4IKFA

Pfv intasome with inhibitor mb-76
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/dna/inhibitor
molecule keywords Integrase
publication title 2-Hydroxyisoquinoline-1,3(2H,4H)-diones (HIDs), novel inhibitors of HIV integrase with a high barrier to resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 101
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ikfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ikfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ikfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ikfA03
1LWFA 1T7PA 4CEZA 4Z4HA 2XY8A 3ASMA 2ZD1A 2QXFA 1WJRA 4CK3A 2P51A 3QJ6A 2RHUA 1EP4A 3VQBA 4RW6A 4M3WA 1YTUA 1LW0A 1BQMA 4KTWA 1UA1A 3NCIA 3NTIA 1S9EA 4H8KA 3O3GA 1TVRA 4FM1A 4ELTA 2RO0A 1CZBA 3SZ2A 3ZSZA 3V81A 2KZZA 1HJRA 1NK0A 3ZCMA 3RRHA 1RTJA 4QQDA 4J2DA 4YNQA 1TK8A 3CM6A 1WLJA 1BL3A 2HHSA 3VQ4A 4FLWA 1BGXT 3DLBA 3AVHA 3AA4A 1QE1A 4FU6A 4C5EA 1B9DA 4DTXA 3LAKA 1S5JA 3EZ5A 4BD3A 4DFMA 3T19A 3L2VA 2DIGA 3TAFA 1ITGA 4TSXA 2E4LA 3MEUA 4KHNA 4DU3A 5C24A 1TK5A 4GMJB 1LWEA 4HVJA 4BWMA 2OZMA 4IURA 4F3TA 4DSJA 1YVUA 5KCHA 1KRPA 4B9NA 5HBMA 4E7HA 4C5GA 3Q1JA 4KKOA 3K5MA 4G1QA 1L3TA 3VQQA 3VQ7A 3EYZA 1NK7A 4N4GA 3ALYA 3ZT1A 5FROA 4KHWA 1UOCA 4FJJA 1ZBHA 1RTDA 3HYFA 3KD1E 4F8RA 2E6LA 3OMCA 4FM0A 1IKXA 1C0UA 4W5NA 1OZ2A 4HTUA 1JLEA 2VG6A 2G8UA 2BANA 4DU4A 2RHYA 3RR7A 4RW4A 3KLIA 1RBRA 4IUPA 1TL3A 4KV8A 2XRIA 3DB4A 4M3YA 3BDPA 4QOZB 3V4IA 1NK4A 3K59A 1NJZA 3TAEA 3MEWA 1BI4A 4I9LA 5J2QA 1S1WA 3TAPA 4W5OA 3THVA 1DTTA 1NOYA 4Q5WA 3O4QA 3NDKA 3TAGA 2HB5A 4LH5A 1RI0A 4FK4A 3C6TA 4CRIA 3OYLA 4Z4EA 3K5LA 4KTQA 2YNFA 3TAQA 1EXQA 1A5WA 1D5AA 3QKJA 3T1AA 2LCCA 3LALA 2RJEA 3HO1A 1RT7A 2DFHA 4ID5A 4NCAA 4CEQA 4C5HA 4M41A 2I5JA 1UWBA 3OYKA 1S1VA 1CXQA 3RMDA 1SL0A 1HMVA 2FBVA 2F8TA 4OPJA 5CYQA 1WSEA 4E7IA 4M3TA 2DTUA 2DY4A 3U3YA 1TAQA 5DMRA 2D0CA 2YRVA 2HVIA 1U4BA 2QQSA 1N6QA 1XC9A 4I7FA 3SD4A 1LV5A 3NF6A 4KHSA 5J2MA 1S6QA 3SPYA 4DSFA 2BUDA 3OYDA 2EQUA 3SV4A 3HPOA 1KSPA 4CK2A 5CYMA 4E1MA 3HVRA 3F73A 4C8KA 1T03A 3ZT3A 3HM9A 3SUQA 1S1UA 2VG5A 4EZ9A 2YNHA 3ZSRA 4CF0A 5FRNA 3HL8A 5M9OA 4CEBA 3ZEHA 4BDYA 2IOCA 4AHTA 2B5JA 3V1QA 4DQQA 2RJCA 1FKOA 4IG0A 1U48A 5KCOA 3AV9A 3AVGA 2AJQA 3I8DA 3PMIA 1BIUA 2XK0A 4FJIA 3NF8A 5CZ2A 1RDDA 4I2PA 2HHUA 4MQ3A 3MP1A 4BDZA 3MEAA 4HUFA 4FZZA 1RDAA 5T7BA 5D6WA 2ETJA 4JRPA 3PV8A 4R5PA 1Q9XA 5IAYA 2RPIA 1UA0A 3AVCA 4BE0A 4FZYA 1VK0A 3ZSYA 3SI6A 4OLBA 1LAWA 2HNYA 2BKDN 1F21A 4C5IA 3AA5X 1OYXA 1KFDA 1NK8A 4RG2A 2BIVA 2B4JA 3DOLA 4II1A 4IG3A 3MP8A 2FC0A 3PUFA 1SV5A 4CJFA 4FJGA 3S3MA 1DLOA 4AILC 3K58A 1I3AA 4CF8A 3KK3A 2NUBA 4NCGA 2HNZA 3V9SA 1TKXA 2KZMA 3OYGA 3TI0A 1CZ9A 1NJYA 3ZSVA 3KLFA 2R7YA 3NAEA 1BHLA 2G8HA 2FHDA 1O1WA 4CK1A 3DRPA 2E6NA 4ZTFA 4DLEA 1NK6A 3VQ9A 3QLHA 2EX3A 5KE2A 4M3RA 1N5YA 4EZ6A 3OYBA 1U04A 2X74A 2OPQA 4IFYA 4N41A 4BE2A 5D3GA 3QEPA 1QTMA 1EETA 3HXMA 3CFRA 1Z26A 2LRQA 4DTPA 2PQWA 3LYIA 4LD0A 4CHZA 1XNIA 5KGWA 1BISA 5I3UA 3DMJA 3FDRA 2YHAA 3PX0A 2VWKA 3VQPA 1JXBA 1KVAA 3L8BA 5C6SA 1W9HA 3QO9A 3KK1A 3NGZA 3I0RA 2MWOA 3ZSOA 1YT3A 1NK9A 3NGYA 3MP6A 5IN1A 3PY8A 3LGFA 2CKKA 4B9LA 3NGIA 3CEYA 3AVFA 4LSNA 3LGLA 3V9ZA 1RILA 4CJUA 4N76A 5EU7A 5E41A 4Z0UA 4GW6A 3L3VA 4E3SA 4CEAA 2OPSA 4DQPA 2KW4A 4DLGA 4CE9A 1S9GA 3O4NA 2RHZA 3GOXA 4O0JA 3DLMA 2EFIA 4CJTA 4CJ5A 3LP0A 4FJ5A 1ZYQA 2P5GA 3B6OA 3RTVA 4OPKA 3LX7A 4IUVA 1TKZA 5FDLA 2ZQBA 3OQ5A 4DWIA 1N27A 4DS5A 1ZBFA 3QBYA 4ZHRA 5HRSA 1SL1A 1JLBA 3AO1A 4HUEA 2RKIA 3F9KA 3WNEA 3NHGA 3L2RA 3VQ6A 1K6YA 3AVNA 3JYTA 4DTOA 1IO2A 4DF8A 3O3HA 1NKCA 4FLVA 4GVMA 5SWMA 1OZ3A 2XDPA 3LZJA 4CFDA 4OKKA 4RW8A 5J26A 4O55A 1GOBA 4WE1A 4W5QA 3D45A 1VSEA 4DMNA 1L3SA 1ZBLA 5J2PA 4M3UA 1JLQA 2YKMA 4Z4IA 1IKVA 5C42A 3ZT0A 2HVHA 4W5RA 4OGCA 4UQGA 3OJUA 4RW9A 2G8VA 4CF1A 2XY6A 3DI6A 2VG7A 3O8VA 3SQ0A 4AHVA 5KH6A 3VN5A 3DLEA 3KUFA 1VRUA 3DB3A 2DFEA 1FK9A 4KB1A 3SQ2A 4KHQA 4DTUA 4E89A 1KVCA 3ISNC 2YV0X 4BDPA 3OS1A 3AVAA 2RF2A 3HK2A 4KTZA 3OYAA 3KKRA 1NKBA 2BDPA 3U6FA 3K57A 3NE6A 3E01A 3MEVA 3G0ZA 3LP1A 2F96A 1OI1A 1C1CA 5SZTA 2D9TA 1KLNA 4NS5A 3OJSA 3QIOA 4ELVA 2F8SA 2X4XA 3VA3A 4M3ZA 2R5MA 3P8DA 3OYIA 3H08A 2ZE2A 1TAUA 3AVKA 1WNSA 4LY7A 2RI3A 4CIFA 4ZTJA 1C0TA 4CEEA 4PQUA 1QSSA 3S6WA 2YNIA 2KTQA 1W0HA 1ZBUA 1D9FA 3TWHA 3OMGA 1VSIA 3LP3A 3TANA 1A5XA 1J5OA 4CCHA 4C8LA 4J2EA 3ME9A 4K8XA 4FJ9A 3QEWA 3OYJA 2R5AA 4E19A 3SCXA 4CESA 3NTHA 3MEEA 1KLMA 4E7LA 4DSIA 3K5OA 4PY5A 1TKDA 2M16A 1REVA 2KFNA 4CJVA 5HP1A 3SUPA 2GV9A 3TAMA 2IDOA 4H4MA 3P5JA 2GBZA 1VSHA 1G5VA 4KAZA 4B9VA 4HUGA 2E6MA 3SQ4A 3AA2A 4DQRA 1JLAA 3H8ZA 1GOAA 3VQ8A 4HCZA 3HPHA 4CHNA 3CQ8A 1BI4B 4CJSA 4CJ3A 1X9WA 3TABA 3FFIA 2HMIA 4PL6A 3DM2A 2Y1JA 3LWMA 2QKBA 4QVZA 4CF2A 2HQXA 3HT3A 5C25A 3MXMA 4Q0BA 2FBTA 3OYEA 4OGEA 1QS4A 3KK2A 4RW7A 1WJSA 5HRNA 5KRSA 4NYFA 4UC4A 2W42A 4M42A 3RR8A 1A5VA 3NF7A 2BE2A 3CYMA 1IKYA 3OA6A 1NKEA 2QK9A 2JLEA 3OVNA 4B9WA 1VSJA 4EP5A 1FKPA 2PYLA 1RBVA 4CGGA 4CIEA 3HP9A 1JLFA 4FLZA 4F4KA 3E9FA 3SJJA 4DF4A 4F2RA 3IS9A 4CHOA 4OJRA 4DFKA 2LDMA 4M45A 1MU2A 5K14A 3PO5A 4Z4CA 