4BE2A

Pfv intasome with inhibitor xz-259
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be2A03
4ZHRA 4LD0A 4C8OA 4KB1A 2K3XA 1SSFA 3BDLA 4IFVA 4AHSA 2CKKA 3FEOA 3NTHA 4ELVA 4CK1A 3QERA 2QK9A 1ZBIA 5HROA 3DM2A 1S1WA 1KFDA 3HXMA 2OPRA 5D6WA 5HP1A 1XHXA 1J5OA 5C25A 4KKOA 4A4HA 4DTUA 3H8ZA 1B9DA 1NKEA 3LAKA 4NCAA 5CIUA 4B9NA 2VG5A 2QKKA 3K5LA 1KLNA 5J26A 1S1XA 1X9SA 2RI5A 3ITHA 4DTNA 1LAWA 1QSLA 1QS4A 2EKOA 4B9TA 3KKSA 1HYSA 4QQ6A 3AO5A 3CFRA 4XIUA 3DLEA 1VSMA 5CYMA 2EQKA 3QETA 4KPYA 4FJHA 1RT5A 1NK7A 1NJWA 4NZGA 2OPSA 1RTJA 1A5XA 1RT7A 4FJ8A 3U6FA 4CJ3A 2K3YA 4FK0A 1BGXT 4ID1A 2R58A 3DMJA 4ELUA 3IRXA 1L3TA 4E3SA 1TKXA 3PO5A 3ZT2A 4OPKA 3VQ6A 1S1TA 2A1RA 3LP2A 4TSXA 2RI2A 1TAQA 4DWIA 4CESA 1U48A 3ZT1A 2HVIA 4ZTJA 1J9AA 2FHDA 2KZMA 1UOCA 4L8RB 3VQ7A 3NF8A 1SUQA 3OS2A 1NKCA 4N4IA 2B6AA 2XY7A 4FJMA 3L3VA 1N6QA 2HNYA 2HHVA 4FL6A 4UC4A 4M41A 3D0PA 4DFPA 3CQ8A 2I5JA 1QSYA 4NCGA 3S3MA 5DMRA 3U3YA 2OPQA 4KHQA 2GBZA 4FJNA 2G8HA 3QIOA 3VA3A 1Q8IA 2FC0A 3EAEA 3SUPA 3OYDA 3ZSYA 5C0MA 4DS5A 4Q0BA 3P5JA 2PQWA 3PX4A 2PYJA 2HHUA 3NGYA 4NYFA 1IKVA 1ASVA 2R57A 1EXQA 4DU4A 3PX6A 3VQPA 3ASMA 1NOYA 3DLHA 2LRQA 3M8QA 4FJLA 4FJ9A 3K2PA 2WOMA 2FBVA 1KHCA 4NCBA 2HHSA 3KD5E 4N4HA 1U04A 2HB5A 3HJFA 4LSLA 4CGFA 1LW2A 4CK2A 1GOAA 1WJRA 2XO7A 1NJYA 3SI6A 1JLFA 3TR8A 5CZ1A 1BISA 4F8RA 2D5RA 3B6OA 3LGFA 4OGEA 1VSEA 3OMCA 3KK1A 2RHXA 3VQEA 5HRPA 1X9MA 4DS4A 3PFSA 2KW4A 3JSMA 4FJJA 3CFOA 1RT3A 4EP5A 1CXQA 4CJSA 3QO9A 3LYIA 2O4XA 4H8KA 4H4MA 2P0KA 3QESA 3MEWA 4KHWA 1BHLA 1UAXA 1BCMA 3OYLA 2G8FA 1JL2A 4B08A 4CEDA 2O4GA 3K5MA 4CHNA 3NGZA 3U3GA 4FLWA 5D3GA 2B8AA 2XY5A 3FFIA 4RW9A 2WACA 1VSFA 2RJFA 5I3UA 3TABA 3NTKA 2LDMA 5KRTA 3SQ1A 3DRSA 1S1UA 4CEEA 4HUGA 4DLEA 4N76A 4DQQA 2RF2A 3MAQA 4IUPA 4I2PA 1KVBA 1TL3A 4F2RA 2ZQBA 5KE2A 4KHUA 4HUEA 3I8DA 4OVLA 3L2RA 4CFAA 3OYBA 3LZIA 1X9WA 4JLHA 3AVLA 1RTIA 5K14A 3VQ8A 2DAQA 1VRTA 3L2UA 4B9XA 3QEVA 3F9KA 3SD4A 4HCZA 2Z1GA 1IO2A 4AHRA 3OYEA 3META 2BE2A 4EZ9A 1RBRA 4CEQA 2YHAA 3V9WA 3NF9A 3ZSXA 2XHBA 1TKTA 4CIFA 4CEZA 3KK2A 4QAGA 3NAEA 4CGGA 1MU2A 1JXBA 3ISNC 3DLRA 4G1QA 3AA3A 4O0JA 4W5NA 4M45A 4C5IA 3MEEA 2HMIA 1YTUA 3ME9A 4CJFA 5KRSA 1HRHA 1I3AA 4DQRA 1WJQA 1BIZA 3RRHA 2X35A 3MEDA 2BIVA 5JS2A 3NH1A 2G8IA 3OYCA 3ZSWA 3OYMA 4KRFA 4OLAA 4CERA 3VQ9A 1QE1A 3PMTA 4E19A 3K58A 4CIGA 1JLCA 2IOCA 2QKBA 4IUVA 1DTQA 5M9OA 1ZBHA 1T8EA 2DY4A 3ZEHA 3PO4A 5HRNA 4KI4A 1L5UA 4RG2A 3GOXA 3D45A 3MP1A 2HQXA 2JLEA 3SUNA 1KCFA 4J2EA 1REVA 3AO4A 5FDLA 4DSEA 3ZSQA 1T03A 1FXXA 4CJRA 5KE3A 1W9HA 5HLFA 5CY4A 3MP6A 5JS1A 1SL1A 1BIUA 3AV9A 1BI4B 3DRPA 3NH0A 4CJ5A 3C4SA 2PYLA 1UWBA 2F8TA 4F4KA 4AHUA 3P8DA 1C1AA 3SQ4A 4HCCA 3ZT0A 1QTMA 3V1OA 4FLTA 3AVKA 1NOZA 3V9SA 2YRVA 4CCHA 3I0SA 3HO1A 4C8MA 3QKJA 4KHSA 4J2DA 1TVRA 1U47A 1ASWA 3VQAA 3SPYA 4R5PA 4PLIA 3WNFA 3AVCA 3KIOA 3DI6A 3SJJA 4BACA 5D6YA 1ASUA 4BDZA 3P1GA 3THVA 2QQRA 1RI0A 3ASKA 1IKYA 3KLHA 4FZXC 1N5YA 1TK5A 2F96A 3VQCA 5J1EA 4DSJA 4CJTA 1Q9XA 3OJUA 4KV8A 5C24A 2RPIA 3T1AA 2BDPA 4EDUA 1S6PA 2VG7A 4OPJA 1WSIA 4Z4FA 3SZ2A 4OJRA 3H6ZA 3NFAA 2Z1IA 3LPTA 1SKWA 2RJDA 3CYMA 1LWCA 1QSSA 1C0MA 3IG1A 4N41A 3SUQA 4FLZA 4CJPA 2JZ2A 4HTUA 1Q9YA 4ZTFA 5KH6A 4Z4CA 4AHCA 2VWJA 1KTQA 4BD3A 1BI4A 2ZD1A 2X6NA 4W5RA 5J2MA 3UT1A 2GUIA 3OYJA 3RTVA 4C8LA 3BGRA 4O4GA 4CJUA 2KTQA 4B9MA 1WN7A 1RT1A 1ZBUA 3Q1JA 3F73A 2QQSA 1EX4A 3QEWA 3L2WA 5J2QA 4BDYA 1RBTA 4A4FA 1OI1A 4OLBA 2YNIA 1HMVA 2HNDA 4CHZA 3VN5A 3ZT4A 2E6MA 3CEYA 5IAYA 4Z4HA 1TKZA 1OZ3A 4E0DA 4OGCA 3DOKA 1YVUA 2DFFA 1VSDA 4CK3A 3DB3A 4HVJA 1XWLA 4NYNA 2WONA 4M42A 4DSFA 4QW2A 1RNHA 2JTFA 2KFZA 4KI6A 1BL3A 5D6XA 4FK2A 3LX7A 4KHYA 3T19A 2KQ2A 2L89A 2HNZA 3KJVA 3DRRA 4HHTA 1KVCA 3AVHA 2G8UA 1TKDA 3DOLA 4QCLA 1WJSA 1BCOA 3KLGA 3E9GA 1RT6A 4FLVA 1L3UA 4DQPA 4ICLA 1RCHA 1T7PA 3MXJA 2OYQA 4IG3A 3M8SA 1VSLA 4Z4IA 3AVJA 5C6SA 4CJLA 4QVZA 1WSEA 4X34A 4FZYA 3S6WA 3TAPA 3SPZA 2OA8A 1XC9A 4CGHA 1WSHA 2HVHA 4DQIA 3NF6A 3MO8A 1RDDA 2GV9A 2FBXA 2VWKA 4FM1A 1X1PA 3AVBA 3OS0A 2XY8A 1B92A 2O4IA 5DK5A 3HYFA 4EP4A 4CGIA 2BGGA 2HHXA 3ZSZA 1ZYQA 3BDPA 1I39A 2F8SA 3DB4A 4FJXA 1YT3A 4WE1A 2NLUA 3ALYA 3TI0A 4CF0A 2Y1IA 1FKOA 1CZ9A 3QLHA 2E6LA 5KCOA 3TARA 1ZBLA 5FRNA 3MEGA 4IG0A 2XRIA 3QEXA 1A5WA 4CEFA 3SV4A 4FYDA 1QHTA 3LH0A 1HNIA 4C5HA 3K5OA 4E7HA 3DLKA 4CFBA 2RJEA 3ULDA 4CEBA 3T3FA 2LVMA 3HL8A 3S3OA 1VK0A 4DU3A 2B5JA 4BDPA 2PY5A 2YNHA 3TANA 4YNQA 2BANA 1UA1A 3AO3A 3L42A 1HYVA 4ID5A 3MXIA 2P5OA 1WLJA 3QIPA 3A2FA 3LGLA 5HRSA 3UIQA 3PNWC 2GFAA 4LH5A 4CFDA 4BE0A 1BQMA 1RTDA 1F21A 3LZJA 3RMDA 2D9TA 5C42A 1VRUA 3LDSA 4B9LA 4E7JA 3ZSOA 2ETJA 4FW2A 4H4OA 4CF9A 1IG9A 3C95A 4A4EA 1GOBA 3IS9A 1XNIA 4KREA 4M3TA 3V9ZA 3K59A 3MECA 2R7YA 2XK0A 2RJCA 3PUFA 4KHNA 3FDRA 3AVFA 2M0OA 4JRPA 3VQBA 3NBPA 4FXDA 1N27A 3QEIA 4FK4A 1ITGA 3HP9A 2OZSA 4DSLA 4E89A 1SL2A 4F2SA 4RW8A 4FVMA 2IS3A 2HHWA 2X74A 1FKPA 3O3FA 3H08A 3MEAA 1DTTA 3AVNA 2JGUA 5J2PA 2LSNA 4GY5A 3V6DA 4II1A 4IFYA 4I2QA 3RRGA 3NF7A 3M8RA 2EHGA 1RT4A 2FBTA 3AVIA 2DFHA 2EQJA 3K5NA 1SV5A 