4BE2A

Pfv intasome with inhibitor xz-259
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be2A03
3PY8A 3KLEA 3SNNA 3F70A 2BDPA 2HHXA 1TKDA 3A2FA 4N41A 4CJKA 2HHQA 1NOYA 4IUTA 2YNHA 3ZT2A 3VQ9A 2G8UA 2RI5A 1W9HA 1RDAA 4B9XA 4II1A 4RW7A 4PY5A 4YFUA 5KGWA 4O5BA 3H6ZA 3NAEA 2HQXA 1L3UA 2XY6A 2YV0X 1JKHA 4CE9A 3MEEA 4BWMA 3LH0A 4CGIA 2HB5A 3PX6A 1ZBLA 4KHYA 1CLQA 3IS9A 2EKOA 4BDPA 4FLYA 1NJYA 1NK5A 4IG0A 2QKBA 1U49A 2B8AA 3OQ5A 5HBMA 2O4GA 4CEZA 1JLGA 3DLMA 3OB9A 1YTAA 2HHVA 3K2PA 2HW3A 2KQ2A 3QBYA 4NCGA 5C25A 2ZD1A 3TI0A 2OPPA 2QQRA 4IBNA 4A4FA 1S1VA 4DMNA 2F96A 1TAUA 3ZSOA 3HYFA 2HNZA 2HHUA 2NLUA 4E19A 3V9XA 3C6UA 3KKSA 1DTTA 3CFPA 3AVAA 2EQUA 1S1UA 1HRHA 3LANA 2DFEA 3VQQA 3ASKA 4DS4A 1ASWA 4KO0A 3PNWC 3PV8A 4DTUA 3OA6A 4HUFA 3U3YA 4IURA 3MEWA 3CFRA 3MP6A 1KRPA 1EETA 4CIEA 4FJJA 3VQDA 3BGRA 3JYTA 4PWDA 4C8OA 4DWIA 4C8MA 1KHCA 3SPZA 1VSMA 4DG1A 2FC0A 3FEOA 4CJTA 3L2RA 1IO2A 3B6PA 3O4NA 3MEDA 3P8HA 2KW4A 3S9HA 4C8NA 1RBVA 4M41A 3T1AA 1ZBHA 2VWKA 2EX3A 3V9UA 5J39A 4F2RA 3V6DA 3KTQA 3IG1A 4NZGA 3B6OA 4NYNA 3AA5X 4EP4A 4N76A 4C5EA 1KCFA 1VSIA 3NTKA 1WJQA 1CXQA 4F4KA 3L3VA 4LSNA 1RCHA 1VSDA 2K3XA 3AVGA 3OYHA 3PMTA 3OMGA 3D0PA 3DOLA 4IKFA 3I8DA 3RWUA 3EZ5A 2HHTA 1WSHA 4FJXA 4I2QA 1C0MA 4Z4IA 5IAYA 1S1XA 3ZSQA 1X9WA 4N4HA 1RDBA 3LX7A 3G0ZA 3S3OA 4DQPA 1BI4A 3NBPA 4PQUA 4KHSA 2PY5A 4DQSA 3ZSVA 3OS1A 2HNYA 4E7HA 3S3NA 2XDPA 3AVJA 2KZMA 5CZ2A 2QQSA 4HVJA 5SZTA 1BI4B 1ZYQA 2E6NA 4E1NA 2YHBA 2K3YA 4OGCA 4HTUA 4E0DA 1RT6A 4HUGA 3ASMA 4FJLA 3VQEA 2HVHA 1EX4A 2EFIA 1QSSA 5HRRA 2RJCA 1KSPA 1WSGA 2GFAA 2RHYA 2BANA 1RT3A 4KTWA 4I7FA 4GW6A 4LSLA 5C0MA 1VSFA 3KK3A 1NJWA 3QEIA 4CGGA 4M3UA 1T7PA 1Q9XA 1D9DA 1HQUA 5FRMA 4BE1A 2Y1JA 1SKWA 1B9DA 2LDMA 2KFNA 4CF8A 1OI1A 5C6SA 3NH2A 1RT2A 4B8AB 4FJ7A 2IOCA 1QE1A 3SZ2A 3QKJA 3KJVA 4CK3A 3UWNA 1GOBA 2G8IA 4KHWA 1IKXA 5JS2A 3AVFA 1NKCA 4CF0A 4MQ3A 4FJ8A 3L2UA 1CZBA 5KCHA 2XO7A 4F2SA 3DLRA 2VG5A 4O44A 3QEXA 1C1BA 4I2PA 4DSEA 4JS4A 4DS5A 1TGOA 3KLHA 2WOMA 4CECA 4XIUA 2RN2A 2RHIA 3OYJA 3V1OA 4ID5A 3OYAA 1J54A 2EHGA 2HQEA 2P5GA 3PMIA 5IN1A 1JLEA 3PX0A 5DMRA 3RRHA 1EXQA 4DSLA 3LLRA 2BUDA 3QEPA 4DFKA 3KLIA 4OKKA 5KCOA 1XNIA 4Z0UA 4FLVA 2XY5A 2R58A 2PYLA 3NGIA 3HT3A 4QQ6A 5FRNA 1BHLA 4J2BA 4FW2A 3WNFA 3AVBA 1H3ZA 3TAEA 2IDOA 2YRVA 1L3SA 2X35A 2X4WA 3TAMA 3CFOA 4CEOA 3SPYA 4N4GA 5J2NA 4FLZA 3VA0A 3CM6A 4FZXC 1WAJA 3H8ZA 4PA1A 1S9EA 2O4XA 3LDSA 5KRSA 4KRFA 2OPQA 1WJRA 1LWCA 3TR8A 3KLFA 3NH1A 4AHSA 5J1EA 1RBSA 3KKRA 5KI6A 1RBTA 5KH6A 2L89A 3CM5A 5J2MA 1IKVA 2VWJA 2E5QA 2OYQA 2O4XB 2MWOA 1BISA 1FXXA 4EDUA 1L3TA 1BCOA 5CYMA 4ELVA 1QHTA 2LRQA 2L3RA 2DY4A 3OYFA 3TAGA 3RR8A 1X9SA 3ALYA 2FBTA 4Z4GA 1VRTA 3I0RA 3ZSXA 3QIIA 4ELTA 4TSXA 2XY7A 3AO5A 2EQMA 3HJFA 2JZ2A 4M3ZA 4E3SA 1N27A 4Z4HA 1HPZA 4DU3A 4CJEA 3RMBA 1KFDA 3HPHA 3DLGA 2B6AA 5CIUA 3MP8A 5KE2A 4KV8A 3OYKA 4N56A 1JL1A 3LZJA 1SL0A 2DAQA 3SD4A 2Z1JA 3HVRA 4FVMA 4RW6A 4AHCA 1REVA 2OPSA 4B9MA 3LP1A 3SUNA 2D0CA 4DSJA 2Z1IA 4UQGA 4KI6A 4C5GA 1JXEA 4DF4A 1RNHA 4HCBA 3L8BA 5E41A 4DFPA 3NCIA 1O1WA 1IKWA 1C0TA 1TKZA 2YNFA 2NUBA 1HMVA 4EZ9A 1TV6A 2R7YA 3O3HA 2RJDA 1L3VA 4CJPA 3KK1A 4PLIA 1KTQA 4RW4A 1CZ9A 1Y97A 3OYIA 4B9NA 4KHNA 4CGHA 4M3TA 1W0HA 3RRGA 4FJKA 4DTRA 4AILC 3OS2A 3PO4A 4CHYA 1S5JA 3G10A 3NF8A 2M0OA 4UC4A 1U48A 2IGIA 3NH0A 4BACA 4CK1A 4CEAA 3HM9A 2BGGA 3HSTB 2RKIA 3MEVA 3VQPA 2EQKA 3H08A 4ZHRA 3DRSA 1NKEA 2L8DA 3GOXA 3L2QA 4ID1A 3DB3A 3SI6A 3PUFA 1ASUA 1JLBA 1WAFA 1G15A 2RO0A 3QINA 1HYVA 3K5LA 3EAEA 1MU2A 1SKRA 4CCHA 1BIUA 1EP4A 1ITGA 3NF7A 4N47A 4QW2A 1BCMA 3OY9A 2QK9A 3SQ2A 1RI0A 1JLAA 4Z4EA 1LAWA 1RT7A 1X1PA 2ITGA 1UA0A 1WSJA 3MP1A 3ZT3A 4QQDA 5M9OA 2BKDN 4BE2A 5SWMA 5D6YA 4KI4A 3PX4A 4A4GA 1Q8IA 3OJUA 1G5VA 4KHUA 4CJ4A 4OPKA 4RW8A 1TL3A 1I39A 4OJRA 4CJLA 1QTMA 1JXBA 3TWHA 1XC9A 4B9SA 3KD1E 4KTQA 3QO9A 2KTQA 4DTXA 3NFAA 3DMJA 2G8FA 2GF7A 3TAQA 1QSYA 1T8EA 1A5WA 3WNEA 2ETJA 3HL8A 4KB0A 4OKJA 3VQAA 4LY7A 4Z4CA 4FW1A 3QIOA 1S1WA 3K5OA 1IKYA 4NCAA 3VA3A 4HCZA 1SL2A 4CJ3A 1RDDA 4IDKA 3C6TA 2Q3SA 3MEUA 2E6LA 2GUIA 3OYMA 3LGFA 1KVCA 2W42A 2P51A 3V9WA 4DTOA 5K14A 2O4IA 3V4IA 1S1TA 3EYZA 4BDZA 3E9GA 3O4QA 4Q5WA 4FJ9A 3NF6A 3VQ6A 4CESA 4F8RA 4DSFA 1TKTA 2E4LA 4M45A 2KFZA 2EQJA 1WGSA 2XK0A 1JLCA 2F5KA 4QQGA 3DRRA 1UWBA 4W5TA 2RF2A 2MWPA 4QAGA 1Z25A 1NOZA 1TK5A 1RT4A 3SV4A 4C8LA 3OYCA 3ZT0A 4DTMA 5HRPA 1WSEA 1TK0A 3OYEA 1QSLA 3M8RA 3HXMA 4FYDA 3SCXA 4FLWA 2HMIA 4KAZA 2X74A 3SQ0A 4CJRA 2X4YA 4CFDA 4CEDA 1D9FA 4CJUA 4IFYA 3T19A 4RW9A 4Y1CA 2OA8A 4B9VA 4DSIA 3MXJA 3K57A 2IG0A 2VYTA 2DIGA 2XRIA 1OZ3A 3PFSA 3VQ8A 4PUOA 4BDYA 2D0BA 3OS0A 4CHZA 3IRXA 5JS1A 4FL6A 1U47A 2E6MA 1QS4A 4CIFA 5D6WA 1R0AA 4O0IA 3ITHA 3V81A 1XHXA 1MHNA 4BD3A 3FC3A 1T05A 3MO8A 1WNSA 5D6XA 1TVRA 3RMDA 1UAXA 4EP5A 4B9TA 1YTUA 3NTIA 2RI3A 4KFBA 2FBXA 3DI6A 5I42A 4FJMA 2RPIA 4CGDA 1RTIA 3LWLA 4FM2A 1TK8A 4DU1A 3MEGA 3OYLA 3VQ7A 2YNIA 4CHPA 3VN5A 4HCCA 3OVNA 1K6YA 4OPJA 4FJ5A 3AVHA 3AV9A 2HVIA 1NK7A 4FK4A 3O3GA 3P5JA 4Z02A 5DK5A 3DM2A 1LAVA 1HYSA 