4IKFA

Pfv intasome with inhibitor mb-76
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title 2-Hydroxyisoquinoline-1,3(2H,4H)-diones (HIDs), novel inhibitors of HIV integrase with a high barrier to resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein/dna/inhibitor
total genus 101
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ikfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ikfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ikfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ikfA03
1QSYA 2RHYA 5T7BA 4DU1A 2IDOA 3HPHA 1RDDA 1LWFA 3SQ2A 3PX0A 2ZE2A 4UC4A 3AO5A 4N41A 1Z25A 4Z4CA 4W5RA 2G8WA 1CLQA 3CM6A 3MXJA 1RTDA 4FM2A 4FJHA 4CJPA 3AVGA 4EZ9A 4FLUA 4ELVA 1OI1A 4DFKA 5FRNA 2Z1JA 4J2EA 2IAJA 1BGXT 2EX3A 1ZBUA 1BQNA 4DSKA 3CM5A 1UOCA 5HROA 2B4JA 4HHTA 4KRFA 4ZHRA 4FM1A 4I7FA 1KVBA 4FZYA 3VA0A 4DTOA 1TKTA 1JLEA 3DRPA 1RT5A 2X74A 3AA4A 2O4IA 4NZGA 3SUNA 1GOCA 2HNDA 4E89A 3PUFA 1U04A 3QEPA 1RDAA 3LAMA 4FU6A 3EAEA 3Q1JA 3ZT2A 3TAQA 3ZCMA 3LGFA 1BIUA 3TAEA 4OVAA 3T19A 3VQBA 3VQDA 1SKRA 3FC3A 3VA3A 2YNFA 4C8NA 1NJZA 3VQ8A 4CHYA 4CJSA 3HK2A 3RMCA 4FLVA 3NBPA 4LD0A 4FZXC 1QS4A 2EQJA 4JLHA 1J53A 5J26A 4Y1CA 1WSFA 4DF4A 1I3AA 1FKOA 1NK9A 1VSMA 3F70A 3EY1A 1IO2A 3CYMA 4AILC 5E41A 4AHVA 1VSKA 3V9WA 3ZT0A 1NJXA 2KFZA 4E19A 4CGIA 1FKPA 4DTXA 3LP2A 3OYIA 1U47A 2VG5A 3K2PA 1XI1A 4B8AB 4OGEA 5IN1A 2ITGA 4FJNA 2VG7A 3TAPA 4KO0A 3DLMA 4DFJA 3RR8A 3V9ZA 3NTKA 4TSXA 3AVMA 3NGYA 3LP3A 2PYJA 3PX4A 1KLNA 3O3HA 3V81A 4KKOA 3LAKA 3QBYA 3HXMA 1T03A 4B9VA 3NTIA 3AVLA 1T7PA 4CK3A 2XY6A 3MXMA 3C4SA 5KCOA 4A4EA 3OYBA 4QOZB 2Y1IA 3OYEA 1SL2A 1R0AA 4I2PA 3HP9A 2DTUA 1Y97A 5KCHA 3IRXA 4L8RB 4FJJA 3NGZA 2OPSA 3LGLA 1JLQA 1S6QA 1TKZA 4DF8A 2YV0X 1YT3A 1KFSA 5KE3A 4B9TA 5EU7A 4FW1A 1U49A 3HVRA 4CFBA 4CIEA 3D0PA 3VQAA 3OS0A 5KGXA 3OJSA 4W5NA 4IUQA 3OYGA 4KTWA 3OYKA 2IG0A 1BHLA 1OYXA 2G8HA 3ASKA 1S6PA 2IC3A 2JZ2A 3S6WA 1X1PA 4CCHA 4DLEA 1ZBHA 4IUVA 4M45A 3AVBA 2PQWA 2RJDA 4A4FA 4IKFA 4LY7A 1RBVA 4RG2A 3DLHA 5CYQA 4F3OA 4OKEA 2G8IA 4DTPA 1S1XA 5KGWA 4B8CA 5C24A 4E7LA 4QAGA 1VSDA 1TKDA 2X4YA 3OMGA 1KVCA 4OLAA 4B9NA 4FVMA 1W0HA 4RG8A 3CFPA 2DAQA 2LTOA 5CY4A 4KHUA 3AO4A 4O44A 4RW4A 4FYDA 1NK6A 2KTQA 4ZTFA 1MHNA 4BDPA 3V9XA 1DLOA 1XC9A 4Z4GA 3G0ZA 4YFUA 1QSSA 2KFNA 3ZT3A 3VQ4A 3DLGA 1RDCA 4KHSA 2HNZA 2YKMA 4Z0UA 4M3XA 3NFAA 4WE1A 3NF7A 3VQCA 4QVZA 3RWUA 3ULDA 3NF8A 3OYDA 3QNNA 4H4MA 1RT4A 3TANA 1C1BA 3LP1A 1WSJA 3OS1A 3OQ5A 2HHVA 4BWJA 3LPTA 3VN5A 2IGIA 4KHNA 3BDLA 5J2QA 2EQMA 3LDSA 1J5OA 2HW3A 1XWLA 4CIGA 3SUOA 4CE9A 3L3VA 2X4WA 4CEZA 1UAXA 1JLBA 1S1TA 4NCGA 3JSMA 4B9LA 3PO5A 4DTUA 4MQ3A 3VQ6A 1RTIA 1S9EA 3OYJA 3FEOA 4FZZA 4CHNA 1JLAA 2RI3A 2KZMA 4KHYA 4DFPA 4CEFA 2DIGA 4PY5A 4PLLA 3QIIA 4DQQA 2YNIA 2G8FA 3HYFA 4NYFA 3ZSQA 5HRSA 4N56A 4CEBA 5KI6A 4FW2A 1IG9A 4DSJA 4FK2A 4FJ7A 3DOLA 2RHUA 3SUQA 2HVHA 1EP4A 4CESA 5FRMA 3VQ9A 3AO1A 3I0SA 1N27A 3AA3A 2MWOA 2GUIA 3AV9A 1ZBLA 3SPZA 4K8ZA 3ZSZA 4CEAA 3AVKA 1JL1A 3P5JA 5J1EA 2E6LA 4HUEA 3H6ZA 1L3SA 2X6NA 2VYTA 3CQ8A 4DQSA 4KAZA 4FXDA 4KB1A 3M8PA 1JKHA 2D5RA 4HCZA 3FFIA 4KI6A 4AHRA 2OPRA 2O4XB 4FJ9A 1YVUA 4H8KA 3M8RA 3NF6A 3QLHA 3MO8A 3KLEA 5D6WA 3DB4A 4R5PA 1VRUA 3HP6A 4F8RA 2Y1JA 4Y1DA 4FJXA 1HPZA 3TAGA 1EX4A 1RI0A 2M0OA 2RKIA 2DFFA 3S9HA 3ME9A 2HB5A 1KSPA 3MEEA 4B9XA 2I5JA 1HYSA 2D9TA 2QKKA 3SCXA 1TL1A 2ZD1A 2E6NA 1FXXA 1ZBIA 2GF7A 4BDZA 1WSEA 2P5GA 5HLFA 1YTUA 1A5WA 5J39A 4KTZA 4KPYA 3F73A 2L8DA 1RT7A 1WJQA 2E6MA 1LWEA 3LANA 3CG7A 4E7IA 2LDMA 3FDRA 2Z1GA 3M9QA 1DTTA 4AHSA 2KQ2A 4ZTJA 4M42A 2QQSA 1RT3A 1VSHA 3L2QA 2LCCA 1L3UA 1EETA 2FHDA 4DTMA 4N4IA 4QQGA 1TK5A 3SYZA 1Q9XA 4IUPA 4M3TA 4FLZA 1TV6A 2P51A 3TR8A 3M8QA 3DOKA 4CJ4A 3EZ5A 1KLMA 1RILA 4B9UA 2G8KA 4H4OA 1T05A 3I8DA 4HUGA 3OYNA 1VSIA 3AA2A 2RI2A 3S3OA 1ASUA 3I0RA 1S1UA 2EFIA 2WONA 4CHZA 5HRNA 3DLBA 2O4XA 4PL6A 4DTSA 1S5JA 3PO4A 4CIFA 2LRQA 4C5IA 4ELTA 1LWCA 4CJRA 3L8BA 1O1WA 4K8XA 4W5OA 3DLRA 1C6VA 4FK0A 5DK5A 4DSFA 3LZIA 1IKVA 3V1QA 4AH9A 3WNGA 1RT1A 4IBNA 1CZBA 4OPJA 1NK4A 1KHCA 4W5TA 2L3RA 1JLGA 3VQPA 3SQ0A 3THVA 1KFDA 4G1QA 2IOCA 2DFEA 4BWMA 3LLRA 1KVAA 4CK1A 5JS2A 2RPIA 1GOAA 2P1JA 1TK0A 3V9SA 2X4XA 4L59A 3NTHA 1NOYA 3B6OA 3U3YA 3P8HA 4C8LA 4B9WA 1RCHA 1TGOA 2O4GA 2ATQA 3C94A 4N76A 4GY5A 3HPOA 5C42A 1B92A 1NKBA 4Z02A 5DMRA 1BL3A 1JXEA 1HRHA 5SZTA 3DRRA 2XY7A 4CFAA 1RTJA 4M3RA 5M9OA 1XNIA 4XIUA 3ZT1A 1SV5A 4M3YA 5IAYA 4KTQA 4I9QA 5D6XA 5HRPA 2R7YA 3QETA 2PZSA 3WNFA 1HJRA 4BDYA 3M8SA 1LAWA 4CK2A 3NAEA 4CF2A 2M1HA 4LSNA 5D6YA 4DU4A 3NCIA 3AO2A 3PMIA 2VG6A 4O0IA 3MP8A 4F4KA 2F8TA 3RRHA 3ZSYA 2RJCA 2EKOA 4CFCA 3TAMA 4LH4A 3AVJA 2NLUA 3E01A 3P83D 4O55A 3VQ7A 4O4GA 2XO7A 3O3GA 4JRQA 3HL8A 1RBUA 1TKXA 1QSLA 2G8UA 1UWBA 2RO0A 3TARA 3VQQA 4FJ5A 4CGFA 3T3FA 3HT3A 3SV4A 2VWKA 3OB9A 2R57A 1UA0A 3QERA 3AVAA 4IUTA 2RI5A 1XHXA 4CFDA 2RJEA 3AVIA 2EQUA 3KD1E 1WJSA 4QW2A 1WSGA 3DRSA 2RN2A 3LP0A 1UA1A 2X35A 5I3UA 2YNGA 4CHPA 3GOXA 2X6SA 5SWMA 4JS5A 3HO1A 1SUQA 4BACA 1RDBA 1FK9A 2HHTA 3L2WA 1SL0A 2A1SA 3L2RA 3K5OA 3KIOA 1NJYA 1HYZA 4CEEA 