4IKFA

Pfv intasome with inhibitor mb-76
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title 2-Hydroxyisoquinoline-1,3(2H,4H)-diones (HIDs), novel inhibitors of HIV integrase with a high barrier to resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein/dna/inhibitor
total genus 101
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ikfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ikfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ikfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ikfA03
4CJ5A 3OYKA 3NTIA 4OLBA 1L3UA 1NK4A 3LANA 3RR8A 4E1MA 5FROA 2XRIA 2F8SA 2G8KA 3F9KA 4DSIA 3IG1A 3K5MA 1WSEA 1RTDA 3P5JA 3TAEA 3VA0A 1NK9A 4EP4A 1VSMA 3DLBA 4M3XA 2BIVA 3Q1JA 2B5JA 3VQ9A 1MU2A 1T8EA 4FZYA 1CXUA 4CHQA 3TAMA 3K58A 4N41A 3KD1E 3I0RA 2HNYA 4CHNA 3LGFA 3RR7A 3UIQA 5CYQA 3AO1A 1W0HA 1S6QA 3KLIA 4F2RA 2DFEA 1LW0A 5CYMA 1UA0A 3TAGA 4DLEA 2D0AA 1QSYA 1B9DA 2OPSA 3PX0A 3RTVA 2XK0A 2R58A 3LDSA 2M0OA 3PO4A 3L42A 3HO1A 1TL1A 3DLMA 2Y1JA 3NF6A 3PX6A 1U48A 3JYTA 3DLEA 1U04A 1WN7A 1LWEA 1JLGA 4OPJA 2KZMA 2Z1GA 5C25A 2ITGA 3L2WA 4CERA 1ZBHA 3DI6A 4II1A 4M45A 3NCIA 3DLKA 4B3OA 5J2PA 3LP1A 5I3UA 3MEGA 3OYGA 3DRRA 4JRPA 4M41A 4O4GA 4C5EA 2E6MA 4B9VA 2NUBA 1REVA 3KUFA 4KTWA 3V9ZA 1WJSA 1ASWA 2KZZA 2JGUA 1RT3A 2KW4A 4NCBA 4M42A 3NH1A 1X9MA 2BE2A 1WSJA 4Z0UA 3V1RA 4K8XA 4J2BA 3E9GA 2RHXA 3LGLA 1U4BA 3SQ2A 4CGIA 3PO5A 1N5YA 4KKOA 4C8MA 1L3TA 2RO0A 4FU6A 5D6XA 4AHTA 4N47A 3SUOA 3NNQA 4HUEA 4CK1A 3OS1A 2YKNA 1VSJA 3P1GA 4CCHA 4CEAA 1J54A 4DU1A 3WNFA 3SPZA 5JS1A 1QQCA 3HVTA 1NOZA 5HRNA 2FBTA 4PY5A 2YRVA 2EQJA 4IG0A 1VSLA 4A4FA 3VQ5A 3K5OA 4E7HA 4N4IA 4QOZB 3VQDA 2DAQA 1X9WA 4DFPA 2HHVA 1BIZA 4FJLA 4FM1A 2G8UA 1IKXA 2XY5A 4FZXC 3MAQA 1J5OA 4CJ4A 3LAMA 1KFSA 1RT2A 1C1AA 3TABA 1S1TA 3T19A 1BL3A 3SYZA 4KI6A 1HNVA 2X6NA 4Z4CA 3AO5A 1TAQA 1N27A 1BGXT 1H3ZA 1DTQA 3PMTA 1SV5A 3QEIA 3QINA 2ZQBA 1NK6A 5C24A 3WNEA 4QAGA 4CGJA 1N6QA 1WJQA 1YTAA 1OI1A 1TGOA 2RI2A 3NAEA 4Y1CA 2RHZA 4N4GA 4CECA 2HHSA 1L3VA 2YNGA 1IKWA 5FRMA 5HRPA 4E89A 1TKTA 3P8DA 1JKHA 4ID1A 2D9TA 4IUQA 2HB5A 4QVZA 4B08A 3I8DA 4RW7A 4Z4EA 2YNIA 1RTHA 4YNQA 1Q8IA 4Z02A 4HHTA 3QKJA 1QE1A 3OB9A 3LZIA 4Z4GA 4E7KA 3RMBA 3ZCMA 3VQBA 4LSLA 4FLXA 4ZTFA 4N5SA 4FM2A 4HUFA 2XO7A 1NK5A 4KB0A 1S1VA 4QW2A 4LD0A 4F2SA 4PLIA 4X34A 2GV9A 1FKOA 3EAEA 3BDLA 1RI0A 1SUQA 4KHYA 2D5RA 4CJSA 3RRHA 1SL0A 3ZSZA 3DRSA 2G3RA 2ATQA 4LSNA 3DYAA 3ME9A 3BDPA 4CJQA 1B92A 2IG0A 3OVNA 4CE9A 3NE6A 1SL1A 3HXMA 4DQPA 2KTQA 2F96A 1UWBA 4F3OA 2ZD1A 3HT3A 5T7BA 4I7FA 2HNZA 3CM6A 3ZSVA 4CF8A 5HLFA 3SD4A 4N56A 4B9UA 1S6PA 3O3FA 3VQ8A 1UA1A 1LWCA 4GMJB 4NYFA 3L8BA 2X4WA 4DSLA 4L8RB 4FXDA 4QCLA 2FBXA 3DLRA 3OQ5A 4H4MA 1FXXA 4KHUA 4OPKA 4CJVA 3S6WA 1LW2A 2M16A 2OYQA 1JL1A 2BDPA 2Z1HA 1F21A 2IC3A 4Z4HA 4MQ3A 4CJTA 3IAYA 4BDZA 4N76A 2P51A 3MEAA 1IH7A 4W5OA 3HM9A 5M9OA 5J26A 5HRRA 1IO2A 4IFVA 2QKKA 2IDOA 1QSLA 1RBUA 3ASKA 2PY5A 4OJRA 4G1QA 1GOAA 1BCMA 1RDBA 3OS2A 5KE3A 2XY7A 3KK3A 3ALYA 2OA8A 2L89A 3QBYA 2YKMA 2EQKA 4Q0BA 1D8YA 3OYFA 3QO9A 4DWIA 4FJ9A 5J1EA 1RCHA 4K8ZA 1BISA 5C6SA 1DTTA 3VA3A 3P83D 4E3SA 4FLVA 3AVIA 3O8VA 3KIOA 4FJKA 4B9NA 2GF7A 4DFKA 3SQ1A 3KLGA 4CJ3A 3SZ2A 3TAQA 2JTFA 3SPYA 3IS9A 4CF2A 1NK0A 3NF7A 1ASUA 3OYHA 3S3MA 3LPUA 1IG9A 4DSFA 1C1BA 5KTQA 3MXJA 1NK8A 1NJXA 4CGGA 4RW4A 4E7IA 2WOMA 3P8HA 1VSIA 3WNHA 3U6FA 1A5VA 1SKSA 2E6LA 4FM0A 1OZ3A 3LP2A 4E19A 3ZT4A 1LWFA 3DLGA 4DSKA 2G8IA 3V1QA 3ZSXA 4OKEA 3ULDA 2PYJA 1LAVA 5KRTA 2XY8A 3MEEA 2O4XA 3KK1A 4KPYA 5IN1A 4CF9A 4LD6A 4CFAA 4RW9A 3T1AA 3TANA 3OYMA 4IUPA 1RDCA 5DK5A 3NDKA 4KFBA 1JLQA 1QHTA 3NH2A 2FBYA 4BWJA 5KCHA 2RF2A 1DLOA 1C0MA 1SL2A 1WGSA 4DTJA 4Z4FA 2OPRA 4C5IA 4CGFA 2EX3A 4CK3A 4CFBA 2E5QA 3IRXA 1L3SA 3BGRA 3B6PA 2RJFA 2A1RA 1HQEA 5C42A 4DU4A 1G5VA 1U45A 3ZT3A 5HRSA 4CRIA 1D9DA 2HVHA 2LRQA 2RHUA 1VRUA 3KJVA 4DTPA 2I5JA 3CQ8A 4CJEA 2PZSA 3F73A 4IFYA 3O4NA 1RBVA 2RKIA 4QQ6A 1WSFA 3DMJA 4OKJA 4ELUA 1T03A 4B8CA 3V4IA 4AHCA 3O3GA 4DTUA 1WAFA 3NH0A 3HSTB 3FEOA 2EFIA 4Z4IA 1VK0A 4I9QA 5KI6A 2YHBA 4CJWA 4GW6A 4EP5A 2EQMA 3TWHA 4CGDA 4OVLA 1KLMA 4DTSA 4ICLA 2B8AA 1RT4A 2LDMA 4NCGA 4DFJA 2HW3A 4KTZA 4QQGA 1NKEA 2X6SA 4PA1A 4L59A 4EZ6A 3M8PA 1T7PA 2RI5A 3HVRA 4CEOA 1B9FA 4CJUA 3SUPA 3QNNA 3DOKA 5KE2A 4DTMA 2ETJA 4XIUA 4CJFA 2HHXA 2D0BA 3M8RA 1RT1A 1S5JA 3O3HA 2QQSA 4LY7A 3MXIA 4JS4A 4AHSA 3OYJA 2IGIA 2R7YA 3KK2A 4CK2A 4IURA 1TK8A 1KFDA 3VQ7A 1RBSA 4H4OA 3H08A 4I2QA 1NK7A 3AVNA 4FJMA 3TARA 3E9FA 5CY4A 3CG7A 2OPPA 1XC9A 4RG2A 3KTQA 4N4HA 4KRFA 3K59A 3QEPA 2W42A 2RPIA 1HNIA 3V9SA 1TV6A 3L3UA 4M3YA 4R5PA 3EZ5A 1K6YA 4BE0A 1JLEA 1HYSA 4LH4A 4CIGA 4J2DA 1EP4A 2DIGA 2HHQA 4CJKA 4UQGA 3KLHA 3K2PA 4HUGA 4KTQA 2X4YA 4PL6A 2A1SA 3L2RA 1QS4A 3VQAA 1I3AA 1IKYA 4W5TA 3PFSA 5CZ1A 5HP1A 3AO2A 3OJSA 1TK5A 4FK0A 2WACA 3MP1A 4DSEA 3MP6A 3ZSYA 2VG5A 1JLBA 4ELTA 4CEDA 4QQDA 4DF4A 1RDAA 3SI6A 4CESA 3KKSA 5FRNA 4NZGA 1WSIA 1UAXA 3A2FA 4BDYA 4EDUA 3C94A 1U49A 1D5AA 3F70A 4Y1DA 4BE2A 2O4GA 1Y97A 3TI0A 4B9WA 4CJPA 4M3ZA 1TK0A 2FHDA 3DM2A 4C8KA 2RJEA 3OYDA 3K5NA 1WSHA 