4N47A 1J54A 1WSGA 2YKMA 4OKEA 1KSPA 1GOCA 3FC3A 1OZ2A 4DSIA 1NK4A 4C8NA 4HUFA 4CEOA 3RMAA 5KTQA 3V1RA 2HHTA 1JXEA 1VSKA 3PMIA 1A5VA 3VQQA 4CF1A 2IC3A 1RBSA 5J2NA 3G0ZA 3HVRA 3KLEA 2YKNA 1HNVA 1ZBFA 2E5QA 1C0TA 3AO2A 1NJZA 1HQEA 4N56A 4M3XA 1HJRA 4AHVA 2X6SA 4I7FA 5CYQA 2X4XA 1DLOA 1KLMA 4M3ZA 1CZBA 1NK9A 1TV6A 3VQDA 4E1NA 4FJ7A 4I9LA 3AA5X 3O3HA 4PQUA 4CECA 3LP0A 2E6NA 3P8HA 5HRRA 2GF7A 4FJIA 3RR7A 5KGXA 4DLGA 4PY5A 5FRMA 4CHPA 1G15A 2DTUA 3ZT3A 3S9HA 3UWNA 4K8ZA 1SKSA 2BUDA 4IBNA 4DSKA 4KO0A 4QQDA 1RDAA 1RDBA 3V4IA 3OS1A 2EQUA 4MQ3A 3ZSRA 4KTQA 4GMJB 5T7BA 3SUOA 3QIIA 4C5GA 1SKRA 4M3YA 1K6YA 2M16A 1RBUA 4CEAA 1KVAA 3SNNA 2W42A 1C1CA 4F3TA 3LAMA 4B8AB 5KI6A 1TAUA 1LWEA 2RHIA 4BE2A 1TK0A 2DIQA 4LH4A 2P1JA 4FJGA 3HK2A 1C6VA 1VSIA 1YTAA 3P83D 4CHYA 1RDCA 1TL1A 1B9FA 4DFKA 3G10A 4RW6A 4F3OA 4B9UA 4FJ5A 3CG7A 3PX0A 3OYAA 3LPUA 1QQCA 5E41A 3LWMA 1EKEA 3O8VA 3V9XA 1HPZA 3MEVA 4OKKA 4CGDA 3LLRA 2P5GA 3L2QA 2MWPA 1S1VA 3LP3A 1WSJA 3KLIA 5EU7A 4KTZA 4JS4A 1D5AA 4C8KA 3O4NA 4CJ4A 4CF2A 3QNOA 2YHBA 4PA1A 3AA2A 4RW4A 1T05A 1KFSA 1JKHA 2EFIA 1SL0A 1U49A 3QJ6A 1VSJA 2BKDN 4Y1DA 3KD1E 3K57A 3NNQA 4FLXA 3OA6A 3M8PA 2G8KA 4KB0A 2YV0X 2D0BA 2A1SA 4UQGA 3SQ0A 4RG8A 2YNFA 1KRPA 1IH7A 1O1WA 4E7IA 2LTOA 4DTJA 4Z4GA 2LCCA 4I9QA 4W5QA 4A4GA 2G8VA 4YFUA 2X4WA 3E01A 1IKWA 1TGOA 2L3RA 2VYTA 1Y97A 4OVAA 2O4XB 4Q5VA 4IUTA 3QBYA 3HP6A 1XI1A 2OPPA 3OYKA 4KTWA 3TWHA 1JLEA 4DMNA 1IKXA 5CZ2A 3VQ4A 3ZSVA 3C6UA 3ZCMA 3VQ5A 5I42A 4M3RA 4HCBA 3F70A 3PV8A 4IUQA 1JLQA 1NKBA 1LW0A 4BWMA 4FLYA 2Q3SA 4FW1A 4OKJA 4Z02A 4PWDA 4IUUA 3AVMA 1NK0A 4CJVA 4C5EA 3SYZA 4RW7A 3KK3A 2DFEA 3HPGA 3NDKA 4CGJA 3L2VA 3V1QA 3OQ5A 3DYAA 3LANA 4FM2A 2MWOA 3I0RA 4DG1A 3OY9A 4E7KA 3JYTA 4B9WA 2YNGA 3OYNA 3SCXA 3LWLA 4O44A 4KAZA 1J53A 4E1MA 1S6QA 2HQEA 4PUOA 1U45A 3SQ2A 4K8XA 4CRIA 3KTQA 2HW3A 2IAJA 5KGWA 1L3SA 1HQUA 3RR8A 2D0CA 3AA4A 3HT3A 1XHZA 3C94A 1Z26A 1RT2A 3QNNA 3QINA 3L8BA 3AVGA 2RO0A 2NUBA 1R0AA 4M3UA 4IDKA 3HPOA 4DTSA 3LALA 4IURA 3CM6A 5FROA 2RHZA 3HPHA 1JL1A 1U4BA 4Y1CA 1CXUA 2IGIA 2FBYA 3L3UA 3O3GA 4QOZB 4CJEA 2L8DA 3RMCA 1JLAA 4LY7A 1L3VA 1JLBA 4GVMA 2Z1HA 4CFCA 2R5MA 3NTIA 1RILA 2PZSA 4Z4EA 4JRQA 3HM9A 3OYHA 4B3OA 2EQMA 4DTOA 2KZZA 4DTPA 3QEPA 4EZ6A 3NGIA 4FM0A 1WGSA 3AO1A 4CF8A 3TAMA 4DU1A 2VG6A 2IDOA 4B8CA 3WNHA 3AVAA 2RN2A 2HHQA 3V81A 4KFBA 1S5JA 3C6TA 1D9DA 4QQGA 1C0UA 2RI3A 1EETA 4O5BA 1H3ZA 1LAVA 1UA0A 3E9FA 1MHNA 3EYZA 4W5TA 1RBVA 3OYGA 3M9QA 1TK8A 2F5KA 1FK9A 5IN1A 4PLLA 5J39A 1NK5A 4DTXA 4CJWA 1BQNA 1C1BA 4DF4A 4AILC 4AH9A 2D0AA 2XY6A 1LV5A 2B4JA 4CJKA 1WAJA 4PL6A 4FU6A 1D8YA 3DLMA 3TAEA 3OJSA 3WNEA 2AJQA 1NJXA 5SWMA 3EZ5A 4DFMA 1WNSA 4N5SA 3MXMA 4BE1A 3S3NA 1NK6A 4E7LA 3CM5A 1G5VA 2QXFA 4CE9A 3RMBA 1D9FA 3HVTA 1Z25A 4GW6A 2IG0A 4N4GA 1HYZA 3NE6A 1EP4A 4CHOA 2XDPA 3WNGA 3OYIA 3DLBA 4MFBA 2Z1JA 3VA0A 3FLGA 2RHYA 3OMGA 2M1HA 4LD6A 3CFPA 2X78A 3V9UA 4B9SA 2R5AA 2E4LA 3NHGA 3TAQA 3RWUA 4J2AA 3IAYA 1WSFA 3NH2A 3KUFA 2RKIA 2EX3A 4IKFA 2X4YA 3B6PA 1VSHA 2ZE2A 4J2BA 2OZMA 4O0IA 4L59A 3DLGA 3KLFA 4O55A 2GFUA 3O4QA 4FCYA 5KCHA 3MEUA 4LSNA 1W0HA 1CLQA 4B9VA 5HBMA 3MP8A 2P51A 4FJKA 1NK8A 3NCIA 2KFNA 2G3RA 4FZZA 1JLGA 1S9EA 3TAFA 3SV3A 3PY8A 5SZTA 3TAGA 4CIEA 1OYXA 2ITGA 4FLUA 4AHTA 1RTHA 3OVNA 4DTRA 3EY1A 3HSTB 2G8WA 4ELTA 2DIGA 3OYFA 4DTMA 3OB9A 2Y1JA 4Q5WA 1WAFA 1LWFA 4DF8A 2ATQA 4W5OA 4JS5A 4BWJA 4Z0UA 3LP1A 3KKRA 4DFJA 2RHUA 4DQSA 4CHQA 4CJQA 1S9GA 4M3WA 4NS5A
chains in the Genus database with same CATH superfamily
5BPLA 5GP9A 1I27A 3DF8A 1HNXK 4XSXF 1VQ5T 3MN9A 3F23A 3I4PA 1PJRA 3FZFA 2HS5A 1TWFJ 3BDLA 4EGYA 3TKYA 2DILA 4CK1A 5HROA 1B34A 1O9SA 2YUNA 5BNGA 2CRGA 1IXDA 2ENMA 5ILUA 1S1WA 2CQXA 5D6WA 1VQNN 5HP1A 1NJIU 1I3QJ 2LG4A 3M1CA 1J5OA 1U8BA 2R7TA 1B9DA 1NKEA 3PJRA 2ZFUA 2Q1NA 2HD0A 5IY5H 4HX7A 2W6KA 1LE8B 4AFUC 1EIFA 3EHRA 2VG5A 3H1CA 1S1XA 1VQ4I 3CJTB 3S2WA 3A4CA 2W10A 1R9TJ 3E2UA 2ZPHB 3J7ZI 1Q82C 2L3PA 3RZDJ 4J9EA 5GJVB 3FIWA 5M5WJ 3CQTA 1GFCA 4D9JA 2DPUA 3A8GB 3FZLA 4AD9A 1X6OA 3ZQGA 3QETA 4KPYA 3CCVQ 3QBXA 1JKRC 1ZR2A 1W2BS 1NK7A 3VB2A 5L3EA 3BT9A 5M1OA 4FSVA 2VGNA 5AYFA 3GMEA 2OPSA 2E60A 1ZHIA 1RLQC 5J8CA 1PUFA 4FJ8A 4CJ3A 4FK0A 3LQRA 1BGXT 4IZZA 2R58A 1L3TA 4OINF 1YITQ 4JP0A 1WEIA 1YWOA 5HNFA 4OPKA 1R0BG 1WDXA 3QYGB 3SFIA 3CCQI 3CC7I 4TSXA 1TAQA 4DOVA 2DYRH 4CESA 1RZ4A 3ZT1A 1K73C 1J9AA 2FHDA 3QJYA 2P9PA 4N0AC 1V3FA 4HCKA 2G0EA 2FOWA 3NF8A 2R0QC 1BJZA 1N33K 1VQ6A 1NKCA 4XOTA 1ZBJA 2O01E 4NC8A 2LT4A 2ID3A 1X1DA 4FETA 3AG3H 4YOVA 3QXEB 1MNDA 1NGNA 3CCUI 4KH6A 4IIOA 3IL2A 2KIFA 1UMQA 2OZUA 3BUZB 4FPAA 4PKHA 3QWYA 1T0FC 3A2KA 1QSYA 2IRFG 3S1QJ 1TG0A 4NCGA 1AWOA 1FNNA 3RESA 1ZREA 4W97A 2W48A 2VPRA 2ROTA 4G6TB 4BREA 2CT3A 3VA3A 1WB9A 3KP6A 3EH2A 5LJ5d 1EBMA 2HR3A 2QTVA 2NOFA 2DERA 3WHCA 4II2A 2FJ1A 3DLLF 2PQWA 2HEQA 2HHUA 3NGYA 5HS8A 1PRMC 1EXQA 1KXPA 3MD2A 3PX6A 3VQPA 1SC7A 2GELA 3J7AP 4RGXA 2L7FP 1YP5A 3RDVA 1JKQC 2RN7A 3K1MA 3CDIA 2L0AA 1X01A 4NCBA 5AQWA 4N4HA 3THXB 5DLOA 2EV0A 2DYSH 5AQJA 3QU6A 3GIBA 