4IKFA

Pfv intasome with inhibitor mb-76
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title 2-Hydroxyisoquinoline-1,3(2H,4H)-diones (HIDs), novel inhibitors of HIV integrase with a high barrier to resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein/dna/inhibitor
total genus 101
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ikfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ikfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ikfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ikfA03
2FC0A 3B6PA 1VSDA 3LP0A 4IKFA 1BIUA 1WSHA 3VA3A 4CK2A 4E1NA 3F73A 2HB5A 3NF7A 3OS1A 4IUUA 2L8DA 4NCAA 4DTOA 3SUQA 1RI0A 1JXBA 3TAMA 2XY5A 1T03A 1NK0A 3NF9A 4Z0UA 4BWJA 1LAVA 4DTUA 3L2RA 4N47A 4DU4A 3K5NA 1Q9XA 2VG7A 4FW2A 4F2SA 1NKCA 2P5GA 4CGDA 2DFFA 4CJUA 3LLRA 4KHWA 1RT2A 2X4YA 2HQXA 4OPJA 1ZBLA 2X4XA 3DLMA 3LPUA 3DRPA 3LH0A 4Q0BA 2LCCA 1UA0A 3AVCA 4IUTA 4Z4EA 2ZD1A 1KLMA 3QEWA 1QSLA 2G3RA 2YRVA 4GVMA 1RNHA 3SZ2A 3MAQA 1WSFA 2E6LA 5C0MA 4FJJA 2BE2A 3V9SA 5J2PA 1U45A 1WJQA 3NGZA 1B9DA 4CIGA 3OJUA 4C8LA 3FFIA 4CEAA 3RWUA 1U4BA 4KB0A 3M8PA 1QSYA 2M1HA 3VQ6A 3WNFA 3NF8A 4F3TA 4BWMA 2RJCA 4UQGA 3MEEA 3KD1E 3NHGA 4C5HA 3O3GA 1UOCA 3ZSWA 1IKVA 3L3UA 3LDSA 3V9UA 4WE1A 4QQDA 4CJ3A 2P1JA 4C5GA 1VSEA 3VQAA 1QHTA 5KRTA 4FU6A 1KLNA 3RTVA 2YKMA 2D0BA 3TAQA 1VRTA 3ZEHA 4DSKA 4E1MA 4FCYA 1JLEA 3CFRA 4IFYA 1LWEA 1TAQA 2R57A 4OVAA 4FK2A 3OYJA 3HYFA 2Y1IA 4OPKA 3ZT0A 3M9QA 3P5JA 2F5KA 3TI0A 2DY4A 3K5MA 2P5OA 3KLFA 2E5QA 4KO0A 3LZJA 1JLFA 3F70A 1RT1A 3BDPA 5FRNA 3C95A 4DS4A 3C6UA 3KKSA 2EKOA 3V9ZA 4OKJA 2L3RA 3TARA 4L59A 2QQRA 3F9KA 3PFSA 4N4HA 1WAJA 3ZT4A 2QKBA 3U3YA 1C1AA 3RRHA 1UA1A 2PYJA 3V9WA 2JGUA 3TAGA 4DFKA 1KSPA 1D5AA 3MXJA 3SV3A 3L42A 1FXXA 2D0CA 2A1SA 4CHYA 2GFAA 4N5SA 4DF4A 3AVKA 4CEFA 3ZSRA 2OZSA 1G15A 4FJ8A 2ZE2A 1JL1A 4OLBA 4BE1A 1BI4B 1SKSA 1I39A 3NTIA 1RCHA 4NCGA 2M16A 3EZ5A 1TKXA 3KIOA 3L2WA 2B6AA 5KI6A 3V1QA 3O4NA 1A5WA 3QESA 1OYXA 4BACA 3RR8A 1WSEA 1S9EA 4LD6A 3RRGA 4HUFA 1H3ZA 3P83D 1BCOA 4DSEA 3MEVA 2XRIA 1C0UA 1S1UA 3ME9A 3VA0A 4O4GA 3C6TA 1Q9YA 4Z4GA 1WSGA 3AA4A 2A1RA 2EFIA 3SQ0A 4CJVA 1X9WA 1J9AA 4ZTFA 4K8XA 2X74A 3ALYA 2QXFA 4J2EA 2XY7A 3RMCA 2DAQA 1ZBIA 4O0IA 3KLHA 2X78A 4CEBA 3GOXA 1RBRA 5HRSA 2EHGA 3QKJA 4RW7A 2DFEA 3AO5A 1YVUA 2VWJA 3AA2A 2OZMA 4C8NA 1NKEA 2KFNA 1JLBA 2RHUA 2HMIA 1ASVA 2HNYA 4FJ9A 4DLGA 2P51A 2IDOA 3MP6A 1EX4A 3V9XA 1SL0A 2WACA 2G8FA 3VQ9A 3IAYA 1RBSA 5IAYA 4PQUA 2B4JA 3OYLA 4FXDA 4Z4FA 3PX6A 4HCZA 5D6WA 1NK9A 4KTQA 4N76A 4O0JA 1YTUA 2KTQA 4M3UA 1LW0A 4M3RA 1U49A 4RG8A 1C0MA 1WNSA 2K3XA 1JXEA 3H08A 3SPYA 4B9WA 1ZYQA 1VK0A 1U48A 4NCBA 1XNIA 3OYMA 3KK2A 3O8VA 4DMNA 2Y1JA 1X9SA 4KB1A 3PUFA 2XK0A 4G1QA 2R7YA 3CM5A 3AVAA 3EY1A 3K57A 2RJFA 2F96A 2GFUA 2G8VA 5HRNA 4B9XA 2RHIA 4II1A 1XHZA 4I2PA 3OYAA 1TAUA 4DLEA 1S1VA 1NK5A 4I7FA 1FK9A 4CGHA 3TABA 2HNDA 3ZSXA 5I3UA 2G8HA 4DU1A 1YT3A 4ID5A 1SSFA 3DRSA 2MWPA 4CJKA 3QEPA 2IGIA 3LALA 5HROA 4E89A 3V6DA 4ELTA 4AH9A 3MEAA 4NS5A 4CERA 3SUPA 3D0PA 1ASWA 3NH2A 4HUGA 3QETA 1QE1A 4O44A 2KZMA 4CEOA 2OYQA 3TAPA 4F2RA 3LZIA 1Y97A 4CEQA 5HP1A 3NF6A 1VSHA 3CM6A 3BGRA 4DU3A 1ZBUA 4LH4A 4CE9A 1ZBFA 4Z4IA 3Q1JA 4KHNA 1RT4A 1NJYA 1N6QA 2OA8A 1T8EA 3QEIA 3K59A 1S1XA 4E7IA 3FLGA 1JLCA 4CF9A 3K58A 2BANA 3ZSZA 2Z1GA 4M45A 3KUFA 4FLTA 2RO0A 3AO4A 4CF2A 4F3OA 4OKKA 3HL8A 1T7PA 2JTFA 3OQ5A 4HTUA 3LX7A 3H8ZA 2YNGA 1BQNA 1CZ9A 4IG0A 4Q5WA 2I5JA 1D9FA 3P8DA 2QQSA 4HUEA 4IG3A 3MEUA 2HVHA 2WONA 1Z25A 3BDLA 1YTAA 3OS0A 3HP9A 3MP8A 4E0DA 1LW2A 4RW9A 4FZXC 3THVA 3OYIA 2HHVA 4TSXA 2ETJA 4CHZA 2WOMA 2FBXA 3ZSOA 3ITHA 1MU2A 3VQPA 4CHOA 5FDLA 3RR7A 2Z1IA 4CCHA 4AHRA 4RW6A 4LSNA 3LP1A 2XY6A 2JLEA 3AO2A 3AVGA 1RT5A 1HYVA 4B9LA 3L2UA 1WLJA 4CEEA 1T05A 3SCXA 4EZ9A 2FBVA 4B9UA 3OA6A 4O5BA 4FL6A 4CJPA 4R5PA 3TAFA 4RW8A 4N41A 2HHQA 2OPPA 4Z02A 1DLOA 2LDMA 3HJFA 5J26A 1C6VA 4GW6A 2E6MA 3L2VA 3CG7A 1NK6A 1HQUA 4KTZA 3SD4A 3DOKA 3NGYA 5FRMA 3AA3A 1RBUA 2YKNA 3UT1A 3PV8A 5KRSA 1S1TA 1JL2A 3ZT3A 1IO2A 3OB9A 2YNHA 4W5TA 3KJVA 3PMIA 3AVLA 4KPYA 4ELUA 1TV6A 2VG5A 4AHUA 4C8KA 2RKIA 3MEWA 4KHSA 4DTMA 4CEDA 3OS2A 3LANA 3NNQA 4DQSA 3TR8A 1L3VA 1QTMA 3SUNA 2LSNA 4C8OA 4JRPA 1VSLA 1CLQA 4CK3A 1RDDA 4IUPA 4O55A 3TANA 3QJ6A 4B3OA 3HVTA 2NLUA 2OPQA 5C42A 4KFBA 5I42A 3PX4A 3NTHA 4DTRA 2YNIA 1KVCA 3CEYA 5CZ1A 4BE0A 1U04A 3QINA 2B5JA 5CYQA 1GOCA 5KGXA 3PO4A 3I0RA 4LY7A 2CKKA 1BHLA 2PZSA 1HYSA 1RILA 1TL1A 3KLGA 3KLEA 3PMTA 3K5LA 1J53A 1A5XA 4CESA 4I2QA 4CFCA 1HNIA 2YNFA 3U6FA 4C5IA 4CIEA 4J2BA 1RDAA 3DRRA 4CFDA 1J54A 5JS1A 4CGJA 4DTJA 1SL1A 4E7HA 4DSIA 4DFPA 3LGLA 4CJRA 3G0ZA 3S3OA 3SYZA 4ELVA 1VRUA 2D9TA 4PWDA 1S9GA 3VQBA 1NOZA 2GBZA 1N5YA 1F21A 4C8MA 3AVIA 3ZSYA 5JS2A 3WNEA 3VQCA 3E9GA 4AHCA 5E41A 1UWBA 2ITGA 3HM9A 3QBYA 4YNQA 3KD5E 4E7LA 3NFAA 1S5JA 4FZYA 4PLLA 1KCFA 5HBMA 5IN1A 3VN5A 3T1AA 2OPRA 1TK5A 3AA5X 3NTKA 4E7JA 2EQJA 4GY5A 3LPTA 3MO8A 3OJSA 1BQMA 1TGOA 5SZTA 4BD3A 1O1WA 4KI4A 3VQDA 2QKKA 2IS3A 5C6SA 5D3GA 1JKHA 3DI6A 4DQRA 1KVBA 2RI5A 3MP1A 3NDKA 3CFPA 4IFVA 4W5QA 1XC9A 2X4WA 3VQEA 