4NYFA 3AO2A 5KGXA 2CKKA 1IG9A 1X9MA 1RBUA 5HRSA 2OZMA 2JTFA 2AJQA 3SJJA 1U45A 4L59A 1VK0A 4FK0A 1OYXA 3V9ZA 1DTQA 4DTSA 4A4EA 3TAFA 5HLFA 5C24A 3HPGA 1CXUA 1RT1A 3K5MA 2QXFA 1N5YA 2RHZA 3DOKA 3OJSA 1DLOA 1HNIA 3AVIA 2VG7A 4ICLA 1RT5A 3AVMA 3O8VA 3CYMA 3FDRA 4C5HA 1VSKA 4CFBA 4CJQA 2IS3A 1RTHA 1J53A 3KK2A 3LPUA 3NE6A 4B9LA 2Y1IA 2RHXA 4DF8A 4F3TA 1B9FA 4LD0A 3LPTA 3DYAA 3L3UA 3U6FA 4CIGA 1UOCA 1C1AA 1KLMA 1NK0A 3AO3A 3HP9A 2BIVA 4CRIA 2PQWA 1FKOA 4CERA 2XHBA 2GBZA 4H4OA 1OZ2A 3ZSYA 2FBVA 3UT1A 3NTHA 4G1QA 4CEBA 4CF9A 1JLFA 2B5JA 4IUPA 4CHOA 3P83D 3MAQA 1RTDA 4FCYA 4GY5A 3ZCMA 4AHVA 2YHAA 4W5NA 4FXDA 3HK2A 3SUOA 1NJXA 4J2AA 1VSEA 4CGFA 4E1MA 2YKNA 4F3OA 3OMCA 4FJNA 3ME9A 1A5XA 5KE3A 3QERA 2DFFA 3LAMA 4O0JA 2PYJA 1J9AA 3ISNC 4DFJA 1RTJA 1D5AA 4FK2A 3D45A 4CHNA 4C5IA 3JSMA 2LCCA 3CG7A 4KHQA 2LTOA 3NF9A 1EKEA 1KVAA 4E7LA 3RR7A 3NGYA 1RBRA 4ELUA 1LWFA 2IAJA 2HNDA 3OYBA 1BIZA 5EU7A 4FZZA 3I0SA 1KVBA 1ZBFA 3S6WA 2DFHA 3VQCA 3FLGA 5I3UA 3IAYA 3SYZA 5FDLA 2YNGA 4LH5A 4M42A 2OPRA 1WLJA 4JRPA 3LWMA 3M8SA 3DB4A 3SV3A 1U4BA 1XWLA 3TAPA 1VSHA 1N6QA 3M9QA 3NHGA 2DTUA 3QNNA 1TAQA 5J2PA 4WE1A 4DTPA 1C6VA 3QLHA 3P1GA 4YNQA 4GMJB 2KZZA 3LYIA 5T7BA 4OKEA 1YT3A 4KPYA 3M8QA 4Q5VA 4CJSA 2QKKA 4IUVA 2D9TA 2DIQA 4I9LA 4FU6A 5CYQA 4OVAA 5KTQA 4FJGA 3DLBA 3HO1A 4N4IA 1HYZA 4CGJA 1NJZA 1TL1A 1JL2A 4M3WA 4H8KA 3ZEHA 1XHZA 2RJEA 4DQIA 3RMAA 3QJ6A 4CJWA 4H4MA 3AA4A 3HPOA 4IUUA 5J26A 4DTNA 1L5UA 2G8VA 3META 3F9KA 4FZYA 2A1RA 3FFIA 1RILA 3CEYA 3HVTA 3NGZA 1NK4A 2ATQA 4OVLA 3QESA 2RI2A 1KFSA 3V9SA 3DLKA 1UA1A 3MEAA 4W5RA 3DLHA 4CJ5A 4DLEA 1LV5A 1LW0A 1QQCA 3UIQA 4B3OA 3TANA 3V1QA 4KB1A 1S6QA 5CZ1A 3MXMA 4R5PA 2X4XA 3C4SA 1U04A 3QIPA 3EY1A 3LP3A 5C42A 4PL6A 2X6NA 2X6SA 3BDLA 2ZE2A 1B92A 4MFBA 4JS5A 3V1RA 3AO1A 3S3MA 3M8PA 4O55A 3T3FA 1NK6A 4OLBA 2XY8A 2WONA 4AHRA 4FM1A 4Y1DA 2D0AA 4Q0BA 1BL3A 3VQ4A 1F21A 4QOZB 2IC3A 1A5VA 3RMCA 3L2VA 4CEQA 3TARA 3LAKA 3KD5E 1SV5A 4OLAA 1HJRA 2G8KA 3MECA 2YKMA 4M3XA 1WJSA 2VG6A 1LWEA 1SSFA 1VSJA 2WACA 3SUPA 1IH7A 2X78A 3RTVA 2FBYA 5D3GA 4IUQA 4CJVA 4FJHA 4J2DA 4PLLA 4FLTA 2I5JA 3ZT4A 3QETA 5J2QA 3KLGA 1LW2A 1S6PA 3ZT1A 2G8HA 3Q1JA 4HHTA 4KKOA 3CQ8A 4AHTA 3OYDA 2R5AA 3KUFA 2P5OA 1BGXT 3VQBA 1KLNA 1JLQA 1ZBUA 3L42A 3LALA 4CEEA 4BE0A 1Q9YA 1GOCA 2RJFA 2LSNA 4LH4A 3U3GA 4FLUA 4CF2A 4QCLA 1WSIA 3LGLA 2GV9A 3NDKA 3THVA 4ZTFA 3MXIA 4JRQA 3LZIA 4BWJA 2D5RA 3AA3A 1VRUA 5HROA 3TABA 3OYGA 2P1JA 2R57A 3AA2A 2M16A 4JLHA 2BE2A 3O3FA 3ZSWA 1S9GA 3ULDA 3ZSZA 1NK8A 1GOAA 4W5OA 1FKPA 2FHDA 4FM0A 2ZQBA 1NKBA 1HQEA 3K59A 4E7IA 2Z1HA 3PO5A 4KREA 5HP1A 2HHSA 2P0KA 4DLGA 3F73A 4NS5A 4B9WA 3E01A 3QEWA 3KIOA 1SL1A 3E9FA 2B4JA 4I9QA 3HP6A 4CK2A 4CJFA 4E7KA 2OZSA 1YVUA 4M3RA 4CFCA 1T03A 3BDPA 1BQMA 4RG8A 4FJIA 2Z1GA 2M1HA 3L2WA 3P8DA 4O4GA 4KTZA 4CF1A 4M3YA 1HNVA 4K8ZA 1J5OA 2G8WA 4DSKA 4DTJA 4K8XA 4FLXA 2RHUA 3AVNA 3SQ1A 4NCBA 3QEVA 3DLEA 4DU4A 5FROA 2R5MA 3WNHA 4AHUA 4CFAA 4DQQA 3C94A 3SUQA 4HUEA 4L8RB 4A4HA 1C0UA 3LP2A 3AVLA 4Z4FA 3ZSRA 3VQ5A 5HRNA 4C8KA 4QVZA 1NK9A 3LP0A 1SKSA 3AO4A 1WN7A 4GVMA 2LVMA 4J2EA 1FK9A 4CHQA 2JGUA 1SUQA 2JLEA 3OYNA 4B08A 3AVCA 4OGEA 4CEFA 2HHWA 5KRTA 4DFMA 2GFUA 3C95A 4B8CA 2PZSA 4DQRA 1Z26A 1TKXA 1RDCA 2F8TA 3NNQA 1D8YA 3K58A 1ZBIA 4W5QA 3K5NA 3QNOA 4IG3A 2F8SA 4ZTJA 3AVKA 3DRPA 1VSLA 1WSFA 2G3RA 4E89A 5CY4A 1I3AA 3WNGA 4AH9A 4X34A 3SQ4A 2A1SA 1XI1A 4N5SA 1BQNA 4LD6A 4EZ6A 1ASVA 4B9UA 4RG2A 4IFVA 1C1CA 4E7JA
chains in the Genus database with same CATH superfamily
2A6AA 5GANh 3LQQA 2NNWA 3SNNA 2BDPA 3GCMA 1TKDA 4CJKA 2HHQA 2EW3A 3WTUC 4IUTA 1NOYA 3ZT2A 4XNFA 5I21A 5AQWA 1PD1A 3DTIA 1S3XA 3O1WA 4XQ3A 4PY5A 4XTZA 1G3WA 3NAEA 1NEBA 3C2GA 3VF4A 5LJ5j 2KXCA 3K0SA 2WC9A 1L3UA 1U2VA 4HNTA 3SFMA 2QSFX 2HB5A 4YEJA 4S05A 4KBMB 2DVEA 5IPAA 4C92A 4FLYA 1I1GA 3SK3A 1NJYA 4D5FA 1BA5A 1ZUKA 1NK5A 4KFCA 2QKBA 3F5TA 4XONA 3REOA 1J5YA 2F2EA 2B8AA 3R8EA 5M3MJ 1WFWA 1SANA 1U2VB 4CZIA 4HQMA 2R92J 4JZ4A 3DLMA 1OJLA 3T9NA 3K2PA 2KQ2A 4NCGA 2JTVA 2VCPA 4C92B 3K1PA 3OWTA 3CDIA 4HSTA 4I99C 5C44J 2R7ZJ 5GADP 1S1VA 2LP0A 1RKTA 1TAUA 3E5UA 3I55Q 3M0RA 3PQJA 1E4GT 2DD4A 4E19A 2VGNA 4JKDA 2LJ3A 3KKSA 4HA8A 1IB8A 2Z2SB 2GQVA 4F17A 3AVAA 3MKZA 3LANA 3ULQB 3GTMJ 4BU2A 1KQ1A 1ASWA 5DM7L 2OD5A 2NOIA 4DTUA 2FRWA 3OA6A 2VBXA 5GPAA 3U3YA 1R0CB 4IURA 3EFOA 2CP7A 4G7OF 2A69F 2G0EA 4KH6A 1NLOC 1EETA 4XLCA 3CQTA 3C18A 3O80A 5A2QK 5HCKA 5LRSA 3BGRA 2KISA 1WH7A 4C8OA 4DWIA 1QCFA 4M7AC 4BH9A 3HRTA 4Y91A 1UB9A 4CBWA 1NGFA 2ZAEA 2EYWA 2FC0A 3I55I 3FEOA 2OF7A 3IHUA 5I11A 3H5AA 1OH7A 1SZ2A 3RVCA 4MO5A 1IO2A 2MC3A 3MEDA 2ECBA 3P8HA 1T6DA 3U1DA 2EB7A 3LSKA 1OPKA 2CZ0B 1EIFA 4LF7K 2DI3A 1YJ9Q 2VWKA 2EX3A 3V9UA 1TNTA 3F0CA 1K4US 4QLCU 2D8HA 2DZ9A 4RMOA 2L0KA 4X62K 1YWOA 5K7FA 4EP4A 1KZHA 5D5XB 3TEEA 2QEXT 5A0DA 4C5EA 1B4AA 4YG2F 2EH3A 1ZSZA 3S32A 4PGGA 1WJQA 3PIPL 2D0NA 4KUMA 3TW7A 1GLNA 3CCSQ 3O6BB 3GWZA 3MQ0A 1YHQA 2JUGA 4A6DA 2K3XA 3OYHA 4BXUA 1K8AO 5GANg 3M1EA 4EQQA 2O8DA 3DQVC 2E3IA 3DOLA 2HF3A 4IKFA 3HOXJ 