4NCAA 4DQRA 3HSTB 1MU2A 3HM9A 1WN7A 2G8VA 2HHSA 4Q0BA 3TABA 4O0JA 4N4HA 3VQEA 2Q3SA 1Q8IA 1VSEA 2HQEA 4CJ3A 1S1VA 3QIPA 2HNYA 3NHGA 2Z1IA 3HPGA 4NS5A 3KTQA 2XRIA 3HVTA 1VK0A 1T8EA 4QQ6A 1HMVA 2L89A 2FBXA 1C0MA 4F2SA 4DU3A 4OJRA 4DQIA 1X9MA 3KKSA 4CJKA 4B08A 2R5MA 1EKEA 3SQ4A 1HQUA 3D45A 3KK1A 4B9SA 1NK8A 2HHUA 2DY4A 1LV5A 2F96A 3IAYA 1N6QA 3ZSXA 2LSNA 1TAUA 2M16A 1SKWA 1VSLA 4Q5WA 4DFMA 3JYTA 3QJ6A 4X34A 2XY8A 2QK9A 3O4NA 3P1GA 3DB3A 1JL2A 4M41A 3SNNA 4FJLA 2PY5A 1VRTA 4GMJB 2HVIA 4FLTA 4CEDA 2K3YA 3V1RA 3LPUA 2QQRA 2XY5A 4A4HA 3RMDA 4OLBA 5JS1A 4OPKA 1DTQA 4CGHA 3WNEA 3K5MA 2RF2A 4FJIA 1C0TA 5J2NA 2G3RA 4FJKA 1Z26A 3KKRA 4NCBA 4IG0A 1HNVA 2WACA 4C8OA 4I2QA 4CF1A 2IS3A 4ID1A 3QNOA 1KRPA 1REVA 3DLKA 4O5BA 1QE1A 2KW4A 1A5XA 1H3ZA 1Q9YA 3OYMA 4BD3A 2XDPA 4IG3A 4CEOA 3L2UA 4KHQA 3MP1A 4DSIA 5CIUA 3DM2A 3CEYA 4N5SA 3QEIA 4FJMA 4E0DA 3NH0A 1D8YA 2E5QA 3PV8A 3MEWA 4DQPA 1CXQA 2GFUA 4KV8A 2FBVA 3SI6A 2R5AA 4DS4A 4EDUA 2FC0A 3MEUA 1X9WA 4PA1A 3DYAA 4FJGA 1HQEA 1TAQA 4M3UA 4CEQA 3SQ1A 2XK0A 4CJWA 4NYNA 3ZSVA 3HJFA 1BCOA 1BISA 4C5HA 1C0UA 1TL3A 2B5JA 4OKJA 2BIVA 4RW6A 1I39A 1TVRA 3SJJA 4CF0A 4ID5A 4CGGA 1CZ9A 3UWNA 2XHBA 4CJTA 4CJEA 3OJUA 3CFRA 4CJLA 3T1AA 4FJ8A 3MXIA 2YRVA 4DSEA 2QKBA 3NE6A 5I42A 1RBSA 4F2RA 4FLWA 5CZ2A 3K5LA 3K59A 4OVLA 4CHQA 1J54A 3LH0A 2YNHA 3V1OA 2RHXA 4AHUA 3H08A 2GFAA 5HP1A 3CFOA 3MEVA 4C8MA 1RNHA 3KK3A 3QESA 3U3GA 3ZEHA 2D0AA 1RT2A 2FBYA 1G15A 1JLFA 1B9DA 3OYFA 3AVNA 3KLGA 1NKCA 3UT1A 2NUBA 1BIZA 4OKKA 3TI0A 5C6SA 2B6AA 4CJQA 3PNWC 4UQGA 4QCLA 3ZSWA 1WAJA 5J2MA 2DFHA 4PUOA 4M3WA 4F3TA 1G5VA 2RJFA 3KD5E 3SPYA 2Z1HA 4A4GA 5KRTA 2OPPA 3A2FA 3NGIA 4N4GA 2D0CA 3QEVA 3MEAA 1ZYQA 1W9HA 1LW0A 1WSIA 3KLHA 4DS5A 3MP6A 3QINA 3DLEA 5FDLA 3LZJA 1WAFA 4FL6A 4HTUA 3ITHA 4MFBA 3LX7A 3IS9A 5J2PA 4CJUA 2BKDN 2ETJA 2YKNA 2HMIA 5D3GA 5CZ1A 3NH1A 2OPQA 3KJVA 4BE0A 1CXUA 2BGGA 1BCMA 4GW6A 2AJQA 3K58A 3V9UA 3KUFA 1SSFA 4B9MA 2OA8A 3QKJA 4CJFA 2ZQBA 4Q5VA 4RW8A 5C25A 4FK4A 3RMBA 3RTVA 1IKXA 3S3MA 3NNQA 3L42A 1C1CA 4CF9A 4CGJA 1S1WA 3VQ5A 4LSLA 2MWPA 1SKSA 1QTMA 1ITGA 3DI6A 1TK8A 2R58A 3IG1A 4BE1A 3KK2A 3QEWA 1OZ2A 1RTHA 1HNIA 3OY9A 3E9FA 3NF9A 4KHWA 2VWJA 2F8SA 1F21A 1ASVA 1L3VA 3RR7A 4Z4EA 3K5NA 4HCBA 4DSLA 2BE2A 2RHIA 3BGRA 4KREA 4QQDA 3EYZA 1WSHA 2D0BA 1K6YA 3FLGA 3TWHA 3O8VA 3AO3A 5C0MA 2JLEA 4HUFA 1IKYA 4RW7A 2P0KA 3S3NA 4RW9A 4N47A 1L5UA 3OVNA 1VSFA 1XHZA 1BI4B 4JS4A 1WLJA 5KE2A 4CERA 3OMCA 5FROA 2HHXA 1NJWA 4II1A 1IH7A 1SL1A 1WJRA 4J2BA 1D9DA 1X9SA 4DLGA 1LW2A 3H8ZA 3QO9A 2YHBA 1GOBA 2W42A 1NK5A 4CRIA 4B3OA 1HYVA 4EZ6A 1YTAA 2EHGA 3K57A 2B8AA 3QIOA 4J2DA 2JTFA 1C1AA 4LD6A 3QEXA 4GVMA 4I9LA 5KH6A 1VSJA 4DMNA 1J9AA 1U4BA 4FM0A 2HQXA 3NH2A 3PMTA 2F5KA 4FLXA 3ZSRA 1L3TA 4DTRA 1WGSA 3SUPA 3ALYA 4JRPA 4ELUA 3C6UA 2LVMA 3OYLA 4FLYA 1S9GA 4IFYA 2K3XA 3LYIA 1ASWA 3L2VA 2JGUA 2X78A 1NKEA 4IURA 4C8KA 1N5YA 3ASMA 1OZ3A 2OYQA 1QQCA 1IKWA 1KTQA 2P5OA 4OGCA 3LWMA 1RT6A 4EP4A 3MEGA 3OS2A 4YNQA 4BE2A 4CHOA 2PYLA 4IDKA 4J2AA 4HCCA 2YHAA 4C5EA 3OA6A 2CKKA 4W5QA 3LWLA 3SV3A 4FCYA 4AHCA 1WNSA 4Z4IA 4E7JA 3MEDA 1BI4A 1NK0A 2FBTA 4CGDA 5HRRA 2A1RA 2BANA 2QXFA 4DWIA 2BUDA 2BDPA 3PFSA 3KLFA 4HVJA 3OYHA 2RHZA 4M3ZA 3ZT4A 4DTNA 5CYMA 2E4LA 1NOZA 3C6TA 1ZBFA 4PLIA 1JXBA 3WNHA 3PY8A 1B9FA 4CECA 1RBTA 3NDKA 5HBMA 3AVFA 4E1MA 3PX6A 2GV9A 3RMAA 1NK7A 4ICLA 4E7HA 3C95A 3META 3O3FA 1LAVA 5K14A 3UIQA 3DMJA 3OYCA 4DTJA 4DG1A 1D5AA 3V6DA 4IFVA 3U6FA 4E7KA 4AHTA 1RBRA 1A5VA 1QHTA 4LH5A 4CJVA 3RRGA 3P8DA 4C5GA 2HHWA 1U48A 3MAQA 3BDPA 4KFBA 3SD4A 3E9GA 4KB0A 2EQKA 1JLCA 3V4IA 3ZSOA 1BQMA 4Z4HA 5KTQA 2KZZA 4Z4FA 3G10A 4CJ5A 3B6PA 3F9KA 2HHQA 3MECA 5KRSA 1EXQA 3LALA 2OZSA 4E1NA 4PWDA 3O4QA 3AA5X 3TAFA 2GBZA 4E3SA 3AVCA 3ISNC 4EP5A 2WOMA 4IUUA 2DIQA 3AVHA 1D9FA 3L3UA 3OYAA 4PQUA 1KCFA 1U45A 3KLIA 4CF8A 3SZ2A 4KI4A 2OZMA
chains in the Genus database with same CATH superfamily
3KFWX 1M8MA 2O3FA 2O01E 1QSYA 1X1DA 3RKYA 2JVGA 1W7PA 4DIQA 2ZPHB 2KE9A 2OI3A 3CW7A 4XTUA 3ESWB 3G3ZA 5E1ZB 1NJIC 1Y8RB 3SQ2A 5EDNA 1UELB 3BDUA 5GJVB 1N77A 2I10A 1PU8A 3DXKB 4JQFA 2QLZA 1Z25A 2HHHK 1SRLA 3NHNA 4A3DJ 3M1EA 2YRCA 3CCUA 1VRLA 3CCMT 1M1KC 3MXJA 2QWRA 1Y39A 2O61A 4CJPA 3AVGA 4FLUA 1KJWA 3H0HA 2ECCA 5GADJ 5DTDA 2CSOA 2AT1B 4M75B 4CW7B 1BGXT 3CQZJ 1WSUA 1ZBUA 2Z16A 1XDUA 3IV5A 1I07A 5JLXA 4M9XA 1JJ2M 3RYPA 4G9YA 3RDIA 1BQNA 4BR4A 4FYWB 1I0CA 1BBZA 2L3QA 2XAJA 2IBDA 4A3MJ 2NOLA 3MFKA 3CC2T 2B4JA 3PE0A 1ATRA 2QWOA 1RR8C 1SD4A 4KRFA 1ORPA 4DV3K 4DTOA 4KHPK 2WTUA 2X74A 3GYHX 2O4IA 3CC4A 2RREA 1YS6A 1UAAA 2V8KA 1R0CB 3NARA 1NHAA 1EWQA 1JUSA 2ZGYA 3H1QA 1MUNA 3QRFF 4FU6A 3C65A 2O7OA 1U06A 1STZA 2NUPA 2OA4A 3ZT2A 3DPUA 4GO1A 3LGFA 1JE8A 3K4CA 3TAEA 2OTJA 2V1XA 3TU4K 1SKRA 2QWWA 4XH4A 3IP4B 3FC3A 1XTAA 1WPYA 2WSFE 1T44A 2KVQG 5L3CA 1OCOH 3VA3A 4FPBA 3H9JA 2YNFA 2MH2A 5K5QA 3TBIA 4C8NA 3SZGA 4FYYB 2XSDC 4EJZA 4MNUA 4CHYA 3ZEUB 1NPPA 2KRMA 1LOTB 2BBYA 1NGDA 3C1DA 3SYTA 4CJSA 1M30A 1P7JA 1VQ5A 1H88C 2STTA 5FLVA 1K9MO 3VTIA 2Q2EB 4FZXC 2A3ZA 1FYMA 3IWFA 3G1MA 4FETA 2WB1A 5J26A 4Y1CA 4ZN3A 