3AO4A 4IUUA 4CHYA 2RHIA 4FYDA 1BQNA 3OYIA 2VWKA 1SSFA 3C95A 3OYAA 3ASMA 3NTKA 1X1PA 4HCBA 4NCAA 4UC4A 4YFUA 4NS5A 1JLCA 2P5OA 2BGGA 2WONA 4DTNA 2LCCA 3FDRA 2VG7A 3SV3A 1NJWA 1JXEA 1RTJA 4ELVA 2YNHA 1NKCA 2VWJA 4C8LA 3OYCA 4FLWA 3MXMA 1KRPA 3U3YA 3CFRA 1TL3A 4IUTA 1EX4A 1L5UA 3AO3A 2RHYA 3ITHA 4B9MA 5KGWA 4BE1A 2HQXA 4A4HA 4FJ5A 4DG1A 1TKZA 3CM5A 1HPZA 2YHAA 1NOYA 2PYLA 4FK4A 3MEWA 4DSJA 2LVMA 3S3OA 4CIEA 1NJYA 1ITGA 1BIUA 5D3GA 4C8NA 1CLQA 5KCOA 1QSSA 1ASVA 2G8VA 4F8RA 1C6VA 4HCZA 2GFAA 1VSKA 2DFHA 4IDKA 4M3TA 2Y1IA 3V6DA 3HPHA 1XHZA 3VQEA 1HQUA 2RI3A 3AVAA 4CF1A 1HMVA 2QQRA 3PMIA 3L3VA 3RMAA 1FKPA 3M8SA 4KO0A 4CHOA 1C1CA 3QEXA 1YVUA 2HNDA 1JLAA 5FDLA 3NFAA 2LSNA 1A5XA 3JSMA 4FW1A 1C0TA 1Z26A 1NJZA 3LZJA 3I0SA 3TR8A 2R5AA 3HL8A 4F3TA 2X35A 3EYZA 3ZSWA 2HHUA 3FC3A 4PQUA 1OZ2A 4DMNA 1QTMA 3OJUA 2QKBA 4E7JA 2PQWA 2JZ2A 1VSFA 4M3UA 2VG6A 1VSEA 1ZYQA 3SQ0A 4OVAA 3LYIA 4AHRA 2RN2A 1Q9YA 2KQ2A 2HVIA 1KLNA 5J2MA 2K3XA 2BKDN 3DB4A 4BACA 3SV4A 1VRTA 3AVGA 4DQIA 1TKXA 5IAYA 4ZHRA 4DQQA 1U47A 3LPTA 2X78A 3QLHA 4CEEA 5J2NA 1KVAA 1I39A 1XHXA 4RG8A 5KGXA 5J39A 4ID5A 5CZ2A 4Q5WA 4I9LA 4DLGA 5HROA 1VSDA 4CEFA 3HP6A 3AA4A 1KVBA 3PUFA 3V9UA 3DOLA 3SUQA 1ZBLA 1KTQA 3V9WA 2E6NA 5JS2A 2G8FA 1CXQA 3MEUA 5EU7A 2XHBA 3QNOA 3ZT2A 2Q3SA 5DMRA 2F8TA 2RJCA 1BI4B 3AVCA 3ZT0A 2B6AA 2VYTA 2BUDA 5D6YA 4DQSA 1W9HA 4RW8A 4W5NA 4PLLA 3QIOA 3ZSOA 4FJNA 3PY8A 1RTIA 4TSXA 3UT1A 4A4GA 4F4KA 3KLFA 1KCFA 3DLHA 3MP8A 3HPGA 2EKOA 3OA6A 1S1UA 4OKKA 4KHSA 4FJ8A 4HTUA 1XI1A 1WLJA 3HJFA 1JLFA 3S9HA 3LP3A 1RT7A 3WNGA 3H8ZA 2F5KA 2ZE2A 3V9XA 1S9GA 3PX4A 3SQ4A 5I42A 3GOXA 4CF0A 3NBPA 2KFNA 4LH5A 2HHWA 2X74A 2G8WA 3T3FA 3NF9A 4FJIA 1UOCA 4O0IA 1O1WA 3RMCA 1T05A 3SNNA 4C8OA 3LWMA 3PNWC 2RJDA 1RBTA 2FBVA 3KLEA 3NGZA 5E41A 3UWNA 2Z1JA 3TAFA 2OPQA 1RNHA 3LAKA 3AA3A 4CHZA 1TKDA 1RBRA 1HYVA 2GFUA 4DS5A 3QERA 4B9XA 3S3NA 3K57A 1SKRA 5CIUA 4CGHA 2X4XA 3HK2A 3AVBA 4O44A 4DTXA 3D0PA 1JL2A 1IKVA 2P5GA 2EHGA 1BQMA 4CFDA 3ISNC 1YTUA 3LX7A 3ZT1A 4I2PA 4DS4A 1J9AA 3VQPA 3AA2A 4DFMA 4H8KA 1D9FA 3L2VA 3ZSQA 3OMGA 4O0JA 1HJRA 4GVMA 1ZBIA 2XDPA 2EQUA 2YNFA 3V81A 4CEZA 2GBZA 4CJLA 1ZBUA 3CFOA 1BI4A 4BDPA 2HQEA 3AVFA 2NLUA 1KHCA 2M1HA 3HPOA 3OMCA 4KHWA 1GOBA 4DF8A 1YT3A 4KREA 4AHVA 4J2EA 3CFPA 2DTUA 4KHQA 3QEVA 1J53A 1Q9XA 3FFIA 2R57A 3SJJA 2IS3A 1EKEA 1OYXA 1HYZA 2B4JA 4FK2A 4M3RA 4WE1A 3H6ZA 2JLEA 2QK9A 2E4LA 4C5GA 3NGYA 2O4IA 4JRQA 1VSHA 1WSGA 3QEWA 1RILA 2DY4A 4DTOA 1R0AA 1S9EA 3C6UA 3AVMA 3M8QA 4BWMA 2P1JA 3RRGA 3META 4CEBA 3HYFA 4W5QA 2GUIA 3EY1A 3QJ6A 3LALA 2XY6A 2G8HA 3DB3A 3AVHA 4FVMA 2LTOA 4E7LA 4B9TA 3MEVA 4O55A 1RDDA 1LV5A 4HCCA 2MWPA 4IG3A 4AHUA 5SZTA 2L8DA 4IUVA 3ZEHA 3NHGA 4CEQA 1XWLA 4JS5A 4KB1A 4DTRA 1C0UA 5KRSA 3AVKA 3RMDA 4C5HA 3DRPA 3FLGA 4IBNA 3L2QA 3O4QA 4IKFA 1TVRA 4B9SA 4FLZA 4EZ9A 3QIIA 1S1WA 1CZ9A 1BCOA 3KD5E 4ZTJA 3K5LA 2YV0X 4FL6A 3L2UA 2OZSA 4FCYA 3VQ4A 4CFCA 4FJ7A 4CIFA 3PV8A 5SWMA 3AVJA 2P0KA 3LP0A 3QETA 4FLUA 3TAPA 3C6TA 3LWLA 3CYMA 3AV9A 4NYNA 3ZSRA 4A4EA 4CJRA 4FW2A 4JLHA 2MWOA 3NGIA 4DQRA 4J2AA 4GY5A 2CKKA 1WAJA 4FLTA 2DIQA 2BANA 1SKWA 3G0ZA 3OYEA 5KH6A 1G15A 3V1OA 1A5WA 1WNSA 3D45A 1BHLA 2Z1IA 3SCXA 1LAWA 3RWUA 4MFBA 4O5BA 1KVCA 3THVA 5HBMA 3OY9A 4BD3A 4OGCA 3VQ6A 3B6OA 3AA5X 4RW6A 1NKBA 2IAJA 3KKRA 3U3GA 5C0MA 2O4XB 4W5RA 3E01A 1XNIA 4CHPA 3QIPA 5D6WA 4OGEA 4B8AB 4DU3A 5J2QA 4KAZA 4PUOA 4FJJA 2AJQA 2DFFA 4B9LA 4FLYA 1WJRA 3VQQA 2K3YA 4M3WA 2QXFA 3NTHA 1EXQA 1EETA 3NF8A 4FJXA 3VQCA 3SUNA 5K14A 3G10A 3M9QA 3OS0A 1S1XA 4KV8A 4E0DA 1GOCA 1CZBA 2KFZA 3OYLA 2FC0A 4AH9A 4FJHA 3MO8A 1FK9A 2L3RA 1HRHA 2OZMA 3HP9A 1MHNA 4FZZA 2HMIA 1ZBFA 3MEDA 3OYNA 3MECA 3QESA 3VN5A 4KI4A 3LLRA 2IOCA 1JXBA 1RT5A 1X9SA 4E1NA 3C4SA 4FJGA 1KSPA 4Q5VA 3AVLA 4HVJA 4OLAA 1RT6A 2R5MA 2HHTA 4PWDA 1Z25A 3CEYA 4AILC 3OYBA 3LH0A 1TAUA 2D0CA 4KHNA
chains in the Genus database with same CATH superfamily
3OYKA 3NTIA 3GIBA 4C3IJ 3WU2C 2JNGA 4C92D 2R7XA 5DUKA 3WU0A 2CO5A 5F0XA 2EGAA 3J7ZO 4PJNA 2CGKA 2XRIA 2R7TA 2IGNA 2JRTA 4P55A 5E1XA 4DSIA 2DVJA 1O7FA 2QK0A 1RTDA 2AQEA 3VA0A 3VGMA 2KLOA 1QHAA 3I56A 2HPMA 4RCBA 3E5XA 4IRIA 4FZYA 1CXUA 4BHBA 5AQVA 3CD6A 4D9JA 3F8BA 1N33K 3TP0A 4CHNA 3LGFA 3I55Q 3RR7A 3F8CA 5CYQA 2QEXT 3AO1A 4C2TA 3NPFA 3VYGA 2M1BA 3KLIA 1I27A 1UA0A 3LFKA 2VT3A 3VS5A 1QSYA 1B9DA 2OPSA 3PX0A 3CUQC 2PUOB 2R58A 1MH3A 5GMKh 3PO4A 1U9NA 2A68F 2V75A 2OBPA 2XD0A 1GUUA 3BR3A 1TL1A 3DLMA 4Z6YA 2Y1JA 3L00A 2VUMJ 1FPQA 5B1AH 3ZYYX 3A8GB 4BR9A 3ROUA 1ZRCA 2R7UA 5KN9A 4II3A 3W2VA 1FY7A 3CCJA 2D1XA 5B5EC 3EUHC 3GVAA 2LZ6B 3L2WA 4U0YA 1X6BA 3K70D 3LAPA 3VEYA 4WFBL 4II1A 1VQ5I 1VQ7T 2HWVA 1YIJT 4UB8C 3LP1A 1NGBA 4LDXA 3IKVA 5I3UA 2XKPA 2KVQG 2NRXA 3JRZA 4GCVA 4F9OA 3CC4Q 4PJJA 1OX9A 1NJIR 2DXCA 3DRRA 4M9ZA 2IBDA 3AG1H 4YOQA 2VQLA 2NOFA 2W1OA 4ESFA 1YITN 2NUBA 1REVA 1FC3A 2PN6A 2VB6A 3V9ZA 1WJSA 4GYIA 4NB4A 1RT3A 5CQEA 1K8AU 2YRCA 2EYXA 4MEXF 5GTHC 3CCLN 1H9TA 2BE2A 1PJRA 3P31A 4I0AA 3I55I 2H94A 4Q4ZF 4K8XA 2EIKH 5I9EB 4J2BA 1T3SA 1IW7F 2OTJI 2RHXA 3LGLA 4JKBA 4BC2A 1K8AO 4B8XA 3SQ2A 1YJWN 