3QESA 4CERA 2Z1JA 4PLLA 4DTJA 1XHXA 2A1RA 1G15A 5JS1A 3LANA 3G10A 1HNIA 4JRQA 1J9AA 4F2SA 3B6PA 2ATQA 1WAJA 1U45A 3QNNA 3AVMA 4N56A 4DFJA 2JZ2A 2D5RA 4CGJA 1Q8IA 4CIGA 4B9XA 4Y1CA 3L2WA 3NFAA 1QSYA 4W5TA 1HNVA 4OKEA 1TK0A 4FYDA 4Z4GA 2Z1IA 4HCBA 2O4GA 1WSJA 1SKRA 3ASKA 2XHBA 2GFUA 4CJ4A 3C4SA 4FLYA 3SV3A 3E9GA 3MECA 2QQRA 4AHSA 3V6DA 3OYCA 3NNQA 4OVLA 4MFBA 3O3FA 3FC3A 1ASUA 3M9QA 3AVLA 3M8RA 5D6XA 3QINA 4QAGA 4DTRA 3ZT2A 2RJFA 1TL1A 2RI5A 2VWJA 5CY4A 4PA1A 2LVMA 3K5NA 1DTQA 3OS0A 2G8FA 3M8SA 4CF9A 4FJ7A 3HJFA 5HROA 2DFFA 4JLHA 4B3OA 1IKWA 4KHUA 2P0KA 4N4IA 4CFAA 1U47A 2YHBA 3HPGA 1J53A 4KFBA 3CFPA 4QQ6A 2IAJA 3S3NA 1QQCA 2FBYA 4FLXA 4DG1A 2WACA 1FXXA 2JGUA 3RMCA 3OB9A 1JLGA 4CEOA 3DYAA 4IUQA 3CG7A 3L2UA 4B9TA 2EHGA 3PX6A 4OVAA 3VA0A 2OA8A 2M0OA 4AHCA 4DU1A 4C8NA 4FLUA 1QHTA 3QERA 2EKOA 4IKFA 1NJWA 1WSHA 4FLTA 2RJDA 4M3XA 4CJRA 3CFOA 2OZSA 2G3RA 4CFCA 2RN2A 4J2BA 4FK0A 3AO4A 2DIQA 3AVJA 3AO5A 1RT3A 2Q3SA 1RDCA 1TKTA 4FJ8A 3AA3A 4AH9A 3P1GA 1VRTA 1WGSA 1HRHA 1TGOA 2X4YA 1BQNA 3SQ1A 3LZIA 2HNDA 3C6UA 1HYVA 3KLEA 1J54A 3V9WA 2B8AA 4KO0A 3LAMA 2RI2A 1HQUA 3L3UA 4I2QA 1NK5A 2G8IA 4CGFA 4KI6A 4GY5A 1ASWA 3PNWC 4BACA 3T3FA 2L3RA 1QSLA 1R0AA 3C95A 5D6YA 4F3OA 3VQDA 2EQMA 3H6ZA 3HP6A 1RBUA 3LH0A 3QIIA 2IG0A 4QCLA 4IBNA 1U49A 1KFSA 2RHXA 4CHYA 4KB0A 3AVBA 4C8MA 5FRMA 1RT2A 3NBPA 1RT4A 1KTQA 1I39A 1JLCA 2M1HA 3DRSA 1RNHA 3AVIA 4RG8A 1WSFA 1X9SA 3QEXA 1HYZA 4AHUA 4HCCA 2X35A 2HHTA 5JS2A 3AO2A 3L42A 4CEDA 4YFUA 5DK5A 2IS3A 1Y97A 3OY9A 5KE3A 3MXIA 3ZSWA 3NTKA 4DSKA 4HHTA 3DLGA 4CJQA 2KQ2A 3RMAA 2D0BA 3VQAA 2A1SA 2HHXA 4IUUA 2Z1GA 1Q9YA 1X9MA 3TR8A 4N47A 2HQEA 4DSLA 2EQKA 5J39A 1HPZA 3LP2A 1CLQA 2F5KA 4FZXC 2LSNA 3MEDA 4JS4A 1T05A 4A4EA 3V1OA 4EP4A 5HLFA 3WNGA 3IG1A 1VSDA 4K8ZA 1VSLA 1RTHA 2FBXA 4DQIA 1SSFA 1XHZA 1C1AA 4OLAA 3IRXA 2VYTA 2IGIA 1KHCA 4Z02A 2IC3A 3RWUA 3MEGA 2P1JA 2L8DA 4FK2A 1L3VA 4C8OA 4Y1DA 1T8EA 4L59A 4O0IA 4LH4A 3FEOA 3NH1A 2X6SA 4Q5VA 4E0DA 3CM5A 3ZSXA 3PFSA 1NOZA 1S6PA 3LWLA 3P8HA 1XWLA 2GUIA 3KLGA 3NH0A 4IUTA 2PYJA 2BGGA 2X4WA 4KREA 4KRFA 1RBSA 2G8KA 4I9QA 3SYZA 1SKWA 3OYMA 2HW3A 5C0MA 3D0PA 2Y1IA 3KTQA 4DQSA 1IG9A 2HHVA 3LPUA 2R57A 4NYNA 1GOCA 2WOMA 4FCYA 3WNHA 1NJXA 2MWPA 4A4FA 3OYFA 5J2NA 4BE1A 3ZT4A 4LSLA 4E7JA 3BGRA 4DSEA 3KKSA 4JS5A 1JL1A 3MAQA 4PLIA 3DLRA 1C0MA 1RBTA 3QEVA 1RT5A 4E7KA 5HRPA 2D0AA 3TARA 3K2PA 4B08A 4OKJA 1L3UA 3ITHA 2X78A 2OPRA 1ZBIA 3DOKA 3RMBA 2EQJA 2PY5A 1IH7A 3UIQA 1LW2A 4CJPA 4IFVA 1D9DA 4AHRA 3PMTA 4CECA 1SL2A 2RHIA 5CZ1A 2XY7A 4PWDA 3LLRA 5KGXA 3KD5E 2PZSA 2WONA 3VQCA 4CEFA 3L2QA 3WNFA 5I42A 3DLKA 2YKNA 4ELUA 1LWCA 3V1RA 4ID1A 1SKSA 1VSKA 1EKEA 5KI6A 3VQEA 1JKHA 2O4IA 3NH2A 3QIPA 4B9MA 3QEIA 4KPYA 5KTQA 4FXDA 1CXUA 2LTOA 2B6AA 2GFAA 3F70A 3EAEA 4B8CA 1MHNA 3A2FA 4E1NA 2L89A 2G8WA 4CGHA 3UT1A 3DRRA 3SNNA 3UWNA 2K3XA 3M8QA 2X6NA 3MXJA 3LPTA 4LD6A 4B8AB 4CHPA 1KCFA 4B9SA 4FJXA 1VSMA 2R58A 4J2AA 1BCOA 1LAVA 4X34A 2KFZA 3P83D 3KJVA 3V9XA 4QQGA 3SUOA 1WJQA 3S3OA 3KLHA 3LDSA 1Z25A 2K3YA 4CJKA 4QW2A 4NZGA 2YNGA 1WAFA 2Z1HA 4DS4A 1RT1A 4L8RB 3V9UA 4N5SA 1RCHA 4PUOA 3S9HA 2NLUA 4A4GA 4Z4FA 3HVTA 1S1TA 4O44A 1WSGA 4CJWA 3OYNA 1JL2A 1SUQA 3C94A 3IAYA 1L5UA 4FJMA 4FJLA 1WN7A 4FW1A 3META 3VQ5A 1UAXA 5HRRA 4DTNA 1HQEA 4BWJA 4EDUA 2HHQA 2ITGA 1B92A 2O4XA 1XI1A 4FM2A 4KI4A 3NF9A 3RRGA 3OS2A 2P5OA 1EX4A 2O4XB 1S1XA 4IDKA 4B9UA 1VSFA 4DTSA 4O5BA 3SUNA 2OPPA 2QKKA 4FVMA 3JSMA 2XO7A 4CJLA 2E5QA 1BCMA 3I0SA 4N4HA 3ZSQA 4XIUA 4FJKA 1WSIA 4CGDA 4NCBA 3AO3A 1YTAA 3QNOA 1RT6A 4DTMA 1HYSA 4CGIA 4H4OA 2HHWA 4FJNA 2DAQA 1TV6A 3U3GA 3OYHA 4CFBA 3EY1A 1BIZA 1RTIA 3QETA 5CIUA 3HSTB 3MO8A 4FJHA 4O4GA 4FW2A 4FL6A 3SPZA 3PO4A 1KVBA 1H3ZA 2OYQA 5J1EA 3FLGA 4CHQA 1RDBA 3M8PA 1C1BA 4A4HA 3KIOA 1B9FA 2XY5A 1ASVA 4KHYA 4DFPA 3PX4A 1D8YA 4CJEA 2JTFA 1JXEA 3BDLA 1C6VA 5KRTA 3DLHA 4ICLA 3ULDA 2GF7A 1X1PA
chains in the Genus database with same CATH superfamily
1J9IA 1LWFA 2XY8A 3THXB 4PJLA 1RUNA 3O2PE 3I5SA 2ZJPL 3X2QH 4CK3A 4ZNXA 2P51A 3OWTA 1T0FA 2JA7J 1UUEA 1EP4A 2RF0A 2RK2A 3BWGA 1S9HA 4M3WA 4A3MJ 1OQKA 5LJ3f 1VQMQ 1LW0A 1JTXA 1EF4A 2FSJA 4FM1A 2DA5A 4UB6C 1Y07A 3M1EA 2KL4A 2K5FA 3TO9A 2EILH 1HJRA 2V1RA 3T1HK 1UE9A 2VGNA 4LJZF 3RKYA 4M78A 4RM3A 3CM6A 3P39A 3M1FA 4D8KA 2CYZB 1YJNA 3E6MA 1ZREA 3DLBA 4KMUX 2DU9A 4JI5K 3A1PA 1SG5A 2MG4A 3MZ8A 2V8IA 2YU9J 4C5EA 1TUGB 4PJOE 3DXMB 4LK0F 2DD5A 4DTXA 3HOZJ 1S5JA 3R0AA 4BD3A 1O3RA 2CH0A 1WWXA 4DFMA 1TWHJ 4DZPA 3MZYA 4M75G 2L2PA 2DIGA 4TSXA 2E4LA 3VF6A 1AWCA 3JCMP 1KIKA 5AQXA 2L01A 4GYGA 2KIFA 3WVDB 2ZJQL 2VT2A 1ERDA 2AK5A 3A5OC 4KH1B 3MKWB 3M3ZA 4BWMA 3BY7A 4IURA 5HK3A 4DSJA 2P5LC 2PBDA 2OANA 5DM6F 2XV4S 1YRNB 2J6OA 4F16A 5KCHA 1MD0A 1QKWA 4DV5K 3KP5A 3Q1JA 2YLCA 4FE7A 1L3TA 3VQQA 2DK5A 1NK7A 3ZT1A 4EVVA 5KYWA 4RTWA 2IS1A 4C92F 3G6EN 5CE3A 1KC8R 4XBFA 2QBYA 1KAXA 4M77G 3L7WA 1IKXA 3C65A 4W5NA 1OZ2A 4HTUA 4I2OA 2YRCA 2XD0A 3W2AA 3QFPA 1J75A 1X3ZB 3CCET 2FUG2 4X65K 2GZWA 1XCBA 3PNTA 5J3BA 2NS0A 5FFZA 3KLIA 1LDJA 2LF8A 3IRQA 3GX4X 3WHCA 3C2BA 3E5UA 2XRIA 1G2HA 4Q5SF 2ZJ2A 1M1KU 5LEKA 