJDA 2DIQA 2RN2A 2GUIA 4PKIA 3CCJT 2DTOA 4J2BA 1M1KO 4XN3A 3F8MA 5GINA 4NL3A 1HU0A 4U7DA 3MN5A 2X1EA 3L9FA 4ZH4F 1ITYA 2W41A 4A62A 1VQKN 1RGIA 2KTQA 2CV2A 2DL5A 2GAUA 3W6VA 1SKSA 4Y13A 5LJVA 2DFIA 1DIZA 2QYOA 1XDUA 1VQPQ 3F9KA 2EBIA 4JZ3A 1D3BA 3L4QA 1OCPA 3AT1B 5GANd 1M8MA 1MH4A 3K0LA 3CCUQ 2HS5A 1KAZA 2ESWA 1RRQA 1RADB 1RFQA 3PO3J 3ZT4A 5TISC 1W97L 3VEPA 3RDVA 2L7KA 4CH7A 2WSEE 2VJIA 1DPUA 4XLEA 5IT9K 4CE9A 3TWHA 5F1XA 2EFPA 2FOKA 3UKUA 2OTJN 4JHDA 2K57A 4CHUA 4EJYA 3PNYA 2HNYA 1X1DA 2RGVA 4OPKA 4WCEL 1C1AA 1Q9XA 5LMNK 2RI5A 3SDGA 5D4RA 1QLYA 1A5WA 5D5WB 2ED0A 2BE2A 5I9EB 1T03A 4CBWA 1HQEA 4CJ5A 4KHYA 3I56T 2JA8J 4C23A 5H1SQ 3N4MA 4DF8A 2L9NA 3DB4A 4FJNA 1N34K 3U9DA 2M8EA 2W1OA 2I5UA 3G73A 2Z1GA 3S3MA 3TAFA 4RW9A 3CCJN 4AMCA 3BOQA 2B8AA 3QRFF 4LDXA 4UV8A 1ZRFA 3PMTA 2HVSA 4PA1A 1RL2A 4A4KA 1X43A 1TS9A 3I71A 4RGUA 3O5ZA 4G9YA 4E1NA 1VQKT 2KIMA 1B1BA 4MDAA 4YG2F 5E3OA 2K7LA 2EZLA 2JLEA 2O4XB 4CZLA 3Q1JA 1FOYA 2NNWA 4QAGA 5ERIA 4HWIA 5CZ2A 2PQWA 3CMAQ 3BUZB 2OBPA 1GVDA 1NK9A 1ATRA 2E20A 4FZYA 3CC2A 3OSGA 3H35A 1JXSA 1X69A 5AQFA 1A6IA 2HQHA 4M7AA 1TTYA 3CMMA 1IV0A 1CXQA 1W7PA 3S14J 4AIDA 5IHIA 2MH9A 3K70D 3K1NA 3KK2A 5HS8A 4FLTA 2LH9A 3S93A 4F7ZA 1PP8F 2DMOA 3J7AY 4F7UG 1WZ2A 4LB5A 4EGYA 2G9WA 4QQDA 4LY7A 4DA4A 2LQ8A 5C42A 1EX4A 4XU2A 1KG7A 2YJEA 2ZNYA 3NTKA 1TL3A 5IYDJ 4M78F 1J09A 5JLXA 2L3PA 3SZTA 3O4QA 4IIOA 3O5BA 5HS7A 2NLXA 4DHYA 3OL3A 5LJ5f 3AHUA 3GO5A 1JEGA 3UKRA 2DLLA 5GAN3 3BGRA 3AVJA 1ZHFA 3LP0A 2DL7A 4K2EA 3F8NA 4FJ5A 1UE9A 5I11A 4AUXA 3CCQN 4B23A 4M7DD 1KG2A 4OB0B 5F27A 2LVSA 4M3XA 2DKGA 4MFBA 2VL8A 2ZXWH 3CBPA 3JSPA 3VSKA 4B9VA 2RH2A 4DU4A 3OIOA 2QASA 1FLIA 4B24A 2D8HA 1E6HA 4PSWA 2O8EA 1Z3YA 1RNHA 3X25B 2AS5F 2O8XA 3MEAA 3K7AJ 2E64A 1PU8A 3LPTA 4ILGB 7AT1B 1MV3A 2XB5A 2HDAA 3QO3A 4DV0K 3M8FA 3I4NJ 3NGYA 2OA8A 1PVEA 3CW7A 4AFSC 4MGRA 1N3CA 1VK0A 4GKJK 4ESFA 4Z6YA 5J2MA 1K1ZA 2ZXJA 1V29B 1IXRC 2FC0A 1FMKA 1XJWB 5HDNA 3CCVN 3E5QA 1S7OA 1LVKA 3HG9A 3I55Q 4B1XB 2KXCA 4BDPA 1BR2A 2KLOA 5M9OA 2YI1A 2HHWA 4ENMA 4QVCA 3O2PE 1OI1A 3TL4X 4GYIA 2MAMA 3GLLA 4YTLA 1HKTA 5LGUA 1JL2A 5HVQC 2CGHA 5AIPA 2ZF5O 1K9MR 4L0YB 5LGTA 3G2BA 2XKOC 3R60A 1JKRC 2B0LA 2QEXT 5CQGA 3LAKA 4JKCA 2JMAA 3RVCA 5JLFA 2X1CA 4ZDLA 2OYQA 2ECCA 5FW9A 1VHXA 3NH2A 2CDTA 2ETJA 1ILYA 1B7TA 4RMOA 1XOVA 1KQ2A 1TP4A 2OF7A 1DGWY 1CSKA 1YJNI 2PMHA 1AOYA 2JN0A 3SUNA 2ESHA 4AM6A 2KQRA 5EC7A 2QTVA 1T3SA 1VYUA 3O9TA 3M7GA 1VQ9T 1QVFM 1JQQA 1RAGB 3S2HJ 3DM2A 3LH5A 3ZXSA 4GBQA 3JCMW 1ETOA 2XIGA 3VESA 1YHQN 4CJTA 1TL1A 2HB5A 2O8DA 5D6EA 1IBKK 4H4MA 3HOUJ 3VDXA 3K4NA 5JLWA 2LVMA 1H92A 4LOCA 4UY8I 2DFFA 3FHGA 1HQUA 4J7FA 2XMFA 3MKWB 1QVGP 3LDSA 1TWCJ 4WCIA 4NYNA 4UUVA 2FOWA 3CMYA 1ZUKA 1I27A 4FX0A 1IGUA 1GLLO 4CGZA 3FDYA 5M5XJ 4UC4A 1HNXK 4M7DF 