4BE2A

Pfv intasome with inhibitor xz-259
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be2A03
1BCMA 4PA1A 5FRNA 4BDPA 3MP8A 4FJ9A 3C6UA 3VQAA 3RTVA 1NK0A 1NK6A 4FJ5A 3S9HA 4IBNA 3AVIA 4FLXA 3QJ6A 2X4XA 3O4QA 5J26A 3NH2A 3DM2A 3SQ0A 4CJ4A 3LPUA 3M8RA 1KSPA 3MEEA 4CGHA 4MFBA 4CECA 4O44A 1RBRA 3RWUA 4ID1A 2RI3A 4I2PA 3ZSRA 2E6LA 3AVMA 3MXJA 4CJTA 5KI6A 1J53A 5C25A 3OYBA 3RMDA 3DLBA 4KAZA 3KTQA 4K8XA 4IDKA 4LSLA 4HUGA 3K2PA 1HJRA 4B8CA 4CEOA 4UC4A 3K57A 3SPYA 3CM5A 4PQUA 1ASWA 1RTIA 1WGSA 2AJQA 4Q5WA 1NKBA 4O55A 4HUEA 1JXBA 2QXFA 4QCLA 5KE3A 4LY7A 5SZTA 4FLUA 2G8FA 4A4GA 2EQMA 2XO7A 1SKRA 1RT7A 3SV3A 2QQRA 4DTRA 2PYJA 4Z4HA 4N56A 1N6QA 4C5GA 2VWKA 3DLKA 4FJ7A 3SUOA 1EKEA 2HVIA 1CLQA 4DTJA 2Z1HA 2OPPA 2RI5A 3LDSA 2XHBA 4L8RB 2BKDN 3OA6A 1VK0A 4AH9A 2Y1JA 2RO0A 4B9VA 3NE6A 4I9QA 3OYHA 4N47A 1LW0A 1QQCA 3KLGA 1CZ9A 2XY6A 4FJMA 3OYGA 1I39A 2VG6A 2R5AA 2FC0A 3NAEA 3KLIA 2FBYA 2HNZA 4FJIA 3HVTA 1ZBFA 4CJ3A 3IRXA 1TAQA 5EU7A 4GY5A 1JLBA 3RR7A 3NGIA 1EP4A 3HT3A 2DFHA 3C4SA 4DSJA 4AHRA 2KZZA 1ZBIA 4A4HA 1Q8IA 3IS9A 3LP2A 1QSLA 3DLHA 2FBTA 4KFBA 5CZ2A 3DLMA 4LH4A 4O5BA 1VSFA 4CHQA 3UWNA 4JRPA 2DFFA 5J39A 2HVHA 1KVBA 2D0CA 4CERA 3LGFA 3FDRA 3G0ZA 5CIUA 4CGDA 4FM0A 4FK0A 4JLHA 2Z1JA 4HTUA 2M16A 3PMTA 3ZT4A 3QO9A 3WNFA 1C0MA 4KB1A 3AA2A 4FJXA 4KREA 3DI6A 3HXMA 2OA8A 4KPYA 2LDMA 4DU1A 3KJVA 4CJQA 4C5HA 1NK7A 2O4XA 1TGOA 1JLFA 4FJHA 4F4KA 1SUQA 4CJLA 4DFJA 1T05A 1U49A 1HNIA 4BWJA 3F73A 4J2BA 3AO3A 4BDYA 4CK2A 3TAFA 4DTSA 2JZ2A 3C95A 1VSKA 3VQ5A 3ME9A 1TV6A 4E1MA 4W5QA 2YRVA 3HPHA 1DTTA 1Z25A 3ALYA 4DQPA 3CYMA 4QAGA 3PV8A 2DIGA 1X9MA 1YT3A 4FLZA 3FLGA 3TAQA 3KLHA 1U47A 3DB3A 4K8ZA 1JXEA 2Q3SA 3BGRA 3VQ7A 5J1EA 3E01A 2HHSA 1NOZA 1S6PA 2PQWA 3M8PA 3VQ9A 2IDOA 4Z4EA 3MXMA 3ZSZA 2EQUA 3AVNA 1JL1A 1A5WA 2BE2A 3AO4A 5SWMA 3JSMA 3CFRA 4FZYA 3SQ1A 4E7LA 4KI6A 3VN5A 3SJJA 3ZT0A 3DLEA 3LALA 1KVCA 1KRPA 2O4XB 1WSIA 1NK9A 5KTQA 3OYKA 1HMVA 1TKDA 3PO5A 4H8KA 1A5VA 5KGWA 3NFAA 3AVAA 3MECA 4CIEA 1QSSA 2PZSA 1UOCA 4OPJA 1J54A 2P5GA 1NJYA 1EETA 1H3ZA 4Y1DA 1GOCA 1C6VA 1WSFA 3OYIA 4C5IA 3LP0A 1CZBA 1Q9XA 3Q1JA 2G3RA 3PNWC 2YV0X 4Z4CA 3K5LA 2KZMA 2HQEA 2X6SA 5JS2A 1SL0A 3T3FA 2ATQA 1RT6A 2E4LA 3VA3A 3QESA 1T03A 4C8LA 2DIQA 4CEZA 3QIPA 1HRHA 2RPIA 3LAKA 3KK3A 2RI2A 4A4FA 3OYJA 3EAEA 2EX3A 3OVNA 4B8AB 5T7BA 4XIUA 4QQGA 4HHTA 1VSIA 2HB5A 2HNYA 3S3NA 2MWOA 3NTHA 1RDAA 3PFSA 3NCIA 5DMRA 4M3TA 1VSDA 1TVRA 4OPKA 3HL8A 3AVFA 4DLGA 4H4OA 2DY4A 4E7KA 4E7IA 2R57A 3O3FA 4ELUA 1RT2A 4FK4A 1HQEA 3T1AA 1VRUA 4O4GA 1DTQA 2P1JA 4B9NA 2KFZA 3LLRA 3P8DA 2IAJA 1VSHA 3B6OA 4KHNA 1I3AA 3V9ZA 1XHZA 2EKOA 4EDUA 4O0IA 1KHCA 2ZD1A 3L2VA 1WNSA 3QINA 4CK1A 1SL2A 3HP9A 2ETJA 4KTZA 2YKMA 2BANA 5KCOA 3I0SA 5D6WA 3M8QA 4OKEA 5DK5A 4DFKA 3QKJA 1S1TA 4C8MA 3HP6A 1X9SA 3V1QA 3ASMA 4QQ6A 4E19A 4WE1A 4CGJA 2O4IA 2HMIA 2G8IA 1BI4B 1ASUA 3F9KA 2GBZA 3AO5A 1NK4A 1B92A 3OYEA 5IAYA 4W5RA 4CJEA 1QSYA 1EX4A 3OYCA 1LW2A 4IFYA 4CF0A 3KKRA 4DLEA 1KLNA 1RBSA 4OKKA 3MEDA 3DLGA 1QHTA 1S6QA 2CKKA 3LP3A 4IUTA 4NCGA 5J2MA 4CFAA 1LAWA 2PYLA 2DTUA 5JS1A 4KB0A 2L3RA 4TSXA 1IKXA 1RBVA 2IG0A 1X9WA 4IUUA 4LSNA 4JS5A 4GMJB 2E6NA 4Z4GA 3TANA 1L3UA 5D6XA 2RHYA 3EZ5A 4YNQA 4E89A 3OB9A 1C0UA 3QEVA 1D8YA 3KK2A 4FYDA 4LH5A 4DTUA 1SL1A 1B9FA 4J2EA 4N5SA 4E3SA 3TAMA 1N27A 3VQ6A 4E7JA 3MEWA 3L8BA 4DSLA 4CGIA 2X6NA 3L3UA 4FJGA 4DTOA 2RHZA 4CCHA 5HP1A 4FW2A 4GW6A 3TAEA 1S9GA 3EY1A 4F2SA 4CJKA 4FJNA 5D6YA 4FLVA 4B9TA 1RDBA 5I42A 4OKJA 2YNHA 3U6FA 2YNIA 2L8DA 3PO4A 5C0MA 3TAGA 3NTKA 2RHXA 2MWPA 1WJRA 3SD4A 4CF1A 1UAXA 3DRRA 2PY5A 5K14A 4FJKA 3QNOA 4DFMA 4QOZB 4CEEA 4A4EA 3DOKA 4CJUA 4KHSA 1U4BA 3VQ4A 2NUBA 4Y1CA 2B8AA 3QERA 3QNNA 1NK5A 4FJJA 2HHVA 1JLEA 1CXUA 1RBUA 4J2DA 4OVLA 2QKBA 2HHUA 4QVZA 2RHIA 1T7PA 2OPSA 3ZT3A 3KUFA 3SI6A 3SPZA 2P5OA 1LWFA 3OS0A 4PLIA 1C1CA 3C94A 4BE0A 1WLJA 4F3TA 3ULDA 2FBVA 1XWLA 2Y1IA 4CHNA 1BIZA 1WSGA 3D45A 3CG7A 4OGCA 4CE9A 4FZXC 3NH1A 3K5MA 3ZSXA 5HLFA 4BACA 1DLOA 1GOAA 1LWEA 3ZSVA 1NJXA 3LP1A 1ZBLA 3OMGA 3OYMA 2IOCA 4E0DA 4HCZA 3U3GA 1BQMA 3NGYA 4NCBA 5HRRA 2X4YA 3GOXA 4DSKA 4M3RA 4DWIA 3ZSOA 1KFSA 3B6PA 1FK9A 1RT5A 1IKYA 4DSEA 1RT4A 4KI4A 1J9AA 3UIQA 4B3OA 3RRGA 4DQSA 4RW8A 3MEAA 2BGGA 3THVA 4Z4FA 4NYFA 2B5JA 3V1RA 1WAJA 3NF6A 4IG3A 2HNDA 3WNEA 4CHYA 2GV9A 1ZYQA 1YVUA 5CYMA 1UA1A 5KE2A 2D0BA 4RW7A 4CJSA 3L2UA 1TK5A 3M9QA 2ITGA 3V9SA 3A2FA 2XRIA 3FFIA 4MQ3A 4H4MA 4Z4IA 2RF2A 1ZBHA 3TI0A 3KIOA 4DTXA 2NLUA 4DSIA 3VQCA 4W5OA 1U45A 5C42A 4CEQA 2HHTA 1JLGA 1KTQA 2F5KA 2HHXA 1KCFA 2EFIA 1S1UA 4Q5VA 1FKPA 3HPOA 3OS2A 1K6YA 2B4JA 1BI4A 3ZT2A 1IG9A 4N76A 3EYZA 1S9EA 3CEYA 1FXXA 4FK2A 3LAMA 4B9UA 2LSNA 4BE1A 1KFDA 1YTAA 3ZT1A 3K5NA 2YHAA 1NJZA 3V81A 2LTOA 2F96A 2WONA 3CFPA 3KK1A 4KHYA 3AVLA 3SNNA 4I2QA 1SKWA 1HQUA 3QBYA 4M3ZA 4RG8A 3S6WA 2RJCA 3L2RA 2OPRA 5E41A 3PX6A 3OYDA 1NKEA 3QEIA 1N5YA 2A1SA 5HRSA 4CFBA 3SUQA 4EP4A 2LCCA 2GUIA 3WNHA 3NGZA 3AA3A 3ZSYA 3SV4A 3DMJA 4FXDA 1BGXT 1RDCA 2G8KA 2WACA 1SSFA 4NS5A 3AVJA 3NTIA 4X34A 4AHUA 3AA5X 5KRSA 