4PFPA 1WBDA 3VDXA 3N0UA 1M2OA 1NJZA 3TAEA 3MCZA 4DV2K 4PUSA 4I9LA 4AFUC 5LMNK 4J7IA 1YI2N 3O4QA 4LMYA 2HB5A 3HRSA 2VGMA 3C6TA 2ASPA 4CRIA 2P5KA 1N32K 3K70D 2MIOA 2LBFA 1JGGA 2AXLA 2DXTA 4LLNA 3K5LA 1G3SA 1EJ9A 2KQRA 2BY0A 3Q3SA 4FOIA 2FU4A 1JHHA 1N39A 4JYKA 3L00A 2DW4A 2LCCA 3GTOJ 3JB9D 5K7FA 3KYDB 4M3FA 2YU3A 3M54A 1X1CA 2RJEA 1U78A 3IHOA 4Y13A 4R1HA 5HLGA 4CEQA 3CXCA 2IS2A 2JMCA 4BXFA 5M1OA 4C5HA 1OH6A 1YJWQ 2DPPB 1IXSB 5BR9A 3MKLA 4OPJA 4M3TA 1VQ8T 2DTUA 2E64A 1TAQA 2FOWA 5DMRA 2D0CA 2DYSH 2YRVA 4FE4A 1PP8F 2CGHA 1YHQT 3I0XA 1G3TA 2F48A 4KHSA 3BF3A 2SRCA 3EQLF 2STTA 2F2VA 4YEJA 5IWAK 4OIOF 3SV4A 1UGVA 3HPOA 2KRHA 3HVRA 3T8RA 2DXBA 4Z88A 2Z1DA 2BGCA 2OTJA 3DAWA 4HRIA 2YNHA 3OGDA 3ZSRA 2XAUA 1A6QA 5FPEA 4KH4A 2VQHA 5K1YA 1VQKI 1UGSB 2FPEA 5M9OA 3ULEA 4CEBA 3PT9A 3D0SA 5BPIA 4XU2A 1VQNT 1MMSA 2O8CA 2O8DA 5AQFA 2A6TA 1IJJA 3WQUA 4XLNF 2RJCA 3QP6A 4MHGA 3E9LA 4IG0A 4OMNA 2A28A 1KQ0A 3K0SA 2CUZA 2KJCA 2QG9B 4LDXA 2GTOA 3JXUA 4R79A 1BIUA 2W0ZA 3U21A 3BJOA 3W6KB 3RTRA 5CZ2A 1SD4A 5KYYB 1RDDA 3D2EA 2X4JA 3I9V2 2O88A 4HUFA 1XSVA 3WQTA 5D6WA 4JRPA 1Q95G 4C8QB 5IAYA 1YQAA 2K9GA 1I5OB 3EUKL 1IBKK 3K7AJ 3FM3A 2E19A 4OLBA 1RKWA 2HNYA 3SJHA 2O8XA 2ELHA 3INZA 5M5YJ 2QUFA 1LFPA 4C5IA 1M3QA 4G6DA 4EJVA 4RG2A 2B4JA 1SS6A 1R00A 1QHGA 2FC0A 2L54A 3PUFA 2XAFA 4FJGA 3AT1B 2N8GA 3CCVI 3K58A 3F6OA 3DKMA 3SDGA 1AWJA 2OF7A 4BS9A 1ESVA 4RGXA 1W4MA 1GV2A 2NUBA 2NOEA 4NCGA 1NTCA 2H8WA 2HNZA 4BHPA 2KZMA 3OYGA 2D1HA 4B3RK 1CZ9A 3E6BA 1NJYA 1KQSM 5EY4A 4H5NA 2F4OB 1BHLA 3M0TA 3M55A 2G8HA 3TEEA 5HODA 3PTAA 5DS9A 5BPDA 3C3WA 1YOVB 1VQ7I 2I0NA 2BEOA 4RGRA 3FGUA 3J7ZI 4QVCA 1TQIA 3CCUT 2GUPA 3TTCA 3QLHA 2IS6A 2V9VA 1KHIA 1N5YA 2JHNA 3JR9A 3OYBA 1EETA 3HXMA 1YLFA 3GYHX 3KFVA 1DJ7B 2DJIA 3A8GB 1W5TA 2UXCK 2EYWA 1QU3A 4Y17A 5E18F 2JJ7A 4FSVA 5D4SA 3CMEI 3CCSA 3FJPA 2OBPA 5KGWA 5I3UA 2ASOA 1K6OA 3SK3A 1M8MA 1P8ZA 1NNEA 4JLGA 3M59A 1N6AA 1UHMA 1U6ZA 2HOEA 1W9HA 4HNUA 3VFZA 3KK1A 4WFAL 4O3MA 3JB9F 4HNTA 4XOPA 1N75A 2IAIA 5FKMA 3EKSA 1AWXA 3MP6A 1N9RA 2OUMA 3CCVA 3RQ4A 3DKWA 4DCHA 4ZC3A 4XLCA 1HPMA 2E5KA 3ZQQA 3NGIA 3CEYA 1Y64A 2I5WA 1B34B 3MN2A 1BYMA 3LWIA 3ATVA 2E1OA 3OSVA 4DZJA 4CJUA 4N76A 4HQEA 2FMYA 1N77A 1XSXA 1UEBA 3LDPA 2DA3A 1QHAA 2MD5A 3CETA 3O4NA 2L0AA 2DKGA 4A3CJ 2EFIA 4EM2A 1K9MC 4CJ5A 4U0WA 2DA4A 3JB9H 3U8XA 2ZBKA 1VQ7A 1KAZA 1KC8U 4RTFD 3B6OA 2QKMB 2HS5A 4IO9L 1X75C 3QHSA 1TKZA 2P8TA 4JLIA 4FOEA 1N27A 1RUWA 5JICA 4FWQA 1ZBFA 3QBYA 4ZHRA 5HRSA 1JLBA 2WAFA 3QWXX 3AO1A 4HUEA 2W03A 5HY6A 2QWQA 2LQNA 4QVDA 3JYTA 4DTOA 2A05A 1AZEA 5I9EB 3QDRB 1NKCA 5GPCA 1BBYA 2CW7A 4X0GA 1SFOJ 4C8QD 1R5HA 2M0CA 3RYRA 3ZMSA 2ME6A 3CMEA 4B1ZA 3OSGA 3TTDA 1T6CA 2CZ1B 5CR2A 3AGRA 4QS7A 2CH6A 4O55A 2QYZA 3CCMN 4WE1A 2DMUA 2CZ0B 3AG4H 3E6DA 5E79C 4DMNA 4WF2A 1ZBLA 1Q7YC 1HKCA 4M3UA 4AVPA 3BJAA 4Z4IA 1IKVA 4CW7B 3HPWA 3HBTA 4CF1A 2O01E 4GV3A 3CCQI 2W84A 3KP2A 3VN5A 1VRUA 2ZWHA 4C92C 2W10A 1FK9A 2GWKA 2OJ2A 4PNOA 4KHQA 1J6ZA 1JUMA 4BC5A 4E89A 3ISNC 2CUDA 3GO5A 1BIBA 2YV0X 4BRHA 2COWA 2JT4A 3AVAA 2RF2A 3KWGA 4LIVA 4KTZA 1IV0A 1VQ9I 4X1EA 2B9SA 3Q9SA 3E66A 3OYAA 3KKRA 1NKBA 4AF1A 5IPAA 4N0AA 5FGMA 3X24B 4A3DJ 1C1CA 3HSFA 5SZTA 4ZH4F 1KLNA 2VQGA 3CF5F 3ENOA 1M3CA 3H9NA 3HSEA 1XCVA 3QIOA 5CR4A 1PUFA 2F8SA 2CUBA 1B72B 3VA3A 4WF9L 1TYQA 3F22A 1W5SA 4XQ3A 4KISA 1R6RA 4JI2K 5HLHA 2YLBA 4BL0B 1F9NA 1C0TA 2KDOA 4UNOA 5AQIA 3FXUA 1LWWA 2KTQA 5GAOn 1W0HA 3VEOA 5EXWA 3TWHA 3OMGA 3LP3A 2KROA 1N8RC 5TKWA 4M3DA 3ME9A 1NK3P 4K8XA 4NHJA 4FJ9A 2H94A 2R5AA 4E19A 3SAFA 3NTHA 5CO7A 3PM1A 2IGNA 4PY5A 2EQIA 2NRXA 1PVSA 3TCJA 3CXCP 2KFNA 4CJVA 1FYLA 3TAMA 1BR1A 4AUXA 1NG6A 1BI2A 2AKLA 5LMUK 5IHKA 1P4WA 3T69A 2OPTA 5EOYA 2RQPA 3CCQA 5ELZA 4AU7A 5J1UA 4KMFA 3H8ZA 1NYFA 4CGZA 1GOAA 3VQ8A 1KU9A 1WSUA 1VQ6A 5HNHA 4BG8A 1DP3A 2ESNA 3TP0A 4OINF 4YRVA 4CHNA 2KK4A 2TDXA 4J9BA 1Y7XA 1JJ6C 1ZUKA 2WSCE 2VXZA 3IH4A 2R4GA 4RCBA 2EQRA 3CMYA 2IS4A 1VQ9A 4LF5K 2LH9A 3R6NA 1NBEB 1VQOQ 4D7NA 4CF2A 2HQXA 3K9JA 2PAVA 3HT3A 2DLPA 4Q0BA 2COZA 1H9GA 3OW2M 1GFDA 3MN7A 2GX9A 4CXFA 2NOZA 1YO5C 4AIAA 1SZ2A 2XVCA 5IHNA 3QU3A 5M5XJ 4UC4A 3L1AA 4G6TB 3OBYA 3JAMZ 4F17A 2P6TA 1ZG1A 4CBWA 3A4CA 4FIBA 3NF7A 2NOJB 3RPUD 2V1UA 2BE2A 4CBXA 1IN8A 5LGTA 2QENA 4JJNK 2BTTA 1NKEA 3ID6A 3G73A 3HB9A 2QK9A 2VKVA 3CP8A 1FKPA 2IIMA 4F7UA 2PYLA 4CIEA 2VODA 1JLFA 2VKNA 2ZXIA 2P4WA 4BXXJ 2PMZA 3SJJA 4DF4A 3R2XC 2A36A 4J83A 3F8MA 2MLKA 1HSQA 4DFKA 2RQVA 1B7TA 5ILSA 3T5XA 4QPQA 1FEXA 4Z4CA 4EJZA 1WJAA 2JA2A 2A6HF 1XHXA 2A1RA 3VMFB 2HVRA 3V4GA 2DD4A 1YWPA 3EG9A 1WCMJ 4H0XB 3CHWA 2YPRA 4C8QF 3BE3A 4HF1A 3LANA 4UNFA 4JRQA 3HTSB 5FLXZ 3JS6A 3B6PA 2YUOA 4CYDA 4EMKB 1WHLA 1VQ8Q 2IW5A 3QNNA 2JZ2A 1V54H 2C06A 4CGJA 1ILYA 2EA2A 4B9XA 2WWYA 1NGCA 5BRFA 3SJMA 1BI1A 2P9NA 1QSYA 1WGXA 2A3SA 1YHQQ 3ZMVA 3BR2A 2V1NA 4FYDA 4Z4GA 3FB9A 2EYQA 5AQOA 3EETA 1CKAA 3K4BA 4RTYA 3T9NA 3VYTB 1WSJA 4KT0E 4NB4A 3KYLA 3ASKA 2GFUA 2XGDA 3A8MB 3SV3A 2NRWA 4GNIA 2HQAA 4CI0C 4LG0B 2JM9A 1NZ9A 2QQRA 3LSJA 2ROTA 2EB7A 3HKZN 5J40A 2IVMA 5HDGA 3P38A 4OVLA 4MFBA 2ME0A 4XKCA 1ASUA 5CLSA 