5AZIA 4CK2A 1WJRA 2UWMA 4BQZA 1NYFA 3FHFA 3O80A 3TR8A 5IHIA 5CZ1A 5JMVA 2RC4A 2W24A 3U21A 3X26B 2D5RA 4F8RA 3TDZC 4HSRA 2UUBK 3GLLA 2NRVA 1UHSA 2JUFA 4DNCA 1VSEA 1NEBA 3OMCA 1TS9A 1FJLA 2RHXA 4K25A 3VQEA 2UU9K 3PFSA 2KW4A 3I8BA 1WHKA 3SWNB 2EZLA 4UXNA 4DBHA 4EP5A 1CXQA 2V6CA 2HBWA 4OMMA 3QESA 1EQYA 4QS8A 4XSZF 1HX1A 3SK3A 5CQEA 2UXBK 1UAXA 4BRIA 1VQON 2IVPA 2F2EA 1FIPA 4HVUA 3KETA 4LG0B 4EPCA 4OB3B 4CEDA 4MDBA 4A6DA 2OJED 3CESA 2W4SA 4CHNA 4A6EA 4D1QA 3CC2A 3PIPF 4FLWA 2ECBA 4P96A 3DTIA 3HTRA 3FZMA 5BRDA 1IN5A 1MMDA 4HKEA 3B73A 2ZAEA 1XMOK 1Y8RB 4JV5K 2XVCA 1G3YA 2A6HF 3SQ1A 3DRSA 4A0ZA 4WQ5A 2PVGB 4EJWA 1YJ9N 1QHAA 4O6JA 4B09A 1KAZA 3GEZA 5K5QA 4DLEA 4N76A 5GAEJ 5EG0B 3HHHA 2RF2A 1VQPN 4IUPA 4A5NA 2RGVA 3OSVA 2ZQBA 4HUEA 4O5FA 3L2RA 2O0YA 1VIEA 2ZGYA 4BRMA 2CREA 2JWKA 4IEJA 2PAVA 3AVLA 3CMEQ 1YQMA 2A5YB 3VQ8A 3D5LA 4OB1B 1X6BA 3L2UA 3O08A 5I2MA 2HZDA 4JJBA 3F9KA 4HCZA 4X64K 1OH5A 5GAMh 1ZSGA 5JLWA 2YHAA 1TUUA 3IAM2 4H5VA 3V9WA 3NF9A 2XHBA 3EDPA 1TKTA 2DTHA 1WIEA 2KFDA 2VPLA 2AP1A 2JSCA 3KK2A 4CGGA 1IC8A 2G6FX 4JRIA 2OZ6A 4M7YA 1VQ4A 3HOWJ 1Q86C 4HF0A 3AA3A 4JI2K 3GWZA 5KN9A 4M78B 4C5IA 4R8HA 3N4QA 2HMIA 2RK2A 4XTZA 1K9MO 4CJFA 1IV8A 2O88A 1HRHA 4IO8A 2ZBKA 2K79A 5IP9J 4JKEA 4EHTA 2JTEA 2DOAA 1T0HA 4A53A 1OYIA 2HOTA 1BIZA 1FMKA 5EZGA 1VQ8T 4BEHA 1MPGA 5FO5A 3H3NO 3M8EA 2G8IA 2A0FB 1P90A 4DW6A 3OYMA 1VQLN 2GEMA 3HSEA 1N39A 4OLAA 1WYXA 3FK6A 1NHAA 3NARA 1T39A 1QE1A 2Y4XA 4BNCA 3K58A 1FZPB 1JLCA 4A3LJ 1Q7YU 4CW7B 5LY3A 1YHQN 2LKPA 3TPQA 4IUVA 4OPHA 3CC7A 1ZBHA 1T8EA 1V5EA 4DV0K 1ZRDA 4M75E 1L5UA 4RG2A 3DJCA 3BF3A 2FSKA 3D45A 4F92B 2PI0A 5CKTA 3MP1A 2JLEA 5J1YA 2KRSA 3D5RC 1REVA 4HNVA 2QCOA 4DSEA 1JXOA 1MBHA 1T03A 2V79A 2CYYA 3CJBA 3QPSA 1W9HA 4K11A 5CY4A 3CC4A 2NUPB 3JRAA 3H92A 1M3AA 4I7HA 1TQIA 1SL1A 1QRYA 1N9SA 3AV9A 3HRMA 3T1BA 5DLQE 5AQFA 1M9SA 2ISYA 3K2ZA 2AQFA 3QWLA 3NH0A 4ZC3A 4CJ5A 3W3DA 4AFZC 2WTUA 1G3SA 3OR2C 2PYLA 3JRFA 1R0CB 1CF7B 1VQMQ 3OR1C 3SQ4A 4XK4A 3CBPA 2I5UA 4C23A 3ZQLA 3MCZA 3ESWB 1NEGA 1ZBXA 4JHDA 2FVUA 1KQSS 1YIJA 3I0SA 4GDFA 5GAOp 1U47A 4A3CJ 3ULEB 1ASWA 2YHYA 3VQAA 3QYBA 4GYGA 4PLIA 3BZKA 2AIRB 1Q82O 1UB4A 4Q5SF 2I0NA 4XORA 2KT1A 3P1GA 3THVA 3A1YA 1RI0A 2OTLQ 1ORPA 1IKYA 3KLHA 4RCCA 2P5VA 4ZZLA 1SMTA 3EUAA 3H5NA 1C0GA 2RE2A 3TTFA 4Y91A 3JCMe 3RKQA 2HVRA 1OX9A 4EDUA 3I54A 1S6PA 1VQ9T 1WSIA 4Z4FA 3SZ2A 5CYVA 3ZMUA 3H6ZA 2DT6A 4UVBA 4IXAA 4U0VA 2Z1IA 1OFCX 1WH5A 4ZYGA 4H5TA 3SUQA 4B3MK 1YS7A 1SEUA 4FLZA 4CJPA 1P7IA 2A28A 2DCEA 2X9HA 4BR4A 2VKHA 4ZTFA 3KYCB 1KTQA 3A5ZB 4RTZA 3FM3A 1K73O 4EHUA 1Y1WJ 2NUTB 1UGVA 1W5CC 4C8LA 2X4JA 2DLPA 2KTQA 1QWFA 1G2HA 4PIIA 2VV5A 3A02A 1F5TA 2OJ2A 4EMHA 1WN7A 5J47A 3D1NI 4MLHA 2CH0A 1UG2A 3HGYA 3BQZA 3F73A 2QQSA 1ZKGA 1BDGA 1ILYA 4RTVA 2RM4A 2ZSIB 1OI1A 3GLXA 2EK5A 3FXJA 3TSQA 1B8IA 3OHRA 2A3ZA 1WI3A 3ZT4A 1X2NA 4P5OA 5FLMJ 4YOQA 3G71N 4Z4HA 4JK1X 4CC7A 4M75C 5FPDA 2VQLA 3CCJQ 4OGCA 2DFFA 3CLQA 2MOXA 2LQWA 3M6GA 4LFAK 4IL6C 2K02A 4HVJA 2UV1A 4NYNA 2WV1A 1B9MA 2WONA 4KIFA 3I55Q 4BRQA 4QW2A 2XAUA 2IS1A 2JTFA 5GAN3 1RNHA 1AEYA 4I2OA 3E0JB 1HC8A 4FK2A 5BQTA 5KYYB 4KHYA 2LH9A 4A2BA 2DK8A 1ZELA 3T19A 3CJAA 5DM7R 3LDOA 2NVUB 5IOYA 1YQKA 2VN2A 3ECOA 5AQIA 5IYCJ 3HBTA 4BQAA 2DA7A 5FB2A 2QBYB 1BCOA 3BP8A 2E5KA 4M77E 3QSUA 1RT6A 2KT0A 1L3UA 3M0TA 4JZ4A 2ME6A 2Z33A 1IF1A 4ICLA 1RCHA 4C92D 4EW0A 1T6SA 1SS6A 5EF6A 3M8SA 2CQQA 2E65A 5GAHP 1VSLA 4Z4IA 2ZXIA 4CJLA 4ZYEA 2GNCA 5LJ5e 4X34A 4FZYA 4RTYA 3BR0A 1U5TC 4KA4A 3IH7A 3A8LB 1QCOA 4CGHA 1USSA 1HKQA 2DQLA 1Y57A 3NF6A 2ZMEC 2KXCA 2XDVA 1BA5A 3G1OA 4BR7A 5BREA 4GVEA 2ZPIB 1D3BB 4FM1A 1ZUKA 1DGRM 1X1PA 2DEUA 4PFOA 2XY8A 3R6MA 3BY6A 4OIQF 1RR8C 1Y8QB 3SDGA 4LDWA 4I01A 3VYSB 3DKXA 3PLAA 3HOTA 1ZYQA 2DETA 2P5KA 5FFXA 3OH6A 2VBZA 4D8DA 1JXSA 2IJLA 1QNTA 1YI2Q 3GP8A 1MBJA 4IEEA 1RRQA 5K1YA 2KHOA 4WX9A 2F5DA 1LDJA 2XRIA 2X6OA 4L5GA 2RQPA 3FGUA 2E3IA 4LLLA 3G25A 3SV4A 2LBFB 2Q2EA 4FYDA 5CR2A 4EVIA 7AT1B 2DK3A 2AO9A 4C0GA 3ZX3A 2K5LA 2J6KA 2NUZA 1O75A 1WA7A 4C5HA 3K5OA 1WJFA 5EC7A 1NM1A 3R61A 1S3XA 3DLKA 1FLIA 2RJEA 3JCMW 4CEBA 3LMMA 2K40A 3CMAT 3S3OA 5BN9A 1KYWA 4BDPA 4A3MJ 1R5HA 1PUEE 3E3VA 4F16A 3I55T 4YNQA 2KL4A 1KC8C 2VE8A 1K8AU 2J6OA 4ID5A 3MXIA 2P5OA 3QAHA 2FB7A 3QIPA 3INZA 2KP6A 1XD7A 4HRIA 1Y96B 4ZNXA 4M7DE 3DU6A 1M8MA 3HOYJ 2NAZA 2WY7Q 3V8JA 3D7SB 1DGKN 2A41A 3PNWC 4CFDA 3LFUA 5FD6A 4BE0A 2NOHA 4KT6A 1RTDA 2GXBA 4F04B 3J81E 3O5ZA 3O9QA 2O8CA 3RMDA 1OVQA 3DPLC 3CCRT 3J80E 1H0MA 2LP5A 4FT2A 2IBDA 3ID8A 1UAAA 4H4OA 2PMHA 2E1YA 2YU9J 1IG9A 2MAMA 4G12A 2P4TA 1N9RA 4A4EA 3GW2A 3M57A 5HS7A 4M77C 4M3TA 5IYDJ 1MA9B 3V9ZA 2E2PA 4YOYA 2PQ8A 3MECA 2R7YA 1XTDA 2RJCA 4RGRA 5IT9E 2R7UA 1ZSZB 4U7BA 3DBLB 1NE8A 3MEXA 2JM9A 3K10A 3I9V2 3HSBA 4XAXB 4JRPA 5AZJA 4JKBA 2QAZA 3O6BB 1S72I 2DXCA 1D5VA 4JJCA 4FXDA 1YXQA 4J6XA 1ITGA 4RBOA 3HP9A 2HKQB 2OAWA 1HBXG 1SFOJ 1LVKA 1VHXA 4J5YA 4UV9A 4F2SA 3PIPL 1OLTA 4FVMA 4ZYAA 3RDIA 2QTXA 4EA5A 1RAHB 1UGRB 2QDLA 3FKJA 3MEAA 1DTTA 2DEQA 3BF1A 3AVNA 5J2PA 