1R0AA 2EQKA 4M3YA 2IGIA 3PMIA 1RDDA 4Z02A 3HYFA 1WSJA 2D5RA 3KLFA 3PY8A 5FROA 2GF7A 2KW4A 2P51A 3AVBA 1XC9A 1NJWA 2OZSA 2KFNA 1BHLA 2X35A 4DFPA 1JLQA 1L3TA 1RT3A 2XY5A 1QS4A 3O8VA 4B9LA 1IKWA 4F3OA 4W5NA 1VSEA 2RJDA 3META 4CJFA 4DMNA 4CJVA 5D3GA 2L89A 3NHGA 3NH0A 1XNIA 1HPZA 3NDKA 2Z1GA 2FBXA 3LZJA 4DF8A 4ZTFA 1MU2A 3ZSQA 2FHDA 4E7HA 3ISNC 4B9MA 4PUOA 3LGLA 4RW9A 1QTMA 4HUFA 2ZQBA 1L5UA 2BDPA 1S1XA 2G8VA 2E6MA 3DRSA 4M3WA 3LPTA 4FZZA 4CJPA 2RJFA 3HPGA 4CHOA 4N41A 4CJRA 1A5XA 2QKKA 2KQ2A 3O3HA 2M1HA 1HYSA 1JL2A 4II1A 1RT1A 3VQ8A 4E1NA 3AO2A 3OYAA 4Q0BA 4DS5A 1SKSA 2LRQA 1Y97A 4M41A 4CK3A 3KLEA 3MEGA 4CF9A 2P0KA 1G15A 4OJRA 4CFCA 5I3UA 2GFUA 2R58A 4B9WA 4CESA 1OZ3A 4RW4A 1IO2A 3OJSA 1TL3A 3H08A 4FJ8A 4YFUA 5C6SA 1TKZA 3DOLA 4AHCA 1LAVA 3JYTA 3V9WA 3LWMA 1BL3A 3HVRA 1Q9YA 3QIIA 3F70A 1BIUA 3NNQA 3L3VA 4N4HA 3VQEA 2ZE2A 1NK8A 1D9FA 2IC3A 1HYVA 3VQBA 4ID5A 5HRPA 5J2NA 3OY9A 2JGUA 2X74A 1EXQA 4ELVA 4IUPA 3OYFA 4OVAA 2HW3A 1ASVA 4FVMA 4M45A 5CY4A 3OS1A 1W0HA 2IS3A 4ICLA 4LD0A 4CIFA 3LWLA 3D0PA 4AHTA 1QE1A 1W9HA 4CFDA 1KVAA 4PWDA 4KRFA 4ELTA 3RMCA 4DU4A 4DF4A 1B9DA 1WJQA 2GFAA 3T19A 4F2RA 3VQQA 3NF8A 4KV8A 5KCHA 2RHUA 4M42A 4FCYA 3V6DA 2XY7A 4IUQA 4O0JA 2K3YA 3I8DA 1S5JA 3SQ2A 4F8RA 2I5JA 3BDPA 4EZ6A 1VSJA 3ITHA 3VA0A 4L59A 2R7YA 4FM1A 3S3MA 1S1VA 4B9XA 1Z26A 2VWJA 4KHWA 3L2WA 3OJUA 4DTNA 3BDLA 4LD6A 3RMAA 3HO1A 1XHXA 2F8TA 3E9GA 1WN7A 3M8SA 4G1QA 3QETA 4DG1A 1U48A 4CGFA 4FM2A 4CHZA 4CF8A 1KLMA 4N4GA 2R5MA 1RILA 4RW6A 1L3SA 3AVCA 3V9XA 3S3OA 2VYTA 3LYIA 4KKOA 5CZ1A 4CJWA 4HVJA 4OLAA 1F21A 3MP6A 5KRTA 3H8ZA 2BIVA 3MO8A 2X78A 4CEBA 3UT1A 4IUVA 3LX7A 4C5EA 3NF9A 4FU6A 5FDLA 4JRQA 3V9UA 2E5QA 1O1WA 1TKTA 2RN2A 4N4IA 2RKIA 3AA4A 1REVA 4DTMA 4M3XA 3OMCA 4FW1A 4KTWA 2XK0A 3DB4A 2EHGA 1RNHA 2OYQA 4CF2A 3SZ2A 2DFEA 4FJLA 2F8SA 2JLEA 5HRNA 4DTPA 1JLCA 3C6TA 2OZMA 2M0OA 3DRPA 3WNGA 3DYAA 4HCCA 1TK8A 1YTUA 3AVKA 3MEUA 3CM6A 5HROA 1LV5A 2G8WA 2XY8A 4J2AA 4KHQA 3P8HA 2WOMA 4PLLA 3G10A 1D9DA 4JS4A 5CYQA 3IAYA 2KTQA 3FC3A 3VQDA 3SYZA 3L42A 4BE2A 1IKVA 4AILC 2G8UA 4OLBA 2Z1IA 2XDPA 3MXIA 1RTDA 1C1BA 1FKOA 1U04A 1WSEA 5IN1A 2D0AA 4IKFA 1TKXA 1BCOA 1WSHA 3O4NA 4BWMA 4AHVA 3LH0A 3HSTB 4B08A 4FLTA 2BUDA 2X4WA 2QK9A 1RBTA 4FLYA 4AHSA 3L2QA 3ASKA 1SV5A 1OYXA 4DS4A 5M9OA 2YKNA 5J2PA 3RR8A 3QEPA 4NYNA 1X1PA 3QLHA 4CJ5A 3OYNA 1D5AA 2RJEA 3SUNA 3AV9A 4OGEA 3O3GA 1IH7A 3PUFA 3DLRA 3ZCMA 1S1WA 4CIGA 3AVGA 1UWBA 4ZHRA 2W42A 4FLWA 1T8EA 4C8KA 3E9FA 3CFOA 4GVMA 3MP1A 4CEDA 4DU3A 3RRHA 1RTJA 1LWCA 1OZ2A 1J5OA 1OI1A 2K3XA 2B6AA 3MEVA 1VSMA 1ITGA 4I7FA 4DQIA 3KD5E 3K59A 4KHUA 3VQPA 4NCAA 4PY5A 5FRMA 5HBMA 1CXQA 4HCBA 3MAQA 4FL6A 4ZTJA 4IURA 4KO0A 3P1GA 4C8NA 3TR8A 3K5OA 3CQ8A 3QEXA 1HYZA 2YNFA 2A1RA 3H6ZA 1BISA 3KKSA 2JTFA 5KGXA 3IG1A 3QIOA 3OYLA 2YNGA 3I0RA 4QQDA 3K58A 1NOYA 4C8OA 3AO1A 4EZ9A 1GOBA 3KD1E 4QW2A 3HM9A 1JKHA 3V4IA 4M3UA 2QQSA 4CHPA 2HHWA 4BD3A 3V1OA 5C24A 4W5TA 1C1AA 2VG5A 4DQRA 4KTQA 4BDZA 3PX4A 3P83D 1G5VA 3NF7A 3OQ5A 2VG7A 3LZIA 2HHQA 3FEOA 3TABA 3SQ4A 1VSLA 2G8HA 2LVMA 1ZBUA 4UQGA 3HJFA 2HQXA 3TWHA 1BQNA 4EP5A 5KH6A 1RTHA 1WAFA 1HNVA 4CEAA 3TARA 4DQQA 3P5JA 4IFVA 4I9LA 4NZGA 2YHBA 4RG2A 3HK2A 5J2QA 1JLAA 2OPQA 4PL6A 2EQJA 1RI0A 4CRIA 4R5PA 3SUPA 4DSFA 1TAUA 3ZSWA 2DAQA 1VRTA 3NBPA 1TK0A 4CGGA 3LANA 1UA0A 1NKCA 3AVHA 4B9SA 3SCXA 1RCHA 4CEFA 4IG0A 3QEWA 1TL1A 3ZEHA 1MHNA 3RMBA 1XI1A 1L3VA 3PX0A 2D9TA 4Z0UA 3TAPA 1C0TA 2O4GA 1WJSA 3U3YA
chains in the Genus database with same CATH superfamily
3EGXB 5FRNA 2FE3A 2HD0A 2P0WA 2ZGYA 5GAMf 1PP7U 2H1LA 5B1AH 4BR5A 4I2PA 3GZ5A 5BRFA 2NAZA 3CI5A 2Y31A 3IH2A 4X0GA 1RTIA 4JKDA 2QXFA 4BY7J 5E20A 5KE3A 5GP9A 3PIPA 4N56A 3EG2A 2RO0A 4S04A 5LLQA 4G9ZA 4N47A 1Q7YU 5EXWA 1T95A 3KLIA 4CJ3A 3VDXA 2HVQA 2PVDB 1HNZK 5D5VB 2O31A 3C4SA 4BGDA 3JAMK 2DA6A 2I5UA 3GF2A 2K5FA 1GLLO 4CGDA 2V7FA 4KB1A 4DOZA 3I59A 2ED0A 4F4KA 3F9MA 1T05A 4R0KA 4CK2A 2A28A 3RMQA 5LGUA 4MHGA 2DTIA 1Z7UA 3WXMB 4W5QA 2DIGA 2M51A 1TT5B 2IGMA 3Q0VA 3FIFA 3TAQA 3K6GA 1NOZA 1S6PA 5A0LA 2Q1NA 2O4XB 2EILH 3OYKA 2JRMA 3I55T 3NFAA 3JRGA 2NOZA 3E9PA 2DM1A 1TYQB 1R8OB 2JT1A 2ME0A 1RAHB 4XLAA 5M5XJ 1QVGS 1HK9A 1MJ9A 1C6VA 4ENMA 3Q1JA 5GIOA 2A3LA 4EM0B 2EJGA 4M7AG 1VI0A 3QIPA 3OVNA 4BXUA 2SRCA 3BR3A 3A5NC 1NJIU 1KFZA 2IIRA 1TVRA 1LOTB 2F48A 2YLBA 2HKQB 4EMHA 4ZJZA 4RTZA 4BC2A 2IAJA 5HS8A 3OSGA 2ZF5O 3CJNA 5FLXE 4CZJA 3FX3A 3LWFA 1VIEA 3TREA 4PJMA 2WSEE 2F2WA 5DK5A 4B3AA 4M3WA 3G1LA 1I5ZA 1ASUA 2CS3A 3F8MA 4CJEA 4W5RA 1ZH5A 4IPAA 4ESJA 3UATA 3LP3A 2IRFG 2Q0RA 2HQAA 5GAN3 4KJZA 4Z4GA 4YNQA 2O8BB 1HUXA 4AQYK 1N75A 2M7AA 4KFCA 5KYNA 1B9FA 4OIPF 4ISGA 2STTA 5C2DA 3TAMA 1QVGM 1M8MA 1GV2A 4RLQA 2KMUA 4CJKA 3EY1A 1HXDA 1XGNA 2DJNA 2F4MB 1PM3A 3F0ZA 3ERED 4YOTA 3U4LA 2QM1A 4JZ4A 3HKSA 3Q5FA 3OS0A 3C94A 2VV5A 4DYQA 2VJ5A 2R4GA 3ECHA 4KGZB 1WZ2A 3NGYA 2X4YA 1T2KA 2NYXA 1VQ7I 2P4TA 1KQSA 3RRGA 1BI0A 2JA2A 3V1RA 4RB1A 3NF6A 2AHQA 4E6RA 4BGBA 4FE7A 4CJSA 1UFFA 3M9QA 1YITQ 5E1WA 4EATA 1FBSA 3KIOA 1JCGA 2QSHX 1PDNC 