4BE2A

Pfv intasome with inhibitor xz-259
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be2A03
3TR8A 1BGXT 1L3SA 3E9FA 2XY8A 4FJGA 2X4YA 1SL0A 2ITGA 4B9XA 4FLTA 2VG5A 3RRGA 4FJKA 3DM2A 1QE1A 4ICLA 1HYSA 3C95A 3V81A 3QLHA 1NK0A 1SUQA 4DG1A 3V9UA 3P8DA 4E3SA 3MP1A 4IUQA 2EX3A 2BIVA 4IFYA 4XIUA 1J53A 2RI5A 1I39A 3V9WA 3PX0A 3SCXA 4CGJA 4NCBA 2BDPA 4L59A 4DSFA 1L3UA 4O5BA 3HVTA 3QINA 1VSJA 5C24A 4Z0UA 1S6QA 4CEEA 4RW8A 1RDDA 4YFUA 4JRPA 1XHXA 3F73A 4FM1A 4DTPA 5I3UA 3NTHA 4AHUA 4EP4A 3MEVA 3NH2A 3SJJA 3LPTA 3WNHA 1ZBIA 1XI1A 5C0MA 1UWBA 1BHLA 2OPPA 1REVA 4DMNA 1TVRA 3AO3A 4FLYA 2FBVA 4BDZA 1BI4A 3BGRA 1QSSA 5J39A 2RJFA 2JZ2A 3NGYA 3HT3A 1G15A 3NDKA 3CM5A 4DTUA 1SL2A 4KHSA 4F3TA 1VSDA 2PQWA 3CFRA 4HUFA 4HUGA 4LH4A 2WOMA 2LRQA 2LCCA 2XY7A 3V1RA 3TAFA 1VK0A 3G0ZA 4E7KA 4BDPA 4FLVA 2EQJA 1WSHA 4CF2A 4KHUA 2FC0A 3DLMA 4CHOA 3H8ZA 3MEWA 3T1AA 4E7JA 5J1EA 4FLZA 4IUVA 1KTQA 1NK6A 1BQMA 4J2DA 4CEDA 3LZJA 4BACA 4ID5A 3MP6A 4FZXC 4Q5VA 3F9KA 4Z4EA 3SQ4A 4W5QA 4N4GA 2G8UA 2L3RA 1LW2A 4ELUA 2BKDN 1KVBA 4FJ8A 4B9VA 4QQGA 3IAYA 1WSFA 4CRIA 4QQ6A 1IKWA 2PYLA 5IN1A 1ASVA 2BANA 3AO5A 3AV9A 4B08A 4CJ5A 1JXEA 5KTQA 4QW2A 2BGGA 1HYVA 3HM9A 1D9DA 4FXDA 4DQPA 4KPYA 3RR7A 4CGDA 3T3FA 3ZT4A 4WE1A 4QVZA 1JLCA 1OI1A 4M3WA 2D5RA 4X34A 4KTZA 3FEOA 2HNYA 4IURA 1QS4A 2KFNA 3ISNC 4B8AB 4CJVA 4FJ9A 3AVKA 2IOCA 1A5VA 2RI2A 5D6WA 3C4SA 4W5RA 2XY5A 3DMJA 2XY6A 2WACA 2Z1GA 3DLBA 4M3UA 3OYLA 1RT7A 3VQ6A 3CEYA 4OLBA 4FK4A 4CJTA 3VQQA 1CXUA 3AVCA 3V1QA 4M3YA 3UWNA 1C0MA 3MEGA 3ZSRA 4CGFA 4CJFA 1WSGA 3LAKA 4CK3A 4DFJA 2B4JA 2DY4A 1N6QA 2R58A 3HYFA 3LWLA 4OVAA 4Z4GA 3SQ2A 2RHIA 2E6NA 3ASMA 3QEWA 4AHTA 3MECA 5DMRA 4E1NA 3TAQA 3RR8A 3NNQA 5HRPA 4CHZA 2NUBA 3ZT2A 1Z25A 2P51A 4IFVA 1NKEA 1BCOA 1LWCA 1C0UA 1WSEA 2HB5A 2DFEA 4G1QA 4N56A 3TWHA 4DSEA 3QESA 4CF8A 1U4BA 5JS1A 4IUTA 1BIZA 1SSFA 4B9MA 1DTTA 3OYIA 4FJXA 2RHZA 3EYZA 2NLUA 5CIUA 1LAVA 3TI0A 2AJQA 4M3TA 1LWFA 3TAPA 2EQKA 1TL3A 2DFFA 1VSMA 4HVJA 3MXIA 3VQDA 4F8RA 1YTUA 3L3UA 5KGXA 3P1GA 3VA0A 2F8SA 1LW0A 4BE0A 3CM6A 1X9MA 2G8FA 1SV5A 5HRSA 1UOCA 2DAQA 5FROA 2IG0A 4CIGA 3L8BA 2WONA 2M1HA 4KV8A 4W5TA 4DLEA 3THVA 2XDPA 5KCHA 2HNZA 3NF8A 5KE3A 1NKCA 3QIIA 4UC4A 3LYIA 1L5UA 3L2RA 3DB3A 3OS2A 3ULDA 4FJJA 3AA3A 4QOZB 1UA0A 4Z4FA 2QK9A 3MP8A 1C0TA 1EX4A 4HTUA 2R7YA 1ITGA 2L89A 3KLGA 1XC9A 2R5MA 1U45A 4PA1A 1EKEA 1NK9A 3K5LA 1TKXA 1I3AA 2OPRA 3DOLA 4A4GA 1QHTA 4CJQA 3HP6A 4C8OA 1J54A 3KIOA 1KCFA 4TSXA 4DTJA 3DB4A 2EQMA 3M9QA 5KE2A 3VN5A 3FFIA 1WJQA 3MO8A 1S1VA 3E9GA 4RG2A 1ZBUA 4AHCA 4DWIA 1YVUA 4CGGA 4I7FA 4FJMA 1A5XA 3OJSA 1WAJA 3O3HA 3DLEA 2RO0A 2RJDA 2YNGA 4C5EA 1TV6A 3DI6A 2RKIA 4DQSA 3QNOA 4DFMA 5JS2A 2G8HA 1RDCA 4II1A 2YKNA 1Q8IA 4N47A 4AH9A 4DS5A 1L3TA 4FCYA 1J5OA 4FLWA 2GFUA 3RMDA 2X74A 3QBYA 1JL2A 1OZ2A 3PFSA 2LVMA 4H4MA 3NGIA 3NAEA 5D6XA 3LP2A 3AO2A 3AVGA 3SPYA 1T7PA 1SKSA 1C1AA 3V9SA 3BDPA 1C1BA 3G10A 1TAUA 4Z4HA 1TKDA 1NOYA 1C6VA 3ZSXA 1S1WA 3L2QA 4NZGA 3PNWC 1MU2A 4CFAA 4BWJA 4DTSA 4DFKA 4AHSA 1RBSA 4FYDA 3GOXA 3AVAA 2IC3A 4OKEA 3L42A 2OZMA 2KZMA 2B8AA 2DIGA 4DSJA 2KW4A 4O55A 3LP0A 1KVAA 5J26A 3IG1A 1NK7A 3OB9A 3DLHA 4J2BA 1TKTA 2VWJA 1KFSA 1FXXA 2YHAA 2MWPA 3AA2A 3AO4A 2EQUA 4I2QA 4CFCA 3U3YA 1KSPA 3H08A 3NCIA 3EAEA 2B5JA 2O4XB 3CYMA 4RW4A 4L8RB 4FK2A 4IUPA 4OJRA 3V9XA 1DLOA 3DLKA 2ZQBA 4M42A 5KRSA 5HRNA 3OYJA 3SV3A 4E7IA 4IKFA 4FM0A 2YNFA 3PX4A 4EZ9A 4FZZA 3KD5E 1IKYA 1QSYA 5E41A 4CEAA 2D0AA 2G8VA 1NJZA 3MAQA 4K8XA 3HPOA 1BCMA 1RI0A 5HP1A 4W5NA 2D9TA 5CY4A 2HHUA 1U48A 4MQ3A 2IGIA 4F4KA 1BQNA 4LSNA 2HHXA 3PMIA 1RDBA 2VG6A 2YKMA 2G3RA 3O4NA 1S9EA 2FBYA 4KB0A 5FDLA 4FU6A 1YTAA 3UT1A 3AA4A 3I0SA 1FK9A 3OJUA 3RMAA 1NK5A 4E7HA 1B92A 3IS9A 2P1JA 1TK5A 4ZHRA 1BIUA 2GV9A 4IG3A 1QTMA 1UAXA 3SZ2A 4E89A 1N27A 4UQGA 2Y1JA 3V1OA 2RJEA 4CEBA 3VA3A 4LD6A 5EU7A 4C8LA 2HQXA 4F2RA 1LV5A 2A1RA 4FJHA 5D3GA 3L2WA 3MEUA 2HVHA 4KTWA 2XRIA 3OVNA 4LD0A 2FBTA 3L2VA 1S6PA 1ASWA 2Y1IA 3DRRA 3JSMA 4DQRA 4GW6A 3HPHA 3OYMA 4DFPA 3O4QA 4F2SA 1EETA 3AVBA 3QEXA 1FKPA 3U3GA 3I0RA 1CZBA 1WLJA 3WNEA 2GFAA 3OYKA 4O4GA 5M9OA 1RILA 3OYEA 4DU4A 4E0DA 4Y1CA 4BDYA 4FW1A 3HXMA 1T05A 2ZD1A 3QKJA 2PZSA 3ME9A 3QIOA 2QQSA 3K2PA 4B9TA 4I9QA 3A2FA 3ZSOA 5T7BA 4KTQA 3NF9A 1SL1A 3ZT3A 1Q9XA 1CXQA 1HPZA 4PL6A 3QEIA 3QNNA 3L3VA 3HJFA 2HHSA 5CYMA 2F5KA 3LPUA 4O0JA 4ZTFA 1T03A 1HQEA 4CIFA 4H4OA 3V6DA 3OYBA 3OS0A 5C6SA 1HYZA 1K6YA 4DTRA 4DF4A 4CGIA 2QXFA 2GUIA 2YV0X 2KFZA 3META 3S6WA 4IBNA 2ZE2A 1OZ3A 4FL6A 3U6FA 4KHWA 4BWMA 3ASKA 2HW3A 4J2EA 1TK8A 4CESA 1G5VA 2I5JA 3F70A 1S5JA 1TGOA 4KREA 3NFAA 2Z1JA 3LZIA 3SI6A 3OS1A 2G8KA 4K8ZA 4LSLA 1S1XA 1SKWA 4BD3A 1KLNA 2HHTA 4C8KA 2BE2A 2G8IA 4KHYA 3OQ5A 2X78A 4M45A 4C8NA 3VQCA 3NGZA 4OPJA 3RMBA 4FZYA 4B3OA 2KZZA 1WNSA 2O4IA 3AA5X 3B6OA 1VSLA 3VQ5A 3O8VA 4KFBA 3PO4A 1RTJA 4FJ5A 3HVRA 4KI4A 2K3XA 1HQUA 5D6YA 3ALYA 2ATQA 2RN2A 2G8WA 3H6ZA 1LAWA 4HCCA 3VQEA 4E7LA 1HJRA 4N76A 1JXBA 3KKSA 3MEAA 1VSFA 4JS4A 4DTMA 4IDKA 1QSLA 3EY1A 5J2PA 3SUQA 1KRPA 4DLGA 4CK1A 3QERA 