4IKFA

Pfv intasome with inhibitor mb-76
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2-Hydroxyisoquinoline-1,3(2H,4H)-diones (HIDs), novel inhibitors of HIV integrase with a high barrier to resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein/dna/inhibitor
molecule keywords Integrase
total genus 101
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ikfA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ikfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ikfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ikfA03
3KTQA 1ITGA 4GY5A 3AVLA 1SKSA 4FJ7A 3LYIA 1C0TA 1L3SA 3LAMA 4ZTFA 3O8VA 1A5XA 3NTKA 1B9FA 1QHTA 2RF2A 4N4GA 3OS2A 3RR8A 1TKTA 1C1AA 1HRHA 3VQEA 1BISA 1RDAA 4W5RA 4I2QA 2MWOA 1FKPA 3AVHA 3PY8A 2HHQA 1B9DA 1GOCA 1D5AA 3U3YA 4KTQA 1VSJA 3PO5A 2HHUA 3HK2A 2DTUA 1SL0A 5JS1A 2RHZA 1X1PA 4DSLA 3TWHA 2RI5A 3V1QA 4KB0A 3MEAA 3G0ZA 4DG1A 4M3WA 1NJZA 1RILA 1HNVA 3VQDA 4DSFA 3OS0A 2GUIA 2EQMA 3QEIA 1Q9XA 4AHCA 4FJ8A 4CIFA 4KPYA 1RBRA 2YNFA 2PQWA 4CJQA 4C5HA 3NH1A 3SPZA 1KRPA 2GFAA 3ZSOA 3MXJA 1JLCA 3HL8A 3WNGA 3ZT4A 3OJSA 3RTVA 3SV3A 5C0MA 2E6NA 2XY6A 4NYNA 3RWUA 3KKSA 3AO5A 5IN1A 3K59A 3AVBA 1OYXA 3SUNA 2QK9A 4EP4A 4Z4FA 3L3VA 4FYDA 2FHDA 4E0DA 4B9NA 2QKBA 3AA5X 1BGXT 2B6AA 3KLIA 1JXBA 3F9KA 4E19A 2G8FA 3LX7A 1VSHA 4FK0A 3AVGA 4CK2A 1HQEA 3AVAA 4DSEA 5CYQA 2MWPA 3HM9A 4Z4GA 2D0CA 4ICLA 1GOBA 3KK2A 1WSJA 4FJHA 3DLKA 4JRQA 4M3YA 4LH5A 1QE1A 3ZSXA 3HP6A 4E7IA 1MU2A 4FK2A 3QESA 2G8KA 2DFFA 1UAXA 4FLXA 1LWCA 3OYLA 4CF9A 2KZZA 3HPOA 3QEXA 1TL1A 1TGOA 3NF8A 2OA8A 3OYMA 4O4GA 5J2QA 2KQ2A 2OZMA 4HUEA 1S6PA 3QINA 4CHZA 3K5NA 1JLEA 1I39A 2EHGA 3P5JA 4ELUA 2OYQA 1EXQA 1REVA 2D0AA 4DFKA 3CEYA 2QQRA 3D45A 4CJRA 3MAQA 1A5VA 2X74A 3RRHA 3TANA 2OZSA 2F8TA 4KRFA 1RBSA 3PMTA 3ITHA 3PMIA 4KKOA 2LTOA 3VQ5A 3V1RA 2HNYA 2OPRA 5E41A 3NE6A 4KB1A 4AHRA 1TL3A 4CK1A 2D9TA 3NFAA 4FJXA 3DLMA 1YTAA 1TKZA 2KW4A 3AVNA 3HXMA 1CLQA 2F5KA 1BQNA 3ZSWA 4FLTA 2BDPA 2K3YA 1VRTA 3MEDA 4RG2A 4MQ3A 1CZ9A 1WSHA 4Y1CA 1TK0A 2LRQA 1ASVA 4DFPA 2F8SA 3LLRA 1QTMA 2OPPA 4CEBA 2HVIA 3SUPA 3SPYA 4HUGA 1JKHA 3VA0A 3VQCA 5CYMA 4FCYA 1SKWA 2LCCA 3S6WA 4ELVA 4O55A 3CFPA 3AVJA 1GOAA 3PX6A 3PNWC 4AILC 3LP2A 4R5PA 4PWDA 1Z26A 4CRIA 3NCIA 1S6QA 4CJ3A 3SUOA 4FK4A 1ZBUA 3OY9A 4OVAA 3CFRA 4N56A 4Z4IA 3ZSYA 2HHTA 3KLFA 1WSGA 1XHZA 1SL1A 1XC9A 3AO4A 4RW9A 2GFUA 3QIOA 1WJRA 2IDOA 1C1BA 2E6LA 3ZT0A 2G8VA 4QQ6A 4RW7A 3RMAA 1KLNA 3V6DA 3BDPA 4IUPA 4LD0A 4FJNA 2HHSA 1BL3A 1SUQA 5FRMA 4B9XA 4KHWA 4FLUA 4Q0BA 2KFNA 3QEVA 2OPSA 3C95A 2VG5A 1KFDA 3E01A 3ZSVA 1J5OA 2WONA 2PZSA 4DWIA 1EETA 3MEWA 3QBYA 4DQSA 3U6FA 4FM1A 2A1RA 4UQGA 1U4BA 4CGHA 5KRTA 4TSXA 3FDRA 3TABA 1YT3A 4F3OA 4I9QA 3WNHA 4W5TA 2HVHA 3LAKA 1JLQA 1S1VA 4K8ZA 3ULDA 1RDDA 5T7BA 4CEFA 3JSMA 1JL2A 2LDMA 3LGLA 4DTSA 2XK0A 2JGUA 1RTHA 4N47A 4DTOA 4DF4A 1KCFA 2Y1JA 4F8RA 4BDYA 3UWNA 3KIOA 4NCAA 4IUTA 2ZE2A 4CEOA 4CHPA 2PYLA 3RR7A 1LAWA 1ZBIA 4CGGA 4CJ4A 2KZMA 4PQUA 3ALYA 4C8OA 4E7LA 2R57A 4B9UA 1LWFA 3VQAA 1NK5A 3AVCA 4KTZA 3MP1A 4KO0A 2XY5A 1Y97A 4DQPA 3FEOA 3MP6A 2OPQA 2IGIA 4FW1A 1T03A 3P1GA 1SKRA 1Q9YA 5HRSA 3AA4A 5CZ2A 3JYTA 4A4FA 3HVTA 1UA0A 2VYTA 2RJDA 5HROA 2HB5A 1TK5A 2XDPA 3VA3A 4OKKA 4E7KA 3QKJA 4OLBA 3SQ0A 4Z0UA 1RBTA 4C8LA 5HLFA 3HYFA 4XIUA 2EX3A 3KD5E 4M42A 2YNIA 5JS2A 1BIZA 2L8DA 2IS3A 3DM2A 3ZT2A 1IO2A 1KLMA 3ZSQA 4CHQA 4OPKA 3T3FA 1LV5A 3KJVA 4PLLA 4B8AB 4DU1A 1ZBHA 2HHXA 3M8SA 2DY4A 4PL6A 4CJKA 2RO0A 4CJFA 2E5QA 2W42A 3ZEHA 2E4LA 2GBZA 1NK0A 4PY5A 2IG0A 2B4JA 5DK5A 3QIIA 2FBXA 1A5WA 4M3UA 1ZBFA 1T7PA 4BE0A 3C4SA 2YHBA 3OS1A 3AO1A 4CGDA 4DLEA 3VQ4A 1EP4A 3KD1E 1NK4A 2EQKA 4DTJA 2F96A 4N4HA 4M3RA 2EQJA 5C24A 1NJXA 3NNQA 3L42A 3OMCA 1ASUA 1DTTA 1O1WA 3O3HA 2YNHA 1NKCA 3OYFA 4J2DA 4Z4EA 1WNSA 4F2RA 1RDCA 2A1SA 3DLRA 3T19A 2ETJA 2KFZA 2ITGA 2X6SA 4LSNA 3ME9A 2HNZA 3L3UA 1RI0A 4FVMA 4AH9A 5KGWA 3V9SA 4BDPA 2DFEA 2WACA 1X9WA 1WGSA 5KTQA 4QVZA 4GVMA 1L5UA 2Q3SA 3DRPA 1TKXA 1KTQA 4AHVA 3QERA 4E89A 2G8HA 4KHUA 5D6XA 1NKBA 4CFBA 4DTRA 3G10A 3TARA 1NJYA 2RPIA 4DQIA 2K3XA 1CXUA 3H6ZA 3OQ5A 5C6SA 1IKVA 3META 1RDBA 1WSEA 4CESA 2R7YA 3LPTA 3P8DA 2HNDA 3IG1A 3CQ8A 3VQ9A 3K57A 3HPGA 3L2UA 3SZ2A 3DLHA 5FDLA 3MO8A 3LP0A 4PA1A 3NGYA 1FK9A 4CFDA 1HNIA 4CEEA 1S9GA 3O4NA 2QQSA 4G1QA 3QJ6A 3AO2A 4NYFA 3QNOA 4HHTA 4CJEA 1WSIA 4DQQA 3ZT3A 2M0OA 2IAJA 3TI0A 3L2WA 4WE1A 3L2QA 2X4WA 3E9FA 4GW6A 4DQRA 3IS9A 3K5OA 4OKJA 5KE2A 4CJUA 5J1EA 3KLHA 4DFJA 4CERA 2BKDN 1RT3A 3VQQA 4AHSA 5C42A 3TAGA 1HQUA 4Z4CA 4C5GA 3MECA 3PFSA 2L3RA 4LSLA 3LZIA 3PX4A 3EAEA 4BE2A 2NLUA 2EQUA 3OYEA 4NS5A 1HYVA 2Z1HA 1JLGA 4IG0A 1QS4A 4EP5A 4YNQA 3QEWA 2HMIA 1SSFA 4FZZA 3S3MA 4QQDA 4B9WA 3FFIA 1BCOA 4CJSA 2QKKA 1WSFA 1VK0A 1RT2A 3V81A 4B9LA 4KTWA 1TAQA 1RTIA 5KCHA 2VG6A 3OYJA 4CHOA 1XNIA 3AVIA 2D5RA 2Z1IA 4Z4HA 5SWMA 2XHBA 2KTQA 3DLEA 4FJJA 3B6OA 4FM2A 1N6QA 1JXEA 4C5IA 1JLBA 4M41A 4IURA 3VQBA 3KLEA 4EZ6A 1XI1A 1TKDA 1VSMA 1BHLA 3HO1A 3NGZA 3OJUA 2RHIA 3LANA 4FLWA 3VQPA 2RN2A 2RI2A 1S1XA 3OA6A 3ZSRA 2P5GA 1MHNA 4E1MA 3MXMA 4IUUA 4DTNA 1C6VA 3M8PA 