4BE2A

Pfv intasome with inhibitor xz-259
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be2A03
2EQKA 3HPOA 3NTHA 2LVMA 4JLHA 1GOBA 3DLHA 2Z1GA 2Z1JA 1IKYA 1HYZA 1Y97A 2BKDN 3ME9A 3DOLA 2HQXA 1KTQA 4Z4FA 3S3MA 1RT5A 1T7PA 2KTQA 5KCHA 4DTUA 4J2BA 5HP1A 2RJEA 3C6TA 2D5RA 2RKIA 5HRNA 3VA0A 2EX3A 4CRIA 2QXFA 4KHYA 4KFBA 3O4QA 2Z1HA 2JZ2A 2X35A 4I2PA 4CEEA 2FHDA 3LZJA 1KLMA 4E0DA 3AVHA 4F2RA 3PUFA 2Y1JA 4FJNA 5J26A 4Y1DA 1U48A 4PA1A 3AO5A 3OYDA 4CJFA 4E3SA 4FZXC 2P51A 3QEWA 3NCIA 4B9LA 3V6DA 4CJWA 1LWCA 1SUQA 2B5JA 4M3RA 3SNNA 3MEUA 3S6WA 4B9NA 2DFFA 3I0SA 3ZSVA 4FVMA 2K3XA 3HT3A 3KK2A 2EFIA 5KGWA 1EX4A 1TKZA 1VSEA 1U4BA 1UAXA 1SSFA 2DAQA 4CIFA 3B6OA 1RT7A 3VN5A 4CEAA 3S9HA 3NH0A 2CKKA 1X9WA 3PNWC 4CJRA 3MECA 3QEIA 4CCHA 3OS2A 1QHTA 1L3UA 1UOCA 4CFCA 4CJPA 4F2SA 3V9ZA 2KZMA 4DG1A 4QW2A 4FLUA 4ID5A 3TR8A 1R0AA 4I7FA 4C8MA 3L2VA 4CGJA 5SWMA 3D45A 3K59A 4N47A 2HHUA 3U3YA 1S9EA 1NJWA 3MEVA 2JGUA 4FZYA 4HTUA 4OLAA 4MQ3A 2YHBA 3LWMA 3QEPA 2VWJA 4F3OA 1HMVA 4FW2A 1C1BA 5J2PA 3KK3A 3CFRA 1S6QA 4FJHA 4QVZA 3K58A 1FKOA 4KB1A 3L2QA 4KREA 3AA2A 4O0IA 4KO0A 1KFDA 3CEYA 2HB5A 1EETA 1T03A 4C8NA 2OPRA 3RMDA 3T1AA 3QERA 4HCCA 3OS1A 1YTAA 4FJLA 4CIEA 1CXQA 3ZT3A 4FU6A 1WLJA 5HRSA 3OYAA 3OYEA 5J2QA 2XY8A 4DQRA 3LAMA 3PX0A 3L3VA 4HUGA 3SYZA 3C6UA 1I3AA 1VSLA 1JLEA 2KW4A 3KLHA 1N5YA 3LPTA 3NTKA 5I42A 1RDDA 3KTQA 4DSKA 1RCHA 2YNGA 1DTTA 3HYFA 4CHQA 1D8YA 3PFSA 4RG2A 3K5MA 2RHIA 2ZQBA 1QQCA 2MWOA 2KQ2A 1Z26A 3ZT2A 5FRMA 1ITGA 3EZ5A 1OYXA 3ASKA 3SCXA 4FJXA 4B9TA 3PMIA 1IKVA 3BDPA 4H8KA 3LX7A 1RT4A 1S1VA 2HHXA 1L3TA 1ZBLA 4NCAA 3DLRA 4GVMA 4CGGA 2FBYA 3A2FA 3OYKA 4DU3A 2G8FA 3TAQA 1IO2A 4IG3A 4C8LA 2B8AA 4LD0A 3AO2A 4FLVA 3QIPA 1JLFA 4J2EA 4CJ4A 3EY1A 4DFPA 5EU7A 4OPKA 5JS2A 4Q5VA 3WNEA 2RI2A 3HVRA 4WE1A 3KK1A 1A5VA 1RILA 4RW9A 3QKJA 5J1EA 1VRTA 4DLEA 1RT1A 4RW7A 4PL6A 2R5MA 4EZ6A 2DY4A 4DTNA 4B8CA 4FZZA 4E89A 2ATQA 3VQ4A 2PQWA 3TWHA 2LTOA 3QEVA 3RTVA 4QQDA 4A4GA 3V1RA 2YV0X 4CF0A 1S1TA 3DYAA 3TAMA 4IUUA 1WJSA 3OVNA 3ZT4A 4M45A 3VQCA 3MEDA 3AVBA 1C0TA 4KHNA 4C5GA 1C0UA 2R58A 1RT6A 2QQSA 3FEOA 4FJ9A 3ZSQA 2Q3SA 4IUTA 5CZ2A 1MU2A 4KHUA 4CHNA 3AVJA 4F8RA 2ZD1A 5FRNA 4NYFA 2BIVA 3AVAA 4YNQA 4RW8A 1VSFA 4KV8A 2E6NA 3RMAA 3SV3A 4IFVA 2OZMA 3LP1A 1WSGA 2P1JA 4AHRA 4M3ZA 1BCOA 4AHTA 5C25A 2RN2A 3AO4A 4OVAA 5I3UA 3E01A 1XC9A 4OJRA 2OPPA 4BD3A 3QIOA 4LH5A 3AVGA 1XHXA 4DQQA 1EXQA 3VQ8A 3GOXA 2B4JA 2QKBA 4EP5A 2O4XB 4HVJA 3OY9A 2GV9A 1LV5A 4LSLA 2RO0A 1DTQA 2XY7A 1YVUA 2OZSA 4BE2A 4IFYA 1LAVA 1HJRA 3C94A 4DQIA 3LDSA 2WACA 1WJRA 4MFBA 1XHZA 4DTPA 3M8QA 2L89A 3ALYA 1W9HA 3DLGA 2FBXA 1ASUA 3THVA 2HNYA 3DB4A 2E4LA 3OS0A 4II1A 4ZTJA 3NH1A 2IOCA 3QINA 4N4GA 5D6WA 3V9XA 1ASVA 3DLBA 4YFUA 2VWKA 2IG0A 3O8VA 3LANA 3NH2A 2FBTA 1OZ3A 4HUFA 2NLUA 1LWEA 3S3OA 2LSNA 3C4SA 1BIUA 1FK9A 2XDPA 3KLFA 3OJSA 5D3GA 3ZSZA 4CJVA 3OYHA 3SD4A 4W5RA 2A1SA 3LWLA 1RBTA 2O4IA 3OYBA 3CQ8A 3V1QA 2X6SA 1S1XA 3BGRA 3VQPA 3QJ6A 3SUPA 1KSPA 4DTMA 1XWLA 1F21A 1GOCA 2G8VA 5C6SA 1HNVA 3V4IA 2QK9A 4FW1A 1SKRA 2YRVA 1J53A 2PYJA 3V9UA 5HLFA 3OYLA 1U47A 4N5SA 2RHYA 1KVAA 4DFKA 2YNHA 1TGOA 4FM2A 4FJMA 4W5OA 1RDBA 4FJJA 4C5EA 1NK8A 4HCBA 3I8DA 3HK2A 1L3VA 3HVTA 2PYLA 1XNIA 1WAFA 4BWJA 3MAQA 4EZ9A 4Z4EA 4OLBA 1VSDA 4CHPA 3QNOA 5C42A 2G8HA 1CZ9A 2HMIA 3AO1A 3RR7A 1D5AA 4Z0UA 1SL0A 1WSFA 4C5IA 4CEFA 4EDUA 1RT3A 4Z4IA 3ZSXA 1ZBHA 4CK1A 2PY5A 1TK5A 2G3RA 4OGCA 3F70A 2KZZA 1T05A 3SV4A 4CHZA 3BDLA 1TKTA 4E7LA 2F8SA 3LP0A 4CJSA 1KRPA 1GOAA 4FK4A 3SQ2A 4N56A 3DI6A 4FJ8A 4N4HA 3CFPA 3KKSA 3K57A 3LH0A 3P8DA 4UQGA 2NUBA 2HHVA 4CERA 4JS5A 4QOZB 2D0AA 4CJKA 2X6NA 3MXIA 4KPYA 4I2QA 3KLEA 2BDPA 3AVIA 4R5PA 3QNNA 1NK4A 1RTIA 1HNIA 1KVBA 4H4OA 3C95A 3IRXA 3T3FA 5KRSA 4DTRA 3E9GA 4BE0A 4CGHA 3OYCA 2VG6A 3VQBA 1RDCA 1TAQA 4B9SA 3ZEHA 4B9WA 2X4YA 4CK2A 2M1HA 5E41A 3HO1A 4B9VA 4QQ6A 4CEQA 2EQMA 2HNDA 1U49A 4FJ5A 3V81A 2HNZA 4HHTA 1WN7A 4F4KA 1HPZA 3AA3A 4FM1A 1H3ZA 1LW0A 3RRHA 4IG0A 1QSSA 4CFAA 1U04A 2L8DA 3M8RA 4AH9A 4FLZA 4CJ3A 1BIZA 3NF6A 4C8OA 3LALA 1KFSA 3L2UA 2EHGA 4DTSA 5J2NA 1UA0A 2KFZA 1UA1A 3HP9A 4QAGA 4LD6A 4W5TA 4CEOA 5M9OA 4NYNA 3OJUA 2RJDA 4GW6A 3ZT1A 4GMJB 4Z4CA 4KI4A 1RBUA 3RMCA 2P0KA 3SUQA 3ZSOA 2P5OA 3MEWA 4W5NA 3FDRA 1D9DA 1WSJA 1KLNA 4NZGA 4DWIA 3M8SA 4E7JA 3PX6A 2FBVA 2M0OA 4M3UA 4BDPA 5CYQA 3O4NA 1ZYQA 1X9MA 5SZTA 1UWBA 1T8EA 1BQNA 3RMBA 3ITHA 4E19A 3O3FA 3IS9A 4Z4GA 3DM2A 1TAUA 3KKRA 3NF9A 3U3GA 4L8RB 5HRPA 2YNFA 4ID1A 4KKOA 4CEDA 3ZCMA 4N4IA 4CESA 5C0MA 4CJTA 4N76A 1TK0A 1C6VA 3V1OA 4CE9A 1C1CA 3VQEA 4PWDA 1X1PA 2RJCA 3IAYA 1ZBIA 4E1NA 4PUOA 3MXJA 5IAYA 3LGLA 2EQUA 3LLRA 4HUEA 3MXMA 2BGGA 4B3OA 2HVIA 2WOMA 2HHQA 3U6FA 4DSEA 1TL1A 4JS4A 3V9WA 5J2MA 2A1RA 3SJJA 3ZSWA 2XO7A 4A4EA 2OPQA 1MHNA 2ITGA 3QESA 2YKNA 3TAFA 2E5QA 4IUQA 4E7KA 3TAEA 2M16A 4NCBA 4C5HA 1CXUA 4FJ7A 3AVNA 1NK5A 3IG1A 4IDKA 3CYMA 3NGYA 4LH4A 4OKEA 1O1WA 3MO8A 2XK0A 3PO5A 3MEEA 2R7YA 3CG7A 4FLTA 3NNQA 4RW6A 3AO3A 4H4MA 2DFEA 2D0BA 4FJGA 3TI0A 1VK0A 3K5LA 3TANA 2B6AA 2OYQA 1JLBA 