5L3CA 1ZSZB 1YJ9I 2RM4A 1N78A 3K70C 1JXOA 4JI0K 1PG5B 2F2WA 2CMPA 3GBQA 3A98A 3OR1C 1XNRK 1MUZA 2CUEA 1Q82R 5ICFA 5FU6C 1AHJB 1VQPT 3BR0A 3LX7A 3K0LA 3PO3J 4AIAA 2O8DB 3V42A 4PQUA 4CICA 4KHSA 4DQSA 3QUIA 1HBXG 2WFBA 1AKHA 3BZ6A 3ZSVA 3OS1A 2DBBA 5LHHA 2W48A 1NHAA 3H3OB 2DBKA 3CCSI 5JLXA 4BKXA 2DK8A 3H3ZA 1L0OC 4A54A 3HSRA 2QI2A 4KGZB 3MMYB 1D1BA 4X66K 4CC4B 5CZ2A 1RZ4A 4GDFA 3O9UA 3CCRA 2ROLA 4RB1A 1VQOI 3TQNA 4C92D 4BNCA 3I0WA 3BF3A 4J83A 3VQEA 2HVHA 1N77A 2VBWA 2Z1DA 2KRCA 2YXYA 2OAWA 4UY8O 4IF4A 5BQTA 5IT9Z 2EFIA 1Y56A 3FJPA 2LF8A 2RHYA 2AZVA 1OPCA 2XSJC 4OWRB 4I7FA 1CZAN 3CJCA 3SZGA 1VQ9I 3J7YJ 4GW6A 4LSLA 5C0MA 4F7ZA 1JXMA 3M6GA 4CGGA 3A5MC 5F6FA 5HDNA 4HW0A 4J5YA 4A53A 4PK4A 2IA2A 3QPSA 4DUZK 2VWFA 1HQUA 5FRMA 2Y1JA 3EG9A 2M0MA 1B9DA 3N4QA 3AG4H 4R0KA 2KT0A 1WJEA 3PFYA 2FPEA 1ZGWA 2IS4A 2CZ7B 5C6SA 1I4K1 1U9NA 5HY6A 3BWGA 1BJAA 3KJVA 2K9MA 1YX3A 3UWNA 1GOBA 2OZUA 4KHWA 5IYCJ 1NKCA 4HG2A 4XOTA 1U06A 1TG0A 2L7KA 4MQ3A 3IMXA 3DLRA 5F0CA 1KA8A 3QEXA 3I4PA 2FU4A 4I2PA 1FMVA 1V5EA 3J81E 1TL8A 3RMSA 2I2LA 5ED4A 4F7UA 2WOMA 3ID6A 5B8HA 2YG8A 1YI2T 2LKPA 4XIUA 4H03B 2RN2A 4K11A 3K70D 2CU7A 4S0HB 2RHIA 4FSXA 4QPQA 4ID5A 4A3CJ 3CD6I 2HQEA 1K73R 2JK3A 2P5GA 1QZ5A 1UE9A 2VXZA 3D2FB 3I5SA 5FLXO 3LLRA 3VYUB 4F7UB 3KLIA 5KCOA 2ELHA 5AQJA 3C2HA 1XSDA 3MKDA 2DXUA 2UWMA 4FLVA 2GTJA 4HVWA 1R0BG 2R58A 2FF4A 4F7UF 3A0IX 3HT3A 1R36A 1UB4A 4QQ6A 4AG1C 3WNFA 3TP0A 1JCGA 3TAMA 4G12A 2RQVA 2VI6A 3VA0A 2VJJA 3KYCB 4PA1A 5E8IA 3RR6A 1K0XA 3KLOA 1WXBA 2KGTA 2NLXA 2D1HA 2BYVE 2NUZA 1F36A 4JKFA 1OYWA 2FF6A 3FHZA 2ATCB 3KLFA 1IV8A 2UXXA 3HTUA 1KG1A 3KKRA 2CT3A 1RBTA 5KH6A 3M54A 4YFNF 1Q82O 2L89A 1AWXA 1G3TA 1SHFA 3JB9H 2W10A 5J2MA 2OTLN 2GBQA 5AQTA 3QRFF 2CZ1B 2E5QA 1FXXA 4AVPA 1LCKA 4Q5SF 5LD2C 2MWOA 5CR2A 1BISA 3I33A 3PM1A 5CYMA 4ELVA 3HKZN 2LRQA 1U3EM 1LJ9A 4NDLA 4X64K 5HLIA 3CC4Q 3ABKH 5L8RE 3ALYA 5CO7A 3LSPA 1B1BA 1DU6A 3H36A 3IC7A 4GRIA 1OQKA 2XSDC 2ABKA 2FRYA 2BBYA 2BTTA 2DA1A 2BHZA 4I7HA 3E1YA 3PIOA 5M1QA 2DA3A 2XY7A 2HF4A 2J06A 3CLOA 1ON1A 5KAIC 2AP1A 4XIDA 5DV5A 1VQLT 1HPZA 1WLPB 4DU3A 5BRHA 2E7WA 3CWAA 1KFDA 4XLPF 3F22A 3W6JB 2DMPA 4ZH4F 3IRQA 2JPCA 1HF0A 1V54H 2HPIA 2B0LA 4AVZA 2OX7A 2AXTC 2PNIA 4JI8K 1KQ2A 5BREA 1Y96A 3LDOA 3SD4A 3OTOK 1PNJA 3PIOF 4MEYF 4RW6A 2PEXA 4B9MA 1LB2A 1ACIA 1QQOA 5AQUA 3LQRA 3VF6A 4DSJA 4P5OA 2Z1IA 2QWPA 4O5FA 4YHHK 4YTLA 3VF2A 4BB7A 4DF4A 1RNHA 1E4FT 3QYEA 1Y96B 2RPNA 3I4NJ 2X48A 4MZTA 4DFPA 2JOYA 1O1WA 3MCZA 3OIOA 1XS9A 3BCBA 1VA7A 4PDKA 1HMVA 2HBKA 5GAOn 4EZ9A 4BY9C 5GAOr 2R7YA 3HTVA 1YBYA 2RJDA 5AIQA 3FK6A 1O75A 1JJ2S 1L3VA 5KVRA 2ESNA 2CREA 1R5HA 3KK1A 1K73O 4PLIA 1VF9A 1MJBA 3G6EA 1PP8F 4G7HF 1Y97A 5KN9A 1JUSA 3JCMd 3HRUA 4JX4A 4FJKA 1OOTA 1HR0K 1VQNN 4YIIA 3PO4A 2K5CA 4OPAA 4CXFA 2VLAA 2HDAA 3NF8A 2GWRA 3G4SQ 5M1PA 4UC4A 4I2OA 1HLUA 1U48A 1K1ZA 4IOAF 1PKTA 2HYJA 5EVZA 2BGGA 3HSTB 5LHGA 3MEVA 3M9AA 3CJ1A 1NKEA 4HDUA 2L8DA 2P7VB 3L2QA 4CZKA 3DB3A 1AOYA 5FWCA 1F9NA 1AWCA 2HQAA 3DBRB 1JLBA 3P4IA 3C7JA 2XU8A 3QINA 2CGKA 1KONA 2DKGA 3GMEA 2KIUA 1KG2A 1ITGA 3NF7A 4N47A 3O8MA 5B1AH 2V1UA 2DT6A 1FTTA 1RI0A 3BQYA 1U1TA 3G4SI 2VVKA 2CRGA 3EUKL 3PNYA 1OU8A 4BRMA 2MG4A 2EWNA 1U0JA 1H9GA 1I50J 1R59O 3KFWX 1IXDA 3CI5A 3CTAA 1JLAA 3CIPA 4L6V5 3VS3A 1QVFP 1M90U 1X1PA 2XDVA 1YJNN 1UA0A 4CCLA 5K7ZA 1QZEA 4AFSC 1WDXA 2E20A 2BKDN 2QA4N 5SWMA 5D6YA 2HDCA 4KI4A 4E6KG 2QGUA 3J7AF 3VYSB 3IKVA 2CQNA 4CJ4A 4OPKA 3ZQLA 4A6EA 1XTDA 4LN2A 4OJRA 1KFZA 2CQKA 3AHUA 2IT0A 1QTMA 2VPRA 4A2BA 3FWEA 1MDUB 4CCNA 1L3LA 3M56A 1ARKA 1VQ5Q 2KL4A 2KTQA 3EHQA 3V8JA 2FEIA 5E1ZB 4QS9A 2ZM6K 5D7UA 1WZOA 4HEA2 4J9GA 1U78A 5GINA 1VQOA 2NS8A 3CMAQ 1KC8R 4YOVA 1TH7A 3VQAA 4NBQA 1FOKA 4LD5A 4U7DA 4DEXA 2E1MC 3VA3A 1R1UA 1UGVA 4IDKA 4JPBW 2GUIA 2PQ8A 4RTUA 5FKLA 1J7KA 2YJFA 3OYMA 2YHYA 3VSLA 4WXCA 2PUKB 1GXPA 4J9DA 1UECA 1VQ9A 3VTIA 3V9WA 4IJNA 3HYIA 2ESHA 1QVUA 2A05A 5K14A 4UHTA 2ZPFB 5IY5H 1S1TA 2AA4A 1VQ5I 1QP3A 2FZCB 4A63B 1YYVA 1NKUA 3K4LA 3TOBA 3L00A 4GXOA 1KQ8A 1LUJB 2E4LA 2KFZA 4PFPA 2XUBA 3CMAI 4CI6A 2DXIA 4D8KA 2OCEA 1VIEA 1WGSA 2EQJA 5CVJA 2ELJA 1SVMA 5KNLA 4QQGA 5I9EB 1SMTA 1IN5A 3THWA 4MMLA 4XU3A 1NGDA 3QU3A 2P9NB 4H0TB 4L5JA 4QAGA 3EQLF 1RT4A 5DM7R 3OYCA 2IIRA 2DTRA 3PIPA 3P9IA 5HRPA 3X26B 1EA3A 2DPPB 2X9DA 4PUSA 4PFZA 5CQGA 2LY9A 2NAZA 3THWB 2B63J 1NGBA 4ZDPA 2ZJRF 2HTJA 3LA2A 2AQEA 1VQ6Q 4PKCC 3SCXA 2XHIA 2MABA 3X2QH 4DBFA 3EG3A 2JJ7A 3CD6A 4FLWA 3N97A 1YQMA 2X74A 2P9PB 2V7ZA 4CJRA 4FWSA 2HQNA 3VEYA 1POGA 4CEDA 1X3NA 1D9FA 1XGMA 1VQ8N 1S8NA 1A04A 4WXDA 3T19A 1IJJA 4LF4K 3OIPA 3W3DA 1YXQA 5JVTA 3CMEQ 1KAZA 3TP3A 4BGBA 4HBLA 3U1KA 3OL4A 3D5LA 3SZTA 1VFCA 2RK2A 3PFSA 5IOYA 2XRIA 5KPZA 4FTHA 2DM1A 3GLLA 3VQ8A 2OQRA 5D5VB 3WVDB 2D0BA 3OS0A 4DV0K 5LGUA 5LEKA 1PM3A 2C06A 5TKYA 4GVEA 2FNPA 3RQ4A 2MMPA 4JNEA 3HRSA 3UA6A 1QS4A 5D6WA 1XUPO 1R0AA 2PMZA 1TYQA 4O0IA 3QXEB 1Y71A 5EC7A 1XHXA 3WTVC 1P7JA 3FC3A 4MIMA 3IRRA 5C10A 5D6XA 1UAXA 4M4ZA 3CCVQ 1YTUA 3I59A 3ZPLA 3OBYA 4AYBA 3CMEI 5I42A 