4IG3A 4CJVA 4FJKA 3DOLA 4DTXA 3NF7A 3DLBA 3SNNA 4M3ZA 4DLGA 3H8ZA 4J2AA 4C5EA 3FLGA 3K58A 3NH0A 4CEDA 2RHXA 2R5AA 4CEQA 1D8YA 4E7HA 5J26A 1OI1A 2RHYA 3CFOA 4CFCA 4HVJA 3MEEA 3OYGA 4NCBA 4CGIA 2XO7A 4ID1A 3HT3A 4FZXC 3GOXA 4AHUA 1ZYQA 1D9DA 2P5OA 4CE9A 2DIGA 3QETA 4J2BA 4N5SA 4FL6A 3OYAA 5M9OA 3PV8A 5KRSA 4FJ9A 4W5QA 3V9ZA 2IC3A 1JLAA 2BGGA 1FXXA 1HJRA 4Y1DA 1NK8A 1BI4B 1X9SA 4DSKA 3OYHA 5CIUA 3OYKA 2O4GA 1KVAA 2VG7A 3OB9A 1OZ2A 4O44A 4OGCA 4FLVA 4C8NA 4DU4A 5DMRA 4CIEA 4CCHA 4FM0A 1J54A 1S9EA 3ISNC 4CECA 3AO3A 1N27A 1HYZA 1I3AA 5HRRA 4N76A 2DAQA 4NZGA 1B92A 2LSNA 2YKNA 2G8UA 3DLGA 3LWLA 1BQMA 2AJQA 4HCBA 3ZCMA 4FLYA 3SI6A 1VSFA 3SJJA 1KVCA 4CJLA 4FLZA 1ZBLA 4RW8A 4FJGA 4CFAA 3L2VA 4DF8A 4M3XA 2HQEA 3MEGA 1HYSA 4HCCA 4KREA 1RT1A 4OVLA 4CF1A 4CEZA 3A2FA 4IUVA 3AVKA 4E1NA 3BGRA 2JLEA 3HSTB 3IRXA 3HPHA 3S3OA 2VWKA 2NUBA 2YV0X 3V1OA 3V9XA 3LGFA 4B9VA 3M8RA 5I42A 3DYAA 5IAYA 4A4EA 1BI4A 1Q8IA 1VSDA 3H08A 5HP1A 4FJIA 1C0UA 4KAZA 1S5JA 3K2PA 3QNNA 4B8CA 4KHNA 3HP9A 3LZJA 4JS5A 3I0RA 2R58A 4I7FA 2G8IA 2O4XB 1QSSA 3CYMA 4IFYA 2ATQA 4O5BA 1N5YA 1UA1A 3NF6A 4KHQA 2E6MA 5HBMA 1U47A 1RNHA 2RJCA 3C94A 4FZYA 4B3OA 3OYIA 1J53A 4B9SA 3NH2A 2EKOA 3L8BA 1NOZA 4CF2A 3SUQA 5I3UA 1FKOA 1Z25A 4EDUA 3MEUA 3M8QA 3TAMA 3RMDA 2X35A 3NTHA 3I8DA 1IKYA 2HW3A 3QO9A 4O0JA 3MXIA 4BACA 4N41A 1NOYA 3SQ1A 5FROA 2GF7A 1XWLA 4E7JA 1RBVA 4M45A 3TAQA 1WJSA 3TAEA 4I9LA 5C25A 5D6WA 4BDZA 3PO4A 2DFHA 1VRUA 4IKFA 4II1A 4IUQA 4H4OA 3SYZA 4HCZA 4J2EA 4F4KA 3OMGA 2LVMA 1K6YA 4B08A 1T05A 4YFUA 3UT1A 4JLHA 4FJ5A 2P1JA 3D0PA 5J2PA 3CG7A 4O0IA 4DSJA 1IH7A 4F2SA 1LAVA 1RT5A 4FJLA 4BWJA 4DFMA 1RTJA 1RT7A 3CM6A 4PLIA 5KI6A 3NAEA 3AVMA 3V9WA 3QEPA 3E9GA 1UWBA 1D9FA 4PUOA 3SD4A 4CF8A 3DB3A 3O3GA 1BCMA 5J39A 4OJRA 3OVNA 2EFIA 3VQ6A 1RCHA 1EX4A 4ID5A 1CXQA 2YKMA 2Y1IA 4UC4A 2HHWA 3I0SA 3P8HA 5SZTA 3NGIA 1KHCA 4OKEA 1R0AA 3RRGA 4DTUA 4CJPA 4BWMA 2O4IA 3DMJA 1QSLA 1U45A 1T8EA 4CJTA 3SQ4A 1VSIA 3DB4A 2GV9A 3FC3A 1NKEA 1S1WA 4KV8A 2JTFA 3C6TA 1H3ZA 2P0KA 4C8KA 2I5JA 3LWMA 2WOMA 2CKKA 1LWEA 3EYZA 3NHGA 2RI3A 1KSPA 4DMNA 3IAYA 3UIQA 2IOCA 3HJFA 1OZ3A 2RHUA 1G5VA 1RBUA 4EZ9A 4CF0A 4AHTA 1X9MA 1IKWA 1VSKA 5EU7A 1U49A 1DLOA 1NK9A 2BUDA 3ASKA 4Q5WA 3DOKA 3L2RA 2BANA 2RKIA 2FBYA 4FW2A 1QQCA 4QQGA 3WNFA 2Z1JA 3AVFA 3PUFA 3F73A 3PX0A 4RG8A 4DS5A 4OLAA 4CEAA 2PY5A 5KH6A 3C6UA 3VN5A 1S1UA 5FRNA 4DS4A 3TR8A 3S9HA 4HTUA 1KFSA 2XY8A 4OPJA 2XY7A 1NJWA 2HHVA 2X4XA 4BD3A 4QAGA 4CJ5A 1DTQA 3RMBA 4FU6A 3OYCA 4BE1A 2B8AA 5CY4A 3NF9A 4H8KA 3KKRA 4JS4A 2BE2A 3K5MA 5KE3A 3LDSA 4HUFA 5J2NA 3AA3A 2X6NA 4K8XA 3TAFA 2ZD1A 3F70A 5HRNA 2VWJA 2BIVA 1S1TA 3P83D 4A4HA 1VSLA 1WJQA 1RT6A 1WLJA 3LP3A 4IFVA 1HMVA 3S3NA 3KK1A 1C0MA 1RT4A 1W0HA 3KLGA 4N4IA 2B5JA 1L3UA 4IBNA 2YNGA 1G15A 4E3SA 4RW6A 3ZSZA 4F3TA 4CJWA 3EY1A 3ZT1A 1SL2A 4KI4A 4ZHRA 1J9AA 1IG9A 1KVBA 3DRRA 3LPUA 2Z1GA 2G8WA 2D0BA 3SV4A 5KCOA 2G3RA 4Q5VA 4X34A 4Z02A 1WAJA 4CK3A 3V4IA 3DI6A 3VQ8A 5J2MA 1UOCA 1NK6A 1BIUA 4W5NA 1CZBA 3EZ5A 3AV9A 2YHAA 2M16A 4DTPA 4CIGA 1QSYA 1TK8A 3RMCA 4MFBA 5CZ1A 3BDLA 4IDKA 4LY7A 4DSIA 2RJFA 1YVUA 4QW2A 3QLHA 4CGJA 5D3GA 1L3TA 3MP8A 1SV5A 1IKXA 2XRIA 3HVRA 3KK3A 1HPZA 3T1AA 1C1CA 4M3TA 1VSEA 1WAFA 1LW2A 3MEVA 1WN7A 4OGEA 2JZ2A 1JL1A 2RJEA 1F21A 4KFBA 3AA2A 4CHNA 4LH4A 5KGXA 2QXFA 1RTDA 1YTUA 4B9MA 4B9TA 2HQXA 3VQ7A 3OYBA 4LD6A 2PYJA 4NCGA 1EKEA 2YRVA 2FBTA 3NDKA 4QOZB 3M9QA 1ASWA 3ASMA 4KHSA 3LH0A 1TAUA 1NK7A 4ELTA 4DTMA 2DIQA 2O4XA 1U04A 4QCLA 3QIPA 1TVRA 5HRPA 4L8RB 4A4GA 1XHXA 5K14A 1TV6A 1JLFA 4FJMA 3THVA 3TAPA 2X4YA 1LW0A 4RW4A 4JRPA 3SQ2A 2L89A 3NTIA 3Q1JA 4L59A 4GMJB 4H4MA 3WNEA 4CGFA 4CHYA 4DU3A 1L3VA 2ZQBA 4KHYA 4FXDA 2M1HA 3DRSA 3V9UA 3OYDA 3SCXA 2FC0A 5D6YA 2P51A 3LP1A 3LALA 3O4QA 4C8MA 3U3GA 4W5OA 1U48A 4ZTJA 3NBPA 3O3FA 2FBVA 4KI6A 2R5MA 3OYNA 4I2PA 3B6PA 3CM5A 3KUFA 2X78A 1W9HA 3K5LA
chains in the Genus database with same CATH superfamily
3OL4A 1YIJN 5AQXA 1L3SA 2KSSA 4KT0E 3QQAA 3CDIA 4BAYA 3CCSQ 4JJCA 1D3BA 2Y48A 2LKPA 2X85A 3CCEQ 3MEAA 4C8QD 3PO2J 4M7AG 1WHMA 2O8EA 1IGNA 2PU9B 2ZGZA 4KPYA 2P9IB 1NH3A 2PQWA 1I50J 4UNFA 2OFKA 3SPZA 2JTVA 1WX6A 3CJNA 1BC8C 5LJ3g 2E6ZA 2E6NA 2PX9A 1WJ5A 1PUFA 2O61A 4YHHK 3G1LA 3K59A 5KQDA 2OFIA 4U67L 3SUNA 4HNUA 2FHDA 2YDLA 2QKBA 3GOIA 3KEYA 4HYEA 1GXIE 3AVAA 4FT8A 3U4LA 3VTHA 1YQKA 1WSJA 2HL3A 3ZSXA 3HP6A 3JCMb 4JYAK 4EJUA 1HKCA 2K2MA 3MWTA 4GYIA 2HW3A 2OYQA 2JRMA 2JPSA 1IXRC 1JJ2M 4UY8O 5GMKe 2R4GA 1XSDA 2OZSA 4C92D 3ITHA 3SZGA 3QBXA 5GAOn 3G1MA 1AWJA 3TGNA 4QIWN 2XI9A 2GAUA 3R61A 1ASVA 4DFPA 1TSFA 4BG9A 2P9PA 5EZHA 3SPYA 5H6QA 1T0HA 3G4SQ 1HW2A 2CMPA 1ZBSA 2A68F 2HGCA 2ZZDA 4RW9A 3HIFA 2FX0A 3QIOA 4BQNA 1QZ6A 2RC4A 3O6WA 4KHWA 4WXCA 4FLUA 3DWLA 3ZSVA 4DWIA 3MEWA 2J6OA 4N9IA 4EVVA 1U4BA 4BXXJ 3C0BA 3ZMSA 2KROA 2M45A 1ZBIA 4J7FA 3FZFA 1HSQA 1PKSA 5K1YA 4E7LA 3C7NB 2Q0UA 4X6AJ 4LN2A 3MEXA 2VB6A 5BN8A 3CXCP 5AIPA 2XKOA 3ZX3A 2HQHA 3DXKA 2A6TA 4JOMA 4WQ4C 3HYFA 4BXUA 5EEAA 1BIZA 1R4MB 4RM2A 3DBHB 1V5FA 2DOFA 3FR0A 4B3RK 1NWKA 3C4SA 2D0OA 2YUOA 2EQKA 2PMHA 1VQLA 4B1XB 1WHLA 