4DS4A 4O0JA 4CJLA 4BACA 3M9QA 4Q0BA 1DLOA 2HQEA 4DSLA 1QTMA 3DOKA 1KHCA 1NOYA 3PV8A 1L5UA 5CY4A 2W42A 3NHGA 2QQRA 4IUPA 5KTQA 2LDMA 3LZIA 3VQ7A 3H08A 4L59A 4ZTFA 5IN1A 1Z25A 1SL2A 4KTWA 3QEXA 1JLAA 4FJKA 1WGSA 5D6YA 4ICLA 3G10A 3JYTA 3TAPA 3MP1A 3QLHA 2RHUA 2RF2A 2Z1IA 3ZT0A 4DTOA 4QQGA 3AVCA 5CYMA 1QSLA 1TVRA 2XRIA 4DSFA 3SPZA 4CF9A 4DMNA 3QBYA 2QKKA 3LGFA 3O3HA 2RI3A 5KGXA 2F8TA 4LSNA 1JKHA 4FLYA 3AVLA 4E7HA 3G0ZA 1X9SA 1IH7A 3OA6A 1FXXA 4I9LA 3HP6A 2E6LA 4CGIA 1RT2A 1W0HA 3OYNA 3K5OA 4OKKA 3SQ0A 4E1MA 3LP3A 4OGEA 2EQJA 1I39A 1WJQA 4NS5A 4UC4A 4DU4A 3AA4A 3DRSA 4CF1A 5DMRA 1NKEA 1A5XA 4FJIA 3QO9A 4AHVA 3META 3T19A 2BANA 4DF8A 1RTJA 3NTIA 3NGIA 4KHSA 2IAJA 3I0RA 4CEZA 3VQAA 1G15A 3KD5E 4KHWA 2YHAA 2P5GA 3HPGA 3CFOA 1SL1A 1LAWA 5JS1A 4AILC 5CIUA 1RBSA 5KE2A 2D0CA 3RRGA 4E7IA 1HQEA 4CECA 4IUVA 1S1WA 3NF8A 2OPSA 4DTJA 3AVFA 2RI5A 4W5QA 2DIQA 3CM6A 1REVA 4OKJA 3LYIA 1NKBA 1JL1A 3ASMA 3WNGA 3VQ9A 4KTQA 3SI6A 2IDOA 4CIGA 2FC0A 1BQMA 4CHOA 4Z4HA 3SQ1A 1G5VA 4N41A 4CHYA 2BUDA 3K5NA 2DTUA 4KHQA 4G1QA 3O3GA 1WAJA 1U45A 1BI4A 2HHWA 1A5WA 4CFDA 1YT3A 2JLEA 2AJQA 1IKWA 1VRUA 3VQDA 4B8AB 4DSIA 3AVKA 4FCYA 5DK5A 2VG5A 2IS3A 4KRFA 3DLKA 2VYTA 3EAEA 1BGXT 2Y1IA 1B92A 1N6QA 5KE3A 1Q9YA 3MP6A 4DQSA 4CGDA 5KCOA 3OYMA 3DRRA 4RW4A 3CM5A 1S9GA 2VG7A 1RTDA 4FK0A 1J54A 4A4FA 4EP4A 1VSKA 1VSJA 2BE2A 1WSIA 4BDYA 1JLGA 3PMTA 4K8XA 2O4XA 4JRPA 3E9FA 1ZBFA 1N27A 4CJUA 1NK6A 4DS5A 3OB9A 4CGFA 1IKXA 3OMCA 4Y1CA 3B6PA 2HHTA 4FXDA 4PLIA 5J39A 1S5JA 4JRQA 4IKFA 2LRQA 3VQQA 4B9UA 4AHSA 3ULDA 3LPUA 3QIIA 3PO4A 1NKCA 3L42A 3SQ4A 2X74A 4IBNA 3H8ZA 1VSMA 3SUOA 3VQ5A 3OMGA 3NE6A 2D9TA 4ELUA 4I9QA 4CK3A 4A4HA 3NBPA 4DQPA 2RJFA 2LCCA 3PY8A 5HRRA 2E6MA 2RHXA 4HCZA 4FYDA 4O55A 3KUFA 3DRPA 3ZSYA 1FKPA 4B9MA 3NF7A 4KI6A 1RI0A 3AV9A 4B9XA 3MEAA 3L3UA 2JTFA 3AA5X 2IC3A 4X34A 3L8BA 4C8KA 2F5KA 3HL8A 1IG9A 3NGZA 2HW3A 4DF4A 1JL2A 3K2PA 1TKXA 3UWNA 3HPHA 2G8WA 4XIUA 2X4XA 4J2AA 4O4GA 1HYVA 4PY5A 4GY5A 3ZSRA 1CZBA 3VQ6A 3QETA 1JXBA 1SKWA 1Q9XA 4ZHRA 1LWFA 1TL3A 1K6YA 2ZE2A 3LAKA 3NDKA 4O5BA 3WNFA 3ISNC 2GBZA 3L2WA 3HJFA 4PQUA 2PZSA 3UIQA 3MP8A 2DIGA 5HROA 3DLMA 1LW2A 3SUNA 2WONA 3OQ5A 3DLEA 3KIOA 1QSYA 4ELVA 3TAGA 2G8KA 4J2DA 1J5OA 3Q1JA 4CEBA 5CZ1A 1SKSA 2R57A 1NJYA 3V9SA 1B9FA 3LP2A 2XY6A 1SV5A 4Z02A 1S1UA 3TARA 4M3XA 1EKEA 1ASWA 4FLWA 1NOZA 1TKDA 2K3YA 4NCGA 1NJZA 4DLGA 1Q8IA 1NK0A 4F3TA 4FK2A 3KJVA 1VSIA 1NK9A 2EKOA 5K14A 2X78A 4IURA 3DB3A 2I5JA 4M42A 3P5JA 4CF8A 2GUIA 2IGIA 1NK7A 3SZ2A 4M3WA 5KI6A 4Q5WA 3HM9A 1HYSA 4AHCA 2XHBA 3OYJA 3FFIA 4DSJA 3KLIA 1QE1A 1BI4B 1BCMA 1RNHA 1C0MA 2X4WA 3UT1A 3KLGA 4OPJA 2XY5A 1KCFA 3FC3A 2GFAA 3AVMA 1JXEA 3M8PA 3RWUA 2R5AA 1RBRA 2OA8A 2RPIA 4FL6A 1OI1A 4LY7A 4DU1A 3HSTB 1JLCA 4BWMA 1YTUA 2HVHA 4QCLA 3NAEA 4M3TA 1S6PA 4KAZA 1EP4A 4FM0A 1TK8A 2O4GA 3P1GA 2GFUA 3OYGA 3P8HA 1RDAA 2G8IA 4CJ5A 4FLXA 3SPYA 1WSHA 1OZ2A 2G8UA 1WSEA 5C24A 5HBMA 3MEGA 4TSXA 1JLQA 4B08A 3F73A 5KRTA 1VSHA 3VA3A 3P83D 1HRHA 4KB0A 3KD1E 4DFMA 1BHLA 1CLQA 5KH6A 1RTHA 1HQUA 4DTXA 1XI1A 3PX4A 3D0PA 5FDLA 2DFHA 2L3RA 1C1AA 2YNIA 3OYIA 1TV6A 4M3YA 4PLLA 1L3SA 3EYZA 4K8ZA 3TABA 3RR8A 1D9FA 4DFJA 1RBVA 4CFBA 4AHUA 3FLGA 1J9AA 4O44A 2HHSA 3NFAA 1B9DA 4KTZA 1NJXA 1KVCA 3S3NA 4CJQA 3HXMA 4M41A 3L2RA 4RG8A 1ZBUA 2RHZA 3H6ZA 1WNSA 4OVLA 4CF2A 2MWPA 1BL3A 2ETJA 4ELTA 5FROA 1QS4A 2F96A 4BDZA 3JSMA 4BE1A 4CJEA 5T7BA 3OYFA 2YKMA 3DMJA 1BISA 2GF7A 5D6XA 2KFNA 3F9KA 3WNHA
chains in the Genus database with same CATH superfamily
2EQKA 5EVZA 3VRZA 1R59O 4QT7A 1I81A 2LVMA 2D5VA 2DKGA 4M7AE 4KT5C 1GOBA 5E3NA 3DLHA 2Z1GA 2Z1JA 3QOPA 3LAPA 3EHQA 2K57A 1NJIU 1N36K 3GTJJ 2MD5A 3EYYA 4AWXB 3GF2A 1VQNA 1RRSA 2CQXA 2CJJA 2D5RA 2RKIA 4IXAA 1I5OB 5HRNA 4R1HA 2GTJA 2QXFA 1IHVA 1RUWA 4OB2B 2X35A 1NM7A 4CCNA 4CEEA 4IEIA 2CV0A 5BPIA 3FZVA 3LZJA 2XRNA 5I21A 4F2RA 1X75C 2NRHA 3H5RA 1S72A 2Y1JA 2ZFUA 3UB5A 1X01A 4Z88A 4IOAL 3C12A 2QVOA 3X24B 3JB9I 4WQ5A 4F3QA 1WZOA 2QEXI 3HKZA 2DEUA 3O1WA 3GFJA 2HDDA 4BRQA 1SPKA 2MBFA 3CCEQ 3P9KA 4E6KG 3VPZA 4B9LA 2D1XA 4B21A 1YQRA 2I10A 3SNNA 3CCRT 3S6WA 3JB9G 2DFFA 3LDNA 3SEZA 2EYZA 5AYFA 5HLTA 4FVMA 4LG3A 3PIPL 1GLLO 2EFIA 2EA4A 2QASA 1RRQA 1TKZA 1VSEA 2LKPA 4IHXA 1FX7A 2QGGA 2DYBA 3OSSC 5HLHA 2DL3A 2ZB9A 3S9HA 1YFHA 3GF5A 3SLCA 3MKYB 1BJAA 4XOTA 4EJOA 3MECA 1Z7UA 1KD1C 1U1TA 2BGCA 1QHTA 4CFCA 4CJPA 2VODA 1RLQC 3LL3A 2YHXA 4M6XA 3NMZC 5EGOB 1U78A 1PNJA 5IP6A 3M9AA 1EWRA 4KJZA 1YW8A 4EJZA 3JAMK 1VQKQ 4EVVA 1R0AA 2OA4A 2ZJRF 1QRYA 1U84A 1JU5C 4XSXF 1ZUYA 1SRLA 2DM1A 4N47A 4H0PA 3DWLE 5A2QO 4CCKA 5BNGA 3J7AO 2JGUA 4FZYA 1K73R 4OB3B 4ENJA 3V8JA 5KVRA 1Z21A 3LWMA 2DPPB 2VWJA 4F3OA 4FW2A 1C1BA 5ILSA 2EILH 4CZJA 3CCUN 4FJHA 4UOBA 3K58A 2KJBA 1TWBA 2DD4A 1XTAA 2JWLA 1NGHA 1Y07A 4KB1A 4KREA 4O0IA 4LF5K 3ZEUB 2HB5A 2VIXA 2W85A 3FMRA 1JCEA 3ONQA 1L3LA 2JXBA 4PNOA 2NYSA 4RWTA 2EJGA 1D8JA 3SYTA 2ZJQF 4HCCA 1BOAA 1Q82C 2QYOA 1N8RR 4FJLA 3GYHX 2DA2A 4RM3A 3ZLJA 1CXQA 3ZT3A 3AL0B 1I6XA 2HEOA 2OTJQ 3OYAA 1Z77A 2F7TA 3MZYA 