3MKZA 4EJWA 1K8AO 2FSJA 1X6OA 2DO7A 2KP6A 5C10A 4U0VA 4HT9A 2DRMA 2CSQA 1TQIA 5A2QE 3OSFA 1QBJA 3C2BA 2M0OA 2BUPA 4CC3A 2E5QA 1VQPN 3RQIA 5CYVA 2OJ2A 1EIFA 5FKOA 1IF1A 3S15J 2C0OA 4C92B 2A3ZA 1K7AA 4LF9K 1PP7U 3M8RA 2DMQA 4M73A 1XNRK 2WC9A 3EG2A 2L9VA 3OYBA 4N4GA 2BE7D 2PLYA 2BV6A 2ZB9A 1F1BB 4C8KA 3DXKA 3GUDA 4XRFA 4DW6A 3CCUI 5HY6A 3GL1A 1YJWI 4L5GA 2D5RA 1IW7F 5FWBA 3TTDA 2ELHA 2ZMEA 5HNHA 4OGCA 2RM4A 2WFBA 4RLQA 3VS2A 5F64A 5K14A 3WTYC 3T8TA 3H3VK 1MWMA 2GXAA 2SRCA 5J3LA 1KC8C 3M0UA 1WJ5A 1AA7A 4HG2A 4JS4A 4C0DB 1CF7B 1AD5A 4IHWA 2KEAA 4M6VA 3CLOA 2RDPA 1VQ6I 4B9TA 3KXTA 2NUBA 1A6QA 1NK8A 2W40A 2CQXA 2NUTA 1SEMA 5GAOp 4D1QA 1MUYA 4FYXB 2PMZA 4RLFA 2NOEA 2CQNA 2A41A 4OVLA 2DPNA 2J4RA 1KQ1A 1NJIC 5FU7C 4OGEA 2XGEA 1S6PA 4ZYDA 1EP4A 2O7OA 2O2OA 3I8DA 1YIJI 2WACA 1N77A 1ZQ1A 2LJ0A 1P7IA 2ZAEA 3ID8A 1FP1D 3G71Q 2V51B 4KO0A 3M0SA 1K73R 1YITT 5HDKA 4OWRB 4A59A 3G71A 4E7KA 2DA5A 3RYRA 1YIJN 2DETA 1EH8A 4ZGEB 2AIRB 1WQWA 3NAEA 1P90A 4JLIA 2F9WA 4X6AJ 2BE5F 4JD2A 3VEOA 4DOVA 3T1AA 2EZIA 4DWIA 1W5TA 2JA6J 4KGXB 2NS7A 2K40A 1QZ6A 4H5TA 3ZQFA 2JVVA 1X1BA 3HB9A 2IGIA 1WQ2A 4O0IA 4F8RA 4CZIA 4R5PA 1UGSB 1EA3A 5GAMe 4M3UA 4OMPA 1TLHB 2PBDA 4JKHA 3C12A 4BGBA 1IBLK 2V1NA 3A4CA 1RZ4A 3DBRB 2WWYA 3E1SA 1M8VA 3OYCA 3KK7A 1IRFA 4DTOA 1Q82O 2XK0A 3VA3A 3I56I 2E7XA 1SANA 3AO1A 2ZBKA 2V1UA 2ASMA 1YI2Q 3ZMVA 1Q86R 3FXKA 4DTXA 3TAEA 3VFZA 1KTQA 3LP2A 4JHDB 3A8YA 4CHYA 1Y56A 1XQHA 1M2VA 1QSSA 4IDHA 2IRFG 1R59O 2D0CA 1BB9A 2O8FA 2VWKA 2PMZN 3LA2A 1JLFA 4IEEA 1XMQK 2KDZA 1K6YA 4A5MA 1U4BA 4M3GA 4LFAK 5J1UA 3DJCA 3IV5A 1YITI 4ZTFA 1I0CA 3TW6A 2LYCA 3L1PA 3E3VA 5IHKA 3QBWA 4UVBA 1YIJT 2JK3A 3V42A 1X3UA 1D3YA 2LR8A 2BVMA 1TWGJ 2B63J 3F23A 4ID5A 1M3QA 2LD5A 2YHAA 4E9FA 3M8JA 1GL5A 2K02A 3H9GA 3FZMA 4CJFA 2A05A 2VWBA 5C15A 2OV7A 1VQPA 5BOXA 4QT7A 4YNQA 1Y8RB 3FXLA 4CSWA 2HMAA 1XNIA 5GMKi 3MKYB 3JCMV 2FF4A 2O4XA 2DTIA 1HW1A 3HP6A 4JRQA 4LUDA 1RT6A 2D0OA 2V79A 5GMKe 1P7MA 4HTUA 1NGAA 2CUBA 4M63C 3VS5A 5I22A 3TSUA 3RKXA 3CCUA 1M90C 4EMKC 2OFIA 2FJ1A 1J75A 1I3QJ 2K9QA 3OH6A 1DP3A 4CJKA 2DA7A 3L2QA 2COWA 2YCHA 1ETKA 4KIFA 4KGZB 3AVLA 3H3NO 2ZZDA 4FJMA 1KAYA 4WF9L 2LFBA 3ZQLA 3H1VX 3ABLH 2LCSA 2GX9A 2I0NA 4CHNA 1O1WA 3GF2A 2FZCB 4LD5A 2FMLA 2OAWA 1UTIA 1IKYA 2MYSA 3KP2A 1Q1HA 1YUWA 4DSKA 3DMJA 4M42A 4Z88A 3P8DA 1KK7A 3LDQA 3MEUA 3U8XA 5T7BA 3BDDA 4FSSA 5BPDA 1JUMA 3F8CA 5A2QO 5GMKh 4AG1C 2DE0X 1LDJA 3P9IA 3QP5A 3R0AA 2QSFX 3CUQA 3EG9B 2Q8KA 1WJSA 2MF2A 4CZHA 1E4GT 3QNOA 3K6GA 4IFYA 2OTJQ 3DLMA 1UFMA 2YS9A 3CC2T 3FJ5A 4KYWA 3GP8A 4KUMA 4B48A 1HMVA 2DEUA 4XLAA 4LB6B 5KYNA 1KQSM 1M1KC 3CC7I 3QOPA 1JCEA 1MPGA 2EGCA 2M4GA 3CC2Q 2FF3B 2R7WA 1ETVA 5LJWA 4M3FA 2A28A 1SL0A 2NWMA 4IWVA 4JK8A 1ATSA 4J9EA 3KD5E 1OYIA 5GAHJ 3VEZA 3MP1A 4IHVA 4FWPA 