1RTIA 3EZ5A 3C6UA 4FK0A 3OYDA 2YRVA 3SNNA 2XHBA 4QCLA 3OYFA 2R57A 5KGWA 4CEOA 2RHUA 4CJ4A 3KLIA 3NH0A 1O1WA 1WSJA 1Z26A 2E6LA 1RT6A 4H8KA 2YNIA 4CECA 3M8RA 5J2NA 2JTFA 1JLQA 3NF6A 4M3RA 3KTQA 4FJNA 1JLEA 1W9HA 1WGSA 3V4IA 1L3VA 4I2PA 3TABA 3V9ZA 5HBMA 3HK2A 3SD4A 2JGUA 3KD1E 3LWMA 1CZ9A 4BE1A 1H3ZA 1RTHA 2RJCA 4E19A 3WNFA 5HRRA 3MXMA 4A4HA 1ZBLA 4CF9A 3HPGA 1RT5A 3PUFA 3VQ9A 3NE6A 3NTIA 3NHGA 3RWUA 3Q1JA 3TAGA 5SZTA 3KK3A 1F21A 1WJSA 3DRSA 4FW2A 2HHWA 2X6NA 3DRPA 4C5IA 3VQ8A 4CK2A 1RT4A 4LH5A 4YNQA 3M8QA 2BUDA 1D5AA 1RDAA 4FVMA 2PY5A 4GY5A 4DTOA 1DTQA 1VSHA 1X1PA 4ELVA 1NJXA 1EXQA 2X6SA 3LALA 4C5GA 1BI4B 1W0HA 3CG7A 4W5OA 4CERA 1TAQA 3K59A 3UIQA 4N41A 4DU3A 4JS5A 4A4EA 3HSTB 1TK0A 2QKBA 5FRNA 1B9DA 2JLEA 3L2UA 4DS4A 3PO5A 4M3XA 3SQ1A 5C25A 2X35A 2YNHA 3OYCA 1VSEA 3LP1A 4DTNA 4PLLA 4EP5A 2EFIA 4FJ7A 4PQUA 4AILC 3AVFA 1VRTA 5IAYA 3HO1A 3K57A 1JLBA 3MXJA 4CE9A 3NF7A 4CHPA 2Z1IA 3ZT0A 5HLFA 3ZT1A 4Q5WA 4CCHA 2P0KA 4KI6A 3LGFA 3M8SA 3P8HA 1WJRA 1S1TA 3QO9A 5K14A 4Z4IA 2HVIA 2L8DA 4KB1A 4A4FA 4HHTA 2OYQA 4KKOA 1BL3A 1D9FA 2OA8A 3ZEHA 1IG9A 3LLRA 4Q0BA 4EDUA 3AVHA 4NYNA 4IUUA 3QJ6A 2F96A 3ZSZA 4AHRA 4B9UA 2M0OA 1KHCA 2Z1HA 3TARA 4RW9A 1RCHA 1ZBFA 4QAGA 1JKHA 2IAJA 2EKOA 1ZBHA 1RNHA 2HNDA 4NYFA 2CKKA 3ITHA 1WSIA 1TKZA 2LSNA 1R0AA 5KCOA 1A5WA 1XHZA 1IKXA 4DSIA 3K5MA 3PV8A 1NJYA 3QEVA 4J2AA 3DLGA 4ZTJA 3DLRA 1QQCA 4GVMA 4CF0A 3LDSA 3OA6A 3OMGA 2RHXA 4OKKA 2PYJA 3KJVA 4DTXA 3CQ8A 3S3OA 4B9SA 3AVIA 3M8PA 4Z02A 3QIPA 3SV4A 3DYAA 1VSIA 3TAMA 1OYXA 1FKOA 3FC3A 1YT3A 4CJEA 2RHYA 1WN7A 2GBZA 4PUOA 4CJRA 3KK2A 3PY8A 3LGLA 2GF7A 1KLMA 3B6PA 3SUPA 4CF1A 4N4HA 1Q9YA 4B9NA 3I8DA 3FLGA 3S9HA 4CJ3A 3C6TA 4OPKA 4OVLA 1WAFA 3FDRA 3AVLA 4Z4CA 4QQDA 1HMVA 1J9AA 4C5HA 4IG0A 1HNIA 4E1MA 2MWOA 3AVNA 4CFDA 4M3ZA 1RBVA 3K58A 3JYTA 1B9FA 3AVMA 1JLFA 1RT3A 3VQAA 3ZSWA 2D0BA 5J2MA 5FRMA 1NK4A 1RBUA 1NOZA 3SPZA 3KLHA 4CJLA 4DSKA 2FBXA 4RW6A 2DFHA 3DOKA 3ZCMA 1UA1A 4DQIA 3NBPA 1ASUA 1GOCA 2E6MA 4KO0A 2OZSA 1TL1A 3S3NA 3NTKA 2IDOA 1U47A 2LTOA 3SUNA 1XNIA 1HNVA 1U04A 2RPIA 3RTVA 1D8YA 4FM2A 3WNGA 3NH1A 4FLUA 5HROA 3RMCA 3LANA 4MFBA 3TANA 4FJLA 4JLHA 1NJWA 4OGCA 4B9LA 3CFPA 4I9LA 5CZ1A 2A1SA 2VYTA 2HMIA 2FHDA 3HL8A 2LDMA 2RI3A 3VQ7A 4B8CA 3VQ4A 3ZSVA 4NCAA 3CFOA 4CGHA 2HQEA 1VSKA 3BDLA 4O44A 1RT1A 4C8MA 3S3MA 1JLGA 5KRTA 3SQ0A 4CJKA 3C94A 2E4LA 3MEDA 4CJUA 1BISA 4CEZA 1N5YA 4DSLA 3ZSYA 1X9WA 3KUFA 1GOBA 1EP4A 4ID1A 2IS3A 5DK5A 4PLIA 4R5PA 3RRHA 4PWDA 4OLAA 4CFBA 4KHQA 3VQBA 4OGEA 3LX7A 1LWEA 5CZ2A 4O0IA 1MHNA 3O3FA 4JRQA 2O4XA 1IH7A 1U49A 3P5JA 2P5OA 3K5NA 3P83D 3PX6A 1HRHA 2RF2A 2B6AA 2EHGA 3HP9A 4CHYA 2X4WA 3T19A 1NK8A 1RT2A 1CLQA 4CHNA 4PY5A 5I42A 4AHVA 5KH6A 3AO1A 3OYNA 5C42A 4RW7A 4DQQA 3SYZA 4CEQA 4RG8A 4Y1DA 3O3GA 2W42A 4DU1A 2P5GA 1S1UA 4OKJA 2HHVA 3QETA 2K3YA 4LY7A 4CJWA 1NKBA 3ZSQA 2HHQA 2E5QA 1VRUA 4DF8A 1JL1A 3D0PA 1ZYQA 1KVCA 4F3OA 1X9SA 3KLFA 2O4GA 3D45A 4CJSA 4CHQA 2DTUA 2KQ2A 1SKRA 4N5SA 4GMJB 1RTDA 2VG7A 3OY9A 4HCZA 4HUEA 3LH0A 4EZ6A 5KI6A 1IO2A 2D0CA 3LP3A 1Y97A 3E01A 2R5AA 3KKRA 2DIQA 3SUOA 4HCBA 2Q3SA 4CEFA 1GOAA 2OPQA 3TAEA 1RBRA 3KK1A 1IKVA 5CYQA 2X4XA 4M41A 1S9GA 1RBTA 2VWKA 2QQRA 5SWMA 4FJIA 3IRXA 4CJPA 3KLEA 2QKKA 1KFDA 4NS5A 4KAZA 4ELTA 3VQPA 3OYAA 3OYGA 2XK0A 4N4IA 3AVJA 1JLAA 2YHBA 2XO7A 1T8EA 4KRFA 2KTQA 1XWLA 2OPSA 3PMTA 4CIEA 4FLXA 3K5OA 3OYHA 4BE2A 4B9WA 3QEPA 4KHNA 5J2QA 3LAMA 3MEEA 4NCGA 2F8TA 1C1CA 2ETJA 3OMCA 2M16A
chains in the Genus database with same CATH superfamily
2KLOA 5LHIA 2W4SA 2L0AA 3T5XA 4E6RA 2HI3A 2K9SA 1N78A 2LF7A 4V19K 1SUQA 2KJCA 2COZA 4C3IJ 4PFPA 2CT4A 3PX0A 3E6MA 2ISZA 4PFZA 4O5BA 2BY2A 4BR2A 1N75A 4BEHB 2BYVE 5EZGA 1XI1A 1YFHA 2FBVA 2YU3A 2L2PA 2FD5A 2EQRA 4J9DA 4BQOA 2LRQA 4E7KA 2YS9A 2EQJA 2ZFWA 3QOPA 1N34K 5D8KB 3IAM2 4ZNXA 4FZXC 1NGGA 1LW2A 2BKDN 5H1SQ 3ERMA 3AV9A 2SEMA 2KI7A 3MKLA 1MBHA 2JZYA 5GAMg 2UUAK 5LJ3d 3TP3A 3PIOL 1WIEA 3REBB 2HNIA 4C1NI 2RNAA 5KN9A 1K61A 3LAPA 2FOKA 1VRLA 4FYYB 3UPUA 2EV5A 2HGCA 3CUQB 3BFMA 4CGFA 4FPAA 3ENHA 1SSHA 1M1FA 1EH8A 3C7NA 3FF5A 2NOZA 4NLCA 3CCEQ 1X3ZB 3ZT2A 2P51A 1RAAB 1BO5O 3TWHA 2VBZA 5J3BA 4XLNF 2LKPA 1Y0NA 5KYUA 1RETA 3P8BB 3HRMA 1O4XA 1VQ5A 3K4MA 4QTRA 3FXLA 1OCTC 4JK7A 2VYPA 2E5ZA 2GTOA 2UV1A 2P81A 3FR0A 2D4WA 2B7EA 1AOJA 1ZSGA 3KLGA 1EKEA 1W1WE 2DLPA 2JK3A 1M1KU 3FFIA 1FJLA 3CCST 1VQ5I 1S8NA 1TV6A 3G2BA 5GJWB 1E3MA 3CESA 3PFSA 3RZOJ 3M0TA 4I2OA 1C1BA 3G10A 2QF7A 1S1WA 4CFAA 2H8WA 2EYYA 3J8AA 3ZQGA 3IG1A 1KQ9A 3H46O 3ECHA 3U9GA 2LX9A 1RGIA 3CJBA 3FFKB 2CUZA 2JA7J 2DTOA 4A3KJ 4FQGA 2UYTA 4MFDA 1G8XA 2NOIA 4M77E 3CMAA 1NJZA 1V5EA 3ZX3A 1VQ9A 2GLOA 1RABB 1Y1VJ 1IDZA 2V75A 2XIGA 4XN0A 3C6HA 1IV8A 2KKZA 3MKWB 1OCCH 3V1OA 4BC2A 1PU8A 4FJHA 1S1NA 2A1RA 4M7DD 5CVIA 1MMNA 3DXKB 3VV0A 3DRRA 1KQSA 3FM5A 4A6DA 2E1OA 1CZBA 1WLJA 3QMLA 4O4GA 4B1ZA 1WI3A 1QCNA 3H9QA 3F0ZA 1SKUB 4EGYA 1OCZH 4I9QA 3PO3J 3VPZA 4JN4A 5IWAK 2ZWHA 5HOOA 2IAIA 2XRLA 3U1DA 2LQNA 2GUIA 3G25A 1SMTA 1M8MA 4PGGA 3BROA 3V8KA 4M7DF 2JWTA 1G5VA 