3OWTA 3WVEB 2CO5A 2XY8A 4M7AA 1AT1B 2EJ9A 3CI5A 1R5ID 2JMAA 4LLGF 5F6FA 4CC7A 2K85A 4JI0K 3LAMA 5K7FA 4HUGA 1JE8A 3C0BA 3C1DA 4XKBA 1QLYA 1DP7P 4HF1A 2KW4A 1K1ZA 2E1MC 4AFUC 1N5YA 1NEBA 1QW1A 4PJJA 4ENKA 3BW1A 4AIAA 4EW0A 1TTYA 3G71N 1AOJA 4DSKA 1RCHA 4F7UG 2MI6A 4CHQA 4ISGA 3OGDA 1D8YA 2ECBA 1UFMA 2XAHA 4OU0A 3T8TA 1QPIA 5CPRB 3JCMV 4RCCA 3RSEA 1WHGA 5FRMA 1RETA 5ILVA 3EZ5A 5J1YA 3ASKA 1U8BA 4M9SA 1HDDC 5JVGF 5J4VA 1NNEA 4B9TA 4J9BA 3PMIA 3HFNA 1OPLA 2AQEA 2DPUA 1TTHB 3LX7A 4NCAA 4UY8O 4GVMA 3FB9A 3HTUA 4CGGA 3C2BA 3CMEN 2HMAA 5D5WB 2FBYA 3WTYC 2R7TA 3X20B 5C44J 1IRGA 1J5EK 2M87A 2RA2A 4HG2A 3MD2A 1VQNQ 1R7JA 3CLQA 2NOGA 5AQPA 3M1EA 4FLVA 3QIPA 1JLFA 2DERA 1NGFA 1D0XA 3UKRB 4M7DG 1NPPA 3R6MA 1M9SA 2H27A 3U21A 1G2BA 1X2MA 2P5LC 1MDMA 4M7YA 4Q5VA 2CGLA 2EFWA 4WE1A 1Q81O 1G99A 2LFBA 1R23A 1AOYA 3QKJA 5J1EA 1AWWA 1K79A 1VRTA 3RYPA 1RT1A 1QP2A 2R5MA 3ZMUA 2HKXA 5CKTA 4WQ4A 3BDDA 2JJ9A 3WEEB 4DTNA 4FZZA 3AHUA 2CFOA 3VQ4A 1AKHB 2ZGYA 2M45A 3DWLA 2O8CB 2K4YA 3K70D 1ABOA 2VUMJ 3RTVA 1UEBA 4X62K 5GANh 1WVRA 1QZ6A 4KT0E 2VI6A 4RTTA 4CF0A 3TAMA 5GAGP 2O61A 2JJ7A 3O08A 4C2MJ 2R58A 2KT1A 2QQSA 3NVKA 2PMHA 1UHMA 4IHWA 1NGNA 5LY3A 5GMKl 4F7UE 3UE5A 2D0OA 1YJNN 2TDXA 3MX2A 3L09A 1FSHA 2FZGB 3PSFA 4NYFA 3T1YK 3G1LA 5JVTA 2XROA 4OPHA 2BIVA 4BVOA 3AVAA 4QTRA 1BW5A 5JLWA 4YNQA 2DRMA 5L3DA 1LPQA 4ZYDA 4KV8A 1UHSA 1JKPC 3CCLI 5D4RA 3SV3A 4KISA 5J3BA 5GAN5 2E2PA 2MLGA 3LP1A 4M7DB 4AHRA 1UG0A 4FIBA 2EQIA 1H89C 3C2GA 2F9TA 1BCOA 4AHTA 1PSFA 4XLCA 1SFOJ 3I58A 4FL9A 3E01A 1XC9A 1B9NA 2OPPA 2YLCA 3PGGA 3AVGA 4NQWA 3GOXA 2HOEA 4B1RA 3ZRGA 3OS5A 1X6BA 4KN7X 4JI3K 4M78G 3DXKA 2Y4YA 4IL6C 1S3JA 1DTQA 1MNMC 1HXDA 3I0WA 3G1OA 2RQQA 2R7RA 3BE3A 3NWTA 3E6MA 3BG6A 1IUYA 4IEEA 4DR1K 1QQIA 1TU0B 3AY9A 4YIRX 4DTPA 2DA9A 2W10A 4AC0A 1VQ8T 2ZCWA 1T6SA 4XRFA 1FTZA 1BI3A 3CCMQ 4M3EA 2W6KA 3CCST 4XICA 4MLHA 1OX8A 1OR7C 2E4LA 4FYYB 3NQOA 1WJCA 3NH1A 3DCFA 3HRTA 1FYLA 4BY6B 1WI3A 2IOCA 5BS6A 1BOBA 5D6WA 3V9XA 1T6DA 4IJNA 3T0YA 3DLBA 4H0EA 3HSBA 1OZ3A 3DTEA 3E3VA 3RKYA 1GV2A 3JW4A 4UB8C 1UDLA 4ZN1A 1VQOQ 2RNGA 1H8KA 1LWEA 3E0JB 2A5YB 2O3FA 2HD0A 3GW2A 1SD7A 1QCFA 1U9NA 1VQ9I 3ESWB 1S6LA 4HDVA 1FBUA 1RBTA 4A3IJ 5HVQC 2ZKZA 3EFOB 1SVLA 3VS2A 4M77C 1MA9B 3OYBA 1S1XA 5H6RA 2FMLA 1OX9A 1KSPA 4DR5K 1GOCA 2G8VA 3CJQB 3LWHA 2RB6A 4M78B 3THWA 2JA2A 2A61A 1U47A 4N5SA 2EKHA 5JLXA 5F1JA 4DFKA 4XAXB 3VMFB 3MWMA 1F9NA 4M77F 4ZYHA 8ATCB 1N3CA 1Z0XA 1RDBA 5FLMJ 4FJJA 3A5ZB 2VPRA 4LFAK 3I8DA 1L3VA 2ZPFB 2VQHA 1IN4A 1W2BS 4OMOA 3PNTA 2AKKA 3G4ST 4CHPA 3QNOA 2G8HA 4DV4K 1APLC 2HMIA 3W2WA 3LFUA 3RR7A 2VT3A 4Z0UA 3FLCO 4M3DA 1YNZA 1SHFA 3UR3C 4CZKA 4CEFA 4EDUA 4CZGA 4DOZA 4PJLA 3JRBA 1G2HA 4DR3K 1KG2A 1ETKA 4OGCA 4MEXF 3F22A 4M77E 1T05A 1B4AA 3W6KB 4DBQA 2EYYA 2DEQA 3ISPA 4D0PA 3M1CA 2P4RA 3GBGA 2ZZDA 1Z9QA 5ADXH 4M7AD 4XLFA 2PU9B 2GA1A 5IXBA 4JHDA 1J6ZA 4N4HA 3CFPA 1EQYA 3KKSA 1QCNA 1WI7A 2GQQA 2P4TA 2HHVA 4CO8A 4FM4B 3CCVT 5B3SH 1FMWA 1M3AA 3FF5A 3EE8A 5FW9A 3SZGA 2X6NA 3MXIA 1VQ4I 4H5NA 4KPYA 2OANA 2DJZA 5DEQA 4FQGA 2KQWA 3J7YP 4FWKA 4M75G 3AVIA 4RAYA 3I56T 2YXYA 2HQAA 3CBPA 2ZO4A 4CZIA 2AKLA 2G9WA 4ZGDB 5HDGA 2IS4A 4H4OA 5FPDA 3M8EA 3IRXA 3EZWA 4U7DA 1QA6A 3S8PA 1VQPA 2F4IA 4BE0A 2Q31A 2KVQG 1I1JA 4G7ZF 3IKVA 2V26A 4CI0C 3ZEHA 2W7NA 2E7WA 1YIJT 1KFZA 4RMNA 5E41A 1K9MO 3NHNA 4M75C 1R58A 1TW3A 1Y8QB 2AK5A 3RR6A 3J81K 2JUCA 3GMEA 4CZZA 1Y56A 2H3EB 3BTIA 4F52A 2QSHX 1GRIA 2WTUA 7AT1B 3GTQJ 4FM1A 5LJVA 3CXCP 2FQ4A 1QVTA 1V54H 3OH9A 1QSSA 2O8FB 1RR7A 1BW6A 1U04A 4CFAA 1GLFO 3NGPA 3FIWA 2DQLA 2JSCA 4XBFA 1O3RA 3L2UA 2EHGA 4HWIA 4EIKA 1T6CA 2KFZA 4BI8B 3HP9A 1VNDA 4LD6A 3G7ZA 2ROTA 3CCQN 1ULYA 4MHGA 4E2FB 2RJDA 1E3HA 2UXCK 4GW6A 4Z89A 4HV5A 3ZT1A 1GVJA 2Y9ZA 4B47A 2P5KA 1TWHJ 3GEZA 3RMCA 5A0LA 1P92A 3ZSOA 2P5OA 3MEWA 1IXDA 3FDRA 1Z1DA 4YELA 4CSWA 4XEIA 2HQ5A 1W1FA 4E7JA 1P59A 2P0QA 4C92F 4BHPA 2FBVA 1GLBG 3WGGA 3GXOA 3ULEB 2XICA 4S05A 6AT1B 4OMQA 1ACIA 1ZYRF 1ZYQA 1NM1A 3THKA 4M75E 2LNBA 3DPUA 3PL8A 4HCKA 2V52B 3BPVA 1LUJB 4HEA2 1T8EA 1KD1U 3RMBA 4E19A 2NUZA 4M77A 3DM2A 2CS3A 2QGFB 4A5BA 3KKRA 3JAME 2R7WA 3S17J 4GY2B 4CEDA 3ZCMA 5AONA 4N4IA 2XAGA 3RKQA 3ABKH 1D1CA 5C0MA 3CMMA 4IHVA 2O6GE 3V1OA 5GMKi 1X3MA 4MDWA 1YHQN 1KU9A 1SD6A 2RJCA 4C92E 4C3JJ 3KETA 1ZBIA 1VQ5I 3I55N 4D8KA 3TREA 1XMXA 3WE3A 3MXJA 4LF8K 3OH6A 2EQUA 1RR8C 2BGGA 4CCOA 2WOMA 4A3FJ 1YJWN 1CF7B 3I9QA 3WG9A 1WX6A 1TL1A 4MFEA 1I0CA 4JS4A 5M1QA 2M34A 3WODF 3AGKA 2QAZA 5GPCA 2MLKA 5LJ5f 2PJRB 2L9SA 4FSXA 1M27C 5C15A 1MBHA 2OPQA 2ITGA 2L3SA 4NXNK 1W6XA 2OQRA 4NCBA 4V2FA 4LC9B 3AVNA 3LQRA 3VYSB 4KFCA 1YX5A 1R5GA 3O5ZA 1XS9A 2V9VA 2V7YA 4DBFA 2IXSA 2QTVA 2FJ1A 2M0CA 1BG3A 1W0UA 3QU3A 1W5SA 4EMKB 1K9AA 2DX1A 4RAFA 4BY7J 2VGNA 5C2DA 1PP7U 1B7TA 3ER0A 3MEEA 5LGUA 2R7YA 2Y75A 2X1EA 4G12A 1QVGM 4FOEA 3MKDA 3CG7A 1U0JA 1XMQK 4XK4A 5FFXA 2RHKA 1WJ5A 3EL2A 2E1YA 1NGGA 2A41A 4EGZA 2ZNZA 1VQ6A 5AQYA 3TANA 4DYCA 2DO3A 4O3MA 2B6AA 1JLBA 2H8RA 3H35A 1I4K1 3W2AA 3WXIA 4CJLA 2CH5A 3DBHB 