3K2PA 4OVLA 4EZ6A 4M3WA 2R5AA 3RMBA 5D6XA 1Q8IA 4KKOA 2HHXA 3ZT2A 3AO1A 1IKWA 1BL3A 3QEVA 5KE3A 4KREA 1VSIA 2BDPA 4A4GA 4GMJB 5HRPA 1IG9A 3AO3A 3QNNA 3HP6A 1ASUA 4HCCA 2XHBA 3O3HA 4BDZA 4E3SA 4CHPA 1NK8A 3NGIA 2HHTA 3OYEA 1LV5A 4EDUA 3RMDA 3KLIA 1C1CA 4CJTA 3SQ1A 4RG2A 2P0KA 4BE2A 4K8ZA 1RDCA 3OY9A 3LP2A 4KI6A 4ZHRA 3DLEA 4NYNA 1L3UA 1JLGA 1RTJA 4RW4A 4B8CA 1HJRA 2IG0A 2XDPA 4NZGA 1RBVA 3DLHA 4FJXA 2QK9A 4HVJA 2GF7A 3V81A 3OYCA 1WGSA 4FYDA 1VSFA 4L8RB 1HQEA 2GUIA 3SQ2A 5K14A 2BGGA 3LP3A 1NJWA 4I9QA 4QW2A 4IUVA 5M9OA 1EP4A 3IS9A 4CF1A 1B9FA 4J2DA 1NOYA 2G8KA 1KVAA 1XI1A 4W5RA 2DFHA 2PY5A 1SKWA 1LWFA 3VQ7A 2RN2A 3NBPA 1HYZA 2G8WA 4CJ5A 1Z26A 4E19A 3CYMA 4M3YA 1RBTA 4B08A 5DMRA 4AILC 4DSLA 3E01A 1EKEA 2VWKA 3DLGA 3PX0A 5CY4A 2HHSA 2XO7A 5J2MA 3CQ8A 3NH0A 3TAEA 1RTHA 2JZ2A 5CZ2A 3OYHA 1HMVA 4B8AB 2ATQA 3SQ4A 3B6OA 3VQQA 3S6WA 3QIOA 2W42A 5DK5A 2IAJA 3QLHA 4AHVA 4QAGA 1N27A 2EQKA 3KK3A 5C25A 2O4IA 3AVNA 4E7KA 3EAEA 2RF2A 4JS4A 1GOAA 1IH7A 2RI3A 3D45A 3VQ4A 4B9TA 2BKDN 3JYTA 1BIZA 4JLHA 5HRRA 1WJRA 4PLIA 4Z4HA 4QOZB 3META 4FJHA 3DMJA 4BDPA 3KKRA 1CXUA 4KAZA 4OGEA 4LSLA 4M3ZA 3FC3A 3PNWC 1BISA 3DM2A 3LAKA 2OPSA 4F4KA 4EP5A 4QVZA 3ASKA 3OMCA 4B9SA 4FLZA 4CGGA 4KHUA 5FROA 5HLFA 2PYLA 1C0TA 2KZZA 3ISNC 2KFZA 4FLXA 3QIIA 1JLQA 4FJMA 3LWMA 2KW4A 1BI4A 2FBYA 1S1WA 2LRQA 1LWCA 2RJDA 4MFBA 1BGXT 4DQIA 4QCLA 3RMAA 4DWIA 2R58A 1OZ3A 2VG6A 4CJQA 1SL2A 2HHUA 5KCOA 3OYFA 3ASMA 4N4GA 4IURA 2FHDA 1D8YA 2EX3A 2MWOA 3DLBA 1TK8A 3TWHA 2HW3A 3QEXA 4KRFA 1MHNA 4H4OA 2O4XA 4CGFA 5T7BA 3AV9A 2Z1HA 5CIUA 3O4QA 1IKXA 3NH1A 3LYIA 1GOBA 4AHSA 4B9VA 3WNGA 1WJSA 1TKDA 3VQ5A 1ITGA 4FJ5A 1WSIA 2EQUA 1TKTA 2HHWA 3P1GA 3QNOA 3CFOA 1X1PA 3AVHA 3HPGA 5J2NA 4MQ3A 2F8TA 3QIPA 2VYTA 4CJWA 3ZT1A 4KHYA 4FJKA 3KK1A 1TK0A 4IUQA 3S3NA 4X34A 1JLAA 1KHCA 2DTUA 4PL6A 1R0AA 4FW1A 3I8DA 3MXIA 4A4HA 4CGIA 4OJRA 5SWMA 4CFAA 1IKYA 4DTNA 2X6SA 4XIUA 5KE2A 1UAXA 1RT7A 4CF8A 4FJ7A 1ZBHA 2KQ2A 3MEGA 3C4SA 3G10A 2IC3A 4UC4A 5CYMA 4OLAA 5D6YA 3OYDA 4FJLA 2IOCA 4EP4A 4I9LA 4FM2A 2YHAA 1SKRA 2RHZA 5KH6A 2RHYA 4A4FA 3P8HA 1W0HA 1W9HA 4FLVA 1KFSA 1A5VA 4W5OA 3HPHA 2EQMA 3SV4A 1WSJA 5J1EA 2FBTA 4JRQA 4HCBA 3HO1A 3T3FA 4AHTA 1TVRA 3HT3A 3DLKA 4FLYA 2RI2A 1VSKA 4CJSA 3LGFA 2G8IA 1NJXA 3KTQA 4FK0A 4CHNA 1FKOA 4CJEA 4CK1A 3LWLA 3HXMA 3AVMA 4CEZA 1QQCA 2HVIA 2G8UA 1B92A 4KTWA 4FM0A 4QQ6A 3L2QA 4FJGA 3E9FA 3OMGA 4CHQA 5J39A 3QO9A 3ZSVA 3SUOA 4QQGA 3MXMA 3OYNA 1LAWA 2HQEA 1G5VA 2K3YA 1RTDA 1RT3A 2BIVA 3DB4A 2LVMA 3NCIA 2GV9A 1FKPA 1S6QA 3EYZA 4DSFA 4OGCA 4JS5A 4DS5A 3SI6A 2RJEA 4FZZA 5C24A 4DSJA 2F8SA 4C5EA 3V1OA 4FVMA 4ZTJA 2O4XB 4M3TA 4NYFA 4M42A 4CFBA 4DTPA 1EETA 4DF8A 2HNZA 4LD0A 4H4MA 2M0OA 1XHXA 3ZSQA 4FJIA 2RHXA 3UIQA 2O4GA 4N4IA 1I3AA 1HNVA 4M3XA 3M8SA 4F8RA 1RTIA 3I0SA 1NJZA 1KFDA 3FDRA 2DIQA 3ZCMA 3T19A 2YV0X 2RPIA 3QERA 3O3FA 3HSTB 1DTTA 1SUQA 2AJQA 3SNNA 1KTQA 3DLRA 1D9DA 2DIGA 3VQ8A 1EXQA 2D0AA 1CXQA 3LAMA 4HHTA 4N56A 2D5RA 4CJFA 3IRXA 5KTQA 3L8BA 4DFJA 1REVA 4ID1A 3M8QA 2PQWA 3AVFA 4PA1A 3V4IA 1L5UA 1OI1A 1WN7A 4J2AA 3IG1A 3K5OA 1J5OA 1XWLA 1RT6A 1K6YA 3MECA 2E6NA 2X6NA 1OZ2A 3ULDA 4FM1A 4DTSA 3H6ZA 4PUOA 3S9HA 2XY8A 2Z1JA 2Q3SA 4DQPA 3A2FA 3U3GA 4IBNA 2B8AA 3L3VA 1QSSA 2E4LA 4M41A 4CJLA 4Z4CA 4CRIA 3AVJA 3OYBA 4B9NA 1X9MA 3FEOA 4BDYA 4IDKA 3OYGA 5KGWA 4B9MA 4Q5VA 5EU7A 1C1BA 4H8KA 5J2QA 3DOLA 2BUDA 1DTQA 3NAEA 4KV8A 2NUBA 3PY8A 1NKBA 4DQQA 1VSMA 3C94A 3NE6A 1NK7A 4CF0A 2YHBA 1SV5A 4FLUA 2LTOA 3HK2A 1WAFA 3M8RA 4PY5A 4LH5A 1TL3A 3AVBA 3DB3A 3OYKA 4YFUA 4KHQA 2R5MA 4FJNA 4DG1A 3HPOA 1VSJA 4Y1CA 1BCMA 3V1RA 1L3TA 4DTXA 1S6PA 4A4EA 3PO5A 3HVRA 4ICLA 4OKEA 3SPZA 1RDBA 1HPZA 5KCHA 3MEDA 2L89A 3UWNA 1TKZA 4FLWA 3DYAA 3WNHA 1U47A 3S3MA 3OVNA 1L3SA 4CIFA 3JSMA 4W5NA 4CJ4A 1QS4A 4FK4A 3SJJA 1KRPA 4DFMA 1CZBA 1HRHA 4CECA 1NK4A 2ZQBA 4Y1DA 2X35A
chains in the Genus database with same CATH superfamily
3B6PA 3EYIA 2JVGA 1PHTA 3NHNA 1YHQQ 2OTLN 1VQ8N 1UHWA 2FU4A 2DX1A 3ZETA 1O57A 4XAXB 1JKOC 4DTOA 3GTGJ 1E17A 1JXBA 4ATOA 3K0LA 4BWJA 3DKMA 1ZELA 3FGUA 3M6GA 3UPUA 3A5MC 4BROA 2YXYA 2FF6A 2YDLA 3VOVA 1YJWN 2CJJA 1NTCA 3NWTA 2VXFA 5EC7A 1VZ0A 4DV7K 3LLRA 3LFKA 3JW4A 2LZ6B 1TT0A 2HQXA 3WVEB 4IOXA 1UA0A 5D5UB 3TVTA 4BR5A 4IUTA 3QEWA 1QSLA 2DYSH 3ZN0A 4QTRA 3CCRQ 5EY4A 4GVMA 3UATA 1RNHA 5I2SA 4A93J 1U45A 1WJQA 4CIGA 3OJUA 4W1UA 5ICCA 1FBQA 3IP4B 3FFIA 3FJPA 3M8PA 4AFQC 2M1HA 3OA9A 5FKLA 2ESWA 4Z88A 3WNFA 3COAC 2CP5A 1IRZA 4F52A 2NVXJ 1S72Q 1K8AO 3I56A 2E4HA 4C5HA 1YITT 4C0DB 3DLLF 4G7OF 3EN9A 5LJ3f 1S7EA 2GQQA 5AZJB 1G2HA 1IKVA 3L3UA 1XCBA 4BY6B 3FJ5A 2H3GX 1X6GA 5E79C 4WE1A 2AQFA 2K02A 3D2EB 4CJ3A 5CO7A 5GAMe 3MCZA 1TQMA 4BRHA 4C5GA 1VSEA 1QHTA 4BQNA 3BC8A 1MW7A 2ZXIA 5IXFA 3H3ZA 1KLNA 3EHRA 3RTVA 3PL8A 1JO8A 2YKMA 4HX4A 1VQ9Q 1Y8QB 2VBZA 3CFRA 1OH8A 3TP0A 4XH4A 1ZAOA 1D8JA 2EIFA 2FZGB 1X4PA 2R57A 3K9KA 4J6WA 1K76A 4OIOF 1NM7A 1USTA 2Y75A 1QCNA 2FLOA 2ELJA 3LDOA 3ZT0A 1BBZA 3RBBB 5KYYA 1IG8A 2HKXA 2F5KA 5JMVA 5L8RE 3TI0A 4F7UE 2DXTA 2R7UA 4OB0B 4KBMB 2A69F 1JLFA 2V9KA 3BDPA 5GAN3 5EJCA 3VYRB 