3RMSA 4HW0A 1JGGA 3A5MC 4TVRA 2DM1A 3RRGA 1OMIA 3ZXSA 1DJ7B 1K4US 3QICA 2FBTA 1KEAA 4KGZB 4N47A 2KRMA 4JPBW 1J54A 2MIOA 1E6GA 1Q7YO 2QKLB 1AOJA 4GXOA 1OPKA 4C8NA 4HUFA 5ED4A 3NGPA 2QG9B 3QP6A 1JXEA 3PMIA 1WJAA 1A5VA 4C9YA 2EZIA 4LF7K 2L9VA 2QGGA 4YTLA 5J2NA 4D0PA 3Q7CA 2QEXQ 5KPTA 3MKZA 3KLEA 2DT7B 1ORKA 3UR3C 3R0AA 1KQ0A 3GNFB 1BWFO 1ZBFA 5E26A 2NRZA 3M0QA 3C6AA 4N56A 1E3PA 4M3XA 3CWAA 1J9IA 2QI2A 3ZX2A 2X6SA 2JWTA 1GLCG 2PMZA 1R5ID 4YEJA 1ZX6A 4NL3A 5JFRA 5LJ3j 2YUOA 1ZUUA 1Y39A 4NUBA 3SHWA 2O6GE 1KLMA 5FLXK 1Q95G 4M7DC 1OVYA 1M90C 1VAZA 3LP0A 1LKXA 4BRNA 2EIMH 4HX4A 1YJNA 2VLAA 1YFNA 4QVDA 2BW3B 4FJIA 3J81Z 1VQ6T 3MK6A 1ZQ3P 1G15A 2JPBA 3LAPA 4BC4A 1KA8A 2ZM6K 5J6XA 3H1QA 1BN5A 3CCVN 4A3JJ 2LMJA 1B3QA 1AWXA 3BJOA 2PBDA 2Q97A 2BUDA 2ZWHA 2NRWA 4KO0A 2W40A 3WEEA 1VF9A 5J8FA 1Z6RA 2H8HA 1TQMA 5DEQA 5AQOA 3EZWA 2EQUA 4A3KJ 4EJUA 3K0LA 1JI8A 4U88A 1MDUB 4FX0A 1ETQA 3BDDA 5IT9Z 4J9FA 1YITN 3SUOA 3SBTA 1SKRA 4EJTA 4M3YA 2X6XA 5CHIA 4RUGA 4KGXB 3L2CA 2JT4A 4C1NK 2K4JA 4E7ZA 1OU8A 5J1UA 5C4JJ 1BW6A 2FBKA 2XAJA 2YS9A 1C1CA 1NG2A 2DXTA 1XGMA 4GYIA 4JKCA 4OMPA 1LWEA 3OYYA 2DU9A 2FF6A 4WWCA 4EATA 1KK7A 5BOXA 1K83J 1C6VA 1SG5A 3MHXA 3N4MA 3ZPLA 3P83D 1KZHA 2LVSA 3BG9A 1PSEA 4F7UB 1B9FA 4DFKA 5AIQA 2M0MA 2Y31A 2MH2A 4JNEA 3KK7A 1UFMA 3OYAA 1N25A 1YQLA 3CCSQ 4IZ9A 2RAEA 3CXCP 2GWJA 3LPUA 2EW3A 1REPC 3WE2A 4A5MA 1KFZA 3GTQJ 1RAFB 1JJ6C 4C0ZA 2QSGX 2FSNA 1FOYA 3VS2A 2CO5A 3FHNA 1U06A 2OI3A 4N9HA 2KHMA 5M1FA 3LLRA 3L1PA 1NMDA 3I71A 5DS9A 2K9MA 5JI6A 3IKMA 3KLIA 3O3KA 4KTZA 3JTHA 1D5AA 2E64A 3CCQQ 5D4RA 3QNOA 1DQUA 4OIPF 3OSFA 4BJTA 3JB9I 2CUFA 3RUXA 1R1TA 3M54A 3GTGJ 2NVYJ 1JCEA 4HOBA 1JUSA 2BKDN 2FD5A 4M7AB 4FLXA 3CC2T 3OA6A 4EIKA 3AGRA 1UG0A 4KULA 3M8PA 2G8KA 2YJEA 3UE5A 4A3FJ 2YV0X 5LMUK 3V42A 2RNAA 3CCUQ 3SBGA 3A01B 4NQWA 3DBHB 4MLEA 2O8FB 4WK8F 2JMWA 4RG8A 2YNFA 1KRPA 3SLCA 1IH7A 4ESJA 1APLC 5FD5A 4LC9B 2L9RA 1S72A 4RB0A 5BPDA 1TH7A 4NDLA 4A4GA 1TP4A 3ZX0A 5KYXB 1BC8C 3MZYA 3E01A 5CCAA 1KYZA 2KK4A 2L3RA 3SZGA 1QVFP 1MMSA 2KLAA 3V8KA 3NWTA 2Q0OA 1RI7A 3FR0A 5HDGA 1JLEA 4DMNA 3G1LA 2ZSHB 5LJ3h 1JKOC 5I42A 4M3RA 3VMFB 3S1RJ 1W2BA 5HLHA 3PV8A 1JLQA 1JJ2S 1ZAOA 2ZZDA 1V4TA 2Q3SA 8ATCB 4FW1A 1VQ4T 4N0AA 4IUUA 4JI1K 4XLFA 4CJVA 3SYZA 2JPSA 4OAYA 5AFUA 1WI9A 3ZMVA 2P4RA 3V7CA 2L7ZA 3M59A 4BRHA 1W36D 5AQRA 2RF0A 3S8PA 4EJOA 2UXCK 3G2BA 2O9VA 4LDVA 4IWVA 2GA1A 1T0FA 4KUDK 4JAXA 1AKHA 4M78E 2MWOA 2JN0A 5ILVA 4DV1K 3F6OA 1ULYA 1HOMA 5FU7C 2C6YA 1DKGD 2ASPA 4B9WA 3DKMA 2HNIA 2ISZA 3KCCA 3LWLA 2DI3A 4Y52J 2E1OA 2CW7A 3MN2A 3IKTA 1P9QC 2RHKA 5F6FA 4HLYA 1OCZH 2HDWA 2HW3A 2IAJA 4E1JA 3D2FB 1XC3A 3CC7T 1K8AO 2L54A 3WHBA 5EYRA 4K43A 3H9JA 2D0QB 2EWNA 2QF7A 3VS3A 3UKUA 1XCBA 1WH7A 2XAFA 2NUBA 3CCMI 1R0AA 2JMAA 4L6V5 4PHTX 3HPOA 2HXIA 1PD1A 2PZ1A 4H0XB 3CCEA 5FROA 5CR4A 5AQVA 4H0PA 2P9LB 2Z3YA 1GBQA 3TQ7P 4E9EA 3CC4T 1U4BA 4XLCA 2JVGA 2HXOA 1GV2A 5F1RA 1KD1O 4OMOA 2IGIA 1MUYA 1K0XA 5GAN6 1UHFA 1ETVA 4A3EJ 1W2BP 4C92B 4NLBA 1JLAA 1RKWA 1I81A 1TUGB 2M45A 1JLBA 4GVMA 1IXRC 4KMUX 2L4AA 2R5MA 2K9NA 2Y4YA 1NGHA 2VXDA 1F9NA 2PZSA 2QGFB 2X3XD 2Q0UA 3EKSA 2O8DA 4JRQA 4BG9A 3H0IA 3ZETA 4D5FA 4XH4A 3QEPA 1YIJT 3ZMTA 1BIAA 2KDZA 3KX2A 4F17A 3B6CA 3P9IA 2EYXA 3TAMA 5M1NA 4MZTA 2VG6A 5GMKj 2R5ZA 3WNHA 2YHTA 5LJVA 4RB1A 4RB2C 4A93J 1EH7A 3RPQA 5LLQA 3V81A 2GAUA 3DPUA 3THWB 1S7AA 5IWAK 3H36A 5AQPA 3VOEA 4FT8A 4FWLA 1X1AA 2RI3A 3JB9G 3BG6A 1RBVA 2A05A 2DFIA 3ZCOA 2KNBB 2NOLA 2X4HA 3T5XA 3H3VK 2KI7A 2Y75A 3D4VA 1D1AA 2N8GA 1NK5A 1BQNA 4DOWA 2ZJ2A 5K5RA 5KK1A 2EA2A 3G4SQ 2XY6A 2D0AA 5AQNA 1SF9A 3FIFA 2UZKA 3M56A 2F5VA 1UE9A 3A8MB 4B44A 1MGQA 4UB8C 1WAJA 4PL6A 4FU6A 1SAZA 1D8YA 3GBTA 1Q81C 3TAEA 1GDTA 2EJFA 3M55A 3RSEA 2V9KA 2WSCE 2A3LA 4ELYC 3S1NJ 1NGFA 5LRRA 2UXNA 2BE7D 4E6RA 2MLGA 1WNSA 3ENOA 4CCJA 4VUBA 5AQLA 4BE1A 1YRNA 3KP7A 1VQ5I 2VE9A 3S14J 5F1JA 1EZZB 1G5VA 5LGNA 2QXFA 3J81O 2OTLN 3RMBA 1AHDP 1D09B 1QZYA 3J80O 3H3OB 2WB1A 2IG0A 3BOQA 1HYZA 4DYCA 4C8QC 4BS9A 2ESHA 5GAMg 2P9KB 2PNIA 3IWFA 4QIWN 5ADXH 5B5EC 4UOBA 4Y92A 5GADJ 5L8RE 3VA0A 1YNZA 2VODA 4KUMA 4J00A 3HOUJ 2PJRA 3TAQA 4B9SA 4B9QA 3RWUA 5IT9O 4J2AA 5KQ8A 3A5NC 3BZ6A 3KUFA 1ON1A 1ITYA 4JDSA 3LSTA 3A98A 4B1UB 2V1NA 4J9DA 4BUGA 2KYBA 2VQGA 4CCLA 3HTVA 1Y7XA 1VSHA 1TOVA 4KISA 1FX7A 5AQHA 3CJ1A 1FEXA 4B47A 1WSUA 1T3SA 3KLFA 1LEBA 2GFUA 2CFXA 2O8KA 3EUHC 4J9BA 4LSNA 1DU0A 2BBYA 3K4MA 1E7OA 1CLQA 2J4RA 4OP0A 4MMLA 2DZCA 4ENMA 3K6GA 2AKLA 4XIDA 1SSHA 4B3AA 3QUIA 2P9SA 5F0HA 5F0CA 2P7CB 1S9EA 3TCJA 2IP2A 5BRFA 3SV3A 4PL7A 3KXTA 1YO5C 4S0HB 1Z0XA 3TAGA 1NGJA 2BZYA 3TOAA 3JRDA 3OSSC 3F9MA 1RTHA 2BEOA 5B66C 4DTRA 1UJYA 5HKCA 1R00A 5KCMA 3CCJN 1B72A 2DIGA 3OYFA 2EYZA 5HK3A 1M1KC 1SRLA 1BI3A 3ZMSA 2D5VA 4NOYA 3VTHA 1K61A 2NXNB 3I55N 3LP1A 2PBIA 3CUQB 3MFKA 3M5AA 2CDTA 4AWXB 3D2EB 1S9GA 4WQ4C 3F6VA 5E1XA 4CYCA 1SRMA 3THYA 4M9SA 4IEIA 5ERIA 1NGGA 2P9PB 1SFEA 1KG1A 4NLCA 1R4NB 4CZMA 3R6NA 2KE9A 4WCIA 3QERA 4MDAA 3I33A 4X1VA 1R1VA 2LNVA 4ELZC 3HXMA 1JBMA 4RM3A 1PNJA 