2HQEA 2PBDA 1QTMA 1L5UA 2VPLA 2Y4XA 2AXLA 3EKSA 2W42A 5GAOq 1NBWA 2ZPIB 1Y96B 1JT6A 2EK5A 4RGXA 2RD1A 3NHGA 2QQRA 1ARKA 5KTQA 1VQPQ 1R4MB 3H08A 1KQSS 2DYRH 4AVZA 4KTWA 3ZETB 5AZIA 1SZ2A 4I2OA 4DOVA 5DM7F 4ZH4F 1GXIE 4MDBA 2WAFA 4ICLA 2Q1NA 1MJBA 3AARA 1QVGA 4J6XA 2UU9K 3QLHA 1YW9A 2X48A 1MUDA 2K5IA 2HBPA 2NRVA 1ZG3A 3L1AA 2HSTA 2JWTA 2XRIA 2E12A 3J7AF 1FIAA 5GIOA 3QBYA 1O9SA 4JLIA 3G6EI 3CC4N 2RI3A 1K61A 2DTOA 2L3QA 2L0AA 4KH0B 2F8TA 5M1FA 1JKHA 1NTCA 3CESA 4MLEA 4K43A 5LJ5e 3CPWS 1FOXA 5ICFA 3JCMf 4L5EA 4KMUX 2YLBA 1RDWX 1FXXA 2WBNA 2MF2A 2QA4T 2WV1A 3FKIJ 4KITB 3GLXA 4IQJA 2D2WA 4JKGB 1MZBA 2HCKA 3SQ0A 4E1MA 4I09A 3KPHA 3M6GA 2Y9YA 3TO7A 1ZRDA 2WY7Q 3R60A 3E5UA 3AA4A 3AG3H 5DMRA 1R1UA 3O8HA 2P9KA 3VEXA 3TEEA 1HW1A 5A2QE 4FWRA 3DAWA 4C92A 1NMNA 1QQMA 3VODA 2QDLA 2FE3A 2EQRA 1RTJA 3NTIA 1BBZA 1D1BA 4JNEA 2P6TA 3A5OC 3I0RA 2MC3A 1G15A 3FZLA 3CP2A 1FP1D 4E7ZA 5CVUA 2P5GA 1SL1A 3BZ6A 3REBB 3GBTA 5CYVA 1Q7YR 4H5RA 5KYWA 4LDVA 4WXCA 5DY9A 4LNPA 2MW8A 1RBSA 4HAMA 3HEFA 3RRGA 2LY1A 4JKAA 4AM7A 1Y1VJ 4IUVA 3WXMB 1S1WA 1BR1A 4FPAA 2EA2A 2JTEA 4GGGA 3T1BA 3H0DA 1X1BA 3SB2A 2JA5J 1REVA 4MTEA 5KQDA 2G7UA 3IWZA 1EV7A 3QHSA 1I1SA 1EF4A 3CCRI 4OKJA 2O8DB 3LYIA 4XM3A 1X2QA 1JKOC 1KK7A 5GANj 1JL1A 2FMYA 3M8FA 1FN7A 2FC0A 3KXTA 1WBDA 4Z4HA 5IT9Z 1K8KA 3LCNA 3OIOA 1GFDA 2H8WA 3SQ1A 1G5VA 4IDHA 2HWVA 2EH3A 1Q81C 4CHYA 3SZPA 2E88A 3VEWA 3L2ZA 2O7OA 3VEZA 4IRHA 5DUIA 3TL4X 5ICCA 1YS7A 4BC3A 3PFYA 5CHIA 3CCET 3V7SA 2W04A 3AAPA 1BI4A 4ETSA 4CI6A 4LD5A 3IRQA 1HQCA 2VQLA 3RKWA 5FKKA 1YT3A 3H0IA 2MCNA 2CQQA 4LLNA 5IT3A 4YIFA 2J6OA 1SAXA 1NGIA 1B8IA 5F0FA 3S16J 3QODA 2I0NA 3GTPJ 2VG5A 3B02A 5HCKA 2VKVA 5GAMf 5EG0B 1S7AA 1NK3P 3E97A 5IP9J 3DTIA 4DQSA 2KHOA 2G6FX 5KCOA 3C7NA 3OL4A 2BY3A 3DRRA 1D0ZA 1S9GA 3RESA 2VG7A 2D6FA 4WF2A 2RK1A 3S32A 2YHWA 4FK0A 5K1YA 1VQ6Q 4LUEA 4L9JA 2XPUA 1OEBA 3EG1A 3CMAA 1VSKA 2XF7A 2CZ7B 2BE2A 1RL2A 2LLKA 4BXXJ 4LF4K 4KA4A 1VQKT 4OMFB 1ZBFA 1N27A 3PNVA 2NOJB 3ZPLA 3FWEA 2YDLA 4A2BA 3OB9A 1V4RA 3ZQLA 3SEQA 4H0YB 1IKXA 3BR5A 1AWOA 5JLFA 4U67L 4M77D 3HB9A 1FZPB 4M6VA 3G73A 5AQMA 1UELB 4PLIA 4KGXB 4OO1J 3HHHA 3K7AJ 4CYCB 1UG1A 3TVTA 2CUDA 3JCMW 1DUXC 1QQOA 3VQQA 2PEXA 3KYCB 2JN0A 3SQ4A 4W97A 2UXNA 1VSMA 2ETHA 1E6GA 2GCXA 1VQMA 1IB8A 1M1FA 2D9TA 4A0XA 2ZGWA 2HKOA 3VF6A 1AWJA 4V19S 1TT0A 3QZ5B 1FBSA 3VGKA 3FM3A 1YN8A 3F8CA 2VT2A 4BRGA 2J5OA 1FOWA 1QZYA 3QPHA 3OMYA 1FKPA 1FYKA 2D4WA 3NF7A 2OTLA 2KXCA 2DA4A 3SXYA 3F8NA 3OHRA 4MQ9F 3KZYA 4KI6A 1PJRA 5F64A 1SSHA 3DXMA 4X64K 4XKWA 5GAMe 3E66A 3S1NJ 3TMOA 1B72A 2KIUA 4BRCA 2VVKA 2GTDA 1VQNN 2FXUA 1FP2A 1OCZH 3OL3A 4L9VA 2JVVA 3NGZA 2J6KA 4PKHA 2NVQJ 4DF4A 3D2FB 1PU7A 3KEYA 4A69C 2KYMA 3GUDA 3UWNA 2CGKA 1I5LA 3E5XA 4OIPF 2X4XA 4J2AA 9ATCB 2EW3A 3CC7Q 4O4GA 1E17A 2HTJA 1S72N 1YJ9N 5D5VB 2BEOA 1VHXA 3S2HJ 5FKLA 1LJ9A 1Q9XA 4ZHRA 1LWFA 1O3QA 1WJFA 2MA3A 1R1VA 1YITQ 5LJ3f 2X6WA 3LAKA 1YI2N 1ENHA 4O5BA 1NGEA 1U1SA 1LQ1A 3L2WA 1GLJO 2LVSA 1N77A 2PZSA 2K5LA 3GL1A 2EIFA 3UKUB 3C7JA 3VETA 2FSJA 3WHCA 3DLMA 3OBYA 5EDNA 2FNPA 3V8LA 3C0CA 2FF3B 4CVNE 4J2DA 1TNTA 3Q1JA 1IGNA 4DZJA 1T3VA 2O01E 2HBMA 3A4CA 2WTEA 4QS9A 4OF1A 5JLHA 4L5IA 3M0QA 2XY6A 4I0AA 3WE2A 3FK7A 5BQTA 3M1FA 2TCTA 4M3XA 2O31A 4IRIA 1I07A 1MWMA 1K73O 4EVIA 1G59A 3VV0A 5AFUA 1X6OA 4NCGA 2GIZA 2H8HA 5DD4A 3G2BA 5CR2A 4FK2A 4K0KK 1IAWA 2L02A 4NB4A 2EKOA 3MHXA 1VQLT 3DB3A 4OMLA 5JICA 3H1CA 3THXA 3Q0VA 1VIEA 2IGIA 2V1QA 1MDUB 4D5CA 3CC2T 2B9SA 4M3WA 1RPWA 2R7XA 3GZ5A 2YRDA 1HYSA 2YUNA 2ASPA 4IZ9A 3FFIA 3R4KA 4DSJA 3T69A 1N8RO 2EBPA 4O8KA 4BXUA 4GV6A 1C0MA 4C92D 2X4WA 1TC3C 3CMAQ 4ILGB 4PFZA 3LA7A 5E84A 5CR4A 2KR3A 2ZMEC 3FKJA 2KBTA 4Z6YA 2R5AA 3NMUA 1VQ8I 2RPIA 2K9LA 3CUQC 2FOWA 3H41A 4DU1A 3RERA 3ZEUA 1U9OA 2XKOA 4BWMA 3PIOL 3CMYA 3CPEA 3CCSN 4DUYK 4BY6C 4HTLA 1WEGA 4KAZA 1K9MC 4E9EA 2GFUA 3P8HA 1WHMA 4CJ5A 4R79A 1ZAOA 2DODA 3LM9A 3D5SC 2J6FA 4N0BA 3FXOA 4A62A 1VSHA 2EIKH 4U0VA 2VXEA 3VA3A 1A6QA 4I0BA 1LWWA 1M3BA 1HD3A 2QBYB 1VQMQ 3CCMT 3FZFA 1YVNA 3TQ7P 4XLHA 1MBKA 2E2NA 4GYGA 3D0PA 5FDLA 3K4MA 3NWSA 4XOPA 1U8RA 5HK3A 1E3OC 3T8RA 5BOXA 1ORNA 3CCJT 4A5NA 4KH6A 4XORA 2OX7A 1V3FA 4C8QG 1IRFA 3RR8A 1D9FA 2Q2EB 1RBVA 1VQOT 2OTLQ 3WU2C 4HKEA 3R61A 4JX4A 1M5Q1 1O7FA 2RQUA 1DGKN 1T8IA 3NFAA 3JREA 1B9DA 4KTZA 4GDFA 1JUPA 1QKWA 2A5WA 4CHUA 3L2RA 4RG8A 5FWBA 2ME6A 2RHZA 5BMZA 4M74A 3SEMA 3O6BB 4JKHA 3H92A 8AT1B 3G4SI 1RUOA 3CCUA 2ETJA 3TEDA 2FRYA 2CP7A 3PT9A 1YP5A 2DA5A 3TSQA 2HI3A 3WTSC 2FPDA 1TUUA 2YKMA 1QMCA 4X9DA 4U0YA 5AQTA 4H0XB 2JTMA 2BXYA 2X51A 3UKRA 2JA7J 2NRZA 4JZ4A 4HXJA 4LXCA 2ZXHA 1H92A 2DL7A 2CYYA 3QP5A 5M1OA 3CWSA 4A53A 3M0RA 1FOYA 2KZGA 2PLYA 1OYWA 5EC7A 1Q86C 2YR2A 3OIQA 1WNLA 1T3LA 4HVUA 1A04A 1PKSA 4P96A 1GV5A 2NOBA 2BKDN 2CYZB 5KN9A 1KTQA 4Z4FA 3WEEA 3KWIA 1T7PA 2PZ1A 2O5RA 5KCHA 4DTUA 4C8QB 2AA4A 1HBXG 5HP1A 1AKHA 1H8AC 5IYDJ 3VA0A 2OZUA 2LQWA 2O8CA 2EFOA 3G71A 3ENHA 2L0KA 3CCVI 1EA3A 1SVOA 3RIRA 4XRSG 1KLMA 2I7PA 4BY9C 3AVHA 3EYIA 1KONA 4FJNA 4IPAA 5J26A 5AQIA 4Y1DA 