2M8EA 3GXOA 3IMXA 2QTDA 3K7AJ 4K25A 3HKZN 2JXBA 4DOWA 2GWJA 5BR9A 1R36A 4N47A 4KICA 3HGYA 2GBQA 2BXYA 3AAFA 4LXCA 3NWSA 2K86A 1L0OC 2IVNA 2P9LB 3B73A 4FL9A 1KYZA 3OS1A 1XMKA 2YX4A 2QGGA 2HSTA 1YJNT 1JHFA 4DU1A 3WNFA 5JS1A 1BB9A 2UZKA 1U6GA 5M5XJ 1IZ1A 1ZK8A 5HRNA 2FBTA 4GKJK 1YQRA 2P7VB 1AEYA 2TRTA 3VQ5A 3HRGA 9ATCB 4RTVA 2P5VA 5D5UB 1TL8A 4L18B 3CC2N 2KISA 2DE0X 4B48A 2DAQA 1SVMA 3BG5A 1X9WA 5EG0A 4FASD 1KAZA 2ZB9A 4CJ4A 3CC4I 3LAMA 1KFSA 4A3DJ 3T19A 1ZSGA 2KYMA 4CZMA 5BPNA 3SYZA 2WADA 2BVLA 1GLAG 3D1NI 3CCUT 3R8EA 3GTOJ 4HT9A 1I5LA 4A63B 4GV3A 3BROA 4AFUC 1MNDA 4HV6A 2Y0SN 5AQGA 1F43A 2BEOA 2HSPA 1SV5A 1S29A 3MN6A 2RQTA 3S1MJ 1JQQA 4PIIA 3S2HJ 1WJQA 1M1KC 5H6QA 1H92A 3A01A 1TGOA 1MWKA 2RI2A 4Y1CA 5F04A 2OX7A 2RHZA 2YCHA 4N4GA 3CTAA 4NUBA 2CWEA 2D6FA 1IREB 1BUPA 1L3VA 2LQKA 1WQ2A 2YNGA 2FRWA 3UNGC 3JAME 3CBPA 4Y92A 4D8KA 3H1QA 1EIFA 5EGOA 1RRQA 2CGLA 1I0CA 3OHRA 3ATUA 4LDWA 9ANTA 2CV1A 4KNYA 3FHGA 2EZIA 3JB9D 4IHSA 2KKOA 5LJWA 1HNWK 1Q8IA 1NMNA 1NJIC 2M7AA 1USSA 2IPQX 4D5FA 4C2UA 4RGXA 3KWIA 4LB6B 1MA9B 4Q5SF 4Z4GA 1YHQN 3CMAA 1C0FA 3VQBA 3TKYA 1K76A 4ZTFA 2BW3B 4N5SA 2Q0UA 1BI2A 3RVCA 2DT6A 3ZQLA 3I3LA 5GMKi 2NRHA 5H6RA 4KB0A 2QQ8A 4QW2A 1X3ZB 1T39A 1IRXA 4XSZF 1W36C 4PLIA 4F7UG 4X34A 1QHHD 2LY9A 4M7DC 1V5EA 1FKOA 3MDQA 2Q0OA 3G6EQ 4AM6A 1M30A 1SFEA 4M7AF 5GAOp 4YOTA 2I0NA 4HF1A 1SUQA 3L6QA 2Y30A 1B59A 1HBXG 5KQDA 3DRSA 4J6WA 3EG2A 5F6FA 3ME9A 1T3VA 4CJQA 2V6CA 1B92A 3PIPL 3BDPA 2X6OA 3HXMA 4HX4A 3CMEQ 2KTQA 3BF3A 4F3OA 1P92A 3KP5A 3HT3A 3P9IA 3GBGA 1ON1A 4GLMA 2RVCA 2DDAA 3HXLA 4PJOF 4PHTX 3THXA 1HOMA 2E3IA 4N56A 5CKEA 2XSJC 4B9UA 3E1SA 1BI3A 2DERA 3LSMA 1ORPA 1J5EK 4QKUA 3I71A 4L9NA 4GMJB 2KIQA 3LSIA 3UPUA 3A98A 4FT4A 4D0PA 3DP7A 1TQIA 4NQWB 3RQ4A 2COZA 4A2BA 3CCRT 4RB2C 2IIRA 4OMOA 1LW2A 1TW3A 3KP4A 3LDOA 1YRNA 2W48A 2OYQA 1RI7A 2Z5UA 4BRCA 2XIDA 2R93J 3AG2H 2IC3A 2E5ZA 2F2WA 2NOLA 2D1VA 2FEZA 2Z33A 4N76A 4BDZA 3WGHA 5L3FA 2P51A 3MEAA 1IH7A 3HM9A 4ZNXA 4H5TA 2LCSA 3HB9A 5J26A 1K78B 2E34A 1DP7P 2LBFA 1BBYA 1Q81U 2V9VA 1IO2A 2CP7A 2YUPA 2QKKA 3H5RA 2IDOA 3ASKA 2HMPA 4IHXA 1K9MU 1GOAA 1Q81O 3G71N 1EH7A 4JAXA 3VFZA 3BR2A 3OS2A 2GWRA 3CJ9A 2KQRA 1R0CB 2L89A 4MZMA 2KQWA 2ZCFB 1HF0A 2EQKA 4CC7A 1K9MO 3QO9A 4FJ9A 4BGAA 1GXIE 3MKDA 2QEXA 1DTTA 3DKWA 5KYXB 2L3DA 2FD5A 2NVQJ 3ZGKA 5HY6A 4FLVA 4PDKA 3BTLA 1XUPO 5HLIA 2V1UA 3O8VA 4DZJA 3KIOA 2GXBA 3DAWA 2I5UA 1VQ5T 3FZLA 4ZYGA 3N5BB 4BRDA 1RGIA 3IS9A 2FZCB 1WZ2A 5IT3A 4EGZA 4AG1C 5AQZA 4HXJA 2RNAA 4BI3A 4IOAL 2P7CB 3LPUA 3V4GA 4C0FA 1JUSA 1IG9A 1KQ9A 4FYXB 2HYJA 4MTEA 4JKGB 3MXJA 1NK8A 1N34K 2KBTA 8ATCB 4M78F 4RW4A 2MFZA 1I1GA 3M55A 4E7IA 3WXLA 3P8HA 5KVRA 1VSIA 2MLGA 5H1SQ 3RCOA 1A5VA 4B3RK 1SKSA 4XK8E 1VQ7A 5F1JA 1IJJA 1TT0A 2WA0A 1YIJA 5IP7J 2GAUA 1LWFA 3WHCA 4BY7J 1WBDA 4DSKA 4M74A 2BH1A 1HSQA 2PYJA 2OTJT 4A12A 4N9IA 1NZ9A 2DYIA 2O4XA 3KK1A 1HK9A 2RA2A 4CF9A 3QPLA 5ICGA 4PL8A 3O9UA 1LB2A 3CESA 2E1YA 4OWRB 3BCBA 4PKCC 1RDCA 4ON0A 5FLXK 4CJ7A 3J8AA 3PIPF 1YX3A 2LREA 1QHTA 5CQXA 4LUDA 3GTMJ 2R4GA 5KCHA 3DU6A 1IXCA 2NRZA 2V4JC 1S22A 1FJLA 1C0MA 3FXLA 2E5KA 1SL2A 1N9SA 1MBJA 4DTJA 4Z4FA 1JJ8C 3WT0A 4UUVA 3E3VA 3A5LC 4C30A 2J6KA 3M0TA 4HVUA 3P4IA 2E5QA 2OTLQ 2DMOA 1K8AR 1SFKA 2H56A 5AJ3K 2CQKA 1XX5A 3IHOA 2JUFA 3H3VK 1P6RA 2ZJPL 1H1VA 3M54A 1G5VA 2A5XA 1U45A 3K2AA 5HRSA 1VQOQ 2Q36A 1YJNA 5JLWA 3M8EA 1OLTA 3ASOH 2DBMA 1VRUA 2QTVA 4XTUA 3ATVA 2DPUA 4B22A 3CQ8A 4CJEA 4PSXA 3F73A 4RTWA 4JKEA 2W04A 3DXKB 3FBIB 5E8IA 5GIOA 4C3HJ 3O3GA 5EZHA 3NH0A 3HSTB 4LF9K 1MNEA 2EFIA 2ZPBB 2HGCA 2KROA 4I9QA 5KI6A 5CKBA 3TWHA 1IO6A 1KU9A 2JUCA 2LVSA 3ZCOA 2ENMA 2AO9A 4RGSA 4QTRA 3CDLA 4ICLA 2PUKB 4CZHA 1MDMB 4DFJA 4JX6A 5D4RA 1RUWA 3CLQA 1QVFM 4B21A 4BG9A 4HWIA 3CCUA 3QDRB 4RTFD 4L59A 1UGQB 1T33A 4OPAA 3VOVA 4ENJA 3CVSA 3UKRB 2ZSIB 5FU6C 3LSTA 2VL8A 2XAHA 5D8KB 2NVTJ 1AWOA 1Z91A 2A5WA 1YF5L 3GCMA 4DTMA 1NGDA 2EIFA 1QPIA 1AVZC 4DV5K 2RNGA 1UMQA 2OTLI 4JZ3A 1K4US 1S7OA 3LAJA 4IIOA 5DLQE 1VQNN 2K5IA 1PC0A 2O8XA 1KFDA 1I4K1 4C8QG 3EG9B 1I07A 3CCEQ 4PFZA 1VQ8N 2R7ZJ 3CCJN 4OPHA 2K5LA 1VQOI 4FJMA 4PL7A 4BNCA 2LCLA 5C12A 2YU9J 3E9FA 5DY9A 2OPPA 4IOAF 4M7AG 4AVPA 4RG2A 4N4HA 4CICA 5M1OA 2AXLA 3C0CA 2UXBK 1WJFA 2D2WA 4GKKK 1HNIA 1BR2A 3BP8A 3T7ZA 4M71A 1TV6A 4D7MA 3L3UA 2M0CA 3ESWB 1M1FA 4M3YA 1LVAA 4FWNA 4R5PA 5GAMj 3JTHA 1MGQA 3CJRB 3SBTA 1PHTA 4MIMA 4Y28E 1P9QC 3VSLA 4CJKA 5FWCA 5I2MA 3MCPA 3KLHA 3CIPA 3K2PA 4KTQA 1OOTA 4C23A 1I3AA 4CZLA 4W5TA 3CBMA 2WC2A 3L0QA 1YX5A 1NYFA 4KA4A 4PJOG 5HP1A 1OU8A 3AFHA 2EIMH 3ZQFA 2K02A 3OJSA 3FIWA 3S15J 4HTLA 3MP1A 4DSEA 1JB0E 3MP6A 2XDVA 2ASOA 4A0ZA 2WBMA 1JLBA 4IZZA 1X58A 1SQKA 1LOJA 1UGVA 1ZC6A 3LSRA 4XRSA 1R1TA 1LNXA 3HSBA 2KNBB 4CEDA 3GL1A 4DHYA 1AA7A 5GAN4 4QQDA 4AI4A 2E60A 3KKSA 1ZLMA 3VPZA 2VXZA 5D4SA 1KG7A 4WCGA 1WSIA 2J06A 1JI8A 4AFZC 4Y1DA 3L7WA 1Y97A 4BQLA 5LHGA 4G9YA 4C92F 3CF2A 4C8KA 5CQYA 3CCEI 4AYBA 2K7AA 1HW1A 3COAC 3OR2C 1PUFB 1WHGA 2X1CA 4K43A 1E6GA 1E3OC 4R1HA 3AO4A 2XVCA 2RF0A 4CHYA 2ZJPF 3GFJA 3VESA 2O6GE 4I6ZA 3NVMA 4M7AC 4O5FA 3OYIA 3M7GA 