3D7SB 4MZPA 4XLNF 3TP3A 3VWBA 5C0YA 3V9ZA 4BRKA 3F9MA 3H6EA 2L3RA 3TARA 4CHUA 3VKIA 5KQ8A 3F6OA 3KX2A 1VRLA 1Q1VA 4LDUA 1UHSA 1JT0A 3TSWA 3U3YA 1VQOA 3HHHA 3JCMQ 2LY1A 3RRHA 1PYVA 1ZBJA 3OSGA 5L3CA 2YJFA 2PQ8A 5KAIC 1NJIU 1RL2A 3HGYA 1M9SA 4YFKF 1FXXA 1CF7B 5LL6Z 1KC8U 2O01E 2HVQA 2GFAA 4LITA 4N5SA 2GM4A 1SVLA 1O3QA 1G2BA 4DF4A 3CBOA 3SWNC 4H5RA 5HK0A 3BTCA 3T8TA 1KAXA 3PIOL 5BPNA 3K1PA 2R7VA 2ZAEA 5CCAA 4DR7K 3QOEA 4E9FA 2QUFA 2GX9A 4FJ8A 2ZE2A 1JL1A 1M30A 5M1PA 2Z9OA 4OLBA 3M0RA 1BI4B 4IF4A 3WE2A 1RAEB 2FOKA 1A35A 1Z6RA 3M55A 4M78E 3I64A 3A8LB 2EIKH 4F7UF 4NXNK 3BDDA 3BJOA 2IP2A 4BVPA 5FGMA 1BA0A 1K0XA 2GWKA 4LB6B 5KYXB 1YYVA 4KITB 2E20A 2PJRA 1X3UA 3CMAT 2UUBK 5IH2A 3RR8A 2YSRA 1WSEA 4WXCA 3RRGA 4NC8A 3N4QA 2OU2A 1EJ9A 3ULEA 4IEJA 3S1QJ 1Q18A 3H36A 3A2KA 4MO5A 1UFMA 3HRUA 2QSHX 2DA6A 1SHFA 4OIRF 5LJ3d 1TTHB 1Q86O 1WXUA 4ISEA 3CJ9A 2MABA 3B6CA 1T3VA 2EFIA 1ZQ1A 2DODA 2CP2A 2L02A 4EHTA 3PJRA 4XLAA 1IXRC 2X74A 1KG5A 5C3EJ 2JTVA 4XRSG 1FYKA 5AQXA 1SFUA 4GKKK 3I56I 4XKCA 2M4GA 2XY7A 4XU1A 3WU0A 4O0IA 1HKCA 2LJ0A 3H5NA 2X78A 1Q95G 3RESA 2GA2A 1ABOA 1SS6A 3M1EA 2M3AA 1AHDP 2DL7A 3RMSA 1LCKA 2W48A 3M1FA 4RW7A 4K42A 3M7GA 2IA0A 1MH3A 2E2IJ 2KXDA 1B8IA 2OZMA 1OISA 2E7WA 2EV6A 3EGDA 2EFPA 2LQKA 1ENHA 2KT0A 2RHUA 2HMIA 2CT4A 2KDSA 2IDOA 2BVLA 4XTZA 1EX4A 2YX6A 1IZ6A 3V9XA 2K5IA 5E84A 2ISYA 1W97L 3FFKB 3WUHA 1AWOA 5IAYA 4EMKA 4FXDA 1BI3A 2V1RA 3PX6A 1FOXA 1F43A 1K9MC 1V5FA 4ZGDB 4O0JA 3CCUN 2FEZA 5E1WA 2KMUA 1IXCA 2KTQA 1X58A 4M3UA 3TL4X 4GVEA 1X2QA 4B8XA 3HFOA 3FZMA 3GTQJ 3EDPA 2DVEA 1JXEA 4M6VA 1HLVA 2QTDA 1R8OB 4LUEA 2YT6A 3IV5A 4JKCA 2R7RA 3CC2I 2HS5A 1AT1B 4O8UA 1ZYQA 1VK0A 4BL0B 2EFNA 3BJAA 4AWXB 5JVGF 2Y1JA 2LFBA 4IOAL 1VQMN 2WY8Q 4CZCA 3D6RA 1WQ2A 2STTA 3C2GA 3R0JA 3TQ7P 3ULQB 4ELYC 4G1QA 2MSYA 2NYXA 1VQNT 2DPDA 4EJTA 3K0SA 3CM5A 1XDUA 3AG2H 3AVAA 3EY1A 5EG2A 1KK7A 4IO9L 2F96A 2EPDA 3VPZA 3CD6A 1I27A 1OR7C 1T0FC 3H3OB 1FLIA 2VASA 1JXOA 1T0HA 1HX1A 2V7YA 2X6XA 2V8IA 1ETKA 3OYAA 5DD4A 1VQPN 4M9ZA 4C8QE 1TAUA 4DLEA 5A2QE 2DMNA 3WE3A 4BRDA 4I7FA 1V4TA 2CSIA 3ZSXA 3R3LA 1E7OA 2A3ZA 4DU1A 1JHFA 3I56Q 1IRXA 4GY2B 1J0RA 3IMXA 3ERED 4YOQA 3JRBA 1KG1A 1U8BA 1HW1A 4ELTA 1N78A 3MEAA 2Z5UA 3B8AX 1IUFA 2ME0A 3LDLA 1ASWA 5JI6A 2E2PA 3NH2A 1R7JA 2QKMB 3TU4K 2KZMA 1W2BM 1X1DA 3VERA 4YFNF 2OYQA 3BR0A 3HGGA 4CZIA 1Y97A 4O5VA 4CEQA 1VSHA 2LBFA 2WAFA 4C92E 4YIRX 3DU6A 1ZBUA 2PBDA 4LH4A 3I5SA 2QYOA 1BR1A 4A12A 2O8BB 1U5TB 1E6GA 1SMTA 4B24A 4DW6A 4D6WA 2EZLA 2KISA 3LM9A 4MFEA 1T8EA 5DLQE 3QEIA 3A0IX 3KBGA 5C2FA 3KLOA 4BNCA 4FQGA 1KD1R 4KNYA 1QZEA 3O9QA 4M45A 1G3WA 1XOVA 3HUGB 4JX5A 4JLGA 4KUDK 4OKKA 1JHHA 3S14J 2JTMA 2OJ2A 3G4SA 3RTRA 2A41A 3DEUA 4YOVA 3A8GB 3OQ5A 3H8ZA 3LWFA 3QXEB 2YNGA 1FT9A 2ENMA 4DR4K 4HDUA 2W85A 2EYXA 4CZHA 2WFBA 1CZ9A 1NG7A 2Q2EA 2FD5A 4UV8A 1AZEA 5FKOA 1KYWA 5IT9E 1VQOQ 4JKBA 5TGTA 5GAEJ 2QYZA 1ORPA 5EOYA 2W4SA 1D8KA 4M9SA 2O5RA 1WZ2A 4IG3A 4K25A 1VQ4N 3OS0A 3HP9A 2F4VK 3THVA 2JWKA 4PJOC 2HHVA 2ETJA 3FRNA 1OPKA 1GLCG 4Q48A 1NK2P 1MA9B 4M7YA 4EQQA 2J05A 3ITHA 3CXCA 3VQPA 4CHOA 1RAHB 4MZMA 4KIGA 4H5WA 2PVOB 4M6XA 3VYGA 2NRRA 1FOKA 4XIDA 1M8VA 5BOXA 1UDLA 1TC3C 4PJOG 3I71A 2V7ZA 3AVGA 1CKAA 1RT5A 3O08A 1R58A 4CEEA 1T05A 2JA8J 3SCXA 2QEXN 2VXEA 2KROA 5HODA 1PD1A 1WBBA 2CDTA 1XGNA 2XVCA 3S2HJ 1ZLKA 1M1KR 4R55A 2CYYA 4JHDA 5CR4A 2OD5A 2Y4YA 4XTWA 5IOYA 2OPPA 1ILYA 1S29A 3CD6I 3G6EA 4BRCA 2F5CA 5J8FA 4LC9B 4BXUA 1NNEA 3HJFA 3JCMc 2LSOA 4GW6A 2RF0A 4BRGA 3SD4A 2NRVA 2L7FP 5DLOA 2F2EA 5GAMh 3CPWA 3AA3A 4CCLA 2GBQA 1WLPB 4IOCL 3O9TA 3D2FB 2JN0A 1K9MO 4IJAA 1NG6A 3MD2A 4NNJA 1X19A 1O3TA 2YNHA 4MLEA 2MPXC 3KJVA 1GRIA 4ELUA 3O5ZA 4MLOA 3VB2A 2KZVA 1BA1A 4AHUA 4PJJA 1P7MA 3LFUA 5E3NA 4C8KA 1UB4A 4UUSB 5E3LA 3LANA 2ZMEB 2G6FX 1W70A 3M54A 4BRIA 5LEKA 3SUNA 1RC9A 4EJOA 2MMPA 4JRPA 1RKTA 2HF4A 4X65K 5AQWA 5GINA 2KEAA 3I55T 1TQIA 1ZGWA 3PTAA 1RDDA 4B43A 1O4XA 2DJNA 4B3OA 4L3QA 5C42A 5I42A 2HOAA 1W7PA 2PBIA 4B3MK 2DM1A 3C2HA 2DOEA 2CV2A 1WZOA 4JJDA 2BOLA 2IVNA 2OZ6A 5FLXO 4BE0A 3SB2A 1YI2T 3BZKA 3J7ZI 2B5JA 2EWNA 2UXXA 3G4SI 2EH3A 3ER0A 1H1VA 3I0RA 4BQOA 2QWOA 3AL0B 3E9OA 1YJNT 1GVDA 4HF1A 1TL1A 5CQGA 3VSKA 5DUIA 3KLEA 2YX7A 3MKYB 4KULA 1OX8A 4CFCA 1R1TA 4R0KA 2EZHA 1HNIA 5FU7B 3ID6A 1UJ0A 3U6FA 3PNVA 3CD6Q 3FZLA 1GFDA 1IV0A 2HYJA 2XGEA 2ZB9A 2K3BA 2ASMA 3LWIA 4BY9C 2HYFA 1J54A 5BRHA 2PMZA 4DTJA 3LGLA 1EFNA 4CJRA 3M0UA 3G0ZA 3PVLA 2D9TA 1S9GA 2ZSHB 3R4KA 4BXFA 1HJOA 2GBZA 2Y30A 1X2KA 4RTZA 1F21A 3AVIA 4WF9L 1KG3A 1OCPA 4OB2B 3WNEA 1VQKN 3VQCA 3MAJA 2DL3A 3MK6A 1Y8RB 4H0VB 1F9NA 5HCKA 1GLLO 2DPPB 4AHCA 3CWUA 5AT1B 4B1UB 5BRDA 2ITGA 3HM9A 2UUZA 3RKXA 4YNQA 4UVCA 3DQVC 2UUCK 1QMCA 5CYVA 5HBMA 5IN1A 3G6EI 1UJYA 3EUHA 1ULYA 2J7IA 3VN5A 4WYBA 1S3XA 3T1AA 4M77F 1YS7A 2LRDA 4IHSA 2EQJA 3OIPA 1R1UA 4Y13A 4QPOA 4M78D 2A07F 1PKTA 4CI0C 1B59A 5KYYB 2CP0A 1AHJB 1O1WA 4DA4A 4KI4A 1LOTB 2VQLA 2IS3A 2A5YB 2FSWA 3Q7BA 4D7NA 1ZUYA 4OAZA 3CDHA 4CC4B 5C6SA 2W24A 1YIJT 4F55A 1U3OA 3MP1A 3RUXA 2GWRA 2GLOA 3L09A 2Z33A 2CGPA 3G4SQ 4JD2A 2ZPIB 1N3CA 4HQMA 