4BE2A

Pfv intasome with inhibitor xz-259
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be2A03
4FW1A 1MHNA 4CGDA 1LWFA 5DMRA 4QQGA 2RHYA 4HUFA 3OB9A 5KTQA 3HM9A 3QETA 2RJFA 1T8EA 1D5AA 4BE2A 5CIUA 1ZBIA 3AA2A 1GOBA 2P51A 1RTDA 1S6QA 4KHUA 5HRNA 4FK2A 4I7FA 1VSJA 1JL2A 2K3YA 2X4XA 5CY4A 1UA0A 3S9HA 1LW2A 4FLZA 3ZT0A 4L8RB 3HPGA 5FRMA 1LAWA 3SCXA 2RHZA 4CGGA 1EETA 1OZ3A 1RT1A 4IFVA 5SZTA 2B5JA 1I39A 3PY8A 4BDZA 4O0IA 2LRQA 1C6VA 2VWJA 2PQWA 3QKJA 2AJQA 3QIIA 3NTIA 4YFUA 3CYMA 2YNFA 2DFHA 1S1UA 1CXQA 1C0MA 2G8IA 2EHGA 3HPOA 2X4YA 1A5XA 4DG1A 4B9VA 4Z4EA 3LZIA 4CHZA 3MEGA 3KKRA 1ASVA 1U4BA 4FJIA 2JGUA 3K5LA 3RR7A 4OPKA 5FRNA 3NE6A 1KRPA 2W42A 1QQCA 3DLEA 1TAUA 4KHQA 2Q3SA 3MXIA 2F8TA 2PY5A 1QTMA 4DFKA 4H4OA 4E7JA 2BUDA 3LANA 3TARA 3HP6A 2HHQA 5C24A 1BCMA 4KREA 4M41A 5DK5A 4HUEA 4DTJA 3MAQA 4AHUA 1BIZA 1NK0A 3AA4A 1HNIA 3NH0A 1UAXA 3EY1A 3GOXA 1T03A 4NCGA 4N4GA 4Y1CA 3SV3A 1A5VA 2P5GA 3MECA 3NHGA 1RTJA 4DTXA 3KLFA 1JKHA 3C6TA 1JLEA 3OYGA 4TSXA 3L3VA 3E9GA 2DIGA 4F8RA 5KRSA 4OLBA 4CJ3A 1NK8A 3AO5A 5J2PA 3HL8A 4CEQA 1JLGA 2GF7A 2IS3A 4FZXC 1J5OA 3QIOA 3EYZA 3TAGA 1VSDA 1CXUA 1XWLA 4J2EA 1WSHA 2XY8A 4HCBA 4CJPA 2ZQBA 1C0TA 3ZEHA 4KKOA 4B9NA 4PUOA 4N56A 4IFYA 2WOMA 3L8BA 5CZ2A 1SL1A 2OA8A 4BE1A 2RI3A 4ELTA 2L8DA 3VQ5A 2P5OA 4CGHA 3MEEA 1IH7A 2F96A 4BACA 1KVAA 3FLGA 1YTAA 5J2MA 3MEDA 1MU2A 1BI4B 4FJHA 4Q5VA 2IDOA 3H6ZA 2FBTA 4EP4A 3CM5A 3AVNA 3L2QA 2KQ2A 2GUIA 4KB1A 1S9GA 2JLEA 4DTMA 4DSKA 3K57A 4FLXA 4CJ4A 4E3SA 2R5AA 3M8QA 1NJZA 1N5YA 1HQEA 3F70A 4KPYA 4CJWA 4ELUA 3AA3A 4LY7A 2MWPA 3F9KA 4CEDA 1U04A 3AO3A 5HLFA 1DLOA 4N4HA 4GVMA 5I42A 1FKOA 3H08A 3F73A 3VQDA 2JTFA 4E7HA 3CFRA 1RT7A 4G1QA 3DLKA 4LH4A 2LTOA 1NK7A 3QEXA 5FDLA 1A5WA 1VRUA 2G8UA 4IBNA 1Q9YA 3O3GA 3BDLA 4AHCA 4UC4A 3L2WA 1U48A 4MQ3A 4CK1A 5C42A 4CECA 2ZE2A 3LPTA 4FM0A 3VQ4A 1Q8IA 4M3WA 3LAKA 3QEIA 2R5MA 3FDRA 1SKWA 2YV0X 4N4IA 1C0UA 4C8KA 3LDSA 3NTHA 2EQMA 1RTHA 3ME9A 4EDUA 4CHOA 1NKBA 1Z26A 4GY5A 1O1WA 5FROA 4PA1A 5CYQA 5HP1A 4DLGA 1KTQA 1D9FA 1NOZA 4W5RA 2XO7A 4A4HA 3DLGA 1RT5A 3NGIA 2HHVA 3ZSWA 4KHWA 2DIQA 3PV8A 4Z4IA 3AVGA 5T7BA 1S1VA 3AVCA 1RBTA 3HK2A 1HJRA 3OS1A 4C5EA 4BD3A 4FYDA 2X6NA 4FXDA 3PO5A 4CEOA 4N5SA 2EX3A 1OI1A 3V9UA 3DMJA 2HHSA 4CHPA 2F8SA 2RO0A 2RJEA 1WAJA 2QQSA 3Q1JA 1K6YA 4KAZA 4HUGA 3TR8A 2YKNA 1WJQA 1LAVA 4PLLA 2Z1HA 4IUPA 2IGIA 3V9SA 3V1OA 4N76A 3HJFA 3NF8A 2ITGA 3MO8A 4CEFA 4E7IA 3AO1A 4RG8A 3K5OA 1XHZA 4DTOA 2RI5A 2DY4A 4H4MA 4PLIA 3JYTA 1QS4A 2HB5A 3PX6A 2F5KA 5D6XA 4FK4A 1BCOA 1BISA 3VQBA 3TAMA 1VSFA 5M9OA 4NS5A 4DU1A 3PO4A 1NK4A 4OLAA 3DI6A 3H8ZA 2PZSA 1EP4A 4PY5A 3LAMA 1D9DA 5HBMA 4CF2A 4FL6A 1B9FA 4ELVA 1UWBA 3PUFA 5CZ1A 4DU3A 1NK6A 3RWUA 3VQ6A 2PYLA 3P8HA 4CJTA 2RKIA 1GOAA 1ZBFA 3VN5A 3DM2A 4IKFA 2QK9A 1HPZA 2GFUA 2OZMA 3DLRA 1RT6A 4O55A 3FFIA 3LLRA 4KHYA 2LDMA 3AVBA 3KLIA 4IUTA 3L2VA 2VG5A 2L3RA 2PYJA 4FJNA 3O3FA 2RI2A 3KD1E 3B6OA 3E9FA 3OS2A 1S1WA 2YNGA 4LSLA 1RBVA 1KVBA 2RJCA 4BWMA 3KK2A 1GOCA 3DLBA 3OYJA 3SPZA 2QQRA 1C1BA 3LH0A 1RDCA 2G8KA 3AVAA 4IUUA 2KTQA 2BANA 4AHRA 1X1PA 2R7YA 4CGIA 3LYIA 3SUQA 3P5JA 4O44A 3AVMA 4X34A 2HW3A 2G3RA 1HNVA 4C8OA 4F3TA 1NK9A 4IUVA 1J9AA 3QNOA 5SWMA 1UA1A 3V1RA 5KE2A 1ZBUA 3CFPA 3MEUA 4KI6A 1FKPA 4M3XA 3NAEA 2B4JA 2EQJA 4Y1DA 2OPQA 2G8WA 4JS5A 5J2QA 3ISNC 5J2NA 3E01A 4CGJA 4Z02A 1BQNA 1HYSA 3QLHA 2HNYA 4FJ7A 1YVUA 4KHNA 3S6WA 5J1EA 1RDDA 1WAFA 3UT1A 4IG3A 4WE1A 3C94A 4R5PA 3CQ8A 1KSPA 3L2UA 3OS0A 3UWNA 1RDAA 1Y97A 3SQ1A 3HXMA 1XC9A 1C1CA 3ZSVA 5EU7A 1Z25A 4H8KA 2EFIA 1KFDA 4B08A 3CEYA 2LCCA 4F2RA 3DB3A 3RTVA 2L89A 3ZSZA 4RW4A 1L5UA 4RW7A 3ZSXA 4OKJA 3AO2A 4II1A 3OYDA 3LWLA 4XIUA 4CFAA 1OYXA 4LSNA 4ZTJA 4M3UA 2B8AA 4FJ8A 1TGOA 1CLQA 4ZHRA 1FXXA 3NF6A 3RMAA 3LX7A 4W5NA 4LH5A 1U45A 4NCBA 4KTQA 1JLAA 4CIEA 4EP5A 1QE1A 3NGZA 4JLHA 4KI4A 4I9LA 2WONA 3FEOA 1C1AA 4I2QA 4FZYA 1TAQA 2ATQA 1WSJA 3HT3A 4JS4A 1OZ2A 3LP1A 3SNNA 4OKKA 1HRHA 1BHLA 4IG0A 2D0BA 3V9ZA 3KLHA 3SUPA 4FJLA 1BQMA 2D0AA 3ULDA 2HMIA 1B92A 3QINA 2RHIA 3ZT1A 3LWMA 1VSEA 2BGGA 1RT2A 4CK3A 1X9SA 4KB0A 3ASMA 1VK0A 4CESA 2KZZA 3OQ5A 3AVHA 3TI0A 1S5JA 3I8DA 1B9DA 1G15A 3THVA 2Y1JA 4CK2A 4A4FA 5E41A 4FLTA 3LP0A 3PFSA 4CJEA 4DF8A 3LGLA 3RR8A 4FK0A 1WSIA 3MXJA 3DLHA 4PWDA 2X35A 4ID5A 3PNWC 3LGFA 2K3XA 3VQEA 1JLCA 1JLQA 1IKYA 3U3GA 4DTUA 4OJRA 3M8RA 3HPHA 1BGXT 4Z0UA 1X9WA 3L3UA 4MFBA 3K2PA 3SZ2A 2XY7A 3TABA 4E19A 4CGFA 5IAYA 2X74A 4EZ9A 5J39A 1WSFA 3NH1A 2OYQA 1HQUA 1RT3A 3OYEA 1D8YA 1RBSA 4CF9A 2I5JA 4O4GA 1WJRA 3OYAA 4RG2A 4FU6A 4CJQA 4FJ9A 3AVFA 2XY5A 5JS1A 1KHCA 4HCCA 3M9QA 1TK5A 3RRHA 5C6SA 2NLUA 1RTIA 3ZSYA 3RRGA 4CHNA 4CF0A 3TAQA 4CHYA 4NZGA 2XRIA 3DOLA 2HHWA 1RI0A 3QNNA 3HP9A 4E89A 2ETJA 1U47A 3T3FA 1IG9A 1I3AA 3KD5E 4KTWA 2BKDN 3T19A 3SQ4A 2A1RA 3PMTA 4CF1A 2OPSA 3V1QA 1SKSA 4B3OA 4HHTA 2DFFA 3UIQA 4CIGA 4FCYA 3DRRA 5C25A 1DTTA 4CJSA 3PX4A 4QQ6A 4B9MA 1QSLA 1T7PA 2FBYA 3AVIA 5KCOA 4BE0A 3PX0A 4CJUA 1NKCA 1TK0A 4QVZA 4J2DA 1ZBHA 3C4SA 2A1SA 3MP6A 2R57A 2BDPA 4KHSA 2EQKA 3T1AA 4AILC 