1LV5A 4XRSG 2JUCA 2FRWA 2R7ZJ 1HUXA 1SRMA 2FVUA 5DM7F 2KRSA 4Y1CA 3QPTA 2NS8A 4JS5A 2A68F 2NYSA 4M7AC 1V3FA 1MDMA 4KI4A 4JUVA 1TG0A 4IUVA 3BG6A 4E7JA 1W1FA 3A2KA 4A53A 4JYAK 2M7AA 1CXUA 4A69C 1YX5A 4D8DA 1BM9A 1SFOJ 4KDPA 2QDLA 5LLQA 4RTXA 3VYHB 3V1RA 4LDYA 3FEOA 4IHYA 2A3LA 4NCGA 4HVWA 3CBOA 2QQSA 5FRMA 3F6OA 3RSEA 1J54A 3RPQA 4BRCA 4EJTA 1IN4A 3ZYYX 2R7XA 2RHIA 1MIJA 1RI9A 4A3EJ 3FLGA 3SXYA 2ATQA 5FROA 3QAHA 1LAVA 3QBXA 2AQEA 4G6DA 4IHTA 1K8KB 3C7NA 4BI3A 1ZSGA 1T98A 5C3EJ 2BBYA 3RERA 3EGDB 3HOWJ 3OYIA 4IUUA 4J7IA 1YQRA 4UNOA 1MJ9A 1MUNA 3OA6A 4O5BA 1X2KA 5GPAA 1BOTO 1G3WA 2HQEA 3PLAA 4Q5SF 3CPWP 2IS3A 4OPHA 3WT0A 2V6CA 3CBMA 1C1CA 1Z26A 5HLTA 2CFOA 1USTA 3G71I 3F8BA 1KFDA 4GKKK 1ITGA 3HTUA 4A4FA 2UXBK 2QWWA 5C0YA 2LCCA 1R00A 4V19K 4LUEA 1HLVA 4YFNF 4BUPA 4S05A 2E2IJ 1Y1WJ 2WTEA 2JWTA 4OF1A 4JI2K 1ZG3A 5J2PA 1WJRA 1VZ0A 4S04A 3AGRA 4J9DA 3KZYA 4PJOA 3QERA 3QDFA 4RB0A 2F4VK 3SFMA 4FYWB 3AVHA 2R3SA 4PLIA 2JRMA 1G99A 1VQON 1FMWA 2FA5A 1BCOA 4XICA 4HLXA 1R8OB 1MUZA 3MN9A 4F4KA 2KRMA 1W2BM 1VQ6A 3C65A 2QG9B 2MABA 3V7RA 3REAB 4KI6A 3ZSVA 3KLEA 4M7DE 1LWCA 2IC3A 4PJOG 4QW2A 2DMUA 1UHWA 2NVTJ 1CQTA 3A5NC 4I9LA 4CJVA 4IZZA 3FXQA 1TKZA 3AL0C 3VS1A 2FF6A 1WI7A 4HNUA 3LSPA 5LL6Z 1M1FA 1KQJA 3CPFA 2MC3A 4P5NA 1TUYA 3I0SA 2M0YA 2DA9A 3TU4K 2BY0A 1KAXA 1P8ZA 1W7AA 2K4YA 3OH9A 4Q48A 3A0BC 2QF7A 4JNEA 2J6KA 4GVMA 2COZA 2L9SA 5CKEA 2I8DA 2D2WA 3SDBA 2YR2A 4CIEA 5LJ3d 2O8CB 3J7AF 2NRWA 1S1VA 4BR5A 4DF4A 3IAS2 2KIUA 4BYYA 3O6BB 5BMZA 5H6QA 1OQYA 4EAHD 3ABKH 2HVRA 2IVWA 4D6WA 2FBHA 3KEOA 2V75A 4BGAA 4FQGA 2CV1A 5BRDA 1LAWA 1X6GA 4M9SA 1QVPA 1OYYA 2G8WA 2V1XA 1WSGA 4A6DA 3RR8A 4BY9C 5GAN8 1L3SA 3LWHA 1X27A 4B1WB 1VFCA 4IFEA 5A2QK 1I5ZA 3G6EN 1ZK8A 3K1PA 1QPMA 3ZGKA 3WTVC 2Q0RA 3M8EA 3CCQI 3KETA 3PL8A 3TGNA 3FZVA 3LSKA 4CZKA 1OH5A 1H88C 3M1FA 2D0BA 3BR5A 4NZGA 5FKNA 2WOMA 3VV0A 2K6DA 2IDOA 2ZSIB 1Z6TA 4IUTA 1K8KA 1VF9A 2XHCA 3CDHA 4CZCA 4FM1A 3V7SA 5I2SA 2KHMA 4Y1DA 4L18B 4ELVA 4OMQA 2A6AA 2GNCA 3IAM2 4NB5A 3SV3A 2ADUA 4L9TA 2HVHA 4LG0B 3H3ZA 1XHXA 3H45C 4CF0A 4MIMA 5IT9O 1E17A 3CC4N 3LNQA 4AFQC 1I3AA 2V1DA 5LBQA 2XKOA 1K9AA 2AZVA 3KYDB 2DT6A 2KRFA 4DK9A 1NLOC 2YUSA 2E65A 3QQAA 3OY9A 2K9GA 2DN0A 3V81A 1TQPA 1MBFA 1MMAA 5BRFA 2NRXA 2GELA 2NAZA 4FHTA 1IRGA 1R1VA 3VYUB 1RRJA 3GOXA 5CVVA 3E5XA 2XGDA 3AARA 4J8OA 4LFCK 1PG5B 1Z91A 3KVGA 3ZL7C 2DDAA 4NC8A 5EEGA 4XKCA 2QA4N 4J9BA 1XD7A 4W5RA 1AWJA 3U6FA 4OIOF 5F04A 4F3TA 2OQGA 1D1BA 4UVAA 1UJYA 3LGLA 4BU2A 3LWIA 5AFUH 2L3RA 5ICFA 1H8AC 3WTUC 1HC8A 1JO8A 4KV8A 5CK9A 2DPPB 4EMGA 1KJWA 3JRFA 3MZHA 3M1EA 4GVEA 1BA0A 3ZT0A 1QQOA 3DYAA 5AZIA 2A5WA 4AILC 3FBNB 3I64A 3NGIA 2EFWA 5JI6A 3PJRA 4HX7A 1U1TA 3F9MA 5J6XA 4OFHA 1Z7UA 2ZPHB 3TARA 4RB2C 4WXDA 4KT5C 3AAQA 2CH6A 2HZDA 3WTXC 1WX6A 