1WSFA 1I3AA 4KT5C 1B8IB 5IH2A 2K2MA 4BRAA 3CYMA 5E41A 2JVVA 3S14J 1Z3YA 4KYWA 1VQLA 4KH5A 5CKFA 4LK0F 3DXKA 1WDXA 2KFZA 2CO5A 2R7FA 2EYWA 1MNDA 2YLCA 4XEIA 1FKPA 1VQ9T 1ZQ1A 2FJ1A 2M9HA 4PDKA 2C06A 1SAZA 4P5NA 2KGTA 3MZHA 4B8AB 4B1RA 3CC7T 4OGEA 3HGGA 4M7DD 4G6DA 2PZ1A 3EG0A 5AYFA 1YW9A 1WJ5A 3G73A 2K3FA 2ZSIB 2PVDB 2OJED 3U9GA 4DFJA 4O8KA 1XB4A 3V9ZA 4TSXA 3AVMA 3LP3A 4MHGA 3OH6A 1R1VA 3GO5A 3CHWA 4BY7J 4FSSA 3SHFA 2NUTB 5E20A 3THKA 1QA6A 5I2SA 1YUWA 2DL4A 1ERDA 1VYTA 1VQMT 3V81A 1C0FA 3S8PA 2ZAEA 2H8WA 3WTXC 3NTIA 4G6TB 4B4CA 2P9NB 1T7PA 1S1NA 4CK3A 1PYVA 1WI9A 1ITYA 4M7DF 5HDNA 1E3PA 3R3LA 1G2BA 2RKHA 4FWPA 3OYBA 4QOZB 3RSEA 2JPSA 4ZDLA 4G7HF 2LNHB 4UVBA 1R0AA 4I2PA 1QGPA 3HZJA 3DBHB 1AT1B 4GYIA 1APLC 2DTUA 2DYSH 4FPAA 4FJJA 5LGUA 5GAN2 4B43A 2QZ8A 3IRRA 3LGLA 2HQ5A 3SAGA 2K5LA 3CCJQ 4LNPA 4FE7A 3VEPA 3CCRI 3DEEA 5M1KA 3OIOA 1KFSA 5KE3A 3BJAA 1U49A 1HC8A 4A5NA 1O9SA 1G3WA 1QWFA 1OR7A 3ISPA 1VQOT 3OS0A 4OWRB 5DM6L 3L4IA 3OJSA 4XKVA 4IUQA 3ZEUA 4EVVA 2IG0A 1OYXA 3H5AA 1QVTA 2KROA 3ASKA 1H92A 3M4YA 2Z0WA 5A2QE 1NEGA 3VEXA 2Q2EA 2LCSA 3HTRA 4C2MJ 1B8IA 1TU0B 2NVYJ 4DR3K 3HUGB 4FWQA 4HF2A 4M45A 1GCPA 2B86A 1WRJA 4IKFA 1G6NA 2NOGA 3HOTA 2NRTA 5LJVA 3G1JA 4RG2A 3U9ZA 3CETA 3DLHA 2EJFA 2CZ7B 1S72N 1OYYA 4B8CA 5JR3A 2MBFA 2J06A 4E7LA 3G1LA 2X4YA 1W0HA 2LTOA 3LM9A 4KHUA 2CV2A 3AO4A 3QYHB 4JI1K 3TSPA 3ZMZA 4EM1A 4B1XB 3W6KB 4A54A 1JKPC 1LB2A 3CCEA 3K4LA 1XC9A 2KFNA 5LJ3e 4LMYA 3CXCS 3KEYA 4MMLA 3HIFA 1PHTA 4KHSA 2HWVA 2YKMA 1IBLK 3NFAA 1FIPA 2LX9A 1NK3P 1GUUA 2NUTA 2HI3A 5C4XJ 3RWUA 3NF8A 1Z1DA 4HX4A 3LQQA 1PD1A 3QNNA 3D0SA 4QVDA 2P9NA 1RT4A 4RCHA 2BY0A 1S22A 1OISA 3A0BC 4A6DA 3I55A 1ODDA 5F0CA 2A07F 2D0QB 3LP1A 3OS1A 4RB2C 3VF4A 1QKXA 3ZPLA 1YO5C 4BWJA 4BRLA 3VN5A 2YSQA 1TSFA 1OQYA 5J2QA 3LDSA 2AO9A 1J5OA 2X3XD 4DA4A 1XWLA 2HW3A 3SUOA 3L3VA 3CMEQ 1V3FA 2X4WA 1S1TA 4NCGA 2BE9B 1TWHJ 3LSIA 3VRZA 1S9HA 1UE9A 3EEQA 3OYJA 3GF2A 1Y64A 2V9VA 3K70C 3CIPA 3O6BB 2ATCB 4CEFA 3OR1C 3R61A 3LDQA 1X69A 1NG6A 4HX8A 1QHAA 2W00A 2DA2A 1S3XA 2W85A 5KI6A 2XI9A 2KFDA 1VQKI 5E8GA 2L5QA 4CD1A 4FK2A 1U1TA 3OW2P 1B72B 4F14A 4C0DB 2V1UA 1EP4A 4CESA 5FRMA 1B59A 3KEQA 3I0SA 1RUOA 2VXFA 3COAC 2MWOA 4BREA 3SPZA 4Y91A 4K8ZA 3SJMA 1FMVA 1JL1A 1W36D 1N3AA 1JBMA 3FKIJ 2LREA 5H6RA 3UKGA 4K41A 4B3MK 3QUIA 3KP2A 2VYTA 4KAZA 1G3TA 1YIJA 4DW6A 1JKHA 4M9ZA 5JVGF 4G6QA 4HCZA 4KI6A 3CDLA 4AHRA 1SMTA 2OPRA 2PUOB 3SK3A 2R7QA 4FJ9A 1BOAA 3H3NO 5CE3A 4H8KA 3M8RA 2ZJPF 3H1CA 4O6JA 3H1VX 3MO8A 1LCUA 3IQLA 4AIDA 2YXYA 5HOOA 5M3MJ 1RGIA 4C92A 2JM8A 4R5PA 2VI6A 4F8RA 3OTOK 1U5TC 2W03A 3UE5A 1W97L 2ZJRF 4HDVA 1SQKA 3BE3A 1HW2A 4IIMA 3SJHA 4PGHA 5FPEA 2D1VA 1EX4A 2VODA 1ZBSA 1YFNA 2E10A 2RKIA 1B07A 4X65K 3CCMQ 1BOTO 2P4TA 1FSHA 5HDKA 3A03A 1KSPA 4MGRA 5DCFA 4UB8C 4B9XA 1KGSA 2CW0F 3T1BA 1HYSA 2D9TA 4M3EA 1WHHA 5AR0A 4XU3A 2JMWA 1ZBIA 4BDZA 2YU9J 1WSEA 2COWA 3GLXA 4CZIA 1VQ6T 5GAN6 1KD1U 4KTZA 4KPYA 1JJ2A 3CC2Q 3LAJA 1M27C 1WJQA 2E71A 5D8LB 4KGZB 1XD7A 4CI0C 4DKWA 5GANd 1N5ZA 4MZTA 4E7IA 4KULA 3HGYA 2Z1GA 4C0ZA 4HBLA 3JCMW 4AHSA 2F2VA 3AHUA 3C2BA 4ZTJA 1B72A 5CCAA 2CUDA 4CDGA 1Q1HA 2LCCA 2GTJA 2M0YA 3MWPA 2OU2A 4FWNA 5GAMd 1HJDA 1BR2A 3TO9A 4QQGA 1TK5A 3SYZA 3W6VA 2EILH 2K6DA 4FOEA 4RLFA 4M3TA 5FKMA 3ZMVA 4E2FB 1BN5A 2P51A 3M8QA 3TR8A 2NRHA 1JXSA 5FD6A 4LUDA 1Y56A 4JYAK 4P96A 1QW1A 2AQFA 1EIFA 1KLMA 3JAME 4B9UA 2G8KA 1U2WA 2VKVA 2E70A 4DR5K 2XAQA 1E3MA 1VSIA 1T2KA 3I0RA 3CDHA 4NUBA 1NGBA 2EFIA 2WONA 3I3LA 2IVWA 5AQZA 1SMYF 3GX4X 1KC8C 2Z5UA 2CP3A 2OCCH 1Z9CA 2PN6A 3PO4A 4CIFA 2C6YA 4FSVA 4J7FA 1SG5A 4KBMB 4HLXA 3CBPA 4PSXA 1MUZA 3QZ5B 3R6MA 4C5IA 3H9GA 4W5OA 3DLRA 1C6VA 5AQUA 1VQ8T 3S1QJ 4DSFA 1IKVA 4AH9A 4KIGA 1FJLA 3I56N 3A5NC 2CGJA 4W5TA 3HL2A 1JLGA 1N33K 1KAXA 1QCOA 1KQ9A 1VQ9Q 4DBHA 1K8AO 3H5RA 4Y17A 4G1QA 4JJNK 2IOCA 2OCEA 2P0WA 2H1KA 4KUDK 1GBRA 2QGUA 3LLRA 1Q81O 3Q9VA 4LD5A 1JKRC 3CC7Q 3X24B 1OX8A 2RPIA 4BHCA 5AONA 2J05A 2DPUA 1VIEA 2CS7A 2FOKA 4NOYA 2FYKA 3CDIA 3V9SA 1IXDA 1IUFA 1V76A 2IS6A 2AK5A 2O8BB 1WXUA 4GCVA 2QXLA 1RCHA 1TGOA 1RAAB 1GLNA 1J6ZA 2LC2A 1YNZA 3RMSA 2CUZA 1VQMQ 1XGMA 3I5RA 1T0FA 1K9MU 2Y0MA 2CYYA 4E1JA 4LDXA 4Z02A 4ILHA 2VJJA 5SZTA 2BY2A 1G4DA 2FF3B 1E6GA 1W0UA 2E6ZA 2Y90A 3QPLA 1MJ9A 2DVJA 1R36A 2HZTA 2HSPA 2PZSA 5KYWB 2XPUA 3VS4A 4BDYA 1VQNT 3LWHA 4CK2A 2HKQB 4A3FJ 1QO0D 3THWB 2M1HA 5HK3A 4LSNA 3NCIA 2X9DA 4HSRA 1Q82O 4CZZA 1YHQT 3MP8A 2RNGA 1VQOQ 4F4KA 3L0QA 3R0AA 4ZGJB 4DR6K 2DK5A 4LH4A 4OIRF 2E19A 2KZVA 3P83D 1VQ7I 3VQ7A 2EYXA 1TUYA 5KK1A 4O4GA 4NB4A 4BQLA 2XO7A 4PJOD 1N34K 3HL8A 1U6ZA 2G8UA 1HW5A 3TARA 1Q7YO 3CCSI 3JCMV 1Z67A 3HT3A 2KRFA 2JRMA 4B1WB 4MIMA 3GZNB 3A98A 3TKYA 4AVPA 4DBRA 3AVAA 3QYBA 2QA4T 1X3NA 3Q3SA 2RI5A 4A2UA 1YI2N 1XNQK 5KN9A 3M1CA 3F9MA 1VUBA 4VUBA 3AVIA 2LKSA 1SKUB 2K5CA 2A37A 2CUEA 2HPMA 3TTCA 5BR8K 2HR3A 4QW2A 4EA5A 1V55H 3LP0A 3BR1A 2X35A 5I3UA 4CHPA 3IHOA 2D1KA 1TW2A 1YCYA 4A5MA 3QBWA 4BRGA 1SUQA 2EJGA 3T8TA 2O8BA 3AG2H 2WC2A 2HHTA 1GFCA 3VW4A 1SL0A 3RESA 4NC6A 2QASA 5M5XJ 2XB5A 2KRSA 1KD1R 3BUZB 3KIOA 2ZMEB 3KZIC 