4RAGA 1KTQA 3JRIA 2L3SA 5GANg 2DTOA 5CR2A 4B9UA 2JNGA 2J6KA 5AQXA 2L4MA 2B63J 2H8HA 4L9TA 2LLKA 4DA4A 1W5SA 2P9KB 4C0DB 4A3FJ 4BROA 1G99A 3L2RA 5EC7A 5LEJA 5HRSA 4CFBA 3WNHA 4H0OA 4LDWA 2WACA 4RUGA 4C1NI 2K2MA 3Q7CA 3RKWA 3I56T 2BHZA 1VRLA 1KC8O 1JLQA 1PKTA 2DPPB 2W24A 3ZXSA 1BOTO 2VB6A 1AWJA 3TL4X 5BPNA 3JB9J 3OIOA 4HEA2 3WXLA 4B9MA 4RW9A 9ANTA 3HI0A 2E6MA 1HSTA 2M1HA 3CCLT 1M5Q1 3DP7A 4FPAA 2X6OA 1K9AA 1EBMA 1HYVA 1YJWQ 4IUPA 4FVMA 2DEQA 1K73O 3V8JA 3LDQA 3CCLI 3E66A 3A8MB 2JA7J 4KRFA 2DQLA 3CCRQ 2GWRA 4BRHA 1Q7YC 4FSVA 5GAEJ 1FMVA 3CC2T 2MMPA 1X3UA 1KQ0A 3ITHA 3VA0A 2ZWHA 3S3MA 2OTLT 3TW7A 4JK8A 1Y07A 4J83A 4FM2A 1FIAA 3CWUA 4A3CJ 2E5QA 3E1YA 1R6RA 3AA4A 1Z9QA 4FW1A 2DBBA 3CF5F 2BW3A 1LNWA 1BA1A 3CC7A 5M3MJ 2E19A 3G10A 1Z21A 2DMPA 2ECBA 3SMSA 3H3NO 5LJVA 2QQAA 3R1XA 2OCCH 2FBKA 3JSPA 4IKFA 2EV0A 1N3AA 3HSTB 4JKBA 1STZA 4HAMA 2DYSH 2F9WA 2HPIA 4E7SA 1YRNB 1XC5A 3PGGA 1IH7A 1Q18A 3ZCMA 2XRNA 4L5EA 3E9FA 3M0PA 4DV1K 2JWKA 4XKBA 4CGZA 2EYQA 3S8PA 4XAXB 4NCAA 4F7UF 5GAHP 2YUNA 4JKEA 3H6ZA 2Y9ZA 4XKWA 3GBQA 4QW2A 4NHJA 3V4IA 2QQSA 4EVVA 4W5TA 2OF7A 2QENA 3GTOJ 3G6EI 2HYGD 2WSFE 3LA7A 2YT6A 2YHYA 4QS7A 5E3MA 1D3BA 4RTXA 3SQ4A 1LDJA 4AIHA 3ML6A 2BE7D 2YHTA 3KP2A 1JT0A 1XSDA 2W7NA 2YHBA 4R5PA 5TJJA 3F21A 5LJ5j 2H09A 3R6SA 3CD6I 1WA7A 2CZ7B 3LDPA 4IBNA 3NWTA 2X4XA 4ATOA 4KT5C 4XLHA 3M8RA 1RBRA 3AG2H 3R0JA 3SHWA 1YITN 3K2PA 1WUAA 4PQUA 3FDYA 1UJ8A 4XQFA 3CM5A 1WGSA 4DR2K 4HUEA 2FJ1A 1SKRA 3HHTB 2FBIA 4M77C 3CBMA 2Z1HA 2XHBA 4FIBA 3BCAA 1B34B 2FC0A 2EIFA 1X2QA 1GUUA 2PU9B 3I9QA 4FJIA 1ZBFA 1NLPC 1ZLJA 1S29A 3CMAI 1Q8IA 2HHHK 4JRPA 2VPLA 4PJOG 1GV5A 2D2WA 5FLXK 1C0MA 2RA2A 4J2BA 1VQMA 2EJFA 3M1CA 1YTYA 2KAFA 5EVZA 2DXTA 3I0WA 1DTTA 4XTYA 4QAGA 1Q82R 3CUQC 3CCSQ 4FLZA 1LKXA 1U47A 3O4WA 3AVNA 3AO4A 1TS9A 4RM2A 1IHVA 1YOVB 2JZYA 2MC3A 4CIEA 2RHKA 1M30A 4Y1DA 2YUOA 4H0XB 4IWVA 2KT0A 2VPRA 1K78A 3WHCA 5JS2A 4BC3A 4LG0B 3PQJA 1XMQK 5AQFA 5C2FA 1D1CA 4A4FA 2HB5A 4DOWA 4RB0A 2KDZA 4XH4A 2P6SA 5DUKA 1Z67A 2PMHA 2ZXJA 2JWTA 5KHDA 1UJ0A 2P9PB 4ILHA 2R57A 1MNDA 1JRIA 4BYYA 2V9VA 5GJVB 2OQRA 2EAYA 1N8RO 2DJZA 5EG2A 5D6WA 1SKUB 5GMKe 3QKJA 3DEEA 4C8MA 1O75A 1RUWA 4QQ6A 2O4IA 3OR2C 1PD1A 2DO3A 2H3EB 4KULA 3AO5A 4ESBA 3OYCA 3ULQB 5F27A 2DTUA 4CFAA 1KJWA 4A3EJ 3LL7A 4L5IA 2M0MA 4LLLA 2CQKA 3OBYA 3A4CA 2NOEA 4YPRA 3K1PA 3GZNB 2HZDA 2HBJA 2RHZA 2VKHA 4GW6A 1S7AA 3FRNA 2QTVA 5LJ3j 1WEFA 1NMDA 4NB4A 3M8EA 1WH7A 3OSSC 2LMDA 3CPWS 1DKGD 2VJJA 3SFMA 4DV0K 1RBUA 4V2SA 4PL7A 1W7PD 3KUFA 4IQ4A 5DM6F 3J7AY 4AIKA 2ZJRL 1C1CA 4F17A 3CTAA 1WLJA 1XWLA 4FZXC 1MBJA 3FXJA 2QVOA 1OPCA 4DOVA 1F4KA 5GMKi 2YJFA 1XCVA 2E2IJ 2VQLA 2UWMA 1MDMB 1T6DA 2NNNA 5KVRA 1M90C 1LDDA 1OR7A 2XSJC 3CPWM 2VGNA 3UF4A 5GMKm 1LMZA 1QWFA 1AVZC 4H4MA 2DF6A 3CCSN 2DA5A 1MBKA 4HT9A 2DNUA 1LWVA 3N0UA 2P9NB 1PC0A 2YG9A 1K61A 1YUWA 1RLPC 1CKAA 5F0HA 2LTOA 4BBSJ 1OCPA 2O9LA 4AIJA 2NXNB 1SHFA 4XKVA 1NU0A 1KA8A 2GOXB 2OFKA 2AK5A 3H41A 4EP4A 4L0ZB 3CCVN 2QLZA 3K0SA 1ZQ1A 4AHUA 3SB2A 2VXFA 1P6RA 5JVGL 4KMUX 1Y6IA 1RT3A 1RETA 5ADXH 5MLCQ 3J81E 3F5TA 4QLCU 2N8GA 4JKGA 3ABLH 2IP2A 4E7HA 1Y0NA 4PSWA 2OAWA 4PUOA 1U1TA 4C2TA 5GAMd 3A1PA 2W04A 4CHOA 2QKKA 1HYSA 3HXLA 1RT1A 2XAFA 2P5OA 4F16A 1G15A 4WX9A 4PHTX 3H08A 3HUGB 3A8LB 3MWMA 2FVUA 1ETOA 3S1MJ 1NK8A 3NNQA 5GADP 2XG8D 1AD5A 3IH7A 4CIFA 3UKGA 1H8KA 1Y39A 3NRVA 2DYBA 4DF4A 2GFAA 5FKMA 1EO1A 2OAZA 3O8GA 4M6VA 1YJ9N 2F4OB 1GL5A 4M9ZA 1T6SA 3CCVQ 3CCJA 3M8SA 5GJWB 3CO7C 3NMZC 5CZ1A 1RAAB 1F21A 3MO8A 4KH5A 1NGGA 3MZHA 2WV1A 2CH6A 1ZHIA 1U9OA 2OZUA 3KK7A 2V6CA 4A59A 1TK8A 2X6XA 1ETQA 4J2AA 2ZJRF 4CZLA 3H0DA 3VQDA 3SYZA 2FZKB 1VAZA 3UDCA 5AQPA 4PJ0C 4BWMA 2BVMA 2DQRA 2V7ZA 4FLTA 2QK9A 2RQWA 1RBTA 5GANh 5AYFA 2JJ9A 5KYYA 2CH5A 1WI7A 3M54A 3WTUC 4AIDA 1ZR2A 5JR3A 3AV9A 1IXRC 4D6WA 2W85A 2KRNA 4GVMA 1HSJA 4ENNA 4GNIA 1D4XA 4YOUA 1PSFA 1MBFA 1SHGA 5FLXO 4I7FA 3J81O 1OMIA 1HW1A 2ZMEB 1M1KR 2RB6A 3CQ8A 2J5OA 3K10A 1XGSA 2RN8A 3PX4A 3MKDA 3FEOA 3AGRA 4BJTA 4GYIA 1XMKA 3J80K 1VSLA 3IRQA 2ROLA 1LVKA 1RTHA 3P5JA 2XROA 3E0JB 1RI0A 2DAQA 3LAPA 4EHUA 1I50J 2XB0X 1L3VA 4WQ5A 3TAPA 3LFKA 3HJEA 3W6VA 3EG9A 1RZ4A 1N25A 5KK1A 1NG2A 2HSTA 3VQAA 4FJ5A 1OCOH 1DDNA 3I0TA 3CC4I 5E18F 1U2WA 3SQ0A 1JKPC 4A3KJ 4B21A 2JUCA 1POGA 1YN8A 1YAGA 1YW9A 1IO6A 3CDIA 1BUPA 1WJEA 3QHSA 2W40A 2NYSA 1ZREA 3HBTA 3T69A 1WQ7A 2NRZA 4DTRA 2QQRA 3G6EN 3AAQA 2D0QB 2E3HA 3IL2A 1QQCA 4CZGA 2DLPA 5DM7R 2Y9YA 1IDZA 2EBPA 4CUGA 1EP4A 4HX4A 2ZNZA 4WF2A 1IDYA 3DLHA 1ZSZC 1KQSP 4JUVA 1KAYA 4RCCA 3SEZA 3ZT4A 2E1MC 1R1TA 3ZQFA 1NK7A 1EIFA 4C5HA 4PGGA 1IV0A 4HV6A 1HNIA 4BWJA 3VF4A 5C12A 3BE3A 2Y0MA 2ID3A 1X9MA 2P9IB 2R7RA 2ESHA 2LF8A 2DOAA 4ON0A 5LJ5f 3O1BA 3QDFA 2DA7A 3VQ9A 3JSOA 4Z4EA 3GTKJ 4RAFA 5SWMA 3FWEA 1IG7A 2VBYA 1MWKA 1VQMI 1WSIA 3VTHA 3RYRA 2PZSA 2WADA 1M1FA 1WOQA 2VLAA 1UG2A 1TYQA 2E4LA 5GTHC 2DIQA 1VYVA 4B1WB 3LAKA 1YIJT 2EFWA 3LQQA 1NKUA 1N5ZA 1MJBA 2RNAA 3NTHA 1KC8U 3M0RA 1H9TA 2MBFA 1WHJA 4FWKA 4E7KA 2JM8A 4O4GA 2FA5A 1UGVA 4FE4A 3DXMA 