2GLOA 3QJYA 4CGDA 4WCIA 2L3QA 4DU1A 2VJ5A 4AT1B 1GLCG 2ZNZA 2YNIA 3H5RA 3VN5A 5LJ3e 3CPWP 2HMPA 1O4XA 3I9QA 3CXCM 1YLFA 3AV9A 4NXMK 4Y15A 3AG2H 3JRBA 2XF7A 1NK7A 1ZQ1A 4XQFA 2V1DA 1JO8A 2DOFA 1KC8O 5TJJA 2RD1A 2XHCA 5BN9A 1H641 5GAHP 2P7CB 4O8KA 1M5Q1 5FKKA 2A6EF 2VT2A 1YHQT 2YX7A 2BHYA 1XCBA 2ENMA 4AFQC 1HYSA 5GMKj 5GANe 9ATCB 2KQRA 1IUYA 2FMLA 3IP4B 2ED0A 2CKKA 4C3JJ 1K9MR 1KIKA 3S41A 4M3DA 1TTYA 5J3BA 5CVRA 2KRNA 4OP0A 2QW9A 1VK0A 1FJGK 5KYNA 5HNFA 4FK0A 4FX4A 5L3EA 4E7ZA 4EGYA 1BI0A 2E19A 5HLFA 3HPGA 1RT1A 3K5MA 3S1RJ 4MDWA 1U5TC 4CD1A 2YUQA 4M78C 2CP5A 2FZKB 4Y13A 1SHGA 3AVMA 2L3PA 3HL2A 3FDRA 4C5HA 1VSKA 2LVSA 4CFBA 4CJQA 2LSOA 1G3SA 3VS7A 3CCEN 4PJOA 1P7MA 4FWMA 1VQ4A 2DTHA 1HXDA 3BG6A 4LD0A 3LPTA 3DYAA 3L3UA 3Q5FA 1UFMA 3CCRT 3RTRA 3TO6A 3HSFA 4B8XA 1D3BB 3HOVJ 1BA1A 4C0ZA 3JCUC 2WB1N 1KLMA 1U1SA 4M7AE 1I94K 2HKXA 2EJRA 2XRLA 1FKOA 3FZLA 1W4SA 3L4IA 3IFRA 1YP5A 4PJOB 3LAPA 3CLQA 2D6FA 2RKHA 1OZ2A 2MK5A 3DLAA 5CKFA 5BNGA 2FBVA 3UT1A 4CEBA 2ME6A 4BC2A 4CF9A 1JGSA 4IUPA 1H9TA 3CETA 2D0OA 2NVQJ 2QK0A 5M1OA 1NPRA 5IT9E 2YHAA 4W5NA 4K42A 3KE2A 1N8RC 4KIFA 1YJWI 1B9NA 4BY7J 1VSEA 1Q81U 2LOOA 3HM5A 3UPUA 5KPRA 3J7AY 1YCSB 1Q86R 3H0FA 1W7AA 3JTGA 1XMQK 3OMYA 2EZHA 1TW3A 3CW7A 2FYKA 3LAMA 2PYJA 2Y75A 3CPFA 2ECCA 3W2VA 4OB2B 1UHFA 2MF2A 4M3FA 4ME7A 3CJNA 4C5IA 3T7ZA 3JSMA 3HFOA 2M8EA 1JJ6C 5BR8K 4KHQA 2HKNA 2QM3A 2KKOA 4IO9L 3WEEB 2R7VA 2NOBA 5TRDA 2ACJA 3LW5E 4DEYA 3OW2S 3A8OB 3FZHA 2HR3A 4M9ZA 3OYBA 1BIZA 5EU7A 2BE9B 1LMZA 5HKCA 1KVBA 4B3AA 2H27A 5EDNA 2DFHA 2BZYA 1X6OA 3SYZA 2YNGA 4M7AB 3LSHA 5AQIA 4F7UG 3DXJF 3OOUA 2KIFA 2XASA 2HI3A 3A8YA 4JRPA 1NM1A 1M9SA 1XQPA 1Q7YU 2VV5A 4M7AF 3I5UA 1QVFA 3DB4A 5AONA 2ZXHA 3SV3A 4KICA 4G6DA 1RRSA 1TAQA 1FIPA 2DK5A 4EJOA 2CH0A 1C6VA 4R56A 3QLHA 4N9IA 3RERA 4C2UA 1XDUA 1APLC 4D0PA 2E3HA 3KXTA 1W0UA 1JT6A 2F1LA 3QG1A 4PJ0C 3EFRA 5EEAA 4DGWB 4BRGA 4IRGA 5C15A 1E2XA 1R5GA 1T56A 4J8FA 5D8LB 5B3SH 1PP7U 3M8FA 2V9PA 3VOEA 2QWQA 4Y0WA 3DWLE 4OVAA 1E17A 2A6TA 1AOJA 2K2MA 4N4IA 4BS9A 1TL1A 1JL2A 2FOKA 2D5VA 3UKUA 5GIPA 3ZMVA 4A3DJ 2RJEA 3RMAA 2M45A 3HZJA 1UGRB 3TO9A 4MDXA 4FT8A 4XTWA 4AMCA 4DTNA 2JW4A 4M6YA 1ZLKA 3FFIA 5GAMj 5AQZA 4E9GA 4CZJA 3CEYA 2VODA 1KU3A 2LY1A 3FKJA 3UKUB 4BRNA 2EZLA 3V9SA 3DLKA 2TCTA 1BK2A 2O01E 4KT5C 5D4RA 1BN5A 2OU2A 4ELYC 4CJ5A 2K40A 3UKGA 5EG0A 4PJOD 3EFSA 5GJWB 2H6BA 3H46O 5IHIA 4JKAA 4XRSG 2F4IA 3AL0C 2LKSA 4M9SA 3BY5A 1YIJN 1OH8A 4B3OA 2NOEA 1Z1DA 1JHHA 4PGHA 3DU6A 3N5BB 5CZ1A 2HFHA 4IIMA 3MXMA 5GAN7 4R5PA 1ZA2B 3C4SA 5EG0B 5IP9J 2QXLA 3CC2Q 3O8HA 2X6NA 3BDLA 5ELZA 5LJWA 3SEZA 1IGNA 4UB6C 1B92A 4C3HJ 1QW1A 1LVKA 1Q86O 2P9LA 3K4BA 1HA8A 1F5TA 2AKLA 2ETHA 4OAYA 4M77A 4CSWA 2CSIA 3KP5A 3G71Q 1BL3A 2VC0A 4F16A 4W1UA 3K9TA 3IH4A 4J8OA 3T5XA 1S3JA 3RMCA 4CEQA 3TARA 3FSPA 2F5TX 3K4CA 5LY3A 5DTDA 3H9NA 4E4HA 4HXJA 3SLCA 2P9LB 3EPZA 4M77B 3AARA 2W1OA 2Z99A 5GP9A 3VS1A 1LWEA 2CW8A 1XGOA 1VQNQ 3DV8A 2WACA 5H6QA 3SBTA 3SUPA 2X78A 3OBWA 4II3A 2B86A 2UV1A 2HQHA 1SD6A 1OCZH 2O2OA 1IW7F 4J2DA 4PLLA 3JCMW 3QP5A 4IHXA 3CCMQ 4AI5A 3S93A 4JI6K 1KQSS 4PL8A 5IOZA 3G6ET 3ZT4A 4DR5K 5H20A 1USSA 1QU3A 4HSBA 3FRNA 1Q18A 1UUEA 2MAMA 5FPMA 2R5AA 1OVYA 4LB5A 2IGNA 4XH4A 3RDIA 3GG4A 3QU6A 1T3LA 1Y1VJ 1P4XA 2M2EA 5JMVA 3L42A 5DCMA 3LALA 4CEEA 1IHWA 4BG8A 4KH0B 4BE0A 1Q9YA 1TQIA 1GOCA 2RJFA 2DERA 2ICWG 3CJAA 4CF2A 1WSIA 3VYRB 1Z91A 1MNDA 5B5EC 3P31A 2R0QC 1K4SA 4K0KK 3K1MA 1NNEA 2QWMA 1D1CA 4KYWA 2Y9YA 2VBYA 2NXNB 2NYXA 1QRYA 2D5RA 3AA3A 3TABA 3CPWA 2R57A 3AA2A 1KD1C 4ZYHA 2CP0A 2O8XA 1XD7A 2V51B 1E0EA 1WHMA 4NUBA 4FYXB 2EVRA 3ZSZA 5JVGL 1TQPA 1FKPA 5J1YA 3C6HA 4MMKA 5IT9O 4B6MA 1Y0MA 2A37A 2Z1HA 4BHCA 2YI1A 3PO5A 4KREA 2GUPA 5HP1A 2WAQA 2HHSA 4OOIA 1D3YA 1GUUA 3A8HB 4CBXA 4DLGA 3F73A 2JZYA 2COWA 3VWBA 4H0PA 4B9WA 1ZC6A 2FF3B 1SL1A 1X4PA 3HP6A 4TVRA 4CK2A 1VQKA 4M7DC 1FBUA 4IZZA 1HKBA 4KHPK 1ZBJA 3KZIC 1T03A 3BDPA 1Q7YC 4RG8A 2STWA 3VS6A 3H3UA 2VQFK 2HBJA 1T6CA 4UNFA 1V76A 3J7ZI 1ORKA 2QBYA 4EAHD 4DSKA 2STTA 2PJRA 2X4HA 2JUCA 2P5VA 2K9QA 1VQOT 4PJJA 3R6MA 4Y52J 2I7NA 1A6IA 2O9LA 4NCBA 5IT3A 2NOLA 4B3RK 2LKXA 4DOWA 4YORA 2ESWA 1WJDA 4DQQA 2FA5A 2E6ZA 2YS9A 4HUEA 1GLLO 3LSMA 4L8RB 4LOCA 1TW2A 1ETWA 4RGXA 2OTJN 3LP2A 2PJRB 1X1DA 4A12A 1VQ9T 4Z4FA 3A5ZB 5HRNA 4C8KA 3IV5A 4QVZA 5DM6L 4WQ5A 4I02A 4CCOA 3F10A 2GTDA 3Q0VA 2NVXJ 1Z9CA 2MOXA 2YDLA 2ITMA 2JRMA 1WN7A 4ZGJB 3BTJA 1YJWA 2ZJPL 2QZ8A 2NRWA 2ABLA 1RADB 2Y0MA 4E7SA 2JLEA 1J0RA 4RTVA 1MSEC 4B08A 1KQ9A 3VB2A 3I8BA 4CEFA 1PU6A 4QT7A 4OO1J 1HCRA 2GFUA 2F7TA 2YHXA 3FZKA 3QOEA 1X27A 2OV7A 3FJ5A 1RDCA 3NNQA 5EG2A 5IP6A 2E2OA 4FOEA 3FXKA 1Y1WJ 4BC4A 1AA7A 3GBTA 2IS2A 4OIOF 3IH2A 3DRPA 3QFUA 2CP6A 3EG1A 4EJYA 2G3RA 4E89A 4AH9A 3JREA 1V4RA 4UVAA 4X34A 1XNQK 4N0BA 2W0ZA 1ULYA 4LD6A 2QEXQ 3IH3A 3WU2C 4IFVA 4C0GA 4BQAA 3M59A 1S22A 3CD6T 4FIBA 3KLEA 1IXRC 4JYKA 3DEUA 1DDNA 2JM8A 4LIVA 1ZBXA 2BTFA 4WK8F 3PVQA 4KMFA 3VENA 4HAMA 4MGRA 3G3ZA 2DO3A 2PU9B 2V1RA 1R71A 5HS7A 4RW7A 4FWRA 4YFUA 1KQ0A 4O5BA 4BVPA 