3H0IA 2F5CA 2R7FA 4X62K 4XU1A 1S1XA 4K8ZA 3GFMA 5I21A 2HQRA 1WNSA 3B6OA 2E1NA 4KFBA 2K5LA 4UB6C 3DLAA 4ESFA 3CC4Q 4M9XA 2W7NA 3F8MA 5LFAA 1E3OC 1XQHA 5B1AH 4PKCC 3B73A 2KIMA 2OCEA 1HK9A 4CK1A 4OMFB 2PBDA 2QA4I 4HF0A 1WSJA 1APLC 5ICCA 4CSWA 1UJ0A 5AQQA 4UUSB 1VYVA 1IXRC 4I2PA 4OFAA 1UG1A 1U8RA 1ZGJA 3HPGA 1I50J 2VXZA 3HGGA 4U7DA 3E2UA 5SZTA 2M8EA 4C5IA 4YORA 4LH5A 1D5AA 1UTIA 5EOYA 1NJXA 1EXQA 5FPNA 4W5OA 3I56T 2KK4A 4DU3A 3WEEB 2R5ZB 2J06A 1QZEA 1CF7B 1YIJT 1Y1WJ 2CFXA 1XQPA 5AQMA 4FWPA 3P8HA 1WJRA 3OW2A 2OYQA 4KKOA 1NM1A 2RQUA 4CCNA 4DV5K 4KGZB 2CV1A 2CW7A 3BC8A 2HSTA 4V19S 5J1UA 3CW7A 3LM2A 3DLGA 3KYDB 4CF0A 1YIOA 4XK4A 4Z02A 4IQ4A 3P38A 1YT3A 1PP8F 2VBYA 5GANe 3T8RA 2AQFA 3C6TA 3FDRA 3CMEI 2KIUA 2CGHA 2AO9A 4L5IA 2YDLA 4ATOA 1RBUA 4I6MA 4JKAA 2A05A 3AHUA 3ZCMA 2QCOA 2E6MA 3L1PA 2E2NA 4KO0A 4KH4A 3O8GA 3H35A 1E6GA 2LY1A 3LANA 1AHJB 3CMAT 5LHGA 2WADA 3HBTA 3QPSA 5AONA 1RT1A 5FKOA 4BRDA 4CJKA 1N5YA 1HQCA 2KLAA 3ZSYA 1EP4A 5J8FA 2IS3A 1WX6A 1FIPA 5IT9Z 4E9EA 3ZMVA 1U49A 2RF2A 3T19A 1E0EA 4CHNA 4RBOA 4RUGA 3QZ9B 2N8GA 2BE5F 3O3GA 2P5GA 2QWNA 3EGXA 4CA0A 4RTVA 3LWHA 2VONA 3K9TA 1RR8C 2HDCA 2W82A 4PL7A 4IL6C 2R5AA 2E5LK 2I0NA 5J4VA 4BG9A 2LREA 3HOYJ 2CQXA 3G6EQ 5CK9A 5BPIA 1XWLA 5LJ3j 3CJ9A 2LY9A 3CD6T 4EJYA 4NCGA 4KT6A 4E4HA 3HOZJ 4FJGA 4UB8C 4UUSA 4WXDA 4B9XA 5KHDA 2HBKA 1WHLA 1C0GA 1HYSA 3CWSA 4DBHA 1XMAA 3G1JA 1U5TC 4K43A 1U0JA 1I39A 2RI5A 3JAMO 3HPWA 5TKWA 1GLBG 2KHMA 3CERA 2DMPA 5HLTA 3VESA 1PHTA 1L0OC 4B6MA 3NGYA 3CM5A 3JCUC 4CICA 4J19A 1EF4A 4D6WA 4BDPA 3EHRA 4KBMB 1DUXC 4F7UG 3T1AA 3VU3C 1NK6A 4GYGA 4AFQC 5HCKA 4E2FB 2QQBA 3C18A 4N4NB 1LDKB 2Q36A 1RRQA 4CJ5A 2P84A 3ZETB 2EFNA 1JGSA 4CGDA 1KC8C 3HSRA 3CTAA 4RAFA 3WTZA 4LDXA 3I5RA 3SXYA 4M6YA 2Y0SA 1QWFA 1IO6A 1AKHB 3DKMA 1OISA 3OYLA 4AI4A 1UB4A 1ONVA 5CYVA 4J5YA 3WU1B 3BY5A 5IHIA 5LJ5h 3QBWA 1NK3P 3TAQA 3VEXA 4YIRX 5ILSA 3ZQIA 3QP5A 3SK3A 3JCMQ 4CHZA 3ABUA 2HXIA 1K9AA 3SAFA 1WHHA 1D09B 3P1GA 2OAZA 1R58A 4Z8AA 3CM6A 3BF3A 4B1VA 4DLEA 2DYIA 1TTHB 2WONA 4LE9A 4A12A 1MDMB 2JJ9A 2NS7A 1IC8A 1WJBA 1EX4A 4PA1A 3VYGA 3RPQA 4IZ9A 2QGGA 3VS6A 3HYIA 1T38A 3PFYA 2GXBA 4BU2A 4I7FA 5AQRA 4DFMA 2LR8A 3WG9A 5AQTA 1IBKK 1RESA 2JJ7A 4Q48A 3MCZA 1Q86C 1QHGA 1C1AA 2CSQA 2X6WA 2DJNA 4B23A 5AZJB 1VUBA 3HOXJ 2UXBK 2QWWA 3EEQA 1VNDA 2Z2SB 3AA2A 1QA6A 1VQ8N 1SFKA 3UB5A 2LBFA 2LP5A 2DA6A 1X3UA 2ZJPL 4HLXA 5DTDA 4E7IA 1J7KA 2CMPA 4IOXA 1B3QA 5EGOA 1POGA 2LX7A 4P1WA 4EM1A 2JA8J 1NZ9A 5LJ5e 1MH3A 1BIUA 5GMKe 3E5QA 1YWOA 2RJEA 2LNBA 1J75A 3HM8A 3VA3A 1LV5A 2VT2A 5BRHA 4IJNA 3L2VA 1D3BA 1ZKGA 2A6TA 4H5NA 2VPRA 5F08A 2HOEA 2D45A 4Y1CA 3ABLH 5F6FA 4ZJZA 3GPLA 3K2PA 4IXCA 3A2FA 2JQ7A 2HSPA 3NF9A 5E8IA 3I0TA 3WHCA 3LPUA 4MFEA 2RC4A 4OMNA 1QZYA 1SF9A 1Z9CA 2QXFA 4ISGA 3M3ZA 1TS9A 4IBNA 2ELJA 4J2EA 4CESA 1A0NB 3M55A 3NFAA 2CGPA 2FRYA 2VQCA 3GTJJ 4OB0B 3VJPA 4BD3A 1TTYA 1X27A 2X78A 4OPJA 2ZNZA 2CH4A 3KP5A 2HD0A 1U5SA 4HAMA 2NRWA 1KZHA 3CCET 1YWPA 3VQEA 2DZ9A 1QQIA 3MFKA 3WG7H 2VQHA 3AL0B 4L9NA 5J2PA 1RTIA 3P31A 2X6OA 4RLQA 3KNTA 2M4KA 2XSJC 3PJRA 3V9ZA 2M9UA 5GPCA 4D7MA 3WNFA 4DR1K 3Q1JA 3CC7N 1W70A 2F4MB 1MDMA 1ETVA 2X9DA 2JRTA 2GAUA 1EFNA 2KR3A 3I4NJ 2EIKH 3QG1A 3TCJA 1AZEA 5HLFA 3GWZA 2YSRA 3N5NX 3ULEA 4KB1A 2VODA 5AFUA 3TEDA 2OA8A 3GEZA 5DV5A 1DPUA 1I0CA 4JI4K 1JKHA 3WVDB 1ZBHA 2HNDA 1B9NA 4P55A 2K4BA 5E20A 4ME7A 1PU6A 5D6EA 1BW6A 1VSIA 2A61A 1R4MB 4CJRA 3OIOA 1Q9YA 4Y91A 3CC4N 4UVBA 3GNGA 3M3YJ 1RPWA 4BAYA 3DJCA 2E12A 1J9AA 4AM7A 5EDNA 3HUGB 4YOVA 1RT3A 1H3HA 1XSVA 2FBXA 3DOKA 1YJNI 4PHTX 3CCJN 1JJ6C 2ESWA 1GV2A 1NGCA 2LTOA 3N0UA 1GLNA 2RHKA 3LH5A 4P5NA 4F16A 4ELYC 4JLHA 1RAFB 1PSEA 2Q2EB 1ETQA 1BK2A 4BRAA 3WQUA 1WHKA 3VYRB 5F0XA 4YIIA 1Y64A 2E4LA 2LRDA 1PRMC 4CFBA 3NHNA 1Z7LA 5KK1A 2K5FA 3C1DA 4B09A 5BN9A 4U7BA 1YHQT 4DR7K 4H5TA 4YHHK 1KVCA 1KG4A 1EQYA 1OH5A 1SKRA 3M5RA 5K7HA 4B47A 2DIQA 2KMTA 3FWEA 4OIRF 1S9GA 5J47A 5JVGL 4ELTA 3U2RA 3AVJA 2XO7A 2KROA 1JCFA 2EINH 4C8QG 2O01E 3E6DA 1ILYA 1T6CA 3TR8A 3TSPA 1MNDA 1VI0A 1KYZA 4AU7A 1HYOA 3C0BA 2KKOA 2DMTA 3TEEA 3MZHA 4YY3K 4NCBA 2K3FA 1NGHA 5KNLA 3HBLA 1LOJA 4EMKB 3SJJA 3OGDA 4NCAA 2PMHA 1QSSA 1RIOH 1HXDA 1R7JA 1RDWX 3QWXX 5JR3A 1DGRM 2NRZA 3BR3A 5GANd 3M1FA 2JWLA 3ZQLA 3O6WA 4FWMA 2E8AA 4JOMA 4FJ8A 3B8AX 1NHAA 1MMSA 3V4GA 3H3ZA 1V3FA 2ITMA 1Z7UA 3HM9A 2F5FA 2OTJI 4IOCL 4IHSA 1JLCA 2I7PA 3FEOA 4IURA 1MIJA 1VZ0A 2DOFA 4PJOD 3C4SA 1QLYA 3THXA 2EYXA 2C06A 1DQUA 3MN5A 2STTA 3EG9B 4RGSA 1RR7A 1G6NA 3UWNA 4C0DB 2GXAA 2JVVA 1XX5A 2QDLA 1R9TJ 9ATCB 1ZAOA 3NNQA 3QP6A 1NKEA 2HB5A 2MOXA 4J2DA 1YJWN 3H6EA 2K3PA 1DTTA 2M1BA 4JDSA 3L2CA 4CUGA 4MNUA 3EE8A 1IG8A 3CC2A 3LYIA 2AS5F 1KAZA 1XJWB 2YUNA 3S17J 2E6ZA 4M77G 1AA7A 1R4NB 1I3AA 3HP6A 1W97L 4HV5A 1DGKN 4LIVA 5KE2A 1EBMA 3BCBA 1Y56A 2QA4T 4EJUA 1G3YA 4JKCA 3PNTA 2OD5A 2OTJQ 1Q8IA 4CCLA 4FTHA 2X74A 3G3ZA 1KHIA 4CH7A 3V9SA 3EUAA 3ZEUB 4Q4ZF 4F04B 2O8CB 1TU0B 1N5ZA 3L42A 1IREB 3EFSA 2HR3A 2K4JA 1T3SA 2ID3A 3SBGA 3VS0A 3FK6A 1L3LA 4KUMA 2IJLA 1O3TA 4OINF 