4CZIA 1VQ4Q 3CCRA 2D1KA 3F9MA 2CZ7B 3ASMA 5KYUB 1X1PA 2PJRB 7AT1B 3EYYA 4U0WA 5DCMA 2PG4A 1O7LA 4NS5A 2A07F 1O3QA 3SYTA 1JCEA 2NOHA 2P5OA 2BGGA 3UATA 2LCCA 4PNOA 3Q7BA 3SV3A 2MMPA 4BROA 1NWKA 1FIAA 4RM2A 3OYCA 3ZX3A 1V5GA 1TL3A 4PJOC 4CVNE 2OUMA 2HQAA 4IUTA 4RS8A 3OA9A 1OR7C 1RAHB 1IXRC 3AO3A 5F2RA 4HNTA 1XGSA 1Y39A 4WF2A 3I64A 5D5WB 1ZG1A 3EZWA 1JEGA 4BE1A 4A4HA 4FJ5A 4MHGA 5L3BA 3T9NA 1HPZA 4JHDB 1NOYA 4XLAA 4V19K 2PTKA 4FTHA 2LVMA 3DBLB 3E6BA 2DTOA 2HVRA 1YJ9N 2K9NA 3QYEA 1Q81R 1AT1B 4W1UA 1FT9A 3TW7A 5KCOA 1PYVA 1QVGA 1ASVA 4F8RA 3CUQA 4ZZLA 4D5CA 4KIFA 4BJTA 3FGUA 3ULEA 4RM3A 4BRHA 1DGWY 3HRSA 5DEQA 4RCHA 4QSHA 3CJCA 1K9MR 4M78G 3V6DA 1UJ0A 3HPHA 1A35A 3BPXA 2KIMA 3A8OB 3EGXB 3A8LB 5IWAK 2RI3A 3RZOJ 3M5RA 2LF7A 3MFKA 2EFOA 3RESA 1HMVA 4JNEA 1EH8A 3MCZA 3CPWP 3PMIA 1VQ5A 1MZBA 2B9SA 3TEEA 2NVUB 1GVDA 1OULA 1APLC 3EUHA 1SAZA 3SEZA 3NFAA 4HAMA 2LSNA 4CI0C 5E3MA 1GCPA 3JSMA 3K6GA 1QCFA 2ECZA 3TR8A 5CAIA 3HG9A 1ZSZC 2E41A 3A03A 3ERMA 1YW7A 1USTA 3HL8A 3J7AP 3DTIA 2LRDA 4UVCA 3EYZA 2Q2EA 4RB1A 1GL5A 2L7MP 5FU7C 2JWTA 4MMLA 4XH5A 3GP8A 1NHAA 3KCCA 4DGWB 1UTIA 3EEQA 1DU0A 4M4ZA 4WQ4C 1RKWA 4RLQA 1NG2A 1UHWA 3OJUA 4Y7NJ 4C8QB 2P4RA 1XG7A 2PAVA 2OTJA 4AIDA 2EJGA 2EV0A 3E1YA 3SDZA 2O31A 2VKEA 3FXOA 2YRDA 4JI2K 4I76A 4OVAA 2HKOA 3CCQT 2EINH 2ELJA 1Q9YA 3VW4A 1KLNA 2M51A 1X3MA 2IJLA 3SMPA 1IDZA 2HKQB 1RRJA 4F16A 5KPRA 3G4SQ 4M78C 2YLCA 4DQ2A 1MDUB 3J7YP 3A8MB 2ZFUA 4A3EJ 3KFVA 1G2HA 1HCRA 2BE9B 4CEEA 5J2NA 1MBFA 4OMZA 3TDUC 1I39A 2A36A 4LDYA 1R22A 3V7SA 1TQPA 2ETHA 1KC8C 5AQIA 1YFNA 3MCAB 1PDNC 1K4TA 3IDHA 1B07A 2KDOA 5HROA 2KRSA 1IXDA 1K8KB 2HPIA 3O8HA 3TGNA 2OV7A 4N0BA 1ZBLA 2K4BA 4I01A 2KGTA 2G8FA 1VTNC 3HUGA 3K4KA 4IHVA 2VPLA 5LJ3d 2IS2A 1YNZA 4J6XA 1WRJA 2IT0A 4AT1B 5GAOr 1UJ8A 2FU4A 4NQWA 1YI2N 5DM7L 3KLNA 3M1CA 3D7SB 5EU7A 2DA6A 3ZT2A 5DMRA 1X43A 4XTWA 5AQYA 3EHQA 2HYFA 3TTCA 3VWBA 1B8IB 1T0HA 2B6AA 2G9WA 4GV9A 4QIWN 2BUDA 4RUGA 4QS9A 4XONA 2KXDA 3O3KA 5IPAA 2JVHA 4E9HA 3PY8A 4TSXA 2VOPA 2ECCA 3UT1A 2CQNA 3IV5A 3F3XA 2E12A 4CCJA 4B3XA 4ZC3A 1OYYA 1KQ8A 3MP8A 1XCVA 1WJAA 3G4SI 4HTUA 4OINF 5DTDA 1XI1A 1WLJA 3DKXA 1JLFA 4P1WA 3V9XA 2VYPA 5K7FA 3QDKA 2LMDA 1VQPN 5EF6A 5DLOA 3D2FA 1TWGJ 3GOXA 2XGXA 1M3AA 1QQNA 3QWLA 3NBPA 4LH5A 3PM1A 1U9OA 2XROA 2X74A 3GPLA 4FJIA 4KFCA 2C0IA 2VCPA 3LWMA 2OI3A 1VQLN 3AL0C 1YWOA 3D2EB 3TAFA 2OJ2A 2OPQA 3CWUA 2GQVA 2DJQA 5M1FA 1ZGJA 1TKDA 3Q9SA 2HMAA 2CP2A 3LL7A 3GNGA 2DMPA 4CD3A 3QERA 4LD9K 1XG1A 3HOSA 5IYBJ 4L6V5 2FVUA 5GMKe 1SKRA 3BT9A 1UECA 4C92G 3HK2A 5C10A 5LRRA 4ESRA 3N05A 1ARKA 1JL2A 2MLKA 1K1ZA 1PSEA 2EHGA 1W4MA 2YLBA 4CFDA 2DILA 4UUSA 4I2PA 1OQYA 4C0GA 3AA2A 3CCLQ 3PQJA 3ZSQA 2ZF5O 4YFKF 2RQVA 3FZVA 8AT1B 1ZBIA 3SZTA 1GLBG 1V76A 5EEHA 1YJNN 5J3BA 1PRMC 2YNFA 3F8NA 2Q31A 3LSPA 2QGFB 5FPDA 2GBZA 3OIQA 1JUPA 4NXMK 4IQ4A 3NEUA 3FBNB 4PUSA 1M2VA 2XB5A 1T6DA 3CP8A 2HVQA 2E2JJ 1YT3A 4AHVA 1HSTA 2DL3A 4PK4A 3QEVA 1Q9XA 4JRKA 2R57A 1PP8F 4KH0B 3GMEA 1Z9ZA 4F7UA 2B4JA 5GAEJ 1NK2P 4XU1A 4M3RA 2STTA 4BI4A 1UJYA 5FJ8J 4X0GA 1YUWA 3DWLA 3CCUN 3CC2Q 1T38A 4FE7A 1S3JA 4C5GA 2RKHA 3E19A 4JRQA 5BRFA 1ETWA 4JYKA 2W40A 5DM7F 3QEWA 1RILA 1BW6A 2ZNZA 3WTZA 4C92C 5KAFC 1R0AA 4A3CJ 1S9EA 4MDAA 4A3GJ 1JXSA 1ZXOA 4JUVA 2HU9A 2P1JA 3RRGA 5L8RE 3H36A 4FX4A 3EY1A 2GUIA 3QJ6A 1UFMA 2G8HA 1IRZA 1GFCA 2HSEB 3AVHA 4FVMA 1HJOA 1NTCA 5IHIA 4G6QA 4DV0K 2GUPA 3LL3A 3SXYA 1MDMA 3LDNA 3PUBA 3SMSA 1OV3A 1C0WA 1F1ZA 2L8DA 1XMQK 3BW1A 3NHGA 3LQRA 3JB9H 1C0UA 5KRSA 3GYHX 2P9PB 1NGIA 4DV6K 1IBMK 5GAMf 1P4XA 3FLGA 1OH6A 2JA8J 4P5OA 2KHOA 4IKFA 1TVRA 4B9SA 5J4VA 2A7YA 1OH7A 3QIIA 1S1WA 3OIPA 3EHRA 1ZR2A 2QM1A 2EJRA 3K5LA 5LRSA 5CKTA 1ETXA 1X3WB 2YV0X 4FL6A 3VTHA 3EE8A 4FCYA 3VQ4A 4CIFA 1VIFA 5ILVA 3KNTA 3E66A 2R5ZA 1YHQQ 2P0KA 3LP0A 5GAOn 4JKDA 4A3BJ 1BW5A 2NOIA 5LD2C 3C6TA 4L9TA 3CBOA 2XICA 2E1HA 2M9UA 2L3QA 2MWOA 4J2AA 1NGGA 3K70C 4I7HA 1OKJA 4KDPA 4BY1J 1U84A 2DIQA 2LP0A 4KMFA 3F0ZA 3A2KA 3WQTA 2XIGA 2SEMA 1ZN2A 3OYEA 2VQGA 5KH6A 3ZXSA 2GLOA 1G15A 2WTEA 1JKOC 2XDBA 1FLIA 3CWAA 1WNSA 3K69A 5JLXA 4HRIA 2Z1IA 2LQWA 3CCQA 1LAWA 3OY9A 1W0TA 4XSXF 4OGCA 2DMQA 1MSEC 3BE3A 1VQMT 2VASA 4KUDK 2DXUA 2Q2RA 2OFKA 2YUQA 1NKBA 1GV2A 3GTGJ 3U3GA 4FWMA 4W5RA 3IHUA 4G8XA 3J80E 3QIPA 2MC3A 3TSUA 5F0HA 4KH4A 1Q86U 4FLYA 2BY3A 1WJRA 1EBMA 1U5TC 3PSIA 4DQ8A 5JMVA 3MQ0A 1Q7YU 2BZ8A 1WFXA 3FJPA 2HL3A 4MTDA 4X66K 4C3JJ 2QXFA 1JXMA 3WTTC 1LEAA 4LF6K 4DR4K 1Q86O 2ED0A 4E7ZA 1KG1A 3VQCA 2IA0A 4DR7K 4O8UA 1Q7YO 2JT4A 3M9QA 4G12A 2QA4T 4E0DA 5AQXA 3FXUA 2KFZA 3OYLA 1UAAA 5I2SA 4F3QA 3KZYA 1KFZA 5BS6A 3A4CA 3JB9G 2OC6A 2ZGWA 3SB2A 2M34A 1F36A 2XASA 4E9FA 1T98A 2RNJA 1EH6A 1OPLA 2DPNA 3L2CA 2W10A 2G0EA 3KP3A 4FZZA 2ZCWA 1AWJA 3MEDA 3OYNA 3MECA 3QESA 2DU9A 5K5QA 4ZH4F 1MJBA 1XB4A 3QRFF 2IOCA 1S6LA 1SHGA 1AU7A 3BQZA 2YDLA 1ULYA 4FSVA 5D5VB 4DCHA 3HSRA 3GZ5A 1TUCA 3G71Q 1RUNA 4B23A 4Q5VA 1MBHA 3AVLA 3P39A 1W2BP 3THWA 4JKHA 3E97A 4N4NB 4MFEA 2R5MA 1WXBA 4J9DA 2FRHA 4XNFA 1X2QA 1S5LC 3PFYA 2D0CA 1VQ5N 1W5TA 4KIBA 4OLBA 2WAQA 3HSCA 3KX2A 5LL6S 4B6MA 1BJZA 3DTEA 