2JT1A 5FFZA 2NOFA 2HQXA 3HDDA 2XY6A 1Y8QB 2YV0X 1QPIA 1QVGS 1JKHA 4CE9A 5GAEP 1YG2A 3SEMA 1QCOA 2DAOA 4IJAA 1BI3A 1S72I 4C3IJ 1VYTA 1XMXA 1YHQN 1T0HA 1VQPQ 1N25A 4BR7A 5DS9A 2OQGA 2DL4A 2EKOA 4IEIA 1JI8A 3E6DA 4U0WA 2E1CA 1EF4A 2HEQA 2E71A 4FYVB 5CAIA 4YFXF 3PQKA 4IG0A 3GFMA 5BPIA 1CQTA 1T0FC 1VQ7I 1DGKN 4E47A 2YG9A 4U0VA 1JLGA 3OB9A 2CGLA 3MCAB 4EMHA 1ORNA 3KP4A 5FLXK 3GOIA 2W4SA 1X3ZB 4WQ4C 2ZD1A 1MZBA 2K9NA 3INZA 1W97L 2B9SA 2FBIA 3CDHA 1D1AA 1JKOC 5B1BH 3KHYA 5D6FA 2HHUA 4FOIA 3WE2A 4IOCF 1AHDP 4ZNXA 1VQPI 1KEAA 2NLUA 3V9XA 1RPWA 1GXIE 2EQUA 2UUBK 1X01A 2EBPA 5BS6A 2R5YA 4F14A 4FX0A 4BL0B 5FW9A 3PV8A 2E88A 2EQRA 2YCHA 2E1ZA 3OSVA 3MP6A 3CCQI 1KRPA 4CIEA 3M4GA 3VQDA 3K4MA 1X3WB 3CCUN 2R5YB 3JCMP 4C2TA 1M3CA 5AZJA 2K7LA 1VSMA 2R7WA 4MDBA 3ZMSA 3CCJN 3M55A 3HHGA 2PFUA 4A5BA 1IF1A 3I56A 3L2RA 1YS6A 2FSJA 1S7AA 2KW4A 2V1XA 3S9HA 2VQGA 5AZJB 1WEGA 4M41A 4J00A 3T1AA 1ZBHA 1LPLA 3K4KA 1YI2Q 1VQ4T 2HSTA 2EIKH 4IO9F 2H56A 1ZRDA 3IG1A 4KUIA 2DN0A 2L7ZA 4NYNA 1JJ2M 5F0XA 1YOVB 1WB9A 2LH9A 2F5VA 5C4JJ 3DFGA 4GV3A 2HQ5A 2W41A 2G9WA 4ISGA 3CC7N 4JI3K 2D45A 2YU9J 1XB4A 5LRRA 1BU1A 4QWQA 1ZAOA 2QKMB 1KCFA 3HJEA 3D2EA 4OMPA 1U84A 3L3VA 3IAS2 4LSNA 5JLWA 1RCHA 1IRFA 1FZPB 1I3QJ 3MZYA 5E84A 4DCHA 2JN6A 1HNXK 4ABZA 3EE8A 3OMGA 1K61A 5L23A 4IRIA 1IN4A 1XG1A 4IHWA 3D0PA 2PN6A 4IFEA 1NK2P 4AWXB 2PVOB 1T95A 3RWUA 2E1OA 1DP7P 1YI2I 3WTZA 1SD4A 1X3UA 4I2QA 1ODDA 3DTEA 3R6NA 1C0MA 4YRVA 1UJYA 1S1XA 3ZSQA 1NM7A 4N4HA 1RDBA 1XC5A 1SEMA 3G0ZA 2DTZA 3GPLA 3NBPA 5JHUA 3BE3A 2PY5A 2VB6A 4RKUE 4CW7B 4E7HA 4H4KC 1MJ9A 3KEOA 1YQAA 2YR2A 4XK8E 3WHCA 3LM9A 3S3NA 1T3SA 3U9DA 3CUQA 4C0DC 3CCLT 4IEEA 3IWFA 2QQSA 4JHDA 3S1MJ 4HVJA 3JAMO 2JPBA 5SZTA 2P5LC 3BZKA 1ZYQA 2ZCWA 2JMCA 5J3LA 5H6RA 1VQMN 3AG3H 2QDLA 2YHBA 4RWTA 3BCAA 4HV6A 1M1KU 1TP4A 2K3YA 4OGCA 2JMWA 4E0DA 1KGSA 3BDUA 1RT6A 3O4WA 1OKRA 3M07A 3J80Z 4M7AG 3CO6C 3CUQB 5J6XA 2ZJ2A 2L7MP 1WSGA 2BANA 1RT3A 4M78E 4JHDB 4NOYA 1H3HA 2NWMA 5LJ5h 2GA2A 2R7XA 2DXCA 2DYBA 2AZSA 2P9IA 1VSFA 1VQLQ 3BJOA 3KK3A 2GCXA 5LMNK 2GM4A 3CF5L 1T7PA 1LEBA 1Q9XA 3N0UA 1ORPA 1U8RA 1D9DA 5ILUA 5J1RA 4BE1A 2R3SA 4A3FJ 3VUZA 2XAUA 4BHBA 4CF8A 1OI1A 4J7IA 2KYBA 4ZYEA 2CJJA 1QE1A 2P9IB 3SZ2A 3B8AX 2H3JA 1S7OA 2MLGA 2MD5A 4LF9K 2DTIA 2EZKA 1IKXA 1YW8A 3C0BA 1I6HJ 5FU7C 4KUDK 3L2UA 1KAYA 3RNJA 5KCHA 2E60A 5EZGA 2VG5A 3ULEA 4XU0A 4O44A 1C1BA 3WGHA 4JS4A 1SFUA 1VQLI 3FZVA 1FBSA 3O6WA 5C2DA 1TGOA 4LMYA 3KBGA 1HSJA 2NVTJ 5IXFA 4M7XA 1S9HA 2CGPA 4ZGDB 3MAJA 1J54A 3VRZA 3ULEB 4XEIA 5IN1A 3PX0A 1VIFA 4BXXJ 3VGLA 1XJWB 1EXQA 1IJWC 2GWJA 4M72A 3QEPA 4OKKA 2XKOA 1U5TB 1P90A 3VEXA 1Z6TA 2J5PA 5HVQC 4F92B 2XY5A 1WOQA 4RM3A 4GV9A 3ZLJA 1PRLC 2IPQX 2O8KA 4M78F 4RGUA 2YLBA 5GAOp 4ITVA 3TAEA 2IDOA 2YRVA 2XI9A 5DLQE 3CFOA 1KYWA 1BW6A 1PVEA 1SPKA 3CWTA 1K83J 3H8ZA 1J75A 4O3MA 2A40A 2R7RA 2E2HJ 5KRSA 4WTOB 2FPFA 2UZKA 2FL7A 2ZWHA 2XAHA 4BRQA 2MGQA 2A07F 2FBHA 2EGAA 1Y07A 4AHSA 2IP2A 2J6OA 5J1EA 1RBSA 4TV7A 2CQXA 1AU7A 1ZHIA 3NFCA 5KI6A 3I55N 1GDTA 3GW2A 5CKDA 1OLTA 2WY7Q 4B24A 1T33A 1M90R 3TSWA 1ZN2A 2AT1B 3SJMA 4W97A 1BCOA 5E1XA 3CUOA 4Y4RA 2WBMA 1JE8A 2A3ZA 2DXTA 2DY4A 3CF2A 1QQJA 3DEWA 3IWZA 5D5UB 1FYLA 1T44A 3TDZC 2ZMEC 1NG2A 4Z4GA 3I0RA 2A5YB 3QIIA 1M8MA 3I4MJ 2O9SA 2JWTA 2X6WA 4M6XA 4ISFA 1UELB 3H9QA 4Z2YA 1SD5A 1E3PA 2JZ2A 3FBIB 4M3ZA 4KNYA 4RTTA 1NBEB 4C8QC 3G2BA 1ABQA 1N27A 2K85A 1S72A 1PC0A 4DA4A 1OX9A 3GTGJ 1MH3A 3HPHA 2W00A 3O1BA 3SBGA 3HOWJ 5CIUA 2EYYA 1GFDA 2IXSA 1OCTC 5ILSA 3P38A 1YJ9N 2KSSA 5J47A 3BQZA 4B47A 1LNXA 1VQ7A 1D8KA 4N56A 5LJ3d 1JL1A 3LZJA 4Z8AA 2QQ9A 3DF8A 2EBIA 2Z1JA 3ASOH 1V3FA 2FUG2 4H5WA 4RB3C 4AHCA 3ZQQA 3SEQA 1G4DA 3QYGB 2OPSA 4J7FA 4C1NK 2EAYA 3LP1A 1X69A 4YELA 5GAGJ 4IIOA 4KI6A 5GANd 4C5GA 3DP7A 3KTUA 1JXEA 3CCSN 1HQCA 2XICA 1YFHA 1J59A 2DETA 2Q2EA 1KU9A 3H0HA 5E41A 3VESA 1N33K 3OH6A 5HS8A 3JCMh 1M1EB 2DOAA 4BI8B 4A3EJ 5H2FC 1TKZA 2YNFA 5KHDA 3TU5A 2K9LA 4MTEA 2V8JA 3O3HA 2W03A 1X2KA 2BW3B 5DM6F 4LFAK 4PHTX 3EYIA 3A5OC 3CCQA 2Q2EB 2KT8A 4RCHA 3FE1A 3VGMA 4RW4A 2K4YA 4LDUA 1CKAA 3OYIA 1M1KC 4KHNA 4CGHA 2HMAA 1Z9QA 1BOTO 1HNWK 2ZJPF 3JB9J 2DX1A 2V52B 2BOLA 4MEXF 2JHNA 4UY8I 2MC4A 2E1HA 3U23A 2CW7A 3G10A 5FPNA 1VQKT 4BACA 4CK1A 3F6OA 2EJGA 1D5YA 2FVUA 4CEAA 3VQPA 2EQKA 3LL7A 1I0CA 5AIPA 3REBB 4XOPA 3EHRA 3M7GA 3WXMB 5I22A 4BGDA 3AAPA 1HC8A 1ASUA 4RM2A 4HYEA 4FE4A 2RB6A 1MMDA 2GIVA 3SFZA 1ZELA 1HYVA 3EAEA 2DMQA 3EUAA 1MU2A 1RUWA 1E3OC 4MLOA 3AL0B 2HBMA 3RBBB 3PFIA 3OY9A 3P9CA 3TREA 4ZYDA 2QK9A 4B1UB 2QSHX 2LQKA 1WGXA 5HODA 3SQ2A 4QVCA 4GFBA 4UUSA 1M90O 4PCQA 4YOYA 2W84A 3DKWA 4R1HA 3QDRB 4CI0C 2E2JJ 5HK0A 1MBGA 1FOWA 2AHQA 4UUVA 3RKXA 1NJIU 4Z4EA 3BDDA 1MNMC 2XROA 1B34A 3GZ5A 1XQOA 3LAJA 1K8KA 2EYZA 4AM7A 1YJWT 4BR0A 1LKXA 2AQFA 1K6OA 1QMCA 3S16J 1ETVA 5M9OA 3KFVA 4UUSB 3LSRA 2DNUA 4JI2K 4PZJA 3C7NA 2F5DA 5DDGA 4CVNE 3OJUA 4A3BJ 4KITB 1W5TA 5F0HA 1MD0A 1E6HA 1B34B 4N0AA 1K8KB 4CJLA 3IHOA 3TWHA 1S6LA 4C0FA 3OW2M 4KTQA 3C7NB 3QO3A 3QO9A 2JWKA 3NRVA 2WV1A 2E5LK 