4BE2A

Pfv intasome with inhibitor xz-259
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be2A03
2RHZA 4CGDA 2XY6A 4H4MA 1KSPA 3PFSA 5J39A 1IKYA 4FJMA 4HCZA 3WNGA 2NUBA 3QEWA 2Y1JA 4BE2A 4IUVA 3NE6A 1WJRA 2NLUA 2RI2A 2O4XB 3AO1A 1IKXA 4KTWA 4O44A 2XY7A 2RO0A 3KJVA 1VSEA 4ELTA 2HHSA 1BI4A 4C5GA 2WOMA 3AVMA 4IUQA 1DTQA 3NH0A 4KB0A 2LVMA 1HYVA 4FJXA 5HROA 3PX6A 4Z4GA 3LX7A 3RTVA 2KZZA 3SCXA 3GOXA 2B8AA 5HRPA 4CGJA 3PNWC 3T1AA 2FBVA 3ULDA 3AA2A 5IN1A 4FLUA 3RRGA 3NH2A 3RR8A 3O3GA 4E89A 3OJSA 5M9OA 1VSDA 3HT3A 3O3HA 3MXIA 1XC9A 1TL3A 2RJCA 4IKFA 1U47A 1BHLA 4DSEA 1FXXA 2XRIA 3C6TA 2F8TA 1HNIA 1RDBA 1VRUA 2IC3A 2ZQBA 3QEIA 2L3RA 4UC4A 3ZT0A 4I9QA 4K8XA 3AVGA 4Z4FA 1KRPA 2LCCA 5J2NA 2DFEA 4E1NA 2YHBA 1SL0A 1XHZA 1L3UA 1RT7A 4I2PA 4RW9A 2PZSA 3LYIA 2D5RA 3TAMA 2DAQA 2X6SA 4E7HA 3ISNC 4GMJB 3AVLA 3V9UA 3SQ0A 1R0AA 3RR7A 1KVAA 1KCFA 5SZTA 1YVUA 1XI1A 4KTZA 1O1WA 2BIVA 4NCAA 4BDYA 3E9FA 1HQUA 1D9DA 3T3FA 1VK0A 4DLEA 3TI0A 2E6NA 5C6SA 1JLCA 3KKRA 1N27A 3DB4A 1LAWA 4CJUA 3ZT1A 4QCLA 3EAEA 2BGGA 2JTFA 3PMIA 4IURA 3P5JA 3VN5A 4CIEA 3QNNA 3NGYA 2Z1JA 3OJUA 4OLBA 1SKSA 3MEDA 5DK5A 1YTUA 4Y1CA 3KTQA 4KHWA 4CHPA 4DU3A 4FJ8A 1WNSA 4BDZA 1KVCA 1RBRA 3ZT3A 4Q0BA 3HPGA 3MEGA 3TAFA 4CGIA 3L2WA 2EX3A 2FBYA 4CF1A 4CFCA 3OS2A 2F96A 3WNFA 3AV9A 4CEOA 3LALA 3SPYA 4FJ7A 1OZ2A 4Z4CA 1EKEA 4KHNA 2PYLA 4CRIA 1MHNA 3HM9A 4M3ZA 3V1OA 1VSLA 4DF4A 4CJPA 3NF9A 1ASVA 5HRRA 4JS4A 3OYCA 4M41A 5HLFA 3I0SA 1ZBUA 3DLKA 1U48A 1T05A 5I3UA 1UWBA 4CJ5A 2FBXA 4JRQA 2A1RA 1DLOA 1ITGA 2Z1IA 1X9MA 3NTIA 3IAYA 2QKBA 2P5OA 3AVNA 1JLQA 1WSFA 3NAEA 2D9TA 1U45A 2JZ2A 3DRSA 3AVIA 1U04A 3QIPA 4Y1DA 4CHOA 2D0AA 3LP0A 3F70A 3L2RA 3UWNA 2RJEA 