4W5OA 3NCIA 3CG7A 1TK8A 3SQ2A 3AVJA 4I2PA 1HYZA 5HRRA 3DB4A 3OYCA 4CFBA 2HNDA 1TVRA 4OVLA 3SQ0A 1G5VA 3ZSRA 3SUOA 4KO0A 4OGEA 1JLFA 2JZ2A 1TV6A 4DSJA 2D0CA 4O5BA 4F2SA 1TKZA 1WLJA 3VQAA 3WNEA 4FJKA 5HRPA 2HQEA 1RCHA 3D45A 2VWKA 1X9MA 4HCZA 1KFSA 2KFNA 3ITHA 1TKDA 2RHUA 3V4IA 5CYMA 2M1HA 3HVRA 2P0KA 4B9SA 2YNHA 2HVHA 4GMJB 2OPPA 3OMGA 3L42A 1HMVA 3C95A 1KVCA 4Q0BA 1ASUA 1XHXA 3KJVA 1L3SA 4DS4A 4DSIA 5K14A 3TANA 1NKEA 4K8XA 4E0DA 3LPUA 4KTZA 4KFBA 4Z4FA 1SSFA 2XDPA 4IUQA 1BIUA 1QHTA 4M3RA 3AV9A 3JSMA 4Z4GA 2DTUA 4DQQA 4B9WA 3V9XA 2KW4A 2DFEA 3DYAA 4IURA 1Q9XA 3M8SA 2M16A 3IG1A 4DTNA 4C8MA 1VRTA 3NGYA 3QO9A 1YT3A 4CERA 3O4QA 2E5QA 2HHTA 3O4NA 4FM1A 2HHUA 3OA6A 1WSGA 3KUFA 4M3TA 4CIFA 3EAEA 1CZ9A 2XHBA 2RPIA 4QOZB 3ALYA 1QSSA 4QCLA 4BWJA 2OZSA 3U3YA 3EZ5A 1NJWA 4Z4HA 4J2AA 2VYTA 4HTUA 4LD0A 4DFJA 4KRFA 2RN2A 2BE2A 4K8ZA 1S1XA 2VG7A 3MEAA 3VQ8A 5KE3A 1S6PA 3OYIA 3KTQA 3RMBA 3FC3A 1RBRA 4ICLA 4FZZA 4JRPA 3LP2A 3SJJA 3OMCA 3NF9A 4UQGA 1NJYA 3OY9A 3QJ6A 3AVLA 3VQ9A 4DFPA 4EZ6A 3OYKA 1DTQA 1J54A 3HO1A 2R58A 2Z1GA 2O4XA 1SV5A 1YTUA 5J26A 3VQPA 2O4XB 4CEZA 2NUBA 3DLMA 4FLYA 1ZBLA 3G0ZA 1N27A 2FHDA 4FJMA 3KK3A 2FC0A 5KCHA 4HVJA 3KIOA 3NNQA 3ZSOA 4E7KA 1RT4A 1JLBA 1R0AA 3L2RA 2G8FA 1BL3A 3MP8A 1VSKA 2OPRA 4DSEA 1NOYA 2CKKA 4CJLA 4RW6A 4E7LA 4DU4A 4QW2A 1VSMA 4FW2A 1WN7A 2GV9A 3ZT4A 1WJSA 1FK9A 4CEAA 1SL0A 4DSLA 3NH2A 3S3NA 4NYFA 4O0JA 4C5GA 3HYFA 3ASKA 4FVMA 3QEPA 4FJGA 1H3ZA 2KZMA 1QSYA 3AVKA 2IOCA 3AA5X 4J2BA 5HROA 1ZYQA 4GW6A 3I0SA 3ZSQA 4FLUA 3NF7A 3OYLA 4W5QA 1RILA 1L3TA 4CFDA 3K5NA 2X4WA 1JXBA 4BDYA 1LWCA 3LZJA 4CCHA 3D0PA 2QKKA 4L59A 3CFOA 4B9LA 1EXQA 5IN1A 4CF8A 5JS2A 2DAQA 3AO4A 4DQIA 3NDKA 4DFMA 3IS9A 3V81A 1VSLA 3SD4A 4DS5A 3B6PA 3META 3DRPA 1ASWA 4FM2A 3K5MA 5KH6A 4RW9A 3NFAA 2O4IA 2IC3A 3KLGA 4DQRA 2Z1IA 1TL1A 2O4GA 1XNIA 1VSIA 4ID1A 4AH9A 1LWEA 4M3ZA 4OKEA 1TKXA 3SI6A 3NTKA 2YKMA 3ZT3A 3P1GA 2QXFA 3VQCA 5KGWA 3TAFA 2D9TA 2XY6A 4N47A 2IG0A 2LSNA 4CJFA 4B9TA 3LP3A 1W0HA 2HHXA 3VA0A 5D3GA 4CE9A 1BI4A 3I0RA 4DTPA 4FJXA 4CJ5A 4NYNA 3C6UA 4BDPA 4PQUA 4CJRA 2X78A 2G8VA 1KCFA 3TAPA 4FLVA 2GFAA 2RHXA 4OGCA 3OJUA 2X6SA 1NK5A 3IAYA 4DLEA 3ZCMA 4DQSA 3KKSA 5I3UA 1EX4A 4A4EA 5D6YA 1JL1A 3TWHA 1N6QA 4DF4A 3V6DA 3HSTB 4JRQA 2YHBA 1WNSA 3SPYA 1RBUA 5KRTA 4CHQA 2HQXA 2YRVA 4B8CA 3OYHA 3SUNA 1L3UA 3K59A 1SKRA 3IRXA 4C5IA 3CM6A 4OPJA 4C8NA 4CJKA 2HNZA 3WNHA 2FBVA 1WSEA 4DQPA 2E6NA 1S9EA 4E1NA 1NJXA 5KI6A 3G10A 1IKVA 5D6WA 3S3OA 2VG6A 4M45A 2YNIA 4CEEA 1W9HA 3MP1A 2E4LA 3SYZA 2ZD1A 4OVAA 2RJDA 1U49A 4DTSA 1UOCA 4CJVA 2MWOA 4ZTFA 1ITGA 2D5RA 1HYVA 4B8AB 2EQUA 1XI1A 3S3MA 4QQDA 4LD6A 3P83D 4Q5WA 3OJSA 4B9UA 3P8DA 1F21A 1RNHA 2Y1IA 4FJJA 1L3VA 3RMDA 3O8VA 3OYNA 4QAGA 4CRIA 3KLEA 1VSHA 4Z4CA 4E1MA 1REVA 3QEWA 3MEVA 3DOKA 3MEWA 4FLWA 1T05A 3M8PA 3U6FA 4N41A 4W5TA 3K58A 2QKBA 3OYBA 2HVIA 2Z1JA 3WNGA 3RMCA 2E6LA 2EKOA 3OVNA 4F3OA 1WGSA 3VQ7A 4B9XA 4AHSA 2XK0A 1JXEA 4AHTA 3TAEA 4YNQA 4CFCA 4FJ5A 2YHAA 2RF2A 4DMNA 3QESA 4DTRA 1KLNA 1IKXA 4RW8A 1S1TA 1CZBA 1LW0A 4M42A 4IDKA 3SV4A 3O3HA 1SUQA 2P1JA 3VQQA 3OYFA 3LALA 1LV5A 1J53A 1RDBA 4AHVA 4DWIA 4A4GA 3DRSA 5KGXA 2LVMA 2M0OA 4C5HA 3QEVA 4F4KA 3VA3A 4NCAA 3V9WA 1TKTA 3HVTA 4C8LA 4I9QA 2IAJA 1SL2A 2WACA 1TL3A 3A2FA 3QIPA 3BGRA 2B6AA 3QBYA 4KV8A 3KK1A 4M3YA 1KLMA 2KFZA 5HRSA 2E6MA 3MXMA 4CEBA 2G8HA 3QERA 2BIVA 2GBZA 1IO2A 4PL6A 5C0MA 4DSFA 1EKEA 3BDPA 3ZT2A 1IKWA 3PMIA 3NBPA 2FBXA 3OYMA 3WNFA
chains in the Genus database with same CATH superfamily
1WHUA 1M4ZA 2COYA 3OW2A 1MA9B 1MHNA 3WXMB 1NJIR 2YHWA 2A37A 4QQGA 4LK0F 2KXDA 4HUFA 4RCHA 4X62K 2R7RA 4ESRA 5CQEA 1POGA 2XPUA 1QWEA 2SRCA 1G83A 4WTOB 4JKGB 5A2QK 1UG0A 2DYBA 2IBDA 1RTDA 4C92B 1S1NA 1S6QA 3QG1A 3B73A 2QBYB 5AQJA 2CSQA 3WTUC 3FDYA 4FK2A 5EZGA 3E9OA 4FIBA 1VSJA 3LSJA 2CJJA 1VZ0A 3M5AA 5JFRA 3MFKA 1DP3A 5AFUH 1UA0A 2Q31A 2PFBA 2MMPA 5C12A 4GY2B 5KPRA 1T6SA 3R3LA 4L8RB 4I01A 1H88C 2V8JA 2FE3A 3CCUQ 4CZZA 1X3NA 1JJ2P 4FHTA 4RGRA 1RT1A 4IFVA 5SZTA 1WJ5A 2MBFA 4HVUA 4O0IA 2NNWA 3WQUA 3MDQA 3QKJA 1F43A 2OTJN 3K2ZA 3G6EI 3QIIA 3NTIA 1M1KU 3SJHA 1P4WA 2JXBA 2YNFA 4PUSA 2PVOB 4LB6B 4F9OA 1FMKA 2LJ1A 5GIPA 4EJVA 2PUKB 1VQ6T 1ETQA 2QQBA 1J0RA 2EHGA 5DV5A 1VQON 2EWSA 5EVZA 2X4YA 5ILVA 4N4OB 4C8QD 3BF3A 4YOUA 2VQLA 4C0GA 4ZNXA 1I07A 2C06A 4LIVA 4B9VA 1U6GA 4BBSJ 5AT1B 2E7XA 3LSMA 3FXQA 1C0FA 2ISZA 4X1VA 5LJ5e 4FJIA 2HOTA 4C3IJ 2RQVA 1KJWA 3GEZA 2RD1A 3Q9VA 4DYCA 5FRNA 5I2MA 2EFOA 1VQ7N 1A04A 2DMUA 1QQCA 3HYIA 4QPQA 2XGCA 1USTA 4HCKA 2VVKA 3PQJA 4Y15A 4E7JA 3WXIA 3C6AA 4PHTX 5F08A 4M41A 2VBXA 1D8KA 3CD6N 4IF4A 3GZ5A 3SMSA 2IPQX 3MAQA 4RKUE 4DGWB 4OMYA 2Y4YA 1GV2A 1HNIA 2MLGA 4LMYA 4KBOA 4X0GA 3NH0A 5I21A 3LL7A 2WWYA 5JR3A 4CCMA 3I4MJ 5JI6A 4NCGA 4PSWA 2MI6A 4N4GA 2K86A 3MKYB 2FZKB 2F2WA 2E2JJ 2EFQA 2HVRA 2I8DA 4JBAA 4M75A 4F17A 2J06A 2JG6A 3KLFA 3IAS2 2FJ1A 3H5AA 4Z94A 4M75B 3ML6A 3L3VA 3O1WA 3RKXA 3E9GA 2DIGA 2DRKA 3BR0A 5IOZA 1JHFA 1DJ7B 2OZ6A 4F8RA 2QEXT 2Y69H 2DODA 2W24A 2RV8A 4CJ3A 4OB2B 2XKOA 