1U48A 3CWTA 3I56N 4DNCA 2YU3A 3MZ8A 4XSZF 3DPLC 4FZXC 4EJVA 1JGGA 3IV5A 1JBMA 3ENBA 1RKTA 1WJEA 3K2AA 4D7MA 5LGTA 1NYFA 1VOMA 4UXNA 5HY6A 1FY7A 1LWCA 3QRFF 1RAHB 1Z3XA 3CPFA 5CHZA 3UF4A 4B9NA 1YIJI 3I0SA 4BKXA 3K6GA 2EFPA 4ELYC 3CMEA 4RGRA 4FYVB 2J7IA 3JCMc 2K3XA 3HT3A 3KK2A 4A12A 4BRPA 2ABLA 1XQSC 3I64A 4PJOB 1UAXA 2QTXA 1SSFA 4CIFA 4JYAK 1RACB 3B6OA 1RT7A 4PGHA 2WAEA 2GZWA 3HBTA 4M9ZA 5KYXA 2MGQA 2CKKA 1X9WA 3MCAB 3PNWC 2LH9A 4B23A 2PG4A 4A54A 5IT9O 1LWYA 3M0SA 2Z33A 3EG3A 2ATCB 3PTAA 2GNCA 3OS2A 1UOCA 1XGMA 1D09B 4DG1A 3VWBA 2IIRA 1AWXA 4FLUA 4XU2A 2NRTA 3TR8A 2K3FA 3TTCA 3EGXB 4EMGA 4B3SK 4CGJA 3ZMZA 2HYFA 4CXFA 1SFXA 1CSKA 3D45A 3VDXA 2RF0A 3U3YA 2OUMA 4K25A 2JNGA 3CUQA 5DPKA 2BW3B 4CW7B 1VYTA 3QEPA 3C3WA 1HMVA 2WADA 4BROA 3MFKA 2E5KA 5J2PA 2D45A 3D0SA 4NNJA 1S6QA 2IVPA 2K40A 3FXQA 3IKMA 2KPMA 3CJ9A 1TUGB 4GXOA 2NUTA 2QKLB 3AA2A 3IL2A 4ZDPA 4F14A 1W0TA 1LEBA 3I5SA 1Z91A 1Q81U 1YJNA 3PE0A 1YO5C 1EETA 1T03A 4C8NA 2E2IJ 3HXLA 1PDNC 2EFNA 3BJAA 2DMQA 3T1AA 2V7FA 5FD5A 1XC3A 2A6TA 3X26B 3ZX2A 1KC8C 2L4AA 1SG5A 3BR1A 5C12A 3CCLA 2XGCA 4G9YA 4DQRA 3BUZB 4CUGA 2DPNA 1HYOA 2JRTA 4LF7K 3KHYA 1E4FT 5HNHA 3SYZA 3C6UA 2Z1DA 1M3CA 1VF9A 4BJTA 3NTKA 5I42A 3IAS2 1X27A 2K86A 1VIFA 3KTQA 1YCYA 3CCUQ 5HKCA 2VWBA 1SFUA 2YNGA 3IMXA 1DTTA 4JYKA 3EETA 3HYFA 4LOCA 4BRKA 2ZQBA 2QDYB 2MWOA 2A28A 2DPDA 2F2VA 1K4US 1ITGA 1RAFB 1OYXA 3F0CA 1IDYA 2PNIA 1R4NB 2W0ZA 1Q95G 4GV3A 2F5FA 2VJ5A 1RT4A 4ZDOA 1S1VA 2HHXA 4UVBA 1L3TA 3DLRA 5K7ZA 5M3MJ 3GOIA 2X3WD 3EG9B 5FPMA 3CERA 2HSEB 2FB7A 3OYKA 2G8FA 3RSNA 1ONVA 1HNXK 4X1VA 1MH4A 4IG3A 2P81A 4C8LA 4R56A 3J80K 3MKZA 3I35A 3K9TA 2KMTA 4J2EA 3HOWJ 3G71Q 3FDYA 3EY1A 4PKCC 3LFKA 2PX9A 2LK2A 5GAEJ 3GVAA 1VQ9A 2GLOA 2ZXWH 3N0UA 5JS2A 4DGWB 3HVRA 4PK4A 3KK1A 1A5VA 1RILA 4RW9A 1VQ7N 5AQZA 4LN2A 3KZZA 5GAHP 1LNWA 2L2OA 3EUHC 1I5ZA 1P4WA 4E1JA 4BHBA 4E89A 2YG8A 5BRFA 4JI6K 1HKQA 2LTOA 4J9EA 2F1LA 2P8TA 2A69F 1U6GA 3OA9A 2W84A 4A4GA 3CMEQ 1JTYA 1Y6IA 4LE9A 1S1TA 4IUUA 5E18F 1N25A 4M45A 3CETA 3MEDA 2VGMA 5F27A 1C0TA 1C0UA 2MAMA 3NEUA 2E4HA 3FEOA 1YXQA 1W36C 4IUTA 2XPWA 4LK0F 2E8AA 4RB1A 3DP7A 2ZSIB 2IAIA 3EG0A 4F8RA 4MZMA 4P9FA 1ZHIA 3JAMZ 4L0YB 1DU0A 4KMFA 1Y71A 3TO6A 4RW8A 4QVDA 1VSFA 2PVOB 1NE8A 3BZCA 3TSZA 3TW6A 3RMAA 1HNZK 2RH2A 3KNTA 1ERDA 5KYYA 2Y0SN 3M54A 2QA4I 2JRMA 2O8FA 2YX7A 2NLXA 3K1NA 1J9IA 3AO4A 2VXDA 2Y0MA 3IFRA 1IZ1A 4QLCU 1QZ5A 1F4KA 2HF3A 3DBRB 4DQQA 1EXQA 4HBLA 2UXDK 2X6OA 2XU8A 3N5BB 2QKBA 4DCHA 4EP5A 2W82A 2O4XB 5DCMB 2JMCA 4JEPA 2EV0A 1KZHA 2O2OA 3BQZA 2RO0A 4A5AA 3RMQA 4IO9L 3QICA 1N3AA 1KG1A 1W97L 1YJNQ 4JKDA 1QGPA 1N9SA 1DGRM 2JS2A 1WQ2A 3X25B 1WJRA 5C0YA 1J3TA 4MFBA 1B34A 1XHZA 4DZPA 4FVUA 2L89A 1VQ4A 1GUUA 2QM1A 4C0FA 1W9HA 3DLGA 2FBXA 1ASUA 2HNYA 3SJHA 2OU2A 3OS0A 4YOVA 3CCLQ 2B7EA 5AQQA 2BOLA 4ZTJA 2JQ7A 2E5LK 4N4GA 3K2ZA 1ASVA 5E1WA 1W2BA 1FSEA 1RAIB 3J8AA 2IG0A 1Q82O 3NH2A 1WOQA 3FXKA 1Y7XA 1OPKA 1RI7A 2MABA 1O7LA 4Y17A 2DDBA 1E6HA 1XQHA 1Y0NA 2W25A 4JRIA 3OJSA 4ZYEA 3RMSA 1WLPB 1KAYA 2ASMA 1XMKA 3OYHA 4B6MA 1YBYA 3SD4A 2LP5A 2EJRA 3A8YA 3KWGA 2O4IA 3CQ8A 2X6SA 1SFEA 2WBMA 2KLAA 3H0GJ 1GCQA 3ZGKA 2DFUA 2DT7B 1AZEA 2M0YA 4DTMA 3CCEI 2A7YA 5C6SA 3BF3A 2P84A 2YRVA 2B0LA 1SMYF 1PRLC 4U87A 3OYLA 4M71A 1ABQA 2RHYA 5FU7B 2DN0A 4UUSA 5LJ5d 1TGOA 5L3CA 2PJRA 1NLVA 3CCQA 2JM8A 1NLPC 1K9MU 5GAOr 2GELA 1WJAA 4X0GA 1YRNB 3CJ1A 4XLPF 1FJGK 4HCBA 1Q1VA 1QHHD 4HNVA 1XNIA 1WAFA 4ILJA 1YF5L 2OAWA 4Z4EA 4BRIA 3M07A 4P55A 1OYYA 2EPDA 3O1BA 1BA0A 3DJCA 2IP2A 3AO1A 1K73C 1VQ9Q 1D5AA 3KP3A 1RNLA 1T44A 2ELKA 1WSFA 4MIMA 4EMSA 1VQKI 1EZZB 2I5WA 1RT3A 4J9FA 4AIJA 2AO9A 1IJWC 1E3MA 2L9VA 2LCLA 4OWRB 4JPBW 3GG4A 4A57A 4G8XA 2FUG2 2G3RA 4UVAA 3F70A 2M9HA 2LRDA 4DR2K 1PSEA 2DJQA 1IW7F 4DEXA 4O8UA 3BDLA 4CHZA 1TKTA 4E7LA 2F8SA 2O8BB 1K7AA 4CJSA 2STWA 1G83A 1Y96A 4FK4A 1N8RC 1FC3A 1XDUA 3SQ2A 2DOAA 3QFUA 4JN4A 1IV8A 1P90A 4IIMA 3I71A 3DI6A 4FJ8A 1U5TC 4HSRA 1YHQA 1W5TA 2K9GA 3I55A 1TXQA 2NUBA 4HZFA 4CERA 4BRLA 1LVKA 4QOZB 4BNCA 3RUXA 2D0AA 2FBKA 1WWXA 1YJWA 4CJKA 5GJVB 5GAOl 3BFMA 2UXXA 3HRSA 4MO7A 2JUGA 5E3LA 1X9JA 2OTJI 1TQMA 4R5PA 3BZKA 1AWCA 1RTIA 4JX6A 1D8KA 3BOQA 5JI6A 3V7RA 3T3FA 1WHLA 2MH2A 4J5YA 3L4IA 3HOSA 4DTRA 3E9GA 4CGHA 1X3NA 2HKNA 2L2PA 4ZZDA 1RDCA 4LFUA 4B9SA 2DMPA 4EM2A 4B9WA 2CUBA 1Q7YO 3H5AA 3K1PA 4B9VA 1N5ZA 3OW2M 4IOCL 3QZ9B 1X19A 1KQ8A 2HNDA 2DBBA 2F2XA 3V81A 4EQQA 2VOOA 3Q5FA 1HKTA 1F43A 1HPZA 3WTTC 4HF0A 3FHFA 2QSGX 1LW0A 4RBOA 3KEOA 1BA5A 2IA0A 3PQKA 2P9IA 1VQ4Q 4CJ3A 2HL5C 1SS6A 2HBLA 3NF6A 3WQTA 2PUOB 1T2KA 4G6QA 4DTSA 3LSGA 4WF9L 1QHAA 1QCOA 5HOOA 4QAGA 3WHBA 2Q97A 3U1DA 4NYNA 3HBLA 3GTOJ 3EGUA 3H1VX 5AQSA 3HRUA 3K4KA 1M2OA 4W5NA 5C10A 2XC7A 1FOKA 2LC4A 2CH4A 3GE1A 1HW2A 2EGAA 4DWIA 2O8DA 3CC7T 3M8SA 1WSUA 1WXUA 1TYQA 3K0SA 4ASNA 3LMMA 4C30A 5GADJ 4HOBA 3A5MC 2K02A 3CC4A 3IWFA 2Y31A 4MO4A 4R0KA 1YITT 5CKFA 3IQLA 1UB9A 3W6VA 1UWBA 1VI0A 3J7ZO 1CKAA 1KQSM 2E41A 2M2EA 1YUWA 3ITHA 1BJZA 4A3DJ 3O3FA 4Z4GA 3ELKA 3VS6A 1TAUA 2DL8A 