3W6JB 2XGDA 2LT4A 4JHDA 1I6HJ 4E1MA 4BKXA 3ZEUA 1W4SA 4M77B 4M7XA 5GAMh 2F8SA 5F08A 5EZGA 4CA0A 2A6TA 3KWGA 3P5JA 4KGZB 1Z67A 1NK9A 3CCMT 3DLBA 4M3XA 2BIVA 3H1VX 5JLHA 3I55N 4CSWA 2OA4A 1H641 1MU2A 1W7PB 4XRFA 3SDGA 4M75B 1Y8RB 1R9TJ 4OB0B 2OTJN 4LLNA 3EGXA 4S05A 3WXMB 1WXUA 2DZCA 3K58A 4J7IA 2BBYA 4ISGA 3ELKA 2CUFA 2JW4A 3SAGA 4OMQA 2XAFA 4A3JJ 1FW6A 4OMMA 3OL4A 2VKHA 4NB5A 1VNDA 1ORNA 2JJ9A 2DRMA 3FHFA 3ZN1A 4BQZA 1QCNA 1ZUKA 4WYBA 1WI9A 3WHBA 5AZIA 2K5FA 1LW0A 3AAPA 5CYMA 2F4MB 4BQAA 2NUTB 2D0AA 4B1YB 2ZMEB 3RTVA 2XK0A 3LDSA 4J00A 2WAFA 3GFLA 2EJ9A 3HFNA 1GBRA 1Z9CA 2Z3YA 1M5Q1 1QKXA 4Y52J 4EW0A 4BJ6C 5GAHJ 4LOCA 2D5VA 4JI1K 4Z89A 3DLEA 1U04A 2J7IA 1K73C 3X24B 1WN7A 4HQMA 1FOYA 4C8QA 1LWEA 2JPCA 2BHYA 4HNVA 3LDLA 4E47A 4HW0A 2DYRH 1R4MB 3MMYB 3CC4N 3CERA 5EXWA 4BUGA 1XGOA 3ECOA 1QZZA 4JN4A 4UHTA 4M7AA 4GGGA 3NCIA 3S17J 1OCCH 3PTAA 2WB1A 4B3OA 3BZCA 1Q18A 4OMPA 1DKGD 4XEIA 1K9AA 4XLHA 3NHNA 3MEGA 3OYGA 1QVFS 3PGGA 2EFPA 1RPWA 3EPZA 2E6MA 4F7UE 4B9VA 5A2QO 4Y13A 3KUFA 3KZBA 2KZZA 2KK4A 1MMSA 4EJWA 3DWLE 4NCBA 3WXIA 3MX2A 4GFBA 3I56Q 2XF5A 4HF2A 3C7JA 4Z0UA 4PJOA 1KU2A 4ENKA 1T6CA 4M3BA 3ZETB 1BYMA 4J83A 4C2MJ 1ABQA 2JUGA 4YFNF 5A2QZ 1UGRB 4FO0A 1N5YA 4NNJA 5BQTA 4C8MA 3JCMf 3CD6Q 1V54H 2FPEA 1YQAA 2LNBA 1L3TA 2JN0A 1ZELA 4A57A 1WB9A 4AHTA 1QZ6A 4HVVA 4CXFA 4HUEA 2YUNA 2DLPA 2RK2A 2VLAA 1HNZK 1LDKB 2QXLA 3P1GA 4CCHA 3HHHA 2CUJA 3NARA 2KJBA 3IFRA 3SPZA 2DMTA 4Y91A 4GV6A 1QQCA 1QP3A 4KUIA 4PY5A 3MKLA 4PFOA 2VBXA 3S2WA 1DJ7B 2NNYA 3X26B 1Q1VA 3S32A 1VSLA 1E3HA 2O8DB 4TV7A 2QWRA 5H20A 1Z21A 4E7HA 5J47A 5CK9A 4QOZB 1RUOA 4ZN1A 4BY9C 1M27C 2YHXA 1FNNA 3VB2A 5LJ5d 4DFPA 1IJWC 1O4XA 4ZN3A 4FJLA 4FM1A 3CCJQ 3VGLA 2XY5A 1MUNA 4FZXC 3MAQA 4FWLA 5A0DA 3NAUA 2CGJA 2ZGYA 3TABA 1MPGA 1ZA2B 4A3FJ 1BL3A 1ZSZA 4IIMA 5B8HA 2X6NA 1R8OB 2NUPA 2WWYA 2DT7B 2QASA 2LTPA 2NOBA 3LFUA 2KT8A 1N27A 3I56I 4A62A 5E8GA 5GP9A 5GAN7 1XGNA 5I21A 4WWCA 3J81O 3BG6A 2EGEA 5TKWA 2X3XD 3EUKL 4WQ4A 4MDXA 3VRYA 3D5RC 1NK6A 3HOWJ 5C24A 3WNEA 1UGPB 1ACMB 3ZN0A 1YTAA 4XLCA 2LT1A 4FWKA 3G1MA 2PU9B 2W00A 3BG9A 4A0YA 3N4QA 3NAEA 4M3FA 3CD6I 1GLFO 2X6YA 3H9GA 5BREA 1YXQA 2PZ1A 2CFXA 3WVDB 1MBEA 1IKWA 3J81Z 1TKTA 5HCKA 1TLHB 3WEEA 3VDXA 2BZXA 1TWHJ 2COWA 4IUQA 3LA7A 2HB5A 4U87A 1MUDA 3CPWM 2NRTA 4RW7A 3W3DA 2ASPA 4M78A 2K40A 2Q97A 1VQ9I 4AIHA 3O08A 1VQMA 3CC7I 3DFGA 1IUYA 3QKJA 2ATCB 3A02A 2KE9A 4ME7A 3LZIA 4D1QA 3ZCMA 1HW5A 5D6FA 5AQMA 1NK5A 3WGGA 2ISZA 1WHMA 2WFBA 4F2SA 2ISYA 3CMET 2MF2A 1QNTA 4WFAL 2X85A 3GE1A 3IWZA 5ED4A 4B24A 3BDLA 2EW3A 1JE8A 3PIPA 1RI0A 2R3SA 4KHYA 5TJJA 4DJAA 3RRHA 1JKPC 1SL0A 5DYMA 5LFAA 3M0UA 4BEHA 4YIFA 2G3RA 4KBMB 2ZFWA 3LA3A 2QA4A 2WV0A 2VE9A 2PQ8A 3I9V2 1Q86R 2D8HA 3WUHA 1O57A 3OVNA 5KYNA 1V4SA 2E36A 1Q7YR 5HL7L 4CBWA 3BDDA 5J8CA 2KZVA 2FB7A 1R23A 2HNZA 1CF7B 3IAS2 1MV3A 2CREA 1RI9A 5M1NA 3G4SA 3S16J 5HS7A 3JCMh 3RKYA 1UB9A 4FPBA 3O3FA 4IOXA 1F5TA 3LWFA 2V26A 5HVQC 3K10A 4A54A 2V7ZA 1WEIA 3GTPJ 2ZJRL 2PFUA 3FHZA 4FXDA 4QCLA 4J7FA 2FBXA 2E64A 3OQ5A 4H4MA 1ETVA 4OPKA 1H0MA 1YG2A 1AOJA 1X4OA 2M16A 4LG0A 4K41A 2MD0A 4YIRX 2GIVA 1YW9A 3OW2A 1M90U 2OCEA 4ZGEB 1JL1A 2M02A 3KYLA 1VQKI 2BDPA 2KT1A 5DS9A 1HC8A 5F0CA 1FBQA 2L0KA 3CMAQ 1M90O 1P59A 2IVMA 2R7VA 5E1ZB 1DT9A 5M9OA 3K9KA 5HRRA 3HJEA 5GINA 1T3LA 4JKAA 1DGKN 1NEGA 4CCNA 3CCMA 4KISA 3JSCA 2O9LA 3O1WA 1IN7A 1W0UA 4OFAA 2DA1A 4YEJA 1MV0B 2P9PA 2WSFE 4D6WA 3TO9A 1JJ2P 5KE3A 2XY7A 3OGDA 3KK3A 3JAMO 3QBXA 1GFDA 4JDSA 2YKMA 1S7EA 4Q0BA 3VF4A 5HLGA 2CSOA 1RCHA 5CO7A 4K8ZA 3M9AA 2JN6A 4L0YB 1Z7UA 3ULRB 2L3PA 1Z05A 3CMYA 3S41A 2F4IA 1WKMA 4MZTA 2XF6A 3JAMZ 1I1SA 4ELYC 4FJKA 2Z2SB 3SQ1A 4AD9A 3I5UA 3KLGA 1B72A 4CJ3A 3SZ2A 3TAQA 3JCUC 1NK0A 4C8QE 2IVWA 4AUXA 1LEBA 2M5WA 1KU7A 2KP6A 4FVUA 2CDTA 5KPZA 2A42A 5CQGA 5GAN8 2HBMA 1ZX6A 1PM3A 2WC9A 3CXCP 1NJXA 1TWBA 1HXDA 2QWNA 2AHJB 1B7TA 4M7AE 4OB1B 3U6FA 2JHJA 3CMAI 4RB3C 2MW8A 5KCMA 4YOXA 2E6LA 4FM0A 2DW4A 3RDVA 2UXNA 2QQBA 4QPQA 1KJWA 1M8MA 5AYFA 2G8IA 2MYSA 5BPMA 1XQOA 2HS5A 2EYQA 2A6HF 4UY8O 1E4GT 2XY8A 3IL2A 3IH3A 4R56A 3E5UA 1D3BB 2O8KA 1HR0K 1BWFO 2DODA 2LG4A 5GAMg 3G73A 2UU9K 3TANA 4CBXA 3FISA 4IUPA 4JD2A 4YOYA 2VGNA 2LKSA 5IHNA 4MNUA 4PJOE 1JLQA 3TO7A 3PVQA 2OTLN 4C92A 2HDWA 3NH2A 2FBYA 4BWJA 4BXXJ 4ZDOA 1OPCA 3BC8A 2KAFA 2ELHA 1PKSA 3KK7A 2DK3A 4B1ZA 2HOAA 1WGSA 2VWBA 3DCFA 3H35A 4CGFA 1VQON 4CK3A 4XTXA 3OSFA 3S93A 2F9WA 3HI0A 2V1QA 1N3CA 4JI4K 2X0LA 3T1YK 3M0RA 2QEXQ 2WAQN 4ZZDA 3GTKJ 4ELZC 2A1RA 2OD5A 1HQEA 3FXMA 1HLUA 3ZT3A 3L09A 2ZJRF 2X6WA 2ECBA 2RHUA 3KJVA 3OMYA 4XLNF 3U9GA 5ADXH 3BR5A 5KYWA 1ZUUA 3O4NA 3O6WA 1RBVA 2DOFA 2RKIA 5AQHA 1U1SA 1N8RR 1JUMA 2LFBA 4EMKB 4BVOA 3AARA 3V4IA 2DT5A 1JRIA 1GBQA 4DTUA 3O2PE 4RMOA 3I59B 1WX6A 5CVRA 2YHBA 1NM1A 1TYQA 1MUZA 4EP5A 2EQMA 1R4NB 3MN5A 2KL4A 4CGDA 4H0EA 2AHQA 3MWMA 2YJEA 2LR8A 4J6YA 5LL6Z 4RAFA 2B8AA 1RT4A 2LDMA 4YHHK 2RHKA 2O01E 2HF3A 1VQ7Q 3EETA 1BN5A 3BY6A 4KTZA 1TOVA 1YIJQ 3URGA 4OIQF 3CJNA 4L3QA 2O8EB 2X6SA 2V7FA 2LKPA 1RAFB 1OCZH 3CCYA 4PSWA 4OFEA 3M8PA 2JJ7A 3S8PA 1T7PA 2NS7A 3HVRA 