1HQCA 1SSHA 1G4DA 4QQGA 3VEXA 4LD9K 5AONA 1T2KA 4FYYB 2GV9A 3QEXA 2UWMA 3HPOA 2KFZA 4HUEA 3JTGA 2K9MA 3T8RA 1XC5A 1YITA 2JM9A 2ZPBB 3HYFA 1RI0A 1WHKA 1YW9A 3TKYA 2QA4T 1YJ9T 2TCTA 4M7DG 3CVTA 3PUFA 1JKPC 4R1HA 2CH0A 2UXDK 3I9V2 4JK7A 4H5WA 2IXSA 3BWGA 1VQMQ 3FIWA 1BJAA 2KMUA 2RNJA 2DEQA 5IWAK 3SLCA 3NWTA 2DO3A 3BZ6A 2FXUA 3BG5A 2K2MA 5AZJA 5HLGA 4YOQA 4B9UA 1Y1VJ 4JN4A 2R5ZB 4M7AB 2YDLA 2JUFA 3WUHA 2E1OA 2I7NA 3MEEA 5EYRA 3REOA 2CP0A 2M0CA 3ZMUA 3DI6A 4BS9A 2JJ7A 2LCLA 2I5JA 4DV4K 4DG1A 2GGRA 1X4PA 1UEBA 3VUZA 3NFCA 3CCLN 3DEEA 5F6FA 3VYGA 2QM1A 1KVAA 2M2EA 4RW6A 2D0PA 3G7ZA 3FMRA 1N32K 1BC8C 1RLQC 3FC3A 2VT2A 1NK0A 1R9TJ 4NCBA 1T0FC 1RC9A 2RD1A 2YU9J 3I5UA 4CO8A 1D5YA 1VAZA 2HMIA 5M1FA 4Z8AA 4EVVA 4RG8A 3QDKA 2DMNA 4Z2YA 4R0KA 3VYTB 3NH1A 4RS8A 1X19A 5HODA 2HSTA 5CVUA 3VQAA 5GAMd 1JJ2P 3C7JA 3CUOA 3P9CA 4N9HA 3KKSA 2JT4A 4J01A 2FE3A 3TSWA 4A5NA 4WF2A 1F1ZA 4XOTA 3EUKL 3FB9A 3P1GA 4H0OA 1UJ8A 4VUBA 2R0QC 1VQ7Q 1N33K 1U78A 3AAPA 4NO7A 2W6LA 1F5TA 5J39A 5HLIA 1PKSA 1XG7A 4ELUA 2F5TX 1FIPA 1BBZA 5FU7B 3L6QA 1YHQI 4BRHA 2J6OA 1T05A 2ZGWA 1T6CA 1Q9YA 3ENHA 4RWTA 3B6AA 2EA4A 1WFWA 1YCSB 1ZYRF 2HBLA 3VOVA 3SK3A 2HBPA 3GW2A 3G4SN 3HPWA 3TU5A 4JRPA 1JCFA 1GFCA 3F6VA 2JTVA 4M78B 3G25A 3K9JA 4M3ZA 2LY1A 1G8XA 4E6RA 2NOLA 3QIOA 2XPUA 4O8KA 2NZTA 5KE2A 4EM1A 5DM6L 1QO0D 4M77B 3NPFA 3BCBA 2X4WA 5GANh 4XTUA 4IXCA 4QVDA 5DLQE 3CETA 1OPKA 1YITQ 2L2OA 1T33A 2CJJA 1IXSB 2G0EA 3PGGA 2E3IA 4LLNA 1ORNA 4IJAA 5KTQA 4CK1A 3O8GA 3J81Z 4E2FB 4GXOA 5A2QZ 4XKWA 2LMDA 3PIPA 1SD6A 5E1WA 3FM3A 1VQNI 4XLFA 2DK3A 2ASPA 4HZFA 2YUQA 1WAJA 1VSHA 1KFSA 4NL2A 2PI0A 5BPIA 1NK2P 1NJZA 4IURA 1TGOA 3AVIA 3AVBA 1HJRA 3LP3A 2XAQA 5B66C 3M0QA 3RKYA 4FT2A 4IRIA 4NQWB 2X4YA 2OQRA 3SEZA 3BROA 1YTAA 4AF1A 1SFUA 2YNHA 2DK5A 3D2EB 1ZA2B 4IOAL 2A6HF 5AT1B 4K8ZA 2CSOA 4KHNA 5FWCA 4HSBA 4BEHB 3X2QH 2PYLA 2KI7A 2NOZA 4PGHA 3HRMA 2JS2A 1XSXA 3WXLA 4CEFA 5LFAA 1SAXA 5KPRA 1TNSA 4AHUA 4EM0B 5GAHP 4C8QF 1K9MC 3FISA 1HF0A 2GFUA 1B9NA 1VQ6Q 3C94A 1U5SA 5K5QA 1YP5A 3JSOA 3GBQA 1QSYA 6PAXA 1M3BA 3DTKA 1BA1A 2YHWA 3K2PA 4FWNA 1TSFA 4H8KA 4AT1B 3F0ZA 2CP3A 4FL6A 1MSFC 5GAN6 5E26A 4XNFA 5DCMA 3Q0VA 4GDFA 3H0IA 1YRNB 3A0HC 3JCMd 4PJOC 1JHHA 1Z7LA 2KIFA 1W2BA 3O80A 4J9CA 3PSIA 2IP2A 1RKTA 2Z3YA 1DJ7B 3LZJA 1WCMJ 1P59A 2NVYJ 4EVIA 1IAWA 5E3LA 2H27A 4RCBA 3GWZA 4MFEA 4A5AA 1JBMA 1QE1A 1XNQK 2ZXHA 2AHQA 2MGQA 1KZHA 2D1KA 2E2NA 4O55A 1IDYA 3EGXB 3K5MA 1Y96A 3M5RA 1R58A 4M7DB 4OKKA 1VQKI 1H0MA 5KPTA 5GANf 3FZFA 3C0CA 4XLPF 2XD0A 3SQ4A 3CCMN 3U2RA 4HEA2 5EG0A 3I0RA 1Q18A 4M74A 1Q7YC 3Q5FA 1J53A 3H6EA 3RTVA 5BR8K 1VQ4Q 4J9FA 2A08A 3S41A 1NG2A 3MN6A 2FBXA 3LSMA 3CQXA 1WLPB 3WTZA 1WNLA 2EA2A 1D0YA 2DOAA 3M07A 1RDAA 5M1OA 2W04A 2VXDA 4H0XB 2VBXA 3ROUA 2DVEA 2RA2A 1C6VA 4HCZA 