3CJCA 2F1LA 5D6XA 3JAMO 3QINA 2CV1A 1YIJT 3NPFA 3O1WA 4PJOD 3N5BB 3ZT2A 2RJFA 2E2JJ 3K6GA 5BN8A 2PUOB 5LGUA 2OAUA 3EKUA 3GTJJ 1YX5A 1I8FA 1BB9A 3OS0A 5D5VB 1I50J 4CF9A 4XLHA 4H0TB 2ZPHB 2RREA 3SEZA 4ANJA 4BRAA 1U9OA 4JLHA 4KHUA 5CKBA 3QOEA 3CMAT 3CJ9A 5JVGL 3G6EQ 2FA5A 3ZEUA 1K4SA 1Q82C 3K70C 5LL6Z 2VV5A 1KQ8A 5DCMB 1I1JA 1QQCA 1R5ID 2HKOA 2HBKA 2E65A 4LFBK 2UUCK 4CJ7A 4IRHA 2RAEA 5FLXO 5HDKA 4M75E 5GANe 2M87A 1ODDA 3VERA 4FETA 2YHXA 5F27A 3DYAA 4B3XA 3CG7A 1DU0A 1WHKA 2I10A 2UZKA 4MO7A 5AZJA 3THWA 1VQPN 5FB2A 3WU0A 1IHVA 1TWBA 8ATCB 3O4WA 4QS9A 2P0WA 4DU1A 2E2NA 5LY3A 4FLUA 4ZYEA 1QHTA 1YTYA 2I8DA 4RKUE 3BG9A 2HBLA 2LZ6B 2DXUA 2DAOA 1K78B 1WSHA 2OD5A 2NWMA 3CPWA 1TUDA 2RJDA 1FX7A 4UY8I 1MBJA 3WT0A 4M3XA 4YOUA 1S72N 2C0OA 4CFCA 2RN2A 3CMMA 3CCEN 4BBSJ 5TRDA 4FK0A 3G71Q 1QVGA 3UDCA 3H92A 1KEAA 1SRLA 1PKSA 3AO5A 1XQPA 2LX9A 2HYGD 1RT3A 2Z5UA 1MA9B 1RDCA 1KYWA 4I02A 3AA3A 3BG7A 1X01A 3CCRQ 4X9CA 4AH9A 3IL2A 1V5FA 3WE2A 2HFHA 2K3PA 1VRTA 4LF7K 2VXEA 3A8LB 4KFCA 3QPSA 2EVRA 1SF9A 3LZIA 2GM4A 3C6UA 1HYVA 3KLEA 5ADXA 1PSEA 4K43A 3J7ZO 1YI2I 2RI2A 2YJFA 2M51A 3S2HJ 4DYQA 1O75A 1HQUA 4I2QA 2WUSA 1U1SA 1AVZC 4P96A 4CGFA 3DCFA 2L3RA 3RSEB 1SFUA 1QSLA 2KFDA 3C95A 4RS8A 2H8RA 7AT1B 4A3GJ 5AQQA 3CCYA 3SYTA 5AQTA 3H6ZA 2AQFA 2E36A 3LH0A 3QIIA 1JKOC 4JKHA 2O31A 2QGGA 2L7MP 2IG0A 4IBNA 1U49A 5GANg 4BROA 3EFOA 2XGEA 2RHXA 4CHYA 4KB0A 5FRMA 3T8TA 3D7EO 1UHSA 1T3LA 3WG7H 2M9UA 4PGGA 3FMSA 2KEAA 2EZKA 1OISA 1P9QC 2M1HA 3DRSA 4GYIA 2QA4A 2E3HA 2JUCA 1RAIB 5EEGA 5DEQA 3EUHC 2KXCA 3REAB 4DYCA 1PJRA 3ZQLA 2L3DA 1PDNC 1R9TJ 4C2UA 3LW5E 2QQ9A 1V5GA 2DZCA 4DSKA 2J5PA 1I6XA 4F93B 3DPTA 3DLGA 3RMAA 2L3PA 1WKMA 3ABKH 2GBQA 3VB2A 1X6BA 3H5RA 5AQYA 3EYYA 2JHJA 4PJOF 4L9NA 4N47A 1VQNN 4OMZA 5CKEA 4DSLA 3GFJA 1IW7F 1Z7LA 3O80A 2CQNA 2FRYA 2XDVA 3F8NA 4XIDA 1AHJB 1NPPA 4A69C 1T05A 1G83A 1E3HA 4A4EA 4EP4A 3PO3J 1PU6A 2JWTA 4A59A 2K02A 2ED1A 4OF1A 2MA3A 1RTHA 1MWKA 4H0EA 1ZC6A 2A5WA 2FBHA 2VXFA 3ABUA 3FFKB 1GDTA 1NLVA 2HEQA 1C1AA 3DXKB 4OLAA 3I3LA 1RI9A 3IRXA 2VYTA 3H1CA 3HZJA 3GDQA 5GAOm 3KLOA 1YYVA 2F7TA 1Y1WJ 4FK2A 4II2A 4HLYA 3TSUA 3RNJA 1T8EA 1QQOA 4LE9A 2YG9A 2WV0A 3OIOA 1DQUA 3M6GA 4JI7K 1O57A 1NGFA 4D8DA 1SD7A 2IEKA 2ZF5O 3UR3C 4CD3A 4A3KJ 1ATRA 3GMEA 3FEOA 1CF7B 3OL3A 4YFNF 4DW6A 2X6SA 2W85A 3ZSXA 4B1XB 3BR1A 3KTUA 5F2RA 4JI8K 4EFHA 5E1XA 3OIPA 3KLGA 5DD4A 3VUZA 4WX9A 4YELA 2BGGA 3S14J 4KREA 2DPNA 3I56N 1VA7A 2EZHA 3K4JA 4ME7A 3IUOA 3SYZA 1SKWA 1B1BA 4C92A 2HW3A 2W57A 4Y15A 1VQMA 2Y1IA 3KTQA 4DQSA 5GAN7 5GJVB 3U1DA 1C6VX 4G9YA 1A31A 4YG2F 1T39A 2E1NA 3EL2A 3TTFA 1OH7A 5AR0A 2EFNA 2DT5A 2JRMA 4B1VA 1JCEA 1NJXA 2DQLA 2MWPA 4A4FA 4JYAK 4HNVA 3JREA 2M0MA 1QVFA 1Z3XA 3JCMf 1O13A 4C8QC 3RKQA 3TGNA 4QLCU 1C0MA 4F7UE 4CA0A 2E7WA 3NMZC 2CH4A 4YFXF 2H56A 3OL4A 2NRHA 3QOPA 2OTLQ 3SBTA 1V3FA 2GIZA 3TQ7P 1ZUYA 3R9PA 3GTMJ 1Q18A 2RE2A 1ZHIA 4JV5K 4BHBA 1WJFA 3M0UA 2F2WA 2WV1A 3DLAA 2P0QA 3MJXA 1XTDA 1IH7A 2EV0A 4ZN1A 1JXMA 4FHTA 4BRKA 2KMUA 1PU7A 3C2GA 1H641 2E41A 3DU5A 3DF8A 4LF9K 1VQ5I 4DV0K 2MABA 4XRSG 1UJYA 4KH0B 4V2FA 1OV3A 2FXUA 5D6FA 3MHXA 2WC9A 1I6HJ 1RAHB 4PWDA 3LLRA 3UNGC 4BRNA 5GAHJ 5LGNA 3C2HA 4EJTA 5D5XB 2WONA 5JR3A 3WNFA 3J7AF 3DLKA 3HHHA 1JRIA 3HGGA 3V1RA 2HOSA 3CC7Q 3FHGA 2CQKA 4W97A 5LRSA 3QJYA 1FMWA 3VS1A 1JKHA 2O4IA 2Y0SA 2HPMA 3N4PA 4B9MA 3TOAA 1M90R 1CXUA 2P0PA 4X6AJ 1MUDA 5HDNA 2MOXA 3ZETA 3F70A 3IUCA 3EAEA 4GLMA 4NXNK 4QTRA 1MHNA 4KN7X 3UT1A 2UU9K 4M7AB 3SNNA 2K3XA 1NJIC 2O8EA 4LD9K 1HK9A 4R8HA 3LPTA 2HMPA 3HI0A 3GTPJ 4LD6A 4B9SA 2NS8A 1FYMA 4U7DA 1Q1HA 3ZQCA 4HYEA 5HOOA 2XKOC 3CCMI 2RB6A 1FIPA 1LAVA 3QYFA 2QSGX 4JK9A 3PIOL 3WGHA 3A5NC 2XAGA 2JS2A 2KE9A 3I55T 2DFUA 5B1BH 2IPOB 1LKXA 1GFCA 4EIAA 4HDUA 1VQ5A 3SUOA 2L0KA 2ECBA 2YUNA 3VV0A 4XL9A 5LJ3e 3L2ZA 4K11A 3CPWP 2E34A 4HVUA 2DTOA 1OU8A 5I2SA 4NZGA 1YITT 1ATNA 4BVPA 1YIJQ 2LTPA 1RT1A 2LSOA 1PG5B 1E3OC 2EIMH 1QVGP 4LF8K 4U87A 2K9QA 4I98B 5AQRA 2NLUA 4HVWA 1OR7C 4GFBA 3HVTA 4O44A 5F0XA 2EJRA 1VQ4T 1YXQA 3BC8A 2KP6A 4YOVA 3E7LA 4UUSA 4D0PA 1X3WB 3JB9I 4V2GA 4FJMA 1WN7A 5GINA 3VQ5A 4EHTA 1ETVA 1HQEA 2AHQA 3DBLB 2XUBA 3WTWC 1ZXOA 1WXBA 3U9GA 2X4HA 1G6NA 1N78A 4J5YA 1B92A 4DR4K 1Y96A 8AT1B 4ESJA 3CCLT 3IH3A 4RMNA 1Z0XA 4JI6K 2P9KA 3OS2A 3AARA 1X3UA 4L6V5 2AKKA 4XH1A 1EA3A 3QPTA 4JKGB 2DERA 1FNNA 4M7DG 1VSFA 2BY1A 4JEPA 3F3XA 1RFQA 3JRGA 2F9WA 2VONA 4LFAK 3ZX0A 3BG3A 1ZAOA 3S32A 3GEZA 4C23A 3K2AA 2XO7A 3WTVC 2E5QA 1K8KB 2VKDA 4LDYA 1OCTC 1BCMA 1IN7A 3MKDA 3I54A 3BR6A 4N4HA 2WBMA 4DV1K 2PI0A 3ABTA 4H5WA 3AO3A 3CXCM 2V1QA 1LDKB 2LC2A 4F52A 2FZKB 3SFIA 4MZMA 1Q86R 4H4OA 2KKOA 2HHWA 2MD0A 3HHGA 3VS4A 3BPXA 2EPDA 1K8AR 3PSIA 4V19K 3U3GA 1NE8A 4XORA 2W25A 1M90O 3GTLJ 1WUAA 3G4ST 2R7VA 1IGNA 3ZCOA 1IB8A 4FL6A 3P7NA 2MCNA 2R7QA 4M77B 2YHWA 1XGNA 5D8KB 5EYRA 3FLGA 4L0YB 5LJ3g 5FPDA 1NPRA 2E10A 3ULRB 1R58A 1RDBA 5GAGJ 4L9TA 1IO6A 4DR7K 4DBRA 1TP4A 5CYVA 4EIKA 5HS8A 1MGQA 2HL5C 2NUPA 4DFPA 4DNCA 3COAC 1MPGA 3THXA 4HCKA 1ZSGA 5E3OA 1N3CA 2JTFA 4OPHA 1PYVA 3SXYA 3GBTA 4BRLA 2BXZA 1XPXA 1V1CA 2ZD1A 