3IUOA 3W0LA 3A03A 4OVLA 3CJ1A 4EZ6A 4M3WA 2R5AA 2NRAC 2G0EA 2DDBA 4KKOA 1TNSA 3ZT2A 3AL0C 2R7SA 4LLNA 1QHHD 4ENNA 5KE3A 2FF4A 3HB9A 2EVRA 1DJ7B 2BDPA 2A6HF 3OSFA 3HSEA 2EFQA 1ZBSA 1JUSA 1DDNA 4B47A 5HRPA 2DBKA 1ORKA 5FU7C 4GLMA 4V19S 2OTJA 3U9ZA 3HP6A 1X3MA 3CUOA 4LNPA 3HRSA 1OEBA 1I1GA 3F8MA 5CVJA 5GAN2 1LV5A 2KP6A 2ROLA 2VXZA 2CH0A 4JZ3A 3JAMK 1X27A 1WEIA 1R5ID 2BVMA 2L3QA 3DBLB 3S1MJ 4PSWA 2EJGA 3LA2A 1R4MB 4A3IJ 5GAMj 3WXJA 4M78C 3ZMTA 4EPCA 2E5KA 2KT8A 3S15J 1YNZA 4ZHRA 3C65A 3CCSN 5CE3A 3DLEA 3ZMSA 1L3UA 3EFOB 1JLGA 1Z7LA 5LHGA 3M0SA 1HJRA 2DEUA 4FYXB 4NZGA 3TREA 3DLHA 1LFPA 2PJRB 4KIBA 3GWZA 1S6LA 2FZKB 4M78G 1QVGP 4EA4A 3OYCA 3ULEB 2CP6A 1Y71A 4B48A 1OCTC 3G6EQ 4NQWA 3SYTA 4QW2A 4IUVA 1OVYA 2HL5C 3IRRA 2CUBA 4HZFA 3FXQA 2L2OA 2ZJRF 5AQFA 1KVAA 1XI1A 1BU6O 4CZGA 1LE8A 2BXYA 1J75A 2RN2A 3NBPA 1HYZA 2FXAA 1B07A 1T39A 1GFCA 5J3BA 2FMLA 3S32A 1RBTA 1RRSA 2BY0A 3TQNA 1SFKA 3TW6A 3I9V2 1U9NA 2VWKA 1X9JA 4YDUA 3CQ8A 1ZX6A 3DV8A 5B1AH 3BROA 2E1ZA 3M53A 1B8IB 1VQ7T 3JB9F 4B8AB 4C8QD 3EGDB 3AY9A 3SQ4A 3B6OA 1KFZA 1NGNA 5KCMA 2P9PA 3CC7A 3BT9A 5E3MA 5DK5A 2LCLA 4MDAA 4XLPF 1Z3XA 4AIAA 4QAGA 1C0WA 1N27A 2GQIA 4HVVA 1YJ9N 4F7UA 2D45A 4UY8I 4EMKB 1K73R 2OA4A 1KQSM 2Y31A 5DEQA 4A63B 1M4ZA 4A3CJ 3HKSA 3EH1A 1ONVA 3EFSA 4BC4A 4EGYA 2FL7A 4JS4A 4NBQA 2AIRB 4GYIA 1YITI 2MC3A 1IH7A 1VQLN 3NQOA 2PFUA 1IHWA 1NGFA 1HUXA 2IT0A 4KH6A 2RB6A 3SHWA 4WX9A 3JYTA 5HLIA 4C92D 1IDYA 1WJRA 2COZA 3K1NA 4HV6A 4OGEA 2R7ZJ 1WBDA 5LJ5f 2J06A 4M3ZA 2QDYB 3PNWC 3C3WA 3CC4T 1BISA 1EQYA 3DM2A 2KQWA 3TCJA 2OPSA 3ZOBA 4EP5A 2EINH 2H3JA 2V6CA 3CP8A 1FJGK 4B9SA 2P9UA 4Z8AA 2HHHK 2YUQA 2NOHA 2QA4T 1I4K1 2O61A 1I1JA 5LJ3g 2W6KA 3JCMP 4NL2A 3QIIA 1JLQA 5EZGA 3LWMA 2XKOC 3DAWA 1M3BA 4C8QC 2KJBA 4C0FA 2P7VB 3GMEA 4OMQA 1FBSA 2CW7A 2E70A 2DERA 3H0IA 1S1WA 3AAPA 3HRGA 2MYSA 4Y7NJ 1BGXT 4NC7A 4UUVA 4QCLA 4DWIA 4HA8A 1JJ2S 1HXDA 1SANA 1N3AA 1T6DA 4CJQA 5AQVA 4F9OA 2PN6A 2HSTA 2K9LA 4C8QG 1V55H 2K3PA 2EJ9A 2FHDA 4IURA 1D8YA 4M9XA 2MWOA 3DLBA 3JR9A 2JHNA 4ZYHA 5M5XJ 3QEXA 5CQXA 2JN6A 2WBNA 4RLQA 3EKSA 3SAHA 2ZFUA 3GIBA 3G1JA 2YJEA 3F0CA 2LT4A 1GLAG 1Y1VJ 5F0XA 3I0XA 3WNGA 4YOYA 3F2KA 4C92C 2R5YA 1ITGA 1YHQN 5ILVA 4H0OA 2KXCA 4YOWA 1PD0A 2HHWA 1YE9A 1FJLA 4HLYA 2JXBA 3CFOA 4PHTX 3SZPA 3HPGA 4HRIA 1DIZA 4JK8A 2F8TA 4I6ZA 1YIOA 3BCAA 1MNMC 1EA3A 4CICA 1YLFA 1M1GA 2A6EF 3HDDA 4C92G 2XB0X 4D5FA 3ZMZA 4IUQA 4CZLA 3S3NA 5GAOl 1K61A 5LBQA 2DTUA 1ZRDA 4H03B 4CO8A 2LJ3A 3SDGA 4A4HA 1YITQ 2CGHA 5SWMA 3OR1C 1IKYA 4XIUA 2LNBA 2J6KA 1RT7A 3CCRN 3C7JA 3MEGA 3CMAI 3KZBA 1UGPB 1UHCA 3G10A 4A5NA 2XPVA 4UC4A 3N0UA 5D6YA 1FY7A 4BB7A 2Q2EB 3N05A 3DP7A 2LY2A 4DBFA 3HYIA 4GDFA 3LDNA 1WCMJ 5LJ3j 1SHGA 1Z0XA 2RHYA 1WJCA 1NEBA 3CC7I 1HPMA 1KFSA 1HW2A 3HPHA 1YX5A 3THYA 2EPFA 1PRMC 3EGXB 5J1EA 3HO1A 4M75F 4Y15A 1S72N 3EG3A 4ESFA 3J7AF 1KG6A 1VSKA 2HEOA 5LJ5d 2JM9A 2MH2A 2YHYA 1H8KA 4PNOA 3UKUA 3LA3A 4ME7A 4LF9K 1YFNA 2VT2A 3ZQ7A 2IS1A 3ZX3A 4CEZA 2HVIA 5CVRA 4HYEA 1I6HJ 1IJJA 2DD5A 2OAUA 4IRHA 3A8YA 1VQ9N 5CAIA 1KZHA 2W1OA 2XAUA 2NOIA 3ZSVA 3WGHA 3SUOA 2Q36A 2XGXA 3TMOA 2E10A 3F8FA 4UVAA 1LAWA 2KKOA 1DUXC 4Y91A 1BOTO 4JHDB 4I6MA 3FKIJ 4ZNXA 3CCYA 3TSPA 1FKPA 2PNIA 3DF8A 3KEOA 4ESJA 3EYZA 4D9JA 4IX7A 3RVCA 4DS5A 2HQRA 4I0AA 4FZZA 1WEGA 1QBJA 2F8SA 4C5EA 2JRMA 5M1FA 1OCCH 4M3TA 5B8HA 4NYFA 4M42A 3J7YP 4I76A 2XHKA 4CZKA 4H4MA 5CKBA 2HZYA 4FJIA 2QASA 2RHXA 4I2OA 3UIQA 3WTSC 1K78A 1N32K 3I0SA 3P31A 3WEEA 3I5RA 1NJZA 3CWTA 5H6QA 5EGOA 1KQSP 2LKPA 1XMXA 3W2WA 2RPIA 4DQ2A 3QERA 2OZUA 3H3UA 2JA7J 1IXDA 1NU0A 1X69A 1UCRA 4J19A 4XLHA 1KD1U 1EWRA 3GXOA 3ECOA 3UA6A 3SNNA 3SQNA 1D9DA 3VQ8A 1XNQK 4EATA 4DZPA 5C44J 4N56A 1Z9ZA 4KGXB 2RAEA 3VRZA 4CJFA 1DU0A 1Q82U 4F92B 3K4MA 3CC7Q 4CCKA 1ETQA 1VFCA 5E8GA 4UV9A 4FHTA 5J6XA 2XC7A 1OI1A 1WN7A 4J2AA 1Q82O 2ELHA 1AWJA 1O3RA 1W7PB 4JBAA 2FBIA 4OAYA 1ZA1B 2E6NA 2OTLT 2X6NA 4FYWB 1TUGB 1VQ8T 1EH7A 4FM1A 4M7DF 3H6ZA 2XAQA 4HXJA 1ZC6A 5BRFA 3S9HA 1OKRA 4O5FA 1FIPA 2EQRA 2E35A 2LVSA 4N0AC 1QZYA 3IWZA 1RR7A 3X2QH 4QS9A 4PUSA 1YJWT 4A3KJ 2XAFA 3L3VA 4CA0A 2E4LA 3FIFA 4M41A 4CJLA 5BR8K 4ZC3A 4U87A 3RKQA 1MBEA 3TW7A 4CRIA 1U3EM 1WUAA 3OYBA 4L5GA 5AQSA 2HPMA 1MWKA 1XGOA 2XF7A 1M1EB 2LP5A 4B9NA 1XPXA 4IDKA 2OJED 5KGWA 3K4JA 3QYGB 1CQTA 1C1BA 1CGPA 4H8KA 5F08A 4WK8F 3DOLA 2G7HA 3GE1A 1M1KU 1N77A 2KNBB 3FK7A 1DTQA 3NAEA 4XU0A 4GLKA 3IC7A 1VSMA 3C94A 3CCUA 2K5FA 3VS1A 3IRQA 2YHBA 4B3RK 2FSNA 3QP5A 2M0MA 2ABLA 4KRTA 1H9GA 2BHZA 2QW9A 1WAFA 1IN6A 2ELKA 2QXLA 2YUSA 1QCOA 1JGSA 4EEFG 1UGRB 4BC5A 1FMVA 1M90C 5BREA 2DYRH 4I99C 1TL3A 3TO7A 3AVBA 4DB3A 4JKAA 4KHQA 3L1AA 2R5MA 4FJNA 2CV0A 3FBNB 1TL8A 2LY9A 5E26A 3QODA 5DPKA 1L3TA 1S6PA 1ETOA 2VC8A 4RGUA 4LDWA 3GZNB 4J5YA 1YQMA 3CCMA 2EIJH 2VL8A 1RDBA 4OX9K 1A6QA 2JMCA 3QWYA 1WVRA 2L89A 4PKIA 1GV5A 4HNVA 3DEWA 3ZMUA 4HDVA 2ISZA 4UUTA 1VAZA 4DOWA 1MD0A 3S3MA 3OVNA 2DI3A 4DOVA 3JSMA 4W5NA 1PRLC 4G8XA 4CJ4A 2IPQX 2K5CA 3R6MA 2HKOA 2XROA 3HSFA 1IC8A 4JJCA 4JD2B 4PL7A 1HRHA 5B66C 4BI3A 4FWNA 3M56A 2FC0A 2CRGA 3U9GA 2WSFE 5HS8A 1WSHA 1OOTA 2NVUB 