1ACMB 4IO8A 2RAEA 3ECOA 4FTHA 4OLBA 3JTHA 3UKUB 3IKTA 2HHQA 2LKSA 4CYCA 4Z4IA 3CC4T 4RB3C 5CR4A 2YLCA 3AA2A 2RF2A 2A3SA 2IS4A 2DZ9A 2P4RA 4WFAL 3CCMQ 2HQAA 4BBSJ 1U6GA 3RUXA 1AWXA 2WBMA 2M4KA 4DFKA 3IC7A 4AHVA 1BL3A 4M72A 2QTDA 5HRSA 5ICCA 4NXMK 1LKXA 4PZJA 1G2BA 2VOPA 2KQ2A 4M75E 5FLXK 2OI3A 3CXCA 4C8NA 4NC6A 4ENJA 4KTWA 2NS0A 2R7OA 1Z3XA 1DT9A 1VQ8Q 3KTUA 2IPOB 3ZN0A 3A5MC 1QTMA 2G8HA 4KAZA 3RPUD 4EJVA 3ZN1A 2D9TA 4ZN3A 2EZHA 3SFZA 2E6ZA 5C44J 2HDDA 1TK8A 3HOZJ 4LDUA 4LN2A 4JOMA 1R22A 5M5WJ 4FOIA 1ZLKA 4I6ZA 1YVUA 1K9MO 3K5OA 2QA4I 2CMPA 2LQKA 2EFQA 1MKMA 3ECHA 2RV8A 5DS9A 5FLXO 5DEQA 1NWKA 2QI2A 1J9AA 3G4SI 1QQNA 1VQOQ 4RTVA 4PK4A 2KKOA 2KT8A 1HLUA 2XAJA 3CZ6A 1H89C 3OYYA 2BDPA 1YVNA 2X4XA 5AQIA 4LD0A 1WI9A 4F04B 3LH0A 3ULQB 3SAGA 5JVGL 5CY4A 3KP4A 4OMZA 2IG0A 4H0PA 3ZX2A 2Y2ZA 1B72A 3M4GA 2LNBA 3F2KA 1W2BP 3S8PA 2LTPA 1FBQA 1FYMA 2R7TA 2HHSA 1BI4B 3T19A 3PM1A 2QXLA 3BQZA 4KRTA 2Q31A 3PQJA 3C6UA 2AA4A 1MWKA 4G9ZA 2V8KA 5HRNA 3I4PA 2EKOA 3V6DA 2BZXA 4KMUX 3N0UA 1VQ9A 1AVZC 4JEPA 1TBXA 1SHFA 1QVGS 2E10A 1U06A 1FC3A 1U5TB 3TO9A 3QKJA 2MMPA 4RTFD 1TUDA 2O8DB 1P4AA 1EWRA 1ZX6A 4RTZA 2Y1IA 2P0QA 1Q81O 1T3LA 5KYUA 1XGMA 2RPNA 2CQQA 4JI4K 3E9LA 2NOHA 1VTNC 4C8LA 1UB9A 4HTLA 4F93B 2Y0SA 4BBRJ 1XGSA 1VQ5I 4B3AA 3P39A 2AXLA 4NCAA 3IQLA 4CXFA 2ELJA 1E0EA 4GGGA 3R1XA 1YLFA 1VOMA 3GFLA 3I55T 4KTQA 4BQQA 1EH6A 5GTHC 2P9UB 1BI1A 4B1ZA 5LL6S 5CVIA 4C2TA 4IIMA 3CJ1A 1VSLA 1XQPA 4AG2C 2Z1DA 3A1YA 4E9GA 1IUYA 4PKCC 3CPWS 1YJNT 3RMCA 5GANj 1XX5A 2NOFA 2QWPA 5LJ3h 3QETA 3ULRB 5FO5A 2P5LC 1JJ8C 2O6GE 3EETA 2CYZB 1V5FA 2EH3A 3DWLE 2RB6A 4X9DA 1S72A 1KVBA 3SMPA 3DP7A 1U9NA 3HM8A 3I53A 3ZCMA 1G3TA 1VQNQ 3I55A 3LSJA 2RKHA 2EYWA 4CHZA 2YT6A 2QAZA 5DD8A 1VRUA 1BR4A 4GV6A 2DJNA 2V8IA 1BIBA 3LM2A 1UG0A 3E9PA 1NTCA 2CS3A 3WHCA 4XR6A 1TXQA 4UV9A 4OMFB 1BI2A 3CQZJ 3Q0WA 3FXUA 2HNDA 2W25A 1UG1A 2ZE2A 1KYZA 4PNOA 2K5LA 4CI0C 2L54A 5KN8A 3HM5A 1QQMA 1TKTA 2JUGA 4Z4EA 3CCQT 4D0PA 3QB0A 5DCFA 4KHUA 4B9QA 3IRRA 5HDGA 2QWLA 4YY3K 3N5NX 5K7ZA 1W1WE 1XN7A 2KT0A 4M78E 1HOMA 2IEKA 4DQ2A 3HIFA 4DV1K 2CGPA 4DYQA 4PHTX 3R9PA 1SKWA 5J4YA 2EYYA 3KCCA 3VETA 3E9GA 3OS2A 4A3IJ 3IHUA 3ENBA 3RMQA 4IEIA 1IDZA 2FQ3A 2EJFA 2FL7A 2K9NA 2LBFB 3CPWA 4HXJA 2K3BA 2ZJQF 5LHHA 3OYAA 5HOOA 1I8FA 1QQCA 1IZ6A 4P5OA 1KCFA 4K43A 3QJ6A 3CD6Q 3I0XA 3S6IA 2JA5J 3ZSXA 1H9GA 2G8IA 2R7QA 3E6CC 1EXQA 3ZSWA 3KYCB 2XY5A 3DOLA 2XF5A 2CGKA 1D8JA 1ETXA 1WVRA 3OYLA 2FNPA 3MEGA 5ADXH 3AL0B 4O5VA 1Z6RA 1GLJO 1AZGB 5GAN5 1HYZA 5KCMA 3TEDA 5AQWA 1ZBSA 4KB1A 3M0RA 1NPRA 2XY7A 4DTJA 2EFNA 1QPIA 1FP2A 4DTUA 3I33A 1HNZK 1S9GA 3M55A 1G15A 3VQ5A 2P1JA 3WGHA 4I76A 2Q2RA 3C3WA 3VF6A 1ZH5A 2FX0A 4KJZA 4L9NA 2IS6A 3RWUA 2QENA 5KAIC 3ZEUB 5C4JJ 4O44A 2JJ9A 4LF8K 1NJIU 1SV5A 3TTCA 2R92J 2O8BB 