2D0PA 1NZ9A 3V9SA 2BOLA 4RAZA 1L5UA 2CUFA 4A2BA 3EUAA 3CCUI 2VUBA 4CFBA 1KO9A 1GFCA 1IKVA 1WSEA 3META 4C8QF 4CESA 1O3SA 5JLFA 2HBWA 3K57A 1ZYRF 5FDLA 2FZKB 2DJIA 4C30A 5LJ5f 3A5OC 3E97A 1H9TA 1QQOA 1LDKB 4DQRA 1VNDA 5AFUH 1VQ5T 1RT3A 2NRXA 2FEIA 2JWLA 4C5GA 4LSLA 3CD6T 2DA5A 1YTYA 1DQUA 2FXUA 5TKYA 1K73O 4A5AA 4ANJA 4DA4A 1UTIA 3UKUB 3CCVQ 4LLGF 1IN8A 1K0SA 3HHHA 1KC8C 1R4NB 1WJFA 1MUNA 4FWRA 1VQOA 2E3IA 3DOLA 3HI0A 2HMAA 5GADP 2XHKA 5H20A 1XMQK 1WH7A 1IC8A 4BBSJ 1OI1A 2RHYA 2YX4A 2BUPA 1YWOA 3CCJT 2DTOA 1P90A 5M9OA 2AHJB 4OMQA 5KRSA 2YLCA 1PNJA 1OZ2A 4DU4A 4DHYA 1SFKA 2M7AA 3NWTA 2K86A 5L3DA 3GTLJ 4G6TB 2ZXWH 3TO7A 1ON1A 2KQWA 3LSRA 1VSFA 1YYVA 3OS5A 3L2VA 5D6EA 2QEXN 2SEMA 4FX4A 2CV2A 2OX7A 3CQXA 3TSQA 3BGRA 4BNCA 1N32K 2MK5A 3LGFA 2H8RA 1Q8IA 1Q1HA 5LJ5h 1QSSA 1LE8A 1R49A 2COYA 1JXOA 1KD1R 3EPZA 3GFJA 3NF6A 3CTAA 1N3CA 3ZR8X 3OYIA 1PUEE 3BG6A 1IZ6A 5AQQA 2O8CB 5CYVA 1YITI 1KQ8A 1YI2T 3MXIA 1YIJQ 2LF8A 3R8EA 2R7OA 3H6EA 1BJAA 2DFHA 1NM7A 2MMPA 2DEQA 1IH7A 1LAVA 5AQOA 1ESVA 5DUKA 2XD0A 4AI4A 1BOAA 3RDVA 1CXQA 5D8KB 3H1VX 1NMDA 4KH1B 5FKMA 4ZH4F 3CWAA 2M0CA 1IAWA 1SFUA 1Y0MA 3WTUC 2L9NA 1PCXA 3GLLA 4OFHA 1D4XA 1W5CC 4AM3A 2CP0A 3PJRA 1D5YA 1DLOA 1XQSC 1OKRA 1W7PD 5IT3A 4X1EA 1OCZH 5K5RA 1S1UA 3S9HA 2Y2ZA 1LNXA 2P5VA 4XRMA 5CY4A 4WFAL 3UKRB 1DUXC 4CI0C 1OYWA 4JEPA 2EFNA 4HA8A 2CP3A 2C0OA 4A4HA 4BY1J 2NNNA 3M6GA 1W0HA 3CMEA 1L3UA 3C3WA 2ROLA 1I5ZA 2GM4A 4XKBA 5KN8A 1YW9A 3BPXA 2G8WA 3H1QA 1M90O 2I7NA 3B73A 3EZ5A 3AV9A 2IEKA 4XTYA 2HZTA 2RQRA 3E7LA 2X4HA 1MUDA 1U2VB 3JCMV 3I5UA 3AA2A 4R8HA 3WTVC 2VC0A 4B9TA 3ZLJA 4D5CA 3UDCA 1EKEA 3VS0A 3LMMA 2XB0X 4IO9F 4KHSA 3M0QA 4HPQA 4HKEA 4BHCA 1TV6A 2KZVA 1LPLA 4PJNA 3TSWA 5BMZA 2Q2EA 1M1KU 4NC7A 5EX5A 1YJWN 4N0BA 1VQPT 3HRTA 2EQIA 1C0TA 3AKZA 3O8VA 1A5XA 1QHTA 4BI8B 9ATCB 3OWTA 2ACJA 1B9DA 3DJCA 4Q4ZF 4ZDLA 4ZN1A 2W10A 3CCMI 3F5TA 5DD8A 2QM3A 5GANf 4FT4A 4JX4A 4H0YB 5KNLA 1KZHA 2YI1A 3MX5A 2AKKA 2QK9A 4GRIA 1AWCA 2KJCA 4A57A 2WTEA 4E0DA 1FBUA 1Y6IA 2ZJ2A 3HSRA 5FKLA 4EMGA 4ELYC 2B6AA 3ENOA 1TP4A 3OH6A 4U0YA 3CC4T 2MI6A 3ULRB 3RYRA 4D7MA 4U88A 2MSYA 2DTHA 5FFXA 2V7FA 1EXQA 3JCMP 1ZLKA 2X74A 3M1FA 3I59A 5IY5H 3VQ5A 2HNYA 3K9KA 2JQ7A 2CSQA 2ECZA 4LDUA 2L7KA 4FHTA 1J9IA 1ULYA 1BOBA 1X58A 4XOPA 4M77C 3F0ZA 2MLGA 3HSCA 5F0XA 2PJRB 1U3EM 4AILC 3QMLA 3RYPA 2PI0A 3WXKA 2E19A 3A2KA 1VQMN 2M4GA 2Y30A 3K4BA 3LSMA 1SL1A 2R7DA 3BT9A 2DYSH 1XGSA 3RMAA 1KLNA 3GEZA 2RH2A 1B8IB 2CU7A 2VG5A 3CCRI 2WONA 2XRLA 3IWFA 1H8AC 4OO1J 2A1RA 2DYIA 1RDDA 4IDHA 1XQPA 3KD1E 3R6MA 3JRZA 2XK0A 3DTKA 1U5TC 3GZNB 2KYMA 3L09A 4AIAA 3J7YP 4C1NK 1RL2A 4A53A 5CKDA 1O3QA 4UXNA 1C0WA 2HNIA 4WTOB 4Z0UA 2DZCA 4LITA 1GXPA 4M42A 3IHUA 4RA2A 1KLMA 1W4MA 2YWWA 3M8SA 4DYRA 2R3SA 4CJFA 3K0SA 1PJRA 2IG0A 2XPUA 5L3CA 2STTA 2GX9A 4MZTA 2NOZA 1TUDA 4KICA 3RKQA 1HW1A 2J06A 1JXSA 3GE1A 5FPDA 2NRVA 1OH5A 2X6SA 3U9ZA 3L3UA 2P6TA 1U2WA 1QNTA 2P9SA 2LQWA 5LJ5g 3K10A 4M78B 4LG3A 4KNYA 2CQ7A 3HUGB 4LK1F 2G8HA 4BGAA 2H6CA 2VN2A 3P8BB 3IG1A 2HDCA 4J9EA 1MMGA 5CVJA 3ENBA 4ESFA 2YRDA 2W6LA 1WFXA 4KH6A 3G71I 4PZJA 2HZYA 1LNWA 2MABA 4BE2A 5HOOA 4RB3C 1NG2A 1SSFA 3S3MA 1VQ4A 3VS3A 4GKJK 4UUTA 5GANd 2VG6A 2RVCA 1DT9A 2RNGA 2MH9A 3GTGJ 2KAFA 3CCEA 3WU0A 4A2AA 1MHNA 1ZSGA 1KQSM 1UEBA 3TDZC 1ZSZA 4JD2B 1YQMA 4DTXA 3NF7A 1X75C 1R0BG 2L3PA 3LH5A 2Y75A 2JPBA 1OPKA 3ONQA 3CC7N 5GAOp 2LK2A 3JXUA 1OV3A 1YJ9T 1ZREA 3VEZA 2ZMEB 1Q82C 4WF9L 3OYKA 4O44A 4BL0B 4D7NA 4X9CA 5AYFA 1HYZA 2O8BA 1B92A 2G8UA 2V8KA 1IGUA 3CCRA 4OP0A 4YIIA 1JU5C 4M9SA 4B44A 4PKCC 3BCAA 4CEZA 3PTAA 1AHJB 2HQNA 2ZJQF 4HSBA 4FJIA 5M1FA 2G7UA 1JKOC 3CCJN 1N9SA 2RJCA 3HBLA 3VRZA 4B21A 1FOWA 4C3IJ 1ACMB 4EVIA 5IP9J 1D9DA 1IDZA 1XWLA 4EMKA 5FLXZ 2OV7A 4F7UE 2CZ0B 2H09A 3WVDB 3UT1A 2QQ8A 4M7DG 3LSGA 3LCNA 2GCXA 2BVMA 4LB5A 3HOTA 2ETHA 2JA7J 3NAEA 2W0ZA 1BN5A 1BCMA 3DBRB 2VE9A 4OJRA 3DPUA 4FETA 1GV5A 2DJNA 2YSRA 1M1GA 4EW0A 2O4IA 1U45A 4CZMA 3BR1A 1VQ6I 1B59A 1NKEA 3CCSN 1NLOC 1H3ZA 4C8KA 2I5JA 4B1UB 3UIQA 1LWEA 5CKHA 2RI3A 1G5VA 2RHUA 2M0YA 5DD4A 3H5NA 3ZX2A 5EU7A 3OH9A 2P5LC 1Z9CA 4F7UB 2VQCA 4JI8K 4OLAA 1W7PB 4BRGA 2DTIA 1V5GA 5CR4A 4W97A 1BBYA 2ZCFB 3ZYYX 3CLOA 1J59A 3EFOA 4D8DA 1W0UA 1G83A 3SBTA 3DXMA 4DR5K 1D3BB 1RT4A 2C0TA 4AFSC 3LPUA 1MWKA 3NVMA 4B1VA 3MJXA 3CJ1A 4FWOA 1CZBA 3SAGA 3M59A 2NXNB 2FRYA 4LF8K 2W00A 1QP3A 3T1AA 3QUIA 5GJVB 4BC5A 4KFBA 1UG1A 2ZPBB 1LQ1A 1X2QA 4JKEA 4PJOA 4JNEA 2K9GA 1ZELA 5JLXA 2KI7A 3F8FA 4KUMA 3GIBA 2QYZA 3SFZA 3O3FA 2D2WA 1WJAA 2VOOA 1KFZA 1ITGA 4A3JJ 4GY5A 1VF9A 3NTKA 4ZN3A 2VASA 2HZDA 4DSLA 3V1QA 2VODA 4M3WA 2KVQG 2GUIA 1SFXA 4M77D 4A2UA 2LKXA 3AL0B 2IXSA 1VYTA 3MXJA 2X9DA 3SV3A 3LAPA 3SWNC 2YJFA 4BHPA 3KNTA 3L4QA 4B9NA 2A7YA 3FKJA 4P5NA 4CC4B 3F9KA 2FZCB 3K4MA 4PDKA 1CSKA 4P96A 5CYQA 4OIPF 3P9CA 3ZX0A 4JRQA 3F8NA 4E1JA 5HNHA 1MU2A 2GQQA 2CUZA 2KNBB 1IHWA 1KXPA 2RQUA 1HCRA 1R59O 1NNEA 2LC4A 2FOKA 2FQ3A 1NMNA 3DXKB 2L3QA 2DY4A 2RREA 1YTAA 1SAUA 3HXMA 1AHDP 2EW3A 2WADA 1W5SA 1VRTA 2KIQA 1DP3A 3KP3A 4KUIA 2F8SA 4C1NI 4PSWA 2QQ9A 2F4IA 5CYMA 3LFUA 5EG0A 2LCCA 