4CEOA 3SUPA 1D3YA 1X9JA 4KT6A 3DEWA 4NL3A 4HSRA 4O3MA 4BQNA 4F92B 1BM9A 5KE2A 3X20B 1RETA 1JTXA 3CCEN 3SWNB 4XIUA 3EG1A 2RM4A 3BZ6A 3M8RA 3O3HA 1OYWA 1SMTA 1IC8A 4AFSC 4JS4A 2W24A 1VQ9T 3CC7T 4C0DC 1QQJA 3H92A 1IXSB 4HLYA 1OPKA 2CJJA 2H6BA 4CK2A 2EH3A 1A36A 2QEXI 1BIAA 3VS0A 4GLKA 2R0QC 5IXBA 4BC5A 3P8BB 4I2QA 5J1UA 1ZREA 3VF2A 5CKHA 2UXDK 3TARA 4M78E 5FKKA 5CY4A 3ZMVA 3LH5A 2NOJB 2D0OA 1NGAA 2ESNA 3MK6A 1ZLJA 3WQUA 2NUTA 1MJAA 2W42A 4Y17A 1M3QA 1YJNQ 1X1DA 2LLKA 2ZMEA 2DBBA 1EV7A 3V9SA 4XQFA 1EWQA 1HYSA 1W6XA 4CIGA 3SK3A 2RGVA 1EP4A 2DIGA 3R2XC 2X6XA 1NLVA 3TOBA 3GG4A 2A1SA 3L2RA 1BO5O 1VQ7I 5EVZA 2COMA 2ABLA 2DK8A 1YIJI 5GANd 3PFSA 4CCOA 2J5PA 3QUIA 1BI1A 2DPPB 1YITI 3AO2A 1VQ6T 4H0TB 4BQOA 3Q7CA 1TK5A 2WACA 2Y2ZA 4EVIA 3ZSYA 4DYQA 4FT8A 1S72I 4M3EA 2IGOA 2MGQA 4DF4A 3SI6A 3RNJA 3CCUQ 4FIBA 1UAXA 1YTYA 1U49A 5F27A 4BE2A 1SEMA 1U78A 1RR8C 4B9WA 2R92J 3CJQB 4FOIA 4M3ZA 2XRLA 1HKQA 2XRNA 1QZYA 2FHDA 3VYUB 2BVMA 2ACJA 1PNJA 2JK3A 1N8RC 2H1KA 4EM2A 3BJAA 2EVRA 3QP5A 1Z3YA 1Y6IA 2CT4A 1VQKT 2PNIA 4FYDA 2JVVA 5GAN5 1BQNA 2AIRB 3ZETA 4FM4B 1Y57A 4BR4A 1ZQ1A 2VWKA 1WCMJ 3C95A 3NTKA 2ADUA 4HCBA 1FN7A 4NCAA 1X4PA 4UC4A 3SZPA 1JLCA 1LPLA 4H0XB 2FNAA 5GAGP 3O6BB 1NG6A 1FWZA 3R0AA 2VG7A 2P0PA 1JXEA 1CZAN 2P9SB 2ZSHB 1NKCA 2E20A 4C8LA 4UXNA 2OCCH 4B9QA 4R0KA 4OIRF 3U23A 5B66C 3LDPA 4BHPA 2E5NA 1QU3A 1M90R 4ZYAA 1LE8B 3LCNA 1KQ1A 3JV3A 2FSNA 5KQ8A 4K0KK 3BG3A 4DSJA 4ENNA 3OV8A 5GAOm 3S3OA 1TW2A 1W2BM 4X1EA 1ITGA 3O9QA 2L9RA 3WXKA 5D3GA 5IP6A 4C8NA 1TT5B 1QSSA 1D4XA 2Z9OA 1PD1A 2M45A 3EG0A 2QZ8A 2XAJA 2GFAA 2NRAC 2RD1A 1BL0A 2IPOB 3JTGA 4KJZA 1STZA 2ESWA 3Q5FA 2Y1IA 4U7BA 3GEZA 3VOEA 3F8MA 4PFPA 4CZEA 4BH9A 2FG0A 5F1XA 3PLAA 1G2BA 3T5XA 2DL8A 2QQRA 4AU7A 3M8SA 4IZ9A 4KO0A 4CHOA 1S9HA 4WCEL 1MW7A 3GF5A 3CXCA 3I35A 1C1CA 1C0GA 1KG4A 1IRGA 3JCMg 2VXFA 1SZ2A 1JT0A 2CZ6B 1RAEB 1JLAA 5FDLA 5E3NA 1KQSP 2FBKA 1CQTA 4FW1A 3JSPA 1Z26A 4FT2A 2A6EF 1NJZA 5EOYA 4HCKA 3GTLJ 3MKYB 1KD1C 4JZ4A 1XTAA 3QZ5B 3CCRQ 5LGNA 1QLYA 3DU5A 2HHUA 3FC3A 1Q82O 5JICA 3V7RA 5CR4A 3M53A 5ERIA 4EM1A 5H2FC 1AZGB 2NUZA 3HOYJ 1X75C 3Q9VA 3HM8A 4Y0WA 2P5KA 3FLCO 3ENHA 2RDPA 1WWXA 2DOAA 2E1NA 2AZVA 1BOTO 4M3UA 4OO1J 5HOOA 4JK1X 1X2NA 4MLOA 2VG6A 3CF5L 3G4SN 3SQ0A 3CCVT 4C92E 2DL5A 2HQRA 5HS8A 1TXQA 4N9HA 5KYYA 2FXUA 4XKVA 2R7RA 1RKTA 3SV4A 2Y0MA 4G9ZA 2FPFA 2KRCA 3I4NJ 4MO5A 2KIUA 4OIPF 5DPKA 4ETSA 3ZQCA 4FE4A 4WFNL 1ZAOA 2KEAA 2DF6A 4ZHRA 4DQQA 3I0TA 3CDHA 1X6OA 2CYYA 5K5OA 4IPAA 1A31A 1KVAA 4OFHA 2F5FA 1TNTA 3PIOL 2P9IA 4RCCA 5KAIC 3BPVA 1XHXA 1R00A 4BRLA 5CZ2A 4DLGA 5JVTA 4CEFA 3AA4A 1VQ5Q 1KTQA 2E6NA 5DV5A 3TPQA 1TUGB 4F91B 3CCRI 1QP2A 2F4OB 3JRAA 4O8KA 3IUOA 1CXQA 4HYEA 4MDWA 1SEUA 3TDZC 3L4QA 3VEXA 1WPKA 2KMUA 4ESBA 4CC4B 2NOEA 3G1OA 2XHBA 5E18F 3CI5A 1IN4A 1HYOA 3I53A 3GW2A 2M9HA 2F8TA 1IV0A 2RJCA 3D7EO 1BI4B 3EGDB 3AVCA 4IEJA 3Q0VA 3ZQQA 2A37A 2HDAA 2XB0X 1DDNA 4DQSA 4W5NA 4PLLA 1LCUA 1RC9A 3ZSOA 3CCSI 2OTJQ 4B3SK 1P4WA 1OISA 4WTOB 2RN8A 4M7DD 4CHUA 4F4KA 2A41A 4EJUA 3KLFA 1KCFA 3DLHA 3DQVC 4BJ5C 2EKOA 1GXPA 4RBOA 1NE8A 4P96A 5EY4A 1H3HA 1QPMA 1LFUP 4MLEA 4HZFA 3HJFA 1ETKA 4E9EA 4J9FA 5GAMe 3S9HA 1VQ9A 1E3MA 3CC7A 3H8ZA 2F5KA 2D1HA 3K1NA 2L9SA 1D8KA 2QKLB 5IOYA 2E71A 5I42A 2KFNA 1K6OA 4M77D 1N78A 1VRLA 2EQRA 5MLCQ 4O0IA 3KPHA 3RMCA 4KIGA 4X64K 2GOXB 1NPPA 3NGZA 1CKBA 2Z1JA 5B3SH 1YITT 2D8JA 2GWKA 3E2UA 3LAKA 3AKZA 3VERA 1W7PD 1RAAB 1R71A 5JFRA 4M75D 3FF5A 2EFQA 1RBRA 1S72T 3RMSA 4H5RA 2DZ9A 3VRZA 2GFUA 4DS5A 3GX4X 3SJMA 3LMMA 3S3NA 1SD7A 2HHHK 4WXCA 3O9TA 1VAZA 2HI3A 4CGHA 2X4XA 1OCTC 3K4BA 1YJWT 3AVBA 3M8JA 4DTXA 2LQNA 1VQ6A 1XC5A 2CS3A 3MX5A 3OTOK 3SFMA 5K7HA 2JWLA 5DUIA 3CF5F 5CVVA 1IG8A 4GBQA 3MJXA 3ZT1A 4DS4A 1ON2A 1QVPA 2BYVE 3VQPA 2HVSA 2BY0A 4DFMA 4H8KA 2AZSA 2K85A 3ULQB 2DXIA 3OMGA 3A5MC 4MO4A 1Z1DA 4QVDA 1HJRA 4GVMA 2XDPA 4BRAA 2K2VA 5FW9A 2QYOA 2UXXA 2X1DA 2QSHX 4R55A 1NEBA 3MPUB 2DI3A 2R7FA 4EIAA 5EC7A 3E7LA 3VUZA 3K0LA 3F6VA 3R9PA 1QGPA 2M87A 4CJLA 1WNLA 4Q48A 2O8BA 4ZYEA 3CC2T 3M5AA 3CFOA 3F2KA 1VQKA 2E2NA 5HODA 3AVFA 1KHCA 4CCMA 3HPOA 3PIOF 3OMCA 1V5FA 1WJBA 3REBB 2ZJQL 1GOBA 5CR2A 2K3BA 1PSFA 4EHTA 4J2EA 4WK8F 3VYTB 1J53A 2XU8A 2DN0A 3FFIA 1A0NB 1EKEA 2GM4A 1GXQA 4FK2A 2P9UB 4WE1A 1BDGA 3EG3A 5JLFA 1MGTA 2E1MB 4OX9K 3JSOA 2F6CA 5HS9A 4A5NA 1SANA 1GCQC 1Y96B 4XKCA 2E4LA 3ABMH 1Z77A 3JREA 3ZP5A 2HNHA 2H8WA 2FUG2 1H8AC 5LEJA 1B9NA 1TNSA 4KITB 3GZNB 5FD6A 2CUDA 1AKHA 4BWMA 1MD0A 4EMKA 2ZPEB 2V9PA 3META 4PZJA 5L3CA 3HYFA 3OBWA 2HBJA 2ESHA 1LQ1A 4H5VA 2M30A 1K0SA 3U1KA 4CZKA 2ZXWH 1E3PA 1ZARA 3DB3A 2KJCA 3CP2A 3IKTA 1Y0NA 3LA2A 4E7LA 2IAIA 5GAHP 5GMKj 3CPWS 4J8FA 1XNQK 3I4MJ 1N36K 2CYZB 2E3HA 1LV5A 2PEXA 2MWPA 4FHTA 2P9KA 1FX7A 4CEQA 2UV1A 1D0YA 2E8AA 4IQJA 4MMKA 4DTRA 3F22A 1UG1A 4C5HA 1TQMA 2WSCE 2CGPA 3SFZA 3FMSA 2FE3A 3J81K 2XPWA 3FIFA 1IBKK 3L2QA 1HDPA 4LF4K 1RIOH 2MH9A 1POGA 1KQSA 2IGKA 1WVRA 4I98B 4HPQA 3ZQIA 1D5VA 1RACB 1NGJA 5L3EA 4XR6A 2D0NA 1J75A 1BCOA 3KD5E 4NC6A 1S3XA 4C8QF 2QCOA 5KHDA 2YSRA 4PJMA 1WQ7A 1I3QJ 3L2UA 3O4WA 2GA1A 2K9LA 