5K5RA 5KYYB 3DTIA 3L2CA 3M8PA 4E7ZA 2GWKA 2MA3A 1KONA 2VN2A 2XPWA 1VQ7T 1D9FA 4QLCU 4EMHA 4GV3A 1N6AA 1KG3A 2PY5A 2DBBA 1FYNA 4BQNA 3QODA 2DBKA 2QBYB 1IO6A 3BE3A 2E70A 4AFUC 1MUDA 1CKBA 1JB0E 5TGTA 1W9HA 3ZOBA 2HYJA 2KRCA 2R7RA 4CDGA 3GTOJ 2MWPA 4YOUA 1HYSA 3WU1B 3HL8A 1YE9A 2AK5A 2HHHK 3TP0A 1YG2A 3S32A 3M57A 3DLLA 4CI6A 4CGFA 4CEBA 2DYIA 4LXCA 4RGRA 2ME6A 1JKOC 4BI4A 3UKRB 5EG2A 4CC7A 2XIDA 1TUCA 1GCQA 5FLVA 3DLHA 2Y69H 4L5JA 1VQOA 2BVLA 1RRSA 5IP7J 3W2WA 3HVTA 1RBRA 5F0XA 5AQHA 3CWAA 3BY6A 3ABUA 3HOVJ 4HQEA 5IP6A 5AN4A 1WI3A 2P7VB 4PJMA 3J7YP 5GAN4 1X1CA 4HHTA 4DUZK 3VEYA 1NHAA 5JFRA 2EWNA 2Z1HA 4GO1A 1VQ7N 3VQ6A 4FT8A 2E4LA 1RT1A 3CLQA 5IOYA 1N75A 3CCSI 3P5JA 2VT3A 3AVCA 5D5UB 1T6SA 5D6YA 1N8RC 5L3GA 3L8BA 1YAGA 2PZSA 3HSEA 2FPDA 3VWBA 1XCBA 1JI8A 3EG9A 3RI4A 4HF2A 3MEDA 1UJ0A 3RMSA 4QQ6A 2BANA 2ZJ2A 2ZQBA 5KYWA 1WXUA 4XU3A 1YI2A 4IXAA 4N4OB 3SMSA 4WWCA 3LCNA 3VPZA 1RT7A 1GXQA 1T0JA 2LKPA 3JS6A 2EPDA 4C8OA 4CZGA 3CCQA 1R0BG 1X58A 3ZETA 4B43A 3JRIA 4DYCA 2O4IA 2L3DA 4RKUE 1VSFA 3LGFA 5IPAA 3WTTC 2RO0A 1GLNA 2XDPA 4LH5A 4M75F 4A6EA 2CGLA 2WY7Q 4LE9A 1CF7A 3CJQB 2RPIA 3DCFA 3V1QA 1MNMC 3QYEA 3QEVA 4C92F 5GPCA 1M5Q1 5JLHA 2QLZA 2CP7A 1N6QA 3EG0A 1XHZA 1YS6A 4A61A 1VYTA 5K5OA 1ZLMA 3CCSA 3OW2P 1GBQA 1SD7A 1WQ7A 2F7TA 2MD5A 5GP9A 5HKCA 4F7UB 5IY5H 2L8DA 2VBWA 4YOVA 3K4BA 1LCUA 3QYGB 2M51A 4DOWA 4EA4A 1AZEA 3MX2A 4IBNA 4FSVA 2CGJA 1NGHA 4YPHA 2DTHA 2ZJRF 3VQPA 1R1UA 4ISGA 1VIFA 1P4XA 3IWZA 4ISEA 1WAFA 1VQMA 1OVYA 4IZ9A 4PJLA 2ZKZA 2IA0A 2A07F 1KO9A 3P7NA 1G83A 2RQQA 3ZMDA 2MI6A 1LMZA 1N8RU 2IVOA 4WQ4A 3DLKA 2DL4A 3QJYA 3CMAI 2YKMA 2ZCFB 4EIKA 4RGSA 1K73C 2PU9B 2PFUA 1MD0A 3D5SC 2HHVA 3BW1A 3KD1E 4FJ9A 2PQ8A 2TRTA 4B44A 3VF2A 2OTLQ 4LLGF 4M7XA 3QYHB 2XHIA 4BY6C 4A3GJ 1UGRB 4OPJA 1QS4A 2HKNA 1L3LA 1HPMA 3EYIA 4QIWN 1ORKA 2DM1A 4LMYA 4AM3A 5DMRA 4G94A 4OMYA 2CP2A 4PGGA 2HR3A 5KYUB 4CICA 3PX0A 3CCEI 4CHOA 4B3OA 3QU6A 3J7ZI 2KR3A 2XHBA 5K7FA 2CT3A 2EX3A 3DXMB 1FSEA 2OTJA 5KVRA 1K4TA 5CKDA 1ZBHA 3MHXA 5EGOB 2P7CB 1ERDA 2KZZA 2BYVE 4WFBL 2M1BA 4LDWA 4XIDA 3O3KA 1VSJA 2HNIA 4BHPA 5AQGA 3JB9J 1MBHA 5J1EA 2UUAK 4XAXB 3HOYJ 2F5KA 4YIFA 5J1YA 4FO0A 1QCFA 4WXHA 3ULEB 4PJOB 4BY1J 1C0TA 1OX8A 3MMVA 4M75D 3EYYA 4B4CA 3SQ2A 2LG4A 1NEGA 2VE9A 5CAIA 3MP8A 4H0VB 5IN1A 5J1RA 2L7FP 4XK4A 4DV6K 4DTMA 3RZDJ 2DL8A 2FBIA 3K4MA 1YTYA 1XC3A 1MH3A 1U8BA 1HRHA 4II2A 3L42A 2M7BA 2YG9A 3I59A 2B9SA 2D4WA 1NK5A 3MEWA 2EYXA 2YU3A 3LZIA 2JHNA 3HRGA 4XN0A 3PVQA 2DA3A 5IHNA 5LJ3f 2KGTA 3CMEA 3D2FB 3EZ5A 1WN7A 4DQRA 1SVOA 2NUZA 4JX4A 4YFUA 1KA8A 1NGEA 3FXJA 4AYBN 3OYEA 4J19A 3M59A 3OMGA 2MD0A 2VI6A 3CMEQ 2PMUA 3F8FA 5AYFA 4V2FA 3RSEB 2DD5A 4BXFA 1K73O 2D8JA 3UPUA 2PZ1A 3C6HA 1OH8A 3O9QA 4V2SA 4C9YA 1TYQA 3PSFA 4J6WA 3WVEB 1U9OA 4PDKA 5KPZA 