1KQ0A 1QSYA 1P4XA 2ZJ2A 4OMOA 1VF9A 2D0AA 4BNCA 2XASA 4BXUA 2MYSA 3BG7A 4UV9A 3RVCA 1I4K1 1FK9A 4BGBA 3QJYA 1X4OA 3PTAA 4RTTA 3SZ2A 5LGTA 3BZ6A 4PKGA 3THWA 3BQZA 1JI8A 3I0WA 3O5ZA 3MCPA 3PNYA 3ZRGA 4N0AC 1JU5C 3O4QA 5GADP 2V1NA 4CZMA 3KP3A 2KYBA 3E97A 2KDSA 4HNUA 2QA4Q 5DD8A 3S8PA 3FX3A 2DYBA 1VQ6A 4OPHA 2ZD1A 1W2BS 1M90U 1T39A 4KTQA 4Y3OA 2JUCA 3QEIA 1VQON 2ZPHB 4JHDA 5BS6A 1HYZA 4O5FA 2KFZA 4FHTA 2COWA 2DPDA 1OZ3A 1VYUA 3T1YK 1M8VA 4CI6A 5GAN5 2DPUA 4KREA 1YW8A 1DP3A 5B1BH 1M1KC 1SKWA 4M3FA 3PIPL 3U1KA 2J5OA 2FBIA 4F7UE 1R6RA 2I7NA 2B0LA 1EA3A 2ATQA 3BCAA 3WEEA 3EG9A 3R0AA 1YIJQ 5L3BA 2FVUA 1ODDA 4OPAA 2E6LA 1YIJA 5J2NA 4VUBA 1JLQA 3TABA 1M3AA 1DKGD 1RL2A 4J8OA 3OOPA 4CC3A 5FKLA 3KFVA 4G9ZA 3NHGA 4II3A 5IY5H 3VODA 1SS6A 3ZOBA 3KP2A 3M8QA 4DTOA 2COBA 5LGUA 4DUZK 1BJZA 2BTTA 2JPCA 2IIMA 4RDUA 2O2OA 1IRXA 3CI5A 2GXGA 3HJEA 2Z0WA 3ZT1A 4KUIA 2P4TA 3QO3A 3KP4A 2E4HA 3V7SA 2J6FA 1MKMA 1D9FA 3LLRA 2NVTJ 2FG0A 2F96A 4FASD 4RW9A 3ML6A 5I2MA 1GBQA 5HS7A 2LSNA 4M75E 5C2FA 1KG6A 3ASOH 4J2AA 5HLIA 2EWSA 2V52B 3OMGA 4B9SA 3KJVA 4DTXA 3M8PA 5FLXK 4BEHA 3JRZA 1KLMA 1YXQA 2LLKA 2UXDK 2HAXA 1M1EB 1VQLT 1UCRA 1RBVA 3K58A 2F69A 3CCEA 2CU7A 3OTOK 3IH7A 5BRDA 4JD2B 1UA1A 3KZYA 1IGQA 2EV0A 2QKLB 2WC9A 1J09A 2ZJPF 1FNNA 2FB7A 1FOWA 1U04A 3EH1A 2EYZA 1KC8U 5BPLA 4MFBA 2HL5C 3IUCA 5GAHJ 1KEAA 2A1SA 4KULA 4JV5K 1QP3A 3VQ7A 1E7OA 3VENA 3CFOA 3RMQA 4CGHA 3CVSA 4NOYA 3SQ0A 5DCMA 2ASOA 1OV3A 4AIAA 3F6VA 3BDDA 1W4MA 3F8FA 4OLAA 4JP0A 1OPKA 4XTUA 4LFBK 4O0IA 5CZ2A 1IJJA 2BTFA 3HTUA 5E26A 3REAB 3HTVA 1D5YA 5M1PA 3EUHA 1YJNQ 3P83D 2MLKA 1TUDA 1CLQA 2K2MA 3AO1A 4BQZA 1M90O 1TW2A 2ENMA 1MW7A 3LWFA 1OKJA 1VQ6T 4F3OA 1I6HJ 1NGJA 3BG3A 3LH0A 4X65K 1QGPA 1N77A 3HOUJ 1YS7A 2AZVA 4CVNE 1N25A 2HL3A 1JRIA 1KQSM 3RKQA 2F2XA 3CBMA 3GXOA 1JTYA 4CCJA 4M77B 1IV6A 1BOAA 2BVMA 3VEPA 1D1AA 1KG7A 4XU0A 3IMXA 3S14J 5EVZA 4BH9A 1Q86O 1AT1B 4S04A 1L3SA 2KQWA 1SL0A 3RRGA 4IRHA 4HOBA 3DXMA 2LJ0A 3P9CA 4DZJA 1X69A 1MUZA 3ZMSA 3V9UA 1IUYA 4B9UA 2WB1A 4EPCA 3SCXA 4JRIA 2VKVA 2KIFA 3MN2A 1VSJA 3P4IA 5E3NA 1WXTA 4F7UA 4D0PA 4MLHA 2OPPA 1VQ6I 3LSJA 4FLYA 3CF5F 4DV7K 1WHJA 4CYCB 4XLHA 1BG3A 4XTWA 4V2GA 1U6ZA 1PP7U 2PVOB 4M3BA 4M7AC 4HV6A 4N4GA 3IAYA 4BRNA 5IN1A 2MPXC 3ULQB 3CDLA 2OAUA 4B1RA 1P9QC 3LCNA 2EGEA 2D8HA 3MKDA 2E41A 4EQQA 3DXKA 2XY6A 5CCAA 3F10A 3CEYA 4CJTA 3PIPA 1VQPN 1JKRC 1KYWA 3HYFA 3QEWA 5DS9A 4DV1K 3R6SA 2NUBA 1LWCA 5F04A 5DM7R 4BL0B 1U4BA 5CIUA 4DCHA 2MAMA 2DJZA 4F8RA 3IP4B 3L3UA 3VA0A 1LW0A 2XUBA 4BE0A 1PDNC 1TW3A 2G8FA 3CBOA 4KV8A 2MF2A 2P9SA 2COMA 1O57A 3NGPA 4LD9K 4KH6A 1LEAA 4Z94A 1YJ9Q 1ITGA 3TVTA 4IZZA 3CCLA 1SD7A 2BY1A 4KH5A 2HKOA 3JCMe 1JKPC 2YNGA 2ME0A 5JS2A 1RDCA 3GFJA 3M1CA 2YKNA 4N47A 3JREA 2BE7D 4NNJA 2QWOA 3J80E 1DEJA 2A6AA 2HSEB 4IHWA 4H0PA 4JKEA 1TAUA 4HCKA 2PU9B 3FB9A 1KQSP 4AHSA 3FXUA 1IHWA 4TV7A 4QVDA 1F4KA 5HODA 1D3BB 1GLLO 4EV0A 1IRZA 3B6AA 2ISYA 5A2QZ 4E70A 2R7SA 5FO5A 1YI2Q 4M4ZA 4KFCA 4LUDA 2Q1NA 2E60A 3WXMB 3U9ZA 5IHNA 2HQHA 1WWXA 2Q31A 1B92A 4CCKA 2R7TA 4BBRJ 1U8BA 5GAMd 2VWFA 4F2RA 3GLLA 3MEUA 1X6BA 3WE2A 4FT4A 1ASWA 4HG2A 1QQJA 3HL2A 2QQ9A 1UEBA 2RN8A 4GW6A 3GTLJ 3J7YJ 3O6BB 1VQ7I 5K7FA 3OYKA 3L2ZA 5CQYA 2OCCH 2HKQB 4CYCA 2W6LA 4HVVA 2E1MC 1U3EM 2NUPB 4CIFA 3WTSC 3BJOA 3COAC 2P5VA 3GTQJ 1PUEE 5CHZA 3KYCB 3VFZA 2XKOA 1BIBA 4G6DA 5F0CA 1TGOA 1Q86R 1K9MU 3TSWA 5LMNK 1BDGA 4C8KA 5FLXE 3K9KA 2QSGX 1WHUA 4KI4A 1NEBA 2Y0SN 1R5HA 3M1EA 4C92C 4DTMA 3CXCA 2GM4A 4M7AB 1AWWA 3DU6A 4FOEA 1JT0A 2KDOA 1NJIO 4CECA 2QWRA 2NRXA 4J6XA 2HWVA 1S7AA 3I33A 3CMYA 2D1XA 2VT3A 4GLMA 4DR3K 3JCMb 3TAGA 1KGSA 5FKMA 3RR6A 5DM6F 3GZ6A 4J00A 4PDKA 2O9LA 1RT4A 2P9SB 3FZLA 4YOQA 3EKSA 2MG4A 2QKMB 4MEXF 1Y7XA 5FPDA 2P0PA 2ZMEB 4XTYA 2QUFA 4JK9A 1ZUYA 3QICA 2CRGA 5FRNA 4DS4A 3TSZA 1H89C 1ZGAA 3CCVT 2F5EA 1F36A 3R6OA 3OR1C 3M8SA 4C8QB 3AG2H 2HVIA 1VQOQ 1SVOA 1XGMA 2CJJA 5FU6C 1YJNA 3C12A 3ZSZA 4LB5A 2DTZA 1M9SA 2DK8A 5LEKA 4U0YA 2EKOA 1R0AA 1XHZA 2X4HA 2UXXA 5A2QE 1W5SA 2F5VA 2A5WA 3JW4A 4X9CA 3HEFA 5DPKA 4IJAA 2FF6A 2KMUA 1K4US 3OSGA 3LGLA 2NOHA 4BI4A 4G7HF 1TUGB 4OVLA 4XU3A 5LL6Z 1QZ6A 2Z99A 1TXQA 1RI9A 3G6ET 4XNFA 2R4GA 1H8KA 4RAZA 4RW6A 4LG3A 3INZA 1IBLK 2XB0X 2HF4A 1J5YA 2CSOA 3AL0C 5DM7F 2YPRA 4FM2A 4GRIA 2R93J 4KITB 3L09A 2GUPA 3A98A 2MGQA 5E8GA 1KG5A 3H45C 2O8BB 1KQ8A 2PG4A 3G71I 4O44A 1X9WA 4AMCA 4J7FA 4PLIA 3RRHA 2EK5A 2XHKA 4A5BA 2DXTA 3O3FA 4EM2A 1I94K 2DI3A 3HRSA 1H9TA 2J6OA 2EHGA 2CP3A 4JI5K 1E17A 3OW2S 2NYSA 1NM7A 2HHVA 3K0SA 2K3YA 3GTMJ 1Q81C 3ZSQA 2E5QA 2PFBA 1JL1A 4FWRA 2EFOA 3SWNB 3ZMTA 4RTYA 1ZRFA 4M75B 3M59A 2RQPA 1YFNA 3EGDA 1H88C 3LP3A 2FLOA 4BXXJ 2DJIA 2Q3SA 4EMKA 1P7MA 3IRXA 4GXOA 1UJYA 1XNQK 4N4IA 2CREA 4GV6A 2Y0MA 3BF1A 1ZELA 3O3KA 3ZQ7A 1NBWA 3I58A 5J2QA 2FYKA 3OMCA 2EYQA 2QBYB 4FJKA 2QYOA 1YQAA 1WZ2A 3DM2A 2HOSA 3F21A 1VQ4N 4DG1A 3M4YA 3VF2A 3V9WA 2BVLA 3CPFA 3N4MA 5GAMh 4YFUA 5AQKA 1WHMA 3NTHA 5FFZA 4LB6B 1QO0D 3MEVA 4NB4A 4C0ZA 2IIRA 1WDXA 1G15A 4KHSA 3PSIA 4MIMA 4YOYA 3U4LA 5LJ5j 2QASA 