3FXMA 1AWWA 1NJYA 2GNCA 1YJNT 4CEEA 2P9KB 3HSTB 2JQ7A 4LFAK 3MQ0A 3D6RA 5K5OA 2AHQA 4Q0BA 1W1WE 3TABA 2LY9A 1D4XA 1Q86U 2EQIA 3ZQHA 2KJBA 1DP3A 2NS7A 3THWA 3EHRA 2LNBA 2L4MA 1OU9A 2ROTA 1P6RA 1C0MA 3S1RJ 3J81Z 1QBJA 3CMAN 4DU3A 3VEWA 3KKSA 1T39A 3KZZA 4MDWA 5E84A 3D45A 1PKSA 4B9SA 4FISA 2HHUA 2K86A 2K79A 3WXMB 2O5RA 4P1WA 1T6SA 2COYA 4LB5A 1TAUA 2XKOC 5BRDA 1JU5C 1SKWA 2YX6A 4DFMA 4M6YA 1VQPI 4X34A 2STWA 1MJAA 3CD6A 2I7PA 1V1CA 3F21A 1JL2A 1RDUA 2OTLT 2DPPB 4M41A 4EMKB 4KISA 1HW1A 4OIOF 3GBGA 5FB2A 2R7VA 4N0AC 4GMJB 4XQFA 2HVIA 2F5EA 3VS0A 2DA7A 2JA6J 2HF3A 4XIDA 1JUPA 1R5ID 4BVPA 2FBHA 3V1RA 2QQRA 3EDPA 3DXJF 1JTYA 5IYBJ 2KAFA 4WK8F 4KMUX 1PD0A 2NOIA 1UJYA 1DTQA 4CGHA 3SLCA 4M7AD 5J1YA 2R3SA 4IHWA 4FJIA 4EEFG 3ID6A 5M3FJ 2G3RA 1Z26A 4O3MA 4A5BA 5FU7B 3KKRA 3I58A 4IG0A 2E35A 2WACA 3N4PA 1VQ4A 4KIFA 4C8OA 3R8EA 2GQQA 1MNMC 4I2QA 2ZMEA 3IUOA 3DTKA 4L9NA 3PT9A 3DLKA 3GTMJ 2J6FA 1F43A 1IHWA 2P9KA 3RZOJ 4JPBW 4IO9F 4LFBK 1QE1A 1Y6IA 1K9MR 2LYCA 1DP7P 4M7AF 1XN7A 1R49A 1PRMC 3OYMA 5JI6A 2GM4A 2HQRA 3B6CA 3L2UA 3CCMA 1BDGA 2GCXA 1R1UA 2VGMA 1TUGB 4DSIA 4IRGA 4JI6K 3A8HB 2XAUA 3GE1A 4JJDA 2HDDA 4UY8I 2DFUA 2YU3A 4RMOA 3JB9J 3OS5A 1VQ6Q 5AQXA 2ID3A 1YIOA 4FO0A 4IZ9A 1LPQA 1F1ZA 2R5AA 3CJ9A 3EG1A 4YG2F 3CLOA 2FC0A 2NRWA 2LLKA 4M7DB 4AMCA 4AD9A 3ZMDA 1WJBA 3G4SN 1LDKB 2IEKA 4IX7A 5CKEA 2KRHA 2DDBA 2XK0A 1I6XA 5E3MA 3ZSVA 4IIOA 3ONQA 4HV6A 1W2BM 4C5HA 2B5JA 4OKJA 1FY7A 1IAWA 3BC8A 4L5EA 5DYMA 2DXIA 4DV1K 2YHXA 3SJJA 4XR6A 2PVGB 1ETXA 3CCUN 3BR5A 3H3ZA 3UWNA 4RGXA 4CJTA 3I5UA 1RAGB 3FBNB 1IJJA 4RAGA 3MN6A 3I4NJ 1J75A 4BXFA 2YRVA 2OFKA 4RAYA 3DPTA 1QPIA 2YLBA 3OIQA 3CO7C 4HVVA 1BR1A 1IGQA 3VS6A 4JKDA 1VZ0A 1J09A 4OVLA 4JZ3A 4M6XA 1D0YA 1R5HA 2GXAA 2KT0A 4YFNF 2VPLA 5GP9A 1OPKA 2V4JC 3SZTA 4ISEA 5GJWB 2ISYA 3LFUA 2XF5A 1VQ8Q 2CSIA 2GA1A 2M51A 1B9DA 2NS0A 4KUMA 3JSPA 1EFNA 1EH7A 3AAPA 3BZKA 2Q1NA 3F8NA 3A5MC 3M0TA 4M74A 3I59B 1JCFA 3TGNA 4A62A 3S32A 1QPMA 4BQOA 1WCMJ 4Y13A 3MKWB 4FWSA 4QCLA 3M0RA 3HHHA 1YQMA 2DFHA 5I2MA 1I1SA 2CH5A 5KRTA 2LD5A 1YJWT 1YW7A 4N4GA 3QEVA 3G6EI 3MEAA 1VQ5N 2RH2A 1RACB 4LDUA 1WSIA 4H03B 3KLHA 4BHPA 2NVXJ 4M7DA 1VTNC 1XQOA 1QMCA 3FX3A 3DLEA 5AJ3K 2WB1N 3LZJA 1GFDA 2A42A 1SFUA 4HTUA 2P7VB 4I2OA 3ZR8X 3HSBA 5A2QK 4I6MB 1DEJA 1NYFA 2NNNA 3QFUA 2HBPA 4JKGB 4DB3A 2YT6A 1VQLN 2ROLA 1P92A 3NH1A 3KJVA 2W48A 3RKWA 2O0YA 4YFXF 3MX5A 3R1XA 2DTOA 3HHGA 1MBJA 1MGQA 2R5YA 2D1XA 3TTFA 1SSFA 1G3YA 2ZFWA 5AN4A 3NMZC 2B7EA 4CD3A 1O3TA 1VQNQ 2HL5C 1YITT 2ZQBA 4Q5VA 4RW8A 4M73A 3CCQA 5AQOA 5C25A 3EGUA 3V8LA 1Q81U 3L42A 3FBIB 3UKUB 1MJBA 1YHQQ 3SAFA 1XGNA 3G7ZA 1NK2P 2Y31A 2IT0A 2D8HA 3BG7A 1QTMA 8ATCB 4OMPA 2GQIA 2EV0A 3QEWA 5H20A 4XLEA 5EZGA 2Y30A 3ASOH 2VWJA 4CA0A 4KBOA 4K25A 1J5EK 1L3VA 3LH5A 2LDUA 3UF4A 2RHIA 1BW5A 2CQXA 5GMKj 1M3CA 3WT0A 1Z77A 4WQ5C 2LH9A 1YRNB 2IS2A 1WNLA 3EYZA 2ZPEB 1N8RU 4JX5A 2VT2A 1WSHA 3MZYA 2QA4Q 2D0BA 3V8KA 4JD2A 3TWHA 5C3EJ 2VPRA 3LDPA 3THYB 3E7LA 3CJ7A 5HY6A 2DBBA 1TC3C 3TEEA 2EBIA 2P0KA 3I59A 4WCEL 1W4SA 1L5UA 3OVNA 3L2ZA 4I6ZA 4ESRA 2LK2A 2CFXA 2HBJA 1RNLA 4XOPA 5BMZA 3D7SB 3BG6A 5L23A 5M1FA 4J9HA 1JJ2P 4II1A 3WXJA 2FLOA 1IH7A 2EZIA 1WJRA 4OOIA 3LL7A 1Q82U 2E5NA 3F6VA 2V79A 3VF2A 1LW2A 2XHIA 5IXFA 1Y0UA 1GOBA 3CJNA 5LJ3h 2VOOA 2W42A 1WQ7A 4CRIA 1SAXA 5DDGA 4O8UA 4ZYEA 2GZWA 4ZGDB 2EHGA 4LXCA 4ENMA 1X6OA 3NVMA 2B8AA 4J2DA 1DGKN 1YJNQ 3EPZA 1Q7YU 4I6MA 1X3MA 1HNWK 4IEIA 1VSJA 4DMNA 2B63J 4M78C 1IZ6A 4L5JA 3VENA 2K4BA 1VHXA 4HZFA 1VF9A 2FPFA 1OVQA 3SUPA 2FRHA 4PKCC 3ALYA 1M1EB 3A02A 2A6AA 1OH7A 1ETYA 1YXQA 3H5NA 1AZEA 3CJ1A 1ZHFA 1SD7A 3I5SA 4FLYA 3S41A 3AGKA 4J6XA 1S9GA 4IFYA 5CHIA 4NXNK 4F3QA 3ASNH 2DOFA 4OIQF 3UKUA 1ASWA 5FU6C 3CCEN 1TG0A 1IBMK 3IKVA 4DJAA 4KNYA 3Q0WA 2RB6A 2EYYA 1K76A 3ASMA 3G71N 1OZ3A 2A40A 2OYQA 1IKWA 3OSVA 1KTQA 2L2OA 3R60A 3R0JA 4OGCA 1IF1A 3HEFA 1RT6A 4BC5A 3TMOA 2JM9A 1R71A 3WODF 2M8EA 4F93B 2K85A 1ZBXA 4M78G 4CHOA 3GIBA 3EUAA 1HKBA 5F1XA 2I5WA 5L3EA 5E3OA 1YRNA 3I55N 4KMFA 3VEOA 1KZHA 4J2AA 1GLCG 5L3BA 4M77E 1HA8A 1HOMA 1N9RA 2OTLQ 4W5QA 1RDWX 3THYA 4NBQA 1EH6A 1WNSA 1MH4A 4N9HA 5JLHA 2M7AA 3CCLA 1QQIA 2RHKA 1WFXA 4DZPA 3FWEA 3L9FA 2O8FA 1AHDP 1ZG5A 3H9QA 4FX4A 1HR0K 3WQTA 2UXXA 4DV2K 3BTIA 3ZGKA 2D0NA 5KYUB 1O7FA 5CO7A 3GCMA 1UTIA 4V2FA 3CMYA 2UWMA 2HCKA 3NMUA 4DWIA 3E19A 1JT6A 3GEZA 1RI7A 5LHGA 3KLFA 3ELKA 1C0WA 5K7FA 3ZT4A 2XAFA 1WEFA 3QBXA 2XKPA 2JPCA 1NNEA 2O8EB 1N9SA 2K02A 3E66A 4FL9A 2JMAA 1YJ9I 3C6TA 4WFNL 3CCRT 3LSPA 5H6QA 3GTGJ 3BEXA 3RBBB 1B9FA 4CECA 2MFZA 4C3IJ 5LFAA 2RVCA 2PMZN 3W3DA 1UEBA 4F9OA 5HBMA 3AVFA 1H8AC 3PX6A 4BR5A 2CT4A 2DJNA 2IXSA 3JCMb 3SQNA 3SWNA 3A1YA 3HBLA 5ERIA 4IOCL 1MDMA 3O3FA 3CCUI 1V4RA 3BPVA 3UIQA 2XROA 3I4MJ 4DTJA 2CH0A 4JDSA 4AF1A 2IJLA 4E7KA 2YWWA 2F5CA 4C2TA 1A5VA 4EJTA 2VIXA 4RUGA 3JAMK 1Q81R 4CJVA 3SXYA 3P8DA 2HHWA 4BJ5C 3MAQA 4UB6C 1DUXC 1AWXA 2JT4A 2ZCFB 4OMQA 2MABA 3H6EA 3D2EB 3HOYJ 2YPRA 2V1NA 3PTAA 2X9HA 1O57A 2UXNA 4B6MA 1YVNA 4Z4HA 4B47A 3G10A 3FFKB 3U21A 4ZZDA 2HHQA 3HXLA 3CC4I 2QWNA 1W2BA 4HT8A 2AA4A 1M3AA 2W0ZA 3ABUA 