2ZPBB 3RZOJ 3Q9SA 5GMKh 2LMDA 2P6TA 1FYMA 4KKOA 3CXCM 4IOCF 3SHFA 3I56Q 3HEFA 5CIUA 1KLNA 3CQZJ 2RB6A 4BY6B 2RI5A 1M1FA 1QS4A 1EO1A 2QA4I 3HKSA 3CD6I 2V7ZA 1AA7A 3AO5A 1KQSA 4IO9F 1GLLO 4XM3A 1ZYRF 2NZTA 1EFNA 2J06A 1XQPA 1VQ7Q 1M2OA 5CYMA 1OKRA 3HPWA 4BH9A 4MTDA 3JCMP 2D1KA 2NNNA 1RT5A 3P9KA 3CPEA 4A5BA 1NJWA 4NZGA 3EQLF 1H8KA 5H1SQ 3HIFA 1A5XA 1RT7A 4HLXA 2JN6A 1VYTA 3U6FA 3F8BA 3A0HC 5DV5A 4FSXA 1KC8R 1VRLA 2BUPA 4M75G 3UPUA 4E3SA 2A3SA 1TKXA 1QHGA 3WGIA 1QP2A 5GAOn 2W6LA 1S1TA 1RUWA 2RI2A 2HVIA 4ZTJA 3HHTB 5FWBA 5KPZA 3G73A 3EGDA 3FLCO 4WF2A 2R7WA 1P2FA 1SUQA 1SEMA 4RDUA 4RKUE 1KO9A 4GNIA 1QVFM 4PUSA 5IH2A 2XY7A 2R4GA 4IFEA 3L3VA 1AWWA 4FL6A 1JU5C 2ADUA 2GTOA 1VQNQ 4M41A 2CS3A 4CZLA 3CQ8A 2I5JA 5D4SA 4EM2A 3ONQA 4HWIA 2ZJRF 1I4K1 5DMRA 3ZMZA 4QS9A 3U3YA 4M75A 2EB7A 5EEAA 4KHQA 4FJNA 4JI8K 1IHWA 4YIIA 2FC0A 4XRFA 2ASOA 3F8CA 3SUPA 1OULA 1S7EA 3RBBB 2OCEA 3P5JA 1KQ9A 1UJ8A 4BR2A 1ETXA 3M9AA 1HNZK 1FSHA 1IKVA 3CMYA 2R57A 2RN8A 4WCEL 2ME0A 1MNEA 1NOYA 2QSHX 2LRQA 2WC9A 4FJLA 2GLOA 3NEUA 3K2PA 2JA8J 2FBVA 2EINH 4I76A 5LL6S 1U6GA 4JD2B 4L3QA 2NOJB 3URGA 4BRPA 2D0PA 4RGSA 2DVEA 2HHSA 3KD5E 2DYBA 2O9LA 2HB5A 4ME7A 4R1HA 1N32K 3SMSA 2XDDA 1N3AA 4CGFA 3EE8A 4M9XA 1FOKA 4KUIA 3GFMA 2XO7A 4DR6K 1PD0A 5LJ3f 1JLFA 2L2PA 4QS7A 5F64A 2CWEA 2P81A 4EM0B 2MPXC 1GV5A 2ZMEA 3BTJA 3LSMA 4OGEA 2R5YA 4E7SA 2CGPA 4CJSA 1S9HA 2EIJH 3QO9A 3LYIA 1ZR4A 1MH4A 4H4MA 5FWCA 3ZN1A 4BG8A 1VI0A 3BJAA 4J6YA 1YUWA 1QHHD 1VQ8I 1T0JA 2CT4A 5FPNA 1A5JA 3C1DA 1BJAA 4KHWA 1BHLA 4XKWA 1XX5A 2K7LA 2IT0A 4JKDA 4B08A 2O4GA 4DR7K 3RQ4A 3OW2S 1W2BM 4B22A 2IGMA 4E9HA 2L7KA 3NGZA 1NG9A 3U3GA 2WAQN 1T6DA 2ZXHA 2D6FA 1IGUA 3VEYA 2XY5A 2WACA 4CA0A 5GANj 5I3UA 4AMCA 5LRSA 2JOYA 3NTKA 4DV7K 1S1UA 4RTXA 4HUGA 4FYVB 1M90R 1YJNT 2HBKA 4H4KC 3BQYA 3D0SA 4I2PA 4MMKA 3IHUA 3M8JA 4OMQA 3P38A 4BQLA 2W82A 3I0WA 4OVLA 3PVLA 3KZIC 3OYBA 2K9QA 1X9WA 2BXYA 5DD8A 1GL5A 1S72Q 1OU9A 2DODA 1RTIA 5CKFA 3CI5A 2YSQA 3AT1B 4M77G 1VRTA 2QEXN 2GIVA 2ELJA 5FW9A 2Z1GA 4AHRA 4I98B 2COMA 4EZ9A 1RBRA 2V1UA 1Y07A 3JB9F 3F22A 5D8KB 4CEZA 1X1BA 3D7EO 5DDGA 5CK9A 4CJ7A 3ISNC 3DLRA 1WJEA 4W5NA 3MKDA 4M45A 1UHCA 1ZSZC 2QA4A 3MEEA 3SZTA 3CD6A 1YTUA 2QWNA 5FLXE 3ERMA 1X3NA 3ME9A 5KRSA 5A2QK 2XPWA 3HFNA 5DM7L 4GRIA 2LT1A 2VJ5A 1N8RC 4DQRA 4JZ3A 3OSGA 1QP3A 1VQOQ 1S6LA 2VT2A 4M77A 4AM6A 1P7MA 4E9FA 2CYZB 3K4LA 2HKXA 5HL7L 1QKXA 5JS2A 3NH1A 1ZLKA 3TP3A 1ABQA 1SVOA 3LSIA 1AT1B 4KRFA 2E2HJ 3X20B 1R49A 2CP7A 4FWOA 3VOVA 2VQCA 1LJ9A 2XDBA 3FDYA 1T3LA 3PMTA 1R5GA 2OUMA 1QPIA 4F7UE 4IPAA 2EZHA 1BBZA 2KAFA 3IDHA 3FXUA 5FKNA 1C0WA 2QKBA 4IHVA 1K78A 4JJNK 1VQPQ 2LF8A 2OFKA 5M9OA 1X3UA 2MF2A 3TO7A 4KMFA 3ZEHA 4X9DA 2MG4A 3H3ZA 3COAC 1CKBA 4CYDA 5GTHC 3IKVA 2E5LK 4R56A 2RQQA 2C0OA 3SZPA 5D7UA 2XF6A 1M1KO 1VQ4N 4J2EA 1TTYA 4AFQC 3AO4A 5FDLA 1WJBA 4UY8I 2O8XA 3FXLA 1RRSA 1QKWA 2VOPA 3AKZA 2A08A 4LDYA 3VSLA 3M4OJ 4FYWB 3C4SA 4A69C 1UWBA 4M7DG 1FTTA 4F4KA 3P8DA 1Y0MA 1C1AA 4XH5A 1UHMA 4M7AE 4MDWA 1S72T 5GAN8 3AGKA 3ZT0A 2I10A 4FWSA 1FOWA 2Y9YA 3JCMc 2F69A 2IA0A 3V1OA 2V8JA 3AVKA 1NOZA 4ZJZA 2YRVA 3EH1A 2O7OA 2UXXA 3HO1A 4J2DA 1KG6A 3Q3SA 2ABKA 3HRTA 1Y0UA 3M8FA 4CZJA 4GY2B 2V1RA 2XASA 3CCQN 3H35A 3CC7N 1OPCA 3KIOA 2DOEA 3QRFF 4XRMA 2DL7A 2ZJPF 3CO6C 3U8XA 3KP5A 5HOOA 4BDZA 1ASUA 1BOTO 2F4MB 3SFZA 2F6CA 1MV0B 3D6RA 4UHTA 3R9PA 2LNBA 4M6YA 1VQLI 5DUIA 2E6ZA 3VQCA 2E2OA 2EBIA 4G7HF 2OQGA 4M7DA 2DNUA 3CCUN 1R71A 1M2VA 2KSSA 1ATRA 2ROLA 3I58A 3VODA 2O8BB 2QDYB 1PHTA 1NPPA 4DV3K 3H1VX 1WJCA 4KICA 1YHQI 1SKWA 1LWCA 1QSSA 2QWRA 1C0MA 4EGZA 3JAMZ 4IOAL 3I4MJ 4N41A 4CD3A 2FRYA 1WCMJ 4A5AA 3QFUA 2JZ2A 2VXZA 4JI3K 3E6CC 3AAFA 4AHCA 2R93J 1Q18A 5AQXA 1BI4A 4EJYA 5J2MA 3RTVA 1XQOA 2FF3B 4CJUA 1M3CA 4UUSA 2LY2A 3Q1JA 3FBNB 2XSDC 1X1CA 2YXYA 4JX4A 2Q2RA 1UZCA 1EX4A 3DU5A 3L2WA 1KG4A 4BDYA 1RBTA 2DMTA 5GAOq 1A31A 1M3QA 1NH3A 5CE3A 2XG8D 2HNDA 5L3GA 2EYYA 3VN5A 1OCCH 1YLFA 2RH2A 2V9VA 2FRWA 3F72A 2B7EA 3AL0C 4HVVA 1FJGK 2X1EA 2W41A 4HYEA 4Z89A 2L3QA 1Z7UA 4KH1B 1K8KB 2AQEA 2DL3A 4CH7A 2PTKA 3CCET 4CK3A 3HSRA 4Y15A 2BGCA 4DYQA 3DKWA 4M75F 4XK8E 4FWNA 1X69A 3LCNA 1NZ9A 1EJ9A 2KFZA 2CP6A 3QO3A 2A69F 4A3BJ 4KI6A 5D6FA 2YUQA 2V1XA 2FZGB 3MWPA 2ZB9A 3T7ZA 2WADA 3LX7A 3HBLA 3HRSA 3M58A 4YRVA 1ZBSA 3Q0WA 4BJ6C 3KJVA 1FOXA 1DIZA 3DRRA 3O9UA 1W5SA 1VQKI 4HHTA 3CCYA 5TJJA 3JRCA 1WHMA 3JV3A 2L7MP 1TKDA 4QCLA 3KLGA 3C7NB 3N97A 3TBIA 4C92E 2MMPA 4M7AC 3H9QA 1LE8A 3VGKA 2P4WA 2OYQA 3CCLI 3O1BA 3JCMQ 2JA5J 3JB9D 1RNLA 1XPXA 4MO5A 5D6EA 4NHJA 3J8AA 5FKMA 3VS6A 4DBFA 3DXMA 2OA8A 3TSZA 2BVMA 1MBEA 4DQIA 1I0CA 3EYIA 1R22A 1RDDA 2G7HA 1AOYA 4FX4A 2GBQA 3A1PA 2AZSA 2WUSA 1X58A 4KH4A 2L4MA 1J59A 1QLYA 3JRHA 3HYFA 4EP4A 2O8CB 2WV0A 3IUCA 4V2GA 3ZSZA 1HKSA 3BDPA 4FJXA 1IN6A 1MBFA 3KP3A 2IGOA 1ZLMA 4V19K 2DMPA 3ALYA 3FF5A 1CGPA 4MIMA 4CF0A 3E9LA 3PNTA 3H3UA 3G71I 4JLIA 3S16J 2R7RA 1YJ9A 3C0BA 5KCOA 2A6EF 2Z9OA 1S22A 1Q81R 4RGUA 3ATUA 5AONA 1TYQB 1BU6O 3O2PE 5FRNA 2O9SA 4XL9A 3LSHA 3ZEUB 2IA2A 4F7ZA 4L9JA 