2Z5UA 2P7CB 1OEBA 4JRIA 2RQUA 4M3DA 1Z6RA 1X9SA 4B8XA 4AFSC 2KPMA 1DU6A 3HP6A 3LMMA 4OMNA 2W41A 1W1WE 3N97A 5JICA 5F1JA 3OYEA 4YDUC 4CF0A 2KE9A 4DQ2A 3DLGA 2CKKA 2EBIA 4M77D 4RB3C 3C6HA 4E89A 1C0UA 1XMAA 4BG8A 1MSFC 2LP0A 3MEWA 1P8ZA 5A2QK 4M6XA 3U6FA 3H5AA 4PFPA 2ZMEC 2CW0F 3VQ4A 2P9UA 2PJPA 4RKUE 4MO7A 4XKCA 2JOYA 4M63C 4XRSG 3K9TA 3EUHC 5K7HA 2ETHA 4F93B 4V19S 3ULDA 3ZQIA 2A3SA 3JAMZ 2JA8J 1BIZA 2LNVA 3EN9A 3NH1A 4DGWB 2X1CA 3I5SA 3PVQA 4M7AC 3P8BB 3SJHA 3ZSOA 3J80O 2ZKZA 1R4MB 3KTUA 4C8QG 4GGGA 5DPKA 4Q5SF 3NAUA 1VQ7N 3A02A 1TUUA 1JKQC 5KE2A 1J7KA 4ZYHA 2QWQA 4CZFA 2DZCA 4JK9A 1X6GA 5C42A 1U5TC 4HQMA 3NVMA 1PD0A 2L2PA 3W2AA 1VQ6Q 5DD4A 4LC9B 4IRGA 3ZL7C 4GV9A 3V81A 5AQKA 1UAAA 1R0BG 3L1AA 2O0YA 4M3ZA 2Q1ZB 1ACMB 2P9SB 4X62K 2YXYA 2LCCA 2JN0A 4YFNF 4NB5A 2G8KA 1VQOA 2BHYA 4Y28E 4QSHA 2QCOA 1IG8A 4OB2B 4U7BA 1XC9A 2CRGA 4XLNF 1L3TA 1Q81O 4AFQC 1IAWA 5KN9A 2VE8A 1FMWA 4ZTFA 4FOEA 4U0WA 3EYYA 2L01A 3LGLA 3DRSA 4LD5A 3X2QH 2DYRH 1LB2A 1P90A 1JL2A 1ZSGA 3ZMZA 4ZZLA 4OJRA 5JFRA 4B9WA 5AQIA 3P7NA 4GO1A 5GMKj 1GLEG 3CC7N 4G7ZF 2NUPB 3VQEA 3KWIA 1BR2A 1QWEA 5HRPA 1UUEA 2GLOA 3OY9A 2JGUA 4XU1A 4ELVA 1KO9A 2PTKA 2DMTA 3U21A 3BZKA 4YIFA 5GAHJ 3GCMA 2AHJB 4DU4A 3SMPA 1B9DA 4IO9L 3T19A 3I0XA 1I3QJ 1LCKA 2XKOC 4DV4K 2EFOA 3SQ2A 4M4ZA 1VSJA 1KU9A 3DLLF 3IV5A 1J5EK 2KFDA 1IHWA 3C2GA 3EQLF 2JW4A 4HNUA 2ZPEB 1L3SA 4Y92A 4C92C 3CCJT 4HVJA 2QYOA 3FXLA 3SAFA 1QCFA 3SEMA 1O1WA 5J3BA 4N4IA 4RS8A 2CP0A 2O8FA 1K76A 3J80Z 4PUSA 1EA3A 3SZ2A 2YX7A 2HBLA 2JLEA 4A57A 1JLCA 4IEIA 4BR7A 3A01B 2Z0WA 3SWNA 3R6NA 1SFKA 1D9DA 3S2HJ 2JG6A 4I99C 5DD8A 2HU9A 4JI6K 1RNLA 2DA4A 4J01A 1SEUA 2KIQA 5E84A 4KH6A 1W0TA 3TGNA 3A5LC 1N9RA 2BE9B 2VT3A 2R3SA 4DIQA 3N4PA 3PTAA 1Q86U 4GY2B 4RTFD 2EGAA 3K59A 3CC7I 4AMCA 1VQNQ 4KO0A 3QPHA 2HKNA 3HM9A 1HPMA 2HVSA 3KP5A 1DU0A 4AIAA 1C1AA 5AQQA 4KTQA 1M1KC 1TT0A 2ISZA 4A2AA 3AG4H 4M77A 3D5SC 2KRCA 2QTDA 3I9V2 4RG2A 3FZKA 3QJYA 2QBYB 3MZ8A 4CRIA 5F04A 4DYCA 1TAUA 1EH6A 4IHTA 1YI2N 2FPDA 3I55A 4IG0A 3QEWA 1MMDA 1PUFB 3DBLB 4Z0UA 2O3FA 3QWXX 2QI2A 2O4GA 4BVOA 4XQ3A 1WWXA 2EIJH 1GBRA 1YIJN 1K0XA 4H5WA 4EMKC 3DM2A 2M30A 2P8TA 1A6IA 1OH6A 3F8BA 1ZKGA 4AC0A 1J53A 3KE2A 3DLBA 4R79A 4D0PA 1YJWT 1QBJA 2G8FA 3REAB 2Y69H 5IT9K 3PIPL 3RSNA 1N6QA 5LL6Z 3TEEA 4RMNA 1Z77A 2GA2A 2H94A 3TQ7P 4L8RB 2QG9B 3G4SN 3B8AX 1NM1A 5JMVA 1U78A 3L0QA 2B0LA 3NAEA 1I6XA 4CSWA 1EQYA 1QVGP 4AHRA 3UA7A 3IS9A 2V51B 1NG6A 2HMAA 4LF6K 4C3JJ 1VHXA 4CO8A 2D0CA 4J9CA 2IW5A 3QO9A 2FQ4A 1TGOA 1M90U 4M7DD 3TSQA 4I6ZA 3BG6A 5AQSA 3BDUA 1M2OA 1ZR4A 5J8FA 2XPWA 4F04B 3MK6A 1VNDA 4KISA 3CYMA 4M7AB 3A8YA 3R2XC 5GAEP 3CXCM 2HHSA 5E3OA 1SVMA 3QZ5B 2IJLA 1IB8A 3L7WA 1OQKA 3VN5A 3H6EA 4YOYA 4ENJA 4OPJA 1CSKA 1BB9A 4BRAA 3VUZA 1Q86R 5J8CA 3M0QA 3FF5A 3RUXA 1U5TB 1G2BA 2W10A 3K5LA 4ZDOA 1SL0A 4J8FA 3VA3A 3IKTA 1W4MA 1D5YA 5K7FA 2V1UA 3AG1H 1BWFO 3CCEI 2B7EA 4OPKA 3JRDA 1NTCA 4DLGA 3H0GJ 4XNFA 2UXNA 4ZGJB 2OQGA 2KZGA 4KHNA 4HZFA 3OOPA 5GAOr 2CT3A 2E88A 3CO6C 1QCOA 1JJ2M 3IFRA 1SL2A 3L2VA 5KCOA 2NWMA 1W7PA 2R7DA 3MKLA 5FD5A 1K9MC 3ZOBA 5BNGA 1D0XA 4P1WA 4C92G 4LFAK 2M1BA 1JXOA 1QHTA 2LSOA 2PYLA 4LF5K 4HX7A 1IKXA 3CJ1A 2P9NA 3CCLN 2F6CA 3I56A 1UHSA 2CJJA 5EX5A 4D5CA 1YBYA 2EFPA 3H35A 1IXDA 5ICEA 4FW2A 2P4RA 4C92D 3AY9A 4C8QD 2E35A 2EIMH 5IP6A 4MLOA 4FJKA 1WJRA 5K14A 4QOZB 4XSXF 1LVAA 1FN7A 1VQ8I 3DOKA 4QKUA 1XSXA 2DA9A 4Y1CA 1JLEA 2WUSA 1VIFA 4X9DA 2FZGB 2R5ZA 5F08A 4MO5A 2UUCK 4CHNA 1FTTA 4OGCA 1RRJA 3ZSVA 1IXSB 2WB1N 3WXKA 4KT6A 1R5HA 2YRDA 1BA0A 1FK9A 1QA6A 1RT4A 4XIDA 5A2QO 1O3SA 2QEXT 2BGGA 3ZGKA 4IG3A 2HNDA 5GAGJ 2OBPA 4D5FA 4DR3K 3A2FA 4MQ3A 2NLXA 3KLOA 1U45A 2D4WA 1K9MO 3OTOK 2EZKA 2LSNA 5JVGF 2DL8A 4A3GJ 4HV5A 2P84A 2DOEA 3THWA 1W2BA 3QEIA 2A1SA 3C1DA 4OWRB 3CETA 3WU2C 3CCVA 4NS5A 1E7OA 2VQGA 1R0AA 2GQQA 2IGIA 1PG5B 3L4IA 3I58A 4Z02A 1QZEA 4W97A 2XPVA 2X6YA 1WHMA 4YOXA 3NEUA 4F3OA 5I11A 4XN0A 1VSEA 3HM5A 2NS0A 1RAGB 1JXMA 4U7DA 5M3FJ 3QUIA 2F5CA 2FHDA 3CCRI 3ASNH 4ILJA 1USSA 5LJ3h 4CJPA 2RJFA 4ZZDA 1ZGWA 3SZTA 2KIMA 1VYUA 2LRQA 4H5TA 2MF2A 1NGIA 4DS5A 1HYOA 1K73U 3CCMN 1DGRM 2ZJPF 1Z6TA 1UECA 3LWMA 4PIIA 1D9FA 3ULEA 3CUQB 4XTUA 4PJOB 1VQNT 1UFMA 1QQIA 1QE1A 2OZ6A 4LFCK 4C3IJ 4ELTA 3G1MA 3KYDB 3WTSC 4DR4K 2LD5A 1S1NA 2RHUA 2R7QA 1MPGA 2DXIA 4RAZA 1HW2A 3G6ET 4B9XA 3CCRA 2AA4A 5J40A 2R7UA 2PUKB 2C6YA 3CD6Q 2X78A 4BUPA 3UT1A 4BRIA 1VQ4N 4KYWA 3R0AA 4FYVB 2Z9OA 4RAYA 4B1XB 1ZYRF 1ULYA 2OZMA 2M0OA 2LF7A 3WNGA 1WXUA 3OYYA 1YTUA 2CQ7A 3FZVA 3CD6T 1TWBA 3VW4A 3LAJA 1T39A 1O3QA 3MN9A 1A35A 2E60A 3MEXA 3I33A 1LJOA 3OGDA 3ASKA 3RI4A 4LF7K 1D5AA 1XNRK 3DLRA 1MV3A 3QYGB 2K3BA 2JQ7A 2DXBA 3I55Q 1OZ2A 5AQGA 3KZYA 3I3LA 1RDUA 3VEVA 1ETYA 2CREA 4RTYA 1HKGA 2VGMA 3TU5A 1TWGJ 3VF2A 2W25A 3ZN1A 1E3PA 5FLMJ 3ZR8X 4YDUA 2KRHA 5EYRA 1ZTRA 4ZH4F 4ILGB 5DM7F 1U06A 4MDXA 4KN4X 3TARA 5KPRA 1HKCA 1OCZH 3FXMA 3AVHA 3JB9F 1QZYA 3RMBA 4DUYK 1BO5O 3PFYA 3G1JA 5IP7J 1JU5C 1MUDA 4IJNA 2DK8A 2JK3A 3SBGA 1BOBA 5CHIA 3HSRA 4XTWA 1BBYA 2RI3A 2KI7A 1VQKN 