4CJQA 4CHNA 1TK5A 3DB3A 3OYLA 1HNVA 4FJ5A 4TSXA 3SV3A 2E4LA 1C0TA 4CF9A 5KGWA 3P8HA 4LH5A 1NJXA 3PX4A 1QHTA 3QJ6A 4PA1A 4DSJA 4DS4A 3LZIA 4O4GA 3TR8A 3ZT2A 3B6PA 3SYZA 3QERA 2P1JA 3G10A 4CERA 4DG1A 1NK7A 1ZBIA 4QOZB 3PY8A 3M8QA 3V9XA 1ZYQA 1T7PA 4J2BA 3DMJA 1QSYA 4E1MA 2HHWA 3D0PA 4CE9A 4CFDA 2IAJA 2LRQA 5J1EA 4W5QA 3V9ZA 2HHQA 4B9WA 1KVBA 1LWCA 1UAXA 2X4YA 3U3YA 4KFBA 2RHYA 3ZSWA 2HQEA 3HP6A 1RT6A 3NHGA 2W42A 1KHCA 3F9KA 4RW8A 2BDPA 5D6YA 2IS3A 1KTQA 4HVJA 1RT2A 2R7YA 1T03A 3I0RA 3QNOA 5KE3A 3WNEA 5CZ2A 5KE2A 2B4JA 3M8PA 4AILC 4DS5A 4CJTA 3CQ8A 4ICLA 4DFPA 4B9NA 3QINA 4PLIA 4KHUA 2WONA 2O4XA 3NGZA 4J2EA 4FJNA 3QO9A 1QSLA 2L89A 2D0CA 2VG6A 4O5BA 4Z0UA 3ITHA 3P1GA 4NCGA 1JKHA 5K14A 2G8UA 2HNYA 3HO1A 1A5XA 3SJJA 5FROA 1U49A 2G8IA 4GY5A 3LWLA 1IKWA 2YNFA 1J53A 1SUQA 2YHAA 5C25A 2RHXA 1WSHA 3KK1A 2XDPA 3ALYA 4QAGA 1ZBFA 3OYEA 2HVHA 4W5NA 3MEAA 3OYFA 3MEVA 3ZSXA 2FC0A 5CZ1A 4CF2A 2MWOA 3H8ZA 1LW2A 3V9WA 1U4BA 1HJRA 3THVA 5J2PA 3HXMA 3BDPA 1TKZA 4O0IA 1X9WA 1VSJA 2GBZA 4BWMA 4ZHRA 4DTNA 1RBSA 3DOLA 4HCBA 4BDPA 2YRVA 1KLMA 3LWMA 4DQQA 1RBUA 1D8YA 2Q3SA 5EU7A 2Z1GA 5HRNA 3EYZA 2EQJA 3DLHA 5JS1A 3C95A 4FM1A 1CZ9A 1NKEA 2LSNA 5J2QA 3P8DA 3EY1A 1SKWA 4IBNA 5CYMA 3K57A 2DTUA 2MWPA 4KHSA 4DLGA 2HMIA 3DI6A 3QKJA 3ZEHA 4DQSA 2VG7A 4I9LA 1TAQA 4DQRA 2YKNA 1VSIA 1VSHA 3L3UA 5DMRA 4B3OA 2HQXA 3AA4A 4I7FA 3MP8A 2DFFA 2XY8A 4FM0A 1NK9A 4ELUA 3QBYA 4DU4A 3L2QA 3KD5E 4B9XA 1A5VA 1OYXA 3FFIA 4FLXA 4B9SA 2IG0A 1WSIA 3HJFA 2Y1IA 3TAGA 4I2QA 1NJWA 3TARA 2YNGA 3BDLA 3SPZA 3LP3A 5D3GA 3KUFA 4QQ6A 1TGOA 4CJWA 1C0UA 5D6XA 2ATQA 2HHTA 2CKKA 3DLRA 3OMCA 3KLGA 2E6MA 3KLFA 1BQNA 4JS5A 1MU2A 3OYNA 3K5NA 4AH9A 3O8VA 3VQPA 