3VWBA 2W04A 4XLEA 1WHLA 4NL2A 2DPNA 1EWQA 2ZJRL 2M7BA 4HF1A 3G1MA 4X65K 4ETSA 1QHTA 4CUGA 3BTCA 3CCMQ 4BHCA 2CUDA 5BRHA 2JS2A 3HM5A 2A6TA 4ESFA 2EGCA 4A2UA 3CDHA 3VEXA 1HF0A 3JCUC 2W7NA 2X9DA 5LJ3g 1SHGA 1VK0A 3G4SN 4P1WA 1EWRA 2A5XA 5L3DA 2KPMA 3FMSA 1JJ8C 1UA1A 3L42A 1XNQK 5J4VA 2CW0F 1JJ2A 3CBOA 3SEQA 3HGGA 1JEGA 2H3EB 4JKGB 3VENA 2E41A 2EGAA 4UB6C 2NS8A 3SDBA 1BQMA 5D5UB 2H3GX 3OTOK 1MUDA 2EV5A 3LZJA 2YPRA 3CETA 1QQOA 4FM4B 1X2MA 1VRUA 2VVKA 4LLNA 1YW8A 1TL8A 4B9LA 2DBMA 3THXA 1N8RO 5LJ5h 4CF9A 1VQLA 4OU0A 3IP4B 1J5YA 3C95A 3JTGA 2MSYA 1Q81U 4YDUC 3I9QA 3I0XA 3IS9A 4OMYA 2XC7A 2TDXA 5E79C 3L09A 5AQUA 4GLMA 4BXUA 3K59A 3HDDA 4M77F 2XK0A 1TT5B 1YWPA 4KHNA 4XTUA 1YHQA 2Z2SB 1TNTA 4ON0A 2HDAA 4LF6K 2FO0A 1ZUYA 1DEJA 2D8JA 2CUEA 2E1MB 1N27A 4RTWA 3X28B 5KHDA 1VQ6I 1HSTA 4LNPA 1SD6A 4KHPK 1RAGB 4CC2A 5J1RA 4ZDLA 2HTSA 3I53A 4J19A 3DEEA 5GAGP 1Z3XA 3G6EI 5HDKA 1MZBA 4LG0A 3TQNA 1BB9A 4LGWA 1QU3A 2HSEB 4LJZF 2E12A 1VQ5Q 5FJ8J 4NO7A 5FGMA 1R8OB 3CJRB 4II1A 4IFYA 4I2QA 3DTEA 1L3LA 2PLYA 3M8RA 3HTSB 2SRCA 3TSPA 3AVIA 1E2XA 1SV5A 5C0YA 1YJWI 1JT6A 1W6XA 3TL4X 4H0OA 1XG7A 4Y33A 3RYRA 1GOCA 1OZ2A 5EXWA 4OMFB 5KYUB 5EG0A 1RR7A 5E1WA 3RMAA 2CQNA 2K85A 1LCUA 2K9LA 5K7HA 1VSKA 3QU3A 1T2KA 2CGLA 3GTOJ 1LOTB 3VQQA 4DEXA 2IC3A 2HPIA 3W2AA 5DTDA 1CQTA 4M75D 4XMYA 1FBSA 4C8QG 3BWGA 1MBGA 2BH1A 1E17A 3KZYA 3E6DA 1VQKA 2BY2A 2EILH 4HV6A 1LPLA 3CIPA 2K9SA 5I9EB 2E5QA 3IWZA 1C0TA 3OWTA 2Z5UA 3MCAB 4QT7A 4X62K 1W70A 4XTVA 1HQEA 3CJ9A 2HKOA 3AAPA 1K9MC 2M4KA 4I7FA 5CYQA 4WF9L 3I56N 2RV8A 2E5NA 3CCLA 2DKGA 3K70C 3QOEA 2FE3A 4D6WA 2D1VA 2KJCA 1WI7A 1CZBA 3FXKA 1TV6A 1R4MB 2FZCB 3O3HA 3HOSA 4WXHA 1V4RA 1RABB 4M7DF 3ULQB 5JICA 4LF4K 5HRRA 5GTIC 2GF7A 3JAMO 2EPDA 4FIBA 3WG9A 1PP7U 2QWMA 5KGXA 3HTUA 2O31A 2DAOA 4DLGA 4PY5A 5FRMA 2F5EA 4C8QA 3ZBDA 4H5WA 1HUXA 1VQ7N 2DTUA 3EFOA 3ZT3A 2VKNA 2D8HA 3E6BA 4BY7J 1X27A 1MSEC 4ZZDA 3WXIA 1QVGP 4GV9A 3FISA 2IS2A 3MKLA 1TWGJ 1RDBA 3MWMA 3OMYA 3VPRA 2PG4A 1M3HA 4MQ3A 3ZSRA 4MQVA 4FVUA 3CBMA 2L3DA 4I09A 2BHYA 1QO0D 4ORZA 3G71A 2O03A 1GLFO 4B1VA 3SAGA 2MD5A 5BPNA 4ZDPA 1YS6A 4CEAA 1DP3A 1KVAA 1YF5L 3FXQA 3EUHA 4FWQA 5E3LA 4UNFA 2PMZN 3CQYA 3UDCA 5BR9A 5KI6A 4KT5C 3WUHA 4BVOA 2DPPB 1X4PA 2PUKB 3JCMd 4AIHA 4RLQA 2NUPA 1X2QA 2DIQA 1DUXC 4LH4A 1LNWA 3OL4A 2QA4Q 3HK2A 2E2JJ 4Z6YA 1FYLA 1VSIA 3KEOA 4W1UA 4X0GA 3OH9A 3CD6Q 2L3SA 4MLOA 4CHYA 3VKIA 1V54H 2K3PA 3G10A 4LF8K 2LX7A 1PG5B 1FWZA 3DBRB 4EQQA 3ZP5A 3EUKL 1SD7A 4FJ5A 3CG7A 5GANf 1QQCA 5ELZA 5H6RA 3VS7A 2QENA 1K6OA 3EKUA 3E5UA 3O8VA 4WQ4A 4OKKA 4Q4ZF 3A8HB 3L2QA 3ULEA 4AIAA 1N6AA 1NG7A 2LY9A 2MA3A 3L9FA 5EU7A 1BIBA 5IXBA 3WQUA 5CQYA 2V7YA 2MD0A 4C8KA 3OGDA 3O4NA 4H0TB 4ZYDA 1NJIC 1NWKA 4DCHA 5AJ3K 4PA1A 1A36A 3AA2A 4DV6K 2DF6A 4RW4A 1T05A 1KFSA 2FF4A 2YCHA 1JKHA 1SL0A 1U49A 2GOXB 1UGQB 4Y1DA 3KD1E 3NNQA 1AKHB 2QQ8A 1NGBA 3GYHX 2K9GA 5GAMj 4XOPA 4KB0A 4EV0A 1WXTA 2D0BA 2A1SA 1YITI 4UQGA 4C3IJ 4PDKA 3X25B 2KMUA 3SQ0A 3JB9H 4MEXF 3W3CA 1M30A 1O1WA 3LA2A 1ZXOA 3T1YK 1U78A 2JVVA 3BR3A 3QP5A 4M77D 4FL9A 4CZGA 2LCCA 4PKGA 1TSFA 4BU2A 4EW4A 2NRRA 1ARKA 1IG8A 2XF5A 3OS5A 1IKWA 2COYA 2NUTA 3Q5FA 2VYTA 3CC4I 3SMPA 4ZGEB 5ILSA 4HSBA 5GAEP 5EOYA 2O4XB 4Q5VA 2DVJA 3G6EA 5A0DA 2B63J 4IUTA 3QBYA 1XI1A 2PVOB 1XUPO 3OYKA 2A7YA 4KTWA 3T8TA 4ZN3A 1UB9A 2E70A 1IKXA 1SVLA 3QYFA 1YX5A 2W57A 4Q47A 3C6UA 5AQGA 3E1SA 1EV7A 3VQ5A 1U3OA 1OQKA 3C3WA 2BE9B 1NKUA 4HCBA 1FC3A 3K4BA 5GMKm 4IX7A 4BWMA 4FLYA 3SFMA 1YJWA 4ENJA 4HT8A 1YIJI 3QHSA 4AUXA 5LHIA 2YRDA 2QA4T 3K9JA 4C5EA 2E88A 1N5ZA 2HFHA 3CD6T 1MBKA 1RUNA 2JWLA 4LK0F 1ZG1A 3MPUB 2UUCK 3GVAA 2P9IB 4JI5K 4K2EA 4C3JJ 3NWSA 3NVKA 3ZETB 3BFMA 1I5ZA 3LANA 1ZG5A 3K9KA 1S72N 4N0BA 1A0NB 2WBMA 5KYYA 3REOA 2V7FA 3OA9A 5DM6L 2XHIA 3KFVA 2YNGA 1VZ0A 3GDQA 2Z0WA 3LOCA 4KAZA 1J53A 4E1MA 1VQ8Q 4IRGA 2HQEA 4PUOA 4K8XA 4PJOB 3CUOA 2JHNA 2IXSA 3KE2A 5KYWB 2DJIA 5KGWA 1IRGA 5GIPA 4Y3OA 3RR8A 4CZHA 1NBWA 3HZJA 3AA4A 3HT3A 1RACB 1FN7A 4AT1B 1Z26A 2EFOA 3MVPA 4PJNA 1RT2A 1MDMB 4LN2A 4ESRA 4C0DB 5CJ9A 3AVGA 5BR8K 3I5RA 4M3UA 2X1DA 3UATA 5JHFA 2EJ9A 3LALA 2LLKA 1ORNA 3CM6A 1FY7A 3UKRB 1ACIA 2JUGA 5EG2A 4Z2YA 4M7DD 1LWVA 5K7ZA 1ATSA 3H9NA 3GTMJ 4PJMA 3RSEB 2FBYA 3VS0A 1HCRA 5A2QE 1MUNA 3CZ6A 2LF7A 4M74A 4DZJA 5DPKA 3O3GA 3CP8A 3RMCA 4HG2A 4M7XA 1ETYA 3GG4A 4QWQA 5FKOA 2OANA 3VPZA 2Z1HA 3X24B 5HLIA 3NTIA 4BI8B 5MLCQ 3HM9A 2D2WA 4L5IA 3OYHA 3GTJJ 1QQIA 4DTOA 2KZZA 3E7LA 2LYCA 3C12A 3NGIA 3IH2A 4FM0A 1WGSA 4I02A 3Q0VA 3AO1A 1IGNA 1T56A 4DEYA 5JVGF 1MSFC 3RKWA 3D5SC 3AVAA 2RN2A 2LBFA 1XJWB 4KFBA 1KG5A 2PJRB 3CMEI 2KVQG 3EN9A 1BYMA 1MHNA 3EYZA 3Q9VA 3WT0A 3M9QA 2MABA 2F5KA 1WJ5A 2VQEK 1Y0NA 5H20A 2W85A 4PLLA 5EGOB 3VFZA 1Z9ZA 4BUPA 1UDLA 4AH9A 4BGDA 3OW2A 2IGNA 3KFWX 3BR5A 1Y96A 4FO0A 2KISA 5ECAA 2FBHA 2CJJA 2JJ7A 3DLMA 1ZGJA 1VQ9Q 3OJSA 3AHUA 2DW4A 4PK4A 3VRYA 3VYTB 4LD9K 5HK0A 3ER0A 3RPUA 1OCOH 2H8WA 3M1FA 4N5SA 3KBGA 3VS4A 3ID6A 2CQ7A 2ZC2A 1WUAA 1NK6A 3CCVA 3KYDB 3RCOA 3CM5A 4BRFA 3HKZN 2XGDA 3BPXA 4CE9A 1D9FA 