1JLGA 3FIWA 5K5OA 2ZPEB 2JTVA 2DBMA 1W36D 4XN0A 3FSPA 2L3DA 1AU7A 2YUOA 3F5TA 2XB0X 3TAGA 1CXUA 1NH3A 1R71A 3NWSA 2KMUA 4CJPA 2HEOA 1C0TA 3CCUN 1Q7YR 5M5YJ 4B9NA 1UZCA 2WOMA 4J6YA 3L8BA 1V5GA 2OA8A 1RUOA 2VC8A 3E2UA 2EA2A 3CPWS 2WBNA 1AWXA 4BQAA 1JEGA 4BRIA 2RI3A 2VGNA 1BI0A 1VQPT 3VQ5A 4FWKA 3C1DA 4ZYAA 2BZTA 2L5QA 1P92A 1K0XA 3PVLA 2HCKA 2RQUA 5J2MA 1FPQA 3MEDA 4GCVA 3DCFA 3KP5A 1NEGA 4Q5VA 2L3QA 2FBTA 4EP4A 3CM5A 1YBYA 3CVSA 4XRFA 1NZ9A 2YCHA 1W6XA 2JLEA 1QQOA 2P84A 2KZGA 1HBXG 4RGUA 4AYBN 1KQSM 4FLXA 3EO3A 2M45A 5HODA 1LDDA 2R5AA 1K73U 4EMKA 2DXCA 1U6ZA 3BCAA 3H45C 1YI2I 3AFHA 1HQEA 3F70A 2D1VA 3HOXJ 4EMKB 2Q97A 1W36C 5ADXA 4ELUA 2KKOA 3AA3A 3KP7A 2IVPA 3H6EA 2QSFX 4OIOF 1DLOA 1N3CA 2B63J 4N4HA 4L6V5 2R7DA 1FKOA 3H08A 3QOEA 1B4AA 4JK8A 3VQDA 3GUDA 2QASA 5H1SQ 1HYOA 1D3YA 2VWFA 2O7OA 1UELB 7AT1B 3DLKA 4F14A 3VTHA 3MWTA 4E9FA 1RUNA 3EKUA 2QGUA 3MN5A 3O2PE 5FDLA 5DEQA 3CCRI 4OFEA 3H5NA 4IBNA 2HSPA 5KQ8A 1J59A 3O3GA 4OU0A 3BDLA 4UC4A 1TL8A 3V8KA 1U48A 3SWNC 5IYCJ 2LLKA 2C0TA 1Q81U 1U2VA 4BRCA 4M3WA 4J9CA 3GXOA 2CT3A 3FDRA 3BW1A 1U2VB 2J5OA 4XICA 3C2GA 2CH0A 1C0UA 4C8KA 3LDSA 2J05A 4WXCA 3NTHA 4P9UA 3F21A 1RTHA 1R5ID 2L54A 5CHZA 2H1KA 4EDUA 4WYBA 2H1LA 1NKBA 2K3PA 1O1WA 2KLAA 4RB2C 1X6OA 5CYQA 4AU7A 4G7ZF 3D5RC 2XHKA 2X6WA 2HOAA 3SZPA 2ZJPL 4UVCA 1I81A 1NOZA 4BUPA 3HOWJ 2KIQA 2XO7A 1M1GA 1RT5A 3NGIA 3WTSC 2HHVA 3DTIA 4JX5A 2P8TA 3H1QA 1WEGA 2K5LA 3TEDA 4MLEA 1KAXA 1Z7UA 2VBWA 2A3SA 1WEIA 4BRGA 3HK2A 2QVOA 2M0CA 1TW3A 2RN8A 2K40A 5C44J 4M7YA 4WFAL 1XSDA 5E3OA 2PMHA 2WBMA 4FYDA 5GPCA 5KAIC 2X6NA 2QWQA 2X1EA 3Q7BA 1OI1A 3O5BA 4GO1A 3CIPA 2BZ8A 3HKZN 2HHSA 2F4IA 2DF6A 1F1BB 2RO0A 3RQIA 2HQRA 3D2FA 2KHOA 4B3SK 1KQSS 5AQNA 2O0YA 4PJMA 4M7DG 1X2QA 3D2FB 3TR8A 4O8UA 1W2BA 4CSWA 1KGSA 2BY3A 1VOMA 2Z1HA 4ENKA 2IGIA 4RCCA 4C8QF 2UZKA 2WSCE 1OCRH 3HJFA 1MGTA 3ZETA 4WCEL 4Y7NJ 3MO8A 3VPRA 2YRDA 3T8TA 3EFRA 3ZETB 3NARA 4AC0A 4RG8A 3K5OA 4DTOA 2RI5A 2E71A 4O8KA 1ULYA 1ZR4A 3JYTA 3WGHA 3PX6A 2JS2A 4NLCA 2Y75A 1Z1DA 3WODF 1AOJA 2O9SA 1BCOA 4ESBA 2NWMA 2WAQA 2AQFA 4RMOA 3CJQB 5M9OA 4BY9C 3E1SA 1UHMA 2K9SA 2DPPB 3PO4A 1NK4A 3GTPJ 1MH3A 4RGSA 1YJNA 2E1CA 2O8XA 3NMZC 4M6VA 4PY5A 1D9DA 3C12A 1DPRA 5F64A 2KDOA 1MWMA 5KYXA 2X6XA 1OX9A 2ZGWA 5KYXB 4DU3A 5JMVA 4MTDA 2E34A 2KIFA 3MWMA 2RKIA 2STTA 4FQGA 2K4BA 2OFIA 1QZYA 3VN5A 5AN4A 5HKCA 1TYQA 2DU9A 1VRLA 1S22A 4BY6C 4HZFA 3KWIA 2E20A 1KAZA 1TYQB 5AQUA 3ZCOA 2MH9A 1SSHA 4IOXA 4O55A 3FFIA 2P9KA 4KHYA 4XLFA 2ZJQL 3KLIA 4JI8K 3GYHX 3M53A 2P9KB 3L2VA 3BZCA 3MCPA 3A1PA 2PYJA 2A5YB 1KG1A 3E6MA 4KH1B 1AHDP 2QLZA 1Q1VA 4H0EA 1S1WA 4MDBA 1AZEA 3E6DA 4B1VA 1PU8A 2UXBK 2RJCA 4DV6K 1GOCA 3DFGA 4CYDA 3I59A 2QQRA 3LH0A 1RDCA 1HUXA 3AVAA 3DLLA 3P9KA 4IUUA 1VQ8Q 2FMYA 4PFZA 1ZC6A 5EG0A 3JCMQ 1V55H 4CGIA 3BC8A 1NE8A 4LNPA 2KVQG 3SUQA 2H6BA 1IG8A 3CCQQ 1HNVA 4XEIA 3G4SN 4C8OA 1AHJB 4F3TA 3VU3C 1XDSA 5CYVA 1J9AA 3QNOA 3CC4T 4KYWA 3K6GA 4MLOA 3WTWC 1ZSGA 1NM1A 4B9QA 1YHQT 1UA1A 3MKWB 4MFEA 4AT1B 4B4CA 4JI1K 4AIKA 1KG5A 5AQRA 3W6VA 4LK1F 4XTYA 1NGDA 1R22A 2LQWA 1XTDA 2G8WA 2GQVA 4TVRA 5J2QA 2IRFG 1ZGAA 2X6YA 5CR2A 5J2NA 4A3BJ 1YJWI 3E97A 3RPUD 4FASD 1UGPB 2QA4A 2VKVA 3K1PA 1RDWX 1HYSA 4BHPA 4C3JJ 3CJ7A 3J81K 1JO8A 4FJ7A 5LMUK 1YVUA 4KHNA 3SZTA 4Y92A 1BR1A 3I9V2 2B86A 2NXNB 1JCGA 1J3TA 4MMLA 4RTWA 2IS1A 1KSPA 3L2UA 3VEWA 3LL3A 3QMLA 2HBKA 1Y97A 3SQ1A 5DM7L 3HXMA 1T38A 2VQFK 5GPAA 1AVZC 2CV0A 3R61A 4QS7A 5LEJA 1TUGB 1YCYA 1HSJA 1UTIA 1KFDA 4B08A 3CCLI 2FRYA 2O3FA 2XRNA 1LFPA 2MAMA 5LJ3g 1NJIC 2L89A 4RW7A 3DU6A 5JVHL 2YUPA 4OAYA 4OKJA 1WFXA 3BR6A 3DXKA 4II1A 2DYRH 3HZJA 5FU6C 3K70D 1R1TA 4DIQA 4G6DA 4XIUA 2VXFA 3DXKB 4DR2K 2PLYA 2DA3A 4M3UA 5E1ZB 4FJ8A 2OJ2A 3BLYA 4I98B 4DV2K 3J7ZI 4Y91A 1TGOA 1CLQA 2KGTA 2DA2A 3RMAA 3EGDA 4ELZC 1G6NA 3O9UA 4C0ZA 1JLAA 2HBLA 1QE1A 1NBWA 1LEBA 4CH7A 2L2OA 4UB6C 1VQ8N 2RF0A 2ELKA 1NGNA 4I0AA 1K8AR 1C1AA 2L9VA 4H5NA 4K41A 2LH9A 1TAQA 3IL2A 5DLQE 4MEXF 3LP1A 2WUSA 4OKKA 4PJNA 2D0BA 3CCQN 3SUPA 3P31A 4R0KA 3KEQA 2DXUA 4LUEA 3JRGA 1Z6RA 5GAMj 1E4GT 3ZFJA 3K0LA 4HSRA 2BGGA 4M4ZA 3C7NA 5LJ5h 3D4VA 1UB9A 4AI5A 2NUZA 5DPKA 1VYVA 3OQ5A 1EH6A 3K70C 1M3AA 5GAGJ 3AVHA 4LFUA 2E1OA 1VQ6A 1S5JA 1SFEA 3THVA 4BC5A 2PMZA 3OV8A 5FPMA 2CO5A 4DNCA 4A4FA 3OOPA 5E41A 3LP0A 5KN8A 4CJEA 3LGLA 3RR8A 4FK0A 2DEQA 1WSIA 2X35A 4ID5A 1EF4A 4OB0B 3TQNA 3LGFA 4CYCB 2NRTA 1JLCA 1WSUA 4BHCA 1XDUA 1REPC 1ZLMA 1XQOA 1Q82O 2JTEA 2I10A 1NGAA 3U3GA 1GLAG 5CAIA 2JQ7A 3LFKA 4O5FA 2E1HA 1RAEB 5H6RA 1W0TA 2V6CA 4M3BA 3E9LA 1HF0A 4Z0UA 3F8MA 2HVSA 3FXOA 4XSXF 1WKMA 5EXWA 3SZ2A 1ZELA 3TP3A 1CF7B 4IWVA 1PWTA 2X74A 2OV7A 1TNTA 5J39A 1Y96A 2NOHA 4B3AA 2ZPBB 4CC7A 1WVRA 1Y96B 4NB4A 2CP0A 4M71A 4CJQA 1MPGA 1KQ2A 4M7AD 3K4LA 1ZARA 5GANe 4FJ9A 1KHCA 1WPYA 1TK5A 2D1XA 1EQYA 3RRHA 5EX5A 1Z9QA 2W48A 2F7TA 4L9TA 4UNOA 5BN8A 2L02A 4NZGA 2XRIA 4IO9L 4J8OA 2G7HA 2QEXA 3CCMQ 1ONVA 3C3WA 2O61A 2IPOB 4E89A 2ETJA 3SZGA 1I3AA 3KD5E 4BR7A 1QVGP 2FEZA 3T19A 3CC2Q 3A8HB 4MTEA 4NO7A 4RS8A 4BQQA 