2G8FA 2GF7A 4RTWA 2QQAA 4BREA 5ERIA 1LNWA 1T8EA 2IGOA 3GTOJ 3MDQA 1A5WA 2HDDA 3QODA 3RPUD 3VPRA 4FW1A 4M75C 2K57A 3K5OA 1QHAA 1J6ZA 2E2IJ 2HZDA 1E3HA 1TWBA 5LJ3f 3O2PE 2Q3SA 4M7DE 4AYBN 3MEUA 1UGPB 2QF7A 3RIRA 1YHQQ 3LGFA 2W42A 5CVIA 1IN7A 1YITI 1QHHD 4L9VA 2O4IA 3V4IA 4OFHA 4LLNA 4FASD 3EYZA 5KYYA 3S2HJ 4LLGF 2EK5A 2QQBA 3JR9A 3VS5A 4Q5WA 5GANf 3OYYA 2CFOA 4LD9K 5KQ8A 3VQ6A 5BRFA 1TKTA 4MFEA 1FSHA 3KP7A 3CVSA 4M45A 1NGNA 3BT9A 1TUDA 1UDLA 2LCLA 4HT9A 1VHXA 2V6EA 3ZMDA 2KIQA 4RGSA 1JTXA 3BF1A 5KYYB 3DRRA 3NEUA 3JSCA 2UXNA 4W5TA 4BUGA 5CHIA 3THXB 3UDCA 4LB6B 4HVUA 1BI1A 1TK5A 3SV4A 1I07A 4C8LA 1J5EK 4BI4A 3L4QA 4DTMA 1YFNA 1IGQA 3CC4N 3ABLH 1WSEA 3CCRQ 2HZYA 2Y48A 1N9RA 3SXYA 4IWVA 2H94A 4M6VA 3JV3A 5H1SQ 4MO4A 6AT1B 3HXMA 3PJRA 1FIAA 2YHWA 2HWVA 2GXGA 4IXAA 1WH5A 5E79C 2YRDA 1Q81R 2IA0A 2YU3A 2HMIA 4HNVA 4GV6A 1OCOH 3FXQA 4CJUA 3RYRA 2WADA 4IFYA 4RW9A 1PU7A 3VEZA 2GX9A 3W2AA 2OA8A 1VOMA 2KFDA 5GTIC 4DSIA 3MXJA 3S8PA 4C2MJ 4A2UA 4M7DF 2HYFA 2I5WA 1H92A 3QFPA 1W7PA 1KQJA 3KP3A 2P4WA 4OMYA 4MDAA 3QPLA 3CCRI 2M7AA 4CHZA 2O8FA 1SFXA 1YO5C 5JS1A 2OPTA 3M5RA 3U4LA 2E6MA 4RA2A 1N32K 3HHHA 2HXOA 2DZCA 2Z33A 1W7PB 1P9QC 3I56T 4BD3A 2RA2A 4H0VB 1UHCA 2XDBA 4E9HA 3H3VK 1EV7A 1PRMC 1WNSA 1TVRA 3RMDA 2DJQA 2O8FB 1N3CA 1H1VA 3JRAA 4MQ9F 1M8VA 4DK9A 2QA4I 4KFBA 2A0FB 4BRKA 1IBLK 1GBRA 5EJCA 3BR6A 2RPIA 3R60A 2HEOA 1RTIA 4FM2A 2JA5J 3OH9A 3MEGA 2XIGA 2FLOA 2X0LA 2BVLA 1IDYA 4CGZA 4YY3K 3DKMA 3KZZA 3QDKA 2LG4A 1KK7A 3T8RA 1WEFA 1K6YA 4FJ5A 4V2SA 1OR7C 1KQSM 1KG3A 3D6RA 3HUGA 4PFOA 1AWJA 1BG3A 1LFUP 4FK4A 2XG8D 4NB5A 3O3GA 2NNNA 3P5JA 2OC6A 3N4PA 4Z02A 2XVCA 5DK5A 1EO1A 1Y39A 2MW8A 4I01A 2BZ8A 2LNHB 2CH5A 3G4SN 3O08A 1TTHB 5KGXA 5E8GA 4CCKA 3MD2A 1IG9A 1W2BP 3CF5F 1ENHA 3HUGB 4LDWA 2VASA 4KN7X 1RBUA 1WKMA 4ZN3A 5HRSA 4XKBA 3M3YJ 1V4SA 1U45A 4L59A 2I10A 3MWPA 3RKQA 1OYXA 3FMRA 3BR2A 4DTSA 3CBMA 5C24A 3SQNA 4HT8A 2O31A 2RHZA 1NJIC 3VERA 5C4XJ 1DLOA 3ZN1A 3QYHB 3QB0A 2JT4A 2IW5A 1JEGA 1FOYA 2JS0A 4PNOA 1FJLA 1FSEA 1J53A 3KK2A 4RAFA 2RHKA 3CJ7A 2Y1IA 3FIWA 1MBEA 2MBFA 1FPQA 4DF8A 1EQYA 2YUOA 4RGRA 4F3TA 1NEGA 1B9FA 1D0XA 1IV6A 3JXUA 1B9MA 3U6FA 3LDNA 1M30A 4IOAL 2M0CA 3ZGKA 4EMKC 4V2FA 1F1ZA 2DXBA 2ZC2A 1ONVA 1C1AA 4AIKA 1NK0A 2YHTA 3AO3A 3EL2A 2DT7B 2OCCH 1I81A 1UGSB 4CRIA 5AQHA 3DBLB 2LQWA 2EYXA 2GBZA 5J8FA 4NO7A 2PUOB 4H4OA 3NTHA 3M4YA 3DLLL 2DW4A 1JLFA 4RCBA 4CHOA 1Q81O 1QQMA 4FCYA 3ZCMA 3MKYB 3I35A 4AHVA 1ZG3A 3IQLA 1TQMA 3J80E 2QGFB 3BTCA 4BC5A 3SUOA 4J2AA 3VGKA 4E1MA 3L6QA 1K8AR 1DT9A 1S5LC 1JB0E 1KJWA 1VQ5N 5IP7J 3T8TA 1WJFA 2F4MB 2O3FA 1FX7A 3ME9A 2K4BA 2FSWA 1VQ8I 3OGDA 3QERA 3F2KA 5AZIB 2DFFA 4EW0A 2P0PA 1RTJA 2MA3A 4FK2A 3CMAN 2GQIA 2BY1A 1P4WA 1U9OA 5BOXA 3GIBA 2PTKA 1W7PD 3U2RA 2CZ6B 1WJ5A 1T3VA 4BQZA 3NF9A 3ERED 3C12A 1KVAA 5IT9K 1WFXA 4E7LA 3RR7A 2CS7A 4AF1A 2Y2ZA 1FBQA 2L5QA 5DUIA 1RI9A 3Q9VA 2LNVA 2RGVA 4NL2A 2AIRB 2X6YA 1BC7C 3VJPA 2KHMA 3GFJA 3I0SA 1I5OB 1Q7YO 3DPTA 4NL3A 1M3AA 3VQCA 2BGCA 4WCEL 1P6RA 3CQZJ 1PUEE 1FYKA 1MA9B 4M78G 2OTLA 4NC6A 2E4HA 2R7TA 3J8AA 2M02A 3G6EQ 2HVQA 3EDPA 3QPHA 2DTOA 4L9TA 2KK4A 3SZPA 2E64A 3NGPA 1KG7A 3NWTA 5J2PA 4UV8A 1MMGA 2OBPA 4WE1A 3HTSB 2WTUA 2M3AA 2KKZA 1NWKA 1VYUA 5J4YA 3L2ZA 4F9OA 2MLKA 5AFUH 1H0MA 3LYIA 4C1NI 2XHKA 1LEAA 3U9ZA 2XDDA 1RL2A 1WHJA 4OKEA 3K2AA 5HL7L 4Z6YA 3JRDA 4RLQA 2ZSIB 4CJSA 1YQRA 4U67L 4D9JA 2QKKA 4ILGB 4DYQA 2YSRA 2LQNA 1VQ6N 2CT4A 3WTYC 2LF7A 1UGQB 3WGGA 3LA3A 1I5LA 3QOPA 3WGIA 1BUPA 4FJGA 2E12A 3DU5A 3HO1A 4CGJA 3ZQ7A 5GAN3 2VQEK 4HWIA 2AKKA 4C92C 3CJBA 3G6EI 2WUSA 2VPLA 3ZEHA 3R2XC 3SAHA 5B66C 1P59A 1P2FA 4DQIA 1BJZA 2DA6A 5E3MA 2W6KA 3AA4A 4JOMA 1TXQA 1L5UA 4CD3A 1RESA 3F9KA 4B48A 3META 4DR1K 3CMEN 4FZYA 2A1RA 4XLNF 2OUMA 1RILA 2DL5A 4CO8A 4KH4A 4OVLA 3QESA 4EATA 1YITA 3GNFB 1IBMK 4RTYA 4HF0A 1FTZA 1QVGM 5GMKh 4OX9K 1RAGB 4RAGA 1UA1A 3MEAA 1JXSA 3DLHA 4FQGA 4FISA 4AFUC 2H3EB 4WF2A 5AR0A 2ZJRL 4DLEA 5LGTA 4B43A 1QQIA 4A0XA 4XH5A 1SD7A 4NC7A 1LW0A 3J7AP 1S72T 4C0DB 5LJ3g 3TANA 4J9HA 3CCVN 1NPPA 5LJ5e 5AJ3K 1RAFB 5GAN2 2R5ZA 1JJ8C 1LDDA 2KLAA 2WAQN 3LP3A 1NGGA 1VQ7T 1OPLA 1Y7XA 2C6YA 2FSNA 3AO1A 1RAEB 3U9GA 3URGA 2ZPEB 3GFLA 4OLBA 1VQOQ 3RZDJ 1H88C 2E34A 2XY8A 2AXLA 2DA4A 2VJ4A 4RB0A 2R5ZB 4Y1DA 4DV2K 3VQ4A 1BDGA 3EKUA 1DPUA 3LDLA 1Q82C 5AQXA 4G7ZF 1MKMA 2G8KA 3MECA 4M3XA 3BTIA 4KH5A 1PCXA 1VQ9Q 1WJSA 1VSJA 5CPRB 4X1EA 3QZ9B 1SSHA 2DILA 2HZTA 4LDXA 4OINF 1BW5A 4FJHA 2ISYA 1Y0NA 1M27C 3CCQT 2KVQG 1J09A 1O3SA 5KQDA 2D1XA 1ZSZC 3ZT1A 4ENJA 2LMDA 5ECAA 4RCCA 5F0FA 4FPAA 3KPHA 2F9WA 1BKBA 3KUFA 4KJZA 1BGXT 4DBQA 3VQBA 1W6XA 2KRSA 5FLXZ 1JLQA 1ZLMA 1K4TA 2VOPA 2QA4A 2M8GX 3LWFA 1MGQA 3AY9A 4OFAA 1XQHA 5EGOB 3LWHA 1V5GA 2KHOA 2HNIA 1QVFS 4L0ZB 1AT1B 4C8QE 1JGGA 3CD6Q 2W6LA 5FWBA 3VRYA 2YWWA 1KHIA 2YUSA 3KYDB 3ROUA 3V7CA 3OR2C 2M16A 4JLHA 1RAHB 3TPQA 3O3FA 3ULDA 2TRTA 1NK8A 2FHDA 4B1VA 3J80O 3D2FA 5GTHC 4A2AA 2DQLA 5GADJ 1R1VA 5E3OA 2HHHK 3QWLA 3MKLA 4GY2B 1KAXA 4P9FA 2CSOA 3UR3C 1W2BA 2QLZA 4LK1F 1JKRC 4Y28E 4NS5A 