1MD0A 3V8JA 2FC0A 4PJNA 1GLFO 1GXIE 2Q0RA 4L18B 4CEDA 4BACA 1VQ8I 4A3CJ 1D0XA 3SQ4A 4EJTA 2K5CA 2XAJA 1FJGK 2PYLA 3CCUT 2A6HF 3Q7CA 4KPYA 2X3XD 2RREA 1FY7A 2P0QA 1TT0A 3CC7T 3GOIA 4M3UA 1KQSS 2I10A 5ICFA 2EAYA 2HKNA 4I76A 2EA2A 2Y30A 3ZSRA 1SD5A 5HLGA 3GP8A 5E3OA 1Z25A 1N8RU 4G1QA 4CF8A 3LNQA 3EYZA 1HW1A 2CYYA 2AHJB 1VSMA 2EVRA 3ZCOA 1X9MA 2L4AA 1PSFA 2A3SA 4F52A 3NVMA 3THVA 4J6YA 5IT9E 3ZPLA 4L9JA 3AA3A 2QK9A 1C0TA 5C4JJ 1GLJO 2NOLA 1XC9A 1JCEA 2BXYA 4DV3K 3M57A 4ZDOA 1NJIR 4IEIA 3MCAB 3MWMA 3CBPA 2QEXQ 4OO1J 1RUWA 5L3DA 2W40A 3VGKA 2RKIA 1IZ1A 1X75C 2ZXIA 1QVFM 2J5PA 4FCYA 2RF0A 1YG2A 5D6XA 3LP2A 2A36A 1C6VA 4C8QD 1G59A 4J2BA 2YUOA 2GX9A 3U3YA 2O4XB 1K8KA 1FYMA 3KD5E 3DKYA 1TC3C 5HP1A 2RVCA 2WAEA 4F4KA 3EPZA 4L0YB 5KYXB 4JK1X 3NFCA 3IS9A 2GIVA 4BROA 3VTHA 3CC7Q 2FSWA 4C8LA 2A3ZA 4KTWA 2EZIA 4DR6K 1UGVA 4IXAA 4DFPA 4F2SA 2LTPA 3SFZA 1FSEA 4NC6A 1R23A 2E1MB 4AIJA 4B9TA 4XRSA 4DZPA 1N39A 1TSFA 2HHSA 3HJFA 5I22A 3OS5A 4MDWA 3UF4A 1WBDA 4ILJA 3MD2A 3RERA 1QWEA 4FL6A 3QPLA 4BWMA 1LCUA 2DA9A 1ZQ1A 3F70A 1LVAA 4BB7A 1Z21A 2QI2A 3IRQA 1KLNA 2OZUA 3UATA 3VQ5A 3ZFJA 4WFBL 4OX9K 1B72A 4YIFA 1NLOC 1YIJN 1OR7C 1OR7A 1JHFA 4I6ZA 3QERA 4NHJA 1UGQB 4QS9A 1Z6RA 3ZMZA 4QCLA 5C15A 3VF4A 1W9HA 3PVQA 5EYRA 1MJ9A 4M7AE 4OF1A 1LKXA 4M78F 3PUFA 2P9UA 2O8DA 2V26A 5GAN7 3ZX0A 3WT0A 1RNLA 2MBFA 2RNGA 1X1PA 1VSHA 4NC7A 4J9IA 1BN5A 5HLHA 1KSWA 1B8IB 4C5GA 1TAQA 2V8KA 3SB2A 3SQ1A 3QQAA 2XSDC 1M3HA 3HO1A 2QGFB 1N36K 4JI7K 1BL3A 1X2NA 3A5OC 5FU7C 2KPMA 1KU7A 1ZC6A 2BUPA 2E3HA 3BP8A 2ZJQL 1ACMB 3SJMA 1QZZA 4B4CA 1Q7YC 3EE9A 4Q5SF 1K8KB 4OPKA 5CE3A 1WKMA 1AEYA 1B9FA 3UKUA 2FOWA 3RKWA 5CKHA 2LCSA 1MA9B 2DFHA 1ASUA 3TTFA 2GTJA 2OZSA 2FNPA 2YU9J 1U47A 1ULYA 5HROA 2V8IA 4AI5A 2GZWA 4OWRB 4JX5A 4HA8A 4RTFD 4I9LA 3IV5A 2VYTA 1C6VX 1WQ2A 2P9KA 1JO8A 2Z1DA 5DM7L 1IRGA 3A2KA 1GDTA 3X26B 3O9QA 1MHNA 1IH7A 1G3TA 3ZXSA 3PX6A 1XMKA 3FMSA 1G99A 4X64K 4PFOA 5EEHA 3RJPA 1YJNN 1BC7C 2WA0A 3UR3C 3ZP5A 4BRGA 1TWCJ 2DTUA 4NXMK 1NTCA 3A8HB 2O7OA 4PIIA 2DVJA 3IHUA 3M8EA 3TAEA 1YRNA 3PVLA 5LBQA 3CPEA 4CJPA 5EC7A 5B3SH 1NMDA 3MEXA 4FLXA 4ON0A 2LYCA 4UXNA 2XC7A 1SHFA 1RAIB 5KPZA 4EW0A 4E3SA 5GAN3 4JKGB 2JT1A 1VQ9I 2DXBA 3CWUA 4BKXA 3VMFB 4I98B 2B63J 1HC8A 2DEQA 3FZHA 1OJLA 5J39A 3T69A 4LH4A 3CF5L 3O9TA 2Y69H 3JRCA 3CCRA 3ROUA 5LRRA 1MGQA 5LL6S 3LZJA 1EO1A 1UHMA 4XU2A 4ELUA 1ZSZB 4CRIA 4JJDA 4QQ6A 2QTVA 3BR1A 1RUOA 5D5VB 1UAAA 4QPOA 2DE0X 3QFUA 3T3FA 3CMAI 1LB2A 3EG1A 1V54H 4OB1B 5LJ3f 1YI2T 4JJNK 4HQEA 2Z1GA 3VQ6A 3I59B 2DD4A 4IEEA 3IKTA 3AVCA 3MEGA 2IBDA 5AZIA 3RQIA 1T98A 2V7ZA 3K10A 3UKUB 2KGTA 5HRPA 4YFKF 1JUPA 1RAEB 2PBIA 2XGXA 2HTJA 4FJXA 5JICA 4NDLA 2HZDA 5CJ9A 4B21A 5GAMf 2NAZA 4CIGA 4B3MK 4HXJA 2R7DA 1NG2A 3AT1B 4AD9A 3ULDA 3DP7A 1VYTA 2IVMA 4C8OA 4ASNA 3GZ5A 4AHCA 1FBUA 2DN0A 1YQLA 4FOIA 1WJ5A 3DLEA 4J8FA 1U78A 3AKZA 1L3TA 1YJ9T 1VFCA 1PC0A 2GFUA 1RAHB 1QHAA 4M78D 1RFQA 2CH0A 4K42A 2X1CA 1WI9A 1OVQA 4BWJA 2XPUA 1AZGB 3AVAA 1MUDA 1YAGA 1I1GA 2L9SA 3D1NI 3SAHA 1FXXA 4UOBA 1WSUA 3H08A 3VOVA 1OQYA 3Q3SA 3IHOA 3V9XA 3DLKA 3SV3A 3OYJA 4XBFA 2ZO4A 2PFUA 3MAQA 2DDAA 4A5MA 1R1VA 4WYBA 4LSNA 3Q0WA 2VG6A 2ZCFB 3T1HK 4D8KA 1K73C 1W4SA 1UGRB 4NO7A 1X58A 1UAXA 2RE2A 1D8KA 3X25B 2BBYA 5ILVA 3RCOA 1WJDA 1GCQC 3M4OJ 3AVBA 5GAGJ 5AFUH 4DU4A 3JRHA 4BDYA 4FW1A 3FHNA 3H5NA 3WTWC 1SL1A 4PL6A 3M58A 1JUMA 1X3WB 4DTRA 3SFIA 3M4GA 1Y8RB 2JMCA 2LC4A 2P5LC 5AQNA 3KTUA 3CPWA 3BQYA 4M7AG 3MKYB 1OCRH 2GNCA 3EFOA 2P9NB 3R60A 3ZMDA 3GTPJ 2ROLA 1T08B 3ISPA 4A62A 4HVWA 4C8QC 5EG2A 5D6YA 3CC2I 2O6GE 5DEQA 4IDKA 3SUQA 2NOJB 4DLGA 2ZPEB 2CUJA 4C92F 3QYEA 2YNIA 4LN2A 1X1CA 3NF6A 4M6XA 2GQQA 4OIQF 1QVGM 5HBMA 3KD1E 2MD5A 5D4RA 4AYBA 2DFIA 3FHZA 3JB9I 3RWUA 4UNFA 2BW3A 2GA2A 1MUYA 3RESA 2ID6A 4XR6A 1DTQA 4KT0E 1PUFA 2OTLT 4J01A 3LALA 3OOUA 2ZPIB 1W7PA 5FKNA 4F9OA 5IOYA 5C25A 3OYCA 4WCGA 3A01B 1O3SA 4YPHA 1WJCA 3R9PA 4FX4A 3UKRB 2HXOA 3SHFA 2NUTB 2OTJN 3LA2A 4Q0BA 4EDUA 2YLCA 4MTDA 2LMDA 4YPRA 3S1NJ 3TOBA 4L5EA 3CJ7A 2DERA 4M3EA 1MPGA 3PV8A 1LVKA 4R0KA 3CMEA 3FXMA 5GJVB 4GVMA 1HU0A 4E9HA 3F72A 4EIKA 3D7SB 1WN7A 2LJ1A 4B9NA 4PKHA 3BR2A 2LKXA 2PVDB 1O75A 2BXZA 1BA0A 4EJVA 4ILHA 4L3QA 3ZSWA 1ZR2A 4HSRA 1VQ8A 1TWAJ 3I55I 2V6CA 3WXKA 5JLWA 3PQJA 3BPVA 1Y6IA 3MX5A 2YXYA 4IFEA 3J7YP 2ZXHA 2E2PA 3GE1A 1JXMA 1JUSA 3DTKA 1YO5C 4M74A 4M75A 1VQ6Q 5LRSA 3TANA 4FJLA 1NJWA 3N5BB 4OGCA 3CFPA 4KA4A 1W2BP 3SLCA 3GFLA 2IS6A 1VSKA 1STZA 5E18F 1SANA 3C94A 3TKYA 1ETXA 5D5UB 1CSKA 3CJ1A 4RWTA 2KDZA 2V79A 3VQBA 4A63B 2E3IA 1YJWT 4XKCA 5GTIC 3ONQA 5GIOA 2P5OA 3FIFA 2B6AA 2XV4S 1TWFJ 1R0BG 3WUHA 4A59A 2XAGA 3ULEB 2Y75A 2X9HA 1QVFP 3D0PA 2EJ9A 2Q8KA 1G4DA 3JAME 5D8LB 4HUEA 1KQJA 2W03A 3SZGA 2NRTA 4Y0WA 3MKZA 4CEFA 1ETKA 2VWKA 3QZ5B 2DT5A 1PM3A 1NGEA 4M78B 3LSPA 2ZPFB 2KQRA 4KRFA 3CWTA 3B6CA 2Y48A 4BXFA 2ETJA 3G4ST 1TWHJ 3DFGA 1BGXT 3E9FA 4HLYA 4G7ZF 4PNOA 3CCSQ 2NS8A 2W10A 2DPNA 2QXLA 2SRCA 4PJOA 4O5VA 1RKTA 3G1OA 2V51B 5KVRA 2HQNA 3KP7A 4E6KG 4FX0A 3HOSA 1XPXA 2HEOA 4AM6A 