3BR2A 1WBDA 2XGXA 4Y28E 2DTZA 5HNHA 3VYHB 4EEFG 4CYCB 2D1XA 4NXNK 3THYB 2P5LC 2M02A 4BB7A 2DQRA 5AQQA 4C8QF 1X9JA 1YITA 1ZSZA 1PKTA 3DLBA 3ABUA 1OKJA 3F8MA 5B3SH 2Z1JA 4LMYA 3CHWA 2RHYA 3OMGA 3Q0UA 2VL8A 2R5AA 3T8RA 2VKVA 4GGGA 1R77A 1IXCA 5C15A 3NH2A 2RD1A 1XDUA 3B6PA 1SAXA 2JQ7A 4J2BA 3J7AO 2DE0X 2ID6A 5J3LA 1VNDA 2YRCA 3L4QA 3DLGA 1RC9A 4IHTA 2KQWA 1GXPA 3EFRA 5LHHA 5KCHA 3GF2A 3MEUA 5D5VB 1MNMC 3RMQA 1NGCA 5A2QZ 1LPQA 2G7UA 2P51A 4L9TA 2W00A 1NK8A 4AIKA 1PVSA 1Q7YC 3VETA 1XMXA 2V1QA 1PVEA 3CLOA 2AK5A 3ASNH 1QVGM 3QWXX 3PY8A 1PCXA 1SPKA 2K27A 1VQMI 3O8GA 2ITGA 2JG6A 3S6IA 4OX9K 4P5NA 3OVNA 4MHGA 1POGA 2Y0SN 1PC0A 3HSTB 4ELTA 2ZGWA 5E1ZB 3QPTA 3WXLA 4Q5WA 1XMKA 4L5JA 4AYBN 1LWFA 2ATQA 1WQ2A 4JS5A 3L6QA 2EQIA 1HLUA 2J5PA 4C0FA 4DFJA 1J5EK 4DQSA 2R3SA 4CHQA 2GCXA 4CJQA 3IRQA 3ZQCA 3NAUA 4M3WA 4LD0A 3CW7A 4C8OA 3HXLA 3NQOA 5LJ3e 1W1FA 1IREB 1D4XA 1N77A 2LR8A 2A6AA 5H6QA 4KB1A 2K3XA 4PSWA 1WHUA 2ZNYA 1SSFA 4NB5A 3EGDB 1ZRCA 4AHSA 2CKKA 2R7QA 1NJIO 3FEOA 4ELVA 3EE9A 2QK9A 3HI0A 4B24A 5C3EJ 2E1CA 2OPRA 3DCFA 4PSXA 2FMYA 4KITB 1LFBA 1DGWY 3CO7C 5A0GA 3LSKA 5C25A 1LEAA 1YJ9T 3ELKA 3LAJA 3ENHA 5LEKA 3H8ZA 3PQKA 3BZCA 1Z3YA 2NOGA 4NCAA 1MV3A 2BTFA 2XD0A 2CUBA 2KR3A 3WU2C 4B9NA 3H0DA 2QKKA 3K5LA 1JHHA 1MMNA 1HJDA 1W4MA 1BI1A 2VQFK 1X9SA 2BW3A 4DTNA 2PUOB 2A5WA 4EMGA 4BC5A 3KKSA 1JHFA 4IJNA 2JK3A 1IG7A 1KIKA 3CFRA 4XIUA 2CSIA 1VSMA 3EPZA 4D7NA 3M5RA 2HBPA 2KYMA 4FJHA 3FM5A 3IQLA 2HEOA 4J9HA 4ANJA 4F7UG 5GANg 2L5QA 2K3YA 4LUEA 2EJRA 3LM2A 4ELUA 3IRXA 3CMAQ 4XU3A 3KWGA 3ZT2A 2DRKA 2AA4A 1GLEG 3VQ6A 3O4WA 2A1RA 3LP2A 3CCJI 2V1DA 4DWIA 5DCFA 3MN5A 1U48A 4MZPA 2EA4A 1B7TA 1U5TB 1BUPA 2KZMA 4J8FA 3HUGB 3TU5A 3W2WA 3CMEA 4JI0K 3B02A 3OS2A 4KT0E 3CCMN 3ZN0A 3J7YJ 3MCPA 4N4IA 2IAIA 2R5YB 4OAZA 2AZVA 1VQLT 2Q1ZB 4F7UA 1HQCA 4FYXB 2HQNA 2GXGA 4KNYA 4KH0B 4UC4A 1NK3P 3P7NA 3D0PA 3VS1A 3CCRQ 4DFPA 5FFZA 4MZMA 3JRBA 4M7AG 4A3GJ 4X66K 2LTPA 2DK5A 2FQ4A 4BRAA 4NB4A 5AT1B 1LWWA 2CUJA 4GBQA 1YHQT 3ZQ7A 2M51A 2Y90A 1HW1A 2GBZA 4HTLA 3I35A 1M1GA 4GCVA 2JRTA 1XG1A 3QIOA 3N0UA 1PWTA 2X51A 1BI0A 2V52B 4HZFA 1QQMA 3EAEA 2UYTA 1YJNI 4FQGA 2GQQA 4WXCA 2BZXA 2BVLA 1WFWA 3CJ7A 4NYFA 3J7AY 1FBQA 5F08A 5I11A 5DD4A 4BHBA 3W0LA 4DU4A 2XUBA 5IYBJ 4GV6A 3M8QA 3VW4A 4IHSA 3S32A 3CWUA 1QZEA 2WOMA 3AAQA 2EIFA 3EETA 4ZGJB 1YQRA 1KHCA 1SAUA 2A68F 3GPLA 1EH6A 2ZNZA 2Q31A 2XKPA 5IXFA 1V29B 1W7PD 4M7AA 3TTCA 4BGAA 3HJFA 1P4AA 2Z16A 1VUBA 1FMVA 4LSLA 1BBYA 1LW2A 1GHCA 1NJYA 2O8FA 2ZKZA 1LDKB 4RTUA 5K7FA 1T3VA 3J7ZO 8AT1B 2HOAA 1YI2I 1PU7A 3C2HA 4C8QD 1QGPA 2ZPFB 3HFOA 5E3MA 5E8GA 4ZN1A 2LC4A 5FU6B 5KYXA 4B1RA 1X9MA 4DS4A 2EPFA 3JSMA 4CGZA 1RT3A 4BRKA 3BTIA 2QVOA 2QSFX 3MEWA 3DLLL 1VQKT 1NM7A 1BCMA 3OYLA 3T1HK 3BPVA 3E5QA 1JL2A 4BQQA 2HWVA 1VQ5N 2EIKH 2VC0A 1VQMA 1UJ0A 4FTHA 3K69A 3BR6A 3GTLJ 2B8AA 1K9MR 3GOIA 3CCLT 4U7DA 3U9ZA 4FOIA 5CVVA 1N3CA 5GMKi 1NGDA 5DYMA 1M8VA 1NBEB 3LWIA 4PGHA 1J3TA 1QZ6A 1L0OC 4DQQA 2HYFA 2DTOA 3MAQA 4J83A 5C12A 1KVBA 1XGNA 4I0AA 1F36A 1XSDA 2R7DA 3SEZA 5KE2A 4KHUA 2QWWA 4CFAA 2PU9B 1XDSA 2JA7J 2NVQJ 4JLHA 1BC7C 3I64A 3OIPA 2OTLA 4XBFA 3M4GA 3FK7A 4I6MB 2DAQA 5GJWB 1VQ6Q 2QXLA 1K8AC 4O8UA 5LHGA 4EA4A 3MAJA 3KWIA 2YLBA 2BE2A 1FW6A 3BG3A 4BGBA 1G4DA 3UF4A 1YVNA 3D2FA 3UKGA 3G71T 1ZGWA 1BW5A 4L0YB 1H88C 1GVJA 2YG9A 3RVCA 1Z91A 2ZCFB 1LMZA 4XNFA 2LQNA 4QAGA 3NAEA 3HOVJ 3PTAA 1MIJA 1MU2A 2VBXA 1JXBA 4B23A 1KD1C 4G1QA 4EMKB 3CXCS 4O0JA 1KAXA 3TDUC 2YX7A 1HKGA 1YJWQ 1QZ5A 2P9LA 3WXKA 4EMSA 5GANd 4YDUA 4J9IA 2EAYA 3PNVA 4RLFA 1TW3A 2IVOA 3ABTA 2E1MC 3RRHA 2X35A 2GA2A 3I0TA 5GAN2 1OJLA 2BIVA 4XONA 4CXFA 3OYCA 4OOIA 1GXQA 5LJ5g 5A2QO 5GAMf 4XN3A 3CJNA 4CERA 2M2EA 2ED0A 3MZ8A 1S1NA 1C0FA 4OB0B 3IRRA 4E19A 4CIGA 5CQXA 4OIRF 1A6IA 1TNSA 2IOCA 2NRTA 1SD5A 1KQJA 2IVMA 1SZ2A 1Q82R 4KH5A 3CCJA 2IW5A 1ZH5A 2GGRA 2I7NA 4JOMA 4KI4A 1WPKA 4JX5A 4ISGA 3NFCA 3WVEB 2ECCA 4R0KA 3GOXA 3IFRA 2P9NB 4XEIA 4C2UA 2KQRA 4M9ZA 3U9GA 1AHJB 1KCFA 1MW7A 3ZSQA 2QA4N 5GAOm 5KE3A 3FZKA 1WVRA 2O5RA 3CD6N 2FBIA 3MP6A 1WWXA 2CH4W 3HJEA 3PNYA 3ZQHA 1QVFS 1BIUA 2IVWA 4I0BA 2DD5A 3V7SA 1BI4B 2E7WA 2DA9A 3JAMK 4Q48A 3E5XA 3DRPA 2KRFA 5TGTA 4AFSC 4A59A 3M53A 4AHUA 1ZC6A 3CC2Q 1CZAN 2YHXA 1K73R 4HCCA 2NYXA 1QTMA 2ZCWA 1VIFA 2CGHA 4H5RA 3A0IX 4CCHA 3CCEI 2VOOA 2OD5A 3QKJA 4KHSA 4GKJK 1U2WA 3M0PA 3QODA 1H9GA 3U1DA 3VGLA 1EA3A 2VC8A 2E1ZA 3G6ET 4R5PA 2DJNA 3DFGA 5IOZA 3SJJA 5D6YA 2K57A 4CDGA 2QQRA 3GFJA 3M3YJ 3ASKA 4CBWA 4AM3A 1Q82U 2YI1A 1IDYA 4FZXC 4JRKA 2DDBA 2KDSA 1TK5A 2OC6A 4CJTA 4DR2K 4U0YA 2P9KA 2GTJA 2NLXA 1Q9XA 4NC7A 3ISPA 1YJWT 4WFBL 2FXUA 3T1AA 2BDPA 4J9CA 2VG7A 5KYNA 1YI2A 1WHGA 2FU4A 4OJRA 2MYSA 1R6RA 3LPTA 2QM3A 3IC7A 2H1KA 4WYBA 1VQ4Q 2ELHA 4ENKA 2JT1A 1SANA 2FPEA 4HTUA 3LSGA 5KH6A 2VWJA 3HRUA 2CV1A 2X6NA 2DXBA 4W5RA 2XKOC 3OYJA 3BR1A 2EFPA 2KMTA 3BGRA 3JRIA 4O4GA 3H9GA 1Z77A 1YFHA 3M3ZA 3HYIA 1K73U 1RT1A 3VF6A 3DXMB 2IIMA 5J2QA 3THKA 1RKTA 1FBUA 3ROUA 2RQVA 4A4FA 3OIOA 3CCSI 2XGCA 3RJPA 2WSEE 1M4ZA 1D0XA 2E6MA 3O1WA 