1Q7YC 4A3EJ 2HMAA 3HM5A 2ZXHA 2WAEA 4AFUC 1WCMJ 2DFFA 3Q3SA 3BTJA 4YFNF 2HNHA 3UIQA 1HKBA 1P4XA 4CIGA 4FCYA 3DRRA 1ZBXA 4FSVA 1QSLA 4IRGA 1T7PA 2FBYA 2E7WA 1KFZA 4QT7A 4CJUA 4J2DA 3HGYA 1ZBHA 4MDWA 3GBGA 2FEIA 3MP6A 2BDPA 3E19A 1I6XA 2UXNA 1QP3A 2FRWA 3T1AA 5EEHA 3BQZA 3NCIA 4BJ5C 1TK8A 1YNZA 3UATA 3GNFB 3AVJA 5B5EC 2QTDA 2WB1N 4IZZA 4UVAA 3OYCA 3LAPA 3G71A 2HNDA 5EG2A 1RZ4A 3PIPF 2E10A 2L3PA 3ZSRA 2XV4S 4KO0A 1WHMA 4OMFB 1LPQA 3CJ9A 2P81A 2D0CA 5E1WA 2P4RA 1UHWA 5AQIA 4CA0A 5FD6A 1YIOA 4L18B 2D5VA 4E2FB 2HYFA 3OSSC 3CCEI 1OKRA 2GTDA 2NRWA 3GX4X 1LWVA 3E0JB 2RDPA 5HS8A 2GTJA 3H0GJ 1OMIA 4CCLA 4LC9B 4QS8A 2OAUA 2MA3A 5LJ3d 3U9ZA 3O9SA 3HTUA 2IVNA 2XAFA 2AA4A 2D2WA 2DBKA 4B9SA 4G9ZA 2OPPA 3OMGA 2LP5A 1T6CA 5FKLA 3EYYA 1TWCJ 3K10A 2HXIA 5F04A 3CMAI 3CCMN 1SFUA 4UV9A 2PNIA 3HIFA 1JXSA 3IFRA 1BOAA 1DPUA 4K8XA 4LLNA 2VGMA 4OMLA 1ZSZC 3I56I 4IUQA 2KZVA 3GLLA 1NTCA 4M3RA 1RUWA 3X24B 1N5ZA 4HT9A 5HK3A 2DYIA 2DTUA 2L4AA 3Q0WA 4B9WA 3W3CA 3OTOK 1I8FA 3IH4A 3OH9A 4WFBL 8AT1B 2KW4A 3SYTA 3ERMA 2VQCA 2K9LA 3REAB 1Q9XA 4EMHA 3M8SA 4UUTA 2AXLA 3WG7H 4DTNA 2DT7B 2FYKA 5F1RA 2LX9A 2QWNA 2OUMA 1QO0D 1YT3A 4CERA 2VN2A 2NZTA 2VBYA 2A08A 4FM1A 1KQJA 1WSGA 5JLFA 2CP6A 3GFLA 2K4YA 4FWPA 3IQLA 1KG2A 4QCLA 4CUGA 2E3HA 2JM8A 1M90R 2VYTA 4ISEA 3CO6C 5FKKA 4C8QE 3QUIA 2A5XA 2XHIA 1LQ1A 3L00A 1GLLO 5KE3A 3P38A 4YORA 3A8GB 3RMBA 3FC3A 1RBRA 1QCFA 1HC8A 2HL3A 4JRPA 3JCMb 3QZ5B 3M54A 1YWPA 1WBBA 3GFIA 3GTLJ 1NJYA 1W70A 1KSWA 3HFNA 4UY8I 3OY9A 4LG0A 5ADXH 3AVLA 4DFPA 2D1KA 4EZ6A 4HXJA 1J54A 4B21A 4JRIA 3HO1A 3HEFA 3CMMA 2O4XA 3FJPA 3SAGA 5C2DA 3VQPA 2O4XB 2ZCFB 3IWFA 1PKTA 2GTOA 1ESVA 1RKTA 4PJJA 3NVMA 4BUGA 1K9MR 5LGUA 2EGCA 5F1JA 3G0ZA 2F5DA 2W6KA 3KK7A 1N27A 2FHDA 1YITI 4FJMA 3JB9I 2QGGA 3FXMA 5KCHA 5GMKe 2JVVA 2X0LA 2ZC2A 1R0AA 2ID3A 5KNLA 4IIMA 1VI0A 4I99C 3VENA 4EHTA 1GLDG 4KDPA 4D6WA 4JKAA 1M5Q1 5A0DA 3ZYYX 2EZLA 3J7AF 4DSEA 1NOYA 1VQ9I 4CJLA 1BR4A 3G6ET 3PSIA 1G3TA 1TSFA 4DU4A 4B3TK 3N0UA 1OQKA 2Y0SA 4CZIA 5M3MJ 1XOVA 3DU5A 1WN7A 3GBQA 1QLYA 1WJSA 4M7AF 4CEAA 4DSLA 1E4FT 2DQRA 4O0JA 4C5GA 2GOMA 3ASKA 1MJ9A 4F92B 1GT0C 2QF7A 1WZ2A 1X1DA 2HF4A 2H3GX 1KD1R 1FNNA 1CKBA 2NUTA 1BG3A 3O4WA 5BPIA 1FOYA 3NF7A 4W5QA 2NUTB 2JMAA 4DBHA 3ZR8X 5A2QE 4BC3A 3ABTA 3WEEA 3CW7A 3LZJA 4KITB 3UR3C 4IFEA 2JSCA 1WB9A 3M1FA 3WEEB 2VONA 4B9LA 1EXQA 5IN1A 5D6EA 1WH7A 3HOYJ 2D0PA 4DQIA 3MQ0A 4XLPF 3MPUB 2EIJH 1I3QJ 3B6PA 1KQ8A 2GIZA 4IX7A 1YP5A 3IDHA 2AK5A 4BB7A 1TS9A 3HG9A 2OTJI 1RIOH 5IYBJ 3KLGA 4DQRA 2Z1IA 5H6QA 3I0TA 2CV2A 3KLNA 3UDCA 2O4GA 4FISA 4CZLA 2VV5A 1N8RR 1U3EM 4C92D 1Y07A 3CC4A 4ID1A 1I1GA 3KYCB 4PJOC 1YHQA 2LTPA 4FE7A 3JSOA 1TKXA 4P96A 2ELHA 2YKMA 2IGMA 3P1GA 2ME6A 6AT1B 4FWNA 2LCSA 4PSXA 5DCFA 4XAXB 4BC2A 1X6GA 3VOEA 2LSNA 1MMGA 1MMDA 4B9TA 2QKMB 3N4PA 2F4MB 5LL6Z 5D3GA 3FHFA 1FSHA 5AONA 4CE9A 1XTAA 1Y1VJ 5CQXA 2AKKA 4V2GA 4CJ5A 3C6UA 1GFDA 1NGHA 4PQUA 1FP2A 3PO2J 3MZHA 1VQ7I 4FLVA 1ACMB 2JRMA 1DUXC 2KHMA 4XLEA 2O8DB 2RHXA 1GLEG 3PUBA 2XAUA 5IT9K 3M5RA 4M78D 2X1DA 3GTJJ 3CCJQ 4RTXA 1NK5A 3IAYA 3S93A 3TMOA 3CD6I 3FISA 1IC8A 1IB8A 5FLXO 3J81O 2F2EA 3J7AO 3BY5A 3S41A 3FFKB 3QU3A 5I3UA 2NVQJ 4IHYA 2JOYA 1Q82U 2OA4A 3HSTB 4C92C 2R7OA 5K7FA 1SD6A 1ZHIA 2D8JA 3KFWX 4D5CA 1AZGB 2J4RA 1JJ2A 3H46O 2HQXA 3CXCP 2YRVA 4ZGJB 5CLSA 3LM2A 4QS9A 3KHYA 2ZWHA 2JA8J 1OEBA 3FWEA 1IN7A 4LDVA 4C8NA 2O8EA 3RDVA 4AVPA 3FR0A 1B9MA 2FD5A 1YI2T 5GAN6 4CJKA 2HQHA 3QBXA 4HKEA 4BVPA 4E1NA 3HSRA 1XGNA 1O57A 4XKCA 1OULA 3LSRA 2VG6A 1IDYA 2L7KA 5DDGA 4ELYC 5CKFA 1QA6A 1STZA 1PVSA 3SYZA 1LEAA 4OVAA 2R7ZJ 1VAZA 1K8AC 3CCUI 1SF9A 4DTSA 2WA0A 4M78C 1ITGA 2E65A 3R0AA 3T1BA 3L7WA 2KSSA 1P90A 2CP2A 3CCRT 4LD6A 3P8DA 1X43A 3JCMg 2Y4XA 1RNHA 5FLXZ 3J81Z 3RUXA 2E70A 2Y1IA 1IDZA 5J1UA 2JJ9A 1MBJA 2XPWA 3OYNA 2WTEA 4PFOA 3EZWA 5BOXA 3KLEA 4EW0A 2R92J 2LR8A 3DOKA 4FLWA 2EAYA 3DPUA 3PNYA 4XU2A 3VEVA 2O9LA 1FYNA 3K58A 1CGPA 2HVIA 4QWQA 1E2XA 2E6LA 1C6VX 2VC0A 2EKOA 2FZGB 4F3OA 2JT4A 1RFQA 2UUAK 1VQPQ 2NNYA 1T8IA 2V8IA 5EYRA 4CC2A 4AHSA 2XK0A 3IWZA 2J5PA 2VPLA 2E41A 1E3HA 3M4OJ 3CCJN 2ZPHB 1QZ5A 4CFCA 5KYWA 4FJ5A 1T2KA 2FL7A 2C6YA 4M75C 4UUSA 4C8QA 5GANh 2FSWA 4GDFA 4M77D 1BYMA 4DQ8A 2M87A 1IRZA 2M9UA 1LW0A 4C8QB 1EBMA 1WIEA 3RKYA 3BR2A 2OFKA 1UB4A 1J9IA 2P1JA 3VQQA 3LALA 2DO7A 2XKOC 5K7HA 3DKYA 3CLOA 1PDNC 1FZPB 1R6RA 3HI0A 4A0ZA 1Y8RB 5CCAA 1F36A 3O8HA 5LFAA 4NCAA 2JWKA 2COZA 4NC7A 2QWOA 3JB9D 1TKTA 4MFDA 3T9NA 2M3AA 4F04B 1KU7A 1LCUA 2OD5A 2IIRA 3OOUA 3W3DA 1O7FA 4PGHA 2ZCWA 4I6ZA 3HHGA 1VA7A 2ZM6K 4GV9A 1YW7A 5J4VA 1VQ5T 1MUNA 3MXMA 4CEBA 1ZLJA 3PE0A 3QERA 1R4MB 2BIVA 3QODA 4ASNA 1IO2A 2ZJPF 1KONA 3U9GA 5C0MA 2VQHA 4DSFA 4BU2A 1EH8A 2EJ9A 3ZT2A 1JKOC 5FLMJ 3JR9A 3NBPA 5BPNA 2KXCA 1V5FA 4FT2A 4F7UA 2QEXN 2DXIA 4CGDA 4IL6C 5H20A 3ZQCA 4I0BA 5CVJA 3C2HA 2ZNYA 2ASMA 3QETA 4EMKC 2RJFA 4JOMA 3VESA 2F5CA 1D5AA 4BE2A 5CIUA 2P51A 3O8MA 3H1CA 1VQ4Q 4KHUA 3BY6A 3IKTA 2Y30A 4CZMA 5HRNA 2LY1A 5BPMA 3HGGA 1GV5A 4IQJA 3SJMA 1VQPN 5CY4A 1QPIA 5LD2C 4FLZA 3D2EA 