4UY8O 2QXFA 1WJRA 2XF7A 2JWKA 1K61A 4M7AD 2Q31A 3P9KA 2EFWA 3CC4T 3R6OA 2JA8J 4JAXA 5F0CA 1Z05A 2HDWA 3E19A 5IXBA 1KZHA 1GLFO 1BQMA 3NTIA 1IG8A 4B3AA 5I2MA 1V29B 3O9SA 4M9ZA 1MSEC 5J8CA 2KRNA 1TVRA 1FIAA 3EH1A 4ELTA 1RC9A 2RO0A 1HDPA 1OPLA 1AT1B 3ZSZA 2KZZA 4ILGB 3W2WA 3ZCMA 5DTDA 5C12A 3RRHA 1RTJA 1D8KA 2G6FX 2PNIA 4WQ4C 3I4NJ 1VHXA 4YNQA 3VYUB 5IHIA 1WLJA 4ATOA 2P7VB 5JFRA 2A61A 1FJGK 3N4QA 4FLWA 3CP2A 1BGXT 2OFIA 4XRSA 3DXMA 3FZHA 5BRDA 5GAHP 5ILVA 1D5VA 2KQWA 3I53A 3RERA 4XNFA 2F5CA 2E6ZA 4DGWB 4HZFA 2CU7A 2OA4A 1R49A 3KETA 2HZDA 3CD6T 3EFRA 3EZ5A 1ON1A 3MN6A 2XHCA 2LQ8A 1A35A 3TW6A 3L2VA 4ETSA 1Y0NA 4JD2B 3TAFA 2RQQA 4BI4A 2VPRA 4LOCA 2IA2A 1YRNA 1FTTA 4KHNA 4DU3A 2VJJA 5C24A 3DBRB 4LGWA 3TBIA 1LWEA 4HVJA 4A2AA 2OZMA 3GZNB 4F3TA 4QWQA 1YVUA 1F1ZA 1JO8A 1XMKA 2ZGYA 1KRPA 3EHQA 3JB9J 2EFOA 4KKOA 1WH7A 5F0FA 2X1CA 3ALYA 2GGRA 4Y33A 1EV7A 3OH9A 1UOCA 1K8AO 4XU1A 1QVFP 4C0FA 1RTDA 1OVYA 1Z9ZA 2LT4A 4F8RA 2EW3A 1Q7YO 1R0BG 4M75D 4OMQA 1VYTA 3OW2S 4FM0A 2W1OA 2CUFA 1L3LA 1GVJA 3A5LC 1JLEA 1N25A 1WRJA 3GNFB 2CUEA 2LK2A 4EA4A 2BANA 4DU4A 4G9ZA 3CMAN 1RDWX 2NRAC 3RR7A 4EMKC 1M90U 4RW4A 4JK7A 5M3MJ 4IUPA 4KV8A 3LFUA 4A4KA 1LB2A 3DB4A 4XM3A 3WTSC 1H8AC 5E8IA 4B3SK 2JTMA 3BDPA 4QOZB 4CZIA 1NK4A 3K59A 2DXIA 4FWOA 3FLCO 4E7ZA 3P9CA 1BI4A 2I7PA 4M77D 1VIFA 3AAFA 4Q5WA 4CZCA 3NDKA 3M1CA 4LH5A 4B23A 4BNCA 5AONA 1RI0A 4KGXB 1Z7UA 4FK4A 2NZTA 2HBJA 1AD5A 3DFGA 5DPKA 3M0RA 3M0PA 2L9SA 2YNFA 5IH2A 4FWRA 1VQPI 1X2QA 1A5WA 2W04A 5H1SQ 4XLAA 4O5FA 1F4KA 4WK8F 2CYYA 1REPC 5GAMd 4RAFA 3GP8A 4LLLA 1IRXA 3VS3A 3LALA 2DL7A 4BR2A 4DOWA 3HOXJ 3HKZA 4ID5A 1RRJA 1F36A 3KP4A 1X9JA 1N8RO 4MO5A 2HXIA 1UWBA 3CUQB 2I5JA 1S1VA 1W1WE 2KLOA 3C7NB 1S72I 1SL0A 1W36C 2DOAA 2ECCA 2VQEK 3CCEI 3SBGA 4X62K 3F2KA 3TSQA 2DY4A 2A6AA 5GAN6 1U5TC 3BOQA 4PFZA 2RDPA 2COMA 2JMAA 4IZ9A 5DDGA 1ORKA 4RTUA 3B02A 2HTJA 2HYFA 1U4BA 1YG2A 1R71A 3J81Z 1BM9A 1NGAA 4I7FA 4M7AF 4HBLA 3OA9A 2LMDA 5J2MA 3ZPLA 3K4LA 5AQSA 5CYMA 3F73A 1ZR2A 3FJ5A 1T03A 3NARA 1W7AA 3ZT3A 3GWZA 2V26A 3ZQFA 1HLUA 3GLLA 1FP2A 2GAUA 3HL8A 2NXNB 4MFDA 3EGXA 4O5VA 1ZTRA 4BDYA 1NK2P 4JQFA 1X43A 3IKTA 2FJ1A 3V1QA 4DQQA 2F5VA 1E4FT 3VSKA 4GV6A 2STWA 5KCOA 3AVGA 5KYYA 1VOMA 3PMIA 1RLPC 2VWBA 4M6XA 4AM3A 3NF8A 4C8QA 2AA4A 3CJRB 3O8MA 4BDZA 4FZZA 1XQSC 1FZPB 4K25A 1MNEA 2HGCA 3KPHA 3H3NO 1K8AU 4W1UA 1KD1R 2IVOA 3AVCA 2Y75A 2EFQA 1MJ9A 4UV9A 1CSKA 4DR1K 4K2EA 4FZYA 1NH3A 1VK0A 3ZSYA 5E8GA 4B47A 4E9FA 3DJCA 3CCEA 1F21A 3AA5X 4FWKA 1OYXA 5IOZA 4XKWA 4ESBA 3I59B 3MP8A 3HSBA 4B1RA 4XTUA 5ICCA 2RA2A 4AILC 3S8PA 3OYYA 3QWYA 1KG6A 1XTAA 1RAAB 3SZPA 3CC2T 2LKSA 1W7PB 3J81O 4DUYK 4BY1J 3HOYJ 2KHOA 5LRRA 1VQNI 5C4XJ 3HYIA 1ARKA 4M75F 3DQVC 3KLFA 1AWWA 5J4YA 4GXOA 1T6SA 2K2MA 2OTJN 4I0AA 2FHDA 1YJ9Q 1B3QA 4CK1A 1RR7A 1A36A 2X0LA 2E6NA 1RPWA 1GUUA 4YPHA 1QCFA 3A01B 1OCCH 4P1WA 2XASA 3JTHA 1HNXK 5KE2A 2ADUA 3WODF 1NEBA 1U04A 2X74A 1YITQ 4IFYA 4FVUA 2LC4A 3BQYA 4BE2A 1RI7A 3CCJT 5FLMJ 4YOWA 3QICA 4DTPA 4AG2C 2LQKA 1N8RU 4M77F 5CJ9A 2QQAA 1VQ4Q 2ZFWA 4A53A 1UHCA 3LYIA 4LD0A 1J2XA 1VQ8A 3SMPA 2ZPGB 3G1OA 1HW1A 2D6FA 3M8JA 4K41A 2YSQA 3DMJA 2PVDB 2KYMA 2YHAA 2ZJPF 3DPLC 4KH6A 4BRIA 1YHQA 2XKOA 9ATCB 4BEHA 3L8BA 1AZGB 3H1VX 3I0RA 4CBUA 1DKGD 2MWOA 3ZSOA 3CCLQ 2L7ZA 1B34A 4A6EA 3I58A 3PO2J 4V19S 2X48A 1Q82O 1PWTA 3LGFA 2Q1ZB 3GZ5A 2WB1A 2KRMA 3I56I 5CVUA 4LSNA 4FX4A 1M9SA 1RILA 3J80E 3H5AA 3LL7A 3UKGA 4ZZLA 1HSJA 4GW6A 3L3VA 1JTYA 1VQNA 4Q47A 3ZX2A 4CEAA 1SAUA 5K5OA 4JX6A 2KW4A 1TNTA 1KFZA 3BZ6A 1J0RA 3JSOA 1K76A 3CCUI 4D5FA 1A6IA 4O0JA 3BTJA 1OR7A 1OX8A 1YW7A 1BR2A 3LP0A 3K1NA 3O8HA 2HZTA 3WXLA 4I6ZA 3C6HA 3FMRA 2P5GA 4QS8A 3RTVA 4OPKA 2GTDA 3K10A 3LX7A 1HJOA 4BRQA 2LP5A 4AWXB 4Y92A 2ZQBA 3OQ5A 1OOTA 2O9VA 3RPUA 1WXTA 2H6CA 5A2QZ 4HQMA 2XIDA 2BBYA 2DJZA 1YFHA 3WNEA 1G59A 4YHHK 2ZGZA 1WLPB 4HX7A 3JAMK 3VU3C 2QEXQ 3AG1H 1K6YA 3AVNA 3KEYA 3H6EA 2R7XA 2A08A 3L9FA 2ZJQF 5GIPA 4I7HA 1JCFA 3DU6A 4FLVA 3E97A 5SWMA 5CCAA 2XDPA 4CFDA 3MDQA 3CCSN 1GOBA 4JK8A 2RD1A 5GPAA 1PCXA 2CW8A 4LC9B 1QWFA 1BOTO 1FYNA 5JLFA 1JLQA 4IRIA 3VS6A 4PCQA 4UQGA 3AFHA 3ZN1A 3UA7A 4J9HA 3MWTA 2XY6A 3WUHA 3DI6A 2VG7A 3SQ0A 4AHVA 3CUOA 2ROLA 3I56A 2VCPA 4H5TA 4J7FA 1OULA 1LPLA 1KO9A 4XSXF 2HDCA 5JHUA 1X3MA 1I27A 2JMWA 3GTKJ 5L3FA 4M9XA 1UFMA 1KONA 4IO8A 1ETWA 1Q81R 2ZCWA 5FW9A 1KVCA 2Y9ZA 5FKOA 3CCUA 3OS5A 3K9KA 5AQZA 3A1YA 4RAGA 4B9QA 4AFZC 2O61A 3BY5A 5B5EC 4E9GA 2A3LA 1FWZA 3LSMA 3U6FA 3E01A 1DP7P 2E1CA 3T7ZA 4Z89A 1B72A 1C0GA 1EH8A 4F9OA 4ZGJB 1GLEG 4FASD 4CCOA 2EJFA 3WU2C 3PVQA 5AQMA 4DR3K 4OAYA 3HOTA 5CVVA 2K2VA 2R5MA 1XMQK 4PJOA 2ZE2A 2P84A 1TAUA 4KDPA 3AVKA 5A2QO 1OPCA 5GMKl 4XH5A 4F14A 3H0GJ 2Q97A 3CD6Q 4CEEA 1QSSA 3S6WA 3DV8A 2YNIA 1O3SA 1ZBUA 3VGKA 2PVOB 1VSIA 3KX2A 3R1XA 2TRTA 4C8LA 4J2EA 2HQ5A 3CMEN 2CREA 1VNDA 2BH1A 4CESA 2DXCA 4E7LA 3K5OA 3OSSC 5C15A 1Q81C 2R3SA 1UTIA 2M16A 4J8FA 5HP1A 3S41A 1R1VA 2BY2A 2R7FA 2GV9A 2DJNA 2V7YA 3CTAA 3CPWM 4MTDA 4CCMA 4A5MA 4WQ4A 1N5ZA 4MZTA 1RETA 5LJ3h 4O6JA 3N97A 1B8IA 4B9VA 4IZZA 4HUGA 4ZZDA 4ELYC 1U06A 4HT8A 4DQRA 