2TCTA 4ZGEB 1PUFB 4DBRA 4J9BA 1K78A 3BGRA 3W6KB 3JCMW 4HUFA 4HUGA 3V1RA 3QRFF 4JZ3A 1G2HA 2EBIA 4QVCA 4U67L 5IOZA 2H09A 4OP0A 4FLZA 4E7JA 2DFUA 3H9JA 2DT6A 1YQMA 3ZR8X 1ASVA 2AA4A 4B08A 4YOWA 4DV6K 4Y15A 1D3YA 1HYVA 1D9DA 4DQPA 1IXSB 4BR4A 1OI1A 4KTZA 1QS4A 1W7PD 3E5XA 5TRDA 3JB9G 1IBMK 4IDHA 3DMJA 3AAFA 1RT7A 1TUCA 3R6MA 2LT1A 3BJAA 3QDKA 4HWIA 4BBSJ 2VKDA 4JAXA 1RLQC 2PMZA 1OOTA 4ZYHA 3M9AA 4PJ0C 2NUPA 4FM4B 3SMSA 3T1BA 1MGTA 1WCMJ 4B9MA 1TL3A 2F8SA 4OAYA 3I64A 4JKHA 2KT0A 2M1HA 1N3AA 3H0FA 1FX7A 5DY9A 1VQ9Q 2LQKA 2NXNB 2OV7A 3H3NO 3HSCA 4B3SK 5D6FA 2JWKA 3CC4I 1XTDA 1BIAA 2JNGA 2DYRH 1AVZC 4FPBA 2ACJA 1FTTA 3QNOA 2E34A 2PJPA 3DKXA 4II1A 4GV3A 1ENHA 4DS5A 3KCCA 1J5OA 3RDVA 1Q18A 5IP6A 3JB9J 2ICWG 1P90A 2PJRA 3QBYA 2LVMA 3SHWA 1QVGA 3AVGA 3WGIA 4Z4HA 1ZK8A 1MWKA 2UXCK 1LNWA 5LLQA 2CQNA 3GOXA 4A3JJ 1QKXA 3FMRA 3CXCM 2VWJA 4NQWB 1D4XA 2MWPA 3HSEA 2DPPB 3F22A 1YBYA 3TQ7P 3FXJA 1KG1A 1VQ5Q 1B9MA 1IKYA 3LQRA 4CEAA 2NVXJ 3VGMA 3KE2A 5KQ8A 2DJQA 3FRNA 4C8QA 5AQJA 2FBYA 4IVNA 5IHKA 4B3AA 4C8QF 2WV0A 4HQMA 2K9GA 2O8XA 2X0LA 2FBTA 1VQ7A 4AF1A 3JSMA 2H94A 3HXLA 3N05A 1KXPA 1S6LA 1N9SA 3EH2A 3CC4T 3RKXA 1BBYA 3CQYA 3GVAA 3ZSOA 2P5KA 4E47A 3KX2A 1ON1A 4KH0B 2E1HA 2F5KA 4WXHA 4G6TB 1ZREA 2PNIA 4DF4A 1OMIA 2LDUA 3S6WA 2CFOA 3I4MJ 4Z2YA 2Z1JA 4UUTA 2PEXA 2O8DB 3HRGA 2NOGA 2KZZA 1TH7A 5DM6L 3RSNA 1NNEA 4KIFA 2QSFX 1FBSA 4IF4A 2OQRA 4CZJA 3URGA 2R7ZJ 1LMZA 1KD1U 2P7CB 2E19A 2EFQA 5BR9A 3WXIA 2XVCA 1KD1O 4MTEA 3KLIA 3NH0A 3QHSA 3K70C 2VC8A 3EG3A 1XCVA 4M3RA 4BJ6C 5J4YA 2CP6A 1GT0C 3LQQA 4IWVA 2UUZA 1H3ZA 1FTZA 2W04A 4CO8A 5ELZA 3RBBB 1GCPA 3E7LA 4A4HA 4HF2A 3NE6A 1SEUA 1WH5A 2YHYA 1USSA 1WJSA 3MN7A 4YNQA 2JG6A 1W0UA 4M78C 3LM9A 2WY8Q 2HQAA 1W0HA 4JS5A 1TK0A 4JYAK 5C44J 2WTUA 3PO5A 1B9DA 2I5WA 4BRQA 3QSUA 4FJ7A 2V8JA 3MXJA 5I9EB 3VS1A 4YDUA 4D1QA 1UECA 1DT9A 3ZT0A 3I56I 5CQXA 3RTRA 4Z4IA 4A3LJ 2COYA 4MZTA 5K5RA 2OI3A 3PNVA 4L9TA 4MO5A 5GAOr 2VJIA 4M71A 1WPYA 1R77A 2CDTA 4C0FA 2XF5A 4D7NA 3G71N 3IAS2 5ADXA 1OYXA 1VQNA 3FC3A 1VQNI 2ESHA 1VQ4A 1R1TA 2VL8A 3ZQHA 3AAQA 1SRLA 1OU8A 1HNIA 3CCMI 3O8MA 4O6JA 3WTVC 3JB9H 5C2DA 1Z6TA 4EJZA 4LFAK 1HNVA 3RTVA 1SC7A 3DEEA 2YRDA 2FJ1A 3E9LA 1N32K 3C0CA 3RYRA 2FHDA 3BT9A 4BQQA 4PK4A 3G4SN 5M5WJ 1RLPC 2DDBA 3CCRT 3S3MA 2Q2EA 3CMEQ 1A6QA 1RRJA 1VQLI 3DLLL 4KHQA 2OTLA 2FBHA 2L54A 3P5JA 1YUWA 5L3FA 3V8LA 2JMWA 2JA5J 2LVSA 2X4WA 1Z77A 1KAXA 1RT2A 5C42A 4RW7A 3RPUD 1K8AU 1W1FA 4RG8A 4XRSG 3KEQA 1OH6A 2L0KA 1WH7A 4RTZA 2V7YA 2O4GA 4GMJB 4WQ4A 1CGPA 1BJAA 3EUKL 3JSCA 3KKRA 2ZSHB 4E7ZA 4C2TA 3SDBA 2ABLA 2X4XA 4FYVB 4ZYGA 2XHIA 1K8AR 3QBXA 2VWBA 1M5Q1 1FWZA 3H1VX 1LEBA 2DTHA 2RMOA 4OIPF 2X4YA 2X48A 3HHHA 3W0LA 1QE1A 3O1BA 2A6EF 2HYGD 1YHQN 2Y4YA 1SAUA 5D7UA 4ITVA 4M3GA 3QINA 2XI9A 4DTPA 1QQMA 4FM1A 4D9JA 4ZDPA 3PIOF 3IKVA 1NGDA 5CPRB 2QWQA 4DMNA 5GAN2 4BDZA 3OV8A 3NDKA 4F3TA 3THKA 4DK9A 4CF2A 1VQMT 1YJ9A 4CHOA 2IS2A 3BDUA 2PUKB 3I3LA 4LG0A 5GINA 3I55A 5GAN8 4P9UA 1LDJA 4A3BJ 3TW7A 1KVBA 1YJWA 1JBMA 2VUMJ 1D8YA 3KLOA 1QPMA 4G7OF 4WE1A 2R7OA 5LEJA 1TQIA 1WI7A 4M3WA 5KQDA 4X34A 2F4OB 3V7CA 2CH4W 2JHJA 3VTIA 1JGGA 4FK4A 1F5TA 5FWBA 4BREA 3THXB 2HU9A 3GMEA 3IQLA 3SFMA 3R2XC 3GW2A 2E6NA 4RTUA 4AHTA 4WTOB 1A36A 3RR8A 1UUEA 3C2GA 2GQIA 3UA7A 1Q7YU 3LL3A 2K6DA 3I8BA 1BIZA 3JCMV 1PG5B 1MMAA 2P9LA 5M1FA 1NK2P 4DNCA 2NNNA 3VRZA 5AQPA 3ZYYX 1ATSA 2HNZA 4UC4A 2XPVA 2IGOA 3L2RA 2VVKA 4D8DA 1BA5A 4RGRA 1HUXA 6PAXA 3FISA 4HTUA 2XAUA 4XOPA 2DCEA 2L89A 1B72B 2P9IB 3CCMN 1QHTA 1J54A 4B1XB 3VN5A 1S1VA 4FJMA 2RPNA 4DIQA 2RO0A 3DI6A 4C5EA 4QIWN 4H4KC 5GPAA 1KA8A 1YVNA 1SKSA 3CO6C 1K7AA 4B1WB 2DL7A 4OMYA 4DTSA 1I6XA 4FWNA 4H0YB 2KZMA 4XH4A 4CYDA 4WK8F 1NK7A 4EJOA 1OQKA 3C7NB 1TKTA 1K6OA 4A3GJ 4P96A 1P7IA 3EAEA 4ZYEA 5KYYA 4IUPA 4OJRA 3K4LA 2IVOA 1VQPT 1VQKA 2AXTC 2EGAA 4XQFA 2D9TA 5KYUB 4MQ3A 2RDPA 1S29A 3W6JB 4YTLA 4CCOA 1IXDA 5FDLA 3UT1A 3I0SA 2R92J 3RMAA 4E7HA 1CKBA 3KP6A 4Q47A 4E89A 3GL1A 1Z3XA 3I56N 2O03A 3WTUC 5LJ3g 4KYWA 2G0EA 4XONA 1YJ9I 2KXDA 3Q9VA 1Y8QB 2K9QA 4JKBA 2AZSA 3G6EN 1G3WA 3QEXA 4N9HA 3U3GA 1IB8A 2EB7A 5M9OA 1RILA 1MBKA 3X2QH 2JA6J 1IAWA 3NMUA 3ME9A 5E79C 3K2ZA 1BI3A 3ZT3A 3FXOA 8AT1B 3L3VA 3ZX2A 3CPWM 1GHCA 2E70A 3GZNB 1HSJA 1TT5B 3H3UA 1ORPA 3L6QA 2DVEA 1NGFA 4CGIA 2ZPGB 2GBYA 4U0VA 1IN5A 4N9IA 4KGVB 3C2HA 3CQZJ 3LZIA 2G8KA 2DMQA 2V1QA 2BW3B 4DW6A 2QWPA 3VQCA 2KZGA 1RI7A 2RN2A 1S72I 4HCCA 3HTRA 5E3MA 2EILH 5AN4A 3K6GA 4KH1B 2JA2A 3DWLE 3SNNA 4MMKA 2DEUA 1YI2I 5KYWB 3FMQA 1RAGB 3OW2M 1RTHA 4HVUA 3OH9A 3QWYA 1SD6A 5GAEP 1X2QA 2HHWA 3FJPA 3VQ8A 1RDAA 4V2FA 4FVMA 2Q2RA 2CS7A 2KEAA 3JRBA 4A4EA 5M5YJ 4JUVA 1JXSA 2YNHA 3LDPA 4AILC 5M1QA 3V7RA 5IAYA 4MDXA 1JLBA 3AFHA 4M3YA 1LUJB 1S1TA 1YI2N 2JSCA 2XPWA 3BY7A 1SFUA 1PVEA 3F3XA 3QJ6A 1ZHIA 1PCXA 1WSIA 3ITHA 1IKXA 2HOTA 5CKFA 1NJYA 4ZTJA 2XD0A 3DLRA 1TP4A 4OKKA 2PYJA 2FRWA 3O80A 5DLOA 3IFRA 4HSTA 3KK2A 3SUPA 3B6PA 1FMVA 4QS8A 3ASNH 3QPTA 2DRMA 3X24B 2P4WA 1WAFA 2H3JA 2E1CA 5CO7A 1OX9A 2TDXA 3CCQI 4BRCA 1VQKQ 1TWBA 3IH2A 