5D6WA 2DIQA 3MAQA 4C8KA 1NJYA 5FRMA 3SNNA 1S5JA 3U6FA 4IUUA 4FZZA 4OJRA 2M16A 4CEAA 2OPSA 1WJQA 3MEWA 2YNIA 3HSTB 5HBMA 5CYQA 3VQBA 3OYBA 4B8CA 1VSKA 5KI6A 4CHQA 4HTUA 5HP1A 4EZ6A 3NH1A 2HHVA 3SQ4A 4DMNA 4C5IA 1S1UA 3T19A 4AHRA 4E7KA 1WSJA 4DTPA 4FK2A 3F73A 3HPHA 3HK2A 1EXQA 4IUPA 4JLHA 4MQ3A 2LDMA 2E5QA 3S3NA 1LWEA 1WAJA 3VQ8A 4CHZA 4CJEA 3V81A 3UIQA 4OKKA 4F3OA 4IDKA 1HYSA 3SUPA 4AHVA 3AVHA 1B92A 3NDKA 3KIOA 3U3GA 4M3YA 4HUEA 3P83D 4CJFA 2P5GA 1TAUA 4G1QA 2RPIA 4ZTFA 1RNHA 1XWLA 4CK3A 2K3XA 2M0OA 3OYGA 3AA5X 4NYNA 1LV5A 4KREA 3NBPA 3MEUA 4LY7A 1ASWA 3ZSQA 4C5EA 3ZSOA 4DFJA 4N4HA 4E0DA 1WGSA 4OLAA 4CIGA 1NJZA 3CEYA 1BGXT 4O0JA 1Q8IA 1WJSA 1QE1A 1JLFA 2R5AA 3OA6A 1C1AA 1S6QA 3WNHA 1VSFA 4NCBA 2QQRA 2D0BA 4W5OA 3HVRA 4FJHA 3DLGA 1C1CA 1HMVA 3OMGA 1RTJA 1Y97A 3VQEA 3JSMA 3RRHA 4F3TA 1RBTA 4FLWA 4J2AA 1YTAA 4CJKA 4C8OA 1RDDA 4H8KA 3VQDA 4AHTA 2YV0X 2QKKA 3NFAA 3LAMA 4C8LA 3NNQA 4OGCA 3OS0A 1IO2A 1WSEA 3V1QA 1YT3A 2ETJA 3UT1A 3DYAA 4KV8A 4CEQA 3EZ5A 3SV4A 3AVJA 1QSSA 3HVTA 1NKBA 1D9FA 1TKDA 1SL1A 1D5AA 2RF2A 4E7IA 4KO0A 4MFBA 2G8HA 4HUFA 4BE0A 1EX4A 3IG1A 4IG0A 4RW7A 4CFBA 4NS5A 2VG5A 3V9SA 2EQMA 4DTJA 3QEVA 4M3TA 2OZSA 1K6YA 1FK9A 1A5WA 2VYTA 4IFYA 3M8SA 5J2MA 3QETA 3NGIA 1UA0A 3VQCA 3DOKA 3OVNA 1LWFA 4FLYA 1FKOA 4OKEA 4J2DA 1TKXA 2HHUA 3LZJA 3OB9A 4OVLA 2I5JA 5KH6A 2RI5A 3NTHA 4IFVA 3ASKA 4NZGA 1QQCA 4OPJA 3ASMA 5T7BA 4IUTA 1SL2A 1TL1A 2YKMA 1HQEA 3LPTA 3CM6A 1F21A 3CFRA 4ELVA 4FJ9A 3K2PA 3KLHA 1RT4A 2RKIA 3RMBA 1WN7A 3PO4A 1CXQA 4KPYA 2WACA 4A4EA 2G8KA 4Z4IA 2AJQA 2BUDA 3V6DA 4XIUA 4LD6A 1KFDA 1ASUA 3RMAA 2B5JA 4N5SA 3VQQA 4LD0A 1RT3A 2X35A 2R5MA 4GW6A 1J5OA 4OVAA 1FKPA 3ZT4A 1IG9A 4B9TA 