1S7OA 4JKFA 1QVGM 3QO3A 1XS9A 4LIUA 2QWLA 1U8RA 4L9JA 3SEQA 3M9AA 2ETHA 5CKFA 3HPHA 4OOIA 1X9WA 1GXPA 5IYDJ 3DLLA 2PBIA 1KD1U 3DM2A 4Y7NJ 1VQKT 1DGRM 1GLAG 5LJ5d 1KQJA 2P6SA 2QKBA 4AYBA 1VQLQ 4M7AC 1YJWT 3GCMA 4QVZA 2LF7A 2JPBA 3S1MJ 3O8GA 1LCUA 4JZ3A 3VKIA 4JN4A 2XPWA 3OYEA 4OGEA 1QS4A 3KK2A 4JRKA 4RW7A 1VRLA 4NYFA 4M7DE 1I1GA 2G7UA 3K1PA 4M42A 1Y1VJ 3RR8A 4RCHA 1PU8A 1UG1A 3M0QA 3CQZJ 1Z1DA 3R6SA 3QYGB 4B9WA 5AYFA 1VSJA 1RBVA 3HP9A 4AIKA 4FLZA 1P4AA 2J7IA 4F4KA 2FB7A 3E9FA 3E1YA 2E7XA 1C0FA 4F7ZA 3IS9A 2LRDA 4CHOA 3L4IA 3HOWJ 2A3ZA 4H5VA 4TVRA 1R7JA 2IRFG 1UG0A 4M45A 3CJ1A 5D5UB 3PO5A 2K9SA 1N9SA 4RTVA 1J7KA 3UA6A 5TGTA 2CSIA 3NWSA 2JUGA 3OV8A 1W97L 4EMKA 1JBMA 1W0TA 1WBBA 2DILA 2XRNA 4OU0A 3G10A 3CCQN 1U2WA 4Y0WA 4DV6K 2ATQA 5KPTA 1VUBA 1U45A 1JU5C 3AVMA 4DFJA 3ENHA 4H0VB 1VQ6N 2HVSA 2KR3A 2M34A 3IWZA 1Q8IA 4BI8B 4CIGA 2RQWA 4C8QE 4KBOA 4Y1CA 4BGAA 4XLFA 3L2WA 4IXCA 1N34K 5AQLA 5BR8K 1BJAA 2O8CB 2XB5A 2UYTA 2NVXJ 2W4SA 1OJLA 4YTLA 2OV7A 1VQ7T 1ZARA 2X6WA 3KZIC 2Z1IA 1S6LA 3JCMJ 1MUNA 3GPLA 2BVMA 2VQFK 2FYKA 1YS7A 2DEUA 1DT9A 2WBNA 1RKTA 4L5EA 5E1WA 3CC4N 2P4RA 3C4SA 2PUKB 3E9GA 3RR6A 3M7GA 3MECA 4AHSA 3SZTA 1OCOH 4BUPA 1ENHA 4FISA 4J9FA 2NAZA 2FSWA 2PQ8A 2ISZA 4IHYA 3OYCA 3D2EB 3L4QA 5AQKA 2KLAA 2CS7A 1U2VB 3CQXA 3O3FA 2LREA 5IT9Z 5AQPA 4FX0A 3QODA 2CT3A 3M8RA 1LVAA 4QAGA 5CY4A 4PA1A 2LVMA 1ETKA 1DTQA 3KWIA 5BN9A 4EMGA 1U5TA 1WJDA 2G8FA 2IA0A 4B3TK 1F43A 5FO5A 4FJ7A 1SMTA 3SZGA 3ZMZA 4DK9A 4M77C 1BBZA 4DOZA 3EH2A 4IOXA 2P0KA 5DCMA 4FPAA 1ZBXA 1IXDA 1U47A 2G0EA 2YHBA 1PSFA 2ENMA 3HPGA 2B0LA 2NNNA 2PLYA 4RTTA 3NEUA 4DBFA 4QQ6A 2VI6A 2DJQA 4E70A 1M1KC 4LNPA 2O8BB 2FBYA 4FLXA 2FF6A 4AMCA 1R22A 1FXXA 5AQGA 1T08B 3RMCA 1JLGA 4CEOA 4WCIA 1EFNA 4BBRJ 3U23A 2MSYA 1NJIO 1S22A 3L2UA 1MKMA 4OVAA 2H1LA 1HU0A 1UCRA 3BG6A 1FSHA 1YJNQ 1K78A 4AHCA 2VWFA 3HXLA 3WTYC 1NLPC 3QERA 1QZ6A 4BAYA 1NEGA 1IBMK 4IO9F 2DBMA 3FZFA 5KPRA 2GQIA 2P9IB 2EV5A 1QVFM 1FJLA 3BT9A 4KBMB 2OZSA 2LVSA 2G3RA 1GBQA 4U67L 4EPCA 3SB2A 4YDUC 3ABLH 4NO7A 1HBXG 4A93J 2DIQA 3QZ5B 1T44A 3NGPA 3CCJQ 1IG7A 2H3GX 1D09B 3CMAI 3SHWA 4FJ8A 1BWFO 3KP3A 2K4BA 2CRGA 2YS9A 4JHDB 2EKHA 3P1GA 4X9DA 2XRLA 1XDSA 1HRHA 2BV6A 4I0BA 2X3WD 4M9SA 4VUBA 4R0KA 4C3HJ 4A0XA 1XX5A 2DYRH 4JKCA 4M7YA 3VEWA 3RSEA 3QUIA 1E6HA 2AP1A 3L3UA 2VOPA 3RKWA 2ID3A 3SDBA 1ASWA 3FIWA 4ASNA 3T3FA 1X58A 5D6YA 4OX9K 5HS7A 2DQRA 2DPUA 2EQMA 3HP6A 5J47A 2XHKA 4PKIA 3RIRA 3ISPA 2A5YB 1TL8A 1B4AA 3FXLA 4MQVA 2FEIA 2L9NA 3AVBA 3SAGA 4C8MA 1YIJA 3IH2A 3FZVA 2QWWA 2NOGA 2LR8A 2QGUA 1WIEA 2LMJA 1RT2A 3NBPA 1RRQA 3QMLA 1HA8A 2LFBA 1YE9A 2K86A 2EIKH 3JCMe 1RNHA 3P31A 1X69A 1WSFA 3QEXA 3HJEA 3LDNA 4HCCA 3A8OB 1MNDA 2Q8KA 2X35A 1ZK8A 3AO2A 1MDMB 2DOEA 4QSHA 4CEDA 2KT8A 4D9JA 2D1KA 4YFUA 3O9QA 4XAXB 4RB3C 1B07A 1Y97A 3CPFA 5KE3A 2WAQA 4A54A 3CMAA 3NTKA 4HHTA 3TSPA 1I1SA 5F6FA 2CO5A 2D0BA 1BW6A 4ZGEB 4IUUA 2Z1GA 4M6YA 2IVWA 3MFKA 2OAZA 1X6GA 2HQEA 3NFCA 4AIJA 2EQKA 1SHGA 2YUPA 4DHYA 1HPZA 3WEEB 3X26B 2A40A 2LSNA 2F5FA 2AT1B 1KQ2A 2LOOA 1T33A 4HX8A 3I35A 2JPSA 5HLFA 3IG1A 3F5TA 2X1EA 2F5DA 2H3JA 2R7SA 3DXKA 4FT8A 2VN2A 1LDDA 4IF4A 1WJ5A 1LUJB 3D6RA 2JK3A 4JKBA 4XMYA 3M4YA 3CUQC 1SSFA 1VIEA 4WXHA 1Y71A 2QQ8A 1UGQB 2YUSA 1XB4A 2IC3A 2P1JA 1IJWC 3D5LA 3FZKA 4IIMA 4BRMA 1OEBA 1JUSA 1MUZA 2IPQX 5EGOA 3GNGA 3D2FA 5BPNA 2K4YA 3IV5A 5LHIA 3RYPA 2A07F 2QA4N 4XTZA 4Q5VA 2JVVA 2OI3A 3CC2N 4BR5A 3I71A 3PFSA 2RMOA 2LNBA 1NOZA 1XWLA 5GAMh 4E6KG 1QCOA 3I9QA 3E9PA 2KRSA 3JCMg 4GBQA 1H1VA 4IUTA 2NOLA 1MSFC 2VBYA 3P8BB 5ED4A 4KRFA 5LEJA 1IGUA 1VQOT 1M3HA 1RBSA 3NRVA 2KDZA 2JG6A 3HUGA 2E20A 3MCPA 5C0MA 2OTJI 4BUGA 1IG9A 2LCLA 3ZOBA 3HG9A 4AC0A 3BZKA 2BY3A 2J5OA 2R57A 2WOMA 2LT1A 2EH3A 2E2HJ 2L7FP 4KUMA 6AT1B 3J8AA 1AU7A 5JVHL 4HV5A 3LWFA 4E7JA 5JLXA 1ORPA 3KKSA 3MAQA 4PLIA 1M8VA 1KC8C 3DLRA 5C10A 1RBTA 2PJPA 3I5RA 3IAM2 3BFMA 5HRPA 3KE2A 4KJZA 5F1JA 2JS0A 3EE8A 2QM1A 3TARA 3BROA 1G4DA 3ID8A 1L3UA 2R5YB 3ITHA 2EINH 1VQKQ 3VGLA 4B43A 2X78A 1ZBIA 5HL7L 5EZGA 1WPYA 3H0DA 3VEYA 3U4LA 5DM7R 2HAXA 1WA7A 4CUGA 2YI1A 3OBWA 4C9YA 5D8LB 1TUYA 4HSTA 2BVLA 2F4MB 3GF5A 1W1FA 1QQNA 2LJ1A 2HPIA 5MLCQ 3FIFA 4CH7A 4AHRA 1D5YA 4CECA 3J7AP 1SL2A 3RQIA 2RHIA 2I7NA 2DT6A 3OR1C 2EIJH 4M7DB 4MEYF 4FTHA 1QNTA 4EHUA 2XC7A 2B86A 5HS9A 4A3FJ 2L5QA 2YHTA 5CHIA 1K83J 3MKYB 3KBGA 5KGXA 2EBPA 3L2QA 2WTEA 1MJAA 3M57A 2YKNA 4ELUA 4MLOA 1LWCA 3RPQA 1XC5A 1ORNA 1VQMN 5LJ3j 1SKSA 1BO5O 5JVGF 3VRZA 3NH2A 1NU0A 2O0YA 5B1AH 3F0ZA 5HK0A 4KH5A 2P9NB 2UWMA 3B6AA 5C4JJ 4OMYA 4HSRA 3M5RA 1IN5A 3CCVQ 2VKHA 4M7AA 1QZ5A 5A0LA 2GFAA 4N0BA 3J7AO 2P9SB 4B8CA 2A37A 5H6QA 4BXUA 5AFUH 1GLJO 1SFEA 1Y8QB 2E70A 1ZLJA 1ZKGA 2X6NA 3VWBA 2DM1A 3UATA 3HKSA 4E4HA 4CHPA 2DMNA 3CCSI 4FJXA 2V8KA 1VSMA 2K85A 4RB2C 5IOYA 1VQ7Q 3G6ET 1R1UA 2V7FA 2GQVA 2R58A 2E12A 4N4OB 5IT3A 3KJVA 3FXRA 1UDLA 2HSPA 4ILHA 5CAIA 4YOQA 4B24A 2YCHA 4LF6K 3ZGKA 3S3OA 3KLHA 3U9ZA 2OAWA 1PRLC 4M3BA 2YNGA 1TWGJ 4CZZA 1WAFA 2Z1HA 4C1NK 1J59A 3Q0UA 3V9UA 3CMEQ 1RCHA 1NM1A 4PUOA 1K73R 2CFOA 4IQJA 3BG5A 1AEYA 1LEBA 3JCMW 3IHUA 4JI1K 