3TAFA 3HYIA 5F1RA 2JN6A 2IGOA 2E34A 5AZIB 3AVHA 1D9FA 4A3KJ 3OYAA 1E0EA 4M75C 2QEXA 3SZ2A 4KI4A 3FM5A 1XG7A 2CP2A 2OTJI 3KYLA 1SANA 2WUSA 4B3AA 5LJ5f 1V4TA 4IHYA 1X43A 5BPIA 4DU1A 3HPHA 5KYUA 2HOSA 2IDOA 2CQ7A 3JRFA 4N41A 1Q82R 3I53A 4BQAA 1TP4A 1UECA 1XGSA 1VQ5I 2TDXA 3IC7A 2AHJB 5FPNA 1ZGWA 2G8WA 1CLQA 4Q47A 3CM6A 3C7JA 2O8EA 4XRMA 5LY3A 1VQ8A 3FZLA 2JG6A 2HGCA 4EZ9A 2VE9A 2RN7A 1KD1C 1ETOA 1TQPA 4JK8A 3CVSA 4PJOB 2R7RA 2DPDA 4J2EA 1VA7A 2OV7A 1Q7YR 3LSKA 1VQLI 4M75G 2E3HA 2VXZA 2MGQA 3LM2A 1N75A 4E4HA 5C2DA 4DSKA 2P7CB 3BY6A 3K9TA 3JRDA 5HROA 3LQRA 1OR7C 4HHTA 2AKKA 3SFZA 4N9IA 4ZHRA 4IZZA 1X3UA 1VQKT 2AS5F 4FZYA 2K9LA 4A3CJ 2DXTA 4BKXA 3O8GA 3M53A 1RT5A 1YJWQ 1QVFM 3CBMA 4ENKA 4DEYA 3SUNA 2IVPA 2VL8A 4F7UB 2ZGZA 2GWRA 2HNDA 3PUFA 3HRUA 5KAIC 1VYVA 1U04A 1N36K 1EO1A 3QEPA 3EAEA 3WVEB 3Q1JA 4RTVA 4FSXA 1BA1A 3D2EA 3GVAA 4EPCA 3ZCMA 1BIUA 5JLFA 3VQBA 2F6CA 4QTRA 4E6RA 2DF6A 7AT1B 1LDDA 1X3WB 3W2WA 1P7IA 4XTZA 4D7NA 5CPRB 2LKXA 4QWQA 2CS3A 1KU3A 4F91B 4IL6C 1NPRA 3DU6A 2E3IA 3K70D 3O80A 4FM4B 1NJZA 1I5OB 2A3SA 1IRGA 1YITQ 4XU1A 3O2PE 3I0WA 2HDWA 5EGOB 1P59A 1M1FA 5AZIA 4KA4A 3N5NX 1O3QA 2DK8A 4FLVA 1UUEA 1UHMA 3KP5A 4LD0A 1NGEA 2DVEA 1S7EA 2FQ4A 1QS4A 4FT4A 1H1VA 2DFIA 2ABLA 3CXCM 4AFQC 3F70A 1KEAA 2K27A 3D5LA 2HYGD 3V9WA 4UV8A 4MQ9F 4PZJA 5DUKA 1POGA 4RB1A 1W5CC 2DLLA 1IG8A 3R6SA 1K4US 4CGIA 4LOCA 3DBRB 5GPCA 3VS2A 1GXQA 3LP2A 1CSKA 3OYIA 3CCYA 1IHVA 3HZ6A 5BPDA 2EKHA 4M6VA 2VG5A 4RGUA 3ABLH 1XI1A 3JB9I 3KYCB 2P9UB 2ITGA 1AA7A 4FJNA 4QKUA 4Y28E 4H5TA 2CFOA 1OFCX 4KO0A 2JNGA 3NTKA 2PFBA 3WE2A 1K9MC 3KYDB 5GIOA 1Q18A 2VGNA 1RC9A 2PYJA 3BP8A 3H0DA 3CCJN 3EHQA 1NTCA 5IHNA 4HDUA 5EZHA 2HZYA 3R2XC 4NB5A 3HTVA 4DZJA 5LJ5e 2DRMA 2YUQA 1SHGA 5KCOA 4BRKA 3CCEI 4A4EA 4HXJA 4F16A 2FBIA 2Y1IA 3V7CA 3OYEA 5KN8A 1SL2A 3C2GA 3X25B 3T9NA 1MMSA 2EK5A 4GKJK 1D1CA 4KT0E 2KKZA 4JKEA 2GA2A 2P9PB 4FWOA 2OPSA 2ELHA 4M7AB 1TZLA 4LLLA 4A5AA 3SFIA 2M30A 3RZDJ 3A8GB 1V4SA 5FFXA 4PKIA 2KXDA 3HFOA 3ZBDA 2Z99A 4L9VA 4AU7A 2KDZA 1LEBA 5GAEP 4V2SA 3RYRA 2NOBA 2O31A 4XMYA 4II3A 3J7ZI 3I55I 4CFBA 1A6QA 3D0PA 2ASPA 2KMTA 2RQWA 3OYGA 4KTWA 5EGOA 4A61A 1BHLA 2GBYA 5DLQE 3A8OB 5KPRA 3M0SA 3VV0A 1QCFA 2HKNA 2YJEA 5CKDA 4DOZA 2YHYA 3DJCA 2XIGA 4RM3A 3E6CC 1I27A 2KYBA 1ZA2B 3FMRA 2CGKA 1TXQA 4IQ4A 5BRFA 3HRGA 1ZBHA 2JZYA 1KU9A 2W57A 1ILYA 4AM6A 2OF7A 2PQWA 2RJDA 1HDDC 1RBVA 1KA8A 5IOYA 1ZC6A 2HXOA 4JUVA 4BXUA 2UUAK 4H0OA 4BS9A 4OKEA 2G8IA 3BQZA 4DTPA 4CCNA 1S1XA 2FMYA 2YX7A 5FJ8J 3JCMP 3JCMf 5GAN8 4QAGA 4I09A 2D45A 4C23A 4UOBA 5C10A 5IY5H 1YP5A 2R5ZB 1TUDA 3SDZA 4RW4A 4FYDA 1S72A 2BVLA 4IHXA 2P9UA 3V9XA 2Q8KA 2K5FA 3F8FA 3W3CA 1QU3A 1DLOA 4Z4GA 2WA0A 2NYXA 5DCMA 3G0ZA 1MBFA 4JX4A 3VYHB 4M4ZA 1BG3A 2HS5A 3VQ4A 4V2GA 4LF8K 1SPKA 1BI0A 1W1FA 2KQRA 1BJZA 4Z0UA 3JTHA 4CZHA 1U9OA 4DNCA 4WE1A 3KP4A 3VQCA 3DWLE 3BG5A 3FMQA 2DXCA 3I54A 2ESHA 2YUPA 1ZLJA 3OYDA 4YORA 1YIJI 3AY9A 4HVWA 3L09A 1T08B 2DT6A 2MC3A 2YX4A 4A3EJ 2W04A 2FMLA 3IL2A 2ZXIA 5L3FA 3JR9A 3GZ6A 3QODA 2HHVA 3LSGA 3LPTA 3P9KA 2DL3A 4C0DC 1R4NB 3BDLA 5TKWA 1XSDA 2P9PA 4M7AA 1FJGK 2YDLA 4CE9A 3CCRQ 1J5YA 4CEZA 5A0LA 1JLBA 1OH8A 3LW5E 4OMYA 2O9LA 4B9LA 5HL7L 1PUFB 4MQ3A 1RTIA 2KLAA 4FZZA 5AT1B 5AQLA 2HMAA 1KQSA 4DFPA 1VQ7T 1N78A 3KETA 2DIGA 4PY5A 3QIIA 4RTTA 4MFDA 4NQWB 2YNIA 3FXUA 3E1SA 2HBMA 3A5LC 2G8FA 1WJDA 1ARKA 4NYFA 1HF0A 5AQPA 4N56A 4KUIA 3ML6A 3MN9A 1HDPA 1K9AA 3CCST 1X19A 1EWRA 1L0OC 1TWBA 2RHUA 3ZXSA 3SUQA 5LJ3d 1TW3A 4II2A 2WY8Q 3D7EO 2B0LA 6PAXA 2OFIA 2EV6A 2TCTA 1N27A 2K3BA 2JUFA 2GUIA 2PG4A 3INZA 3AV9A 3AGRA 1O4XA 1VQ4N 3SEZA 3ZSZA 4CEAA 3DLLL 2KI7A 4S0HB 4JK7A 1RKWA 3P5JA 1DJ7B 4BI8B 3RMQA 3FZMA 3RPUD 2E6LA 4HUEA 2IP2A 3H6ZA 2FSJA 4XICA 3ZN1A 3CQ8A 2A6HF 1RPWA 2K57A 2R5ZA 1WA7A 2VWBA 3PM1A 3GFIA 2LT1A 2D5RA 3FFIA 3CCMN 4BRFA 3O9TA 1OYWA 5LRSA 1B9NA 2O4XB 1YVUA 1GDTA 2XF7A 4XOTA 3C6HA 3LNQA 2IVOA 5D6WA 1PNJA 1GV2A 1HSQA 3IAS2 1NU0A 2DL5A 1KO9A 1NG9A 2Y1JA 5CQGA 2IVMA 3MKZA 2XC7A 3JB9H 3CC2N 2EAYA 4WXDA 1EZZB 2P9SB 1RI0A 4JRKA 3CCVA 5E26A 4DYRA 5DD8A 2VQCA 3ME9A 1JO8A 3PFIA 1ZG3A 2IPQX 3JCMe 3BR2A 2OAWA 2I5JA 4GYGA 2LJ3A 2GBQA 1TL1A 2E2NA 2DD4A 2E6NA 4LDWA 1FXXA 5F64A 2GF7A 5E3NA 3QU3A 4NL3A 3VF6A 3H0GJ 4D5CA 1PUFA 2K2VA 2RC4A 4C8QD 5FWCA 1DT9A 4HCKA 3TU5A 4XLNF 4ZZLA 2FVUA 2LQKA 3F73A 3S1NJ 2FF6A 3P9IA 3O1BA 4NQWA 3FXQA 1LWEA 2H56A 1VQKQ 3CG7A 4CUGA 4AIHA 2IS4A 2ZWHA 4K2EA 1M3BA 2P4WA 3VSKA 1VQPT 1PDNC 2DDAA 1MMAA 1YJWA 2NLXA 1QVFA 3O9RA 4K43A 3R9PA 5A0DA 3LAPA 3QMLA 4DTMA 4C8QF 2C0OA 3SMPA 4ZH4F 4H0TB 3FXJA 2ICWG 2CDTA 4LUEA 5C12A 3M3YJ 3DOKA 1RRSA 1PCXA 1T6DA 3AAQA 2NRXA 1M2OA 1D3BB 4H4OA 5E8IA 1FTZA 2HEQA 1OCZH 4NXMK 3AA2A 3PVLA 2RI2A 1ASUA 4X9DA 4IF4A 1R0BG 4CHZA 4JEPA 2O4XA 1P7MA 4BR9A 3CC7N 3QSUA 3ZL7C 1FOYA 1WGXA 4B1UB 3HKZA 3HOUJ 5FKKA 1LWCA 3FZFA 3QWXX 4QS8A 4K8XA 2JSPA 4XRSG 5GMKm 3CXCA 3M07A 2RPNA 4QIWN 2VB6A 1GLFO 3EETA 3LZIA 2M0MA 4AWXB 1RT1A 4IBNA 1NK4A 2L4AA 2P9SA 3I4PA 1VQMN 1KHCA 2DXBA 3VQPA 3SQ0A 2SRCA 3C7NB 2CP0A 3BY5A 3ABMH 1FOXA 1KQ8A 4XLFA 5FLMJ 4BWMA 3JXUA 4YHHK 