2HZTA 4LLGF 3KXTA 4HUGA 2ID6A 4B8CA 2HVRA 2Q31A 4O55A 3VGLA 1IN5A 1ZBJA 4NC6A 2E1ZA 4H5RA 4V19K 2OTLA 3KLGA 4FJMA 3WQTA 4E4HA 2M87A 3FIWA 1G6NA 4NL3A 4LH4A 4JP0A 2M2EA 1W5TA 3MKWB 3UPUA 4MIMA 1H1VA 5IP9J 2OA8A 5C44J 1BG3A 1VQ6A 1W36D 3BJOA 2IPQX 1BN5A 3G3ZA 3RKYA 5L3EA 1X2KA 2VJIA 3I5UA 1JGGA 2R92J 4BY9C 3VMFB 3CCEA 2IDOA 5D6FA 2V75A 3MKZA 4DYRA 3D2FA 3O08A 2CH4W 3C6AA 2HBMA 1NK9A 5KTQA 5CR4A 1WJAA 2BY2A 3O6WA 1OH7A 2KK4A 1Y71A 1J54A 4LF4K 4EMGA 1WSUA 2ZPFB 5GINA 3T3FA 3RQIA 3TTFA 2LQNA 4F3QA 3OYJA 4A5MA 5LJ3g 4LD9K 2E41A 3I56I 2XHIA 3CCVT 4E7IA 2O8CA 2QKLB 4EMKB 3FR0A 3T1YK 1YQKA 3GUDA 3LM9A 4O0IA 1JJ8C 3PIOF 2QUFA 2M7BA 2CGLA 4DFKA 2CP3A 3OWTA 1GLJO 1WHHA 1X27A 2VVKA 5IAYA 1EX4A 4DZPA 2HSPA 4DUZK 4JS5A 3NWSA 4C92A 2RHYA 1WX6A 3SZPA 4Y0WA 4FYDA 5E3LA 4FT8A 4J2EA 2EYWA 1K1ZA 4OPAA 4CCHA 5HP1A 3D6RA 4FJNA 4A63B 1B6AA 4OKJA 2LT1A 2YNHA 2O2OA 3LA2A 3V8KA 1FOYA 1R00A 2LOOA 1S72T 4JK1X 3A0BC 4CEEA 4A4EA 4CJUA 3CW7A 5FKNA 4DNCA 2B8AA 1W97L 2QKBA 1IF1A 1QVPA 2E71A 3KP3A 2Z16A 5DCMB 4BE0A 4XL9A 1U2VB 2E2NA 1UHCA 2Y2ZA 4UVBA 1LE8B 4MTDA 4KI4A 6PAXA 1IKYA 2XAUA 4DHYA 4NYFA 2B5JA 4CC4B 4JKFA 3KYLA 3G25A 3INZA 4Z4IA 2RF2A 4FTHA 2XDDA 3L09A 3C0BA 2CWEA 4M75E 3K4JA 4XONA 2K4YA 1S1UA 1KU7A 3FMQA 4LGWA 1VQ9I 3CCQQ 2F96A 3PIOL 4UV8A 4C92E 4F92B 4IHYA 1T44A 1I0CA 4ZNXA 1N5YA 2NS7A 2QAZA 3NGZA 1ETXA 4FXDA 2C0TA 5EGOB 3NTIA 2Y30A 2F5DA 1AA7A 4P5OA 2E6ZA 3BDDA 4L18B 5AN4A 3HYFA 5CVVA 4ESRA 2UUZA 4E9HA 1QS4A 3DEWA 4W5NA 3GVAA 4AG2C 1M9SA 3C2BA 3FK6A 2DFUA 3SDZA 3M3ZA 2Z1GA 5BR8K 2O9VA 5JHFA 1KHIA 2E1MB 1ZUKA 5IYBJ 3DKMA 1QTMA 5HK0A 2A5XA 5F64A 4FYXB 3RIRA 1YI2A 2E2PA 3CMEI 3PLAA 1WB9A 4N76A 2WWYA 5I3UA 4P55A 4I6MB 3WEEA 4BRMA 2DLLA 3C3WA 4CH7A 1TKZA 5LJ5h 3DOLA 2IA2A 1BC7C 4A2UA 2I2LA 2LKPA 2HW3A 3J81Z 1ZRCA 3HOTA 1ASVA 4M45A 4OAZA 5CY4A 4LD0A 1YJNN 4AHTA 4ISFA 1ZA2B 1VQLN 4BGAA 1UE9A 3T1HK 4I09A 3DF8A 1IBKK 4F8RA 2X0LA 2K3YA 5FKKA 3OR1C 3D5RC 3HSEA 4FSSA 1ZC6A 1VQNA 4NXMK 3U9ZA 3H3OB 2ZFUA 3SV4A 4IUVA 3EGXA 3NF9A 1Z9ZA 1REVA 2QEXN 5K7ZA 1AHJB 1IZ6A 5CKFA 2AKKA 1LV5A 3QU3A 4KICA 3BT9A 3CCRT 2KTQA 2KISA 1V4RA 2L3QA 1WSEA 4BR2A 2P81A 3M5RA 1WSHA 6AT1B 5EEHA 4D7NA 4YFKF 5CKBA 3EUKL 2X4WA 5A2QE 3ZQQA 1ORPA 3EFRA 1K4SA 3HOSA 3NQOA 1VQNI 1IC8A 4BQAA 1OI1A 4DR5K 4KHUA 3VQPA 1DT9A 5F0CA 4IEEA 4C8NA 3HKZN 2HDWA 3JV3A 1SVLA 3IG1A 3V7SA 3ZQ7A 1VQLT 1MD0A 2LREA 3RQ4A 4UXNA 1X1AA 3HDDA 2CZ0B 3FXQA 4PZJA 1G5VA 2WTEA 3KWGA 3DKWA 4EIKA 2FF3B 1P2FA 1EV7A 1O13A 1Q7YO 3M9AA 4B44A 5KH6A 1HNVA 1RACB 2WAFA 4HWIA 4H0VB 3NBPA 1WBBA 4N0AA 3CCQN 1S5LC 5AFUH 3PX0A 2FRHA 3A8OB 5HS7A 1ZXOA 1T0JA 3TP3A 4WQ5C 1PSEA 1B34A 3FLCO 2ZXWH 3LPUA 1PKSA 4CECA 4BEHB 4R56A 3IP4B 4IDKA 3U23A 1Y0UA 3A1YA 1O57A 3HRMA 3MAJA 1K8KA 2CW7A 1S22A 2FLOA 1LWYA 1RT7A 3DLKA 3SUOA 2PX9A 3ZMVA 2L0KA 2K3FA 2A0FB 1VFCA 5AZJA 1Z3YA 2VG6A 2IA1A 4X64K 1XQOA 3I64A 3NGIA 3GTMJ 3D4VA 4XLCA 2GZWA 1D5VA 1X69A 1U3OA 4ZGDB 4O5BA 3PIPF 2ZJQL 5J39A 2COYA 3LSIA 2Z1JA 2DMNA 3PMTA 1OJLA 3FHZA 4AM3A 3LDLA 1YWPA 3HC7A 1VQ9Q 3H46O 1T38A 3PT9A 3C95A 4RGRA 1H92A 2LJ1A 4ITVA 4D1QA 2VOPA 1ZELA 1VQ5A 1QQOA 1ATSA 3FLGA 1YLFA 2NZTA 1S72Q 4B1RA 4HLYA 1TBXA 1YQLA 2Y75A 1A5WA 4FZYA 3SJJA 1JXSA 2HKXA 1VQ6I 1HMVA 3HSCA 2YLCA 3PO3J 2OJ2A 1NJIO 1AOYA 2FMYA 1OR7C 2KKOA 3K9KA 3CMYA 2PZ1A 2E7WA 4AVZA 2DVJA 1RKWA 1U5TA 2GTOA 4XIUA 1FX7A 4HT8A 1KU2A 3NCIA 1K8AO 1VQPA 4C92B 4L9VA 1WHKA 2YI1A 4M75G 2E8AA 3FHNA 2J6FA 4RTTA 1TXQA 1DIZA 3IH3A 2Z99A 2IEKA 1ZGJA 2GBZA 3RVCA 4HF1A 1T0HA 4MEXF 3MEDA 3VS3A 3JB9H 3DBHB 1LE8A 4KB0A 3M8FA 4PKCC 3M5AA 2ZPIB 5LJ3f 2X6NA 1FYKA 4ZYEA 4FLVA 1YJNA 1HLUA 2RQTA 3SDGA 2RV8A 2MWPA 1KD1O 3JB9G 4C8QF 3DLLL 4BR9A 1H3HA 2VASA 4M7DC 1NJIC 2I10A 5LGTA 3HM8A 2Q0UA 4G6QA 5HCKA 2BGCA 2FBVA 4OO1J 3D45A 3GFJA 4IF4A 3CC2Q 5HLFA 3A0IX 3PL8A 1QKXA 1OPKA 5CKDA 3QB0A 2V1DA 4NCBA 3F3XA 4N9IA 2OCEA 2QWOA 3KP4A 4XR6A 2CGHA 3MEAA 3THVA 4PDKA 2X1EA 4YIRX 2CFXA 5DM6L 2D0BA 2KRSA 2FB7A 4YRVA 1VQKQ 2ZCWA 4WXHA 2NLUA 1N77A 1DPUA 3SWNC 1X6OA 2X3XD 5BREA 1NJZA 4DR6K 1VOMA 3ZEUB 2BTTA 2EJ9A 3G4SA 3FZMA 1I5LA 3PX6A 3S6WA 2XDVA 3CCJN 2O9SA 3QWYA 3SUQA 3ZSYA 4B47A 3DXJF 1KQ1A 4LE9A 1K4US 3HSBA 3O8MA 4IOXA 1Y96B 2KRFA 5L3FA 3KZZA 1YE9A 2OTJQ 3LNQA 1WLPB 3META 2DEUA 4CJVA 2L89A 3E5QA 1XNIA 2LZ6B 1K79A 3NDKA 5GAGP 1B3QA 3VYUB 1XPXA 1WHGA 5CK9A 2FEZA 2LX7A 1NK3P 2MGQA 1Q81U 3CDLA 4FZZA 4IIOA 3GIBA 4CJRA 3I55N 3PSIA 2O8DB 2AZVA 3JTHA 2WSCE 5C6SA 2EFQA 1ETWA 1Z3XA 1QPIA 3I71A 4C0GA 2DU9A 4JHDB 4GFBA 2PFBA 1QGPA 2K4JA 1N8RC 2L5QA 2YU9J 5AQVA 4PWDA 1NBEB 1UDLA 3QPTA 3WHBA 1YQAA 3SAGA 3DWLA 1OYYA 4BQQA 4RB2C 3BUZB 1WCMJ 2I5JA 4EZ6A 4XM3A 2AZSA 2UUAK 2EVRA 3VESA 1XHXA 3G0QA 4NO7A 3P9KA 2FPEA 2FMLA 3T8RA 2KXDA 4OLAA 4FOIA 3MP6A 3LX7A 1LQ1A 2RKIA 5KQDA 1UB4A 3TEDA 3ZBDA 2C0OA 2VUBA 1FMKA 1X01A 4PSXA 3G71N 1T0FA 5IY5H 3AARA 5ICCA 2LC4A 1EZZB 5KAIC 3FC3A 2Z33A 4BE2A 5ERIA 1NEBA 1XQPA 1RTDA 2CP7A 2G6FX 5IN1A 3O4NA 1BCOA 2HEQA 3L2QA 4L5GA 3S15J 1B7TA 2HQHA 3O3GA 2W6KA 4ENKA 3PNYA 3MP1A 2F5EA 