4CJWA 4ZN3A 1F5TA 5EG0B 1YI2T 2BE7D 2NOBA 2ABLA 1SUQA 4FWNA 3IAYA 1L5UA 5ICEA 2CSOA 3WU1B 1ZA2B 2HKNA 2QYOA 3META 3O9RA 4HWIA 2DL5A 1K4TA 1SKUB 2HHQA 1Z67A 5EDNA 2Y0SN 3EYIA 2DA1A 3ZMDA 2ITGA 4BQLA 3CW7A 2D45A 1IN4A 4JKGA 3LQQA 3G71T 1S3JA 3THWB 3PVLA 2XGCA 3R6MA 3NF9A 3RRGA 2I5UA 4BJ6C 1T3VA 4DJAA 4M75A 1EX4A 2O4XB 2C0TA 1K8KA 3CCRT 3PQJA 2ZJRL 3A98A 1SVMA 2OPPA 3IDHA 5E84A 3JSMA 4BRGA 3OIQA 3I55I 1R77A 4Z6YA 4LITA 2EA4A 3H3ZA 3X20B 5EG2A 3R3LA 3O6WA 4MEXF 4H5RA 2KT0A 4I99C 4YY3K 3P9IA 1Y56A 3QNOA 2FF4A 1LCKA 1HNWK 1HYSA 4CGIA 3AKZA 5DM7L 1PKTA 3LMMA 5BPMA 1WI9A 1X4PA 2QSHX 4FJNA 1OCPA 1VQ5N 2V1XA 2ZFUA 2EBIA 4CYCA 4M77A 3BR0A 2NVUB 4M7DD 5K7ZA 2HR3A 4E47A 3R60A 5CK9A 4UV8A 4OFEA 1RTIA 3HSTB 3MO8A 1U84A 3EE9A 1FYKA 4FJHA 2B63J 3GOIA 4BQNA 3H9JA 2K7AA 2OYQA 2CT4A 1YQLA 4JOMA 1DGWY 3KEOA 3FBIB 5GMKi 2ABKA 1MIJA 2B7EA 3LSHA 1HD3A 4XLEA 2L02A 4D5CA 1C1BA 4A4HA 1O3TA 1B9FA 3O9TA 1GRIA 2YJEA 3PX4A 2XICA 3GL1A 4CJEA 3E0JB 3BDLA 1WFWA 4B1UB 1JXSA 2QWRA 4ICLA 2GF7A 1X1PA 1T7PA 4CEZA 4Z4HA 2EWSA 4B21A 4DOVA 2LDUA 5K5QA 4OMPA 3UKUB 3VQBA 3EFOB 2VE9A 5AQHA 4BVOA 1S3XA 1JI8A 5KQ8A 2E5NA 1TQPA 1UA1A 4J9IA 2E1ZA 2QW9A 1S9EA 2GCXA 3SHFA 3I55A 2NNWA 3O3GA 1QGPA 5J6XA 1MMDA 1VQ9Q 1ZRFA 1IZ6A 4XR6A 2KDSA 2G9WA 3SZ2A 1QZYA 3V81A 2DA2A 4XICA 1K73O 4YDUA 2ZGWA 1NK0A 5JMVA 1J5EK 3AL0B 3HIFA 3J81K 3G4SI 4ZDPA 1YITA 1GCQC 5L3GA 1TSFA 2CP0A 2R5ZB 4J2DA 3IQLA 2GLOA 2HKQB 1WJEA 3A8HB 2O8FB 2K6DA 2ZXHA 1FOXA 4BR0A 1A04A 3WHBA 1ZG3A 2DETA 3FZMA 3CPEA 3MVPA 1WDXA 2K5CA 5EZHA 1VQ4A 3AVHA 2KNBB 1VQ6I 1YWOA 3UKRA 5E3MA 2UXBK 2EGCA 4FU6A 5GAN2 1TW2A 2DEQA 4M3EA 2YXYA 4JD2A 1B9DA 1SVLA 1O3QA 1ZYRF 2QQBA 1VTNC 4PZJA 3T19A 4IRGA 2QASA 1HC8A 1MBGA 1ITGA 4XLPF 3TREA 2D8JA 3MMYB 4YORA 3QYEA 2P9UB 2O7OA 3CC4I 1LE8A 2VB6A 3F10A 1GBRA 3PIPF 4WCEL 4B9NA 1NBWA 5HBMA 4C5GA 3MD2A 1NHAA 3VQ7A 1TWFJ 4N4GA 2HDAA 3A0HC 5FROA 2FG0A 4KHWA 4DKWA 5AIQA 3S1NJ 1MBEA 1ZBHA 3KD1E 2E6LA 1YFNA 3OMCA 2VE8A 2TCTA 4II3A 5LJ5h 4IHTA 1N33K 3VOVA 4FSXA 3ROUA 3FXMA 2VG6A 2G8UA 2PZ1A 2DOFA 2CGLA 4NQWB 1ABOA 1RAFB 1D1CA 3G4SA 1E6GA 3M8EA 5GADJ 1HKTA 4JKEA 4PHTX 1TH7A 4C0DB 1TL3A 2ESWA 4JK1X 2QKLB 4Z8AA 3R8EA 3N05A 3F21A 1RR8C 3V4IA 2Y90A 4ISGA 2GQQA 3CO6C 2HSTA 1S1WA 3TAPA 4W5OA 3THVA 3HTUA 5TJJA 5LLQA 1T0HA 3RDVA 3TAGA 2OTLT 1LWYA 1W4SA 3Q0VA 1U9NA 3OYLA 4Z4EA 2VC0A 2LNVA 4HLXA 5GMKh 4KTQA 4I76A 1YUWA 3C6AA 1EXQA 4NUBA 4M7DF 5H20A 3JRHA 4EGYA 4D7MA 4AVZA 1D5AA 5DYMA 3T1AA 1RLQC 1OYIA 4AM7A 3CC4A 2CG4A 3MK6A 1FLIA 4KGZB 4GGGA 2CP5A 4ENMA 1BU1A 4JZ4A 3CUQA 1UELB 3HO1A 1RT7A 3H46O 5M1QA 2LQWA 4BQAA 2Z9OA 2A0FB 4IHSA 4M41A 5LD2C 3OYKA 1D3YA 3FBNB 1TTHB 3RMDA 2IBDA 2HSEB 3LSGA 4M78G 5GMKm 2BYVE 2FBVA 2F8TA 5GAOp 3ERMA 5CYQA 2Q0UA 1K73U 5C0YA 1MBFA 4E9HA 2D8HA 2V8JA 2H27A 3CCMT 4A3JJ 4MGRA 1GT0C 1BJZA 5GANd 4XKVA 1UHWA 2HQNA 2RN8A 2QQSA 3CC7T 1AKHA 5J1YA 4NC6A 1HF0A 2XHIA 3SD4A 2HTSA 3NF6A 3ESWB 3OH6A 3EHRA 2DVJA 4XN3A 3SPYA 1G99A 1IN6A 3PIOF 1NLOC 1KSPA 3IMXA 1IV6A 4E1MA 4C8KA 3RZOJ 3M58A 2PX9A 2MF2A 3HM9A 4XTYA 5KN8A 1S1UA 5AQWA 2DMQA 4M7AE 1W0UA 1YCYA 4EZ9A 4CF0A 2P7CB 1EH6A 5GAMj 2DTRA 3ZEHA 1X6OA 4DEXA 2H6BA 4XTWA 2B5JA 4IJAA 4PJMA 3FF5A 3TVTA 2E2PA 3X25B 1FKOA 3RSNA 2NLXA 2ZSHB 5M1FA 3AV9A 4BY9C 2AJQA 1S1NA 3I8DA 1OCZH 1AWOA 4K0KK 1HKSA 4FJIA 1WOQA 4NBQA 3CVTA 4JKAA 3VF2A 3BR3A 4CZJA 3MP1A 3MEAA 1RDAA 4XU0A 2ETJA 1QQMA 1SFXA 3PV8A 4R5PA 3GLXA 3LM2A 2RPIA 4PSXA 3S2WA 1UA0A 3HHTB 4BE0A 3I59A 5F1RA 1WHJA 3LDQA 2BKDN 4IEJA 1BKBA 3THYB 3JRIA 4EV0A 1KFDA 2PVGB 1NK8A 2BIVA 1J09A 3DOLA 4WXCA 2PJRB 4OFAA 5BOXA 4RGUA 3JCMX 3S3MA 4U0YA 1SFKA 4FYYB 1JJ2S 4BY7J 2HCKA 1DLOA 5JHFA 3W6JB 4CF8A 4A2BA 2DA7A 3HTRA 1U0JA 1OH8A 2OX7A 3ZSVA 5GP9A 1WEFA 5ILUA 1NGIA 3H45C 5J1RA 3A01A 2XG8D 4KUIA 1O1WA 2Z16A 1KG7A 3E3VA 2BW3B 3CQYA 1U3EM 2YWWA 2Z2SB 1IDYA 1ZGAA 1S7AA 4DLEA 2CDTA 1NK6A 1ATSA 4UUSB 2P81A 4Q4ZF 2Y48A 3VQ9A 1UECA 2ZAEA 4M3RA 5D7UA 2YG8A 3TW7A 2OPQA 4N41A 5D3GA 2ZXWH 3LSTA 2EYXA 3QEPA 3WG9A 2ZMEB 2LRQA 4A2UA 3S17J 2AQEA 1D0ZA 3QQAA 2JOYA 3O3KA 1JHFA 2W6KA 2P9KB 4OWRB 3JCMb 1YI2Q 2HF3A 1WHMA 5E17F 2FNAA 1Z21A 2HWVA 3QG1A 1XNIA 1ZGWA 3KXTA 2J6KA 3FDRA 3PX0A 2HVQA 4RLQA 5IP6A 4M77E 2QA4I 3VQPA 2MK5A 3SFMA 5DUIA 4GKJK 1CGPA 2GWRA 4J01A 4HF2A 4JJCA 3DTEA 1XSDA 3NGZA 3CC2I 3TL4X 4H03B 1YT3A 4PL8A 1VQON 5IN1A 3GUDA 1EH7A 1QKXA 3H3OB 2VJ5A 4I01A 3AVFA 3FRNA 3LGLA 5GADP 3V9ZA 3HC7A 1M1KO 2DF6A 2FSKA 4Z0UA 4OIQF 4KICA 3QU6A 3C1DA 2F69A 2M2EA 3BEXA 2CGKA 2OPSA 4DQPA 3EUAA 3EGUA 1C0WA 2R7DA 4TV7A 1S9GA 3GOXA 1YQMA 1N36K 5HKCA 3DLMA 4MMLA 2D0OA 2FXAA 1ZGJA 2YX6A 4CJTA 4N0AC 3IP4B 2HBWA 4EVIA 1ZYQA 2DYIA 1XMOK 5EC7A 1DIZA 4ISEA 3FXJA 2L3SA 1J5YA 1XQOA 3WTTC 3OOPA 5C3EJ 2JQ7A 3L0QA 4IUVA 2NUTB 4FYXB 3REBB 2A42A 5FDLA 2NUPB 4CZHA 4HG2A 2X3XD 4MDAA 4DS5A 3IFRA 5FU6B 1SL1A 1QO0D 4ZYDA 3F9KA 2RKIA 3DEWA 3OR2C 2HKXA 4EM0B 3SDZA 4E6RA 3VQ6A 2DCEA 1WJBA 3JRDA 5M1KA 3FMQA 3KYCB 4DF8A 3O3HA 1IUYA 3D5SC 2D0NA 3H3UA 5EJCA 1OZ3A 2XAHA 3LZJA 4OKKA 4RW8A 1VQ8N 5J26A 1ZLKA 4W5QA 3CDLA 1P7JA 2F2EA 3ZLJA 1YHQN 3CC2A 1U6GA 2Q36A 