4C1NI 3BG7A 2ESWA 1JGGA 1ON1A 1FIAA 2RHZA 4CGGA 3D2EB 4J01A 1S6LA 3RDIA 2XDVA 3IKVA 2FG0A 1I39A 2PX9A 4WQ5C 3RNJA 1ZGWA 2R93J 4XLAA 2K5IA 4FT8A 2PQWA 3QYFA 1U9NA 4YFUA 1OR7A 1C0WA 1FJGK 1ZUYA 2DFHA 4A57A 2KQWA 4B1YB 4OIQF 3L0QA 1BI2A 1CXQA 1S1UA 1RLPC 3H0HA 2G8IA 3ZQHA 1HJDA 4G6TB 4AFZC 1D1CA 2ZPFB 1S3XA 4YOTA 1BN5A 5K1YA 2V9VA 2YHXA 1OCCH 4OMOA 3OL4A 4X1EA 4Z4EA 1W4MA 5F1XA 3FZFA 4CHZA 3MEGA 3RIRA 1ASVA 3OWTA 2XVCA 2YX4A 1NG2A 2OU2A 3RR7A 2ITMA 4OPKA 1MUZA 1MNDA 1QHHD 2W42A 2FBKA 3MXIA 2F8TA 2HKOA 4BXXJ 3T5XA 2MD5A 4DFKA 2BUDA 3TARA 5CE3A 4V2FA 1YJWT 1UJYA 3HP6A 2HHQA 5C24A 1BCMA 2ZJQF 2EILH 2M02A 4DTJA 1X2NA 3D0SA 1NK0A 3L4QA 1SHFA 3AA4A 1W5CC 4KULA 3QYGB 3H9QA 4BNCA 2MH2A 2YS9A 5KK1A 5J8CA 3VGMA 1I5ZA 3JCMd 5E79C 3EY1A 1T03A 3HSEA 1AOYA 1N3AA 3SV3A 2DPNA 3SDGA 1A5VA 1OKJA 3CETA 3Q9SA 2VUBA 3DQVC 2PVDB 4DTXA 1HNXK 5LEKA 4TSXA 1R4NB 1X3WB 5AIQA 1M90C 3EQLF 3J7YP 1Z9ZA 5EOYA 2BUPA 1YX5A 4DJAA 3HTRA 5GJWB 4IQ4A 1VQ4N 3ZQ7A 1NK8A 3G4SI 3CCLT 3FHNA 3EPZA 1OCPA 2XSDC 1S72Q 5GINA 2NOLA 3K1MA 1ZYRF 5D5WB 3B02A 1S5LC 4EMSA 5I22A 2YJEA 3OSVA 1QMCA 4IXCA 4BRFA 1NYFA 4J2EA 3TEEA 2CW8A 1PC0A 2GQIA 4HCBA 2ZQBA 1WHKA 3LW5E 1HR0K 1ETVA 3CPWP 2QKLB 4N56A 4IFYA 5GMKh 3M3YJ 5TKWA 2JS0A 4ELTA 2L8DA 1K9MC 2P5OA 2E5LK 4J8FA 3HBLA 2KROA 3MEEA 2O8BA 2HSTA 2E2HJ 2A6HF 3A5ZB 3JAME 1YTAA 4JX6A 4M6YA 2GNCA 2DL5A 2O8BB 2H8HA 2BYVE 3SEZA 4KFCA 5IHIA 2JUFA 2V1NA 4G7OF 1BI4B 3DXMA 1K76A 1PNJA 3H6ZA 5B1BH 1G2BA 2DMPA 3AVNA 3DXMB 2QQ8A 2VXEA 3L2QA 4KB1A 2HKXA 4M77F 4DSKA 3HXLA 2B7EA 5GMKi 2M9HA 4M7AE 2A3LA 2KT1A 2YG9A 1QKWA 4FX4A 4XMYA 4CJ4A 1UE9A 1HD3A 3HFOA 3F9MA 2LT1A 1NNEA 4KISA 4YIRX 1YJ9Q 3BDUA 3G6EA 4KPYA 4CJWA 4Y17A 2P5KA 4LY7A 2EZIA 3F9KA 2KR3A 2GBYA 4Y33A 4DV1K 3H5RA 2OBPA 1TUDA 4RTTA 4QVDA 2DA1A 3HBTA 3F73A 2J6OA 2JTFA 1SEMA 1KD1C 3VOVA 1RT7A 1KA8A 4LH4A 5CQGA 1NK7A 4CZJA 2K6DA 3FHGA 5F0HA 1BJZA 2I0NA 1NK2P 3QEXA 3I5RA 2DD5A 2G8UA 1IGQA 4J9GA 4AHCA 4CK1A 2DOEA 4YIFA 2ZE2A 1VQ8I 3FZKA 1Q86R 2HWVA 2NNNA 1DKGD 3VQ4A 4HVVA 5DM6L 3WGGA 1MUYA 3HB9A 3LAKA 3FKJA 1BO5O 2YV0X 3CCQI 3RSEA 2L3SA 2DXBA 3LWHA 3RSEB 3ME9A 2QUFA 2HQAA 1KAYA 1GBRA 3ZX0A 1SMTA 1N8RC 1Z26A 3O6BB 5FROA 5HP1A 2F5TX 3BQYA 4EAHD 1YW9A 3DBHB 3ZMVA 3I9QA 4KA4A 1D9FA 2QSHX 3VKIA 1B9NA 3DLGA 1GRIA 1R8OB 2PBIA 2PEXA 5E3MA 1NKUA 3K4KA 2HD0A 4KHWA 4F52A 2JA7J 3ULQB 2EBIA 4Z4IA 1H8AC 5T7BA 3EHRA 1S1VA 3AVCA 2MD0A 3FXJA 1DU6A 1G3YA 4KUDK 2DCEA 4FWSA 1T3VA 5BQTA 1MBHA 2LVSA 2ATCB 3CC4N 4OWRB 4HDVA 3JTHA 1YHQN 3PO5A 4DV7K 2QWLA 4IOCL 4N5SA 2VT3A 3G1MA 1QCOA 2EX3A 5E8GA 2KAFA 1PP8F 3JB9J 3DLLL 1KQSP 3V9UA 3DMJA 2F8SA 1RABB 1WAJA 1W5TA 4KAZA 3RMQA 3V7RA 1H92A 3CCVQ 3HHTB 1YJ9N 2YKNA 3CJAA 4BR2A 1HQCA 3CCSQ 3PIPA 3ZLJA 4FYXB 1LAVA 1KG3A 4H0PA 4PCQA 5GAMg 4A6EA 3RPUA 3HRMA 2OTLT 2TRTA 4N76A 3WTXC 2A6TA 4Q47A 3ATVA 4Z88A 5GANf 2HMPA 3AO1A 3VS0A 3IV5A 2ZSHB 3GNGA 5EC7A 3VYHB 1XMXA 5D6XA 3VQBA 5JLHA 1VSFA 3X2QH 1OFCX 2Z3YA 5KYUA 3TPQA 1BA5A 4FPAA 4DU1A 1FTTA 4FYYB 3VETA 4CZHA 1YI2A 4KGZB 4IO9F 2BH1A 4RAZA 1M1FA 3DI6A 3BR5A 2PZSA 1EP4A 1LFUP 3LNQA 4CF2A 4JI3K 3KEYA 3ID6A 5HDKA 1RAHB 3CCET 1K4TA 2WY7Q 3WU2C 1SFOJ 1NK6A 3RWUA 4A69C 1IXDA 2PYLA 2HBMA 2HL5C 3ID8A 2I7NA 4HLXA 4DOWA 1L3LA 1HNZK 4IKFA 2QK9A 3CCRA 2GFUA 2M1BA 1M2VA 4U0YA 2DLPA 3CERA 1N25A 1WQWA 1SFXA 4J7IA 3LLRA 3X20B 1DU0A 4C0DB 1M2VB 4L5JA 2LDMA 5FPDA 1YRNB 2ZGZA 4GLMA 5AZJA 2XKPA 1YIJQ 3CMAT 2NRXA 4A2BA 3VYGA 4FJNA 5AZJB 2FF4A 3B6OA 3E7LA 3EFSA 2CFXA 2YNGA 4LSLA 1FSEA 3I56T 5B1AH 5E18F 1RBVA 1M3HA 4BWMA 4LG3A 4XKWA 2XROA 1G8XA 4B3RK 4G6QA 3DLBA 1XJWB 1NJIO 5IY5H 1SAZA 3AL0B 3GF2A 2EV6A 2J6KA 4OMNA 3M57A 3RPQA 1UAAA 1UFFA 3A8MB 5GAOp 4OF1A 4DBFA 4OMMA 3ZP5A 5LY3A 3BR1A 1IXCA 5LLQA 4O44A 3AVMA 4LGWA 4CHUA 3CCVN 4AIAA 3JRAA 2FXAA 3CCSN 1QPMA 2K5FA 3LDPA 4MGRA 2KEAA 2PJPA 4XR6A 1U1TA 2E88A 5SWMA 5DUIA 2YG8A 3U2RA 1QVGA 3CP2A 5KE2A 2A3ZA 1DDNA 1NGBA 2R7VA 4J9EA 2LF7A 4LDXA 3NRVA 1OU8A 4M63C 2DM1A 2EQJA 5GAN8 2OPQA 4JS5A 2EFNA 4N0BA 1O3QA 2L0KA 3ISNC 4B3MK 4XQFA 4YEJA 4KUIA 2X4HA 3EG9A 1EH7A 1U1SA 3M9AA 3Q5FA 3ZN1A 3CCMI 3EG9B 1YFHA 3TO6A 2LK2A 1I5OB 3A8OB 4GGGA 5CK9A 1BW5A 1M9SA 5J1EA 2ISYA 5GMKl 3FZVA 4C0FA 3VEPA 4IHVA 3CC2I 4NOYA 3LA2A 4J19A 4WE1A 4HTLA 2DTIA 1KHIA 3C94A 3I53A 3CQ8A 2C0OA 1ZRFA 5EF6A 1VQ5A 3ONQA 1EV7A 3DEEA 5AQTA 4HA8A 4RAGA 3THWA 1MSFC 3A2KA 5BMZA 3E1YA 3P8BB 1PUFA 2VCPA 4YHHK 4K43A 3IAM2 1S8NA 2E5KA 4C8QG 3THWB 1C1CA 1AWOA 1TQMA 5B66C 4KGXB 5GP9A 2VYPA 2MFZA 2PQ8A 1YITT 3H36A 4M7AB 2DA9A 1TZLA 1VQNQ 1NGJA 3CMYA 1XMQK 2COBA 3DB3A 3ZSZA 4RW4A 5GAEJ 3AO2A 2UXCK 4PK4A 4CC4B 4CZEA 1N6AA 3OYDA 4AM3A 3GFJA 1BOBA 5C4JJ 4LSNA 1VQ9T 3RQ4A 3QPSA 1YIJN 3O1BA 3O9TA 4JZ3A 2B8AA 4OX9K 3M4GA 1NLVA 2L2PA 2G0EA 2IAIA 3IUCA 1QQNA 3VS5A 1QZEA 2I5WA 3HOTA 3N97A 4ZHRA 1PD0A 1FXXA 3KP6A 3NF6A 1IAWA 4LH5A 2NOGA 1UGSB 3DBRB 3F2KA 3NGZA 5E17F 2A5WA 2F6CA 2MW8A 4M7DF 1HNWK 3FX3A 2BE9B 3FMSA 1YOVB 1UGVA 2ATQA 1I6HJ 2EA4A 1N36K 4M78E 4PL8A 2A7YA 2RREA 3KZYA 3CLQA 3ROUA 3LWFA 5KPZA 1KK7A 