5IYBJ 2LG4A 3G0QA 4DYQA 5HRPA 4Y13A 4CESA 3CCQQ 4A3LJ 1OYIA 2BZTA 1VQLN 1MBEA 4CJTA 5EJCA 3EN9A 1R8OB 4CE9A 3ENOA 3GPLA 3CC2N 3CJAA 1LOTB 3O3KA 4PWDA 4F91B 3PVLA 1X1PA 4JI2K 4GNIA 3OOUA 2CG4A 4BL0B 4XQ3A 1EFNA 4E1NA 1UFFA 3CJRB 5IAYA 2F4VK 4HUEA 2HVIA 5GAMd 3MAJA 4DSEA 5EG0A 4OAZA 2CGHA 2F9WA 3CMAN 3V9WA 3CPWM 2HVSA 2A1RA 2FD5A 4CZLA 1WEIA 4B1VA 3MPUB 2COYA 2KRFA 3ZSWA 3ROUA 2XO7A 5GIPA 1I50J 5LRRA 2YKNA 4D1QA 4IUQA 4QPOA 4JD2B 3L1PA 2K7AA 4C5HA 5GANe 3F23A 2HSPA 3REAB 4YOTA 4L6V5 4PDKA 1XGNA 3IG1A 1WXTA 3SJMA 2KP6A 5E20A 2UXBK 3HYIA 4C0DB 2KIQA 5L8RE 4OKEA 1ETXA 2KEAA 1O1WA 3MO8A 3PO5A 1Z6RA 2JT1A 1YHQQ 2QKMB 3CCYA 1MBJA 1USTA 1OVQA 3DV8A 2GBYA 2LZ6B 4FLTA 1X43A 3I55Q 3CWAA 3L9FA 4RW6A 2DFEA 3ZBDA 2YWWA 2XI9A 2D8HA 3NVMA 3SMPA 3Q3SA 1VK0A 2P9PB 3K5LA 3EH2A 4EPCA 2NNWA 5AQWA 1YJWQ 3W6JB 2W24A 4CYCA 3CCMI 3LDOA 2R3SA 1ZLJA 2DZCA 2KIFA 2A42A 1U5TA 3E6CC 1DLOA 1IREB 3F6VA 4YOYA 5EF6A 3I5UA 4II3A 3CCJI 3B8AX 5B66C 3CHWA 4RDUA 5TRDA 2DCEA 4IUPA 1K8AU 3ZXSA 3OR1C 5L3FA 1OISA 2A68F 1VQOI 1ODDA 3VQ7A 4WFAL 2OTLN 4JKFA 1SL2A 2JM9A 3BT9A 3J81Z 2GWKA 4M7AG 4OMZA 1N39A 2IA2A 3DLLL 2JA6J 3M4GA 4GRIA 3PO2J 5B1BH 3JYTA 2LYCA 1RKWA 2VQFK 2RHUA 2RF2A 2Z1IA 3H3ZA 4JX5A 3ULQB 1NGJA 3A0BC 4QQGA 1X69A 1VQMT 3AVCA 3VPRA 1QSLA 3SPZA 5B5EC 1WHHA 4CF9A 1HF0A 3FZHA 3H9JA 1GVDA 3O3HA 1NZ9A 5GMKm 3MMVA 1PVEA 2CP3A 1GFCA 2XB0X 4ON0A 5DLOA 2FO0A 2LJ0A 4IIOA 1JEGA 2QCOA 2P0PA 3D2FA 5HDKA 4M7AC 2HNHA 5IT9E 3ERED 1IC8A 4Y92A 3CD6T 4YY3K 2DA3A 3JAMO 4F17A 3HL2A 1XG1A 5E1ZB 2E6LA 2LX9A 3K5OA 4RLFA 4OKKA 1STZA 3LP3A 3CJ7A 2E60A 1I39A 2EQJA 1WJQA 4UC4A 4DU4A 4AD9A 4M6YA 1U06A 1PKTA 1GT0C 2XAQA 2DTRA 1JB0E 2LKSA 4AHVA 3OTOK 3META 1Z9CA 2FQ3A 4A63B 4A3MJ 3QG1A 4ESBA 2LX7A 2ID6A 2VB6A 1C6VX 3KD5E 1SVMA 4OP0A 3CJCA 4XONA 3FIFA 5FU6B 2YHAA 3UKUA 4PL7A 1AU7A 1PD1A 5J8CA 3BY7A 3T9NA 3CC4Q 3HOUJ 1MV0B 3G6ET 4AILC 4BRFA 5CIUA 1XUPO 5BN8A 2D0CA 2MIOA 1HQEA 2EJFA 4CECA 1KG6A 4YFNF 4CC3A 4A59A 2L01A 2CW0F 2DTZA 1F5TA 1TOVA 3AVFA 5M5XJ 4EEFG 2L5QA 4G7HF 1W36D 4J83A 1XSXA 2AXTC 1NU0A 3H3NO 1OLTA 1D5YA 5LRSA 3WNGA 4HF2A 2IVMA 2X6XA 2FBHA 3RSEB 2F69A 3FXMA 4N41A 1O3SA 1EIFA 3NPFA 1BB9A 2MPXC 2BUDA 3RPQA 4KHQA 3KTUA 2BE7D 2XD0A 3THYA 2WA0A 3JRAA 3CDHA 3Q9VA 2FU4A 4WQ4C 6PAXA 2OZ6A 5LEJA 3A1PA 3HUGB 2RNAA 3T7ZA 2KRCA 1SRMA 3KZBA 5JHFA 3NAUA 1YJ9A 1XCBA 2RKHA 2BTTA 1A5WA 4JP0A 4RLQA 4PJOF 5IH2A 3VOEA 2A36A 1GBRA 1KQ9A 2IVNA 4OFEA 3MZHA 3OIPA 3GFLA 4NHJA 1NHAA 1ZK8A 1IKWA 3VU3C 3JCMX 3JCMh 4RTYA 4B8AB 2QEXN 1YI2A 5E3MA 4FCYA 2CSQA 2IS3A 1WUAA 2K2MA 2KRHA 5MLCQ 5DV5A 3DLKA 2VYTA 4D6WA 3EAEA 2K9SA 4IO9F 3QJYA 1B92A 1N6QA 5KE3A 4JI8K 4CGDA 3LH5A 4PFPA 4CBUA 2KLOA 3AG1H 4LG0A 2HEQA 3UA6A 1J54A 1YTYA 3ABMH 1VSJA 1LMZA 5CVIA 3FISA 2CREA 2YT6A 2VONA 1VUBA 3L4QA 1X3ZB 4BDYA 1JLGA 2CGPA 3PMTA 3DF8A 2R5YA 2XDDA 3E9FA 2K9MA 3AG2H 3J7AY 4CJUA 3EDPA 2HPMA 1ZSZC 3C18A 1NK6A 2QBYA 4RTZA 2HOTA 1A36A 2VJ4A 3HDDA 3REOA 2KNBB 4J9GA 2Q0UA 3S15J 3VGLA 1BUPA 4Y1CA 3B6PA 2HHTA 2QG9B 2NRAC 3QYHB 4FXDA 3SFMA 3H9QA 1UJYA 2DMUA 5CLSA 2Q2EA 5GANg 3OR2C 4IKFA 5CKBA 4M7XA 4B9UA 3KFWX 4AHSA 1YQAA 1S29A 4Y15A 3DQVC 4I76A 2FZKB 4KUMA 4C0GA 5EX5A 4X1EA 1G3WA 3H8ZA 1YWPA 3OMGA 1JXOA 4LDXA 3NE6A 1IV6A 3DKWA 1PCXA 1LKXA 1Y0MA 1K73U 3CQTA 2RJFA 2LCCA 1EO1A 4NXMK 2E6MA 1O57A 1VQ8A 3DXKB 2UWMA 3MKLA 5KYUB 3CCSA 1SD4A 4CD1A 5HDNA 1JKRC 1M1GA 4B9XA 1LJOA 3MEAA 2HMPA 1K78A 3AA5X 1UGRB 2DK5A 2R7OA 1N8RU 3IUCA 5GAMh 2A3SA 1KG3A 1JL2A 1XPXA 1RADB 2DFIA 2VE9A 2UUZA 2VWFA 1FEXA 4L0ZB 4XU3A 5BREA 1UGQB 1XGOA 4XH4A 3K9KA 2XKPA 4XIUA 5K5OA 4GY5A 1I8FA 1T39A 3QETA 5D4SA 3JS6A 2OFIA 4XTVA 1FMVA 3SWNC 2V1UA 1M30A 3F10A 2IGOA 1QWFA 4FASD 3ISNC 2GBZA 5IP7J 4LB6B 4BQOA 4M3FA 4B48A 3UIQA 3FX3A 5ILUA 3G71T 2J06A 1VZ0A 5HROA 5ED4A 4LJZF 3FSPA 1IN5A 2WONA 2DA7A 5AQGA 1KA8A 2O8KA 4BUPA 3TAGA 3HTRA 2G8KA 1MUZA 1FJLA 1MMSA 3ATVA 4XH5A 2R57A 5C2FA 5AR0A 4B4CA 1NJYA 2YHYA 1LB2A 1B9FA 4CZMA 1GLEG 4H5WA 2NRXA 3GIBA 1N75A 5GAGJ 4A6DA 2ZM6K 4Z02A 3MEXA 1NYGA 1S1UA 4PJOA 3TARA 1VQPI 1S72Q 1NWKA 1ASWA 1YJ9Q 3O9RA 4FLWA 1NOZA 3R8EA 2HS5A 2K3YA 2L7MP 1LDJA 3DFGA 1MSFC 3KZIC 1XCVA 1VYVA 4D9JA 4AYBN 2X78A 5GAEP 3OSVA 3VSLA 1YI2Q 4F7UB 2GQVA 3R1XA 3P5JA 3CJNA 2GUIA 4LB5A 4E6RA 1S3XA 3SZ2A 4MZPA 2HQNA 1G4DA 2JVHA 1JT0A 3P9CA 5AIQA 5HS9A 3EGXA 5F1RA 1W1WE 1S22A 4Q5WA 4FWLA 4XNFA 4AHCA 1TWGJ 3GZ6A 2HVQA 3LM2A 2E7XA 3HM5A 5DTDA 4GVEA 1RAGB 2EINH 2FEIA 3ML6A 2BW3A 1G8XA 4XN0A 3UT1A 1QVFP 1ZR4A 1YCSB 5FLXK 3TU5A 2EYWA 3JXUA 5KNLA 3P31A 1BA1A 2OA8A 1FNNA 1TUYA 4BR5A 4LY7A 1WKMA 4Q48A 3LOCA 2DVJA 4YPHA 4OIOF 3AGRA 3I56A 1J0RA 3RQ4A 2EZIA 4HV6A 2HVHA 4QCLA 5F0XA 3NAEA 4ISFA 3E1YA 1Q7YC 4AG1C 3CCLN 2K6DA 2LY9A 1TK8A 2O4GA 1HNWK 1GL5A 4X66K 5LJ3h 3P1GA 2G8IA 4U0WA 4UV9A 2VC8A 2LOOA 2E64A 3LDPA 5F08A 1ZSZA 4P9UA 2FYKA 4FLXA 3SPYA 1WSHA 4RTUA 3ZQFA 3I5RA 1MNDA 1YIJA 1IN8A 1YJNT 3CJBA 3M53A 4GBQA 1B07A 3F3XA 4CGZA 1JLQA 1OH5A 3I0TA 3F73A 3LW5E 1RABB 2YCHA 2YPRA 3I9V2 3EGDB 3EO3A 2LT4A 5KH6A 1RTHA 2ZGZA 1XI1A 