5KK1A 2ZM6K 4W5RA 2MBFA 4OGCA 3OJUA 2EIFA 3IC7A 2NRTA 4RW9A 3TO7A 2G8VA 1W36D 1W2BA 4RA2A 2GA1A 2HNHA 1X2NA 1BA0A 5KH6A 2WB1N 1PC0A 2DZ9A 1ZBSA 3VGMA 4CZEA 3DB3A 3O5BA 3G7ZA 5FKKA 3E2UA 1G3WA 3JSPA 4KB1A 2IJLA 1EWRA 3G0QA 2Y4XA 3SWNB 4DTUA 2JVGA 1VQMI 2EAYA 4BDPA 3CBMA 2K5LA 3JRFA 1QWEA 3ZXSA 4A5NA 4DR6K 1M2VB 2E35A 4ENKA 2MMPA 2BDPA 1KQ1A 2XPUA 3CCJA 2FD5A 4X64K 3GIBA 3MEVA 2F96A 1OI1A 2D9TA 4NS5A 3ECOA 1ZH5A 2R92J 4EGZA 3OJSA 1P90A 1VQPT 4ELVA 2X4XA 1BC8C 5C2DA 2FQ4A 2RK1A 3P8DA 3OYIA 3H08A 1WNSA 1AOJA 3LSIA 4XK4A 2RI3A 2VC8A 3TPQA 5IT9K 2UXXA 1XG1A 5I22A 4PQUA 3ZRGA 2ZCFB 5JLHA 2AZSA 4XRFA 2JSCA 4RAZA 2QWMA 2VIXA 3TANA 1J5OA 1S72T 1TG0A 5CVIA 4NC7A 4FPBA 3ZBDA 4M7DC 3SCXA 4LLGF 1K79A 3MEEA 1FOWA 1KLMA 2YX4A 1Y6IA 3LCNA 1TKDA 1REVA 2DMOA 2Z0WA 3QXEB 5M3FJ 2IDOA 4H4MA 2KAFA 2YX7A 3MWMA 3N5NX 5A0DA 1GCQA 3P5JA 1P59A 4LUEA 4MFEA 1VSHA 3K4KA 1MMGA 1TWAJ 3T1BA 4OMOA 2E6MA 4NXMK 3UE5A 2QGFB 3AA2A 2JZYA 3ULQB 2VXDA 2P9LB 3HOSA 1MMNA 1Y57A 2C0IA 3F8FA 3MWPA 1WJCA 3GFLA 1FMVA 3ZL7C 2X1DA 4IFEA 3CQ8A 1BI4B 4CJSA 4CJ3A 3VUBA 3TABA 4DR2K 2HMIA 4PL6A 4OIRF 3CCUN 2E8AA 3JTGA 2DT7B 2Y9YA 2V75A 1VQ5Q 1ACIA 3G71N 2XDDA 2DFIA 1ZUUA 3PIPL 3S15J 4DQ8A 5C25A 3MXMA 2W00A 2JRTA 4BI3A 4J9EA 2D0QB 3CCRN 1T6DA 1WQ7A 1WJSA 5HRNA 3CESA 2KJBA 4YIFA 5LJ3d 2JVHA 1LQ1A 3F8CA 1A5VA 2W40A 4F91B 3CYMA 1GV5A 3VYGA 3OA6A 2W82A 1MH3A 3LWHA 2JLEA 3HRGA 4CGGA 1KG4A 4Y3OA 1I81A 2R7UA 2K40A 2OCEA 2XSJC 4GY2B 1CKBA 4QIWN 4PIIA 4F2RA 1KU3A 4K42A 4OJRA 3VPZA 4RWTA 5CVRA 2LDMA 3R0JA 4PJ0C 5K14A 3QESA 3E5XA 4KA4A 4CERA 1E17A 4PLLA 1X27A 1OMIA 1P2FA 2ED0A 1G15A 1VZ0A 1HKGA 3JW4A 5LJ5j 1WH5A 2SEMA 5CQYA 2ZC2A 1HNIA 5GAN3 2WSFE 3HRTA 2XDBA 1J9AA 4F2SA 3QPLA 1WFXA 1GLDG 2V52B 1WAJA 1WI3A 2XKPA 4B48A 2VPLA 4IVNA 2H09A 2BOLA 1YJWI 2D5RA 4B1WB 1JE8A 3CCMQ 3P4IA 1ABQA 1V4SA 1OH5A 3EGXB 5KYXA 3K2ZA 1HNVA 2AS5F 1D8JA 5DLOA 4OKEA 1KC8O 4GCVA 4YFKF 4MDWA 3I8BA 3FXQA 2D1VA 3JSCA 2KT1A 2ZNYA 1RNLA 2AXTC 1LFUP 4HCBA 4ZGDB 4BR9A 4AYBN 2O4GA 4LN2A 2ID6A 1SKRA 4QT7A 4EJOA 4CJ4A 1U2VA 2AO9A 4FLYA 1KQSS 5L3BA 4CC3A 5AFUA 4ENJA 4JKDA 2Q2EB 2CSQA 5TKYA 3ZQGA 1ZSZB 3NNQA 5GMKj 3LAPA 2L2OA 4O8KA 2UV1A 1O7LA 3M9QA 1D3BB 4RB0A 3CWUA 1TL1A 2YRDA 1I4K1 1T95A 3QYBA 3K5NA 2A6EF 3V42A 3LA3A 3M8SA 1YJ9T 3BUZB 2JXBA 3CJQB 4ORZA 2DRMA 4YOXA 2DFFA 4B3OA 3LA2A 3VYSB 3HEFA 1P92A 4IPAA 2M0YA 4N4IA 4CFAA 3X28B 1YW8A 4EJUA 3K4MA 3I56T 1Y0UA 2O8BA 1YIOA 1M90C 3DTIA 3VF4A 1J53A 3K69A 4KFBA 1GXIE 3CFPA 1VQKA 1QQJA 2IAJA 5KYUB 2EZIA 2JUFA 3H5NA 4G12A 3UF4A 1YJWA 2EYZA 4BRPA 1KK7A 4A5AA 4HKEA 3EN9A 5BRHA 4DG1A 4M74A 1NGNA 2VT3A 2LY9A 2WACA 3CWAA 3N4MA 4YPRA 2VC1A 3OB9A 4IUQA 3DWLA 4FWPA 4ZYAA 4FL9A 1WHGA 1HR0K 2EHGA 2XGXA 1USTA 3MX5A 2HOAA 2M0OA 3CJTB 1RDUA 4G94A 4F7UG 1JKQC 2L3QA 2P9IA 2UXDK 1K9MR 5HLTA 4DBQA 4I09A 3CF2A 2D2WA 4IKFA 1SD6A 2R7RA 3BQZA 4FLTA 2Z3YA 2AHJB 4BRCA 4CJRA 5HLIA 2BZTA 4B8XA 3AL0C 2ZPBB 4NDLA 2DTHA 3JCUC 1KU2A 4J9DA 4J2BA 4HOBA 4JHDA 4RM2A 2K3BA 1PVEA 1ULYA 4OB3B 2FO0A 3AO4A 2UUBK 4BGDA 3WGIA 5K7HA 2O9LA 2MC4A 4BEHB 1LMZA 2Q3SA 1QP2A 4EEFG 4FT4A 1TKTA 2LKXA 4XONA 1MV3A 3RMQA 2BHYA 2I2LA 1EIFA 1TGOA 3KCCA 3QRFF 3PGGA 3K1MA 1GHCA 5I11A 2KKZA 4LD5A 1J54A 1Q7YR 2B8AA 2OTLN 3LAMA 3MCAB 3KVGA 1IHWA 4S04A 4IEEA 2LLKA 1EO1A 1FBQA 4LK1F 2C6YA 1NK5A 4NNJA 1PNJA 2G8IA 2QEXT 4ISFA 2VVKA 4GY5A 3PNWC 1W2BP 2V79A 1R0AA 4P55A 4F3OA 2QK0A 3WXMB 2F2XA 1IXCA 2RC4A 1T3SA 1RBUA 2ZZDA 1WEIA 1JXOA 1RGIA 3LL3A 3Q9VA 2YUQA 1UJ8A 1LJ9A 5GAMf 1ZRCA 4L18B 4PKCC 4HF0A 2LYCA 3AG3H 4A5BA 2KZVA 3FE1A 4GLKA 1FP1D 4M78E 3MZHA 2O3FA 4E9EA 1Q86C 1Z9CA 1I39A 1MDMA 3V8JA 1BW5A 1JLCA 3ZR8X 3KNTA 3AVIA 1V76A 1X9SA 2RQTA 1K8AC 4AHUA 3CC7N 2HHTA 1YF5L 5JS2A 3EPZA 4C0DC 3CLQA 3HM5A 5BREA 5KVRA 2J4RA 3OY9A 1DPUA 2NVYJ 3FXKA 4M4ZA 4N9IA 4OMMA 4F92B 3WTXC 2NYXA 2FRWA 2F9TA 1GLLO 5CKHA 1N8RR 3VQAA 4I6MB 2MW8A 2A1SA 3DTKA 3JCMc 3VYRB 1FSEA 1X9MA 4CHUA 2V7ZA 3DP7A 4L5JA 4IIOA 1USSA 5L8RE 3CO7C 3WEEA 2HXOA 2LKPA 3C0BA 5EX5A 4CC2A 5GAN4 2ASMA 2DTIA 1YVNA 2XROA 2XAJA 1BL0A 1K9MO 2E1YA 5J39A 2GOMA 4AM6A 3LP2A 2F5KA 3MMVA 4FZXC 4JS4A 2UUZA 4CD1A 1RESA 1OU9A 3WNGA 2MI6A 4FSSA 1XMAA 1VSLA 2FF3B 1O9SA 3F6VA 4DR5K 4BREA 4KN4X 4H4KC 1YBYA 1HYOA 5ERIA 1FY7A 2FBKA 1XHZA 1HXDA 2OFKA 2GNCA 1X1DA 3MEGA 4JUVA 2GXAA 1SPKA 2Y2ZA 4EW4A 2L8DA 4PJOB 1FN7A 3C0CA 4A63B 1E2XA 4V2SA 3K4NA 4KIBA 1L3VA 4C8OA 3CJNA 4Y1DA 1YIJN 3QFUA 1R1TA 3VS5A 2RH2A 2WTUA 1TQMA 4Z94A 2W7NA 4HEA2 2BTFA 3HSRA 1UGRB 4LH4A 2CS3A 1WVRA 3HBLA 5KAFC 1OCRH 3GTGJ 4JI3K 3NH1A 3VJPA 1VQPQ 3CM5A 3EUHA 5FPMA 1NYGA 5FJ8J 1KAYA 5M1PA 3BF1A 1S6PA 2CUJA 3LWLA 2XI9A 2WAQN 3CZ6A 1TWCJ 1O4XA 3U1KA 5AIPA 4LF4K 3NH0A 5KCMA 3PIPA 2PYJA 3JCMV 4ON0A 2K5IA 1VQLT 3AGKA 1M30A 3S2DJ 4DB3A 3VEPA 2FZGB 2G8KA 2CP2A 1B8IB 4P5OA 4C3IJ 1V55H 4DV4K 3OYMA 1D1AA 2MPXC 3EGDB 1S72Q 3B6CA 1H0MA 3CCEQ 2K79A 2HHVA 1FOYA 1UGPB 1WZOA 3RUXA 1Y39A 4EMHA 1YQRA 4NYNA 2DL4A 1GOCA 4FCYA 4EAHD 1R59O 5IY5H 3TP3A 1NGHA 3HFNA 3R61A 4DA4A 5DM6L 4B22A 5J2NA 5GANh 1KJWA 3E1SA 4DYRA 1QMCA 1ZHFA 2Q2RA 1GLNA 1YP5A 2Y0MA 1VF9A 1J3TA