1Z21A 3AKZA 3ULDA 2X3WD 4F7UG 3JSCA 3QINA 2RHIA 2BV6A 2DA4A 5GAMd 2LQNA 3LWMA 3U23A 5GMKj 1VSEA 1OH8A 2KIMA 2LP0A 3OYYA 1FBUA 2ECZA 3ASMA 1XUPO 2HTJA 3FM5A 1HKQA 2XSJC 1Q7YO 3KP3A 4KMUX 3CC7T 3VS1A 2XASA 1ETKA 3ZQLA 4JUVA 1WI3A 2XHCA 3VYTB 5HK0A 3VS6A 3I54A 2K3FA 3OHRA 4AD9A 3VDXA 4M73A 3ZX2A 3DTEA 4CCJA 1NGGA 3DF8A 2M30A 3FRNA 2RHKA 2CV1A 4B1UB 3WXJA 1P7IA 5FB2A 1IKYA 2K3BA 1ERDA 1W1FA 4OJRA 1DP7P 4R55A 1BGXT 1X9WA 3JCMP 1Q18A 1YJWA 1FWZA 1ZGJA 1MMAA 4EGYA 4WK8F 1MJAA 2QGFB 2PBDA 1DGWY 4CC3A 1VQNN 3BG3A 3HOZJ 4E19A 2M0YA 4B48A 2W7NA 1YLFA 1VQ7T 3R6SA 1ORPA 3OYEA 4CXFA 3T7ZA 2I5JA 4LF9K 3QP6A 3OYAA 2P9UA 3CXCS 2M2EA 2XY5A 5JS1A 1RR8C 3CD6T 2P9UB 2NLUA 3ZSYA 2F9WA 3ULRB 2RE2A 1BA0A 3TAQA 1BR2A 4EM0B 2HHWA 2AO9A 1K0SA 3I58A 2NOIA 1U47A 3CCLA 3H92A 1B34A 3DV8A 3IH3A 4J5YA 1UG1A 2VJJA 3A1YA 1ZRDA 3PT9A 1IG9A 5M1OA 1ZA1B 1B34B 3KBGA 3GTKJ 4B43A 1FEXA 2R5ZA 2LMDA 4N0AA 2JHNA 4CF1A 3V1QA 2RVCA 2XB5A 1S29A 1SKSA 4B3OA 5LJWA 2M7BA 1VQKQ 4AM7A 4J9HA 4GKKK 1IV8A 3MAJA 2VWBA 1TC3C 3S15J 4NB5A 3LA7A 3TSZA 4DHYA 1IRGA 4FWMA 3EETA 2X1CA 4M77E 3H3NO 4IDHA 4L3QA 1I50J 3WXKA 2W6LA 3PX0A 1NKCA 1A0NB 4QVZA 1K8KB 2OQGA 4MDAA 1X69A 1GLCG 4JQFA 1ABQA 5AQKA 4KIGA 3LDOA 3GMEA 2E8AA 1QVTA 3S32A 4KHSA 3EH1A 3VS2A 1KQ1A 4IRHA 1ZX6A 4GBQA 2VKDA 3CG7A 3E9PA 3A8YA 5IT9E 2ZXIA 3ERED 5HRRA 2VKHA 1M8VA 2XC7A 4LF6K 1B59A 5GAOm 1FC3A 3K7AJ 2CYZB 1LB2A 4RAFA 3ISPA 4D8DA 1ZG1A 3BZ6A 1HSTA 2QENA 4E6KG 2XAHA 3QJYA 3D6RA 5GAOl 5E1XA 4DSJA 5M1FA 4O5BA 2CFOA 1ETXA 1KG6A 1WLJA 3VQAA 2CGPA 1LCKA 3FKIJ 2HQEA 3OIQA 1JGSA 4BHBA 2R5YA 2V52B 1X9MA 3THXA 3RESA 4BQNA 2KFNA 2R5YB 1VQMQ 2GX9A 3THXB 5D7UA 5L3CA 2L9NA 1SRLA 3V4IA 1E3PA 4E9HA 3LCNA 3DKMA 1WUAA 1TWHJ 1RLQC 1VQOQ 3ZL7C 1R0BG 2ESHA 2HOEA 5K5RA 2DX1A 5BPDA 5HNFA 4CBWA 5KAFC 2ZMEA 2YNHA 4PIIA 1Q86C 4GMJB 4EIKA 2DPUA 2FBHA 1HMVA 2ZMEB 2A68F 4KH4A 4BR4A 3X25B 4XN3A 3HOVJ 1ZKGA 3KFVA 4PJ0C 1XHXA 1K78A 3KJVA 2NOEA 1ZQ3P 1X3ZB 5DD8A 4A3FJ 4DS4A 1U5SA 2STWA 1K78B 3VGLA 3CCYA 5K14A 1NKEA 4EVVA 1QHAA 3CPEA 3VF6A 4E0DA 3LPUA 4KTZA 4Z4FA 1SSFA 1FYKA 5M1QA 3GE1A 2JN0A 3N5NX 4PKHA 4G7HF 3AV9A 5D4RA 4Z4GA 2EV5A 4MO5A 3HC7A 4DQQA 2OZUA 1JUPA 1HW5A 1T3LA 5DY9A 3V9XA 1HLVA 1VQKN 1UECA 3CDHA 4IURA 3CF5F 3U1KA 1ATNA 1VQLQ 3IG1A 3GDQA 4C8MA 2QM1A 1VRTA 2NVXJ 3N4QA 4CCKA 3A5NC 3K9KA 4C2MJ 2HHTA 2QXLA 3KUFA 3EAEA 3ZQQA 4NXNK 2W84A 2XHBA 2FMLA 4QOZB 3JCMe 4CCNA 2LD5A 2MYSA 1QSSA 4JKGA 4U67L 3QHSA 2JA2A 4B24A 3EZ5A 3D1NI 4C92A 1PRMC 4A5BA 3FMRA 3M8EA 4Z4HA 4EEFG 2IEKA 3CCJI 4LD0A 2QBYA 4DFJA 1LOTB 4K8ZA 1S1XA 4D0PA 4JJNK 3MEAA 1YQRA 3L1AA 5HLHA 1NJIU 3OYIA 4BRLA 4A3JJ 2XIGA 4I2OA 1VHXA 5ECAA 4GVEA 2UYTA 4BH9A 5IWAK 4N9HA 2OANA 5E20A 3NF9A 1VTNC 3HRTA 5BRHA 2DZ9A 1UHFA 3D5SC 3QJ6A 2NUPA 2OTLA 3VQ9A 3WUHA 3PLAA 2L4MA 1PU7A 3Q7CA 2NUPB 4BRKA 2Z1GA 4CD3A 5AIPA 3T0YA 2RKHA 5J26A 2NUBA 4FLYA 3M58A 1VQMN 2GWJA 3GBTA 1HXDA 4M78A 3REOA 1YO5C 3QYHB 3F8NA 4M78B 2V1UA 2FNAA 5CKBA 1YAGA 4PKIA 3TGNA 3ZSOA 4E6RA 1LDKB 2CT4A 4YFKF 4E7ZA 3S1QJ 3AY9A 1QVFM 5HDGA 3MP8A 2PTKA 4YOQA 3CHWA 2W4SA 2KRNA 4QLCU 1XPXA 3KETA 5CKHA 1U84A 4E7LA 3CCEA 3JCMJ 2XDBA 1NGIA 3U8XA 1VSMA 3KYLA 1IBLK 3I0WA 2ASOA 5ERIA 3S3NA 1WEFA 4NYFA 3J80E 3BROA 4WF2A 2KYBA 3LDLA 3KZZA 2KZMA 1QSYA 3M6GA 3KE2A 3TSQA 3CWSA 1QVPA 1LDJA 4J2BA 4GW6A 4ANJA 3WVDB 4JK7A 3I0SA 1WJBA 1VQLN 3EDPA 3OYLA 1EZZB 3K5NA 4A59A 3AG2H 2K9QA 2X4WA 1JXBA 2I5UA 3BJ6A 5AQPA 3CMAA 2A6EF 1HKCA 1LWCA 3EL2A 3CUQB 4H5VA 1JJ8C 3RSNA 4KT6A 1RETA 1VQPI 3KZBA 3I56A 2KNBB 4MLHA 1B1BA 3PQKA 3JRBA 5H2FC 4C8QC 2DTRA 3V81A 3SD4A 3META 3DRPA 1QVGM 4E70A 1TU0B 4J9FA 3CF2A 4RDUA 2YX7A 3I3LA 4RW9A 5IXFA 2O4IA 3PM1A 1GUUA 2HQNA 1XNIA 4KJZA 2VC1A 3ZBDA 1LWEA 2YHYA 4M3ZA 1UMQA 2QXFA 1RAGB 2P9IB 4BRQA 5BPLA 5KGWA 3CMEQ 2XY6A 3P4IA 1U2WA 4N47A 3QPLA 4CGZA 5LJ5d 2HHXA 3VA0A 4E9GA 4AI4A 4EM1A 3RVCA 3I0RA 4B1XB 4FJXA 4NYNA 4DR5K 2JTMA 1W7AA 1PHTA 2W25A 2LJ3A 4M77A 2HZTA 2P0QA 3RYRA 5FW9A 2YJFA 2GFAA 4M77B 2XPVA 2OX7A 1QVFS 4D5FA 3ESWB 3G71T 1G59A 5HL7L 1IO6A 4JJCA 4DQSA 3KKSA 4BGAA 3H41A 5EEGA 4BXFA 2Z5UA 4A4EA 2HBJA 1JL1A 1Z3XA 4BR5A 3L2ZA 2HYJA 3CQXA 3HTVA 3V6DA 2PVGB 4A12A 5IT3A 2W41A 1WWXA 1HOMA 2JM9A 1YITA 1WJCA 4JKDA 4XRMA 2PJRA 2CS3A 3SPYA 1RBUA 5KRTA 1AKHB 1JUMA 4CHQA 2JZYA 2PJRB 5D4SA 3M8JA 3OYHA 2LSOA 2ZPIB 1L3UA 1VQ5N 1ZUUA 2LNHB 4Z8AA 1BC7C 4OPJA 1VQ4I 4ZC3A 1VQ9A 3H3VK 1Y0MA 4LDYA 2HNZA 2X48A 1WSEA 4WQ5A 4X66K 1S9EA 2GM4A 4RTUA 2RPNA 1KEAA 5KI6A 1J5YA 4ZGEB 1OOTA 1FY7A 4ZN1A 5IP9J 4YPHA 1MBKA 1KZHA 1W9HA 5GAOn 5FPEA 1KXPA 1OR7C 2RNJA 1UG2A 3H3ZA 5M1NA 2CGJA 3M0RA 3HRSA 1SAUA 4ZTFA 4YELA 5CJ9A 3EKSA 3VS7A 4LJZF 2HDDA 3S1RJ 3P83D 4Q5WA 1F21A 1L0OC 3UA6A 2A28A 3M0QA 3VEYA 1B6AA 4MHGA 1L3VA 5ILSA 3O8VA 1XQHA 4BGDA 1VQ8T 3F8FA 4O5VA 2F48A 4HWIA 1NPPA 3THYA 2IXSA 3TP0A 3CWTA 4EA4A 1VSHA 2BTFA 3A5LC 3FHZA 3THYB 2KI7A 1E3OC 1J6ZA 3CMEN 2KP6A 4GRIA 3M8PA 3U6FA 4LDWA 5B8HA 3CCQT 1N32K 4N41A 5EGOA 4ENJA 2HKNA 1H3HA 2MC4A 1ETWA 3OYBA 2HI3A 5EGOB 3CC7A 2W00A 3RMCA 2YSRA 2P9SA 4FVUA 