3TCJA 1RTJA 1J5OA 3C7NB 2CUBA 5HL7L 4HVWA 2L9VA 2NOGA 3EETA 3K5OA 2YNFA 4QQDA 3AO1A 1OYWA 1SFUA 1I07A 4RWTA 4ISEA 3FB9A 1NPPA 2D1HA 4J9IA 1HF0A 5DUIA 3DWLE 1DP7P 1KG3A 2B9SA 4EP5A 1L3LA 1D3BB 1VQOI 1VQPN 5CQXA 2M5WA 4DEXA 4P5NA 3L00A 1KQSM 5IXFA 1EF4A 1T3VA 2FRYA 1KQ8A 5JLXA 3GLXA 3PNVA 1I94K 1CQTA 5LRRA 4B48A 4BHCA 3K4NA 4H0PA 2J4RA 2L9RA 5IPAA 4ID1A 5CVUA 1NGBA 4EEFG 2LKSA 4EGYA 1I1JA 1VQ5T 4X65K 4O3MA 2E5NA 3LSHA 3KYCB 2EQMA 2XO7A 2R7TA 2RI5A 5JVTA 2EIKH 3KEYA 1XSVA 1CZ9A 1I39A 4ASNA 3RR7A 1V29B 2CW8A 2ELKA 3PUBA 5GAN2 1E6GA 3M07A 1W2BP 3BTCA 4B4CA 4LK1F 4HA8A 1K8KB 3T1BA 4FK0A 1PHTA 5LBQA 2K02A 3HXMA 3KJVA 4NNJA 4FJHA 5BPIA 5FD6A 2IXSA 2Q2RA 1R36A 4UVAA 2ASOA 1VSKA 3VQ5A 1X3ZB 2MD0A 3L9FA 3K2AA 3BTIA 2PVGB 5GAN4 2XGXA 5FWCA 2M4KA 3PE0A 4QPOA 3CFRA 1TP4A 4PJOF 3SQ1A 4KI6A 2J7IA 1Q86C 3ZT0A 3FM3A 1QQJA 2MK5A 4PJOC 3CMET 1FJLA 2J6OA 1WSFA 2KZMA 3KX2A 5IXBA 4K25A 1TU0B 1HRHA 1E17A 2RF0A 2IVOA 3HFNA 4D9JA 4F91B 1ZUYA 3KCCA 4WXCA 4H4OA 1X2MA 4CZCA 2V9PA 3CC2N 5LJ5d 3T1AA 4R55A 3UNGC 3LLRA 3E9OA 3ZYYX 8AT1B 3VEPA 3O9QA 1GT0C 2YKMA 1YG2A 4OKEA 1LFPA 4WE1A 1BI4B 1B92A 1QSYA 5CKHA 2LR8A 1X1BA 4A6DA 2MABA 4GBQA 4M75C 2K7LA 2K2VA 2E6NA 2EGEA 2NVXJ 5D6XA 4F7ZA 4JJBA 4RBOA 4DTUA 5DCMA 4RCBA 2TRTA 4FX0A 2K27A 4CYDA 3TAEA 3EFOA 4DK9A 3DTEA 1KC8C 3H9NA 3VS5A 4PJNA 4CF1A 5F6FA 3QNOA 4LB5A 4IDHA 1VQ9A 2VC0A 4HQEA 2ZJPL 2VC1A 4M3BA 1IRZA 4QVZA 1X6BA 3SPZA 4MMLA 1TW2A 4YOVA 4PLIA 2A40A 3I35A 1XDUA 4Z88A 2FSNA 2Y1IA 3D1NI 2HR3A 3K5MA 4JX4A 4A3DJ 1ZBLA 1T3SA 3BZ6A 5EJCA 4CZMA 1J3TA 3F22A 3B6PA 3DTKA 2Y4XA 4KRTA 1KG2A 4D8KA 1SFEA 1GHCA 1K73C 2ASMA 4LDXA 3BEXA 1GLFO 2GXGA 4DTXA 3QP6A 1V5FA 4M9XA 3GTJJ 4K42A 4A3MJ 1OLTA 2OU2A 1BI4A 2BZ8A 3E5UA 3CJQB 3PIOA 3CEYA 1N9SA 4M3FA 3LAMA 4KN7X 1PVEA 2GBQA 3TSUA 1RRQA 1G4DA 3VOVA 4M7DA 4X1EA 1Q82U 2QEXQ 2WC2A 3TSZA 4A61A 3GPLA 3RNJA 4JQFA 3O9RA 4B1UB 3S16J 3JRHA 1YW8A 4M78F 2CYZB 1GXPA 3H5RA 4IJAA 2AS5F 1WSJA 1RGIA 2DXCA 2X6WA 1VQ9N 4L9NA 4Z89A 3ZETA 4BQZA 5D3GA 4O6JA 1HPZA 2XF6A 2P9KA 5EEGA 2F5VA 1VQNN 2VWBA 2EYZA 1BOAA 5D5XB 3R9PA 3VEZA 3HPGA 4B1ZA 4IO8A 1OFCX 4II1A 3BR0A 1SKSA 2QWWA 2DA2A 3S17J 4CA0A 4MLHA 4ESFA 4DBHA 5JHUA 4KIFA 1BL3A 4IHVA 3W2WA 1QKWA 2F5TX 3FXRA 1NLVA 1UHMA 2G0EA 1K6OA 2KHOA 1VQ4T 4F2RA 3C7JA 1PJRA 5AQTA 2CQQA 3I8DA 3LSPA 5B1BH 3ZP5A 4CCOA 4LD6A 3E9GA 3QETA 1NGCA 2GM4A 3AVCA 3MX2A 5H2FC 2VYTA 1GFCA 1VQ4I 5KRTA 2EZIA 1VQ5N 2ECCA 2V1QA 3R60A 4H0EA 5F0XA 1AOJA 2KVQG 3MEUA 5HROA 4B3MK 4KHQA 4MZTA 2EPDA 3EHQA 1ZA1B 1Q81C 2XDPA 2ZO4A 1C1BA 4CVNE 1YRNA 2UUBK 2XI9A 4DS4A 5J2PA 5M9OA 2PAVA 5HLHA 1Y56A 3QLHA 5C4JJ 3HBLA 1QW1A 4J7IA 4M75B 4BQNA 3MEVA 1UG0A 1NM7A 4WCIA 4B23A 4ZTJA 4G7HF 1QHHD 3TR8A 3NGPA 4BJ6C 1BISA 5IT9Z 1VQON 1JCEA 4C8OA 2E2JJ 3FMSA 4BD3A 3EGDA 1FY7A 5LRSA 4BDZA 4BR0A 2E1OA 1HCRA 1YIJQ 3CC7T 4RTUA 1IN7A 2V1XA 2OPQA 3DQVC 1JB0E 2IA0A 2IGKA 2K57A 4EJYA 3CCMT 2O6GE 3O6BB 5LD2C 5D4RA 1WJSA 4XK8E 4BDPA 1WXBA 3MP8A 4CZZA 5J1UA 4HG2A 3T9NA 3S9HA 5L3DA 4N9HA 4JAXA 4GYGA 4UNFA 5HODA 2F69A 4MFEA 4QPQA 2IS4A 4K8XA 1KU3A 4K41A 2DPDA 1NKBA 3TTDA 2XGEA 4FJ7A 3H1QA 1BJZA 2R5YA 2I8DA 3J7AP 2Y1JA 4J7FA 4I9QA 3NE6A 3HHGA 2DD4A 3M0SA 4KUMA 2I7NA 2HNZA 1EH7A 4AWXB 2NUTA 3BF3A 4HNTA 4J9BA 4DSJA 4PKIA 3LP2A 2E4HA 2X9HA 2GELA 4MDAA 1WRJA 4E9FA 5M1QA 1KVBA 2P5LC 1Q1VA 3QDKA 3JXUA 4JEPA 4KREA 3DI6A 3BG9A 3JRZA 3SLCA 2O4XA 1JLFA 1M3QA 2A6EF 4Y13A 1F36A 4BUGA 4HW0A 5HNHA 3QBXA 3T7ZA 3ALYA 3GMEA 3FK7A 1ONVA 1TW3A 5DTDA 2MYSA 3QRFF 4YORA 3EG0A 2NVUB 2L0AA 1JL1A 4HVUA 1KVCA 4M77G 1TKDA 4H8KA 1A5VA 1GXQA 3S32A 2DL7A 4CZKA 4YEJA 5CHZA 3REBB 1UOCA 2FL7A 2CS7A 2EQRA 3OYIA 4JI3K 1U2VA 3G73A 1XJWB 5LFAA 1ZBSA 3KK3A 1HNXK 3KZBA 1D1BA 2UYTA 4MDBA 2V8IA 4WK8F 5DM7L 3F10A 2PJRB 5DDGA 2VKEA 3AVFA 3S1QJ 3FJ5A 1YHQQ 1WEGA 2J06A 2FXAA 2A7YA 2RQQA 3QP5A 5TGTA 5KAFC 2DZ9A 2NRHA 2D0NA 1S1TA 1MDUB 2Z2SB 4W1UA 1Y64A 2XIGA 1NK4A 2ZBKA 1D0YA 1REPC 1RBSA 1M90R 3WUHA 3CCSI 5DYMA 2K9NA 3S2WA 1L3UA 4M78E 2JUFA 3OB9A 3KBGA 3GDQA 3KEQA 4XH5A 4FJGA 4Y3OA 1OX9A 4CGIA 4DTOA 2JTMA 4IHWA 5DEQA 1Y1WJ 4B6MA 3AL0B 2CUFA 1RDBA 1JJ2P 1W7AA 5I42A 5FPEA 1QO0D 3UKUA 2ZSHB 4B3XA 3K70C 1NK5A 3BPXA 2CH0A 3HTUA 3ZQLA 2YHXA 2W82A 1LWFA 3MCZA 4J9DA 4N0BA 4EPCA 4LLNA 5C0YA 1NJXA 3LP1A 4XOTA 1ZARA 4RTVA 4DSKA 4BC5A 4JKAA 3VF6A 2KBTA 3SK3A 2W6LA 2MAMA 4HRIA 2OTLQ 3DFGA 2ZPGB 2K9GA 2AIRB 3J7YJ 2QQ8A 3L2UA 4WQ4C 2L02A 2HBPA 3JW4A 3F23A 2EFIA 4Q5VA 3TP0A 1YITT 2HCKA 1DQUA 3PVLA 1KQ2A 5AQOA 3CWAA 2YHAA 5C15A 1YS7A 4KITB 2Q2EA 3SNNA 3QBYA 2O8EB 1NKEA 2OPRA 2P6TA 1QLYA 3OYDA 4XU0A 1VQ5I 2TCTA 2QQBA 5ECAA 4A62A 2PMUA 1RDCA 3PMIA 1HKQA 3PY8A 2KW4A 8ATCB 1FEXA 4D7MA 3DLLA 4JKCA 4DFPA 2AKLA 4V2GA 5CVJA 4DMNA 3U9DA 1DP3A 3OW2P 4YOWA 1FWZA 3LZJA 2WAQA 1MU2A 3ZMDA 5B3SH 3QODA 1V1CA 4PL8A 3CMEN 4IFEA 4M3GA 2K6DA 2EKHA 3AO2A 4M41A 1RI7A 3CUQA 2NRXA 4CFCA 2K79A 3K7AJ 1OZ3A 4CZIA 5GAOn 4AHCA 4ME7A 1LCUA 4DEYA 4HSTA 4QS9A 4JJNK 4O5VA 5J2NA 3OYFA 4FT2A 1FJGK 3OS1A 2R5ZB 2SEMA 1FBUA 4M6YA 3VB2A 4QTRA 2YPRA 2E3IA 