1MKMA 3VA3A 2W41A 3R2XC 4D8KA 3DWLE 3CCLA 3F73A 2HB5A 3NF7A 4Z6YA 2BZ8A 3VS6A 2HQNA 1WHLA 3SUQA 5FWCA 1RI0A 4PJNA 4Z0UA 1LAVA 1TQPA 3A1YA 5ERIA 1LDKB 2DEQA 3I56N 5F27A 3ABTA 3K5NA 1Q9XA 1B7TA 4F2SA 4DJAA 4ZGEB 1NKCA 2ZPEB 2DFFA 1FC3A 2D5VA 1GXQA 3CCET 2KE9A 3OMYA 3LSRA 1MMGA 4P5NA 3R8EA 2ZPFB 4RM3A 2I7PA 3DLMA 3SAFA 2VE9A 2VVKA 3AVCA 2ZWHA 2M1BA 1ZSZC 1U78A 2PZ1A 3J81K 2IIMA 2LNVA 2YRVA 2L4AA 4KH4A 3SZ2A 3K4KA 3MAQA 4B44A 2UXCK 1WSFA 4F14A 1F5TA 4JAXA 2E6LA 2BE2A 1B9DA 2BY1A 3A0HC 3FXKA 1KQJA 3ENBA 1FMWA 4XEIA 4ISFA 1AWWA 1NMDA 3NF8A 5ADXA 2NRHA 2LDUA 3I55I 4UQGA 1ZUUA 4A0XA 1OMIA 4NQWB 3ZQQA 3KP3A 4QLCU 2YHWA 5M1KA 3MEEA 2P9LA 1ZR4A 5J3LA 3KD1E 1JTXA 2HYGD 2MD0A 3NHGA 1V5EA 3O3GA 1VQ4A 5F0FA 3VJPA 3I53A 3CC2N 1N36K 3X20B 3LDSA 3E6DA 3VFZA 3JAME 2GIZA 2IS6A 3O1BA 1XUPO 2CREA 2P1JA 3GBTA 4A0ZA 4E47A 5KRTA 4E9EA 2D0BA 2QBYB 2N8GA 5KN9A 3TAQA 1VRTA 4FVUA 1IV8A 4E1MA 3DCFA 1NH3A 1JEGA 4OPHA 4IFYA 1T6CA 3DPTA 3Q9VA 1TAQA 2V52B 2DETA 1GCQA 1QA6A 3FXRA 3N5BB 2OUMA 1IXSB 3M9QA 3LSGA 4BRQA 3WQTA 2JNGA 3BLYA 3VEWA 4HSBA 2VT3A 3CCMI 2E5QA 4F7UB 4EM1A 3AFHA 3F70A 1RT1A 4KT6A 4DS4A 4OWRB 2FRYA 1X3NA 1VQ6A 2BW3A 3C6UA 1T3LA 3PIPL 3TEEA 4CYCA 2Z16A 5F6FA 2MGQA 2EKOA 4OKJA 2Y48A 3RSEB 1PU7A 5EF6A 3WTWC 4RB2C 1WNLA 1ZXOA 1C1AA 4CYDA 3D4VA 3PNYA 1OJLA 2MLGA 2PYJA 2DO3A 1LVAA 4U67L 1PVEA 3GVAA 1IN5A 3SV3A 4CC3A 3UDCA 1XGMA 4BY7J 2FQ3A 5AQQA 3F8NA 2CZ0B 1RGIA 2D0CA 1KO9A 1W7AA 1VQMT 3CCLI 4IJNA 2A1SA 4CHYA 4XTUA 1D09B 2BZTA 1UZCA 3DTKA 1V1CA 3AVKA 2JMWA 4CEFA 1ATRA 3J80Z 4PKGA 4F91B 1ZRFA 3CHWA 4M3DA 1G15A 2XPUA 3I55Q 4PSXA 1SKSA 4NCGA 4NLBA 3KIOA 2B6AA 5I9EB 1Y56A 1VQPT 5D5WB 1H0MA 3V1QA 1A04A 3VS2A 4A6EA 2O9LA 2D0OA 4L6V5 3CCUQ 1E6HA 2R4GA 3KWGA 3NARA 4EJWA 1H3ZA 5F0CA 4CVNE 1WJEA 3P83D 3VS4A 1BCOA 3CUQC 4DSEA 2XRIA 3CXCP 4U7BA 3ME9A 3H9JA 2OV7A 3BG3A 2IVPA 2ED1A 3GFIA 2L7MP 2Z3YA 2MAMA 1Q9YA 2RQRA 4WFNL 5AQRA 2OFIA 1GLBG 4LDVA 2VUMJ 3AA4A 2A1RA 2R5YB 4E9GA 4JKDA 1J9AA 5HKCA 4ZTFA 2GCXA 1X01A 2YWWA 3ALYA 3RMCA 3I0TA 4M7AF 2ZJRL 1DP7P 1Q81C 1BBYA 3ABLH 3CCMQ 2CT3A 2VBXA 2WY7Q 5GAOr 3EQLF 4LG0A 1RBRA 5HRSA 1IREB 2DZCA 3P9KA 2R7WA 1D1AA 2DFEA 3AO5A 4YOTA 4BS9A 3AA2A 4DCHA 3PLAA 4WXHA 1K73U 4C8NA 1NKEA 3CPWP 2CUFA 2KFNA 1JLBA 1HKGA 5L3EA 4BR2A 4WQ5A 4DLGA 2KIUA 3ULRB 1W6XA 2DRKA 2XMFA 1SL0A 3ZBDA 3ZQIA 2G8FA 1HSTA 2E5LK 4R79A 3LOCA 5GPAA 3CD6N 3MQ0A 4F93B 3ZX2A 2B4JA 3OYLA 4D1QA 3HZ6A 4O6JA 4HCZA 1SPKA 2DVJA 3PUBA 4KTQA 4N76A 4AVPA 1YTUA 3L4QA 2ZPBB 2PJPA 3CCLQ 4X1VA 3THYB 4M3RA 1IGUA 3VF2A 2O6GE 3BTLA 3VYTB 3GNFB 4ENJA 2QWQA 2HTJA 1X75C 5CJ9A 1NYGA 4B9WA 2E8AA 4GFBA 1U48A 4NCBA 3PIOF 3OYMA 1VQ6I 1M90R 3UKUB 4RTVA 4AIDA 3O8VA 1NPRA 2E64A 1OX9A 3I33A 5GAOp 4KB1A 1I5LA 3O9SA 4UY8O 5AFUH 3HOWJ 4KUIA 2R7YA 5EEAA 1BI0A 5IYDJ 3L4IA 2RJFA 4BBRJ 5DCFA 2M30A 1RUOA 3ZPLA 1LJOA 5HRNA 3HIFA 4BR7A 3CCVN 3R6OA 2DTRA 5K7ZA 3G71T 4M63C 4FT2A 1JE8A 4EW0A 2QEXT 1M27C 1S1VA 5A0GA 4HNTA 4BEHA 2LQWA 1DPUA 2G8HA 1BJAA 4YEJA 3QQAA 4ID5A 1SSFA 1JJ8C 2CH4W 2LYCA 3QEPA 1AEYA 3DKYA 2FEIA 4YTLA 5HROA 3ZQHA 2DT6A 3CLOA 2QQ9A 3F3XA 5JVHL 3RYRA 4K11A 1VQ4Q 3V6DA 5AONA 3VRYA 3G4SN 3EUAA 4BQAA 3JB9I 2CS7A 3EG0A 4NS5A 4CERA 3PQKA 3D0PA 3SUPA 3X26B 4CZFA 1K78B 4XM3A 3QETA 3WXKA 1QE1A 3M4GA 2K3FA 3WTUC 4CEOA 1BR4A 5BS6A 4F2RA 3LZIA 4M75A 1K1ZA 2F5TX 5HP1A 3CM6A 3BGRA 3CC4I 4DU3A 3WTZA 3MN5A 3VDXA 1NGHA 5DDGA 4NL3A 1NM1A 3Q1JA 2V9VA 1V76A 1WEFA 1S7OA 1XGSA 1NJYA 1S1NA 2VODA 2DK5A 3RPQA 2GQVA 2R5ZA 4IQJA 2RMOA 1E3HA 4EJVA 1S1XA 5D6FA 4YIIA 3C12A 3M3ZA 3HI0A 5DM7F 4CF9A 3TPQA 2ASPA 2H8WA 4QS8A 4CF2A 3L2ZA 3LQQA 2V79A 1T7PA 4BJ6C 2RREA 2VC0A 4AIJA 4LK0F 1W5TA 3LQRA 3TTFA 5HLGA 5IY5H 5FLXZ 4LDXA 1VQ6Q 4OMZA 2C0IA 1E3MA 5B5EC 3JCMW 1ZHFA 1S22A 4IG0A 4Q5WA 4JKGA 4KMUX 1BIAA 1U9OA 1YG2A 3QMLA 1ZARA 3MN7A 3M9AA 3ABUA 2ZGWA 1XSXA 2QQSA 2HNIA 1P59A 4FWPA 2HVHA 2DL5A 2WONA 2ATCB 4ESRA 4CBWA 3K69A 4PJ0C 3JSOA 2DL8A 2V51B 1PVSA 3OYIA 2DXUA 4R8HA 2YUPA 4FL9A 1JUPA 4IO9F 1W2BA 1MSEC 3SMSA 1VI0A 5FJ8J 2WOMA 2VKDA 2FBXA 3ZSOA 2OI3A 2PMHA 3HRMA 2DZ9A 2KHMA 3E6MA 2X48A 3RR7A 1RDWX 3QPLA 3FHGA 5LD2C 3N4PA 1QKXA 2QM1A 3EFRA 4HWIA 2ZKZA 5E17F 4RW6A 4LSNA 3GTJJ 2Q97A 1M8MA 3LP1A 2XY6A 1YJ9A 2V1UA 2MOXA 3T1HK 3MVPA 1HYVA 4BR9A 4B1RA 1FEXA 1EIFA 4XR6A 4KUMA 1Z9QA 1IN7A 5GMKi 1TBXA 3GLXA 2FBVA 3TBIA 4BJ5C 1Q81O 4I0BA 1M5Q1 3OA6A 3CCQA 5F2RA 1ETYA 2ZFWA 1R5GA 4FL6A 3TAFA 3UNGC 2HHQA 4EJYA 1VQ5T 5F64A 4JI6K 3SAGA 3BR2A 3O8GA 3GFMA 4LOCA 1VQKT 2E6MA 3L2VA 1PP8F 3H3NO 2BGCA 1HQUA 4J9FA 3NGYA 2ZNZA 2VXDA 1QVGS 4M7DA 5FRMA 4M3BA 4YG2F 5I22A 2HEQA 1ON1A 1RBUA 5LJ5j 4B1XB 1SD5A 5C10A 3GTPJ 2YKNA 5B1BH 4HT9A 1X43A 3PV8A 2GTJA 4P9FA 5KRSA 1JU5C 3I9QA 3THKA 3M8EA 1XB4A 4PFPA 1JL2A 4KDPA 3ZT3A 3EYYA 1FSHA 4A2UA 2M87A 3PMIA 4RDUA 3OSSC 4H0TB 3VS3A 1TV6A 3H1QA 3MEWA 2ID3A 4DTMA 3IHOA 3NNQA 4JQFA 4DQSA 4JI1K 4JEPA 2M34A 1QTMA 2HCKA 1GLFO 2O8EA 2LSNA 2P9NB 4DQ8A 1VSLA 2HVSA 1POGA 4HAMA 3U9DA 2I5WA 2P6SA 1CSKA 4CK3A 2HU9A 4DK9A 2A0FB 4IUPA 2F2XA 2DF6A 2PMZN 3NTHA 3L00A 2M2EA 4DTRA 4KH1B 2YNIA 2VV5A 2OFKA 4LMYA 