3CEYA 5DCMB 2E2QA 3FSPA 5IAYA 3FMRA 4XLHA 4F7UF 4BC2A 3BG5A 1W7AA 4PJOE 1RDUA 2D45A 1OZ3A 4G6QA 4E0DA 4WFNL 4PJLA 4NC6A 3VEVA 1TLHB 2HAXA 3DOKA 3CC7Q 3O5BA 2WY8Q 1JB0E 3CUQA 2IS4A 3DB3A 3D2EA 1TUCA 2YUSA 3DXKA 4YOUA 5AQYA 3G0QA 2K6DA 3F0ZA 5D6XA 3FZHA 4OB2B 5L3BA 1M3BA 5AN4A 2IVNA 2HI3A 1BR1A 2KQ2A 2HNZA 1ATNA 2E10A 2XB5A 3CC4Q 1GT0C 4J9GA 4DR5K 2GIZA 1VQ8N 1RDWX 2M0YA 1KVCA 3AVHA 2EFNA 5LGTA 1XTAA 4H0VB 1R1UA 4BBSJ 1V1CA 2XAHA 2CFOA 3QPLA 1OV3A 4F3QA 3RPUD 4BXXJ 2CZ7B 4LIUA 1T7PA 4YELA 2LOOA 1G2BA 5TISC 4AIDA 5ICGA 4M7AF 4CC3A 2ACJA 1WRJA 3AVJA 5C6SA 4QVZA 2B0LA 1FT9A 4LFUA 3I5SA 4XU2A 5D8LB 1U8RA 1YIJQ 4BHPA 4RTTA 3SDZA 1QWEA 1XC9A 4CICA 2OF7A 3CPWS 2HVHA 2KGTA 1V4SA 1UCRA 3MO8A 1BA0A 1NNEA 1ZN2A 3MZHA 3OBYA 5FU7B 2RNGA 4JK9A 2K4YA 5ADXA 2L0KA 1B1BA 1M1EB 2FSWA 3OS0A 1CSKA 1ODDA 2O4IA 5DK5A 1W1WE 3TW6A 1D3YA 3TO6A 1OH6A 2WAQA 4YFXF 4CGIA 4CO8A 2H3JA 4DB3A 2HHXA 4U67L 1Q86R 2R92J 3TEDA 1YT3A 2NLUA 1XMAA 1JO8A 1P4XA 4DR4K 2RQUA 2WSFE 5M1KA 2RREA 3C2BA 3VU3C 3GBGA 4M6XA 1O3RA 4L0ZB 4RM2A 2OTJI 2BYVE 4DBQA 1I8FA 2P0QA 3MEGA 1U84A 4LB6B 2E4HA 3QEXA 4EM1A 3NVMA 1MUZA 4F93B 2JTMA 3I3LA 2ELKA 4M3DA 3CCVT 4YIFA 1A5WA 3UNGC 3VDXA 3LH0A 2QEXA 1C6VX 3L0QA 5LEJA 1JUMA 4CZCA 2LSOA 2P8TA 2WBNA 4CFBA 3T3FA 1U1SA 2LVMA 3HL8A 1YITT 4IVNA 2B5JA 3P8BB 2PY5A 1VYVA 2YNHA 3P4IA 3TANA 4B43A 3AO3A 3JRZA 1Z7LA 3QQAA 2E2IJ 1ZLJA 3WTYC 4PJOC 2QLZA 1QMCA 2LD5A 2VONA 1VQ9N 1LB2A 3A2FA 4I6ZA 1R7JA 4HAMA 4OWRB 5HRSA 4WXDA 4B21A 1KHIA 3UIQA 3RKYA 3QB0A 5GADP 3E66A 4GO1A 2GFAA 3SWNC 2FEIA 4LH5A 2STTA 3KEQA 2BZTA 3PSIA 2NNYA 4IXCA 1F21A 4JD2A 4C0DC 2P0PA 4BI3A 2D9TA 2J7IA 4XQ3A 1Q86U 5HCKA 2LCLA 4RAZA 2XU8A 4E7JA 3ZSOA 4FW2A 2KIUA 1Q7YR 2D0OA 2CUZA 5GPCA 1KONA 2QQBA 2EFWA 1X19A 4KBMB 2QM1A 2GM4A 2KKOA 2V4JC 3TU4K 3C65A 4KREA 4GKKK 2OX7A 4CI6A 1U9NA 3TP0A 4XICA 4JUVA 2DYIA 1KU9A 2E35A 1IZ1A 3WXMB 2O8EB 2HSPA 4IIMA 4C92F 5IP7J 4IHYA 4JQFA 4BR0A 3AVFA 2M0OA 1VFCA 4R79A 3I59B 3PT9A 2E5ZA 4PKCC 3AARA 5AQMA 1H92A 4FK4A 1W7PB 2HOEA 4DSLA 3ZRGA 5GANe 2IS3A 2X74A 5AIPA 1SKUB 3O3FA 3JSOA 3LL3A 4P9FA 1JGSA 5CHZA 2P7VB 5L23A 4WTOB 3K2AA 2LJ1A 1RI9A 3WTTC 1BU1A 3T9NA 4C8QB 3CCSA 1RGIA 4GY5A 3EFOB 3G4SI 1XQHA 2K2MA 3QDKA 4YOTA 4XLPF 1RAIB 1ZG3A 2HZYA 2DFHA 1DU6A 5B1AH 4DA4A 4FASD 1SVMA 1SHFA 1E3OC 4OKEA 4G9YA 1ZK8A 1KSPA 2HDDA 3FC3A 3VGMA 3QDFA 5AQTA 1NK4A 4DSIA 3P39A 4XKCA 4BR9A 1KQ2A 4CEOA 3BG7A 3EGUA 4M78C 3V1RA 2NWMA 1X75C 5I22A 3CMMA 2HHTA 2CP5A 3CCQA 2DA4A 1XS9A 1HNWK 2QQAA 4JKHA 2JA6J 2DMNA 4FHTA 4HNTA 1RBSA 2E8AA 2HBLA 5F0FA 2K5FA 1SMYF 1X6GA 1Y6IA 2YKNA 3A5OC 4ENNA 1PU6A 1HNVA 1JCGA 6AT1B 2OCCH 4X9CA 1IO6A 3CCUA 3AO2A 5JHUA 1SFXA 4YIRX 4IRIA 2NVTJ 3B8AX 5EY4A 1PKSA 4PL8A 1U2VA 1B34B 1HJRA 2YSRA 1WEGA 4XH1A 4KN4X 5F27A 4YORA 1ETOA 2Y48A 1H641 1WQ7A 4XN0A 3FXRA 4L18B 1IB8A 4M3ZA 5JR3A 1NK9A 5EX5A 3LSRA 2DBKA 4PQUA 3CMET 2YU3A 4M7AD 1W0TA 2C0IA 4CHPA 2V6EA 2JA2A 3S9HA 4K8ZA 1RL2A 3CF2A 5L3CA 4PFPA 2FXAA 4B3TK 3AG1H 2HVQA 1LOJA 1HDPA 2E1NA 4BY1J 4IBNA 1FTZA 1NMNA 1HSJA 1RDAA 3ZLJA 5KQDA 1JTXA 2DA2A 1U5SA 2COBA 3LL7A 1HW2A 2IEKA 2VC1A 1PUFB 1VQKN 3CMAN 3RTRA 5T7BA 1XSVA 2OV7A 1IBKK 3MWTA 1G3TA 2M16A 3JSPA 1Y1VJ 1RBUA 2AXLA 4PJ0C 1ABOA 2YHWA 4F91B 4UV8A 2GWRA 2DO7A 2OTJA 1S29A 2NRHA 3F2KA 1I50J 2W42A 4F3TA 4ZH4F 2FPDA 4B8AB 1I07A 3J7AF 4HBLA 3CCLN 2KY9A 5BPIA 4BE2A 3K9TA 2HKNA 2P1JA 4FJGA 3QYEA 2M9HA 1MJAA 2DO3A 1YTAA 2COZA 5LD2C 4OMZA 2XIGA 1E4FT 3R8EA 3CCRN 2UUAK 2IGKA 4RW6A 3E9OA 1FIAA 4CCMA 4CSWA 3W6JB 1ZRFA 1W0UA 4CCKA 1T98A 1JXMA 2X85A 2PFBA 2XGEA 2HBJA 3I56I 5EVZA 3LWMA 5TKWA 1AZEA 1EKEA 3RSNA 3V9XA 1IAWA 2H56A 2WFBA 3JS6A 3MEVA 3TTDA 4XTWA 3CWTA 1G3WA 1AWCA 2P5GA 3LP3A 4J6WA 4ISFA 3PFIA 1WSJA 5BN8A 3N5BB 2EGEA 5LBQA 2L2OA 2I8DA 1VQ7I 1P7JA 1YCSB 5A0LA 4FT4A 2YHBA 4DBRA 5E18F 5D5XB 1JRIA 4KBOA 4A57A 2SEMA 1VQMT 2JS0A 2EFIA 1TBXA 3QJ6A 3A8YA 4LD5A 3K57A 3KZZA 1HW5A 4R55A 4TV7A 2O8BA 5AZIB 3IHOA 3K0SA 2DPDA 2EWSA 3TO9A 3HB9A 3PM1A 2QZ8A 1LWYA 3C7JA 5I2SA 4S05A 4E7IA 4Z4GA 4EVVA 4LG3A 4W5QA 1B9NA 4M63C 2IA1A 4YFUA 1U0JA 2V51B 4UVCA 1F1BB 3EHQA 5CLSA 4YPRA 2IIRA 3R1XA 2OTLT 3HRGA 1YJNQ 4FWKA 4OVAA 3OV8A 1QVPA 3HP6A 1K0SA 2YUPA 2OPPA 1K8AR 1G59A 5CZ2A 1VQNI 3ZSVA 1O3SA 2CW8A 3ZCMA 2Q36A 5FPEA 2CH4A 3JCMX 1D1BA 3G4SA 2BY1A 2LY1A 1E6HA 4G8XA 1WNLA 4XLNF 3F70A 3BC8A 3EO3A 1NKBA 2HL3A 1LW0A 1KQSP 1YTYA 1K8KA 4Z02A 1SD4A 4PWDA 3AVMA 4QLCU 3RR6A 1KD1R 1Z67A 3EG0A 4MGRA 4RW7A 3KK3A 2F5TX 5GAMd 2BY3A 2YWWA 2HSTA 2ZXWH 4DIQA 2DFEA 3HPGA 1XB4A 1KC8U 3NDKA 4CGJA 4MO7A 3V1QA 4BQNA 3OQ5A 3LA7A 5AQSA 1UUEA 4MTEA 5CPRB 1VQ6N 4DG1A 2J6FA 4E7KA 3JYTA 2AS5F 2KXDA 3SCXA 3WTZA 2DFUA 1QCNA 2CQKA 1ONVA 2LQ8A 3TGNA 4IQJA 1B6AA 3VERA 3C7NA 3G6EN 4CZKA 1LFUP 3SQ2A 1T08B 2W03A 4JKAA 5GMKl 3F21A 4CRIA 3KTQA 3A5LC 2WAFA 2BTTA 1L3SA 3CCJT 5J40A 2IPOB 3BE3A 1HQUA 2D0CA 2RQWA 4LDXA 5BMZA 1XHZA 1QPMA 3A03A 2P9UA 5EJCA 3C94A 1ZHFA 4RCHA 3QNNA 3BDUA 3QINA 1U9OA 1V5GA 1HA8A 3WTUC 2FRHA 1YJWN 4MEYF 1M27C 3LM9A 1Z6TA 1J2XA 1IN4A 1PDNC 1DPRA