4DV6K 3I56A 1KVAA 3A0IX 1AHJB 3HRTA 2BZTA 1RETA 4B1ZA 3WXKA 1OULA 5LLQA 1GOAA 3CF5F 1TK0A 2UUBK 3E6DA 2DYIA 4X0GA 2E2HJ 5I11A 2KIMA 2GXBA 2PNIA 1BOBA 3ZLJA 2X4XA 3NTHA 1NOYA 1WHJA 3U3YA 3VS3A 5AQGA 3P8BB 1YN8A 2BYVE 5AIQA 2JTMA 3CJAA 1NYGA 1BW6A 2GLOA 3LA3A 3GFMA 3J81O 3HPOA 3IHUA 2R7XA 3BW1A 1B92A 2X1EA 4LN2A 1YX3A 3VTHA 2RQVA 1HRHA 4RTUA 3DRRA 4QLCU 1TTHB 1BL0A 5ICGA 2E5KA 3S1MJ 1K8AC 1RTJA 4CFAA 1JHHA 2UZKA 2E2OA 3K9KA 2A41A 4BU2A 1Q81C 2CG4A 4M3YA 4KTQA 2X1CA 4I9QA 4D5FA 2GIVA 2ZO4A 4A3LJ 1W2BP 4U0VA 3QOEA 2R0QC 4PUSA 3O3KA 1MV0B 5AQMA 3A8YA 3IKTA 2Y4XA 1GL5A 3PMIA 1CKBA 1D3BA 1H0MA 3KZBA 2CH6A 2GOXB 2GX9A 2F8TA 4J9EA 1MA9B 5FD5A 3ZSYA 1LCKA 2EKOA 1M90O 1UDLA 2NLUA 3E01A 4NLCA 2YS9A 3HI0A 5KVRA 1WJCA 4C1NI 5GANf 4DR1K 1QZEA 2BTTA 4JRQA 1RBUA 2NOZA 2RO0A 3DEWA 3VQQA 2ZXWH 2JJ7A 3GF5A 5EEHA 2ZM6K 3UPUA 3T3FA 1KG1A 3GOIA 4FYXB 1CGPA 1K83J 1BI2A 2L0KA 3OB9A 5GAMf 1RLPC 4WTOB 4DYCA 5GTIC 1NBWA 2TRTA 2ZMEC 1LEAA 1NGJA 2K9SA 4CFDA 2EFWA 3C7NA 1Q82C 3FZVA 1BC7C 1TTYA 8AT1B 1Z7LA 1YI2A 1WSGA 2ZF5O 4BG9A 2RN2A 2G0EA 1YOVB 2YNGA 2BW3B 1LE8B 3PLAA 1PU6A 3CD6I 2X6SA 4JI7K 3PNTA 1SHFA 4LDVA 4DR7K 1JHFA 3G6ET 1K0SA 1QZYA 1FK9A 5E79C 1Q7YC 2AP1A 1U8BA 3VS7A 4AM7A 2XGEA 4AI4A 3LDOA 1JXMA 2KXCA 3L2RA 2YUSA 2KLOA 3K5OA 4H0XB 1X6BA 1ETQA 1HYZA 2PJRB 4NCAA 1N3CA 3PIPF 5HNFA 1WJFA 4IJNA 4XSZF 4JAXA 3D5RC 4O0JA 4N4HA 2GTOA 4IOAL 4R8HA 1ZA1B 3K69A 1R59O 1ETVA 1SRMA 1S1VA 3CP2A 1T3VA 1IW7F 3BPXA 2GXGA 1VQ4I 3P39A 2QQ8A 2Z1IA 3KXTA 2Q31A 4EMKC 1A04A 2MG4A 3RKQA 2DLPA 1Z0XA 3QICA 4F2SA 1AD5A 4RAFA 2H6CA 5KPZA 3LSRA 1X9MA 3N97A 1VQ7Q 2DOAA 2R5MA 5E18F 1HQUA 4MLEA 5CKTA 5M5YJ 4AQYK 4HKEA 3F5TA 5D4RA 3MCPA 1I94K 1LV5A 2F96A 3MKLA 1N6QA 1U2VB 1B9MA 3CCSQ 4ATOA 2LSNA 3J8AA 3JAMZ 3WXIA 3HRSA 1KIKA 2EGCA 5C15A 2DX1A 1D8KA 2HKXA 4M9SA 4WXCA 3MK6A 2EA2A 4LG3A 4YY3K 2QUFA 5FU7C 3HJEA 4IQJA 2QK9A 4AIJA 3OMYA 3O4NA 4EV0A 3DB3A 1USSA 4BG8A 2DERA 2DYRH 4FJLA 3QYEA 2PY5A 1IXCA 1YG2A 1Z3XA 3WTSC 3SB2A 4C2UA 3IDHA 5GPAA 1MBEA 3VJPA 2GOMA 2MD5A 3ECHA 2M87A 4DOWA 2JXBA 2XG8D 2VQFK 1ZHIA 2BW3A 3HTSB 4CJ7A 1PSFA 3S2DJ 3I8BA 3WNEA 3K5MA 1ZSZB 4OB0B 3L4QA 4J5YA 4M7YA 3KP6A 2EZHA 5GANe 3IWZA 4OX9K 2HD0A 2RA2A 1A35A 1FBQA 1HNVA 5M1PA 3GFLA 1VQ6N 2F4VK 4CF1A 3C2HA 3O1WA 4LK1F 3QNOA 2CZ6B 1REVA 4O5BA 2PJRA 3ZP5A 4FWKA 5GMKl 2KW4A 1A5XA 4AFSC 1IV8A 5GAMe 5D6EA 1USTA 3HG9A 5GAN7 3UR3C 3RPQA 4ETSA 2XDPA 4IG3A 1VOMA 3F10A 4KHQA 1XCBA 1HKSA 1UMQA 3CUQC 5AFUA 2X85A 1GXIE 4JHDB 5CIUA 3DM2A 2NUPB 3CEYA 2FG0A 4KH1B 4N0BA 3QEIA 3NH0A 4HEA2 5CHZA 5CVJA 2WC9A 4KITB 3PV8A 3E3VA 1CXQA 2DKGA 3M5RA 4KV8A 4ZJZA 3PGGA 2ZBKA 4B22A 2K4YA 3M0PA 1NJIU 5LEJA 2CP6A 4DS4A 2QEXN 1OJLA 4PA1A 3DYAA 1WHKA 3VS5A 4FJGA 4J9GA 2LRDA 2F5TX 2P6SA 2H94A 2V9PA 1UB4A 3QWLA 1Y07A 3UB5A 1VQPQ 2Y0SN 3VYGA 3LA7A 3RVCA 3SQ1A 4WX9A 2QDYB 3A8LB 3H3OB 2KISA 5C4JJ 3WXLA 3MWMA 2CGLA 1BCOA 1DU0A 1KHIA 1PSEA 4CZLA 3LSMA 3G4SA 4M77C 3BWGA 1B7TA 1TVRA 2DO3A 4ID5A 4YDUA 5FLXE 2BZYA 1VQ8N 2XRLA 2XHBA 2VOPA 2ISZA 2L02A 5BS6A 4JI8K 1P4AA 4J00A 2A28A 1QRYA 2ADUA 3MXIA 4DSEA 2QKBA 5HKCA 2G9WA 1YQAA 5LJ3j 2YG8A 2FEZA 3CF2A 1RBSA 5CKHA 4F2RA 5DLOA 1ZSZA 4CHQA 1QLYA 4D6WA 4R79A 4B1YB 2RHXA 4CBXA 3CJTB 4D9JA 2CW7A 3CCQI 5IPAA 3H08A 5J8CA 5GADP 3MEVA 2QYZA 4C8MA 1ZN2A 3KK3A 1Q95G 3QESA 4XAXB 1FW6A 1ONVA 4RA2A 3U3GA 3ZEHA 3EH2A 1RT2A 2FBYA 4ILJA 1G15A 3OYFA 4Q48A 2P84A 1YJ9T 3AVNA 4M77G 2E1MC 1EJ9A 5HLGA 4C0FA 3UT1A 2NUBA 1BIZA 2Y2ZA 3TI0A 5LJWA 5C6SA 3CPFA 3HKSA 3B73A 3RSEB 2JA2A 4P9FA 2DETA 4D8DA 4E6KG 2VQGA 2R92J 2DO7A 3CCUT 4RB3C 4Y92A 3W2AA 4JHDA 4PUOA 5FW9A 1KQSP 2Z9OA 2IIMA 1AWCA 2YHWA 3FHZA 4M78E 1U78A 1KQSS 3ZRGA 2QF7A 2DODA 3KD5E 3E5UA 1OCRH 5JHUA 4JJBA 3JRCA 2NAZA 3WHCA 2PBDA 3J7ZO 5KAFC 1VQNN 1GLBG 1X3ZB 1ZYQA 1W6XA 2DCEA 2GELA 4EVIA 4KGXB 2C0TA 2KSSA 2ID6A 1YHQN 1KG7A 5FDLA 4B23A 1RL2A 1WAFA 4FL6A 2W6KA 5H1SQ 3HSFA 3J7AF 2VKHA 2L2PA 2ETJA 4FTHA 4BEHA 2HMIA 5D3GA 5F1JA 5CZ1A 3CC4T 5J40A 3JSOA 4BE0A 2BGGA 1GV5A 1HNZK 1BBYA 2F48A 4JLGA 3V9UA 3KUFA 1J3TA 2MAMA 2OA8A 4V19S 3FHFA 5EYRA 3MCAB 2WAFA 3RTVA 1IKXA 2NXNB 3NNQA 1C1CA 4RLQA 2OTJT 5EJCA 2QA4N 1KG3A 4M63C 4OPAA 4MEYF 3CMMA 2PI0A 1ZAOA 5GAHJ 1SKSA 5TJJA 4KH6A 1X2QA 3JCUC 3DLLF 4HNVA 1TK8A 2IA1A 5IT9Z 1NWKA 4BAYA 4Y4RA 4HF0A 4GGGA 5C0YA 1VAZA 3E9FA 3NF9A 5BQTA 2F8SA 1ASVA 3MEXA 2IPOB 2RK1A 3VUZA 1VQ5T 5GAGJ 3K5NA 1H641 4BR7A 4RTWA 2BE2A 4B9QA 3C0BA 3I64A 4QQDA 3REBB 2DBKA 1K7AA 5GAGP 1M2VB 4I0BA 2PQ8A 2EV5A 1K6YA 4JI3K 1ZREA 3H3VK 3FRNA 3O8VA 3CWSA 1YLFA 1VQLT 1JGGA 2NRZA 4B3XA 2E12A 4YTLA 1UG0A 2Z3YA 2EIKH 1YJNN 1TT5B 3AL0B 4M75D 2D8JA 3GTOJ 2DK3A 2P9LB 2ZPFB 4JS4A 4NL2A 4M72A 1E6HA 3O9QA 2HHXA 2P6TA 1XMQK 2RE2A 3OR2C 3G6EQ 4DLGA 3H8ZA 4DBFA 3QO9A 2CP5A 2CW8A 4A59A 1M90U 1KAYA 1J59A 1QVFP 3HDDA 1BB9A 4B3OA 3QU6A 3MDQA 4ILGB 4WF9L 4M75F 4ELZC 1QVFS 3K57A 2M7BA 3M54A 3ULQB 3CCLI 3GTJJ 2JTFA 1ZTRA 4RB0A 2YJFA 4A2AA 1JKOC 3QEXA 2JOYA 5HODA 4GVMA 4KH0B 4I9LA 5KH6A 4FM0A 2HQXA 2F5VA 2D2WA 4BL0B 2F5KA 3D2FB 3F6OA 3ZSRA 1YS7A 3F8MA 2COBA 1W5SA 1WGSA 4X64K 1R00A 2JW4A 