4FO0A 2DO3A 3K0LA 1S22A 4CCMA 1MH4A 1WVRA 4PCQA 4JI8K 3F8BA 5FW9A 2XG8D 2IGNA 2YT6A 3KWGA 2EFWA 1Q81O 2JS2A 2FF4A 5AZJA 2HMIA 3HL8A 2HF3A 4EA5A 2LDMA 1HF0A 3ZSVA 3BG9A 4WCIA 1ZG3A 3BDLA 1MNEA 1UHSA 4XLPF 5DK5A 4ESJA 2BOLA 2VQGA 2XB5A 2GQVA 5HVQC 4BR7A 4J9FA 1FT9A 5BOXA 2W48A 4CHYA 4XM3A 5KPTA 4AHVA 2W41A 4JRKA 1KJWA 4CEQA 1K8AC 1SG5A 2MD0A 3I56Q 4OKJA 3QETA 1NKBA 2VCPA 2WSFE 1ZLMA 1ZYRF 5FB2A 3D45A 2KQ2A 2L9NA 3MAJA 4AIDA 2VG7A 1VQ9N 3OSVA 5KI6A 2BGCA 2DF6A 2M8GX 3CMAN 3I0XA 5SWMA 1KG2A 2QQRA 3BG5A 3E19A 3KLEA 3IDHA 4KAZA 3A8LB 3S41A 3DPUA 1JLAA 4XTZA 3G4SI 2PI0A 4M77A 3OYHA 2VQFK 2DQRA 3CCVI 3LAMA 1XGSA 3OA9A 2AIRB 4F55A 2YWWA 3OBWA 3G0QA 3BUZB 4GDFA 1IF1A 2FA5A 2MW8A 2G8VA 1J53A 3AG3H 1KU2A 1TNSA 2XAFA 5IH2A 1PRLC 1Q86U 1K9MR 1XHXA 3S32A 4P5OA 2HMAA 1VOMA 1BHLA 2LD5A 1REVA 4FJ5A 1J0RA 4F17A 2GWJA 2PQWA 3VERA 4FLVA 2O8EA 4XORA 2WBMA 3QFPA 1ZA2B 4KGXB 4L5GA 3CCYA 2DMUA 5EY4A 1K73U 4JLGA 2G8UA 4B9VA 2MIOA 2XRNA 2L4MA 4M75G 1YHQQ 3P7NA 4XKBA 4FXDA 3ZT4A 3LSTA 3JRAA 4FWSA 1KIKA 1FMWA 2L7FP 3EGDB 4ZH4F 3R6NA 3CCLI 2XY5A 5E1ZB 1K4TA 1HBXG 4DEXA 4RAYA 2NZTA 4DJAA 1D0YA 2DY4A 2YX7A 3NQOA 4OVAA 1MWMA 5DMRA 3M0UA 1VIFA 1BC8C 2K86A 5TJJA 2QWLA 4IFVA 2JS0A 2DFEA 4C3HJ 1WYXA 2RHZA 2KHOA 1VQMQ 4HVJA 4LOCA 5LJWA 1T8IA 2MC4A 4WXCA 5BRFA 3AGKA 1UOCA 1T95A 2G7HA 5LJ5f 5KCHA 3VPRA 1U2VA 5M1KA 2R7VA 2IA2A 1E4GT 3MP8A 5FLMJ 3K5LA 5F1JA 1TKXA 1OH7A 1T3LA 1KCFA 4DTJA 3DB4A 1BU6O 5FKKA 3MO8A 3T0YA 1B59A 1IRFA 4FJJA 2G8HA 5F2RA 3HKSA 1JL2A 3LA7A 3D2EA 4I0AA 2STWA 2DU9A 4XSXF 2LCLA 1Z05A 2LZ6B 1KVAA 3F5TA 4C0DC 1JJ2S 2VC0A 4CFCA 4I2QA 2ZCWA 1LE8B 2QEXA 2R3SA 4L8RB 1OH8A 1DLOA 4HDVA 5GANh 2XGEA 3EG2A 2DK5A 3LOCA 3LW5E 3BTCA 3Q0VA 5CY4A 2UWMA 2YKMA 5BMZA 1WXBA 1DGWY 5TISC 5LGNA 4ZHRA 4A3MJ 3QODA 5GADJ 1SD4A 5JHUA 2OFKA 2ZB9A 5EX5A 2VQEK 2I5UA 2OPTA 3L2WA 4LLNA 4JLIA 4N4OB 3PLAA 3TMOA 3OYMA 4DV4K 2RK2A 2DTRA 3CP2A 1PJRA 3TGNA 2GFAA 1QHHD 1X43A 2NLXA 2PZSA 2IVNA 2ZJRL 5AIQA 5T7BA 4NC8A 2O8EB 2IXSA 2IS4A 1UHCA 2KE9A 3CCSN 3SBTA 5C6SA 1N3CA 1FC3A 4XSZF 1A5JA 2ASPA 4BJ5C 2ECBA 4B3TK 3SI6A 2B86A 1YHQI 3OQ5A 2M7BA 3G4SA 4C8NA 4FZYA 4BY7J 2VE9A 2ZKZA 1GLDG 3JCMh 3O8VA 1RTJA 2KY9A 1O3QA 1IN8A 3F2KA 4EMSA 1T44A 1VQ7Q 2ZNYA 3MZYA 4L5JA 5A0GA 3CC7I 2JOYA 1TUYA 5KYXA 5IPAA 4BJTA 2VLAA 1YITA 3NTIA 3HSFA 1F21A 1YJNT 3LWIA 4BHBA 3AARA 1C0FA 2X6SA 3MHXA 1B7TA 3ZL7C 2YHWA 4CBUA 3DV8A 5AQYA 4IRIA 2X35A 4B24A 2ZMEA 3D0SA 5E1WA 1YE9A 3CD6I 3LP1A 5J3LA 4PLLA 5AT1B 5BREA 4IHTA 4BRPA 1VRTA 5B8HA 4M75C 2ED0A 2V1RA 3ESWB 3OBYA 3LGFA 2JHNA 3D4VA 2EZHA 1FSHA 1YTYA 2ED1A 3TSQA 3WVEB 4LK1F 9ANTA 3TARA 1QVGS 4EATA 1YP5A 4QAGA 1U84A 2X51A 3CCJT 2DBBA 4B22A 3CXCP 1FBQA 2HS5A 2MA3A 4B9QA 3FZVA 4DOVA 1QQCA 4JJBA 2RHXA 1HKBA 3AVIA 4RCHA 3DYAA 2Q0OA 4PUOA 3WE3A 4M63C 4EIAA 4N4HA 4M78E 1Q81R 2VXFA 3THYB 4IG0A 3VEOA 1JLFA 1VQLQ 2EFPA 3KLHA 3OSSC 3GF2A 1TOVA 2R7XA 5IP7J 4QKUA 2DA2A 2GOMA 4DYRA 3DEUA 3NH1A 2A08A 4B43A 2P6SA 4B9LA 3FZKA 3JB9D 2ZGYA 2JVGA 1FW6A 4DSLA 4C30A 2KRMA 2O8BA 2MFZA 5DLQE 3DF8A 2XDBA 4JX6A 4NB5A 3K5NA 1YX3A 1HRHA 5FJ8J 4RMOA 5I11A 3NMZC 2CP0A 5BN8A 3SWNC 3AAPA 3SYZA 4FWLA 2W42A 2E2JJ 4CJWA 1HKTA 4DF8A 2CQKA 1FYKA 1ZYQA 1X9SA 4CJSA 4MGRA 3JB9F 4MHGA 1ZBSA 1A04A 2P8TA 3BZCA 1ATRA 5FLXZ 4CZKA 2HCKA 1ON2A 1PKSA 2MLGA 5BNGA 3NWTA 1JT6A 4FJIA 2W00A 3RPUA 1QPIA 4AM3A 1LFPA 3OYGA 1VQOI 1X6OA 3CCEN 2BHYA 1TBXA 2KYMA 2D0OA 4WQ5C 1JJ2M 1JHHA 2QGUA 2EX3A 3R8EA 2BIVA 2PJRB 1NG9A 1YQKA 1S3JA 3BTIA 3KZZA 4CEEA 5M3FJ 2CH6A 3WXJA 4JRPA 3DXJF 1XG7A 2E1YA 5I3UA 2A07F 2UZKA 3OHRA 1ZG1A 5AQLA 3IL2A 2P9KB 1VSDA 2WOMA 3PSFA 2LCCA 4LLLA 2ATCB 3QU3A 4B1YB 2XKPA 2M5WA 4Y92A 5AR0A 4Z4EA 2D5VA 2MMPA 5EZHA 2EH3A 3IWFA 3GBTA 3CCMA 4XRFA 4BRIA 2QWMA 2QQAA 3TOAA 4A2BA 1QKWA 2XU8A 2B9SA 1X9JA 1Z67A 4LDVA 3UNGC 1GCQA 4LDUA 5IT9O 3AVKA 5D6WA 1QZ5A 1ITYA 1ACIA 3ID6A 4OLBA 2W0ZA 3J80Z 3VS4A 4CK3A 4RLFA 3OMYA 4Z4GA 1FPQA 3THYA 2Y9ZA 3VSKA 1A6IA 3SZPA 1WSEA 1IDYA 1E2XA 3C7JA 2K9NA 3TI0A 2AJQA 3M8FA 5L8RE 5HRSA 1KD1C 5FROA 2WAFA 4CZZA 5TGTA 2E5KA 2IG0A 2XDPA 3NF8A 1WEIA 1L5UA 1XD7A 3CUOA 4JPBW 4QOZB 3H0DA 3GFIA 3J7AO 3QDFA 1U45A 2FXUA 3M9QA 2EGCA 4PL8A 3K1PA 1X2KA 1ZBUA 1AU7A 1MV3A 4EAHD 3I55N 1WAJA 3O3HA 2RJDA 1AD5A 1U06A 1EWRA 5HNHA 4C92B 4MMLA 4HEA2 2RQVA 3VRYA 5L3CA 4AH9A 1SFEA 2LKSA 4X9DA 3JCMg 2GIZA 2GGRA 3NAEA 1T7PA 2D1HA 5ERIA 1IXCA 2FEIA 4A5NA 1NOYA 1HJDA 1IN6A 2Q0UA 4DSJA 5HY6A 4CHUA 5FFXA 1HPMA 4KJZA 2NS0A 1M2VA 3AO4A 2EQUA 1SZ2A 1YHQA 1X3MA 1DDNA 5HL7L 3NCIA 1REPC 4RW4A 3BY6A 4FM0A 5E41A 5LMUK 4K8XA 3JRDA 4PUSA 1Z3YA 5ECAA 2EPDA 2DT7B 4I99C 1NK5A 2KSSA 5H2FC 3KYLA 1YJWQ 1KU3A 2CG4A 2IS1A 1U9NA 4CEBA 2VN2A 3OVNA 1X01A 2D0NA 3QU6A 4FE4A 2H6BA 4HTLA 1FMKA 4M7DC 2KISA 4GCVA 4H0TB 4M7AD 3M53A 2DXIA 4XLEA 1K73R 4ORZA 3JTGA 1JKOC 4KBOA 3J7ZI 2QK0A 2DL4A 2R5ZA 2C0TA 1M90C 5CYMA 3FSPA 4K41A 4DB3A 5HNFA 2DETA 3JRIA 1CF7A 3KXTA 2BHZA 3ZEUA 3HKZN 4JX4A 1K0XA 5FD6A 3TTCA 4O3MA 3U6FA 4XN3A 3O9UA 2HW3A 5F27A 1S5JA 3DXMB 4Z88A 3LSKA 2FL7A 3CC2N 