2QWMA 1I1SA 2W40A 4B22A 4O55A 4BR0A 3FXKA 4IX7A 4Y52J 2LNVA 2EIKH 5K7FA 5JVGL 8AT1B 3SEQA 3AO4A 1VQ9I 3CMEN 1WJDA 3QSUA 1MJBA 4YOQA 4C92A 3VF4A 3JB9D 3QEVA 2FF6A 1D3YA 2RQTA 1B9NA 5KRTA 3LDPA 3D4VA 3LAKA 4CEFA 3IAM2 4FO0A 3UWNA 4CEOA 3M8JA 5GPAA 1LKXA 1XGOA 3W2WA 4P9UA 4M77F 3MP1A 4XL9A 2F9TA 3CBOA 2HBLA 2UXNA 3ZQFA 5HROA 1W36D 1KD1U 1ORKA 2V1NA 2O3FA 1Y0UA 4KUDK 4ASNA 3KJVA 1Z91A 4M3DA 4A3KJ 4CJKA 2E4LA 1HBXG 1VQ7I 1GV2A 1IO6A 4LG0A 2Q8KA 3H0FA 4BE0A 2FNAA 3QP5A 5GAMf 3CC7Q 4OB0B 4AIHA 4QTRA 1S72Q 4C2MJ 2XPWA 1WNSA 2XGCA 2JA6J 3NPFA 3I4NJ 2ZM6K 4AHVA 3QDKA 2QA4I 2O8FB 2IBDA 3BR2A 3ZGKA 2VJ4A 3H6ZA 2K79A 4YEJA 1V55H 1IJWC 1HNIA 1ERDA 3KK7A 4OKJA 3GFLA 3KLHA 1W0TA 3CF2A 5F1RA 2Q97A 1I5LA 5IXBA 5KYXA 3CCJQ 1TZLA 4AFZC 2L4MA 4QQDA 4M7AE 2Q1NA 2LRDA 3CJ9A 1H88C 2HI3A 3AVIA 3AG3H 1L3LA 1PWTA 4DV5K 3THXA 1VSMA 3FLCO 3QODA 3P7NA 3OA6A 1M2VB 3ZSRA 4DTNA 2DT7B 1OQKA 4PJOC 1Z3YA 2X6OA 2ZFWA 4BHBA 1YJNT 3EUKL 1NKUA 1Q81U 5FB2A 1NGBA 4CGIA 1MBEA 1ZYQA 1RI7A 1LE8B 2ZPFB 3IP4B 4IOXA 3A01A 3DU6A 3VRYA 2E2JJ 4RLQA 3F23A 2YXYA 2V7ZA 3OYHA 4LF5K 3A0IX 3S2WA 2QLZA 3I9V2 2XAJA 5JI6A 1S9EA 5F27A 2HD0A 2KKOA 1W7AA 2JUCA 4B3TK 1UE9A 2AJQA 3ZCMA 3TEDA 3SI6A 4CJLA 1YI2N 1GLLO 2L4AA 4KREA 2YT6A 4OVLA 3A2FA 3CPWA 2DLLA 5K5QA 4KBOA 3ZQGA 4UB6C 2XIGA 5J6XA 5I42A 2M4KA 3DYAA 2PUOB 5AQNA 4CW7B 1AU7A 2CP7A 2Y9ZA 4KHNA 5E3LA 4J19A 1V54H 1QVUA 3CHWA 3U9GA 1N5YA 4GV6A 2EZHA 5HBMA 4BG8A 2OANA 3N4MA 3AGKA 1J0RA 3NH2A 5DM7F 3TTDA 2YX7A 3K7AJ 3B8AX 3CCQA 3IH2A 1TTHB 5JLHA 3PO4A 4ATOA 5C44J 1CLQA 1EWQA 4IF4A 2WV1A 3D0PA 4O0IA 4CCJA 2E2NA 2M7BA 3E9GA 2P4WA 2Y0MA 4LFAK 2HHWA 2Y1IA 2OBPA 1YX5A 4EGZA 1T8EA 1VSIA 4LMYA 4CXFA 3CWTA 4OMOA 1KSWA 2V9VA 2WOMA 4L0ZB 2KXCA 1TWGJ 2VUMJ 1LFUP 2BUDA 3H9NA 2PFUA 3DOKA 1E7OA 1XTDA 3U1KA 1VQ9N 3CUQB 3IDHA 2DA6A 1RAEB 1FJGK 3VN5A 5HY6A 2XY7A 3MCAB 4CJ5A 1FZPB 1N6AA 3CC7T 1H9GA 1OEBA 2OQGA 3WHBA 4HUFA 2KFDA 2ZD1A 1A0NB 2BIVA 3P83D 1VSLA 1WLJA 2COZA 1HMVA 2GTDA 5AQFA 1S5LC 4QS8A 3CC2N 1HF0A 2ABKA 5CJ9A 4RW6A 2HXOA 5CQXA 5CHZA 2A36A 2EK5A 4V19S 4L5EA 1K79A 2ITMA 4XQ3A 2YHAA 3ATUA 3ZQQA 3BDLA 4IDKA 3QLHA 4NOYA 3IQLA 2VKHA 2GEMA 3CESA 1O4XA 1F21A 2STWA 3A5LC 4XEIA 3CCVI 4BRQA 2HQXA 4YIRX 3VQ7A 4E70A 1ZQ1A 3SEMA 5LHGA 3LH0A 1TAUA 1H92A 4BRPA 3TP3A 2A0FB 1Q86U 4MDXA 4JKGA 3TAPA 1XC3A 4HNTA 4CBWA 5J8CA 3I5RA 3L9FA 1WHHA 3CMEI 3BY5A 2QEXA 1W9HA 2YUSA 1WXBA 3DFGA 2DRKA 3HYIA 4RGSA 1C1AA 4G8XA 4I2QA 2HHQA 5LJ3f 2HAXA 1R71A 4DYQA 2JS2A 2BY3A 3RMSA 5KYUA 1KQSS 3VQDA 3OS0A 2DL7A 3A02A 4CIFA 3E2UA 1A6QA 1TW2A 1B34A 4G6DA 3FDYA 3WQTA 2QTXA 2KRFA 2QWPA 4HVVA 4E47A 2K40A 1YCYA 2XGXA 1Y8QB 3BF1A 4Z4FA 3A5NC 2JA2A 1VQOI 3CC4Q 1MNMC 4DJAA 1FP1D 2IGNA 1RKWA 4RLFA 4Q47A 1HJDA 2W03A 3IMXA 3OYLA 4EQQA 4AFUC 4DEXA 1VQ8T 4FWKA 5H1SQ 4C0DC 5GANg 3SJHA 5LD2C 3HM8A 4ZYAA 5DS9A 5E79C 5FU7B 1ATRA 3N4PA 3B02A 2M9HA 4LUDA 2P4TA 2FSJA 4DR2K 1MMNA 2CGLA 3NE6A 5E41A 3CMMA 2E20A 2KW4A 2EB7A 2F5KA 4CICA 3LQRA 1NEGA 4B43A 2RV8A 4CEBA 3JRAA 1UB9A 4HUGA 1O57A 1JKHA 4A93J 3VQCA 1FEXA 2DYBA 4E9GA 4L9TA 1OH7A 4R5PA 4QWQA 2DLPA 3I55T 2AZVA 2LQNA 1YJ9I 4H5WA 2GQVA 5J40A 1J75A 5AJ3K 2EV6A 4B3SK 1I3QJ 2ICWG 3I3LA 4M7YA 1UAAA 4E6RA 3X28B 5BQTA 2OTJQ 2GOXB 3R1XA 3SMSA 3ULDA 4PK4A 2Y1JA 3RR7A 2KYBA 4N9HA 3CXCS 2E1MB 4BRAA 3WQUA 2KZMA 1VQNA 4UB8C 2DD5A 2CG4A 1C0GA 4IQ4A 2CH6A 2QAZA 1LDJA 4B4CA 2E71A 4M75F 2QTVA 5LEJA 2E5KA 3SBGA 1E4GT 2GBZA 5DK5A 2FBXA 2A05A 3MK6A 5IYBJ 5L3FA 1VA7A 2JSCA 2YHBA 2HOEA 1YWPA 2XF7A 1J5EK 5GTIC 3ME9A 4HF1A 4ESRA 2HKXA 1MW7A 3R6NA 4C92G 1I94K 3EFOB 4Z89A 3DF8A 1X01A 3E9PA 3S93A 4C92E 2Z0WA 2R7YA 1K61A 3P8DA 2HNDA 4FYYB 2LFBA 2X4JA 1ETXA 2FF3B 2K9SA 1EH7A 1RDUA 1ARKA 4JRKA 5FU7C 3EDPA 4PGGA 3EYIA 3N5BB 2PUKB 4IHYA 4GW6A 3VS7A 4CJUA 4YIFA 4BY7J 4DFJA 1YQAA 3VQQA 2CW8A 4Z4CA 1FSEA 2NZTA 2EQUA 2QQBA 5D4SA 4CJSA 3JRGA 1VQNN 1MD0A 1VQ9Q 5BREA 2PFBA 3JSPA 2QQAA 2RHIA 4JKGB 4U0VA 2MFZA 1HA8A 4C8QE 4CBXA 1U6ZA 5B5EC 1DJ7B 3NH0A 4E7ZA 4JJBA 4JK9A 4A63B 4M75D 5LRSA 2ZWHA 2IC3A 2HYGD 4OMYA 3HRMA 1HOMA 3M7GA 3CMAN 4ZNXA 1BDGA 1KD1O 4OFAA 3QXEB 1Y39A 2LSNA 2KRSA 3MN5A 1T98A 4VUBA 2XRNA 2RB6A 3KEQA 4CZKA 2DMNA 3AG2H 5IHNA 1DGKN 3VERA 2LDUA 4QPQA 3VKIA 3E5XA 3QYBA 2BZ8A 3ZETA 3I0TA 3QZ5B 5GAEP 5CO7A 3V8LA 2HTJA 3K6GA 4XICA 3N97A 2KHOA 2M87A 2ZGYA 3L7WA 3LA3A 4Y4RA 2PMZN 1M2OA 2O01E 3ZBDA 1MBJA 4MO5A 1U1SA 3ISPA 3FHNA 2EFIA 4BR5A 1JCFA 4BR7A 1J7KA 5ILUA 1RAAB 2CZ6B 1ZUKA 3VUZA 2KRMA 3DB4A 3SB2A 1BOTO 1QZZA 3C6TA 3EG2A 4HDVA 1W2BA 1TYQA 2IOCA 4JK8A 3CJTB 4C9YA 2QWLA 2K5IA 3DKWA 3D6RA 1SAZA 4FW2A 2XGDA 5M3MJ 1C6VX 3C6UA 2JA8J 4DS4A 1ODDA 2MW8A 3H0HA 2BH1A 2HHVA 4LDWA 1DGRM 2YG8A 5BNGA 2HQRA 1DU6A 4M72A 4S05A 3KWGA 4YOXA 1GHCA 2EPDA 2H1KA 4JI3K 1RLPC 5CLSA 3KLGA 1F5TA 4N4IA 4DOZA 4C3JJ 1NPPA 1X3NA 1YO5C 3T9NA 1REPC 3O6BB 1F43A 2A41A 1PSEA 3QYFA 5D5WB 3UB5A 3KWIA 3I0WA 3RMCA 4M7AB 5CZ1A 4JI2K 1SV5A 2NVUB 3FB9A 3KK3A 4NC8A 2QYOA 1LW2A 2IT0A 4ILHA 2BEOA 2Z5UA 1U2VA 1TBXA 1BW6A 3T1YK 3HSFA 1N8RC 3CJRB 1OPCA 4J7IA 3VMFB 1PU6A 3NMZC 4UVAA 3G71Q 3K4CA 1W4SA 2CH4A 4JZ3A 3WXIA 