2A6AA 3WODF 3PV8A 5SWMA 3R61A 3AVJA 2CQXA 1JJ2M 3ZLJA 4K2EA 3MN9A 5C15A 1IAWA 4BY6B 3PO2J 3ZR8X 3CDIA 5LHHA 3ZSRA 4CJRA 2MA3A 4B3TK 3VUBA 4DQRA 4GY5A 2FZGB 4JV5K 5CKDA 3NGPA 1WAJA 3KE2A 1BU6O 1Q82R 2ZO4A 3G0ZA 2LDUA 3QOEA 1FYLA 1NPRA 2RMOA 3ZPLA 4YIIA 2DMNA 4BRMA 4EFHA 2DA3A 3CCVA 5AFUH 1BHLA 3RMQA 2BGCA 3SCXA 5BN8A 1BOAA 3VMFB 3H45C 3THVA 5HBMA 2HEOA 2MAMA 3T8RA 4BD3A 2QENA 2HEQA 2CZ0B 2AKKA 1KU3A 4RW6A 3HIFA 2O88A 2IIMA 1XNIA 2WUSA 4Q47A 3BEXA 3CXCM 4F04B 5GMKm 4FISA 4KAZA 4BRPA 3BTIA 4FJJA 2LSOA 1A5JA 5EDNA 2AJQA 3M3YJ 2O9VA 1XSDA 3ML6A 2ID6A 4CBUA 3B02A 3HEFA 3PNVA 1LWVA 4M3WA 4GXOA 2C6YA 4LFUA 1EXQA 2ZJQF 1EETA 4H03B 1D1AA 4J9GA 3HTVA 5K14A 3TEDA 2L4MA 1ZG5A 5ILSA 1PVSA 3OS0A 4GY2B 3C1DA 3T1HK 1AZEA 3JS6A 1NGNA 3K0SA 2FC0A 3CCST 1YOVB 1ABOA 2KXCA 2DTZA 2L3RA 3JCMe 1HRHA 4W97A 5CJ9A 1HKBA 1MHNA 2JTEA 3ID6A 2K2MA 2XHKA 3K4CA 1MWMA 4KGXB 2STWA 1R1UA 4LMYA 1IZ6A 2EV5A 1RT5A 2NRVA 1REPC 3MN2A 3X2QH 1SVOA 4E1NA 3BWGA 3SHFA 3EO3A 4FJGA 1KSPA 1GLJO 4C1NK 2PMZN 1LCKA 1UFFA 3A5NC 1N9RA 1RT6A 3TSQA 2HHTA 2ED1A 3E9OA 3X25B 3CEYA 5LJ3f 4AILC 1QVGP 1R7JA 5TKYA 1R49A 4KHNA 4IRHA 1XCBA 1BIBA 3CCQQ 4CJ5A 2PBDA 1LE8A 1L3UA 4J19A 2KI7A 1NK4A 4DBRA 1T08B 4LJZF 5FROA 4RAYA 3JAMK 2VOOA 1GLCG 3SDBA 4A3MJ 1HKTA 3ECHA 2F9TA 3CWTA 1OQKA 1G3WA 3HRUA 3TU4K 2OAWA 4A53A 1VSMA 2LNVA 1IUFA 1TG0A 3Q1JA 2IVOA 1NGEA 1P8ZA 1Q82C 2B5JA 4LLLA 1I94K 1YITA 5M3FJ 4Y15A 2DVEA 3TAMA 5E3LA 2K9MA 4N41A 3CQTA 1S72A 2QLZA 1SKUB 5HKCA 3K1MA 2K9SA 3E6MA 3OSVA 5GPAA 4LIVA 2BTFA 2IS6A 1S6QA 3OH9A 5EG0B 4DKWA 2DFEA 1YJWA 4DLEA 2F48A 1U2VA 4L9JA 1IHVA 5LHIA 3K9TA 3HKZA 2V1DA 1OVYA 3WTSC 5CHZA 4LUEA 1QQMA 3L42A 1WQWA 3A0BC 3KLOA 3HO1A 4MZPA 3J80O 2UXCK 4II2A 4DEYA 3ZOBA 2EBPA 2GTDA 1U48A 3HZ6A 5AQLA 2BZYA 4LB5A 2LJ1A 1SF9A 5LJ5j 3CCQI 1G59A 4OPJA 4AWXB 4DBFA 5FD5A 3S1NJ 3H5AA 3UDCA 3C6HA 4A93J 5FKMA 2CSQA 3WTWC 3MAJA 1JTYA 1Y8QB 4BR7A 2Z1GA 5C25A 1YLFA 3A01B 2ITGA 3J80Z 2LF8A 4DOZA 2UUCK 4JQFA 4KHPK 1ZBHA 3GTQJ 4M45A 2FEIA 5L23A 1WSUA 5J2PA 1ONVA 2CGHA 3H3UA 4GYGA 3I56N 3EQLF 2O8CA 4XOPA 5EGOB 1KG6A 4M41A 3J7ZI 2LMJA 4O4GA 4C5EA 2CT3A 2M4GA 1M1KU 3MKZA 1ASWA 1KAYA 4LG3A 2NNNA 2PLYA 5HNFA 5AZJB 5HLHA 1FYMA 3NH1A 1X9MA 2X4JA 4DR2K 3CD6N 1SAUA 4Z94A 2Y0SA 1SFUA 1ODDA 4DBHA 1DU6A 3I0WA 1M1KO 5GADJ 2XF7A 3E9GA 4LFBK 3O8GA 1U4BA 1NGCA 1G4DA 1D8JA 5EG2A 2R7WA 4J5YA 3IH2A 5FPMA 2GGRA 5FO5A 3M07A 2CP6A 2Z1DA 3E0JB 5M5YJ 1RR7A 3JRIA 2GQIA 2RO0A 2A28A 5D6XA 1S1NA 1VQNT 3SUOA 3PNTA 1QZEA 1NJIU 5AIPA 2DJZA 1VQ9N 3CC7N 3GWZA 4CK1A 2ASMA 3ER0A 2DDBA 2YKNA 1VQ8T 2L02A 5IT9E 4CEAA 4DA4A 3VENA 4ATOA 4G6TB 2VVKA 1Y0MA 3O5ZA 1NOZA 1NJIO 2VWFA 2YRVA 5LJ3h 1AHJB 4A4FA 3ZBDA 3R4KA 3K5OA 4JI6K 1TWAJ 4LFAK 1H8KA 2P5LC 2PJPA 2AS5F 1WH7A 1BIZA 3THXB 2G8UA 1IKXA 3FFKB 2DEUA 5CLSA 3K9JA 3HOZJ 1J5OA 2XAUA 1DPRA 1RT2A 2R5YB 2P81A 2M2EA 3EUAA 3F23A 4OAYA 4IHTA 1HNVA 4BC4A 3U8XA 2LJ0A 4ZYDA 4QLCU 3TQNA 2QKMB 1LFBA 3AO5A 3VYRB 3CMMA 1M3BA 3Q0UA 2L54A 2ZQBA 1YRNB 2O0YA 1R0BG 4NLCA 4QAGA 2PX9A 4KN4X 3VSKA 2QUFA 1K8AC 4ISEA 2HOEA 1NKUA 3QYBA 2F5TX 5GMKl 4CECA 2HHSA 2K4YA 2D0PA 1WEFA 2HOTA 3F8FA 5FRMA 3JB9J 5HRPA 1XMXA 1QVTA 5FLMJ 3MKWB 2LBFB 3PVLA 4YELA 1J6ZA 4F7ZA 2I10A 3GBQA 4G94A 1G3SA 1JKHA 4YTLA 2WSEE 2D9TA 1MMAA 5C2DA 3GUDA 4IVNA 4UV8A 4KT5C 1NLOC 2XC7A 3T1BA 4B08A 4DV2K 2I7PA 4C8QC 1IB8A 1N5ZA 3RPUD 2J05A 2GBYA 1NNEA 1VQKN 1AHDP 5I11A 1XMOK 1VOMA 1QE1A 4A5MA 1KQSM 2DQLA 3OB9A 4XH4A 1JU5C 3IH4A 4LSLA 2K5CA 2GEMA 4FLXA 4FM2A 4RMNA 4IEIA 1KK7A 2QWOA 2AA4A 1KAXA 4IXCA 4LF8K 5AQTA 1S7AA 1NGHA 4C9YA 3BDUA 2QWLA 1KQ2A 1WHLA 2YI1A 1EO1A 3FXKA 4XOTA 2RC4A 2DYBA 2P9LA 4ORZA 2LJ3A 2D5RA 4CJSA 2DD4A 2ZPIB 1RDWX 3JXUA 3ZSZA 1OU9A 4FYWB 3JCMX 4DIQA 1BC7C 1YBYA 4M7DF 2JOYA 4HSTA 2L2PA 4CE9A 5AQWA 1W2BS 1BOBA 3CCSA 1KQ0A 2V8KA 3K2ZA 5ECAA 1O3TA 1YVNA 2CH0A 3WVEB 2HQ5A 1UWBA 1V3FA 2ZD1A 5CVJA 1YJ9T 4I7FA 1FIPA 2CW8A 1NK3P 2HD0A 3EFRA 3SD4A 4D8DA 3ZX0A 1MH4A 5BPLA 1TUYA 2OZ6A 1LNWA 2DLLA 2VODA 4YY3K 3SFIA 1ETOA 1UHCA 4HX7A 3VQ8A 1UA1A 1LWCA 1OCOH 4M77F 5GAN3 5AQJA 4NYFA 4B3AA 3KETA 3D0SA 3D4VA 4DSLA 1D0ZA 3H6EA 2NVYJ 4L8RB 1SD6A 3F0CA 4JJBA 2VJ5A 5C2FA 2HXIA 2MCNA 1C6VX 4L5IA 4KHUA 1J2XA 4CJVA 3CMAN 4WQ5A 4B47A 3QPHA 5DD4A 3H0IA 3J7AO 4M75F 2FF4A 1F21A 1JKRC 4WF9L 3TO6A 1VQMQ 3C2GA 4MQ3A 4EA4A 4W5OA 2QSFX 4AM7A 3RI4A 3REAB 2XKOC 2PVOB 4HG2A 2EWNA 2E1ZA 3V7CA 4PCQA 2GELA 2RAEA 4FYVB 2V7YA 4OJRA 4MLHA 4MEYF 4F93B 1YS7A 3SQNA 2KSSA 2G7UA 4GNIA 2GNCA 3P38A 2Y4YA 4Z88A 3ALYA 2OA8A 3QPTA 3QBYA 3U21A 3VYHB 3OYFA 4DWIA 2H8HA 1YAGA 3HTSB 2BW3A 2QA4Q 4FOEA 1Z9QA 2H6CA 2VGMA 2W82A 5C6SA 1N25A 3BR0A 2UWMA 2HFHA 2L2OA 2EZKA 3P83D 1IGQA 3RSEB 1UG0A 1WHJA 3AVIA 3ENBA 1JXOA 2COYA 3HM5A 4B9NA 2GF7A 1FTTA 1E2XA 2G7HA 4NO7A 2VI6A 3M4YA 2JTFA 2C0TA 2G6FX 3VS1A 4BR5A 3GOIA 3OYHA 3S3MA 1Y07A 4DSFA 3VJPA 2CV0A 2FF6A 4A69C 1NMDA 3QAHA 1VQMI 4K42A 2JPBA 1XTDA 3WNHA 2FBHA 3TQ7P 1O9SA 2BZTA 2YX7A 3W0LA 3LP2A 1UHMA 2W84A 3ABTA 3OOPA 1KG5A 3UA7A 3DLGA 1YI2T 2BV6A 1U3EM 3V1QA 2BHZA 3ZSXA 3ULDA 3J7AF 3CVTA 4VUBA 3G1JA 3MEEA 2EAYA 4KPYA 5IN1A 