3S6WA 3K5MA 1SSFA 1NK5A 1J9AA 3SQ1A 4FJKA 3KKSA 4CFAA 1SV5A 4N47A 3H6ZA 2X74A 1OZ3A 3PV8A 1HPZA 4KAZA 1RI0A 2EHGA 1TVRA 4EP5A 4DSLA 2HHXA 2M1HA 1S1WA 3QLHA 4QVZA 1S9GA 1KFSA 3PX0A 2PY5A 4FXDA 4ZTJA 3FEOA 4F4KA 2RHIA 2PQWA 3VQ4A 2P0KA 2ZD1A 4RG8A 3SD4A 3ZSVA 2KW4A 3QIOA 5KCHA 1B9DA 1RDAA 1RBVA 1W0HA 3A2FA 1G5VA 3CM5A 4CEDA 3JYTA 4CK1A 2HNZA 4JRPA 3KLIA 1NKCA 3TAPA 4ID5A 4II1A 3CYMA 4PLLA 4YFUA 3L2UA 4L59A 4BACA 2DIGA 1S6PA 4DTXA 4DFKA 1ZBLA 3OYDA 2OYQA 5JS2A 3VQ9A 1JLGA 3ZSZA 2PYJA 1L3SA 3NF8A 1BISA 1JL2A 4RW6A 3L42A 1C1BA 1TK0A 2P51A 1XHXA 4W5TA 4FLZA 4N41A 4CEZA 1NK6A 4B8AB 3VQ7A 2X4WA 3B6OA 3DM2A 4RW4A 4RG2A 2E6LA 2XO7A 5C24A 2OPPA 1JLAA 3S3MA 3IRXA 4N4IA 1JXBA 1UA1A 4PL6A 3AVCA 2RN2A 4CGGA 1BCOA 4CJ3A 2FBTA 3RMDA 4KI6A 4DWIA 4OKJA 3LPUA 1RT5A 3LAKA 1RTIA 4GVMA 4CEBA 4FLVA 3VA0A 2G8WA 3OYAA 4ID1A 4CGFA 2QXFA 3TAQA 4BWJA 3TWHA 4DTOA 4DSKA 4Q5WA 3LP1A 4DF8A 4DQPA 3QESA 4KRFA 1S1TA 1S9EA 4A4FA 4B08A 3K59A 4KI4A 5KGXA 3SI6A 1NOYA 1UOCA 5HRSA 4CCHA 3AVBA 3L3VA 4DQIA 4FCYA 4EDUA 3AO4A 1WLJA 2ITGA 2XY5A 2R57A 3AO3A 2YNHA 1L5UA 2GFUA 3OQ5A 3MXJA 3V1RA 3K58A 3NCIA 3ME9A 1JL1A 3OYKA 3D45A 4Q5VA 4DTRA 2RJFA 1BIUA 3AO5A 4CJSA 3CFPA 4EZ9A 1TV6A 4FK0A 1WAFA 1C6VA 3DRRA 4CJVA 2OZMA 2ZE2A 3HL8A 4AHSA 2G8FA 3LH0A 2F8SA 2KFNA 3AVAA 3OYJA 5KRTA 1CLQA 2GF7A 1IKVA 4LH4A 4QQDA 1EETA 1S1XA 4Z4EA 2HW3A 1NOZA 4CEEA 3MP6A 1BIZA 3O3FA 1REVA 1N5YA 5FRNA 4FM2A 4CGHA 4FJIA 1RILA 4CF8A 4B9LA 4N56A 4X34A 3NF7A 4PUOA 4LSLA 1I3AA 1TKTA 4DSIA 3H08A 3MEEA 4CESA 4M3XA 3QEPA 4DSFA 3SQ2A 4C8NA 1BQMA 3PUFA 4B9MA 1DTTA 1KLNA 2BKDN 2Z1HA 5IAYA 3DLEA 4E19A 5FDLA 4EP4A 4CIFA 3HYFA 4LSNA 5SWMA 4DFMA 2GFAA 1C0MA 2B6AA 2GV9A 4M45A 