4BY1J 4ELUA 2M0CA 2QWPA 4M71A 5KCMA 1WBBA 1D3YA 3PSIA 1K0XA 4A57A 1G59A 4IEEA 2RNAA 1VFCA 1RAIB 1Q86O 4LIUA 5J6XA 2J5OA 2OTLN 1UG1A 1QVUA 2OJ2A 3J80Z 1BJAA 1XG1A 4MTDA 4CSWA 4IURA 2UUCK 1U6GA 5LEKA 4JKCA 4A3JJ 1QQCA 3PL8A 2ME6A 3CXCP 1WWXA 2LG4A 5IHIA 1XCVA 3T0YA 3Q5FA 4M75E 4EP4A 2M3AA 3G71A 1UJ8A 1ETWA 4C8QB 2HTSA 3DPLC 3ZN0A 4ZYAA 3ENOA 2HQNA 2IA2A 3PIOF 4EW0A 1M2VA 1S3JA 4C92B 3EN9A 2YHAA 2CKKA 3JSCA 3SV3A 4MDXA 4FCYA 1GVJA 4DV0K 5CR4A 1ATNA 2QSHX 1N39A 1XPXA 2CT3A 4EGYA 3QG1A 4FHTA 2P9LA 1LFUP 3MEDA 4MDBA 1NG2A 1ATSA 1TWFJ 1Z9ZA 9ANTA 3CTAA 4EJYA 1QZ5A 4LF5K 2NRVA 4IWVA 4DYQA 3VGKA 2EH3A 2ZXJA 4CGDA 3CCET 4J9BA 4LJZF 3RPUA 1I6HJ 2NYSA 4A69C 1G83A 2QAZA 2Q0OA 4FYVB 5AZJA 1JT0A 3BQYA 4MLHA 2V8JA 2DD5A 2WY7Q 3N4MA 2RHZA 4TVRA 3HSEA 3FDYA 2QEXI 1IJWC 4NHJA 1U5SA 3TL4X 3OA9A 3WU0A 2ABKA 2JK3A 2E4LA 1Y96B 2LBFB 2ENMA 1ZQ3P 1X9JA 4PLIA 1JXBA 3D2FA 3PY8A 4XL9A 1LNXA 3MX2A 4GLMA 3I55T 3NVKA 5J47A 3VOEA 1YQKA 4E1MA 2CGPA 3RDVA 3C95A 2A6TA 3META 3TDUC 1WJEA 2BGCA 3DTIA 3DMJA 2PMZA 1HQCA 4DG1A 1BI3A 1NM7A 4IFVA 1PUEE 1RBRA 4YOYA 3VETA 2NNWA 2WFBA 4BRIA 2V7ZA 2PUKB 2E7WA 4E7SA 1UGPB 1NZ9A 4I98B 4UVCA 1FLIA 3H0IA 4LE9A 3BDPA 2W6LA 3E9GA 2FBKA 1PU7A 2J7IA 1JLCA 4OB1B 3V4IA 5FGMA 4C8QA 1VQPA 4JK9A 2KL4A 1WEIA 5AQKA 2BZ8A 1A36A 4Z4FA 5ILVA 2F2WA 3OSGA 3MMVA 3F9KA 1JI8A 1IO6A 4KN4X 3ABKH 3CCVN 2NOEA 5KRSA 4IRIA 4E1NA 2RM4A 3AA5X 2GBZA 1ZBJA 4E3SA 3CESA 4IUUA 5IXBA 1K1ZA 2RQQA 1V29B 4PJOC 3CPWA 3A0HC 1K4SA 4PQUA 4OMNA 1E2XA 5D8KB 2JA8J 4JK1X 4CF8A 4JP0A 1K78B 3SBGA 3L7WA 4EHTA 5GINA 1ZK8A 1XS9A 2RHYA 3E0JB 4U7BA 3I35A 4IHVA 4FWLA 4B48A 4AIKA 1ZARA 1YIJT 1OX9A 1MUYA 5T7BA 2M5WA 3BTLA 4BY6B 1LWFA 5L3DA 2VBYA 1G2HA 5KQDA 1ZG1A 3PJRA 1ORNA 2LC4A 1I81A 3TSZA 4Z4CA 1MMDA 4C3HJ 4JRIA 4W5RA 4B3RK 1NGGA 4BB7A 1E17A 1YJWN 2XU8A 1M90R 4C3JJ 1YJ9Q 4ENJA 3QP6A 1WZ2A 4FJHA 1Y96A 3EG2A 5BRHA 2LBFA 3VESA 4OAZA 4EJUA 4ELVA 1OI1A 3EUKL 4U7DA 3ULRB 3VERA 3WU2C 3F0ZA 2V7FA 5FRNA 3TREA 3NGPA 2Z1JA 2HOEA 3JRBA 2JJ9A 4PJOG 2IAJA 1Z05A 3P9CA 2EX3A 2RD1A 2CRGA 3X20B 1LKXA 3CCUQ 2HU9A 5K7ZA 3CM5A 2UXCK 3DQVC 3O5ZA 3GZ5A 4Q5SF 3REOA 2YUNA 2D5VA 4I7FA 3FJPA 1WUAA 1NKUA 3VA0A 1TKTA 1RIOH 2J4RA 1JLEA 1R1TA 3DRPA 1JKQC 4CBWA 3VYUB 4YOWA 4K0KK 5BN8A 1UGSB 1KYZA 5CJ9A 2K9NA 2EWNA 4E89A 3GP8A 4F7UG 2DT7B 1RDAA 4AUXA 3FIFA 3LAMA 3HKZN 3PO2J 2DN0A 2QM1A 3T19A 2HDCA 1G3SA 3PUBA 2HXIA 3CC4Q 4MO4A 2X0LA 5BREA 3EL2A 4QS9A 5CVUA 1WVRA 1MV3A 2VC1A 2V1RA 1MBGA 2XPWA 2KR3A 1T8IA 3U8XA 2P4RA 2H3EB 3OIPA 1TL8A 5E17F 1FWZA 5HCKA 5AIPA 4UUTA 2OTJQ 3CZ6A 3CPEA 3NBPA 5AQTA 3GBTA 2V8IA 1R77A 1K78A 5LRRA 1GLEG 2EQJA 4JLHA 1J53A 1NE8A 4F55A 3C18A 3DEUA 1VSMA 1NK9A 2HOTA 3EY1A 2VN2A 2FD5A 4AILC 1QZ6A 2D1HA 1ABQA 4DK9A 1T0HA 3FIWA 2D0OA 3ZT0A 3KCCA 2WV1A 2O9SA 1VQ5Q 2DPNA 2HKOA 1R58A 3OSSC 2FU4A 4DTXA 1P9QC 3ZETB 4RKUE 1U47A 2QW9A 2P5VA 1YAGA 3VFZA 5GAOq 4CGZA 4UUSB 2NVUB 4CC3A 3QYFA 2FX0A 5AQSA 2GUPA 2VG7A 1IXSB 1U1SA 3M6GA 1VQLQ 1FNNA 1N8RO 4M7AC 3TAPA 1TYQB 4PNOA 5JVGL 4DUYK 1D8JA 1WXTA 3RQIA 3RR8A 1DGRM 2EYQA 1KQ0A 4A6EA 1KLNA 3N5BB 1QZZA 3DTEA 3O3HA 4JI0K 4KKOA 3E9PA 3LAKA 3QBYA 4PJ0C 4L5GA 2E2IJ 1T03A 4B9VA 4LIVA 1BKBA 2UV1A 4WCGA 3AVLA 3MN5A 1S72I 3G6EA 3MXMA 3I71A 3CCJA 1KQJA 3D4VA 3DV8A 2ZJRL 4CZCA 1C0GA 2RF0A 1HUXA 1UHWA 1EF4A 3GTLJ 3TSQA 2VUBA 4BH9A 3HP9A 4W1UA 1Y97A 1LJOA 3BZ6A 3MCZA 2ELJA 3PIPA 3FHGA 1SF9A 2DMUA 1R8OB 3VMFB 1GXPA 4ISGA 4LB6B 4J9CA 4M7AG 1TKZA 1W70A 4DF8A 4OU0A 3M8FA 1YT3A 4B9TA 4Z94A 4FW1A 4JKAA 3HVRA 3UA7A 3RR6A 3FSPA 3QB0A 1KQ2A 1V5FA 3ENHA 4IHSA 3IUCA 1Z7UA 2MYSA 2IC3A 2SEMA 3F3XA 4IPAA 2JZ2A 3S6WA 2JUGA 2MLGA 4HRIA 1ZUYA 3ZFJA 4J6WA 4CCHA 3K4JA 4UNOA 4DLEA 5ICCA 2CUJA 3AVBA 5DM7R 1I5ZA 4XN3A 2ZJQL 3BR0A 5CYQA 4G7OF 5C44J 2V51B 2YCHA 5C24A 5ICEA 3ZETA 3FKJA 5IOZA 5FPDA 3M3ZA 3OMGA 1TKDA 4OLAA 4B9NA 4FVMA 1MSEC 2DAQA 5CY4A 4X6AJ 4UUSA 4DBQA 3J7AO 1PRLC 2KTQA 4XLPF 3KBGA 2DTZA 1LPLA 1TWAJ 2VBZA 4EATA 1TYQA 1QHGA 4XN0A 4P9UA 3DLGA 2UXBK 3JRZA 2CV0A 4P55A 4EM0B 3CCRN 4AYBN 2HNZA 2R93J 4IVNA 2Y4YA 5J4YA 4QVZA 3CVTA 1P90A 1WKMA 4PL8A 2EIFA 2YRDA 4GVEA 1HBXG 6AT1B 3CCEQ 1U3EM 3CMEA 3SAHA 2HEOA 1XTDA 3GWZA 5FPMA 4HF1A 4KIBA 3TANA 3M5AA 1EH8A 1SVMA 3DLAA 1Y7XA 1C1BA 3M9AA 2VXEA 4XQ3A 1WSJA 2E60A 5DY9A 3OQ5A 4BC4A 4B1VA 1XMAA 2AZVA 3THXB 2D6FA 2EQMA 2LQNA 3K7AJ 2XIDA 4HT9A 1UAXA 2L7FP 3EE8A 2EYZA 2CMPA 5A2QO 2E1OA 4HA8A 2AKLA 3I55Q 2F5FA 3PO5A 2LF8A 3VQ6A 1S9EA 4GKKK 3FEOA 4CHNA 1JLAA 3CCVI 4ASNA 3M4OJ 1EQYA 2DE0X 2RI3A 3A5ZB 3F8CA 3LDNA 4KHYA 1D5VA 2P8TA 2JWTA 4DQQA 5D5WB 2LP5A 1QQMA 2QM3A 3HYFA 5FLXK 3H41A 3JW4A 4AFUC 5IP9J 4CH7A 4FW2A 2ME0A 2W10A 4DSJA 2HQAA 5E1WA 3RERA 1SVLA 3DOLA 2HVHA 1T0JA 1PC0A 2JUCA 5CK9A 1RADB 2IA0A 3IRQA 3AA3A 4PJJA 2FQ3A 1QWEA 4J83A 3AVKA 3RUXA 3PQKA 1BU6O 2HF4A 4EJWA 2L0AA 2FEIA 1D1BA 1ZXOA 2X6NA 4DQSA 2P9IB 4JI5K 4XLHA 4FXDA 4GDFA 4KB1A 1S5LC 4A0ZA 2EGEA 3CD6T 5K7HA 3JV3A 3WQUA 4IRHA 2CUBA 2H1LA 3BR6A 4IJAA 1XJWB 3IAM2 1NG7A 4B3SK 2WTEA 2ECZA 2E88A 2ZKZA 2EZLA 3FK6A 2E65A 1OH5A 3QLHA 3KLEA 1T95A 2OZ6A 1YIJQ 3DAWA 1YQLA 3KHYA 3DB4A 