2VYPA 4IXCA 3PX4A 3QPTA 1J09A 2DFHA 3GTGJ 4PLLA 4JRKA 1NEGA 1L3SA 1OKJA 2LJ1A 5LL6S 3TABA 5FU7C 1VQ8Q 2VXZA 2AHJB 3T5XA 3FK6A 1UAAA 3U9ZA 3CCSQ 2CUZA 5CKHA 4LITA 2LD5A 1DP3A 4AHUA 4M77G 1UMQA 5FPEA 1HKBA 4O44A 2J5PA 1XNQK 3N4QA 1ZGWA 4JI7K 3CXCA 4O6JA 4CJQA 3FXLA 2KFDA 2LMDA 3BLYA 4Q5SF 3D1NI 4G7OF 4EA4A 4B09A 1KYZA 3ZN0A 2HVRA 2GXGA 3P4IA 3J81O 2JS0A 3EG9A 2K3PA 4HYEA 1BL3A 3EUKL 3K4LA 1ZHFA 4C9YA 5FROA 5J1RA 1WPKA 4HT9A 2PFUA 3FHNA 1VQ9N 3E1SA 1JKQC 3ASOH 4S0HB 5T7BA 4L3QA 1TUDA 2V79A 3A1YA 2E34A 2E1HA 3DMJA 2X85A 3ID6A 5DDGA 4XKVA 2ZJQL 2CRGA 1OFCX 2ECCA 1DIZA 1MPGA 3P38A 3WNHA 1B3QA 4UV8A 4RUGA 3VTHA 2IT0A 1WFWA 4KDPA 1RDUA 3HSCA 1ZTRA 2DXTA 4AT1B 3GNGA 1VA7A 1KQ0A 1TG0A 4KGVB 2RE2A 5FKMA 1IKYA 5AZJA 3FE1A 1TW2A 4MGRA 1Y97A 3ME9A 4A3KJ 2QWQA 1VQ6I 3GZNB 3S3MA 3SWNA 1RT5A 4FWPA 2KTQA 1SHGA 2P9LA 2RJEA 3BTJA 4A0YA 3C6TA 1ETOA 1HDPA 1DGWY 4YIIA 2FG0A 4CRIA 4BQZA 3QYBA 3TP3A 3M59A 1TUCA 4HVVA 4FHTA 4J8OA 2FHDA 2OBPA 1ACMB 1OH6A 3PUFA 4FETA 1Z9ZA 2EZKA 3MVPA 5LFAA 5CVRA 3OYDA 1P9QC 1D3BB 4CJFA 2BVMA 4E3SA 4BXFA 1X3WB 5AT1B 1A31A 3N97A 1O75A 2XV4S 3WT0A 1M90R 3DLLF 1H88C 3QAHA 2MK5A 4CJWA 3J7YJ 4FE4A 3N05A 3QYEA 4HA8A 3JCMP 4MQVA 3CBOA 3BJOA 4KNYA 4J6YA 2X4HA 2PVDB 2CP2A 2KISA 2SRCA 2NOLA 3HKSA 2XSJC 4M9XA 4NLBA 5HODA 1Z3YA 2NUPB 4YHHK 1IN7A 2DAQA 3K0LA 4UHTA 1GHCA 5F0CA 1H641 3H5NA 3W2VA 2UUCK 2PN6A 4Q47A 2DAOA 3NH0A 3E7LA 4AFSC 5DCMA 4CJRA 1WEFA 3QEIA 3VYRB 2V51B 4CCHA 5LD2C 1L3UA 4UB6C 3JRHA 4F2SA 1T3SA 3V9ZA 1VQ4N 4B3XA 1VQ7A 4PL8A 4WXHA 3I56Q 4LFCK 3M4OJ 5LJ5j 4ID5A 1R1TA 2P9SB 4CBWA 2V8IA 1BIAA 4RGSA 4I7FA 1TSFA 3H9NA 3QDFA 5SWMA 4AM3A 3C65A 3TSUA 2HFHA 1S9EA 1RESA 3MEVA 1NG2A 3FHZA 5C4JJ 4HTUA 2V1DA 4OLAA 4MQ3A 1KQ1A 4IFEA 4DOWA 1YAGA 1YIJQ 1MD0A 2OF7A 4EIAA 1P2FA 1MMDA 4ITVA 5GP9A 2R93J 3O9UA 2L3PA 2XDVA 2GGRA 3EFRA 4C92G 1X2KA 4QVZA 3M56A 2GX9A 3CC7I 1POGA 1FKOA 3C6AA 5DYMA 2CFXA 1QBJA 3CEYA 3URGA 2WB1N 5CJ9A 4KGZB 4NOYA 1A35A 3FR0A 2M8GX 3K4BA 5AZIB 1YITI 2OPRA 2QGUA 4ME7A 4J9CA 1CKBA 2QWWA 1MGQA 1WLJA 5HRSA 2Q2RA 4PJOD 4S04A 4BR7A 4X65K 4BG8A 5GPAA 2Y0SA 3KP4A 4EJTA 4C92C 4O5FA 4PJNA 4KHPK 3PFIA 3EHRA 1X58A 2BZ8A 3L3VA 3VENA 1ZN2A 2VQCA 3KLHA 4BBRJ 2ESHA 4M75B 3QPSA 3LPTA 4HRIA 4KUDK 1W5CC 1RDDA 1FPQA 2JMWA 1HKCA 1TLHB 1DDNA 2ZFWA 1EWQA 4N0AC 5D6EA 4J01A 5JR3A 1M1KR 1SEMA 2XGDA 1YRNA 2JOYA 2DMTA 4AIDA 4LD9K 3ABLH 1W7PB 4RG2A 2RHIA 2PUKB 4IOAF 1QQCA 3ZT2A 2F5EA 3U9GA 5B1AH 3KP6A 4CC2A 4A3BJ 2QENA 3SCXA 4FJXA 4CZFA 2IS6A 3UKGA 1WHUA 1IKVA 3BDPA 2CV1A 5EZHA 3L2CA 5KPZA 2PAVA 3LDQA 1ZBLA 1QZEA 3AAFA 3FGUA 2DETA 2CP6A 2DE0X 3RCOA 1M4ZA 2M3AA 5HS7A 2X0LA 2HNIA 5LMNK 4QSHA 2HHHK 2KE9A 3PIPF 3O8MA 2B8AA 4LD0A 1HJOA 1Q86O 2F2EA 3CDLA 1HSQA 2O8BA 2E6ZA 2DJIA 1TNSA 4CJ4A 1VQ5N 2HZTA 4DFPA 1B6AA 2BYVE 4ESFA 4JZ3A 3TGNA 3WNEA 1MWKA 3FMSA 1XD7A 3LA2A 2D0NA 5LBQA 2K9NA 2UUAK 4ENMA 1ON2A 5AQVA 5HLGA 3DLLA 4YORA 4DBRA 2EIJH 4DLEA 1ZKGA 2LQNA 1I6HJ 2XMFA 1K8KB 5E17F 2DY4A 5TISC 4B8CA 2AS5F 5I22A 4OB1B 4B1XB 1Q82U 4RTXA 3QEVA 2FRWA 1LDDA 4BR9A 2ID3A 5K5RA 1JCFA 3FJ5A 3I55T 1Y39A 3V1RA 2LKXA 3DYAA 1QU3A 1YG2A 1WJSA 1K8AR 3OVNA 5GTHC 3IP4B 2GM4A 2AT1B 3VQCA 3MCPA 1YJWT 4FWQA 5D5XB 2Z2SB 4KHNA 4RAGA 1VQMI 1BI1A 4FJ9A 3O2PE 1MKMA 1MU2A 1Q18A 4CHNA 2P9UB 3AVJA 1YW7A 4FO0A 2JPSA 5FRNA 3BG3A 1B8IB 3I33A 2OPTA 2FX0A 3RBBB 2AIRB 1D0YA 1VQ7Q 3O9QA 2F4MB 2VBXA 1ATNA 4IFVA 3R6OA 3CD6I 5GAN2 2P1JA 3IKTA 4M3ZA 4Y33A 2CH6A 5CKDA 1SANA 4CH7A 4BD3A 1QPMA 2RN7A 4B1YB 1ETYA 3JSCA 4FISA 1XHXA 3VQ8A 2Z5UA 3BY6A 3HOVJ 2LREA 5C4XJ 3EPZA 5GANd 4YEJA 2YX6A 1ZUKA 1VYUA 5HS8A 2FL7A 3VGMA 3SZTA 5BN9A 5GAMj 3COAC 1LV5A 4LSLA 2XY7A 1KG5A 1YVUA 2ED0A 2OZSA 4IFYA 2RNJA 2XHIA 3OW2P 5FU6C 5D7UA 1JRIA 1LAVA 1HJRA 3C94A 4DQIA 1HPMA 5CQYA 3A01A 2WACA 1ZC6A 5GTIC 2JZYA 2M4GA 3P7NA 4V2GA 3QSUA 3G6EN 2ROLA 3M8QA 3M5AA 3ZQCA 4JJNK 3ALYA 2QWMA 4U88A 3I4NJ 1SAUA 4WTOB 2DK3A 4EW4A 3DB4A 4JKEA 3V42A 2JN6A 3AT1B 4EHUA 4UY8I 4ILHA 1S5LC 4ZNXA 2VC0A 3QB0A 1X3UA 4BQAA 3KYLA 4KICA 3A8LB 1A0NB 2QWPA 4YFUA 4X6AJ 2VWKA 3SBTA 4DEYA 2KKOA 4FT4A 1R77A 2PQ8A 1KC8O 2NLUA 2DMOA 2DOEA 2H56A 3S3OA 2LSNA 3C4SA 3PM1A 1BIUA 1FK9A 3KLFA 5D3GA 1BWFO 4CJVA 4FWNA 5GAN8 2JUFA 2H3GX 3SDBA 1X6GA 3CC4T 2Y48A 2A1SA 4NC6A 3LWLA 1T0FA 2OCCH 3Q9SA 4EM1A 3WUHA 3V1QA 2CWEA 2KDSA 1NJIR 1RGIA 4BYYA 4DV1K 5FLXE 2X4JA 4KIBA 2FPFA 1XWLA 1F21A 3DXMB 3M0UA 1YS6A 3M3ZA 4FW1A 4N0AA 1F1BB 1WHKA 1J53A 1B72B 3V9UA 5I9EB 5AN4A 1KSWA 4R55A 4KUIA 1KVAA 2YNHA 3E9OA 2GIVA 2ZSHB 3MN6A 4HLYA 1KQSP 3PIPA 2HBKA 4FM2A 3J80Z 1BC8C 1Q7YU 3N4PA 5ERIA 2EAYA 3B6CA 4C5EA 1SF9A 3HSFA 1JXMA 1NK8A 4JD2A 1T0JA 3HK2A 3HVTA 5DUKA 3CCRN 2PYLA 4OINF 4BWJA 2CT3A 4PSXA 1OMIA 3MAQA 4EZ9A 2VJIA 2R5ZA 4OLBA 4KH4A 4OMNA 3GLLA 3RQIA 3BWGA 1IXSB 4B22A 5C42A 1CZ9A 3QPLA 2O9LA 1JJ2P 2E36A 1MUYA 2CSIA 2NWMA 4XU1A 3D7EO 2GUPA 1SL0A 2KROA 2ZPGB 1OCRH 1GLAG 3BC8A 3A5LC 1GCPA 3HOYJ 4C5IA 3I59B 2KT0A 2CZ0B 4J00A 4Z4IA 3ZSXA 1ZBHA 4FWMA 1MGTA 2KL4A 3CPWP 1GLCG 4B3TK 4CK1A 2P9PA 1TK5A 3TTFA 4A5MA 