1RCHA 1BL3A 4HHTA 1NK8A 3QIIA 4F2RA 4PQUA 3O4NA 3TABA 4FJGA 2LTOA 1LAVA 1L3TA 4FU6A 1QTMA 1GOBA 4DTMA 3SUOA 2QQSA 2BE2A 4N76A 4KTQA 2QK9A 3LGFA 4FL6A 3LP2A 4UQGA 5I42A 1XNIA 3O4QA 4CF0A 3E9GA 4N4GA 1LW0A 1GOAA 4OGEA 2X6NA 3ZSRA 3OYIA 4B9VA 4KKOA 3M8RA 3K5LA 1H3ZA 1W9HA 2KQ2A 4F8RA 5CY4A 5C42A 1TK8A 3KD1E 3AVFA 3RMCA 2KTQA 1CZBA 1J54A 2OPQA 3S3OA 3FDRA 4R5PA 2X4XA 3MXMA 5CIUA 4BD3A 3VQ6A 3OYMA 4FW2A 4CJ4A 4OPKA 1HRHA 1BI4B 1JXEA 2VWKA 4Z02A 4WE1A 2HB5A 3C94A 3L8BA 4HUGA 3TANA 3DLBA 4PY5A 2X78A 4CK2A 5KRSA 1GOCA 4E3SA 1X9SA 3L2VA 2GUIA 2IOCA 2F5KA 1X1PA 1HYZA 4H4OA 1N6QA 2A1SA 2KZMA 3NTKA 4IG3A 3KK3A 3META 1RTDA 4FK4A 4FZYA 4L8RB 2JLEA 4M3UA 2JGUA 3RWUA 2O4IA 4CHYA 3AVKA 1I39A 3MO8A 3IS9A 3PO5A 4BE1A 3VQ5A 1IH7A 2EFIA 1VRTA 2O4GA 4A4GA 3NF6A 4O55A 4M3RA 1Z25A 4Z4HA 3SUNA 1WSGA 5KTQA 4FZXC 3VA3A 4FW1A 4CEFA 3FC3A 3KLEA 2XHBA 4FYDA 1JLBA 4C5HA 5E41A 1B9FA 4C8MA 3DLMA 1G15A 4FJJA 1JLEA 4CJLA 2HNDA 3M9QA 2BANA 4E7JA 3CFOA 3G0ZA 3S9HA 3KK2A 1Q9YA 4DTSA 4K8ZA 3PMTA 4FVMA 4M42A 3VQAA 5C0MA 3V4IA 3I8DA 3MECA 1BCMA 3HP9A 4CECA 4W5RA 3QEXA 1NK0A 4PWDA 3C4SA 4KB1A 5KCOA 3CG7A 1RTHA 1ZBHA 3BGRA 2G8VA 4F2SA 1CXUA 2DY4A 3OYHA 2K3YA 5J26A 2L8DA 1QS4A 3ZSYA 4B9UA 4NYFA 3E01A 1Q9XA 4M3WA 3Q1JA 1VSMA 4DTUA 1SKRA 2RJDA 1L3VA 3OS1A 3HPOA 4KHQA 3LDSA 4DU1A 3AA3A 4HCCA 2EQKA 3FLGA 2VWJA 1OI1A 1EP4A 3ZCMA 2G3RA 1RDCA 3K5OA 2RI3A 3OY9A 2EKOA 4YNQA 1NK4A 4FLTA 2RHUA 3SUQA 4QW2A 2FHDA 4QQGA 2DFHA 3DRPA 2OPRA 3MP1A 1S1VA 4AHUA 4A4HA 2XK0A 1Z26A 1T8EA 4FJLA 3LLRA 2IGIA 2OA8A 4AHCA 3C6UA 3AO2A 3LANA 2HVIA 3SZ2A 4KHYA 4E7LA 4CJRA 2KFZA 2EQUA 2R58A 3TAEA 2IDOA 1RT1A 3LGLA
chains in the Genus database with same CATH superfamily