4KH4A 5HLTA 3W6JB 3QPTA 3S15J 1R4MB 4XNFA 4FJXA 2FXUA 4PSWA 1HPZA 2ZNZA 2M0OA 1GVDA 4BHBA 4XSXF 1F5TA 2A69F 3A5OC 4WFAL 1VQKN 5D5VB 4EMGA 1TQIA 1K8KB 4JI4K 2HB5A 3VGLA 3CC2A 4Z2YA 3THXA 1VQ4T 4L6V5 1YJ9A 4OB2B 3K4BA 2XVCA 3MN7A 2QKKA 3SCXA 3GNGA 2ZD1A 2RV8A 2XGDA 3K4MA 3KPHA 1D5YA 2A08A 2RQTA 5DM6F 2KMUA 1YTUA 4I01A 5J39A 3ZX3A 2R5YB 1JEGA 1NH3A 1XOVA 5CR2A 2JRTA 4CCKA 3LANA 3I56I 2LTPA 5LJ3g 1AVZC 2LDMA 4EFHA 3FDRA 4ZC3A 2QWQA 2QSGX 5B3SH 3ATVA 1TNTA 4NC7A 1DTTA 2KQ2A 5EG2A 3SDGA 2KT1A 4M42A 4H0VB 2DILA 1RT3A 1VSHA 2XICA 1EETA 2FHDA 5GAOm 5C2FA 1Q9XA 1RABB 3V8JA 4IUPA 3NWTA 4D8KA 3BCAA 1QQOA 4FLZA 3QJYA 3WVDB 2LR8A 1WX6A 3WTYC 1V54H 2J6KA 3EZ5A 5J3BA 1XQPA 2RQRA 2D0PA 2P9IA 3P7NA 2LMJA 4OMFB 3I8DA 3GTKJ 4HUGA 3E5QA 3OYNA 2Y69H 3S3OA 3WTVC 4JD2B 3VGMA 1S1UA 2EJRA 5I9EB 3NEUA 2VJ5A 5HRNA 4DTSA 4C9YA 3JCMd 3DLLA 1OKJA 1RAFB 5HS9A 3BTJA 1M3QA 1VQ9A 3SHWA 3F2KA 4XU0A 2NUZA 4ELTA 3ID8A 4ABZA 4CJRA 3L8BA 3P31A 4S04A 3KNTA 3F0CA 3CC7A 3R4KA 4FK0A 5LJ3f 5DK5A 3GW2A 3R6NA 1S7AA 3M57A 2DU9A 1IGNA 1Q86R 3V1QA 3WNGA 4WCIA 1OEBA 2ITMA 1OVYA 1SD5A 5CYVA 4OMLA 5BPLA 1KFDA 2RAEA 2KHOA 1K8KA 2MI6A 4R55A 2DFEA 1HJOA 3OL4A 2I5UA 2JMCA 4A0XA 3EFSA 1VQMA 5JS2A 3FHNA 1KFZA 2VJIA 2P1JA 1UJ0A 3FB9A 5KYYB 2VONA 4E47A 4FVUA 1D09B 3B6OA 2KRCA 1RLQC 4DCHA 2N8GA 4C8LA 4B9WA 2ETHA 2XASA 1X2MA 1BC8C 3C94A 4LFUA 3K4NA 2YG9A 5ADXA 3S17J 3EG3A 1FOKA 4N76A 1YI2I 3NWSA 3PFYA 4YPHA 5C42A 1NKBA 1JXEA 1P4XA 2LJ1A 4M75A 4XTVA 3E6BA 5J8FA 3S2HJ 4M3RA 4IO9L 1F9NA 3G1OA 4CVNE 5I21A 1XNIA 1VQOA 3CWTA 3JAMO 3FZHA 1WYXA 4F92B 1WOQA 1UHFA 1MMGA 5HRPA 2R7YA 3QETA 4BNCA 2IAIA 3WNFA 1IXRC 2WAQN 2XHKA 5J4VA 4J9DA 3M8SA 3NAEA 4CF2A 1WI3A 3UA6A 4LF7K 4O0IA 5ED4A 3CPWP 3OSFA 1S29A 3CPWS 1Y57A 2CQKA 1ULYA 4DR2K 1YYVA 4ORZA 2AXTC 3K1NA 2MW8A 3CCQT 3O3GA 3VB2A 1LQ1A 1QSLA 4F17A 3FF5A 1UWBA 5L3GA 3QO3A 2KY9A 2OBPA 2DTHA 1MDUB 4GV6A 1SC7A 3A01B 4R1HA 4GRIA 3T7ZA 4CYCB 3SV4A 2O8FB 1ZLMA 3IH7A 3MWTA 4RCCA 3QERA 4M77D 4IUTA 3KTUA 5B66C 3M0QA 2QTXA 2BHZA 3PIOA 1XHXA 3U2RA 2DTIA 1PJRA 4XBFA 2Q2RA 2DI3A 3CMAI 2EQUA 3KD1E 2IGMA 1QNTA 3TO6A 2FRYA 3DRSA 4M7DE 1C6VX 2KEAA 1M90C 2E64A 3GOXA 2ZC2A 5KYYA 1ZGAA 5SWMA 3HM8A 4JS5A 3SBTA 3HO1A 4M77F 3T5XA 3FXKA 1RDBA 1UCRA 2E1CA 5GIPA 2E5LK 1NM1A 5FKOA 1DIZA 1OV3A 3O8MA 2W40A 1LFBA 3SWNB 2KIFA 5CQXA 4PIIA 1MDMB 5EX5A 2QQAA 5D6FA 3SMSA 4RGSA 3E9OA 1OPCA 2JT1A 4OF1A 2A68F 1VQ7N 1B3QA 2X4HA 2PLYA 4DQRA 2FNPA 2DTRA 2ZSHB 1TWGJ 2LJ0A 2G8VA 2HHSA 1IGUA 2WSCE 3JRAA 4WXHA 3CCSN 1J0RA 3BY7A 2Q3SA 4UVAA 1CQTA 2KP6A 1NLVA 4CJ3A 1ZUUA 5F0FA 2BTFA 3BF1A 1MZBA 1R7JA 2QGFB 4NS5A 2XRIA 3VKIA 1Z6RA 4YDUC 3HVTA 2XGXA 1VK0A 5TISC 1T8EA 3FMSA 1NLOC 1XX5A 1TS9A 3QPHA 1X58A 2H27A 3EFRA 4DQIA 1SS6A 3BF3A 3SQ4A 3GNFB 3KK1A 2PBIA 3TQNA 4L3QA 1NK8A 3L1AA 3QOPA 4LLNA 4IFEA 3KZYA 4JKFA 3CLQA 1F1BB 4PKGA 3GTPJ 2AIRB 2P0QA 5KQ8A 2O8XA 3ZSXA 3W2VA 2M16A 1ZSZC 3I0TA 1VSLA 3IH4A 4PFPA 1X1AA 2R4GA 1E3HA 1XQHA 3TSWA 4LC9B 3A01A 4CYCA 1A5JA 2WBMA 1ZUKA 2DMTA 4UNFA 3A4CA 3SNNA 2XD0A 4GY2B 2RMOA 2EFQA 1BR4A 5GAOl 2EWSA 3KLNA 1VRTA 2QYOA 1MKMA 4ZDOA 2ASOA 2OUMA 1TQMA 4FLTA 5AQIA 2K9GA 2UUZA 4ENNA 3LPUA 3TPQA 4PFOA 3CD6Q 3HUGA 2XY5A 4A4HA 3OW2S 5JS1A 2DA3A 3MJXA 4OPKA 3VPZA 3N4QA 1WHLA 3G4SI 2RF2A 2PMUA 1CKAA 2L7ZA 3CO6C 3WUHA 2R7ZJ 3OOUA 4CZGA 3K0LA 4E9EA 1KQSM 4FJKA 2XDBA 3QFPA 1GLDG 5H2FC 3MZ8A 3CUOA 2DMOA 3CCLT 3DKXA 2BZXA 1RAEB 3MN2A 2IS3A 5LJ5j 4O5VA 3A1PA 1R9TJ 4ID1A 4FIBA 2YI1A 3HOZJ 4LITA 2VV5A 2E4HA 2ZFUA 2XB0X 2RK2A 1BK2A 5KNLA 3LDLA 1EA3A 1IUYA 1LDJA 1VQ6A 2DEQA 2CH4W 2EJ9A 4BD3A 1HPMA 1VQPN 1VQ4Q 3FR0A 3KWIA 5ECAA 2DA6A 2HTJA 1G8XA 2W84A 3LFKA 5BN9A 4CCMA 5HDGA 1I1GA 3QDFA 2HPIA 2JHJA 1U8RA 4X9CA 4XH5A 4DQPA 1OCCH 3DF8A 4JNEA 1O3SA 3SI6A 1V5GA 4GXOA 1KG2A 3E9LA 2CREA 1X9WA 3Q9SA 3AFHA 1FTTA 2DNUA 1N8RR 3HOSA 5J1RA 4AFZC 1TAQA 3ECOA 1IG7A 2MMPA 4CEQA 1HNXK 5IT9O 3GFJA 4F04B 4CJWA 2QKMB 4LF9K 3HJFA 2GWJA 1BISA 3HOXJ 1TL3A 5AQQA 2Y0SA 5EG0B 2X1DA 4CF0A 3ERED 1QVGM 3SZPA 1CZ9A 4L9TA 2DYBA 4CJEA 2KKOA 3CFRA 2CUFA 2XPVA 4B09A 1SEUA 2ZJ2A 2B9SA 2XDDA 2X51A 4QPOA 1IC8A 3MKDA 1WXBA 2ZJQF 3E1YA 2EB7A 1ZX6A 2CJJA 1XMXA 3VEVA 4BVOA 1SFEA 5CZ2A 3K59A 1MBKA 3QDRB 1J54A 3LH0A 1XGOA 2A61A 2LX7A 3WG9A 3VPRA 2COZA 4IXAA 4AHUA 4YOVA 4BXXJ 2QEXT 3CFOA 4EMHA 1RNHA 3E97A 5E1XA 1QCNA 3TCJA 1JLFA 2L01A 4DEXA 3M55A 1NKCA 2V75A 1R6RA 4OKKA 2NVQJ 5MLCQ 3PSFA 1KG4A 2BOLA 4CJQA 4UQGA 5TGTA 4CC4B 2QK0A 3JRIA 4HOBA 5CVRA 5J2MA 2VKEA 2HFHA 4M3WA 3HM5A 2VJ4A 1G5VA 3IH3A 1LVAA 4K11A 3JCMQ 3SPYA 2Z1HA 4BR2A 1RZ4A 3A2FA 3OOPA 2DA9A 2D0CA 3ZMUA 2BE7D 2A3LA 1KG5A 2E1HA 1Z91A 3OV8A 1DKGD 1W9HA 2F7TA 4O5FA 1LW0A 1LWWA 4G94A 1IRZA 2ESWA 2V7YA 4GV9A 2O03A 3ATUA 3J80O 4OPHA 1VQNA 3Q7CA 5GAOn 4MFBA 3LX7A 2OX7A 5J2PA 2H8HA 4CJUA 2YKNA 1ZR2A 4YRVA 1QQNA 1YHQA 1D1AA 1HYOA 2L9VA 3S16J 3JTGA 2IS1A 1BCMA 3LWIA 1MD0A 2ZZDA 2JA7J 2V6CA 1A31A 2DL7A 2AJQA 3K58A 3JB9G 4B9MA 5EG0A 5AQJA 4CJFA 2VQLA 2QKLB 3CJQB 2JVHA 4RM2A 4FK4A 1XMOK 1VI0A 2BHYA 2RNJA 5AFUH 3E6MA 4RDUA 4CF9A 2Q36A 3QYGB 4HG2A 1YF5L 4XH1A 4WQ4A 2NOFA