3OVNA 3I0XA 4JNEA 2CUDA 2P9SB 1GLBG 1X01A 1N78A 4B9XA 5L3GA 1XS9A 2CQNA 2YI1A 5HVQC 4PGGA 4BRHA 4AHTA 2DO3A 4A2AA 2QWPA 3A8LB 5GAN4 1Y7XA 2M4KA 1ACIA 4PNOA 3G4SQ 1QRYA 2E1YA 1AA7A 4DTRA 2EPDA 4Q48A 2RN7A 3GVAA 1KLNA 4RW8A 3I55Q 1CZBA 4M42A 3SV4A 4HOBA 1SMYF 1SUQA 1KO9A 5LJ3f 3QSUA 1ZQ1A 4X9CA 3CPWA 3QP5A 1VQ7A 3CJTB 3NGPA 4U7DA 4A4GA 1KC8R 1RAAB 3DRSA 3EUAA 3D7EO 5KGXA 2UXXA 1R1UA 3NMUA 3VA3A 5DM6F 4XTXA 3CD6A 4UNFA 4FSSA 3HVTA 3FZLA 3M55A 1ZA2B 1S72I 1BKBA 1SL2A 2NOBA 1K9AA 3A2FA 4A4KA 2B6AA 4WCIA 5GAN3 3J7AY 1OH7A 4KV8A 1V5EA 4ZJZA 1KLMA 3HSFA 2KFZA 3MX5A 5HRSA 4HLYA 1WFWA 2RMOA 4HX7A 2L9SA 2X9DA 4KN7X 1EKEA 4YOWA 4MMKA 3W2VA 1V4RA 1IKWA 1M3BA 2FBXA 2CMPA 3IH2A 1T0FA 2DA5A 2EK5A 2FOWA 4I02A 1R5GA 2CUFA 1MWKA 2MG4A 2DBBA 1LWFA 4B6MA 2FLOA 4LFBK 4ETSA 1RC9A 3DWLE 2EWNA 4P5OA 1Y0UA 1YHQI 3RJPA 2VJIA 2COMA 1SAXA 2EBPA 3RTRA 1T8EA 3CCUA 1ZBIA 1GOBA 4BYYA 4IOCF 5HLTA 4ZYEA 5HLGA 3TOBA 4DZPA 1YJ9I 4A54A 5L23A 2CG4A 2D4WA 4M9ZA 4I7FA 1ZN2A 2D0OA 1JL2A 4DYRA 3QZ9B 2X4XA 3BG5A 3MEXA 1KU3A 1WHLA 4HSTA 3VF4A 2XI9A 2XF7A 1MUDA 3S9HA 1LW2A 3HPGA 5FRMA 2KFDA 2ENMA 3SCXA 2CQQA 1H9TA 1XSVA 1M90O 2JJ7A 2EINH 2B5JA 2EQIA 4BDZA 2HU9A 2FZCB 2LRQA 5DYMA 3JCMV 4AYBA 3HPWA 2VWJA 3ZQGA 2X4JA 3I55N 3CYMA 4UVBA 2UXDK 1TG0A 4OAZA 2W10A 3X28B 4BR9A 3HTSB 3UE5A 2A05A 4JK1X 4JD2B 2NOFA 2HOSA 2WFBA 2CUBA 4C23A 2Q8KA 3DBLB 1F9NA 5GAMe 4PFPA 4DBRA 1C0MA 3HPOA 3PFIA 1A5XA 2EYYA 2OTLQ 4DG1A 4IHWA 1PVEA 4OINF 1M2OA 5FLXK 1ZG5A 3K0SA 4XU3A 2YSQA 2AKLA 1K9MO 4IRIA 1PKSA 3K5LA 1ON2A 1OPCA 1SANA 2HR3A 1LMZA 3NE6A 3M0SA 2QWRA 3BT9A 2NRZA 2CREA 3DLEA 2QCOA 4KHQA 2E6ZA 3OW2M 1KQSA 2PY5A 5CR4A 1QTMA 3TDZC 4H4OA 1OYIA 4GFBA 4BY1J 1FX7A 2DERA 1ZK8A 4OFHA 3OGDA 4KREA 3WT0A 3JCMh 4HUEA 3V4GA 3PIOA 2QQ9A 5KVRA 2QW9A 4AHUA 1BIZA 1OPLA 4PJLA 3K4CA 3MZ8A 3O9RA 4KNYA 1WI7A 5D5UB 8ATCB 3UKUB 2P0PA 3I33A 4PKGA 3VEZA 3GTMJ 3EHQA 3GOXA 2UUZA 3CC2T 3DEUA 3OSFA 1ZXOA 2CP7A 1BM9A 4JHDA 3K4JA 1RTJA 4A5NA 3KP4A 3C6TA 2IS2A 4JHDB 4ZYGA 4ZDOA 3B8AX 1IGUA 4PJOG 2DI3A 1KD1O 2F9TA 3LSPA 1Q95G 4OLBA 4A3GJ 5J2PA 3CCVI 2K2MA 3CCSI 2UWMA 1QWFA 3T1HK 4U88A 2V7FA 2X9HA 3EG3A 2GWKA 4V19K 1B3QA 2P9LA 2BE5F 1IN5A 1YYVA 3QBWA 4FZXC 1MV3A 4M7DB 4BI3A 2COWA 1X19A 5GAN2 2P9LB 1XWLA 4W97A 2E64A 2XY8A 3IHUA 4Y52J 3CPFA 4WF9L 2K79A 3ZEHA 1RI7A 3TTCA 4PUOA 1WJAA 4IEJA 3IKMA 3C0CA 2OCEA 2AS5F 2XU8A 2DT5A 2W04A 2JRTA 3A0BC 4QTRA 1IH7A 5CVRA 3JW4A 3FLGA 9ATCB 1X58A 1XMOK 2KLOA 3ZMUA 3LQQA 2D6FA 4CW7B 1N8RO 1QVUA 4RTZA 3SBTA 1ATRA 4GYIA 2LKSA 4FJHA 2EYXA 2IDOA 2FX0A 2DD4A 1D0YA 2ZBKA 1DQUA 2OTLN 4CI6A 4C92G 2KQ2A 2GUIA 2G9WA 2GZWA 5GAN7 4DTMA 2GA2A 4XOPA 3AARA 5IP7J 4DV5K 3CBOA 2XG8D 2DJNA 4XH5A 2W0ZA 4C0DC 2E1MB 4CYCA 3KX2A 2KMTA 4JKEA 1M3QA 3M8QA 2Q36A 1S7OA 1PJRA 5J47A 4M3EA 3P9IA 1IV6A 4XL9A 4G9YA 3QAHA 5L8RE 3PNVA 4HF0A 2EKHA 1TT5B 1LVKA 4JLGA 3AO3A 5HLFA 4K25A 2V7ZA 1O3RA 3OW2S 4EIAA 2XF6A 1OH6A 2BOLA 4GVMA 1NGEA 5I42A 5C0YA 1UFMA 2KJBA 4EATA 4ISFA 1YIJI 2EB7A 3AL0C 1CF7A 3PNTA 2O88A 3A0HC 2FF6A 3SBGA 4DR6K 4M78G 3AAQA 2B9SA 3DKWA 4UOBA 2EPFA 4XKBA 4E4HA 3L2WA 1NM7A 2HEQA 4MQ3A 1Y71A 4A3LJ 3HSBA 3QPTA 1YQLA 2EZKA 2M7AA 4DOZA 4UV8A 3F0ZA 2CGHA 5J1RA 1XMKA 2EH3A 2E19A 2FBIA 3ZX3A 1X3MA 5AZIB 2IS6A 3BPVA 2WSFE 4VUBA 3CMAN 2ELJA 1FW6A 2LREA 2BZYA 1SVOA 1X1CA 3WVEB 1MGQA 4PA1A 1I27A 5DS9A 3H9GA 4BRAA 2M51A 5L3FA 4W5RA 4A4HA 3BUZB 4CO8A 2ZJRF 2K85A 4ZDLA 2LC4A 4KT0E 3HZ6A 2XAGA 3ATUA 2DVEA 2DIQA 1LNXA 5K7ZA 2HVQA 1T44A 1M8MA 1RBTA 4A0XA 5FKNA 4M75G 3MWPA 3OS1A 4C5EA 5CKTA 2CS7A 4BD3A 5AQOA 4M7AC 3H9JA 3DWLA 5FD5A 4YPRA 4CEOA 3EUHC 3J7AP 4PZJA 5C2FA 4D8KA 5AQXA 2DOFA 1YE9A 1EFNA 2TDXA 4CHPA 1BIBA 2RJEA 3BFMA 3SLCA 1K83J 2W57A 3Q1JA 1K6YA 5J6XA 4EJWA 3V42A 4HUGA 2H8WA 4M9XA 2XICA 1WNLA 2ZXWH 2IA0A 4HAMA 1VQNI 2M5WA 3V9SA 3V1OA 4AVZA 4BI8B 2FQ3A 2O8KA 2ITGA 1RACB 2W85A 1HPMA 3A01A 1VYUA 1N39A 4HNTA 1ORNA 5GANd 1XHZA 4LF8K 3A01B 1YS7A 4BJ6C 1JXOA 4PLIA 1GVDA 2EQRA 4LD9K 1UDLA 4RM2A 2A42A 4FK4A 1HX1A 2NVYJ 4II2A 1Z67A 4HT8A 3EE9A 4FL9A 3FIFA 2DK5A 4NS5A 4YRVA 3S2WA 3B6CA 1N34K 3RKQA 3FXLA 3M59A 3HRGA 4OLAA 2FO0A 1H8KA 3VW4A 4JPBW 4M77G 1UHSA 5HBMA 3TTDA 1O13A 2I7PA 2WC9A 4RB1A 4CJ7A 2KT0A 1UWBA 3A02A 3OR2C 1D1AA 3RR6A 5D5XB 2I2LA 2RH2A 1NBEB 1WXTA 5JLWA 2EGAA 4CJTA 1GOAA 1BA1A 1ZBFA 5FU7B 1NLOC 4BG8A 1WH5A 5J3LA 4A62A 1HPZA 3JRCA 1YJNQ 3VUBA 4ABZA 3JTGA 3JB9G 1CKAA 3A0IX 3DLRA 4JJDA 1RT6A 1LFBA 1BB9A 2W1OA 3TSPA 3L1PA 3HOUJ 1BW6A 2RQPA 2N8GA 5KN9A 1VQ8A 3M1CA 2VB6A 2YPRA 2A36A 2ECCA 5BR8K 2VG5A 2L3RA 3KWGA 2NYSA 3KD1E 4XU1A 3CCQA 3OS2A 4WCGA 1W1WE 4XBFA 2O2OA 4ILGB 2FB7A 2IA2A 3O8GA 1S7AA 3GP8A 3R6MA 3OIPA 2O5RA 3SPZA 1FTZA 4JAXA 1WHGA 1W2BM 1WDXA 1C1BA 1M1KR 2G8KA 1I5LA 2KTQA 4AHRA 3QICA 1X1PA 3ENBA 4FOIA 2MSYA 2KY9A 1WZOA 3U9DA 4X34A 3CPWM 2HW3A 2G3RA 4OIPF 3CC7N 1RKWA 5M5WJ 4IUVA 4K42A 3P7NA 2GUPA 1M90U 4J7FA 4IXAA 3V1RA 3MEUA 3IHOA 4KI6A 1FKPA 4Y3OA 2B4JA 3CCJT 4Y1DA 1T39A 3JB9H 1KC8C 4J83A 4ZDPA 1D09B 4ZZDA 3O6WA 2VLAA 1H641 3E01A 1MMSA 4QKUA 