5FB2A 2DD5A 2R92J 2RMOA 3SDGA 3SV4A 1JJ8C 1MJ9A 3C2HA 3NARA 3JRIA 1B1BA 1ZREA 1ATRA 2IEKA 2NVUB 3PJRA 4OMMA 5LJ3j 3LP0A 3WTWC 1QVUA 2BBYA 3NFCA 1BO5O 1KRPA 4C3IJ 2D0QB 5AFUH 1VQLA 4N56A 4P5OA 5CK9A 5DS9A 2DVEA 1IGQA 2BY1A 1IG8A 5M1KA 3CC2A 3HPWA 2Y90A 2E20A 1WQWA 3K57A 5B8HA 3P8DA 4UQGA 4IF4A 1OH7A 1QQJA 3VS1A 2HF4A 2V6CA 2O9SA 2R7UA 5GAOp 2XKOC 1TS9A 2FOKA 2KI7A 4WX9A 1HK9A 1QVPA 3KLEA 3THXB 5CQGA 1D3YA 2BDPA 3QBWA 2CGJA 4E4HA 5AQFA 1NK4A 2LJ3A 4RKUE 5KN8A 2O9VA 1UE9A 3VEYA 3AL0C 4HQEA 5J47A 1UJ0A 4D5FA 2C0OA 1QO0D 3VQBA 2X4YA 3VERA 1IRZA 2DL5A 2IS1A 1JHHA 3CCUI 1P7MA 3JB9F 1KHIA 2RQWA 2HBJA 4CEQA 2O8EA 3JB9H 3TP0A 4RAZA 4HNUA 4XR6A 1MIJA 2Q0OA 4I02A 1KO9A 1WQ7A 1U49A 2ITMA 4FJ5A 4BVPA 2V8KA 2HNZA 5I2SA 2O88A 4XTUA 4I6MA 1IUFA 3F9MA 1IZ6A 1E7OA 3AA3A 3EG2A 4F4KA 1H3ZA 4RB2C 3RRHA 1K76A 1WXBA 4XU0A 4IG0A 4WFNL 2DBKA 2A5XA 3LL7A 3M8RA 5AQJA 4FLZA 3CCMA 4U7BA 4ESRA 3QOEA 3H1QA 2OTJT 4C8OA 2A3LA 3PLAA 3ZQHA 2FVUA 4II2A 1DKGD 2M9UA 3WQUA 5BR8K 3CCJA 4DR4K 1UA1A 4W5TA 2NVYJ 3TO9A 2BUPA 1VQOA 3OJUA 3RKXA 3MQ0A 1U2VA 2QWNA 2IW5A 4KI4A 1AHDP 1SMTA 5DM7L 4BR2A 2P0KA 3G71I 4BJ6C 1MUNA 2ELHA 4E9GA 1R6RA 2QXLA 3SUQA 5CQXA 1WJBA 2VQEK 3FBNB 1KLNA 3VRYA 2D1HA 4NZGA 3VEPA 4H0TB 4F16A 1HJDA 1NBEB 1N6AA 3IH2A 4WCGA 1QVFS 3PSIA 2JK3A 3PX6A 5DCFA 1IN6A 4FSSA 1HSTA 1PYVA 3M5RA 3CF5L 3HSEA 3UATA 4N4NB 1N9RA 5CYQA 3O4NA 1X9MA 4BC5A 2DOFA 1HC8A 2OI3A 4J8FA 4YOQA 3EFSA 1UHFA 2ZXIA 3F6OA 4EV0A 1BQNA 1KAXA 2XASA 3NF9A 3U3GA 2RK2A 2X6YA 3KYDB 3CMEI 4L8RB 2YNFA 1JTXA 3HUGA 3SBGA 4KKOA 4XTXA 1EH7A 2DL4A 4HSTA 4RCBA 4N76A 1TK0A 1KU7A 3WXKA 1VQNT 2LCSA 2EWSA 5EY4A 1C1CA 1WPYA 3VQEA 1J5YA 3IAYA 1H3HA 1DU6A 3BJ6A 1QP3A 5AQUA 1EH8A 5KQ8A 2WC9A 3KLNA 4PKIA 3LGLA 2MMPA 3LLRA 2CQ7A 3F0ZA 3MXMA 2F2WA 2CP5A 4YG2F 3A2KA 3U6FA 2A08A 5DD8A 1S72T 4F7UF 3A8HB 1YJ9T 4B1WB 3J81E 3WXJA 2EBIA 2WAQN 2CW8A 4A4KA 2ZXJA 3PNYA 1U5SA 2HL3A 3QXEB 5HLIA 1YI2T 1RI9A 3S1QJ 3TAFA 5GMKh 3U9DA 4DV2K 3M3YJ 4UNFA 5KYNA 3HGGA 4BQNA 4M7DC 3MWTA 4FJ7A 1M2VB 2V1XA 1X4PA 1NK5A 5LGNA 4FE7A 4ZN3A 5A2QK 1M3HA 3WU1B 4ISEA 1V5FA 3CYMA 1VQLQ 3NGYA 5EGOA 3BQYA 2EIMH 1NH3A 4LH4A 1KG7A 4OAYA 3CC2Q 3RJPA 3O8GA 2XK0A 1P7IA 1YJNI 1XSDA 4BRHA 3NNQA 3GBQA 3AO3A 2BZYA 4GLKA 2YUQA 4M7DF 1VFCA 4RM2A 1MV3A 4BR0A 1FMKA 3QMLA 5J1UA 3M9QA 4RCHA 4RMOA 2RC4A 3DOKA 1KHCA 3EKUA 2E2JJ 3PV8A 3FXJA 5IWAK 5LLQA 5CY4A 4PIIA 3MN5A 4C2UA 2ME0A 1F1ZA 1VQ8N 4ZGEB 1ZR2A 5LHGA 3LZIA 1OVYA 4BC4A 4XN3A 2M7BA 4L59A 1GDTA 4ZTFA 3LAJA 5IN1A 2DT5A 3QBXA 1Z25A 1TWFJ 5AQNA 3QEXA 1OOTA 4FJKA 5KYXB 2QEXA 1HLVA 5E8IA 3TOBA 3MP1A 2ZF5O 2CSOA 5KYUA 2QUFA 3ZT0A 1UECA 4DTOA 4F7ZA 5IXFA 4M7DE 4OIQF 5L3BA 4XTWA 3LDLA 1ZRFA 2XF5A 4TV7A 4DSFA 4DMNA 5EG2A 3VW4A 3TDZC 3KCCA 3ZQGA 3N4MA 2ZMEB 3H36A 1C0GA 1YQLA 2NRWA 4IO8A 4LSNA 2P9NB 3GO5A 3CUQB 1XNRK 4E7HA 3G0ZA 1X9SA 3CQYA 1TH7A 4M78C 5KK1A 4H5TA 3QYFA 1WB9A 3OA6A 3CCJQ 2KRNA 3HP6A 1W0HA 1ITYA 3H3OB 3MDQA 1E3PA 4BRAA 1GXQA 2NUTB 1BBYA 4NS5A 2FF4A 2XIGA 5AQLA 1QNTA 1R36A 3QWYA 1NKEA 1A5XA 4XQFA 3HHTB 4LMYA 1IXCA 3SHFA 3T19A 2D1VA 4DF8A 2P6SA 2RN8A 2FPEA 4Y4RA 3ZQIA 5DM6L 3NGIA 4KHSA 4E47A 4M78F 4EA5A 3VQAA 2PFBA 3OSGA 3CVTA 1M8MA 1WGXA 3HPGA 3U2RA 3CFOA 3G4SN 2ZPHB 4FYXB 1MH3A 3D7SB 3M7GA 4ESJA 5JS1A 4N9HA 2LNHB 3BY5A 4I98B 4LK1F 1ESVA 4E7IA 2OV7A 3DBLB 5GJWB 3D6RA 3RTRA 1BR2A 2RREA 4B3MK 4DTJA 5IOZA 2ZC2A 3JR9A 1WJDA 2CH4W 3CM6A 4ORZA 4LGWA 4B1UB 1C0FA 3GTMJ 3VQ9A 3A02A 4M78E 2FRHA 2PMZA 4M3BA 2CW7A 4CHOA 3IH4A 4MDXA 2VKHA 2YJEA 4F7UA 3BDUA 1XX5A 4AIHA 4CCMA 2XSDC 4UUVA 2HGCA 1SD5A 3K5NA 2DTUA 2KGTA 2HPIA 3CXCS 4C3HJ 3JRGA 1WAJA 4AFQC 2L4MA 3GP8A 1U3EM 3CCVN 2IJLA 4GCVA 1BR4A 1Y64A 1WBBA 4BQQA 1R22A 2ZPBB 4PUSA 1U45A 1XN7A 4BRNA 4CFDA 3JB9J 1IBLK 4M3GA 4L5JA 2X3XD 3DLAA 3SHWA 1GXPA 2JLEA 4F9OA 3TSPA 1RAEB 1YIOA 1Z7LA 1TT5B 2QQAA 3FXUA 2CQNA 4PCQA 1VAZA 3A0IX 4JAXA 1BGXT 3MP6A 2XGEA 3K1MA 3JRFA 2ENMA 1WDXA 2KZVA 3OYMA 4EJWA 1YIJN 3BPXA 1LFBA 4M7DA 1WCMJ 2RDPA 3J80O 1RTDA 3WGHA 3ZN1A 2W57A 4A4FA 3R0AA 4QS8A 3DKMA 2O03A 2DLLA 5IOYA 2G0EA 4LF9K 3BR2A 4K8XA 4QIWN 1YLFA 1YOVB 2NS7A 3W3CA 4M73A 2LSOA 1HUXA 1ZBSA 2RGVA 5IY5H 2V8JA 2NZTA 4CCJA 1S1NA 3EGDA 3QDKA 1K4TA 4DS5A 4WYBA 3S93A 3HJEA 1YFNA 4BGAA 4EGYA 3OMCA 1QWEA 4AYBA 2QEXQ 4I99C 4PKGA 3BG9A 1PC0A 2M4KA 2M30A 4OMYA 2XG8D 3C6HA 1S5JA 1N34K 4BJ5C 1HCRA 3RZOJ 4RB0A 4JRQA 1NGDA 2JPCA 3CQXA 3O4WA 4J19A 4CBXA 2LRQA 5KPRA 2KRSA 1V4TA 3LPUA 2P5VA 4AQYK 4ABZA 4JJBA 2ED1A 3LSTA 1L0OC 1NKCA 5KYYB 2X74A 3SUOA 1IGUA 3VQ5A 1FW6A 5TGTA 3RYRA 2G7HA 4I9QA 1E0EA 4A4HA 4B9QA 5GAOm 4ZC3A 4DQPA 3DU5A 1SKUB 2HKQB 4M75F 3Q7BA 2IA1A 3VTIA 1SEUA 1QKXA 4JI4K 2F4OB 3VF4A 3CWUA 3LSIA 2IPQX 3CCQI 2RHXA 1S9HA 3EFOA 4HLXA 3CUOA 3KBGA 3DRPA 3ZSYA 4CJ7A 4FOIA 4B9MA 3X28B 1J7KA 4BUGA 1OR7A 4X34A 2E70A 3S2WA 3QWLA 4M78A 4DBHA 2WSEE 3VESA 2YJFA 1OCPA 4C8KA 3BG5A 4IVNA 1B34B 2F5KA 1KD1R 3T1HK 2XUBA 2W48A 1B9MA 4NL2A 2MD0A 2CMPA 1GCQC 2OCEA 3K4CA 2HW3A 4JK7A 3FM5A 5HL7L 2KDOA 2COBA 1TKXA 1M90O 1RFQA 3HPHA 4DV0K 4BB7A 4NB5A