4WX9A 2L3DA 1K73C 3TDUC 1M2OA 1JHFA 3E9LA 3THYA 1WCMJ 3ENHA 1HOMA 2OZSA 4LK0F 2Y0SN 1E7OA 3BG9A 3SYTA 1GL5A 1YVUA 4M3RA 1TWCJ 2CDTA 1LJOA 1O57A 4KGVB 4O6JA 1YQLA 1A35A 2Y4YA 3QYFA 1O3QA 3TBIA 3A1YA 2DA5A 3HFNA 3K9KA 4KTZA 4K8ZA 1J5OA 3THYB 2BY0A 3OIQA 1GCQA 2HYGD 2VUBA 4YDUA 1YIJI 4CYCB 1SEUA 2QWLA 3CQYA 4B9QA 3AVNA 4DB3A 4I76A 5GAMh 2IRFG 3VPZA 5FROA 1P7IA 4Y33A 2ZFWA 4CFAA 3M53A 4E1JA 1DGRM 3SUQA 4ORZA 3VV0A 5FKMA 2BXZA 1DU0A 1ETKA 1W4MA 3VODA 1P4AA 4C8QF 1GBQA 4IQJA 2LQ8A 1T0JA 4YPRA 2YSQA 1B59A 2BV6A 1NK9A 1WI9A 2RNJA 3A01A 2L0AA 2H8HA 4ZJZA 1K79A 1H8KA 4OMOA 4CH7A 2LVMA 2QSGX 1ON2A 4DV1K 1YE9A 3WE3A 3KZYA 5KYWA 5LGNA 1SUQA 5E20A 1VQ8A 3OYNA 4XRSA 4BQQA 5FKNA 2HHWA 5KRTA 3JAMK 4WWCA 4DFMA 3A01B 3GTLJ 4FVUA 3HSBA 1Z26A 4B3MK 4ZDLA 1TKXA 3GP8A 5EYRA 1UJ8A 4CZCA 1ZBIA 2JMAA 3K5NA 4KT6A 5KYWB 1FWZA 3HRGA 3FHFA 5FLVA 1SRMA 5KPTA 1VQ4Q 4XSXF 4CC7A 5AYFA 3AVKA 1VSLA 2EV0A 3SAFA 5CY4A 1I3AA 2IEKA 3AGKA 4A4KA 3BR1A 1BQNA 1JUPA 4EZ6A 1ASVA 2A7YA 1C1CA 1D5AA 1D5VA 3FK7A 2O0YA 4KDPA 3PY8A 1PSFA 2E8AA 3F70A 3UA7A 1MIJA 1ZG1A 3MVPA 4WFAL 1FLIA 1ZQ3P 2GOXB 3VQ9A 5CVVA 2VQLA 4M7DG 1BL0A 1BC8C 2F5CA 1RDAA 3A1PA 1X19A 1AD5A 1ATNA 2HNHA 5KGWA 2DE0X 1OCRH 2D0QB 4NC8A 4DV4K 1VQ4I 3CC2N 1KG4A 1ZUYA 3QWYA 4NHJA 3LSJA 4ASNA 3NPFA 3MEEA 3RKYA 3M0PA 4CGIA 4HX4A 4A62A 4FPBA 4M75E 3PX6A 4B1XB 3TOAA 2NRRA 1WIEA 1CLQA 1ESVA 3ASNH 4HVVA 1UFFA 3G71N 2O88A 3K69A 3CPWS 1UZCA 4X1VA 5HDKA 2VC8A 2E1NA 2KRHA 1GCPA 5HBMA 2O4GA 3CCLQ 3L1PA 5F1RA 2EGEA 4DKWA 2HHVA 3VFZA 2HW3A 1R22A 3DLLA 3QBYA 5C25A 3FISA 2Z5UA 5EEGA 2DMNA 1DPRA 4BY6C 4JLIA 1ETOA 3CBPA 4JK1X 2ZPHB 3QQAA 3WTTC 3TI0A 2QQRA 4A4FA 2BH1A 4FT4A 3GX4X 4DMNA 1RLQC 2F96A 2MH2A 3HYFA 2WSFE 2RE2A 3KLNA 1NH3A 3CCMN 1MBHA 2Z3YA 2JM9A 3T1BA 5AQRA 5DUKA 2DFEA 3CCEA 1HKGA 3BEXA 2GWKA 4DS4A 3DLLF 5GAMg 2K2VA 3BPXA 2KZVA 4CZZA 4HUFA 1IRXA 3CCLI 2HDWA 3MEWA 9ANTA 4PKIA 3Q0UA 3ZFJA 2WB1A 4IHSA 4FJJA 3RPQA 1K9MU 2UUZA 4DR7K 4NB4A 2ID6A 3C65A 2UUAK 2I7PA 4FO0A 3ZOBA 4PWDA 4C8MA 1KHCA 3TSPA 1PYVA 4PIIA 5EX5A 4M7YA 2WAEA 4M75B 2QYZA 5DYMA 3I9V2 3H1VX 4R79A 4JJBA 3ZX3A 1YF5L 4DG1A 4BR2A 4CJTA 5CQXA 4IVNA 4L5EA 2W04A 3ZP5A 3B6PA 4M75F 3O4NA 3D4VA 3HOSA 3KK7A 5CKBA 1RBVA 2O7OA 3E9OA 5J39A 2DOEA 4DNCA 3V6DA 1TS9A 4NZGA 4B1YB 3B6OA 5AQLA 2P9UB 1WHUA 2VJIA 1M3QA 2V79A 4H0XB 2PVGB 3TTFA 4BRCA 3SWNA 3J81O 2F4OB 1CXQA 4M73A 4F4KA 1R5ID 3VKIA 6PAXA 4EHUA 4XRFA 1VSDA 1ZR2A 3FB9A 1N36K 3I53A 1QWEA 3AVGA 3BW1A 4IDHA 3PMTA 5ICCA 1AWWA 1KC8C 3K2ZA 3FXUA 2DF6A 3I8DA 1N8RU 2UUCK 1HU0A 3SWNB 2KZGA 1YTYA 3EZ5A 2HHTA 5JLFA 3CHWA 2A6HF 4B3XA 3R0JA 2CH4W 1OYYA 5IAYA 3A0HC 3ATUA 3EUHA 2CH6A 3T1YK 1RABB 1BR4A 1NU0A 4IHTA 3S3OA 2ZCFB 1BI4A 3PNVA 1TU0B 4NLCA 2HPMA 4NLBA 4R8HA 1HJOA 1HKTA 1WHKA 3BG7A 2R7FA 2P9NA 3DXMB 4RTZA 3IUCA 3AVJA 4M9XA 4BXFA 2NVYJ 1M1KO 2KZMA 1T39A 3HOYJ 2Q36A 1M2VA 3FXOA 2GNCA 2RK1A 1RGIA 3S15J 1UAAA 1BI4B 5CR4A 4J6YA 1ZXOA 1W36D 2RN8A 3PTAA 3TW6A 1M3BA 3LNQA 4HUGA 2RQRA 1AWOA 1EX4A 4LG0B 1YS7A 3H1CA 3JB9F 4J6XA 5HRRA 5K7HA 2RJCA 4OMQA 1M2VB 1MBFA 5J1UA 2P9PA 3ZXSA 4KTWA 1EWRA 1XQSC 2OTLT 3I54A 4JYAK 3X20B 2FZGB 2LP5A 3FR0A 3TEDA 2K5FA 4J9FA 1IG8A 4M3UA 4UVBA 1OKJA 2LNBA 3LFUA 4B21A 3E7LA 1SKWA 1WHGA 4Y3OA 4UB8C 3AAFA 2KFNA 2VQCA 5FKOA 1RT2A 4B8AB 4BRDA 2IOCA 2BUPA 1T6SA 4EVVA 3QKJA 4V2GA 2OAUA 5I2SA 4ILJA 1W5SA 5JS2A 3WT0A 1ZGJA 2QEXN 3D7EO 2EFOA 1BM9A 1XMKA 3EH2A 1CZBA 4OIRF 2XO7A 4F2SA 1YIJA 4JKHA 2OFIA 4JKGA 2MYSA 4LF8K 1VQ7N 4PSWA 2ZGWA 4CECA 4K2EA 1LVAA 3F8CA 3VS2A 3CCJI 1D0ZA 3OYJA 1FMWA 3V1OA 1JBMA 3ZCOA 5LFAA 4YOQA 4EVIA 2VC1A 1JLEA 3WU0A 4LDVA 2ADUA 1YITT 2X1CA 5DMRA 4JKGB 4A59A 1SQKA 4XN0A 4DSLA 2BUDA 2NOZA 1NYFA 1XNIA 4Z0UA 2BZTA 4EJUA 4EHTA 1VQPN 5GAOm 2IA1A 4U7BA 5FLMJ 2QM1A 4B23A 3NGIA 2CV2A 4JLGA 3OA9A 3RKWA 5FRNA 1BHLA 4J2BA 1WVRA 3AVBA 1H3ZA 4IO8A 2MSYA 1L3SA 1VQKQ 4HKEA 2GQQA 3SPYA 1TUYA 5J2NA 2P9SA 5E26A 2HSPA 3J7AO 1NGCA 3CM6A 4FZXC 1WAJA 3BROA 1CF7A 1S9EA 1GT0C 3U21A 4JI1K 4FYYB 1IAWA 2O4XA 1RNLA 2VKDA 4KRFA 3ABTA 3A03A 1LWCA 2IVNA 2Q0RA 1TWHJ 3E97A 1XTAA 2GZWA 2P9SB 1K9MC 1OH6A 4F3QA 1CF7B 3CM5A 2BXYA 3OSFA 2CG4A 3V8LA 3EZWA 5AQNA 2CV1A 2EGCA 3JRCA 2OYQA 2O4XB 4EDUA 2QGGA 2DMUA 2L3RA 2WC2A 4ZZDA 1VQKI 3TAGA 2K86A 3IKMA 3RR8A 5IHNA 3GVAA 1D3BA 1F1BB 4P9UA 2FBTA 2MIOA 2ZSHB 4DUYK 3ZX0A 1YW9A 3ZSXA 3VSKA 5D5WB 4BVOA 4DOZA 1SG5A 3GTPJ 4RUGA 1YJWQ 4JZ3A 2IS1A 3JW4A 1QVPA 3E6MA 3AO5A 1GV2A 3HJFA 4A69C 3V7SA 3QMLA 4C92E 4E3SA 3K4JA 2EJFA 4Z4HA 2O61A 2DYRH 3F72A 3GBGA 4K25A 3K1NA 4IOCL 3RMBA 2X3XD 4EIKA 2NUTA 3D5SC 3C6AA 1R9TJ 3DLGA 1S1NA 4OMFB 1ZLJA 3MP8A 2ME0A 3PVLA 4IOXA 2PVDB 3UF4A 5IHKA 1WI3A 4J01A 5KE2A 4KV8A 2O8BA 3CJ9A 2LJ1A 3F21A 2K27A 3SHFA 1YI2N 1LDJA 1C6VX 3MHXA 1YJNT 4MLEA 3G73A 2ZF5O 2W85A 1SL0A 2DAQA 3ERMA 4XLFA 2QA4T 4IHVA 2NUTB 5ILVA 3F8MA 4MZMA 4E9EA 3SUNA 4F55A 2D0CA 4JQFA 4Y7NJ 5FLXE 1Q86C 2O8BB 5EXWA 2LTPA 3J7YP 1LFBA 2Z16A 2KXDA 3VYGA 4X6AJ 5L3GA 3GTKJ 3CWUA 1N3AA 4HCBA 3WEEA 2CO5A 1Y8RB 1TOVA 4AM3A 1KD1U 1IKWA 2K79A 