4CGJA 4Z02A 5K5QA 4W1UA 1HK9A 4N0AC 4LE9A 4D9JA 4IHTA 2HNYA 3CQYA 3DKXA 3GIBA 1YQKA 4JI2K 3HUGA 3A5MC 2KIUA 2ZO4A 1R9TJ 1WAFA 3HRUA 4FWLA 3HUGB 1GBQA 1A6QA 2DAOA 4HG2A 2M34A 3LDNA 2HFHA 3G1LA 2RQQA 4R5PA 2CP3A 1K9MU 2FVUA 3OS0A 4JJBA 3G2BA 1VQKI 4RTFD 2XGXA 2DMTA 4L9NA 2QA4Q 4EJZA 2WAQN 4YTLA 1U5TA 2LX7A 5D5VB 1H1VA 1QW1A 2V8KA 1Z25A 2LBFA 4XIDA 3QQAA 5EU7A 3H9NA 3ELKA 1Y0NA 1ZREA 3CEYA 2VQEK 1WA7A 1U5TB 3UPUA 2FA5A 1PSFA 2LBFB 3NVKA 1YJNN 2KQRA 3GWZA 4R1HA 2LCCA 3JCMf 2KK4A 1L5UA 2DYSH 4M6XA 3KTUA 2LJ0A 3ZSXA 3TO9A 1SD7A 4J9BA 1I94K 5C15A 3LWLA 5TISC 3K4BA 1OYXA 4ZTJA 1E6HA 3VYUB 4ATOA 4WFNL 5LRRA 1TLHB 4ON0A 1D0XA 3LX7A 2O01E 2F1LA 4W5NA 4YDUA 1YVNA 1N33K 2WAFA 4KTQA 4EP5A 1SD5A 1KD1U 2V4JC 4DZJA 4JLHA 1SEUA 4I9LA 1N77A 1W2BS 2NRRA 4NLBA 4GKJK 2LOOA 3FEOA 4JI7K 1ZR2A 5E8IA 3S17J 4I2QA 4S05A 3BJOA 4I09A 3SXYA 1WSJA 2FRHA 5GAMh 2NS0A 3SNNA 1WBDA 1HRHA 3SAFA 4XORA 3KLHA 4FT4A 2QQAA 3FJ5A 1HA8A 4FJLA 1BQMA 2ZMEC 4BQOA 1VQMI 1HU0A 1WRJA 2VASA 4M3GA 4IJAA 1B92A 2WB1A 4ESJA 1BUPA 1IN6A 3MN7A 3JSPA 4HBLA 2EJFA 1OVYA 2V1DA 1QHGA 1I1SA 1VQOI 1K73R 4BREA 4RB0A 5ICGA 4EMGA 1VK0A 2JN6A 4H0VB 4ZH4F 2DKGA 3AG1H 3R1XA 1CZAN 1MNEA 5DD4A 2V7YA 1G15A 5LJ5j 5TJJA 4FM4B 3OBYA 2Y1JA 4CK2A 1N8RU 3G7ZA 5D6FA 5AJ3K 1I0CA 4EA5A 4FLTA 4DF8A 1OQYA 4XH1A 3DLHA 1JTXA 4JX4A 3PNWC 2O8DA 3KNTA 4IO8A 3DTKA 3VQEA 4OPHA 3N4MA 3BWGA 3FGUA 3I5UA 1W7PD 4CICA 1VQ6Q 3EN9A 5JVGL 3TVTA 3DXJF 1KG4A 1QNTA 3T69A 2QA4N 2LG4A 1VQLI 2K9NA 3M8RA 4AQYK 3HPHA 2E2PA 2PN6A 4MFBA 3H1VX 1Q81R 1NG7A 4BRMA 1WLPB 4Z6YA 3CJBA 4CVNE 4D7NA 3CCMA 3LWIA 2ZNZA 4M3FA 5HCKA 1OLTA 4EZ9A 1WSFA 3NH1A 1SRMA 5BS6A 3BTLA 1HQUA 1ZBSA 2Z99A 3CC2A 3G0QA 5B3SH 3AT1B 1WJRA 4RG2A 3O5ZA 2ZB9A 1ZG3A 3AVFA 3QU6A 1X3UA 4HCCA 2ZAEA 1IF1A 4H0TB 2VJ4A 3L6QA 4QIWN 3EE8A 2E3IA 5C6SA 3RRGA 4CHNA 4CF0A 1U9OA 5AQGA 4CHYA 2IGNA 3JCMX 1RI0A 3QNNA 3WTVC 2F2VA 3JRHA 3NFCA 2Q1NA 1R00A 4A5AA 2DMQA 2IT0A 4NL2A 4X9DA 2JVGA 3UKRA 1DT9A 2M4GA 2CZ6B 4KTWA 5EJCA 3M07A 3UKRB 3TOAA 4EJTA 3BTIA 3M7GA 2OPSA 1Q86O 1IGNA 4WQ4A 1MJBA 1P7JA 2LZ6B 4HHTA 2QAZA 1VQ4T 2Z33A 2BZXA 2KT8A 2P9NA 1Z3YA 2DZCA 3VRYA 4WWCA 5M5XJ 3M8FA 2JW4A 4LF5K 4AMCA 2P9NB 5C25A 2QEXQ 5GTIC 1PG5B 2FSJA 4F91B 4QQ6A 4NC8A 4R56A 1MDMA 4B9MA 1V4SA 3JCMW 3AVIA 4OMPA 5C10A 1MDMB 1TNSA 4BE0A 4LLGF 4OMZA 1ABOA 1MIJA 2A1SA 1R5HA 4AM6A 2R57A 5GAGP 4FTHA 4G8XA 4W5OA 4JYAK 2K7AA 4XLCA 4DA4A 3SQ2A 5J4YA 2QK0A 1HYZA 3PO3J 5GTHC 3DB4A 2BVMA 3U21A 4A3IJ 4B44A 5HLIA 4CFBA 2ME0A 4LFAK 1O3SA 1TVRA 4OVLA 3EG0A 3VERA 2IVOA 5DLOA 3NPFA 3MKDA 2QG9B 4HQEA 3TSUA 1GXPA 4OGEA 3E3VA 1JLFA 1TV6A 3RI4A 5E84A 3CUQC 2RB6A 1VQ6N 1JE8A 1OCOH 4EHUA 5CQYA 1TKZA 1GXQA 3CJ1A 3WNEA 1JT6A 2JSPA 2FXUA 2PMZN 5HRPA 3KEOA 1T33A 3TBIA 1VQ5I 5FWBA 2ZF5O 4EQQA 1ARKA 1UJ8A 4HCZA 1KFSA 1TKDA 4HRIA 2DMOA 3G71Q 5GIOA 2WC2A 1JXMA 4ILHA 2M1HA 1BBYA 1E6GA 4ENMA 4I6MA 2ED1A 3BOQA 2KISA 4L9VA 2PZ1A 2LRDA 2P0KA 3ER0A 1RRSA 1APLC 4TV7A 4I6MB 1MBFA 1TUCA 3G25A 2HVHA 4EJOA 4XTUA 5FKOA 3C95A 3CI5A 1NHAA 1KVCA 2IGKA 4Q0BA 1NU0A 1IUFA 4HX8A 4WX9A 1ASUA 4E47A 1L3SA 4Z2YA 1IN8A 4LDUA 4DSIA 1YG2A 4HV5A 2RK1A 1OYWA 2P0WA 2HXOA 3RKWA 3KP2A 2A6AA 4KFBA 1ODDA 2XDPA 2W03A 3LSHA 1BIUA 4A3MJ 1XQPA 3GZNB 2EFWA 1TXQA 2JVHA 4F7UF 1CQTA 3KPHA 4YFXF 3OSGA 5HOOA 1X9JA 3CMEI 2MCNA 2K2VA 2R7FA 1RRJA 1JTYA 2QI2A 4A2UA 2FUG2 1SPKA 4XH4A 2CQ7A 3V8JA 1FN7A 4M77C 1S72T 3NGYA 2W82A 2HNIA 3QO9A 4B1RA 1E3MA 1U3OA 3C2BA 3O4NA 2HHUA 3OA6A 1PU6A 1JB0E 4PKCC 2ADUA 4GV3A 4H5RA 1M3CA 2KRMA 1RAIB 2OZSA 3U3YA 1UHCA 2ETHA 2HAXA 1NJWA 4IOAL 2CGLA 5AQFA 1LWWA 3I59B 4HTUA 1HJOA 4MQVA 1UJ0A 2E60A 3PFYA 3ENOA 3K4MA 3VQ8A 1S6PA 1S7EA 1EWRA 1IJJA 4DEXA 1DGRM 5EG0B 4H0YB 1JKRC 4AFQC 2KRHA 4ICLA 4FZZA 3DP7A 3SJJA 3OMCA 2NRAC 1V29B 4UQGA 3DPTA 1T95A 3W6KB 4GXOA 4KIBA 3M1EA 2EIKH 3SDBA 2HSEB 3P39A 1YUWA 3FF5A 4L0ZB 4XU0A 1V3FA 3VV0A 1LKXA 3PTAA 1X6BA 1HSQA 5ICEA 3CDIA 1HDDC 1FBQA 3RZDJ 1YTUA 2PFUA 1Y56A 2XRLA 1YJ9T 2JUCA 5FFXA 3DLMA 2KDSA 5I9EB 2Z16A 1FYMA 3G71N 3GTGJ 3JAMK 4JK9A 1RESA 3SMPA 2CSIA 2FC0A 3CBMA 4HVJA 4RMNA 2V1QA 1GCQC 1BDGA 4E7KA 1RT4A 4ME7A 3ENHA 3I71A 3L2RA 2NAZA 3WG9A 3U4LA 2LNBA 2UU9K 3H0IA 2ECBA 5AQQA 2OPRA 1TWFJ 4P55A 1XG7A 4G94A 2HPMA 4QSHA 4QW2A 2OJED 2RQTA 2BY1A 3F10A 4FW2A 2KDZA 3ZT4A 4UXNA 4X64K 1FK9A 1SL0A 1LJ9A 1XMAA 3HYFA 2DK3A 3F0CA 1TW2A 1X2KA 5JLXA 4U87A 3QYEA 4OB3B 4KH5A 4FJGA 2E35A 3RMSA 4FWQA 1T56A 1H3ZA 1HKTA 2VUMJ 4UB8C 2IA1A 3AA5X 4HYEA 1M1EB 4YOXA 3LAJA 2YR2A 4HV6A 3ZSQA 5LMNK 5LGTA 5FFZA 2NVTJ 4HNVA 1L3TA 4CFDA 2DA7A 5AQSA 9ANTA 1SHGA 4I7HA 4M3DA 4JDSA 1TH7A 4JI0K 1B07A 4CCHA 4EGZA 3D0PA 5CVUA 2QKKA 1X27A 1FYLA 4L59A 3CFOA 1T08B 4CF8A 2IVMA 5JS2A 1M1KC 2QM3A 4KICA 3EGDB 4X6AJ 3NDKA 1EIFA 3IS9A 1VSLA 3FB9A 1NPRA 1MBGA 1AWWA 5A2QO 3FBNB 1ILYA 5KH6A 2ID6A 2VI6A 3NFAA 3I55I 1OX8A 1QBJA 1TL1A 4B09A 1R59O 5GAMf 3CTAA 4BG9A 2ED0A 1P6RA 2GELA 5BR9A 3VEOA 2GIVA 1VSIA 4AH9A 5HNHA 2KRCA 3R8EA 4HEA2 2Q0OA 1KG7A 3ZT3A 4K0KK 3VQCA 1TWAJ 3C7NB 2IS4A 2JT1A 3K4NA 2D9TA 3CCJA 3CCVT