1JLFA 3MHXA 1ZRCA 1EWRA 4HV6A 3F3XA 4L59A 4CHYA 4GMJB 4KT5C 3SYTA 2K4BA 2JVHA 3K9TA 4W5OA 4O5VA 2C06A 3ZMDA 4BYYA 1RIOH 1SANA 3FSPA 4G9ZA 3BG3A 3CDHA 2CQXA 4M7DC 1TW3A 3KTQA 4XNFA 3O5BA 4BJ6C 4JLIA 2DYRH 1MDMA 1TT5B 1GVDA 2FL7A 1S8NA 2UXDK 1SRLA 1P8ZA 4ZJZA 1IREB 4GDFA 1Q86R 5LJ3e 2V79A 1LCUA 5ELZA 4LC9B 1TUUA 2L54A 4BRNA 2R5YB 2QZ8A 2C6YA 2O8EB 4DV6K 3RQ4A 2FBIA 3HL8A 5D4RA 1M8MA 1WYXA 3KKSA 1CQTA 4JKCA 3KXTA 1NEBA 3A8YA 4LGWA 4FYDA 2VXFA 3EH1A 3JB9G 5EG2A 1FTZA 4EPCA 1M2VA 1VSHA 1NG7A 4YG2F 3TL4X 1GOBA 4M3YA 3DLKA 3H9GA 2JJ9A 3EFRA 3C7JA 2WWYA 4FLXA 4HNVA 2IGOA 5CAIA 2NRHA 1B1BA 2OZMA 4HUEA 1MMSA 1I39A 3OV8A 2DOEA 4FISA 3MN6A 3QFUA 4M6XA 2WSFE 4KKOA 3I64A 3WE2A 4MQ3A 1SVLA 4I09A 3WTZA 1FTTA 2YU9J 1Q7YU 1V3FA 3RPUD 1XGNA 1Q1VA 4R79A 2WC9A 3NCIA 3AHUA 2ZF5O 3H3VK 3O9UA 3ZMTA 3UKGA 3CCQT 5ICCA 4M7AF 3SZTA 4GXOA 5AQTA 2E6LA 1JHHA 1BL3A 4B9XA 1JT6A 1YBYA 2MC3A 3E0JB 1J5YA 1Q82O 3FDRA 4I9QA 4ITVA 4BJ5C 1JJ8C 4DTMA 3QPLA 1KCFA 2CQQA 2BXYA 2K5FA 1CKAA 3RMQA 2E36A 3PVLA 1UGSB 3VU3C 4DOVA 1UA0A 1ZHIA 5E26A 2RF0A 2DMTA 2EZLA 1SC7A 3L2CA 2JT4A 1VYVA 3H41A 4AI5A 4CVNE 1ZUYA 1N5ZA 2FLOA 1FOYA 3MKDA 1W36C 4K43A 1ZBXA 3MDQA 2EIMH 4KGVB 1JCEA 4PL6A 4XLEA 4G12A 4Y7NJ 4EATA 2QENA 3EE9A 2R93J 3I56N 1RR7A 1O1WA 3MMYB 3T19A 4FVMA 3E1YA 1H3HA 2BE5F 1KTQA 5JICA 3BR0A 2P9IA 1E3HA 3ZPLA 2IP2A 2KFNA 5E1ZB 4M75C 1DGWY 4YY3K 3ZP5A 1VQMI 5GP9A 2NOIA 3UE5A 3L2QA 3E9FA 2LJ3A 3M1EA 3A8LB 1YE9A 2NLXA 1UB4A 3ZL7C 2NLUA 3HSEA 5L23A 3KTUA 4A5BA 1QVFA 3A4CA 5LGUA 1R22A 2JT1A 3BJAA 5SWMA 3NVKA 1NE8A 3OSFA 1QQJA 2LR8A 1K9MU 4LDVA 2NOJB 3LANA 3RJPA 2CH5A 5E20A 2OF7A 4B9QA 3VDXA 3M0RA 2EYYA 1GDTA 5FPMA 1POGA 4Q5SF 4NL2A 1YN8A 2HBKA 1M3AA 2XDBA 5FLXO 3QETA 2OTLA 4LIVA 2VQLA 1JGGA 3JRHA 2WSCE 4AU7A 3DLGA 5C0YA 4HW0A 5ILVA 2G9WA 5E3MA 3CCUA 1ZBLA 4RW8A 4CFAA 4DF8A 4OAYA 4LF6K 3ASOH 1HYSA 4M6YA 4F04B 3I56T 2VXZA 2ZAEA 3G6EQ 2VC8A 3HSTB 3S3OA 1ILYA 4OB1B 4RAYA 3CCMA 4B8CA 4O5FA 4I7FA 2JMAA 1VI0A 3W0LA 3SDZA 2E6MA 2UV1A 3CPWP 4YOUA 2CRGA 1Z25A 3J80Z 3QO9A 3MWMA 4BACA 1NOYA 1UHMA 4IZ9A 2JUFA 1MKMA 2P1JA 3EHQA 2IVNA 1QO0D 3IFRA 1RT7A 3REOA 1WHGA 3SD4A 2TRTA 5BPMA 1R0AA 3NGIA 3RRGA 3CCLN 1M90R 4HSTA 2RKHA 4DBFA 4XRSA 3O9QA 4IEIA 4KV8A 1YG2A 3S32A 3UNGC 1QVGS 2K4JA 4M63C 1SEUA 3LWMA 2X51A 4EZ9A 4CF0A 4AHTA 2GBQA 1BA1A 3L2RA 3LSHA 4G7HF 2LYCA 3CCRT 1IRXA 1IG8A 4NNJA 3AAQA 2VE8A 5KH6A 5GANe 2R5YA 2P0QA 4ZYEA 4M75B 1QLYA 3VEPA 4BE1A 2BE2A 3QZ9B 2X6NA 2VBWA 3WTWC 4HF2A 3CXCA 2EINH 3LAJA 2B5JA 2I2LA 4IBNA 4H0PA 2O6GE 3CCMN 2D0BA 4CZCA 2G3RA 4ME7A 2LQKA 4MHGA 1YFNA 3VQ8A 3S2DJ 5FKKA 5EEGA 1HPZA 1PDNC 5E1XA 4C8QC 1KHIA 3ECOA 1B72A 2W4SA 2EGAA 1JL1A 2K6DA 3LDLA 4XBFA 4GV3A 2LZ6B 3VEOA 3OYBA 2PYJA 1WIEA 1LFBA 3JCMJ 3EQLF 3PIOL 1YW8A 2KXDA 3THKA 3LWIA 2DPPB 2YG9A 2UUAK 1LW0A 4B3XA 1K78A 5LJ3j 3TMOA 1VQLQ 3HKZN 1SKSA 1NGJA 1W5TA 4FJ7A 3CCST 4M78D 3LAMA 5L8RE 1QPIA 2A3SA 2E10A 3OS2A 3L2ZA 1VQ4N 3U3YA 4OIRF 4QSHA 5AQJA 1MNEA 5EG0B 4NLBA 3NGPA 3P9KA 2EFOA 4CJQA 4PKIA 5CR2A 2KT1A 3F72A 3CPWS 3AO5A 1GUUA 4J5YA 1XG1A 1I6HJ 2M9UA 1EH6A 3O08A 1R6RA 1ZG1A 2HPIA 4E19A 1HR0K 1DPUA 3U9DA 2AHQA 2D0CA 5LJWA 4Z4GA 2NWMA 3KK2A 1QE1A 4FIBA 3RI4A 4OIQF 1TWAJ 5DYMA 3QEXA 1Z77A 4N0AA 4PUSA 2MPXC 2KQ2A 3O3KA 3ID6A 3GBQA 4PJOB 3D45A 1A5VA 3RRHA 2BHZA 3QOPA 4BY9C 3CUOA 1TL3A 5EGOA 2P8TA 4A5MA 1XNRK 3I56Q 1YHQQ 2LRQA 1R1UA 3MVPA 2O8CA 2UXBK 5IHIA 3CFPA 3I0XA 3M3YJ 2QBYB 1ZBUA 3VEXA 3ABLH 2KRHA 2VOPA 1XC9A 2GFUA 2IDOA 2XMFA 1TS9A 3VSLA 4C92B 3R9PA 1TQPA 2HHSA 1D09B 4JI7K 1W2BP 2Y4YA 2ZCWA 2QGGA 1JEGA 2R7FA 2JS0A 3G0QA 3QBYA 3BJOA 5AQLA 3KPHA 3TABA 2CUDA 4DV4K 2RQQA 4XM3A 1YRNB 1PKTA 4JAXA 2FSWA 4CHPA 2DK8A 1UG0A 4FT2A 2HF4A 2R57A 3F9MA 2AZSA 2VPRA 3TW6A 4TVRA 4FX0A 3QHSA 2HSPA 4JV5K 1QCNA 1BI3A 3P38A 2BVLA 4E7KA 3VWBA 2J6FA 2EX3A 3K4KA 4YOTA 2ZJQL 2YNIA 5BPDA 2LBFA 3UA6A 1YJ9A 4I6MA 2ZXIA 4JX6A 5HS9A 2RO0A 2E5QA 4WCGA 3THXB 1R5ID 2NVQJ 5E3NA 3OS1A 2O0YA 1DTTA 3HG9A 1U8BA 5HODA 1U78A 3G1OA 5DM6L 5LHHA 2ITGA 4ETSA 3FXRA 3CCET 1NGDA 1EJ9A 5BS6A 2V52B 1ITYA 3JAMK 4KHUA 1VQNI 1AD5A 3G10A 1NJYA 1J6ZA 3WXMB 3VSKA 4J9GA 2QSHX 3L2UA 2OC6A 1BIBA 4ON0A 4CEEA 3J81E 2HOAA 1KYZA 3K4NA 3PT9A 3ZT3A 3LSJA 2M0OA 4QS9A 2HKOA 1OCRH 2X4WA 4WE1A 3ATVA 2BKDN 1HQUA 4XR6A 5GAMj 1S22A 2KDZA 1QS4A 3FXJA 2EGCA 4CZGA 3FFIA 1B3QA 1BO5O 4C8QA 1U5SA 2Z1IA 4Z4HA 4FJJA 1KAXA 2NUPA 1YITT 3D2FB 4MZPA 3I55A 1NGFA 2V51B 5HK3A 1PM3A 3CBMA 2D1KA 2VWFA 1MUYA 4EJZA 4IG3A 1ONVA 1XMKA 2DOAA 2DCEA 3AAFA 3GWZA 3CCLA 2L5QA 4WXHA 3L6QA 3CFOA 4B1RA 3T5XA 1ORNA 1W2BM 3FJ5A 3E19A 4F93B 4KULA 4DSKA 4G9YA 2OZUA 3C7NA 2FSKA 4YPHA 3UA7A 4CIEA 2K02A 1YITQ 4Y17A 1X3ZB 1LCKA 5HRRA 3U8XA 1I8FA 2ZKZA 2L7ZA 1TL8A 3IRXA 4RTVA 3FXLA 2QXLA 3IV5A 3G6ET 1DP7P 3S1RJ 1BI4A 3VB2A 1P7JA 1BW5A 4KAZA 2JOYA 1YQLA 1UHFA 4J9CA 4OMLA 1Q82R 3EEQA 4IFYA 2GA1A 4IPAA 3ER0A 5I9EB 5IYDJ 2OUMA 4FZYA 4DV3K 1HU0A 1ON2A 3TDUC 4PFZA 2P9NB 3C12A 1NGNA 5FROA 3RPQA 1WJSA 3TAEA 4FWSA 4F7ZA 2MAMA 4L3QA 2F4MB 4PUOA 4PKHA 3QEPA 4R56A 2CGJA 1VAZA 3I0SA 2CGKA 4DUYK 1XN7A 4RB1A 1M30A 3QFPA 3ABTA 