4O5VA 2HBJA 2XY6A 1HBXG 4GKJK 2VJ4A 3WNGA 4BE2A 1WJRA 2O4XB 2R5ZA 2W82A 1X2KA 1IKXA 2NRAC 2VONA 1LJ9A 2WOMA 2RV8A 4D5FA 1JXOA 3CCVA 2H94A 2MK5A 4DV5K 1J6ZA 4IWVA 1BHLA 1YX5A 3P7NA 1VRUA 4DQ2A 1WH7A 4BC4A 1KRPA 2JM8A 2YHBA 3VS6A 2RH2A 4RW9A 3L1AA 1VQNQ 3ISNC 3J8AA 1N6AA 2DF6A 5EZGA 4E9EA 3HSRA 2UUZA 4ENMA 1H9GA 2Z99A 1BDGA 4FX0A 1D1CA 2O8BB 1YJ9N 5FKKA 2BW3B 4CFCA 3I0WA 4KHNA 3CJCA 2KT1A 5HDNA 3HOYJ 3T8RA 1FWZA 1ZBUA 2X85A 2Z1IA 3I5UA 4FWPA 3NTIA 1HW2A 1IN5A 3KLOA 4XLNF 1K9AA 1U9NA 2D1XA 1YO5C 4C1NK 3NEUA 2ELHA 1GLDG 4U7DA 5GMKh 4KA4A 1C0TA 3P8HA 1U5SA 2F5CA 4B22A 1VUBA 1UG1A 1SD6A 5KN9A 2BY1A 3S1MJ 1BA1A 3K9TA 4I2OA 2GQVA 4B9WA 5FPDA 2DRKA 4A3MJ 3ABMH 2WV1A 3I33A 2HL3A 4D7NA 5IHIA 2DL3A 2R7YA 3HG9A 1GXQA 5LJ5j 1ZUUA 5GANg 4BQAA 1JRIA 1M3AA 3QO9A 3TOBA 1ZHIA 1FYLA 1A5XA 4EM0B 1U3OA 5C25A 1WSHA 3KK1A 1S8NA 2RKHA 2XDPA 3KP6A 2HOEA 5B1BH 4J8FA 1U4BA 3THVA 3HXMA 2Y90A 2F5EA 2GBZA 3CWUA 4JKGA 3LWMA 1MMGA 3TW6A 1LOTB 5LHIA 3BY6A 1LDJA 2CUZA 1MMDA 3M0SA 2MPXC 4IBNA 4LGWA 3E6CC 1B72B 2P9SA 2XY8A 3HJEA 1RAHB 3E6MA 5E1WA 3X20B 4PJOF 3DTKA 1SFUA 1K8AO 3LP3A 4MO7A 2CKKA 5FU6B 1E2XA 1I1GA 3SWNC 5D6WA 5FRMA 1R5HA 1SAUA 1BIAA 4CEAA 1LFUP 1IXSB 2HHVA 2IXSA 1QVGA 1WSJA 1JTYA 4DV7K 1YQLA 1MV0B 3UNGC 3CMEQ 3CC7I 3AVHA 3DF8A 5AQWA 4XRSA 4G1QA 1KQ8A 3IQLA 1VQ4A 3CCRQ 2GELA 2E35A 3L9FA 2JWKA 4M75F 1OX9A 2LZ6B 4YHHK 4QS7A 3MCAB 1S3JA 4AM7A 4FJHA 2XAFA 1YTAA 2GBYA 4G7HF 5EEGA 3HBTA 3MN2A 5TKWA 1B07A 2VVKA 2ZPIB 3VESA 3CC4N 4QS8A 1FP2A 3OA9A 4L5IA 3IMXA 1WX6A 2L01A 5D5VB 1YE9A 3RZOJ 4L9TA 3RCOA 2VYTA 4PGHA 2XMFA 3TW7A 1ON2A 3WTXC 1WA7A 1HK9A 5HNFA 2L02A 2QF7A 1OKRA 4UY8I 1LDKB 1RT4A 2RKIA 3K2PA 2QWNA 2H1KA 