3CERA 4LITA 3QBWA 2GBYA 1ZH5A 4PJOC 4DR4K 2NUBA 1TV6A 2DCEA 1N34K 4M7AA 2DFUA 3CCLA 1Z77A 4DR2K 1Z67A 4F04B 2QUFA 2X85A 2WWYA 2VXDA 3LFKA 2H09A 3M57A 3ZMZA 2VUMJ 1YAGA 1D0YA 4CZLA 1SVOA 4B09A 2M51A 2VKNA 4M3TA 3RRGA 1I6XA 4CZFA 2OTJA 1G2BA 3OS2A 3GTJJ 4OF1A 1FOXA 5GMKe 4WFBL 2Q1ZB 4CHYA 4JKEA 4LE9A 4E9FA 4C92F 3BY7A 5HS9A 3HKSA 3L7WA 1ZR4A 2RAEA 2VBZA 3R0AA 3H08A 2FOWA 4ZHRA 3DRSA 3OV8A 3CXCP 2W25A 2L54A 3KYLA 2ZNYA 3SI6A 3PUFA 2JUFA 4N4OB 4J9CA 1TWFJ 3I58A 1X2QA 3PL8A 3QAHA 3VU3C 1G15A 4HV5A 4ENNA 1EWQA 3RSEA 1SKRA 3K7AJ 4C8QG 2ZXIA 5MLCQ 4NNJA 1HYOA 4CCHA 3AAQA 3WQUA 1XX5A 3T0YA 1BCMA 2VE8A 1NJIO 1VQLN 4E70A 2QQ8A 3TSQA 1H8AC 3K6GA 3ENBA 3W6KB 3CMMA 1JTYA 3LM2A 3EFOB 3RSEB 3I5RA 1EFNA 1LAWA 2GOMA 5AQYA 1WZ2A 2ED1A 2HL3A 2ITGA 3MP1A 4QQDA 1QGPA 3CJQB 2NNYA 2CP2A 1G3YA 2KIMA 1UEBA 3L09A 5HLGA 3HI0A 5DD8A 1DEJA 2W57A 1I1SA 5D8KB 4A4GA 4CZMA 5K5OA 5IWAK 4JKCA 4OMNA 1VQ8T 2COBA 4RW8A 1KU2A 2YX4A 5GAHJ 3I56Q 3RI4A 1ZREA 1YWPA 5LJVA 5FU6B 3FDYA 4LXCA 2XAJA 5LEJA 1V55H 4B9SA 3SMSA 1X1AA 3MZHA 3VW4A 5CYVA 2NUPA 1B7TA 4DTXA 2FJ1A 3DMJA 1IREB 1MV0B 1D09B 3TAQA 3NARA 2JVGA 2RV8A 4ISEA 2ZGZA 1ZG5A 2CUBA 3WNEA 2ETJA 2L02A 3HL8A 4CHUA 3DWLA 4OKJA 4KB0A 5BR9A 1IUFA 4LY7A 2G6FX 4Z4CA 1Z9ZA 4UV9A 3QIOA 1S1WA 2F6CA 4II2A 3S2DJ 4NCAA 1VRLA 2DMTA 2NUPB 3HGGA 1SL2A 5FGMA 5GPCA 4CJ3A 2LK2A 1WJAA 2E6LA 2QCOA 1IDZA 3I56I 3L9FA 3DAWA 3D0SA 4LJZF 4A93J 3MX5A 4C23A 1NGJA 2R7SA 4HTLA 4XKCA 2CSQA 2M30A 1TT0A 2EQIA 2JSCA 4BDZA 4PKHA 4XTUA 1SC7A 3WVEB 3BR3A 4FJ9A 3EO3A 5D4SA 2VONA 4L0YB 2VXFA 1N39A 2IPOB 2JQ7A 4DSFA 2DT5A 3VEVA 4ATOA 2XK0A 5M1KA 1UG1A 2NS7A 2F5KA 3R3LA 4QVDA 1AKHB 1UWBA 3FIFA 1T38A 4DV3K 2RF2A 4M7AD 5JHFA 3WG7H 1Z25A 2M9HA 3CO7C 4RBOA 4F7UE 3Q7CA 5DLOA 1LWWA 3M8EA 1SFOJ 3CCUA 4YIFA 2E10A 1TK0A 4LG3A 8AT1B 3KX2A 4XLEA 5KYUA 1QSLA 1QCNA 1QO0D 1UHWA 4A3LJ 3CCJA 3H41A 2YUNA 4FYDA 1FEXA 5ICGA 3HG9A 3Q0WA 3HC7A 2VN2A 5L3BA 5E17F 4M77C 2EZIA 5M3FJ 5F27A 1R4NB 3SQ0A 2DLPA 4EJTA 4CFDA 1XOVA 3CCET 2HS5A 5LJ5d 4LFBK 5KYUB 4QSHA 2VOOA 5LMUK 4Y1CA 3TO7A 5GAMe 5K1YA 4JEPA 3EG9B 2DIGA 3P8BB 2GTOA 1VUBA 2W7NA 3CC7A 1PJRA 1TWAJ 2A41A 4EPCA 2IVOA 4RS8A 4A3MJ 3IRXA 3A02A 4FL6A 3VDXA 1BBZA 4Q47A 4CIFA 4M75G 4HZFA 2D2WA 3TCJA 1KSWA 1OU9A 1MHNA 1WXTA 3SDZA 5A2QZ 5AQVA 4DYRA 4BYYA 1XG7A 2Q0UA 1NGIA 3MK6A 2LYCA 1IO6A 1HX1A 1LQ1A 4EP5A 2RI3A 2ZXJA 3FM3A 1BOAA 2W24A 2EKHA 2FNAA 3P9KA 4B1ZA 3CP2A 5DD4A 3AT1B 1TK8A 3LWLA 4ZYAA 3VQ7A 4OIQF 2M4KA 3HOZJ 1U2WA 3T1HK 4CHPA 4FM4B 2JA7J 2JJ9A 1NMNA 3OVNA 4OPJA 3QP6A 2XGXA 4KULA 3AVHA 2QTVA 1YVNA 2O8EA 2KJBA 2HVIA 1U8BA 5F1JA 3WODF 3RDVA 2NOJB 3F9MA 3GTQJ 3NQOA 4ESJA 1ATSA 3FKIJ 4CZHA 2DVJA 1LAVA 2G7HA 3MKWB 4F93B 1VQMA 4NYFA 3CCYA 3AO2A 4OU0A 2O8EB 1FYMA 3OL3A 1JT0A 2Y30A 5C3EJ 3LCNA 2JTFA 2VXEA 2AJQA 3PNTA 1LWYA 3FLCO 4XTYA 5IH2A 2XD0A 3V9ZA 2J05A 3TAFA 4BQNA 4M77D 1CXUA 4ZDOA 5GAOl 2QXFA 2DPUA 1QVFM 1N5YA 1JU5C 5E18F 3KCCA 1WEIA 4MLHA 4BRPA 1HNIA 1FT9A 1WQWA 1STZA 2EV5A 1X1CA 2VG7A 4A61A 2M0YA 3WXIA 3O8VA 3AG1H 3EG0A 3NE6A 4AD9A 1WNLA 3DEEA 2RHXA 1RIOH 2EA4A 3JB9G 4M63C 2KLOA 1QHGA 3LSIA 1UG0A 2Z9OA 2JXBA 1IBKK 3GZNB 3F8NA 1B72A 2GEMA 5GAN6 3ABUA 1QZYA 2HU9A 1OFCX 1YQKA 4GLKA 1WBDA 3E5XA 3HP9A 2BIVA 2PQWA 2XHBA 2F5FA 2FQ3A 1YIOA 3V7RA 4G1QA 1NGEA 2FEZA 3CC4I 1UCRA 4DQ2A 4HF2A 4HRIA 3P83D 1RTDA 4GY5A 1B72B 2YPRA 3DPLC 1S72Q 5GMKm 4AQYK 1SAUA 2OI3A 4FXDA 1YITN 3CBOA 3EN9A 4F3OA 5EOYA 4DIQA 3A4CA 4BY6B 4EIAA 3OMCA 2RMOA 3O9QA 2CWEA 3MN5A 4WQ5C 4XLHA 3ZBDA 1VQ7Q 3R1XA 2ZO4A 1DJ7B 5LJ5f 4XH1A 4G9YA 2ZKZA 1J9AA 3ISNC 3MFKA 2D1VA 4YFKF 4BC3A 1ZTRA 2E5NA 3D45A 4CHNA 4CZEA 3CXCA 3TKYA 2LCCA 1YIJT 1DKGD 2ELKA 4XU1A 4XSZF 4OMMA 2CH4A 5HDGA 2ASMA 3H9JA 1NE8A 2WA0A 1OISA 1R8OB 3F0ZA 2PAVA 2PMUA 4ANJA 2LX9A 3J80K 4DZJA 1RBRA 3BOQA 2EILH 5AQPA 1LWFA 2IAJA 1SVLA 1D4XA 2OZ6A 3PE0A 5LBQA 3B6AA 1ZBFA 4EM1A 2EWSA 3S6WA 2PLYA 3IAYA 5FDLA 2RF0A 3H9GA 3I55A 1LDKB 2OPRA 3F23A 4AIJA 2H6CA 3CCQQ 1IRZA 4BEHA 3TGNA 5F04A 2Y31A 1U4BA 1XWLA 2LLKA 5AQMA 1PSEA 2EIFA 1VSHA 2QTDA 3M9QA 5CJ9A 3QNNA 2LBFA 3FXMA 2KJCA 1REPC 2MH9A 3ECOA 4KA4A 3JCMQ 4YNQA 1RAAB 5DY9A 5JVHL 2KZZA 2X6OA 4BEHB 5T7BA 2M34A 3RQIA 4KBOA 1HSTA 4KPYA 3M8QA 3CCRN 3MEXA 2ZPGB 1RAIB 4DV5K 2LBFB 2DIQA 1WBBA 3ZYYX 4I9LA 2DDAA 3F8FA 4FU6A 5CYQA 5TKWA 1Y57A 2E1YA 5KTQA 4MO7A 3DLBA 2DU9A 4KN4X 1HYZA 4GCVA 1NJZA 4HF1A 1JCEA 3FHNA 2BY2A 4AI4A 1IGUA 4H8KA 2R7QA 1RDUA 1LFPA 2X1EA 3QJ6A 4CJWA 1YJ9A 3DCFA 3CZ6A 5J26A 2Q31A 2NRAC 1X6GA 2E1MB 5CKHA 1MSFC 4FWQA 2YX6A 2V9KA 3HGYA 5KN8A 2X1DA 3M8JA 1NK4A 4A3KJ 2V4JC 2RI2A 1KFSA 3HIFA 1T2KA 2DDBA 4AFZC 4GNIA 3MPUB 5LLQA 3HBTA 4W5RA 3E66A 1OVQA 4A3IJ 2K7AA 1NYGA 2P8TA 4L3QA 3WTSC 3EEQA 3CCSA 1M1GA 2DEQA 1NG6A 2COZA 4BQLA 3JAMZ 4HX7A 3CPWM 2EFPA 2QWWA 4ENMA 1ZHFA 3UIQA 2DPDA 3IH7A 2Y4XA 3V1QA 1OEBA 2L9NA 1LPQA 2LFBA 3WG9A 5D6EA 3LL3A 2FB7A 1MNEA 3QIPA 3EY1A 4BBRJ 1U6ZA 2JTMA 2DLLA 4I6ZA 2BE7D 4MFBA 1W5CC 3V1RA 2OA4A 3M5AA 3C0CA 2RQUA 3HB9A 5FPDA 4O55A 2W40A 2CGJA 3B6CA 1JKPC 2E41A 5LJ3j 2D0AA