2UWMA 3C0CA 2A69F 2DJZA 4RS8A 3PSFA 4OMZA 2O8KA 3HJFA 4CDGA 1Z7UA 2E2QA 3HGYA 1X2KA 4DKWA 3H5AA 4J6YA 3JRDA 2KIFA 2H8HA 1W97L 2FBYA 2FU4A 3SUOA 2UZKA 1FLIA 4F7UA 4BD3A 2EYXA 4B48A 3T1BA 1FYMA 3VYTB 5FU6C 4XAXB 5GJWB 1Y7XA 3OOUA 4IEEA 2YNGA 3I4PA 3M4YA 5GPCA 3KP6A 5IWAK 3FM5A 3DRRA 3GNFB 2D45A 4UUSA 2UUCK 1UOCA 2LY9A 4NB5A 4MFBA 1IV6A 2DPNA 4BREA 4LY7A 2Z9OA 1YVUA 1Z05A 1T6SA 3M1CA 1VSEA 4CC2A 1EO1A 4J83A 1XNQK 3KVGA 5GAN4 3F8CA 2DAOA 1MJAA 4EJTA 4LH4A 5TISC 2QXFA 1RTDA 2QVOA 4NCGA 2E7XA 3NDKA 3FMQA 8ATCB 5DCMA 2DIQA 2J4RA 2FD5A 2DMOA 5HRPA 1M1EB 2QKMB 4KH5A 2R7TA 3J7AY 1YXQA 2M1HA 3RTRA 4U0WA 1NU0A 1ZG5A 3U3GA 2R7SA 5B8HA 3K1PA 4KI6A 2XB5A 2HFHA 1JRIA 3ERED 1Z21A 2ADUA 2NUZA 3FZLA 1BISA 1OR7A 1OX9A 3TVTA 4EA5A 1VSJA 2DTUA 3OHRA 3ZCOA 2RI5A 2JN0A 4A3LJ 2OCEA 3Q0UA 2KIUA 3VOEA 3RESA 1G3WA 4IQJA 4JK1X 3VF6A 4M9ZA 4CCOA 3OJSA 2L7MP 3R6SA 3TOBA 2P0PA 2FNPA 4O8KA 3J7YJ 3KLIA 2HOTA 2A61A 1I4K1 4CK2A 1S3XA 1BU6O 2FMYA 2G8KA 1GBRA 1DDNA 4I7HA 3HEFA 3G7ZA 1X69A 3A1YA 5ADXH 3TKYA 2E5NA 2A28A 4LDYA 3QINA 3KFVA 2FQ4A 4BRHA 2YLBA 2X48A 3KHYA 1IDYA 1S6LA 4CK1A 2O8DA 3EUHC 1XDSA 3E6MA 3VESA 4DR4K 4IHWA 2DPDA 1ORPA 1BB9A 3CIPA 4NC6A 1FYLA 3MQ0A 3D5RC 3CJCA 1B7TA 2GOMA 1S6QA 4WQ5C 4CJ3A 4BC4A 2DXIA 3ZT0A 4MFDA 1RKTA 3AY9A 4LD0A 3ZQLA 2ZGWA 2IA2A 4Q0BA 5IT9E 2QA4N 3BOQA 4U7DA 3M8EA 3JRCA 4UQGA 4HCKA 3WG7H 1YT3A 3JAMO 3WNHA 2KPMA 4C0FA 1FYNA 4XIDA 1ETOA 3GTJJ 4BDYA 3H46O 5E17F 2XY5A 1WB9A 2X6YA 4FE4A 1Y97A 3JYTA 4JKHA 3IKTA 2RJDA 4KIGA 2P7CB 2LSOA 4BXFA 4OKKA 3VTIA 5JS2A 3ZT2A 1ETKA 2UUZA 2RK2A 3OBWA 5LBQA 1HKQA 4Y3OA 5GIOA 2HHXA 4LB6B 1FOXA 1Z7LA 2RQWA 1T7PA 3AO1A 4DLEA 2QWQA 2M8EA 3OYFA 1RI9A 4F2RA 4CSWA 3CC2A 1ZKGA 1WPYA 2DFEA 3GTQJ 2RN8A 2WACA 3IH7A 2Q3SA 5D6XA 5C3EJ 3BJ6A 4RMOA 3HRGA 1KQ1A 3OYYA 1W7PA 4IZZA 2YPRA 3K70D 3QJ6A 2I0NA 1WSIA 1BK2A 4ZYGA 1X6OA 4MTDA 1Q7YO 1NJIO 3OSVA 3QYHB 2DM1A 2M8GX 2XSJC 4CCLA 5J1YA 3WU2C 4GO1A 1DEJA 2HMIA 3M5AA 1BCOA 3EG9A 3ZQ7A 4B9LA 3TEEA 3HGGA 2X1DA 1MA9B 1RTIA 4KH0B 2XHBA 1R5HA 5L3BA 2QF7A 4M41A 1FP2A 4JKDA 1F1BB 1C6VA 3GCMA 5J47A 3ABMH 1RACB 4GLKA 4H0OA 4CEDA 3BR3A 4E7HA 2DA1A 4RCCA 3KLNA 1M3BA 4B1YB 1UECA 2P0WA 2YU3A 3OYAA 4AVZA 3EGDB 2A3ZA 4FJ9A 3EKSA 4RCBA 1X9SA 3IKVA 2LOOA 1IN5A 1VQ6T 2DVEA 1J54A 2HDAA 1N27A 2B0LA 4CJ7A 4NZGA 2CO5A 1PVEA 2KT8A 1T2KA 1A36A 2HQEA 1R00A 3HDDA 2ZPGB 2Y0SA 1SS6A 3K2ZA 2JLEA 2VWKA 2EBPA 3O9TA 2FVUA 3CQZJ 3IWZA 3LDOA 4XN0A 1PP7U 3URGA 3I55Q 3GP8A 2HR3A 3MN2A 2LTPA 1WWXA 2J05A 4KHQA 2CFXA 5LMNK 2O8FA 2W85A 1NGHA 3U23A 3M8QA 3I8DA 4PJJA 3SQ1A 3L4IA 4II1A 4J2EA 1U1TA 2LX7A 2QM1A 2DVJA 4F2SA 1RT5A 5LEKA 2A6AA 1YOVB 2ZB9A 4ID5A 5ECAA 3FZHA 2VC1A 2IJLA 4CJPA 3PSIA 3F6OA 2EJGA 3G73A 1QGPA 1TUYA 3IAYA 1OZ3A 1IKWA 4A5NA 1XGMA 1IB8A 4CA0A 3WT0A 4HQMA 2DMPA 2H3GX 2Y69H 4HEA2 1NJWA 1OJLA 1RAGB 4EJOA 3DPLC 1TU0B 2HKQB 3V7SA 5HRNA 4A54A 4FWNA 2LC2A 4DBRA 2VL8A 1YW7A 2K3PA 1IGQA 3JRIA 4CJWA 3EY1A 2V9KA 4FPAA 1KQ0A 1WRJA 4Q5VA 3CP2A 3M4GA 3SK3A 3OW2M 4CD1A 5LJ5j 4C0DB 2MLKA 2WA0A 4CIGA 4C8QG 4JHDA 5TJJA 2P7VB 4DSIA 2BBYA 1H0MA 2ATCB 1KG1A 5AQZA 3CCQI 1WAFA 4XU3A 1T08B 1WA7A 1M1KR 5D8LB 2V1RA 4K42A 1M4ZA 3DLLF 3I59B 4D5FA 2H56A 3EGUA 4HAMA 1JUPA 2K9MA 4FWMA 1YJWA 4U87A 1HNZK 5F6FA 5HS8A 3LP1A 3LALA 3ENHA 3RKXA 2GLOA 2FBVA 1VQPQ 4XKWA 4YORA 3O2PE 1OISA 4W5RA 1HDDC 1OYYA 1HNVA 2EBIA 2ZMEA 2X9HA 2X6WA 4O3MA 2LF7A 2M2EA 4C2TA 1ZX6A 3RWUA 2XY6A 2K7AA 4BR9A 4JDSA 2P84A 2PVOB 3AA5X 5AQKA 1TLHB 1YHQT 1LWYA 2X3WD 1YITA 2G8FA 1K9MR 3AVGA 1TQIA 3O1WA 3FZKA 2EAYA 3QESA 5AQVA 2YUQA 4IRGA 2D1VA 4X65K 3JSOA 2LCSA 2OTLI 5EC7A 4RDUA 4RM3A 4E4HA 4CHZA 4A0XA 3K5NA 3BQZA 1ETQA 3HOUJ 3JB9I 4CJRA 1M90U 2MBFA 2F8TA 1RBSA 4WWCA 2OAUA 2OPRA 4HTLA 1IHVA 2G6FX 4EMKB 1BQNA 3FZVA 2YHYA 3TU4K 2X1EA 1WSHA 5KPZA 2COMA 1IBKK 3G4SN 2GXBA 2DNUA 5E18F 4FCYA 2B86A 4F52A 1GOAA 2ZXJA 2QUFA 1Z26A 4BRLA 2XIDA 3WGHA 2DERA 2CREA 1O7LA 3BY6A 4QQ6A 4RW7A 4IUPA 1SFOJ 1KC8U 4A61A 3CI5A 3M0TA 5AR0A 2ZPEB 1ACIA 1J5OA 1RAFB 2N8GA 1EETA 4CGHA 1RZ4A 4F3OA 1GCPA 4XN3A 2EYZA 1UELB 3CCYA 2LDMA 5GAN8 4IUTA 4BEHB 1VIEA 4UVCA 2VXEA 4AYBA 4DNCA 4BR2A 2X3XD 1BKBA 4KTZA 5JVHL 3F8BA 2XSDC 2OPQA 3AA4A 2YUPA 3WTTC 2LLKA 4JKFA 4KIBA 1BBZA 3GZ5A 2KIMA 4QT7A 1UJ0A 3W3DA 3KD5E 2KR3A 5KYWA 2BV6A 3SMPA 5I2MA 4OPKA 5GAN6 2VLAA 1ZBHA 4IVNA 1WSUA 3HFOA 2F4VK 3QG1A 4GYGA 4XLHA 4WYBA 2IA0A 3NFCA 4RTTA 1JO8A 3M55A 4IJNA 5LJ3d 2P9UB 2H3EB 3D7SB 3N0UA 1X2NA 4JRIA 1B07A 3KYDB 2KE9A 1ASUA 2UU9K 5HKCA 5AQUA 4HWIA 3DLRA 5D6FA 4AH9A 2W48A 4DCHA 2F9WA 3EH2A 1B9MA 2DJQA 2O03A 5CKBA 5BOXA 4EHUA 4QPOA 5C6SA 1MMDA 2VJIA 4B1ZA 2WAQA 5A2QK 3CUQA 4I99C 3HOWJ 2VQHA 4X9DA 4CFDA 2FJ1A 5JVTA 3RQIA 1S9GA 4DQQA 1NHAA 3X26B 2DFUA 3GBGA 1T44A 5KYYA 2D1HA 2MG4A 2F5EA 4AHSA 1UGVA 2HWVA 4EM1A 3MECA 1NK3P 4M7DB 3I53A 4NB4A 2OAWA 4CHOA 3GDQA 2VQGA 3DLEA 2EWNA 1PSFA 2XDVA 3TBIA 1VQON 4B3MK 4RTWA 2KDSA 1S1XA 3CZ6A 3MXMA 5JR3A 2AQEA 1IUFA 2EFPA 2XAFA 3DP7A 2XAGA 1JJ2A 3ZRGA 3VODA 3MD2A 1BA5A 2NUTB 5EOYA 4AHUA 4CE9A 1KAYA 1WZ2A 4J2BA 2CW0F 1OLTA 4FQGA 2DU9A 4Y1DA 2D6FA 2VG7A 1FIAA 4C8NA 