3VEWA 3CCLN 3QDKA 5FLXO 3GX4X 2G8KA 3V6DA 4LD6A 4JKAA 4E7SA 3K0LA 3RIRA 2DXBA 1FKPA 4HTLA 2MIOA 4AI5A 2KMTA 1RI0A 4PK4A 3JCMQ 4A3DJ 1KA8A 4K43A 2MC3A 2JG6A 3MWPA 3VERA 1QU3A 2KW4A 1G5VA 2W7NA 2W1OA 4II1A 5HDGA 4J9HA 1X6BA 2YUSA 2VWFA 1Y57A 3CCUI 4NB4A 2HMPA 2XO7A 4EIKA 2OPPA 2NRXA 4DOZA 4ESRA 3C7JA 2DEQA 3VA0A 2GOMA 1W36C 1PWTA 4X65K 1S3XA 3QPSA 4RBOA 1S72I 2O31A 2OTJI 4J9CA 3MEXA 2UUBK 4C0DC 2VJJA 2EK5A 1TNSA 3GL1A 2M0CA 5FRNA 4JI2K 1RILA 1YJNQ 4N56A 2RNAA 3H08A 2CUEA 2ACJA 3SQ2A 3CCMN 1J09A 3DLEA 3K10A 4XRFA 4LSNA 1OEBA 5AQZA 5IOYA 4XTVA 4KTQA 3A0HC 4C2TA 1KONA 4LF4K 2Q1NA 4OGEA 5LEKA 2O8DB 1XS9A 1SAZA 5L23A 3O1BA 2JPSA 4I98B 2EA4A 3TKYA 4AUXA 4HVUA 4I6ZA 2A1SA 1Q81R 4JX5A 2HQHA 3META 1T08B 2DX1A 3M9AA 3EN9A 4XKVA 3PIPL 2EILH 2E3IA 4OIQF 1TT0A 1HOMA 4PJOD 2V51B 3ABTA 4E7JA 2VYPA 1HKGA 3I8DA 4GLKA 3WODF 4E1JA 2P4RA 1MBJA 4Y3OA 1BU1A 1VQNT 3JCMW 1W7AA 3A5LC 3ZSYA 3B6CA 5GAEJ 1O3QA 2DOEA 4WX9A 3KZBA 3OS1A 2EQKA 2EJFA 1NK4A 4AU7A 2EPDA 2QQBA 3JB9I 5AZIB 4AHUA 2HVIA 2A6EF 2IGOA 2V9VA 3AG1H 2KFZA 5CPRB 4RCBA 5AQRA 1IKYA 4HCZA 1JJ2A 1AWXA 2K3FA 3M58A 4IEIA 4O6JA 2JRMA 3KJVA 2BVMA 2L3DA 3AG2H 2NOJB 1U8BA 2EIMH 5IYDJ 1AOJA 2XIDA 1K73R 3RTVA 2KK4A 2R5YA 2JA2A 2H6BA 3H5AA 4M77D 5IN1A 3ZX0A 2ZMEB 5HLGA 4CC2A 5K5OA 5JMVA 3J81E 4XH1A 1OISA 3VTIA 3LDLA 4E7HA 5FLXZ 2ZFUA 2FX0A 2IRFG 5AQXA 4LDWA 3NVMA 3T3FA 2E5ZA 1JLCA 1RR8C 1NGCA 4BRGA 1ETXA 2A3SA 1VQ5Q 1SKSA 1ETQA 3IDHA 3VV0A 1G6NA 4WXDA 2M0MA 4CJPA 2Y2ZA 2Y48A 1FBSA 1ATRA 5JVGL 1CF7B 4LG3A 3GZ6A 3MK6A 4WQ4C 3QICA 4Y33A 5M1NA 4CJQA 1Y6IA 2WBMA 2HZYA 2WV0A 4NL3A 1HNWK 1LVAA 2EW3A 1U6GA 4WF2A 4M77G 1K8AU 1C6VX 2KFDA 1MSFC 1NGIA 2WWYA 1LWCA 3L4IA 4E9HA 