3NVMA 2BUPA 3QINA 4J9IA 4BG9A 2WSCE 1GOCA 3P39A 4DEYA 1ZSGA 3PO4A 1HOMA 1BHLA 5F1XA 2E2JJ 3ATVA 1HYSA 1S3JA 3I4MJ 3UKRA 4X62K 1N8RR 1WDXA 2YRCA 4DV2K 1YFHA 1TSFA 4M77B 5ICFA 3EGUA 1A5XA 4CESA 5GMKj 4I2QA 2EFOA 2FF3B 1X1BA 2M45A 3LAJA 4X1EA 2HBKA 3SEMA 3CCST 2K7LA 1TTYA 4JJNK 2V1XA 3DRRA 2YU9J 3LH5A 4CFDA 2Y0MA 3M0TA 4LF6K 3KLNA 3K2ZA 1K7AA 2H56A 2H3EB 1IO6A 2BBYA 2I5UA 3SYZA 4ELVA 1K6OA 4PWDA 4H4KC 2P9LB 3D5SC 3F21A 1YITN 4KICA 1S72A 6AT1B 2HNHA 1NWKA 2QAZA 4BRNA 3LSIA 3MX2A 2NRTA 1WI7A 3E9GA 2DE0X 1MBFA 3P38A 4LE9A 1ZK8A 4A59A 1D5VA 3KD5E 4E7LA 2E2NA 1JKPC 3CCQI 5LHHA 4QVCA 1S5JA 4FZYA 4C2MJ 1KCFA 1FBUA 3A0BC 3DXMA 4LLLA 5LMUK 3J81E 1SC7A 4MMLA 3CCJA 1W0UA 1ZRCA 5GAN6 2DILA 4V2SA 1G6NA 1TLHB 3O6WA 1HSJA 4XORA 3AGRA 4GY5A 1O7FA 3VMFB 3DPUA 3MO8A 3HOZJ 1HKTA 2GZWA 4BD3A 2VQCA 2ETHA 2F4MB 2QKKA 2COMA 5GAEP 4NB5A 1FOWA 2D2WA 3CPEA 3UE5A 3S1NJ 2VB6A 1PNJA 5D3GA 1N75A 3BR5A 2CZ6B 5GJVB 2KLOA 2XAJA 2HD0A 2Q0UA 1KA8A 1L0OC 4LDYA 3CBPA 5KHDA 3NDKA 2ZJPF 2CSQA 2IXSA 2E2OA 1XC9A 1O75A 2BW3B 2RHKA 4LLGF 2R7OA 4EHUA 4Q5SF 4PKHA 2GELA 1J59A 3CETA 1IKWA 2E1HA 3KYDB 4BGBA 2E88A 3FXOA 4FIBA 1IW7F 4KREA 1VSIA 1K83J 1VQLT 1IN8A 3N4MA 1IBLK 4M77C 2DAOA 1LNWA 1T3SA 3C6AA 2DQLA 4XICA 3MFKA 2HXOA 1IG9A 3K70D 3DWLA 1FSEA 5FPNA 5K5QA 3AO3A 4PCQA 3QNNA 4HCCA 1REPC 1TS9A 2V1QA 3K4BA 3LSMA 1MNEA 2J5OA 3O3HA 3OYEA 1RLPC 4EDUA 1SAXA 5EEHA 4M77G 3RMDA 3KYLA 1PWTA 4CD3A 4ZDPA 3KLIA 5CQYA 2XD0A 5B3SH 4CSWA 1EH6A 4J8FA 4CJTA 1V3FA 3SQ1A 1X6BA 4RG2A 3HEFA 2JA2A 1FYMA 4XOPA 4JN4A 3FXJA 3GEZA 1RDCA 1YRNA 3LP2A 4KI6A 3KK7A 2A5WA 4DYCA 1C0FA 3AHUA 2KIFA 4WQ4C 4NYNA 1LOJA 3D7EO 1RTJA 1QHAA 3E1SA 1YJ9Q 4RW4A 2IG0A 2UUAK 3FHZA 1RBVA 3JCMf 3I4NJ 3CMAN 1WPKA 2GF7A 3CESA 2CS3A 4FYDA 5M1OA 1OULA 5FPDA 3OL4A 3CCQQ 5CVUA 1HQEA 3QP6A 2OQGA 3TTCA 1ETXA 2AZSA 5D5VB 3CC7N 1NJWA 1P4WA 5M9OA 1EP4A 1NJIC 2VGMA 4M71A 4LGWA 2ZM6K 3RSNA 4DV6K 1KC8C 3K70C 3ZX0A 1LWFA 3VQ7A 1QQMA 1YHQT 3E19A 5DYMA 1D4XA 1PDNC 1ZREA 2DO7A 1X3ZB 1YOVB 2JPSA 2A3SA 2LR8A 3DBRB 4LG0B 3CCEI 3E01A 1EKEA 3PX0A 5E3OA 3DLGA 1WJFA 3U23A 5CY4A 2XO7A 2KSSA 3NH0A 3KCCA 4A2AA 2D1VA 2EA2A 3I35A 4S04A 1RTHA 4XLFA 1TU0B 2XKPA 2JZ2A 2YG8A 2LJ1A 4PJOF 3MZHA 3H9GA 1HMVA 1MJAA 3R6NA 5AJ3K 2B63J 3RQIA 4BRAA 4DBRA 1BI1A 1LKXA 2AP1A 3CCJI 3QYFA 4DYRA 3VF6A 2P9KB 2EGAA 2KR3A 5FPMA 3GF2A 4KMFA 2PMUA 5GANf 3ELKA 4HBLA 1QQIA 1U8RA 3CCRT 3CF5L 4LF7K 2O4IA 1QVPA 4XU2A 4E7KA 3EUKL 4BGDA 2OQRA 4MGRA 2ASOA 4CCNA 1B6AA 1ZBXA 2OAZA 4J9CA 3TU5A 4WFBL 1J5EK 2NS8A 1GOAA 1I07A 3C2BA 1IAWA 5J40A 1TYQA 2MW8A 1B72A 4B9TA 5AIPA 2E34A 3META 1FTTA 1VUBA 3FMSA 2VCPA 3WGGA 4DGWB 2F5EA 3FC3A 1XQSC 2NOLA 1AD5A 4PGHA 5J1RA 4D8DA 3CQTA 1MNDA 4QVZA 3HOTA 2IW5A 3EL2A 1B3QA 4FLZA 4CGGA 3JAMO 1CZAN 2WWYA 4MQVA 4YRVA 5HLFA 3OYYA 4M7AA 2MLKA 3HRTA 2AZVA 4KN7X 1NLVA 2KZZA 4TVRA 3ISNC 2YG9A 3DXKA 1VQ9T 2EV0A 4RMOA 2IA1A 3KP2A 5DM6F 3SFIA 1LWCA 3R9PA 2RJDA 1FWZA 3JCMd 3RMAA 4JLIA 4BEHB 2F5VA 2HHUA 1OU8A 1IGQA 2X1CA 1HBXG 3OYFA 4ZZDA 3KFWX 3U4LA 2EX3A 3TWHA 1KQSA 1SFOJ 3KYCB 4H4OA 3CLQA 1FN7A 2O4XA 1ZGAA 1WGXA 2JM8A 2NXNB 4CGFA 2L54A 4BI4A 3E6BA 1XNRK 2Z1HA 5CIUA 4AYBA 3O4QA 1IKXA 3EHQA 1GOBA 4LG3A 4B9VA 3O9RA 2VUBA 1WJSA 1KJWA 1R5HA 3GW2A 4I7HA 3KZYA 4M75B 5LGUA 4ILHA 4FJ5A 1ON2A 3CWSA 2EQUA 1H8AC 1LUJB 2QENA 3P1GA 3MPUB 4BUPA 3CJCA 4A54A 1T0JA 3QNOA 1X1PA 3CCJQ 3LNQA 5CHIA 3S8PA 3QIPA 3ZQCA 3D1NI 3S2DJ 3PIOA 3LMMA 1K79A 2K6DA 4CJWA 4OIQF 4DUZK 1BU1A 4DOZA 4UHTA 2TRTA 1HU0A 2R7TA 2DA7A 5L3DA 5HLHA 4FJKA 3K9TA 4M72A 3OH6A 2JS2A 2R5ZB 4IPAA 3FR0A 1A0NB 4O3MA 4X34A 3BDUA 1JLAA 2KL4A 5J8CA 5CKEA 1DGWY 4PL6A 3MXIA 4CGIA 1C6VX 3EPZA 4JK1X 2X6SA 5KE2A 2V9PA 4N0BA 1UAXA 1H3HA 3VEZA 2P5KA 1KQ0A 4CF8A 4FJ7A 5GANd 2KQ2A 2KFDA 5A2QZ 2COBA 1E0EA 4AU7A 3TKYA 3CC2A 1YBYA 2D8HA 5M1NA 3L0QA 1P8ZA 1BA5A 3VEPA 8ATCB 2Y9YA 2JPBA 1YX3A 4JKGB 1YW8A 4FM2A 2F5DA 1SKRA 2RHZA 5KH6A 3PFIA 1KG2A 4A4FA 1W0HA 4IFEA 2E5NA 2RA2A 2X4HA 3ROUA 1QQJA 1S9HA 1A5VA 2XV4S 5ICGA 1PU8A 1N9RA 2Q8KA 2FBTA 5K5OA 4XKWA 4AHTA 2PI0A 1E3OC 1O7LA 3QBWA 1TVRA 2F4OB 4H5VA 2K57A 4XKBA 3DLKA 1FX7A 2ECZA 2RI2A 2DRMA 2XAGA 3LGFA 5HNFA 5CPRB 3CF2A 4XQ3A 4Y0WA 4CHNA 4DBHA 3JCMe 3HOUJ 1FKOA 3K9JA 4M4ZA 3LWLA 2NOJB 3HXMA 3A98A 1ZHIA 1QQCA 2G8UA 5BN9A 3CTAA 6PAXA 1NJIO 3J8AA 4MZTA 4WCIA 1B92A 4KTWA 3BG7A 1HW5A 1IUYA 4FM0A 3RR6A 2PEXA 1KC8O 2HZDA 3E9FA 4XK8E 3BF1A 2MC4A 5J39A 1G4DA 2O9VA 1WJBA 4XU3A 4QQGA 4GXOA 4C0DC 1P7JA 2MBFA 2C6YA 3KP7A 4MLHA 1FPQA 2K3YA 1RTDA 3ZRGA 4BY6C 2XIDA 3NCIA 1K8AR 3F6VA 4DSFA 4JS5A 4HW0A 4H0XB 1RAFB 3JCMJ 2W6LA 1MIJA 5C24A 5LJVA 3L9FA 3MKZA 4FVMA 1M2VA 1A36A 1I3QJ 3DFGA 3VU3C 4M7DB 2HNZA 3TSZA 5IT9Z 2Y0SA 1I3AA 1VF9A 1QZ5A 4JP0A 5IT3A 1T08B 4M3XA 1D5YA 4KHPK 1EH8A 5EYRA 5FD6A 3ZCMA 2OANA 1A5JA 2JUGA 4J6YA 5FLMJ 3KFVA 5GANe 2L3PA 3QDKA 1R23A 4LF4K 3PVQA 2K2VA 1AOJA 4XRMA 1NGDA 4A62A 1CXQA 4HHTA 3G1OA 2D5RA 2ECCA 2HOEA 2O8EB 4M78F 3G71I 5KTQA 1K0SA 2LREA 3TDUC 1RADB 4PA1A 3V4IA 2VPLA 4L5EA 3MZ8A 2JSCA 5H1SQ 2VKNA 3I55N 2O8XA 4Y92A 2YHTA 3NMUA 3NVKA 1K4SA 2KDZA 5M1QA 2HL3A 1RT6A 