3OMYA 2CV2A 1O4XA 3TBIA 3ONQA 5KCHA 3J7ZO 5D5UB 5IT9O 1XN7A 3SFIA 2Y0SN 2M3AA 2AT1B 3BDPA 1UGRB 3EPZA 3C12A 2BOLA 3O3KA 4C8QA 2P7VB 2WY8Q 1Z26A 2VWJA 4DTNA 5CQEA 3TMOA 3IKMA 3K1MA 3F0CA 4BY6B 2QW9A 4DG1A 1ZSZA 4V2FA 1JJ2S 1KLMA 1TG0A 2STWA 1UJYA 4I76A 2VC8A 1EWRA 3H3ZA 1TKTA 1SG5A 3WGGA 4YHHK 2K85A 3HYIA 5FB2A 3IRRA 1YHQT 1EJ9A 1R0CB 2E64A 2QWNA 5J6XA 1O3TA 2XY8A 4DV2K 2FUG2 2MW8A 2DODA 4M77E 3CP2A 3H0HA 3MVPA 1VUBA 2VBWA 4B3OA 2IGOA 4Z2YA 4EJVA 5M5YJ 4KH0B 4MGRA 1KIKA 1M3AA 3EG3A 3AVGA 4DV7K 2RNGA 1M90O 2ME6A 5ILUA 2B6AA 2H6CA 4J9EA 1VSMA 1WPKA 4OPHA 4Y7NJ 4GVEA 1UB9A 2VI6A 2LY9A 4FL6A 2XAHA 3FKIJ 5KGXA 2Q36A 7AT1B 1YS6A 3AL0C 4CW7B 5GAMj 4XLPF 5M1NA 1J0RA 3VRZA 1NH3A 1SD4A 1TUYA 2KQRA 2G8HA 2HQXA 3JTGA 4M75A 5HDKA 5CAIA 1PCXA 2DL3A 5M1PA 4ZDLA 1YJNI 3HK2A 1MNMC 4A3LJ 1SSHA 3VJPA 3ZSWA 3QOPA 1VQ4Q 2W48A 4JKHA 3I4MJ 4KH1B 3OH6A 2EQIA 1QVFS 1RR7A 2K5LA 3OW2S 2D1VA 3H0IA 5J26A 4ZN3A 2ZAEA 3FFKB 3QU6A 5AQLA 4LF9K 3CJ7A 3CVTA 1YYVA 1ASWA 5J47A 4XORA 4DZJA 4K0KK 4WWCA 3LQRA 1NNEA 3EL2A 3EH1A 1A5JA 4C0DC 3ZPLA 1FW6A 3CCRN 3S2DJ 1FTZA 4IRIA 1FC3A 5EG0B 3BG7A 3HVTA 3RR6A 1SD6A 1TAQA 2CV0A 4EJTA 1OKJA 2VOOA 5LHGA 4G94A 2Q2EB 4A4HA 3ISPA 2LY2A 2HVHA 4J9GA 3FDRA 3WXIA 2E10A 5B5EC 4NQWA 4FJXA 5FKOA 3QXEB 3HRSA 3MFKA 4DU1A 1JTXA 4NUBA 3CBOA 1OYIA 1P7IA 2HWVA 1TV6A 4JI7K 3SBTA 3UKRA 5J1YA 4Y52J 3X24B 3KLHA 2HXOA 5BN8A 2P4WA 3VQ7A 3MXMA 4FVUA 5I9EB 2JA5J 3FJPA 2RGVA 4JI8K 5I22A 3BP8A 1A04A 4MO4A 3IC7A 1VZ0A 3MECA 1YJWI 1GFDA 1JGSA 3WGHA 2KNBB 1H3ZA 1TWCJ 5DLOA 3SDBA 3CCUT 2HQEA 1JKOC 5E79C 3CCEQ 2JVGA 4FWLA 5FWBA 2DTHA 1XG1A 2VKDA 2OD5A 2TDXA 3X28B 4LOCA 2KHMA 4CCJA 4P96A 1IN8A 2K9MA 3M59A 1VSDA 5LGNA 5CKEA 2DBMA 1O7LA 2OX7A 1M2VB 3CC2A 3E6BA 1V76A 1MMNA 3ZFJA 4NXNK 5CYVA 3EG1A 2CYYA 3HP9A 1VQ7A 2DMUA 1T33A 2IT0A 4JDSA 4E19A 4HKEA 2HDCA 1KLNA 1MWMA 2EFNA 3FKJA 3ZN0A 1HA8A 5ILVA 1X9WA 4IUUA 2F7TA 4C2MJ 2A42A 2L9NA 4NDLA 2XMFA 3X25B 1N27A 3VQ6A 4DBRA 1M4ZA 4C9YA 3EFSA 3RZDJ 2L8DA 2YNIA 3TAGA 1X58A 3F6VA 3SD4A 5LJ3e 2XAJA 4BRFA 4KHSA 2NOHA 2JSPA 2NNWA 4OMPA 1OVQA 2CUZA 3RKXA 1S7OA 3CBPA 1TWFJ 1LEBA 1U5SA 4IZZA 4MMKA 4G7OF 4YPHA 2XHCA 2O7OA 3A8HB 5E26A 2HXIA 3CJTB 1WZOA 3NARA 1M1KU 1GOAA 1A6QA 2Q8KA 5GANe 3BTJA 4DWIA 4RCHA 1KFSA 4DSEA 3S1RJ 2O8BA 4ABZA 3GP8A 5AIQA 3IHOA 1WAJA 4CHYA 1ZYQA 1UA1A 2KGTA 3V9SA 2X9DA 4O8KA 1GBQA 3KFVA 3TOBA 3VQCA 4Y4RA 3EG9B 4EVIA 4I01A 3DKYA 2R7ZJ 3HPOA 1KK7A 3NMUA 3AG3H 4FK2A 1FXXA 3W2VA 2GUPA 3ZETB 3CC4N 3KEOA 1XTAA 3KK1A 4ELYC 2HQ5A 3S14J 3AVLA 2GCXA 4Y91A 2IS1A 2RJCA 5KYWA 2NRTA 1I81A 5HDGA 2ATCB 5BOXA 2GUIA 1LWWA 1MMSA 1ETKA 3AVJA 5BPDA 3JRFA 4Y17A 1WFXA 4ZYAA 1RR8C 4LB6B 4XTVA 2KFNA 1AHDP 2HTJA 2X35A 4F7UG 2QM3A 1W5CC 2JTVA 1RESA 3IAS2 3K1NA 3GNGA 3GTLJ 2LQKA 3HGYA 1ZG1A 1S1XA 1NZ9A 4NLCA 4ZN1A 4DR1K 3VQ8A 4EMKA 4NQWB 3L4QA 2ZJQF 3KLEA 2DFIA 2QSGX 2XF7A 3OHRA 1NG7A 3M57A 2FPFA 2CGKA 2K3PA 1ZX6A 2QDLA 3CJ9A 1WKMA 2EB7A 3IQLA 4OIOF 5EY4A 1WJQA 2XPUA 4BS9A 1RLQC 3JCMd 4M42A 1X3WB 2KDSA 2IAIA 2A6HF 2O8EA 3E6CC 1SF9A 4L0YB 2IVPA 3NFCA 1J9IA 2QA4Q 2YU3A 1ZG3A 1MV0B 3VEOA 2WB1A 3ESWB 4DKWA 4OAYA 5BPMA 1K83J 2XASA 4PJOD 3J7YP 1K8AR 4KTWA 2EHGA 5ADXA 3UKRB 1HU0A 1LPLA 3ULEB 3O1WA 1HDPA 4LG3A 3P8HA 3E6MA 3QYEA 5FFZA 2DPNA 3SFZA 1U3EM 1ABOA 1FKOA 3VTIA 4B08A 1NJIR 2BUDA 4FWMA 1HW5A 4FLYA 3RR8A 2DTRA 3KFWX 4A3IJ 4ORZA 1OCCH 1S72A 3WVEB 2LRDA 3L2CA 5IHNA 3LDOA 4KHPK 2R7WA 5KYXB 3RRHA 3ERMA 1LWCA 3ASOH 1RFQA 1SPKA 1XMOK 1FNNA 3KD5E 3THXB 2KFZA 3MAQA 3DPUA 4A69C 1R23A 3M7GA 5LJWA 3H3VK 2QASA 1NMNA 2YNGA 3I0RA 1A36A 5HLGA 4CHPA 3E9LA 4CCMA 2VG5A 2DT7B 1MDMA 4WQ4A 4C23A 2JS0A 2P9LA 2RREA 3MX5A 4F52A 4MNUA 1UGSB 1WH5A 1YJ9Q 4IFVA 3C18A 4PL6A 4JYAK 1I5OB 4MTEA 4AFZC 2ZXHA 3CCQT 4RDUA 3C6UA 3OS5A 4WF9L 1C0GA 2HS5A 2HI3A 5I2MA 4CJ4A 3M6GA 2CP2A 2WC9A 2X4HA 2E6LA 1APLC 3RMDA 4CJTA 2X4JA 3CCQI 2HDDA 4OMFB 4Q5WA 4FASD 5KYXA 1U6ZA 2CO5A 1TTYA 5DY9A 1BDGA 1EKEA 1SMTA 1C6VX 4DTJA 2OPPA 5CQYA 2RN7A 5FJ8J 2BKDN 3OA6A 1L0OC 2L9SA 1LW0A 1NGJA 3HTSB 4YFXF 1JLBA 3VUBA 2FU4A 2KXCA 2KZZA 1ZBIA 3J7ZI 1NK2P 2FBTA 2P9PA 4JD2A 3T8TA 4CHQA 2DPUA 4CZHA 3FE1A 3WTTC 3SEQA 3M4GA 1LFBA 4GDFA 1M1EB 3BF1A 2BY1A 4CJQA 2HQNA 5CKTA 3WEEB 1U49A 2RQVA 3F73A 3AO3A 5LMNK 3CMAT 2R0QC 1HD3A 3G71I 1RUOA 2UXDK 1O9SA 3RPUD 1SAUA 2XVCA 4WCEL 4JV5K 2M8EA 5D4SA 1E3OC 1M27C 3MWTA 4KBOA 2P9IA 1LDKB 3OL4A 3DV8A 2H3GX 1N33K 1S8NA 3ZX3A 5HY6A 1KG1A 2W03A 1GLCG 2DMOA 1GOCA 3U1KA 3JCMf 3PNWC 4X66K 4DCHA 2M9HA 4M78A 3IMXA 1W36C 1UZCA 5GTIC 2B86A 3PFSA 1DGKN 4OINF 2ZSIB 1NLOC 1WYXA 1RT2A 3WQUA 1WQ2A 1TC3C 3FISA 4OP0A 3GWZA 1I3AA 4GV3A 3V9ZA 1XHZA 2EKOA 3RTRA 3QINA 2BY3A 4KTZA 1X9JA 1MUNA 4YELA 5IHKA 3Q3SA 1JUPA 3JREA 1IGQA 2O8FB 1C0WA 4GKJK 3FM5A 2CGJA 4OKKA 2ICWG 1S6QA 4A3BJ 1YI2I 4TSXA 1ATNA 3CCLA 4GMJB 2W57A 5KN8A 3VEWA 1Z91A 2KEAA 2GTDA 1HKTA 2X51A 1YVNA 3CPFA 1XOVA 2KZVA 4E7JA 2JT4A 1GVDA 3F6OA 3QO3A 2GWKA 1YO5C 1LOJA 5DV5A 4C1NK 2H27A 4BH9A 3TOAA 1ZSZB 2PMZN 4YIIA 3RMSA 2KMTA 1YQRA 4L3QA 1U4BA 1EFNA 3I8BA 