4JI1K 2VJJA 4WCEL 2JXBA 3H1QA 2OF7A 2PQ8A 3MWPA 2DM1A 2DKGA 4FL9A 1O9SA 2KXCA 1QSLA 4U88A 4Y52J 2PUOB 2R7UA 2RHUA 4CJ4A 1O1WA 4H8KA 4M7DB 3OR2C 2JTFA 2LNVA 2ZFUA 1WGSA 4KN4X 3V4IA 1EV7A 4WF2A 1KU9A 1ZR4A 4I01A 5BPDA 3N4QA 5HRRA 1RT5A 5H6QA 5AQFA 1YS6A 5CVUA 4AWXB 3DRPA 2F48A 4HT9A 1ZUUA 1T2KA 1PWTA 2OTLQ 2P9UB 3CMEN 5AIPA 4MO7A 3ZQQA 3VS5A 1VQ4I 4Y13A 3L2UA 4LF8K 2RA2A 1B8IA 3AG1H 1V1CA 4PQUA 2C6YA 3AVFA 3ABKH 1MUNA 3TU5A 1ZUKA 2P9PA 3MMYB 1FP1D 5E17F 3BZKA 2L7MP 1EH7A 4HHTA 1QRYA 4CJ7A 2GOXB 1ZTRA 2RQRA 2CV0A 1KO9A 2K85A 3CCRI 1KHCA 1QMCA 3TDUC 1RNHA 5AQXA 2O5RA 4OB2B 1OKRA 1EJ9A 3EL2A 3A0HC 3A5MC 4C8QE 4KIGA 3THWB 3FBIB 3CD6A 3TAMA 1FKOA 4BY9C 1X1DA 1LWYA 3FLGA 4ENKA 4BY6C 1QNTA 4HW0A 2RH2A 4XOTA 2ZSIB 1PVSA 4RAGA 3AVNA 4QLCU 1BOBA 1NJIU 1QBJA 2F2EA 1IG7A 3FKJA 5D4SA 3NBPA 3HOTA 1NYGA 1J2XA 3M54A 4DA4A 4J7IA 2CQQA 2LJ3A 2PN6A 1KQ2A 1NPRA 3QAHA 1VQ4Q 3GO5A 4HX4A 4CC4B 1F1BB 3VQ4A 1MZBA 2DODA 4YOXA 4UVAA 2WAQA 3M07A 1VAZA 1R8OB 1GOBA 4R5PA 1HD3A 4XL9A 3BE3A 1VQ8T 1WQ7A 4JRQA 2GWRA 3DBRB 1FP2A 2KRFA 3CCQN 5LJ5g 1S9HA 2HZTA 4JZ4A 5KH6A 1QQOA 2IPQX 3BW1A 3GG4A 2DA7A 2NVUB 1WB9A 1GVJA 3T9NA 2J4RA 1XC5A 4QS7A 4WQ4C 2P9LB 4GO1A 5D5XB 2FUG2 2VKNA 4U87A 4HCBA 3TO7A 1E4FT 4M41A 1SPKA 3CCJA 3H0HA 4X1EA 3N4PA 1LDDA 4RB1A 4MO4A 5IYBJ 1JKQC 2XK0A 1T8EA 2VXEA 2P9IA 1YW9A 4CXFA 1ATNA 4B9WA 3SMPA 2E7XA 2F8TA 1QVGP 1DU0A 2DBKA 1R36A 3OIPA 4ICLA 3FK7A 4A61A 4M6VA 3VDXA 1HKCA 3P8DA 4LC9B 4CGJA 3PUBA 3HVTA 1F1ZA 1GVDA 1S6QA 4EMHA 2V1UA 3TQNA 4KNYA 2JUFA 4JKGA 4PJOG 3LPTA 2FSNA 5EF6A 1UWBA 1ZLKA 4C3JJ 3VYUB 1NKUA 2LSOA 4OAZA 1M3QA 4KHUA 3J7AP 2P9PB 3WU0A 2H8RA 4HT8A 2Q1ZB 3CCEI 4XIDA 5GANf 2HMPA 4O8UA 1IKWA 3S1MJ 4A2AA 2BANA 1ZSZA 2EIFA 3GYHX 3IH4A 4HNTA 5F1RA 4CZCA 3MZ8A 2HNYA 1A5VA 4W5RA 2C0IA 4G9YA 4M7AF 2CUEA 1WEGA 4F93B 1KONA 1NJIC 2B4JA 1N6QA 2R58A 3CMMA 1QP2A 2QAZA 1KC8O 2KJBA 4E1NA 2ECCA 4IEJA 2CW0F 1LCKA 1C0UA 2O31A 3R3LA 2XIDA 1DP7P 1UGPB 2I2LA 4KIBA 2RQWA 1P4WA 4W1UA 1AWXA 2QZ8A 1SV5A 1MSEC 3RI4A 5GP9A 1NKCA 1QCOA 3QIIA 3EO3A 4OMMA 3CD6N 1SEMA 5ED4A 5ICEA 4A54A 3PIOA 5FWCA 2E64A 4A53A 2R7YA 3FGUA 1ARKA 2PZ1A 1YYVA 2AXLA 2XROA 4A4GA 2IPOB 3HGYA 4EA4A 4KICA 2KRCA 1WHGA 1HX1A 1I07A 4LLGF 2QG9B 2A28A 2VQLA 5GMKh 3O9RA 2MI6A 3M5AA 3S6IA 4ISFA 2M3AA 4YFNF 1OZ2A 3SPYA 5C0YA 5EG0B 3O8HA 1NMNA 4XEIA 2HPMA 1R49A 2E10A 3ENBA 1IN4A 4OKEA 4ZZDA 5FD5A 4O55A 1BW5A 4KHPK 1Y96A 1KSPA 1WLPB 3CYMA 4XK8E 1VQPQ 1H1VA 3QUIA 3KPHA 1BCMA 2HHUA 3EGXB 5LJVA 2Z5UA 3O4NA 4KB0A 4A5AA 2CZ1B 2WC2A 5LD2C 4AFUC 3P39A 1YCSB 1QTMA 5CLSA 4A3EJ 5GAOp 4MEYF 1VQKI 4BI3A 4LD6A 1NE8A 5D5WB 4G6QA 2Y1IA 3F8NA 1UB9A 2W6KA 1VQOA 2KRHA 2XICA 1FKPA 2F5TX 1HSTA 3HUGA 4ABZA 3OYEA 4J9GA 3OWTA 2M02A 4XQ3A 4Y17A 4GGGA 2LP0A 1GL5A 1Q9XA 4EM0B 2C0OA 1HPZA 2R7QA 3WTXC 1X1AA 3J81K 3OYBA 2RNJA 3TO6A 1PD0A 2EZLA 1GFDA 3S2DJ 2EJFA 3ASKA 3EDPA 3H1CA 1BR1A 2MC3A 2FPFA 5J40A 2HHTA 3KLNA 2EV6A 4B3OA 3CD6Q 2JPSA 3H3OB 1YITQ 1JCGA 3H6ZA 4I02A 2RD1A 5GMKj 4NQWA 3MK6A 4JS4A 2HQ5A 4BC4A 2BH1A 1B34B 4RGUA 2QLZA 4CEOA 4YELA 2E20A 4BQLA 4JBAA 4FJNA 1M1GA 1JLEA 3ABMH 1BI2A 4RS8A 1W7AA 2AK5A 2CP7A 1VQLN 1XQOA 1H92A 3MXMA 4HDUA 2XAQA 3RKYA 4IPAA 3VUZA 3DWLA 3EZWA 3BWGA 4XMYA 2BUDA 2FSJA 3BR6A 3CCQT 1V29B 3HSTB 2IGKA 5DUKA 3J80O 2V4JC 1XCBA 4M3XA 2OTJA 4CE9A 2A42A 4BR0A 1YJWI 3A01A 1HNZK 1HOMA 1NG6A 3WU2C 2GELA 4AHRA 1B4AA 1RKWA 3R61A 4RB3C 3ZQCA 4L6V5 2QDYB 1RUNA 5C12A 1HKQA 3TREA 3CC2Q 2WTEA 3CVTA 1OYWA 1BA1A 3H0GJ 2OC6A 2Z3YA 3L0QA 2ZM6K 4ZGDB 4OMLA 2HVQA 2QTDA 1J3TA 3SEZA 1TUUA 1ZH5A 2GF7A 4Z6YA 3VYSB 1BUPA 4CC2A 1HMVA 4LITA 3AY9A 1BWFO 5FRMA 2ESNA 2LG4A 4DSKA 2FQ3A 4IOAL 1QVTA 1ERDA 1Y71A 4BR9A 3A5LC 1GBRA 3S3NA 2IDOA 3MPUB 1RDUA 5H20A 2JTEA 3SUNA 3HB9A 3A8YA 3CDHA 2PTKA 3A5ZB 4BR5A 2WBNA 1K73O 1Z9QA 2YUQA 5AQUA 1OYYA 4GFBA 5JLFA 2PX9A 1S72A 3ZQFA 3CCLQ 2O4XA 7AT1B 3CMET 5BR8K 5LHHA 3S1RJ 3OYNA 1HKGA 1NBEB 4M72A 3CCVA 1HW5A 3GBGA 2LFBA 1JJ2A 4LY7A 5KPRA 2HHQA 2NVQJ 3DEWA 4BUPA 4DHYA 3DU5A 3DPLC 4J6WA 3HC7A 4DR4K 2WUSA 2BZXA 2M2EA 3SUOA 4MLOA 1GOAA 2OPQA 4JI0K 2W24A 3KK1A 4LIUA 1LNXA 2F9TA 3FXQA 2VGNA 4WF9L 4FT2A 1BU1A 4MZPA 2ZAEA 3VQPA 3OYAA 2NNYA 1EIFA 2O0YA 4L0ZB 1S72Q 1IW7F 2OPSA 3KEOA 3A1YA 4AUXA 3MEEA 1MBJA 2RQQA 5L3EA 4BGAA 2F2VA 2VG5A 3C95A 3CC2T 1BI0A 5E84A 4OU0A 1NK0A 4IUQA 3D2EB 4LUEA 2VASA 2ZPBB 1D5VA 5JLHA 3TSUA 3F73A 3NEUA 1O3RA 4PSWA 1PD1A 3VEYA 4E9GA 5GAMe 2F4VK 3HDDA 2QKBA 2DOEA 4AC0A 4I7HA 4HX8A 2ZZDA 4B1UB 1WSHA 2D8JA 1TL8A 1U1TA 3H8ZA 5J1EA 3NVKA 3CPWP 4W5QA 4LDWA 4LNPA 3CZ6A 1ESVA 4GNIA 1NWKA 2M30A 2F5DA 1R59O 3ECOA 1IJWC 4QVZA 4NBQA 3HG9A 2D5RA 1P59A 2VIXA 2R5YA 4B8AB 4FJ9A 3JCMc 2RI2A 2HDAA 3FZMA 4G8XA 2V1DA 1W2BA 2NWMA 4CZGA 3I5UA 1WEFA 4JI6K 3LAKA 1NG7A 3MX2A 3CCUQ 3PQKA 2RHIA 3J7AY 1ZA1B 2DILA 1NH3A 4N56A 3K2AA 2BY3A 4IUTA 1UELB 2NLUA 4KT5C 5ILUA 2EQKA 1J9IA 1BBZA 1HSQA 2NRVA 2LK2A 3A02A 2DAQA 3VKIA 2HBLA 1M1KO 2F7TA 4W5TA 5KE3A 4V2SA 3F8CA 2UUBK 4JJCA 3T7ZA 4XKWA 1HDDC 4DBFA 3KK7A 2O8FA 1XSXA 2IP2A 5F0FA 2NOEA 2RV8A