3F5TA 1ZLMA 2O31A 4EM2A 5DM7L 4A3FJ 3KEQA 4EJZA 2R92J 1OZ2A 3H5AA 4WXDA 3ULDA 3GUDA 4C1NI 2MI6A 4ON0A 2QWLA 2PG4A 2GXGA 1SD7A 4DQPA 5GAN7 1BDGA 4P96A 2EFWA 3I56T 1W5CC 2MG4A 2CYZB 2DJIA 2HOTA 1P7IA 4J9BA 4IBNA 1VA7A 1FP2A 2WUSA 1QSSA 2F1LA 3UKRB 3CBMA 5CLSA 1NJIR 3AVJA 1D3YA 5LGTA 4E6KG 1MJBA 1Z7UA 4JI5K 2WTUA 1AWXA 1SRLA 4EW4A 4BDYA 1ACMB 3OYGA 5BPMA 4Q5VA 2DFIA 2LQNA 4BR4A 3TOAA 4IHYA 3CCMN 2JMAA 2BUDA 3CQYA 3CWAA 1XSVA 3QU3A 4DQQA 2JT1A 1FMKA 2WTEA 2LQ8A 2O0YA 3IFRA 3SWNA 1OYIA 3BQYA 3QUIA 1NK7A 3E9PA 2DW4A 3OHRA 3HK2A 3V7CA 4YORA 1TUDA 2QVOA 1Q86R 2X3WD 2HTSA 3ASOH 1JT6A 4OMYA 2XDDA 2WSEE 3EG1A 3DB3A 2XRLA 4FWKA 2CU7A 4YFUA 1MMAA 3HPOA 3DXMB 4B1ZA 3LSHA 4DTXA 5FLVA 1RESA 3QBXA 3CCLN 1U2VA 3CXCS 1MDUB 1VQOT 4PKCC 3VYUB 5BPDA 2RH2A 4XRSA 2EAYA 4X9DA 4PJOD 3CCVA 4RTFD 2WC2A 3MEDA 2NUPA 4OFHA 3PFYA 3UWNA 2CH5A 4XNFA 1USSA 4M74A 4C3IJ 2FPDA 1U47A 3CO7C 4J7FA 2CUZA 1S5LC 2QTVA 1WA7A 4HX8A 5FW9A 4CIFA 4EMSA 3LSTA 2VJIA 1H9TA 1T8IA 1BKBA 4FK4A 1R71A 1KRPA 2FA5A 2NZTA 4DFMA 3O1WA 2ZPHB 3MMYB 4IRGA 1FOYA 1R0BG 5DM7R 2KRFA 2AK5A 4C8QF 1HNWK 3VW4A 2MK5A 4Y1DA 2X35A 4L9JA 3A5NC 2RN7A 3CC2Q 1VSDA 3W6VA 1RUWA 1KQ8A 2CG4A 4CK2A 5FKMA 1VQ5I 4E1NA 3CPWS 3ECHA 4IUUA 3H0GJ 4FT8A 2HSEB 1XG1A 1BYMA 1NK0A 4ZYAA 1QCFA 4DTUA 3KZZA 4AIKA 1N8RU 1Q1HA 3BR3A 4N47A 4DU4A 4FW2A 2F48A 4YIFA 2WADA 2NYSA 5IP6A 2A3LA 5D7UA 2B9SA 4CJUA 5LLQA 3HSRA 3EO3A 4L0ZB 4NXMK 2X4YA 4YOXA 2F2WA 3J7AO 3FZVA 4OPJA 2X4XA 3DRPA 3LH0A 4C92F 2Y2ZA 4Q0BA 1YRNB 3JRGA 4IQ4A 3BJ6A 1QWEA 5F0HA 2G3RA 1JCGA 1MSFC 4Q4ZF 3AARA 4QT7A 5C0MA 4UOBA 4XTXA 4C8LA 1U4BA 4KB0A 2L4MA 3O4WA 1JJ2M 4RCHA 4UNFA 4F3TA 4BWMA 2P6TA 1M3CA 3V4GA 2HSPA 5AQMA 5J4YA 1OR7A 2XGDA 1T0FA 2IS4A 1J9IA 3WU2C 3BTJA 4II3A 1FTZA 1UOCA 1UELB 1QVFA 1KQ2A 2BZYA 3BZCA 1UHMA 2MA3A 1U0JA 4DNCA 3E97A 3V9UA 2FO0A 4XL9A 1U5TC 1VQ6N 5GAGJ 2JW4A 2CFOA 4OO1J 3K4CA 4N9HA 3CMMA 2O9SA 1H89C 1TUUA 3WT0A 2X51A 2BY3A 2UXNA 1FZPB 2KYMA 4PFOA 4GV3A 3DKWA 3OTOK 3IKTA 2FZCB 2DMPA 4FK2A 1WKMA 4OP0A 4HT8A 1UMQA 3CW7A 1GLNA 2DXIA 4OPKA 4NB4A 3E1YA 3WTXC 3CJTB 4CD1A 2LTPA 1Y96A 2P5OA 1KU9A 2WC9A 5M3MJ 2NVYJ 3KLFA 3QYBA 4FPAA 2K79A 3LDPA 4KO0A 3AG3H 3H9QA 5HLTA 3LZJA 3K2AA 2KLAA 1N34K 3CCVI 3UB5A 2FBHA 3CMEA 3CD6T 2QSFX 1SAZA 3C95A 2A40A 2Q0RA 1ETVA 1ZG1A 1XMOK 4RTYA 1SSHA 3J7AP 3CDLA 5A2QK 3A1PA 4B23A 4B4CA 3KKSA 1T56A 3IWFA 5LRRA 2L5QA 1OH5A 1UGQB 1K9AA 1HDPA 3AG1H 3T1YK 3PFSA 3ZT4A 3ZETB 2QKBA 2ZJPL 1B72B 2BE7D 1DP3A 1V4RA 3IAM2 1VIFA 4DFKA 4M7XA 2NOEA 1D5AA 3MXJA 2DMQA 3L42A 3CC4N 1RI7A 1WH7A 3E5XA 3E0JB 4NUBA 3JCMh 2RC4A 3F8CA 4GBQA 3PM1A 5GAN8 4A57A 4M7AB 5AIQA 4LFBK 1TP4A 3WVDB 2M9HA 3ZSRA 1XDSA 4RS8A 3DXKB 2WV0A 4EIKA 1ZKGA 1I39A 4HF0A 3NTIA 1RCHA 4A3JJ 3J81O 4F17A 2M16A 1TKXA 4HV5A 3WXIA 2VJJA 1Q7YU 4PJOA 1ZG3A 1K4US 2VWBA 3R60A 1FP1D 1A5WA 2CW8A 3THXA 2KRHA 4GRIA 5FFZA 3ZL7C 4BRPA 4DR1K 3FDYA 3QESA 1OYXA 4BACA 1W2BP 3FHFA 4KN4X 1S9EA 4OB1B 4LD6A 2O8FA 4HUFA 1Q7YO 4Y17A 3VS0A 1C0UA 3CVSA 4O4GA 2P9IA 1I5OB 1GL5A 3GL1A 4QWQA 1WHHA 1QLYA 3G4ST 2Z0WA 5GAMg 1GUUA 4KGZB 1XTDA 3SQ0A 4CJVA 3Q3SA 1SD4A 3I8BA 5IT9K 1X9WA 1ZYRF 4K8XA 1ESVA 4KFCA 2I2LA 1K9MR 5BPIA 1PSEA 4ZDOA 4J2EA 1MUZA 2X4JA 4HX7A 1YTYA 2ZCFB 2CO5A 2ZMEC 1ZBIA 4ZYEA 3KLHA 4CEBA 4BYYA 3CCVQ 4BQZA 5GANh 4OFAA 2RGVA 1P92A 1BC7C 3QKJA 1M3AA 3E2UA 2EB7A 1LFBA 1UTIA 4RTXA 2QGGA 2DOAA 3NGPA 3ATUA 3ABKH 3VUZA 2DYIA 3G2BA 4OIPF 4RA2A 4AIHA 3JTHA 4WFAL 2YUNA 4GO1A 1OH7A 4G94A 1WSUA 2P0WA 4B6MA 2CUEA 1SD6A 1ASVA 2YLCA 4JI8K 1HNXK 2P51A 3PIPF 1YITA 2WACA 3M57A 3IAYA 4LF8K 1X4OA 3PO2J 3VGKA 1D1BA 1WRJA 5KYUA 1MGQA 4PQUA 4Z4FA 4WWCA 4EM0B 1QQOA 5D6WA 3AG4H 4E7SA 1NK9A 1CKBA 4JNEA 4HOBA 2FJ1A 4RG8A 1C0MA 3EG9A 3VODA 1WNSA 5C4JJ 1WFWA 3QSUA 3QO3A 2R7XA 1ERDA 1NGAA 2K3XA 3H08A 4JK9A 3CMEI 3G6ET 2FSKA 5AN4A 1ORNA 4E4HA 3JSCA 2RQWA 5F1RA 1XNIA 3B6AA 3E6CC 1X1CA 1P4AA 3FXMA 4RUGA 1KHIA 4AG2C 3KETA 2ZJQL 1I1SA 3PUFA 4EVVA 5GTHC 4DR2K 2NS7A 5IWAK 1OCRH 1S7AA 4F7ZA 4EMHA 4XLCA 4B1WB 3LAPA 3AT1B 2GFUA 2G8VA 2RHIA 4II1A 2JA6J 5AQPA 4IHXA 3CJNA 3JCMX 2H09A 5DD8A 4CCOA 2M0YA 1NK5A 4FWMA 1AKHA 3HTVA 4O8KA 1FK9A 3VGMA 4CGHA 2D1XA 2OF7A 1IDZA 4E6RA 3B73A 3C18A 5I3UA 3KXTA 3DRSA 5LGNA 2MWPA 5IP7J 3VTIA 3W6JB 5DM6L 2IGIA 3LALA 4A5AA 3B02A 3BR6A 2QGFB 1HQCA 1JKQC 2IJLA 3CP2A 4RB1A 3JXUA 2NOZA 2FVUA 1NEGA 1IRFA 3F8BA 2KAFA 1WJAA 1TZLA 4HUGA 4O44A 2SEMA 3W3DA 3TAPA 1OVQA 5D6EA 4JKFA 5AYFA 3WXLA 3NF6A 5LEJA 2NWMA 1OYWA 2LD5A 3OBWA 1ETWA 3PQJA 1QRYA 2P4WA 4CE9A 1ZBFA 4Z4IA 1SZ2A 1ZA2B 2JZYA 3MHXA 3BG5A 1RT4A 5KAFC 4ANJA 2XICA 1MV0B 3REOA 5DCMA 3CMAA 2OA8A 3A01A 2V75A 2L9SA 1GLJO 2V4JC 3K59A 5DV5A 4E7IA 4Q47A 4IHWA 2DMOA 2GTDA 3HOSA 3FLGA 1TT5B 5TISC 2Z1GA 2O03A 2GA1A 3REAB 3G7ZA 3SMPA 4QS7A 3E5QA 4IHVA 1M2OA 3NMZC 3CMEQ 5FB2A 1U1TA 1I50J 3TGNA 1JCEA 3LX7A 2NNNA 1EO1A 2FBKA 3L6QA 4BU2A 1IJWC 1F1BB 2G9WA 5JR3A 1DT9A 1QQNA 4A0YA 2CGLA 2J6OA 2I5JA 5D8LB 1XSDA 2UWMA 3CCQN 1KONA 2E41A 3P8DA 3IH2A 1KYZA 2A37A 4BQQA 2VYPA 1NBWA 1QPMA 3VEVA 3KE2A 1DU6A 3BDLA 2DK8A 4HVUA 1LNXA 4RW9A 1QP2A 4FZXC 1X3WB 3L7WA 3TEDA 