2HKOA 3M53A 1MBEA 1R59O 1YJ9I 4HYEA 2JMAA 2OPSA 5LHHA 1ZQ3P 2OPTA 3RDIA 4G6TB 1A31A 1JJ6C 3VWBA 2EA4A 3S41A 4BXFA 1RT5A 3H36A 3UIQA 5EZHA 4DQSA 1B72B 4FO0A 3CLQA 2FNAA 1SMYF 1TK5A 4OMOA 3M1EA 5AJ3K 3TDZC 1W0UA 3ZT2A 5F1RA 4F7UA 1QP2A 4MZMA 1SRMA 3FBIB 5A2QZ 3N4MA 1AWCA 4RTWA 3K4MA 5GAN6 1KYZA 2CSIA 2ZPBB 4ZGEB 4E1JA 3TO6A 4B9QA 3JCMX 3CCJI 1F9NA 3JRBA 2EQKA 3HIFA 3IWFA 3EKSA 2P51A 2XY5A 4A4KA 1E6HA 4EJOA 3CQYA 4OX9K 1BR1A 5I2SA 4WTOB 3MMVA 2XD0A 2LBFA 2V8JA 2ZM6K 2KQ2A 1SEMA 3TDUC 5GIPA 5D5WB 2P0KA 4RW4A 5EOYA 2X3WD 4NL2A 4YFUA 4FJ8A 1LAVA 2FYKA 4B3SK 2IVWA 1Q9YA 3CCEN 4LUEA 5C3EJ 1D0ZA 3CIPA 2CMPA 1D3YA 2VQCA 2JPSA 1W0HA 3GTPJ 2NS8A 2NVTJ 2C0IA 2Q0OA 4XN3A 3CUOA 3NF8A 2MH2A 2WV0A 1YJ9T 1VQ8A 3O5ZA 4O5FA 3DXKB 4M77B 2F8TA 3TTCA 4G1QA 3R3LA 4N4GA 4RW6A 4CJWA 1OH8A 2KY9A 2L7KA 2BXZA 2NOIA 4JRQA 3BR2A 2PI0A 4OFHA 3GFMA 3FBNB 1JUMA 1RNHA 5AQNA 4DTPA 2DTZA 1SS6A 3A98A 2ZC2A 3AVKA 1KD1R 5KCMA 2D8HA 3IAYA 3LA3A 1N36K 3BCBA 1IV8A 1IKVA 4HBLA 3DPLC 4A5NA 5AQHA 3TSPA 1GLDG 1VQKA 2FEIA 3K70D 1TUGB 1YCSB 5CJ9A 4NYNA 1X1PA 2RJEA 4FX4A 4LXCA 3GX4X 3RESA 4BRKA 4I98B 4FLWA 2QSFX 1G59A 1QZ5A 3CMEQ 4XLEA 2WTUA 3DKXA 3A0HC 4AM7A 5FPNA 1PRLC 5K5QA 3BLYA 2QA4N 1V3FA 1JJ2A 5TKWA 2VG7A 3TABA 4FL9A 3LDNA 4EHTA 4LMYA 4DQQA 3V7RA 1WI3A 3WTZA 4MDWA 1UGPB 1VQ6N 2NRRA 3SUPA 2E2OA 5IH2A 1TK0A 3JSCA 5AQJA 3CF5L 3JRAA 2D9TA 2E2QA 4BHPA 1ZLKA 4AFUC 1BCMA 2FOWA 5L3BA 2D1XA 1NK0A 4H0TB 1NK6A 4AYBA 2OJED 1HSQA 1V55H 1NPRA 1TSFA 2DERA 1V4TA 2HHQA 1M2VA 1UG1A 1U6GA 4YTLA 1E3HA 3K57A 3SPYA 4CEOA 4UC4A 2VCPA 2AJQA 4M74A 1NGHA 4FWPA 4LY7A 2HVIA 1PU8A 1GRIA 3LDSA 4J8OA 4G9YA 1K4TA 1VK0A 4M7DF 3H1CA 4B3RK 2QGUA 2XKOA 5HOOA 3IRXA 3L1PA 2DK5A 3MKYB 4XRFA 2BH1A 4M7AA 1QSLA 4LNPA 3LGFA 2JVHA 4KH4A 5GMKh 4KPYA 2KIFA 2R7OA 3RCOA 4DQ8A 3CC4Q 1SUQA 1H9GA 2HL3A 3FZHA 1P7MA 3R61A 2QA4I 1VQMT 4CBWA 4I0AA 3OW2A 2YRVA 2GEMA 3CC4A 1V54H 2Y48A 4K8ZA 3ID6A 3WXJA 3M8PA 1TOVA 5AZJB 4E9GA 3DLEA 1B07A 2E34A 4M7AF 5KGWA 1MMAA 5FKLA 4M78B 5C10A 3DU6A 2A3ZA 3V4GA 2CUDA 2YV0X 3QESA 4C8LA 1X3NA 2HZYA 3EAEA 5T7BA 2HOSA 2ZFWA 3CESA 2QDYB 3QDRB 2RK2A 5DMRA 3CCYA 2WY7Q 1Q7YR 2JMCA 4KMFA 4FK4A 3M4OJ 2ADUA 4HOBA 3KZIC 1IXCA 1VSHA 4B3TK 1GLNA 4EDUA 1KHCA 4QWQA 3MN6A 2J05A 3U2RA 1MW7A 3EDPA 5A0GA 1M3CA 3J7AF 3FZFA 1W7PB 1UGQB 3QPSA 2QWLA 1I6HJ 1D8KA 2O03A 1LAWA 2RQPA 1ZRDA 5LY3A 3THXA 1JTYA 2L3RA 1RBVA 4EW0A 5M1OA 1UHWA 1MGQA 3QEVA 2DD5A 2EYYA 5IT9E 2D5VA 4CD3A 2YUSA 3LSKA 3H9QA 4YG2F 2JXBA 3COAC 1OU9A 4G12A 2A6AA 3MJXA 1YJNT 2V4JC 1UAXA 2NUBA 3QNNA 1GXIE 4BHBA 1IN4A 3VKIA 2LC2A 1WPYA 4CICA 3D2EA 1YWOA 3G6EQ 3E7LA 2IS2A 1LWEA 2L7FP 3CQXA 2HOEA 3GL1A 1U8BA 3PNTA 1BA5A 4LJZF 1DJ7B 1VA7A 5LJ3d 3RSEA 4Z4FA 4J6XA 4HF2A 3W0LA 4A54A 1TZLA 4A53A 4C30A 4E7ZA 4E6KG 2DYIA 3CHWA 4OFEA 1VQLA 2RDPA 1KCFA 3OS2A 3KP6A 3P9CA 3GLLA 2CQNA 2EWSA 4JI0K 3VFZA 3FSPA 4I2QA 3G1OA 1SKWA 2COBA 4RG8A 5E41A 1F1BB 3BY7A 1ODDA 4B9NA 1JE8A 4WFBL 3DMJA 4OB1B 1EWQA 1W6XA 1ATRA 5HS9A 3JCMg 2ESWA 2O01E 1RDDA 1W1FA 1J59A 2OZSA 2GXBA 5HDNA 2NRWA 3CQTA 3WGIA 2VUMJ 1AZGB 4CJFA 2NOJB 3ABTA 4LITA 2PBIA 4OB0B 1RAEB 1HLVA 2FBXA 5EF6A 2K40A 4WFAL 2OAUA 1SVOA 2ZQBA 2HFHA 3EE9A 4N41A 2K9LA 3I55I 3OYAA 1IRGA 3BFMA 3MEGA 4EW4A 4GXOA 3CWTA 3V9WA 2EZHA 2VXZA 3QIIA 5E8GA 3L3VA 2IC3A 2P9SA 2PG4A 2CV1A 3VQBA 4LDYA 2FQ3A 5CLSA 1B9MA 1ERDA 2QXLA 3CMAN 5E1XA 2IS3A 2HPMA 1SC7A 4BQOA 5A0DA 5FGMA 2MA3A 3VQQA 3ZQHA 3VRYA 1OX8A 1OVYA 3I4PA 2CZ6B 4KV8A 2XY7A 4O0JA 1Z9CA 4L59A 2R7YA 5GADJ 4S05A 4IVNA 1JUSA 2QWRA 1WN7A 1U48A 3QSUA 3V9XA 5KQ8A 5JLHA 2ZZDA 2V1NA 3TKYA 4FU6A 4U87A 1J09A 2OYQA 2F8SA 3EO3A 4HCCA 3QYBA 4IOAL 2G8WA 2YUQA 2DX1A 1N6AA 4A0XA 1QPMA 1MIJA 1WGXA 5KYUB 3ENBA 3GBTA 3DXKA 5AZIB 2FSWA 4AHSA 2E70A 2E1YA 5HLTA 3IH4A 1S1WA 2W42A 1UWBA 4BRPA 3M0TA 1Q95G 3E2UA 2IPOB 4M77F 3MPUB 4BBRJ 3H9GA 4DQIA 4CI0C 2DO7A 4UB8C 3HRTA 3HTVA 3KKSA 3C7NA 3OYLA 2OFIA 1BL0A 1NHAA 2JSCA 1ENHA 4M3UA 1MMGA 4JI1K 3VPRA 4BVPA 2COMA 4HDVA 5FW9A 4L5JA 2RPNA 3BJAA 3SYTA 1BKBA 2H8RA 5C4XJ 5ICFA 4CEAA 3MWPA 5BRDA 4C8QE 2JVVA 2M34A 4XK4A 3FXUA 3HRUA 1I1SA 1K0SA 1CKBA 2BXYA 4M75D 3IUOA 4CGGA 1UA0A 4B9SA 3CCQA 3ZEHA 1LJ9A 1MHNA 1OU8A 3MCPA 1LUJB 4M75F 2QYZA 2VKNA 2G8IA 2W84A 4A5BA 4IIMA 1T3LA 3QJ6A 2HYJA 3O4QA 2V6EA 1M8VA 2A5YB 3HOWJ 3LSGA 3ZSRA 3CDHA 4IEJA 1SANA 2LCLA 1CZAN 1TLHB 2YX4A 4MQ9F 4HCKA 3QBWA 1JXBA 1OKRA 3FHGA 4B22A 3UKUB 1YJWN 2D45A 4C5GA 2VWKA 2BV6A 1LFUP 1F1ZA 3MMYB 4AH9A 3I4NJ 4B9VA 2ZMEA 2RVCA 3OYGA 2PVOB 2F5FA 3IAM2 2VBXA 3Q9SA 3HT3A 4EA5A 2JHJA 4M7YA 5FU6C 2E1HA 4DV6K 1V4SA 3MCAB 4O8UA 2VQEK 2MI6A 4LIUA 1YIOA 4HTUA 2EA2A 5J4YA 4OMZA 5AQYA 2Z3YA 3CD6A 2LDMA 4XICA 5FPMA 2DETA 3FMRA 3THYB 4IHSA 3SQNA 1O3RA 2MCNA 4OIRF 3M1FA 4LN2A 1ACIA 1V5EA 1HKBA 2QEXA 3PV8A 4BRLA 5CVIA 1JXEA 3A03A 1CF7A 3E01A 2KL4A 1TWHJ 4DJAA 2PQWA 2BZTA 2VQFK 2HQRA 3ZSZA 5AQRA 1KD1C 3ECOA 2CP6A 2BE2A 1SD7A 2E5ZA 3L2ZA 1B9NA 4I7HA 4OIQF 2QF7A 3PO5A 4BQLA 1YITA 3JCMb 4XU3A 5D8LB 1X19A 1E0EA 1JQQA 2BVLA 3GZ6A 4NC7A 5IOZA 2ABLA 1W2BM 2GOMA