2K57A 3ZFJA 1GCQA 1WHHA 3S1QJ 4CFAA 1Q81C 4S0HB 3OYMA 3BF1A 5DK5A 3CCMQ 3M4GA 1XDUA 2P84A 3J81E 4RTUA 1BG3A 5E17F 4XTYA 2QA4I 1MMNA 1K9MC 1LJOA 3TVTA 2QEXN 2DD5A 3IUCA 5ILUA 4E1JA 5TRDA 3SEMA 1GLNA 4LC9B 2OPRA 4C5IA 2XGEA 2EX3A 2ROLA 3JB9F 4CFBA 1M1KR 1K78A 1L3SA 2AKLA 2EKHA 1VQNA 2P0QA 4HSBA 4LF7K 1W1FA 3W2AA 2HZDA 3B6PA 2CUZA 2RJFA 1WGXA 1TS9A 1VQPT 1I81A 1VQ8A 3L9FA 2XI9A 1QHGA 4CRIA 2HVHA 2EZHA 2LRQA 1B1BA 3A0IX 4DTPA 2VN2A 2O3FA 3T69A 1NG7A 2Y31A 4O6JA 5FB2A 1VQLT 3DMJA 2FMLA 2DQRA 1T03A 4B8CA 1K61A 1PKTA 1FYKA 4B1VA 4AVZA 4JI0K 5GANj 1VQ7N 3JRCA 1TC3C 1YIJN 2VC8A 1FZPB 5E3OA 4JLGA 1VK0A 2UUBK 2FOWA 2NXNB 5KYXA 2DTRA 1KLMA 3SZGA 2EWSA 1WFWA 4NCGA 4OB3B 1S72N 2HW3A 4CC2A 2L7KA 4WXHA 5GAGJ 1QVFA 3JCMW 3JRFA 4QQGA 2W03A 2HBKA 4XKWA 1NKEA 2OJED 4PA1A 3VS7A 3FHNA 3R3LA 3LSHA 3M59A 4EZ6A 4A4KA 3CCMI 2L9VA 1TTHB 2K9GA 1B9FA 2HBLA 2C0OA 4OB2B 3GZ6A 3QNNA 4DV1K 2GTOA 1JJ6C 2Y4XA 3HRTA 5GTIC 3TL4X 4E4HA 4JKGA 2JT1A 4H0OA 1X1BA 2ETJA 3QICA 4CJFA 3S2DJ 5DCMB 2FYKA 2QQSA 4LY7A 2FMYA 5LJ5f 3D5SC 4UNOA 3MXIA 2VBZA 1Y7XA 4AIAA 4PGHA 1Y1VJ 5HNHA 3OYJA 1PP7U 2VXEA 2X3WD 2Q1ZB 2LOOA 4IURA 2CMPA 3R0JA 4YPHA 1RBSA 2ME0A 2W25A 5D6EA 3N4PA 3H08A 2ZKZA 1Q95G 1T95A 2DRKA 1NK7A 3AVNA 4EEFG 3AGRA 3C3WA 1PRLC 5K5RA 4EJVA 4A3IJ 4QS8A 3CG7A 3GO5A 2Y69H 2JA2A 2W7NA 1SFXA 2ICWG 3QEPA 1KO9A 1QRYA 4JX4A 1FMKA 3FKJA 3CO6C 1BC8C 2PVDB 4M7DG 3O9RA 1K6YA 3EZ5A 5AQNA 2EJFA 1JLEA 4M6VA 3CUQB 1JT6A 4HOBA 4J2DA 3N4MA 3ULEB 1HU0A 2VC0A 5AQQA 3IH7A 1TH7A 5AT1B 5LJ3g 3CQXA 2E2HJ 4EM0B 2WV1A 5M5WJ 2QQ9A 5BRDA 4PL6A 4OU0A 3IP4B 3VQAA 4YOUA 4M6YA 1TSFA 4CYCB 5CZ1A 3CJTB 1UG2A 1OVQA 4QS7A 5ICCA 3HDDA 5CE3A 5ELZA 4BBRJ 4I09A 2QWQA 3CZ6A 1IGNA 4HQEA 4CZZA 1KG2A 2XAQA 2VG5A 2NRWA 2EPDA 4M77G 1QO0D 1Z3XA 4IWVA 4ELTA 3DLAA 1O3SA 4EVVA 2LNHB 3GLXA 4NZGA 4CESA 3DXKA 3RZDJ 2KRFA 3R6OA 1Z0XA 2X4HA 4EDUA 3X28B 1D5AA 3F70A 2O4GA 1YJ9A 2GXAA 3TI0A 1SSHA 1D0XA 3FKIJ 3AGKA 4CJPA 2Q2EB 3OOUA 2E2PA 5LGUA 4M75G 2VBYA 3C7NB 3PO3J 3OYDA 1SPKA 5AZJA 2KKZA 3M1FA 3K5NA 1WSHA 3QP6A 2SRCA 1LPQA 3WTUC 4IUUA 5M1KA 2LY1A 2Y9YA 2RHIA 2EZLA 4YG2F 3SAHA 2Q0RA 1QZ5A 4HV5A 3VPRA 3UKRA 3MZHA 5HK3A 5FLXE 2HBWA 3MZ8A 2RQUA 1BK2A 4YFUA 3R60A 1JJ2S 2FA5A 1FOKA 2JWKA 2KHMA 2WONA 2PVGB 2PMUA 3FDRA 1NJWA 1RTJA 2YUSA 4BGDA 2YNHA 4ELVA 2VWJA 4FLWA 3EG9A 2GX9A 3U3YA 1PU7A 2E10A 4XLEA 2HZYA 3HHTB 4DR5K 3I33A 4RWTA 4L5JA 4CZCA 1SHFA 1KZHA 3VTIA 5ICEA 1YN8A 2ZGZA 4B9MA 3AG4H 4M77C 3O8MA 2EBIA 2DL7A 3CM5A 3MEWA 2EIJH 1LWWA 3H9NA 4CIEA 1NJYA 3MWTA 4JK9A 4XH1A 2R5YA 1TBXA 3HUGB 2EB7A 2JRMA 4YDUC 2QWPA 1CLQA 3WTVC 3GLLA 2EFWA 1QVGM 2G8VA 2NYXA 2HTSA 1C6VA 4HCZA 4M75C 4AYBN 5LJ5h 2BE7D 2DFHA 1VSKA 2CH5A 1KC8U 4BYYA 2YSQA 3THYB 3CXCS 1XHZA 1QBJA 3VQEA 3TW6A 3H0DA 3JRHA 1HJDA 3AVAA 1HA8A 2E19A 1KC8O 2CW0F 2E7WA 1RLPC 3LSKA 3CCRN 4B09A 4AFQC 4D7NA 1YVUA 2MD5A 1MJ9A 1A5XA 4I99C 2ZMEC 2VIXA 4JBAA 1C0TA 2NS8A 3LZJA 3G6EI 1RZ4A 1F1BB 3HL2A 2X9HA 1YCYA 2K79A 2V8IA 4J9EA 1AWCA 2X35A 4AMCA 4EJOA 4JOMA 5AFUA 3DF8A 4BR0A 4DK9A 2P0WA 4RB0A 2M4KA 3C0BA 1Z6TA 1PUFA 1YI2A 3A0HC 1U2WA 3CQYA 1QTMA 4OIOF 2RB6A 3HRMA 3CCSN 2WBNA 3ID8A 2QKBA 2W4SA 3CMEI 3D2FB 4E2FB 5IYDJ 5D5XB 4DV7K 2PQWA 2CV2A 1EF4A 2JZ2A 5LBQA 2EK5A 1BKBA 2LH9A 3H9QA 3TBIA 2FF3B 3LYIA 5KYUA 1G6NA 3ZMTA 2PJRA 3DJCA 3BOQA 4ZYHA 4EQQA 2L4AA 3EH1A 4CYDA 2E4HA 3EKSA 5J2MA 1ZG3A 1F9NA 3MEXA 4CD1A 1P7IA 1VIEA 4BACA 3QU3A 1T0FA 4M7DB 3FZMA 1TU0B 4XLPF 1VRTA 2DM1A 4DQIA 4LIUA 1KXPA 5FPNA 4OMNA 1P2FA 3H3ZA 4XU0A 1MMGA 2DFUA 4AF1A 3PIOA 1PVEA 2V1XA 1QCOA 1FOWA 1ETYA 2X78A 3QBWA 1WHUA 3O1BA 3QLHA 1GRIA 3RKWA 4CI6A 2EFNA 4CCKA 4HA8A 2JMAA 1VQPA 2PBIA 2XHCA 2KRMA 3QXEB 4UVAA 5KGXA 4EHUA 4ID5A 4UUSB 1V1CA 3QYHB 3OR1C 1LFPA 1KVBA 4IO8A 3SBGA 2K3FA 3OW2P 3DOLA 1BU1A 1P4AA 3SUQA 3I55T 3V9WA 1VQLA 4MDBA 4A3LJ 2BE5F 2F2EA 4R79A 1ATRA 1UELB 2M0YA 3ZMUA 2KLAA 3DBRB 3JCMb 4UNFA 2Q3SA 4KH5A 5LGTA 2XDDA 3IQLA 1YQMA 3LDQA 2CSIA 4B4CA 2DYSH 2DXBA 1ORKA 5LMNK 4CZGA 2TCTA 1M2VB 1W9HA 4RW8A 3L4IA 4IDHA 2FXAA 3E6CC 2ZWHA 3PT9A 5IXFA 2ME6A 1G3YA 3JB9I 2LD5A 3VEWA 4XN3A 2QVOA 1RTIA 4NLBA 3NMZC 3BTCA 4A4GA 4F7UB 2E7XA 5D8LB 3OA6A 1S1UA 1ZKGA 4OKKA 4FJ8A 1H89C 2VC1A 1XQPA 2HR3A 3DLLL 1ZBJA 3LP3A 1RT7A 1MBGA 3WNGA 2PI0A 2HYGD 2ZE2A 3EFOB 3I54A 4H5NA 1S9GA 3CC4T 4HDVA 2YT6A 4H0YB 3TTFA 3RJPA 1NBWA 2V51B 4EW4A 4BL0B 2VJIA 1V55H 2G8WA 1WI3A 3THKA 3H0HA 3NF9A 2I2LA 3FE1A 1X1AA 3D5LA 3SNNA 3CPEA 4U0VA 3PNWC 2A3ZA 4A5AA 3KEYA 2RJDA 1FSEA 1AWWA 2LKXA 4AC0A 3UWNA 3RSEA 3V8JA 2P8TA 3WGIA 4CHZA 2LK2A 1ILYA 3J80K 3G0QA 1JBMA 4NC8A 4AIJA 2ZAEA 4HNUA 3TMOA 1UCRA 1N6AA 4HX8A 5CIUA 2FSWA 4O44A 3JCMc 5C3EJ 1WZOA 4X1VA 1VUBA 1IKVA 2P5GA 1P7MA 3QSUA 2HNIA 3FK7A 3SLCA 3FZFA 3DBHB 2UUAK 4CCLA 3ISNC 4ISFA 3LX7A 1YTUA 2BTTA 2Z99A 1K8KA 2O7OA 1J9AA 1R5HA 5HDKA 1Y64A 4LK0F 2JMWA 5AQRA 1WLPB 1ATNA 3O5BA 3ONQA 5J1YA 3L2VA 4BRIA 2VJ4A 2R5ZB 3QYFA 4CW7B 2A69F 3C18A 5A0GA 2CQQA 2DXTA 3ZQGA 3V81A 4JJDA 3KP2A 2ZPGB 5GANf 1HNXK 3QFUA 4YOVA 3LNQA 3Q3SA 1B8IA 4BDPA 1VQ9Q 1YE9A 3CC7Q 2PFBA 1YQKA 2FJ1A 4KHWA 1JGSA 2A08A 2W0ZA