4M9ZA 3B6PA 3ML6A 4DJAA 4C0FA 1VQ5A 2RK2A 4MMKA 5IT9E 1QKWA 2VXEA 2G6FX 1WXBA 5LRRA 2XROA 3RRGA 2DA1A 4IQJA 4FT4A 4BREA 2ME0A 3F10A 1NKCA 1ZR2A 3LWLA 1MW7A 4ZDOA 2P9PB 4AI4A 4JD2B 4FJXA 2PJPA 2E6MA 5KK1A 1JJ6C 3SBTA 1IB8A 1Q82R 2K3YA 2DJIA 4PJOD 5HROA 3WU0A 1IH7A 4CRIA 1X9MA 2F8SA 3R6MA 1WGSA 3JAMK 2FUG2 2DTZA 3OBYA 3FRNA 5HBMA 1UFFA 3EFOB 1KG5A 4DLGA 2X6OA 1O3QA 3QHSA 3LA3A 1IO2A 3SQ0A 3EDPA 4M78C 4KITB 4A3FJ 2K4BA 3L2UA 2MWOA 1VQ9N 4Z4FA 3ATVA 1WSFA 2QGGA 4C3JJ 4EA5A 4MO5A 3C95A 5AJ3K 2XDVA 1TT0A 3D5LA 4E3SA 1WHGA 1AKHB 1S7EA 4MTDA 1Q95G 3MKDA 2GWJA 4CVNE 3P9KA 1OKRA 1I1JA 3THWA 1E3OC 4CJEA 1KXPA 4BR0A 2DMTA 3GNGA 4LIVA 1AWWA 2WB1N 3U21A 5GIPA 2RJFA 1WHJA 4BI8B 2X9DA 4QOZB 3E66A 4IVNA 4MTEA 4CCMA 1QVGA 4DQQA 1Q1VA 5C6SA 1JLBA 4HSTA 4PJNA 1R0CB 3AA3A 1JLAA 2KIQA 2F4IA 4KISA 4H4OA 4XLHA 5EU7A 5AQPA 1T0HA 3LMMA 1Q7YU 1MGQA 3SQNA 3OYFA 1W7PB 2JTMA 3IS9A 3GFIA 1IGNA 3V7CA 3CD6A 1N39A 4KHPK 4M9XA 1N9SA 1QZYA 4E6KG 4B1UB 1QQJA 2CZ0B 2NVXJ 5ICEA 5DUIA 3CP2A 4B3MK 1T38A 3IUOA 5KQ8A 4MQ9F 4IOCL 2XAHA 4HCCA 4C1NK 3JRGA 2EW3A 4RAGA 2F69A 3SFIA 3D5RC 3O1BA 4CIGA 4M4ZA 5LJ3g 2CH4W 3MJXA 1D3BB 3NQOA 2VQCA 3K2AA 3UDCA 1H641 2VKHA 2VKNA 4BC5A 2ISYA 4FISA 3WVDB 3THVA 2EJ9A 3W0LA 1UECA 5KCOA 4OP0A 3CM5A 1UWBA 4GW6A 1N5YA 4QPQA 1RABB 2O01E 4I2OA 4M7DA 1MJBA 1EO1A 3V8JA 4CF1A 3OHRA 4OMMA 2FBTA 2VBZA 2EB7A 3OR2C 2IW5A 1XB4A 1Q7YO 4CC4B 2GOMA 3R61A 1I5LA 4YHHK 3WU2C 3QESA 2NRHA 1KIKA 3LAMA 2A7YA 4BWJA 5AZIB 2M87A 4BUGA 2HGCA 1U45A 2VQFK 5CKFA 2PVOB 2DCEA 2VQHA 4I98B 3NNQA 4CJLA 4A3JJ 3AG3H 3SYTA 2O9LA 4ILJA 4WQ5C 4X9CA 3H0FA 1W70A 4F14A 1I6HJ 1K78B 2EQJA 2Y31A 1YIJQ 2V26A 4A93J 3H9NA 4H5NA 3CCMA 2R57A 1DUXC 1PC0A 1NOYA 1ORPA 4PKHA 3AO4A 2LLKA 5LJ3j 4N9IA 1S22A 2E5NA 1KQSS 1U6ZA 5LD2C 2E1CA 4I99C 1WH5A 3GZ6A 2F2XA 1TOVA 2Y4YA 4LFUA 5GAGP 1KC8O 3PIOL 9ANTA 1ZA1B 1KQSA 1EKEA 4DS4A 5AQTA 3PE0A 1VQ5Q 1Z67A 1O75A 4JKAA 4K11A 3BCAA 4ESJA 1M1KU 4CECA 1ZBUA 4EW0A 4LFBK 4K25A 4GY2B 4CCNA 3JCMg 2WAQA 1RDWX 5DM6F 2D6FA 1GBRA 3SZGA 3KLFA 3WE2A 2NNNA 3MCZA 1ZBFA 3ISNC 1QU3A 2CUZA 4WTOB 3KP5A 4XONA 2P5VA 3CQTA 1W0HA 4G1QA 4RW8A 1SQKA 1RLPC 3KZZA 1F43A 1M9SA 2E34A 4AQYK 3K4LA 1NGIA 4B08A 1LWYA 1ZBXA 1JTXA 5B5EC 4IUQA 4CFAA 3G4SA 2O8BA 2KQWA 1USSA 1Z9CA 1F21A 3EPZA 1YJWA 1N8RR 4XK8E 1RBUA 4BG9A 3EUHA 2EIMH 3JXUA 5HRPA 3VRYA 4R56A 1WSJA 2BY2A 3NARA 2DAQA 5GAN7 4A0XA 2DD4A 2H1LA 2FMYA 1RUWA 4FE7A 2GQVA 4JRIA 4ANJA 2LNHB 3MX5A 4CK3A 5L3EA 4YDUA 1CZ9A 4M77A 1VQKQ 4CEAA 4FPAA 2NNYA 1O3SA 3S9HA 1NBWA 1D1CA 2J6FA 1VQ7A 3KHYA 2QTXA 5FLMJ 2IA2A 3RYPA 2YHBA 4FWSA 3LPUA 2DERA 4BRMA 4EW4A 5EG0B 1LOJA 3BJ6A 1IJJA 2Y90A 1M2OA 2HSPA 3SZ2A 1TAQA 2JA7J 5HLFA 2OPQA 3MECA 1WBBA 2ITGA 4CYCB 2R7YA 5KE3A 3KWGA 1YQMA 1H9TA 1OQKA 3CG7A 4MDBA 3X24B 3DLAA 1NM1A 