4GNIA 3EN9A 4A3CJ 4QLCU 1QHHD 2E88A 4CECA 4UUSB 3M5RA 1HKGA 2ME0A 1ZH5A 3FFKB 2M51A 2RGVA 4LFCK 2QEXQ 3JAMZ 4M78G 3S17J 4HCCA 3GFMA 2UYTA 3IUOA 3AVKA 4E1NA 1GBQA 3EFSA 5LGNA 1F1ZA 2YV0X 3C6HA 2P9KA 3NARA 3UF4A 3RPUA 4KN4X 1YJWI 5HLHA 2V75A 1XDUA 4K0KK 2ZJRL 2ME6A 4MMLA 1NOZA 1MBGA 4DGWB 4JQFA 5FO5A 1RUWA 3S6IA 5FLXE 3E3VA 4MGRA 1QP2A 1YIJT 4B08A 3TOAA 3CCRQ 2V8IA 3CG7A 4JX5A 5A2QE 4DFMA 3BWGA 1RTJA 4M3GA 5CQGA 3MKLA 5IOYA 3GX4X 3CCUQ 4GVEA 5CKEA 2CZ7B 4WQ5A 1Y96B 4YTLA 3CETA 2E1ZA 4CD3A 4ZDOA 1VOMA 5IXFA 3D2EB 3MX2A 2VQFK 2HVSA 4A6DA 3SZPA 1IG7A 1KSPA 4UY8I 4YFNF 1RBUA 4YPRA 1O3RA 3K1MA 3ASKA 1K4TA 1HDPA 3PX0A 2TDXA 2CT3A 4RG8A 3BF3A 3BCBA 1KFSA 1YHQA 2LREA 1QZ5A 5GAHJ 2DX1A 3AA3A 1N75A 1S1TA 4XLCA 1WJQA 4WX9A 3ULEA 1XCBA 2JUGA 1M1KO 1KVBA 5F0FA 2Z1GA 5FPNA 1I1GA 1ZAOA 1WAJA 3CF5F 5J2MA 1NK2P 2M16A 3IL2A 3HTUA 4HVUA 3QO3A 4ESJA 1I6XA 1L3TA 2M0MA 4M3FA 1FX7A 1KYWA 5DM7L 3VF2A 3W6JB 4KBMB 2HXIA 3OL3A 4B9MA 2AQFA 3UPUA 4DB3A 2ZJPL 4MO7A 3SAFA 1RAHB 5DY9A 3LL7A 3QPSA 4JRPA 3RSEA 4H4MA 3Q0VA 3RVCA 4OU0A 4FWQA 2IAIA 3Q5FA 4I2PA 1GLCG 2IS2A 3KUFA 2MD5A 3K5LA 1LMZA 1ZA2B 3VGMA 1IF1A 3KP5A 2HNHA 4DZPA 1HRHA 4MDWA 3QOEA 3IRRA 2CUBA 2YHXA 2VYPA 5JS1A 2LT1A 1NJZA 3JCMW 3J7ZO 1PYVA 3R2XC 2Z1DA 3AG4H 1H89C 4LF4K 2GFAA 2NNWA 3ZSOA 1GLFO 1JLCA 1WCMJ 2O8DB 4EP4A 1NLVA 4DIQA 1KU3A 2RD1A 5F08A 1MGTA 3KZZA 3X24B 3TQNA 2C0IA 2PBDA 1RRQA 5EF6A 2CV1A 2E35A 2Q31A 4ICLA 4H0XB 3SWNA 1BR4A 4A6EA 3J7AP 2VONA 1HSTA 2KP6A 3CCMQ 4HBLA 4M77B 3A0HC 1JUSA 2QASA 4JYKA 3M3ZA 4I6ZA 2QGFB 1X43A 4NL3A 2J5PA 1P4XA 1K4US 3TANA 4KRFA 3JB9J 2QWNA 5J4YA 4RTXA 2I5WA 2OTJI 1WXTA 4EA4A 3AVNA 3WEEA 5IHKA 3MCZA 4RG2A 2PN6A 3VYSB 2OPPA 2CZ1B 2NOBA 4K2EA 3WTXC 3F21A 1VQOT 2E5ZA 3S6WA 4AVPA 1R1VA 1VQMQ 4CRIA 2K2VA 3BZKA 2H8WA 2L9VA 4YELA 1XHZA 4JI6K 2O31A 3K0LA 3H3UA 4ZZDA 1Q86O 4FJNA 1WGXA 2DA9A 5BRDA 3C95A 3SDBA 1KQSA 1V5EA 3GXOA 1ZR4A 4FM1A 2JM8A 3CCSI 2R0QC 1VFCA 2NOHA 4DF4A 3GUDA 2MD0A 4P9FA 1G6NA 1KD1C 2OJED 1LWFA 1NK5A 3OA9A 3MP6A 3HPWA 3MZYA 3AFHA 4A4FA 1P2FA 2R92J 3BR6A 2HBJA 3QKJA 3Q7BA 1VQ6A 3H36A 1W1WE 3GTKJ 4XIUA 2XGEA 2DO7A 1AT1B 3T3FA 1HXDA 4DV0K 4NBQA 3FZMA 2B4JA 2PTKA 3LA2A 1YLFA 4CZEA 4DTJA 2F96A 4N4HA 4GCVA 4J2DA 2YNHA 2ZXHA 1RC9A 3HTSB 1RDCA 2A1SA 1N34K 4ZGJB 1RI0A 5KGWA 4BDPA 1U06A 1HC8A 1X9WA 2P81A 4QVZA 3VENA 2R7VA 5CVIA 3I33A 3NQOA 1NKBA 3EGXA 4DTRA 1VIFA 1GRIA 1F9NA 3ZEUA 1Y57A 3VQ9A 1XB4A 1ZK8A 4GLMA 3SZ2A 3SAHA 3RUXA 2EIFA 5AT1B 3CCUN 1JXMA 3NHNA 4RTFD 1X9JA 3L2WA 3IS9A 3TAGA 4L5JA 1QVGA 2EQRA 2L3RA 4M78A 3EAEA 3S8PA 1K7AA 4WFBL 2E60A 4YNQA 1FSHA 2R7XA 1RT2A 4DR6K 1NYGA 2D5VA 4OPAA 1WI9A 3WE3A 1UCRA 1MMAA 1ZGJA 1NGIA 5TKWA 3KLEA 1XI1A 1X19A 2M1BA 2OTJA 3M8PA 2B7EA 3V8KA 3O1BA 3SDGA 2FE3A 4FASD 4DZJA 3W2VA 4J2AA 1YJNQ 4I0BA 3FX3A 2BHYA 2XO7A 4B47A 5D5XB 4EW4A 3MN7A 5IPAA 4P55A 1VQ8I 3G71T 3Q9VA 3SUQA 2O4GA 2M5WA 4ENJA 1YJ9N 1OKJA 3T1HK 5GMKh 3JCMg 4KT6A 5A2QZ 3A8MB 2EJFA 5F0CA 1VQ7T 1JT0A 3GBTA 2FOWA 4KGXB 4LK0F 1AOYA 2WB1N 1JTXA 4PL7A 3R0JA 1YIOA 2EYQA 3KCCA 1O3TA 3DKYA 1W6XA 2IGKA 1MSEC 2A07F 2JRTA 3V1OA 5CKFA 3BR5A 5C12A 1U8RA 2GNCA 4K41A 4BRKA 3H08A 3RIRA 3DEUA 3M0SA 4L0YB 4PFOA 2RE2A 1LOJA 3EKUA 4LIUA 2CH4W 3C94A 5GAN2 1IZ1A 4A3BJ 4B9SA 9ANTA 1OMIA 2LQ8A 1FKOA 1RGIA 1TWCJ 3A8GB 3OSSC 3ZN1A 4XLAA 4WQ4A 2XICA 3AG1H 4IKFA 1FWZA 2AK5A 4FJ5A 1D0YA 2LD5A 1BL0A 1PG5B 3J81Z 3QICA 3PQKA 3AT1B 4CYDA 3UKUA 4PLIA 1UWBA 1ZGAA 3JCMh 5E1WA 2OTJN 2HQ5A 3P8HA 4CJTA 2DL5A 4QVDA 2HF3A 3FC3A 4DQ8A 2ZFUA 1S1WA 2OZ6A 3G6EA 1T0FA 1L0OC 5BPIA 2XPVA 2J5OA 3BUZB 1VQ9A 2MA3A 2LG4A 1QMCA 3P39A 2XKOC 2RKIA 1OULA 4DS5A 4M4ZA 5KYUB 2P4RA 4HTUA 1ZGWA 1AKHA 3EGXB 2VKVA 4FU6A 4H8KA 3KKRA 1P6RA 3WG9A 1TTYA 5FLVA 3F70A 4B6MA 3VYRB 4OFEA 1HKSA 3KK1A 4CYCB 3A5MC 3FIFA 3ZSZA 1LOTB 3SV4A 5E84A 4Z02A 4CK3A 1NK6A 2V6CA 2BY1A 1P7IA 2RJFA 5M5WJ 4I0AA 3ZQHA 3DU5A 4M3TA 3AARA 4M3BA 4OX9K 3BFMA 2K5CA 2V8JA 2EA4A 3G25A 4AUXA 4XLNF 3I56I 3KE2A 1YJWQ 3MZHA 4LD6A 1SHGA 2KL4A 1P9QC 2FBTA 3BEXA 5FD5A 2FYKA 5GINA 1P59A 3OGDA 4A4GA 3E66A 4FJMA 1V4SA 4HG2A 1V1CA 4RW4A 2OU2A 2DA2A 3LWFA 2ZQBA 3DRSA 4L6V5 1AWOA 3HRSA 2NVYJ 2DMQA 1BU1A 1G3YA 1ENHA 1KU2A 1S7AA 1OYIA 3AVLA 4D8KA 2RF2A 1YF5L 3VQEA 2EGEA 2E5LK 2K3FA 1ZXOA 1Y56A 2FMLA 4KMFA 3TWHA 3G0ZA 4PGHA 1H8KA 5M1NA 4DSFA 2MGQA 2E1NA 1RBRA 3NH1A 1OR7C 3E6DA 3D0SA 3WNGA 3EE8A 3AVBA 4HX7A 3MAJA 2K9NA 1LWWA 1JXBA 4II3A 1VTNC 1FPQA 3E5QA 2R7ZJ 1RUNA 4LG0B 4XKVA 2QDLA 1T95A 4CF9A 3DKXA 2B63J 3EL2A 1LVKA 3H35A 3GPLA 3WGGA 1IRZA 3CWUA 2KLAA 5AQHA 1R58A 4ILJA 3BTJA 2W82A 4AHRA 2D9TA 1O13A 5FWCA 3DV8A 2JTMA 3H0DA 1K8AC 1QHAA 2HVRA 4IXAA 5CKTA 4HSRA 4BY6B 1K8KB 5FGMA 1TUGB 4XLFA 3ULQB 3O8MA 4GV9A 3JRBA 3PX6A 3PNWC 4M7AA 3LP2A 2O8XA 3JTHA 4HX8A 3KBGA 1GLBG 4XTWA 3OY9A 1QKWA 5B66C 4ZGEB 1YUWA 4Z2YA 2GWRA 3B6CA 3S1NJ 1SVMA 1JBMA 2K5LA 2XAHA 2BTTA 3V6DA 2H94A 1DU0A 2Y4XA 4CI6A 2DBMA 2RNAA 3GYHX 2HYJA 3U6FA 5JLWA 2DEUA 1MZBA 3GTOJ 1FIPA 1WQWA 4JP0A 1JL2A 2QWRA 3SJJA 2DZ9A 4V19K 4MMKA 3GVAA 2A3LA 3QWXX 3CC4I 1VQOQ 2ELHA 4M7AD 4CJ4A 1HQCA 5M1QA 1KC8R 4XH5A 