3MCAB 1EF4A 1GLDG 4TSXA 1KD1C 4IXAA 3VUBA 4ZJZA 4FISA 1J5YA 1UUEA 5I21A 1MU2A 2DBMA 1WYXA 5FDLA 2RPNA 4AHRA 1HKSA 2KJCA 1Q82C 3NFCA 3OR2C 4IVNA 2NOBA 2JK3A 2JLEA 3AO2A 5GIPA 1K8AU 1JGGA 3U1DA 3C1DA 3T7ZA 4AM6A 5GADJ 2R7QA 4DKWA 4EZ9A 3SWNB 1PKSA 5GANj 2YPRA 4K41A 1O3SA 4CGZA 4BHPA 1LMZA 4M78A 2NAZA 4BY1J 2IRFG 4N41A 4L18B 3THWA 4Z02A 3R1XA 1DLOA 2LDMA 3IH7A 1RNLA 2QLZA 4BHCA 4HF2A 3GPLA 3QB0A 5AQOA 1NK6A 5TJJA 5JLWA 1ZTRA 1XTAA 4BQLA 1PC0A 3HOVJ 3H45C 4L9TA 2RQVA 1VQNA 2YLBA 1U2VB 1MDMA 1OQKA 3K4LA 2GUPA 5BMZA 3GTLJ 3BW1A 3GCMA 2W00A 2RM4A 1BG3A 2LBFB 3LA7A 2NUPB 3IDHA 1S1TA 4MO7A 2OTJT 1XMAA 2E3HA 1AU7A 3F22A 1TUYA 3H92A 1GDTA 1M1KC 4EMKC 3AVLA 4KPYA 1QZZA 3PO3J 1KG7A 4FSVA 2LF7A 1WIEA 3QWXX 3OW2S 4HG2A 5HL7L 2M0CA 3H3VK 2Z2SB 4KHSA 3OS2A 2M9UA 2VOPA 1EBMA 3ONQA 2RK2A 1L3VA 3GZ6A 5AQLA 3DEEA 1FW6A 4CBXA 2NVQJ 1LWYA 3ZR8X 4M3FA 1CLQA 3QFPA 4OMPA 1YCYA 3HOXJ 1WHKA 1NGBA 7AT1B 3TANA 3SEQA 2LCSA 2E5ZA 3DPLC 3RDIA 2NLUA 2OPQA 3ZLJA 2GEMA 4KFBA 2L9VA 1BWFO 3GBGA 4J9HA 2XUBA 2JHJA 3O2PE 4JX6A 2BTFA 4E1JA 3IH4A 3S6IA 1KVCA 2EJFA 1WI3A 2X9HA 3CEYA 1UECA 5A0LA 1MMDA 1MGTA 3RZDJ 2WBMA 5CYQA 5KGXA 3HBTA 3V8LA 4LY7A 5LL6S 2PZSA 3CCEN 3Q7CA 1D1CA 1RILA 2H6BA 4BRLA 4BAYA 3MKLA 1ABQA 2AO9A 5ILUA 2DFUA 2IAIA 3PMTA 4KJZA 1J53A 2YNFA 3VF4A 3F0ZA 3I4PA 3PSFA 2MF2A 1HNZK 3EETA 4C5IA 3EFOA 4CIEA 3CCJN 1Z77A 2YSQA 2ZSIB 3ZCOA 5BNGA 1UG0A 5JS1A 4MQ9F 3QHSA 1SL1A 2ITMA 2K5LA 4DSIA 2LH9A 1Q86U 2EYWA 2K9QA 2DPUA 1LFUP 3VQBA 4CH7A 3CERA 3S16J 3FSPA 1NOZA 3CC7T 2ZO4A 1N5YA 2XKOA 2I10A 4C8QA 3FZHA 3IKVA 2DL4A 3V8JA 4KA4A 5E41A 2E7XA 2NUTA 4MTDA 3NFAA 2DLLA 4Z89A 4PLLA 2KYBA 2FNPA 3OWTA 3T69A 4R1HA 2CW0F 4J83A 1MWMA 4RCBA 4B3AA 4KISA 3ML6A 1ATSA 3RKYA 3WTVC 1TK5A 3AA5X 1RUNA 1XG7A 4M73A 2H1KA 1RABB 3LPTA 1QVTA 4YFXF 4ZZLA 4PIIA 1BQMA 2TDXA 3MWTA 1NZ9A 5SZTA 3CMAQ 3CQZJ 3CJBA 1UE9A 4C92A 3VQDA 1VQNI 2FPEA 5M5WJ 1Y96B 4IWVA 4FSSA 1Y0UA 4DQRA 4LN2A 2ZZDA 3KEYA 4FPBA 5AQKA 3X25B 1KD1O 3K7AJ 2DTOA 3N97A 2GBYA 3HFNA 4IZ9A 1MMNA 3AO1A 2NLXA 2E3IA 3BCBA 1BL3A 2XRNA 3DXJF 2Y9ZA 1BM9A 2K9GA 4OINF 3FISA 4A4GA 2DNUA 3I3LA 4A3MJ 2LKSA 1W0TA 2K85A 3X24B 1XX5A 4AFUC 5K5RA 1RAGB 4V19K 2LC2A 4RAYA 2SRCA 3JAMZ 1XQPA 4BDZA 1HKQA 1D0XA 1Z91A 1OKJA 4CHPA 3NGIA 2YRDA 1NK8A 2XASA 2GGRA 1VQOI 4ZGJB 2C06A 1GBRA 4A3DJ 4I01A 2P0KA 3P4IA 1DQUA 4K8ZA 3IAS2 1BJZA 3CQXA 1UAAA 1F36A 4L5IA 4A2BA 1LWVA 4MEXF 4MTEA 1W7PD 3REBB 3V8KA 3I55A 3J80O 4B8CA 4PJOB 4EVIA 4QIWN 2MCNA 5LJ3e 3THXB 4AM3A 3BY6A 4GV9A 3TTDA 2QK9A 2CUDA 4HVJA 2YUOA 2O8FB 3QICA 2X3XD 1WGSA 4Y4RA 4BVOA 2R7DA 1VSFA 4L8RB 4XTVA 1G3TA 1YI2A 2P9IB 3SQ2A 5CVVA 2GTOA 1W1WE 1QKWA 1YAGA 3LP3A 1M1KO 1OCOH 4B9QA 2H27A 4I9QA 2XIGA 3IS9A 3FBIB 1RKWA 4CF1A 1B9FA 4J9EA 1YJNA 4J2DA 4TV7A 3P9CA 1A6IA 1NOYA 2DXBA 2G8KA 4LIVA 2BYVE 2QWMA 2HXIA 3DLAA 2IA2A 2L01A 2VBYA 1NE8A 1KGSA 3HHTB 3MN6A 1T6SA 3J7AY 1VQNQ 4CJ5A 3G73A 3IL2A 3P7NA 2V8KA 4E19A 2B7EA 1WI9A 2NNWA 9ANTA 3CYMA 2RK1A 5AQZA 4M3YA 2L0AA 3VS7A 4JYKA 4B08A 3GLLA 5CQEA 2JJ9A 5DMRA 4ZH4F 5JHFA 4AILC 4DSLA 4C0GA 3FM3A 4RTUA 1RFQA 3TAEA 2CWEA 2L9RA 5E20A 4P9UA 5CZ2A 3OYHA 5E8IA 2GIVA 1WHMA 2GNCA 4BC2A 1PUFA 4MHGA 4J8OA 1QU3A 4V2GA 1MBJA 3QIOA 4H0PA 2AHJB 4A6DA 2R3SA 3HKZA 1UG2A 3QLHA 2HR3A 5KN8A 1U06A 1Q82R 4X9CA 2EQKA 3KK3A 5KYUB 4D5CA 1TH7A 4JUVA 1STZA 5ECAA 1R6RA 4HPQA 1J6ZA 1T2KA 1QGPA 5GIOA 1QVFM 3EG9B 2DJQA 2RF2A 5JHUA 4DEXA 1NLOC 3FXUA 3RERA 2RI3A 3D45A 3VQ4A 1T44A 3EGXA 3C0BA 3IUCA 2E2HJ 1BIZA 1DPRA 4JLHA 4PLIA 1JJ6C 2F4IA 4Z4HA 4QOZB 3KKRA 5AZIA 3UF4A 4KAZA 2BEOA 3V42A 3JS6A 5IHIA 4QVDA 4DV3K 2E1NA 3BEXA 4WCEL 4CI6A 1PJRA 1NGJA 4AYBN 4F4KA 3SBGA 4A69C 1YIJA 3ZMVA 4WCGA 4YPRA 4JI3K 1QO0D 1K73C 2PYLA 1SAUA 1RI9A 1XQHA 4N0AA 1ZGJA 3NWSA 3O3KA 1C0TA 4AUXA 2KFZA 3I59A 3K10A 5GAHP 3LDQA 1BO5O 3MN2A 5AQGA 4IRIA 4AFZC 4FX0A 3G71N 3ASNH 2KGTA 5BR9A 2FBYA 1Z9CA 1SVMA 2LRQA 4IO8A 4MFBA 3RNJA 1AKHB 2J6FA 2A5XA 4DQIA 1NG9A 2XDBA 3NPFA 1NPPA 2RD1A 2QZ8A 1OZ3A 2VG6A 3OOPA 2WB1A 4CXFA 4OMMA 2KQRA 5KCOA 3J7ZO 3H0HA 3JRIA 3PIPA 4FYYB 1LJ9A 1MH4A 1BUPA 3EUHC 4XSZF 2HW3A 4XKVA 2XSDC 4KRFA 1MHNA 5FKKA 5J4VA 3JRAA 3A4CA 2FXUA 1K9MU 1WB9A 3OS5A 1XMKA 3NH1A 4AHSA 2KHOA 2XU8A 2K27A 4FSXA 4C0ZA 1QVGM 1X2NA 1EZZB 1U1SA 3HM8A 3VQ5A 1LE8B 5ICEA 3G1LA 2HMAA 4BI8B 1YI2I 1UGVA 2HPIA 2CUJA 3NRVA 5J2NA 1LPLA 1R0CB 4MQ3A 2PFBA 4FE7A 1TXQA 2VYTA 5H20A 2VQFK 3QOPA 2K2MA 4KHYA 1YJNI 2FE3A 5ADXH 1GBQA 5DCMB 4Y52J 3A01B 3CJAA 3KK1A 1QNTA 1MUNA 2JG6A 4U88A 5KVRA 1BW5A 1NGGA 3CF5F 1R00A 1R0AA 3I8DA 2E1MB 1W4MA 1HD3A 4OJRA 2ADUA 1MV3A 2P9PB 1Z6TA 4BREA 4UXNA 3TO9A 2KRCA 3CI5A 3CIPA 3M4YA 4RKUE 2LOOA 4N9IA 2BV6A 3D5LA 2IC3A 2HDWA 5JVTA 2A61A 4IZZA 2X0LA 3OYDA 3A02A 1UEBA 1KU2A 4EP4A 1TWAJ 4PK4A 1SF9A 2HGCA 1OH6A 5JLXA 2CQNA 2Z1DA 3CCUT 1YWOA 3P8HA 1W9HA 4FLVA 4W5OA 2E1OA 4G7HF 2W25A 3V7RA 3SV4A 1WSJA 2WA0A 3T3FA 3O9UA 2RQPA 2HDCA 2NUZA 5IYBJ 4B3TK 1RACB 4RWTA 4M77E 5DY9A 2AXLA 4FLYA 2E60A 1VQ7A 2QI2A 5ED4A 3KTQA 2LX9A 4JX4A 1IBMK 2DPNA 2Y0SN 2K9SA 1M3QA 1OCZH 3GP8A 2EQIA 2P9UB 5ELZA 2B86A 5H2FC 2VLAA 3SDBA