2BHYA 2ZJRL 5E3MA 5IAYA 3EE8A 3QIIA 2D5VA 2QEXI 1ON1A 3O3GA 4BR4A 3P31A 3HUGB 1PM3A 1WDXA 2E2OA 3QYBA 4MLHA 3EUAA 1VSEA 1G6NA 2FEZA 4HUFA 1A36A 4BRGA 4DTSA 3TAPA 3AAFA 3CCJA 3MN7A 1K6OA 1VQ4A 3CO7C 5JVTA 3MEVA 4NNJA 1RUNA 2LP5A 1ZELA 4Z4HA 4KN4X 2DU9A 1Y0MA 4MDXA 2W00A 3J81K 3EGUA 4II1A 1HKQA 1GLBG 1WJBA 1GDTA 1VI0A 3I54A 4XH1A 3I9QA 4C8QG 2J5OA 1VQNA 3VTHA 2O4GA 4BDZA 3BR2A 2WV1A 4P55A 2NUPA 1EJ9A 5TJJA 2P6SA 3UE5A 3GLXA 3JRZA 4H5RA 3OL4A 4M75C 1IGQA 4H4KC 2MOXA 1G3YA 4CJ4A 2IGNA 2BZ8A 3PO4A 2M3AA 1KG4A 2K5IA 2V4JC 4BD3A 1YJWN 3K57A 3DBLB 4KUIA 2E35A 2GXBA 3K59A 4FETA 4DR4K 1FWZA 5D4SA 1IKVA 2MSYA 3S1RJ 3JB9H 5JVGF 3CC2N 3VS7A 1VQNN 3WQUA 3KYLA 4M75B 4J6YA 3G1JA 3WQTA 4DV7K 1GLEG 3K4JA 3C0BA 2XC7A 2YX7A 3RJPA 2DOFA 1IG7A 4Y52J 3GEZA 3AVMA 4CYDA 3GTKJ 4M6XA 2CZ6B 2QGUA 3CIPA 5H6RA 5KNLA 5LHGA 2EPFA 2VXFA 1Q81U 2HTJA 2COYA 2F2WA 4LF6K 1BQMA 4E7SA 4XH4A 2XICA 3FF5A 1U2VA 1IV8A 3SWNB 4B3SK 1YJNQ 3COAC 3TO6A 3G1OA 2D45A 3DAWA 4UVCA 2A61A 2DA2A 4R55A 1R5ID 2E1ZA 3DKMA 2OPPA 1YW8A 3HJEA 4XKVA 4B1VA 2DTRA 3SEMA 4B21A 4YOWA 4BC3A 3DOKA 4X0GA 2NOJB 3CDIA 1YQLA 3L3VA 4M3RA 2Q3SA 1IJWC 1QZZA 4ENNA 4W97A 3GTQJ 2GWRA 3T7ZA 1OYXA 3N4PA 3S1QJ 1RTDA 4OIRF 3IWFA 1RR7A 1WJFA 4ITVA 5M3MJ 3JCMh 4RAFA 3NTIA 4RTTA 5J40A 3B6OA 1KU2A 2ED1A 3MFKA 4OJRA 1HDDC 1WRJA 3RR6A 5L23A 3JCMQ 1YQAA 1AHDP 1QCOA 2QCOA 2WAEA 3IHOA 1C0MA 4OINF 3CCLT 4FZZA 3ZMTA 4WE1A 2HDWA 2KDOA 2RI3A 3KUFA 2YHTA 4DFMA 1O3TA 4MNUA 2RNGA 3CD6I 1TKXA 5LEKA 3KK1A 3VGMA 1BI0A 5TRDA 1OVQA 4A0YA 2D1XA 4YORA 5D7UA 4I09A 1FBUA 2A6TA 5IP9J 4A3DJ 2O9SA 4FWKA 2F4OB 1SRLA 4JKFA 2IS1A 4JJDA 4FJLA 1HCRA 4DOZA 3O4WA 3HSCA 3AO2A 4BQOA 1HSTA 1JE8A 4Y15A 1BG3A 5FPNA 3CFOA 1O7LA 3DPUA 4EPCA 3UNGC 4Y4RA 1ATNA 3AV9A 4EMKB 4KFBA 4BNCA 1EFNA 4AYBA 5CZ1A 2M8GX 1L3UA 1G59A 4N47A 4JKGB 4M7AG 1XQSC 1Q7YR 1IV6A 1ZGWA 4JPBW 2PNIA 2MW8A 4YOXA 5GAOn 4AFZC 1E3PA 2K3PA 3RMAA 3JB9D 2B86A 1AEYA 3FM5A 3FMQA 3DV8A 1SS6A 2FBVA 4D7MA 2VONA 1O57A 3LWFA 4ELTA 4M3WA 1NPPA 3SCXA 3OYKA 4J00A 1FPQA 1GT0C 3EHQA 1O4XA 3DWLA 5CYQA 3LSGA 2K85A 4HT8A 1C0GA 3JAME 3J81O 3O9UA 2HL5C 5E8GA 2HOTA 4PJOE 5AQJA 1X2MA 2V7ZA 3AVGA 1V55H 1S3XA 4LG0A 2HVIA 3TPQA 4IOXA 1BR1A 4IJNA 2PFBA 1S3JA 4XIUA 3EEQA 3AA4A 3DXMA 4M77F 2E2JJ 1HNWK 2HOAA 4N0AA 4P96A 1IREB 4QPOA 1KQSP 3HSRA 4AIKA 4I9QA 1N78A 4CHPA 3NDKA 2P9IB 2K3FA 2E7WA 4CGJA 1QVFP 2VGMA 5LJ5j 4FM0A 4OX9K 4EJZA 4EJOA 2KW4A 1TTHB 4NHJA 3ZPLA 1ZAOA 4BR9A 3ZQ7A 3HVRA 5HRRA 4ATOA 3BTJA 1BIUA 3FXRA 5KQDA 3LQRA 3BTCA 4J2EA 1NBEB 3LSRA 2ICWG 1XTAA 3JRHA 3U9ZA 2Y48A 2OTLI 4ZN1A 1K8AC 1M3HA 3W2VA 4FJIA 3MMYB 1KD1R 1KSWA 2LF8A 5GMKm 3ZQIA 3CMEN 4ME7A 5E8IA 2PAVA 1MDUB 2FZKB 3L2WA 1VQPT 3HBLA 3OTOK 1WJCA 1S5JA 4A2AA 2OTJT 4KUDK 2YPRA 4FJKA 2VB6A 2DPUA 3HFNA 3GDQA 1WEIA 3AGKA <