5AN4A 3CUQC 4DQPA 3E5UA 2DL4A 4LXCA 5CZ2A 3HVTA 4AT1B 1W2BS 1VQKT 1ZC6A 4Y91A 5D5UB 2DTRA 5EVZA 1RBTA 3LWHA 3BC8A 4XTZA 5CQEA 2F2WA 1SF9A 1VQMA 1R8OB 7AT1B 1D8JA 4PY5A 5DUIA 4F14A 2WY8Q 3NNQA 2D0QB 5IT9O 1NKCA 3L1AA 2QSGX 4BI3A 4M7DA 2KFZA 2ABLA 3H0GJ 2V1XA 3HOZJ 3FHZA 4M9XA 5GAMd 3LOCA 3HKZA 2PEXA 4KJZA 1OCPA 4JI1K 5GAMg 4RMNA 3T69A 2E2OA 2ED1A 1MWMA 1R36A 3CJAA 3S14J 2P9PB 3G71N 2QQSA 5HVQC 1X27A 1QVFP 4CJEA 4N4NB 1MDMB 5M1OA 3TSZA 5DLQE 5HDGA 5M1PA 5EGOB 1GCQC 1SPKA 4L5GA 3J7AO 4XSZF 4ESBA 2R7UA 3D2EA 4EP5A 2IVWA 2YCHA 1OPLA 1K78B 2K57A 2CYYA 2NS7A 1RRSA 1NYFA 2D5RA 1FNNA 1ATNA 3B6OA 1N6QA 5AZJB 1BHLA 1HNWK 4E9FA 1IXDA 3A01B 2RN2A 2RI2A 1NGEA 5E3OA 4IUUA 5CVVA 3B6AA 4ORZA 3FLGA 2RHXA 4NCBA 1D0XA 1JCGA 3MEEA 4F3QA 1M27C 1VZ0A 1WXUA 2Y90A 3GOXA 2J6KA 3CMAA 1NJIU 1MV3A 1O7FA 4G6QA 3L0QA 3V9ZA 4LE9A 1K4SA 2NAZA 1SAXA 3RSNA 4FM0A 3WTYC 2QEXT 1YI2Q 3TU5A 3LWLA 3LDNA 4FLYA 1R1TA 5DLOA 4CYCA 2H6BA 1RT1A 2VI6A 3A8HB 1LVAA 3O80A 5HS7A 4M73A 2FXAA 1BUPA 4FE7A 1E6HA 3JRFA 2EFWA 3BPVA 4UVBA 2EKHA 1RAIB 1MJ9A 1RABB 1BR1A 1TG0A 2DE0X 1QU3A 1VQ7Q 4CF2A 3MEUA 2BZTA 4O0JA 4BJTA 3THYA 1U0JA 4I9LA 2RAEA 2ZNZA 3M57A 4HCZA 1K6YA 3ZXSA 4M77E 3G4SI 1JHFA 3LDQA 5ICFA 5GAOm 4FJLA 2LH9A 1P4AA 1QZYA 1D9FA 1KIKA 4A0YA 3AVMA 1JUMA 4YOYA 5GMKm 4IFEA 5EEHA 3CCMT 1U5TA 4JN4A 3BG5A 3TQ7P 3I56A 1ZG3A 2JMWA 4A69C 1YP5A 1TNSA 1UFFA 5GAN7 1FBQA 3VV0A 1U9OA 4IHSA 4YFXF 4IHVA 4DR3K 1APLC 1ZA1B 1WHJA 4X62K 4QAGA 3LNQA 1AA7A 2IW5A 2PAVA 4HX4A 2K9QA 5KE3A 3C6AA 1M5Q1 2VWJA 1D1BA 2AT1B 2OTLT 4X64K 2ZJRF 3CC2Q 2O5RA 2F5DA 1C0MA 2Q0OA 2LP0A 4EMKC 2DMUA 4ENKA 3TREA 4PHTX 1Z67A 2DXTA 4MFEA 5DTDA 5KCOA 5DCFA 4X34A 4H03B 1WBDA 2Q2EB 2VIXA 4ZZLA 5AQIA 2VBXA 1GLAG 3CCSA 2FBHA 1WN7A 5ADXA 2JZ2A 4IIOA 3BTCA 4JK7A 1USSA 1Z9ZA 1ASWA 4ENMA 4JBAA 2ISZA 3I35A 1QQMA 2OJ2A 3Q1JA 3NTIA 4M77A 2KLOA 2L2OA 1L3VA 1V76A 3SCXA 2FC0A 1U48A 1IRGA 3TPQA 4XMYA 1K0XA 4Q48A 3GL1A 4M75E 3EZWA 3EYYA 4N4GA 1Q81C 1D0ZA 1GOCA 5GANh 2HHUA 2E1CA 1SL0A 4LD5A 4KB0A 4L5IA 5LJVA 1KG3A 1GLDG 5ILSA 2HBPA 4AHCA 2PLYA 3CCVT 3VS1A 3H9JA 5LJ3h 3D1NI 2BW3B 3CF5L 3ZT4A 1MH4A 2UXCK 2BY2A 5FJ8J 2L02A 5IT9Z 1J2XA 1QVFM 3CCLI 2CWEA 1SFEA 3NWSA 1OU8A 1BGXT 2QEXI 3G2BA 1PVSA 1PU8A 2Y31A 5FLXK 1A5JA 2DFFA 2GA2A 2CP5A 1EH8A 4J6XA 3VS6A 3NF8A 1ETWA 2W24A 2KEAA 3G6EN 3H3ZA 1REVA 2D0AA 3CEYA 2TCTA 3MAQA 3LQQA 1ZRDA 3HFNA 2CQKA 4PNOA 2F2XA 1IXSB 3NFAA 4FJXA 2Y0SN 2YR2A 4NXMK 5KCMA 1TK0A 1LDDA 3F10A 3PL8A 2HVIA 3VA0A 1RETA 1SKWA 2V26A 3U21A 4FK4A 2VQEK 3KZYA 3KLFA 1WSGA 3TSPA 1PU7A 4MLEA 1BG3A 3CCJI 1SUQA 3THWB 1K9MC 2ECBA 1QCOA 2VKEA 4XSXF 5KVRA 3RZOJ 2RMOA 2RQPA 3UATA 4TSXA 3JCMe 5ICGA 5HNFA 4YDUC 3LGLA 1R7JA 4N47A 1RTHA 1XMOK 3PQJA 4FWLA 2F2VA 5K7HA 5LL6S 1HK9A 3ALYA 4C8OA 4UUVA 3R3LA 3AVCA 3BG7A 1I27A 1S9HA 1N3AA 2IGMA 3J81K 4FW1A 4CZJA 4AIJA 2QG9B 3U2RA 3X2QH 2DK3A 1S72N 2P9SB 3SQ0A 2VJ5A 4NHJA 4XU1A 1UMQA 5AZIA 4KIFA 4MIMA 3DEEA 3VFZA 5GAHP 4QVCA 3S1QJ 2Q0RA 2DTZA 5AONA 4EM2A 2JHNA 1WDXA 3QIIA 1FYKA 5K7ZA 2XAQA 3FIWA 2QGUA 2KRCA 2XUBA 3EUHA 3L42A 4OPHA 4H5RA 4GFBA 5KYXB 3PM1A 3LM9A 5KTQA 4RBOA 1Z6RA 4A3DJ 1GL5A 4LD9K 4FYVB 3BTIA 1MBKA 2RPIA 2K3XA 2E12A 3LPTA 3CQ8A 1WVRA 3HPGA 3DLHA 4BQAA 3QNOA 2KMUA 2DT6A 3HUGA 1YCSB 2EIJH 2DQLA 1JQQA 4DR1K 5KE2A 1XMXA 2KKZA 1SMYF 5CQYA 4NO7A 1SRMA 1W70A 3J80E 1JLGA 3REBB 4B9WA 1XD7A 5IP7J 3V81A 4LFBK 2ISYA 3W6KB 1MSFC 4K11A 1JXEA 2EZKA 1CZAN 1TKDA 1KQ9A 4DV1K 2DD4A 4FLWA 5BR8K 1UFMA 2HU9A 3JV3A 1RR8C 3CCEN 4FJKA 4XRFA 3DLBA 4MDBA 4C5EA 5A0LA 4CEQA 3VPRA 4G7OF 4PJMA 2WB1A 3PV8A 4W5QA 2OA4A 2GZWA 3PNVA 1YRNA 3LSKA 1K8AO 4CCHA 1QWEA 2IVPA 4FJGA 3PIPA 1KQJA 5GAOq 1N8RR 2RK1A 4BR4A 1SD5A 4ENNA 3LW5E 3FXOA 2XV4S 1T0FC 3A8OB 3N5NX 3HPHA 1XQHA 2EZIA 5C15A 2K27A 1SHFA 1ZSZC 4A4EA 3V7RA 1X1AA 1S5JA 4MQVA 3R0AA 4FTHA 2R58A 3J7ZI 2EPFA 4UHTA 2Q2RA 2XF6A 2E70A 3V8JA 1U47A 3CBPA 2KRNA 2QA4T 4M78F 3I5SA 4LLNA 1K8AU 2PMZA 1J09A 1BC7C 4BDZA 4GGGA 4H5VA 1QQNA 2QSFX 1HUXA 1K8AR 1LUJB 5IYCJ 2X6XA 1IJJA 2NYXA 5TRDA 2F1LA 3ESWB 5SZTA 3PIPL 1KHCA 3RCOA 3DMJA 3M9AA 1YQRA 1GT0C 1U84A 2GV9A 5M5YJ 5LHIA 5BRFA 3JS6A 4KHPK 3F0CA 3TO9A 4FOIA 5GMKl 4A3EJ 2BW3A 1CF7B 4Q5WA 1SMTA 3E9OA 2AXTC 3AVFA 4CEAA 5FRNA 1XQOA 3ID8A 4K25A 3G4ST 5J2NA 2PMUA 1M3QA 2X1CA 1T39A 4K8XA 4OAZA 1O75A 2NOEA 1MDUB 1GVJA 3NAUA 1E3OC 1NJIC 5A2QO 5GAGP 2AXLA 4J00A 1SD6A 1Y96A 2I10A 2E64A 2ENMA 2RM4A 1B6AA 4BRDA 2ESWA 4YFKF 2FRHA 1SKUB 4CGJA 4EV0A 3MEVA 3M0UA 4ISEA 1XG7A 5AQGA 4M71A 2FEZA 3OSGA 1YTUA 1PC0A 5JHFA 3NEUA 2YRVA 1Z9QA 3IC7A 1NK7A 1ZSZB 2I5UA 2GTJA 2O4XA 4QCLA 4WF2A 4KHYA 1RPWA 1Z6TA 4RGUA 2P51A 2WAEA 1W1FA 2IPQX 2RQVA 2V9PA 1Q95G 3JCMc 3BTLA 1VQKN 2P9NA 2WY7Q 5AFUA 2MWOA 2WC2A 3PO5A 2OD5A 1HNXK 3BDDA 1RILA 3UKRA 3CMAT 4OWRB 4J9HA 3WODF 4C5HA 1RRJA 1TOVA 2BGCA 2GQIA 4TV7A 5GMKi 4JUVA 1F4KA 1A6IA 1X4OA 1TUCA 4LJZF 1OYXA 4XU0A 4CZIA 2MC4A 4ZC3A 1H641 2GBYA 3L3VA 2K7LA 2VPLA 3CPEA 4AYBN 4DSEA 1Z0XA 2MWPA 3ZMZA 1LWVA 2JPCA 4XTVA 2HBMA 5DDGA 3CCEI 3J80K 1WNLA 1LWCA 1KG4A 3IH3A 3NMUA 1G99A 3SWNB 1DPRA 2LBFB 5E8GA 4HF0A 3OYMA 2FO0A <