4M77B 2FO0A 4IHVA 3JV3A 2DJIA 1T03A 3CUOA 1I50J 4BAYA 4MQ9F 2ZSIB 1FMWA 4DFPA 4YG2F 2ROTA 1YJWA 4B1WB 3G4SN 4M75B 1NEBA 2P9KB 3ITHA 3IHOA 1E17A 3CMEN 4NCGA 2DYIA 2DVEA 3SJJA 2RVCA 1WFWA 1W7PA 2LJ0A 3M3ZA 3BT9A 3B8AX 2J7IA 3D5LA 2XICA 1OQYA 2IAIA 1KQ2A 3CJNA 2DMQA 1SANA 2KAFA 2FBHA 4B44A 5IT9O 2Z1GA 5TKYA 1X9JA 2NUZA 3G2BA 1LWWA 1WBDA 2DTUA 5D5UB 2A5YB 5CKHA 5MLCQ 2YKNA 1TUYA 2QK0A 2C0TA 3KYCB 2JMWA 3L2QA 4B9XA 2OTLT 4PJOB 1VQ4Q 2A07F 1OJLA 2XHCA 3KYDB 3NGPA 4FT4A 3DLRA 2O5RA 3HRMA 2M51A 3CQZJ 4HSBA 2ISYA 4F7UA 4OJRA 1I6HJ 4B8CA 2CZ7B 3T19A 1GFDA 5DDGA 4E7KA 5GAMd 4AD9A 2DW4A 3HKZN 1LWEA 3QPLA 4GY2B 2CFOA 2VC8A 1MWKA 3KIOA 5BPIA 2EH3A 4HUEA 3EE9A 2RQTA 2E7WA 5CVJA 2K3XA 3OYGA 3SMPA 1AVZC 4A3BJ 2DYRH 4BYYA 4FASD 3G4ST 2KROA 2PVDB 3E9PA 3WNHA 3W0LA 3E1SA 1VQ5I 3P9CA 3T0YA 1Q1VA 4OAZA 1ABQA 4C1NI 3NNQA 3IKVA 5CKEA 5H6RA 2RF2A 3BJAA 4DTJA 3QEVA 4M3TA 2EQMA 2OZSA 1IF1A 5J2MA 2KRCA 1UA0A 5LJ3f 1NH3A 3OVNA 5FJ8J 2UWMA 2PNIA 1VQ6Q 4IFVA 3PFYA 3ASMA 4IUTA 1TL1A 1QZYA 2YKMA 3LPTA 3CFRA 3RMBA 3CVTA 1TBXA 5LJ5g 1KFDA 3PL8A 3VQQA 1YJ9Q 3BPXA 4A5BA 2NNYA 3JSOA 3K5MA 5A0LA 1VQ9N 3SQ1A 1W7PB 4M3BA 2CSIA 1HUXA 4RKUE 2QI2A 1TT5B 2D5VA 1S9GA 1KFSA 3MX2A 5ADXH 1K9MU 2CP2A 3VRYA 1M1KO 1Y96B 2MABA 4ZJZA 4ID5A 4PLLA 3VDXA 1OYWA 3MDQA 1KC8U 2A7YA 1JL2A 3A03A 1KAYA 3B6OA 1UFMA 1BI3A 1D5VA 4S05A 3CJAA 4CJ3A 2FBTA 1TS9A 5K7ZA 3H6EA 4N9IA 4I02A 2O8CB 2O2OA 1NOYA 5CAIA 2FQ3A 1SRMA 4AFSC 1KGSA 2NVYJ 5J8FA 1IN6A 3HC7A 1BOBA 4BKXA 1TV6A 1BI2A 2QGFB 3BR2A 3QP5A 3DFGA 2W0ZA 3ZYYX 2MGQA 4B9LA 3SXYA 3JAMK 4PUOA 4WWCA 4CESA 4IZZA 3E2UA 3DLLF 2HBMA 2ZJ2A 4M45A 1GOBA 1YW8A 2DA1A 3SZGA 1IREB 3CC2A 3PO2J 4Y0WA 1GLNA 4KKOA 3WTVC 2NRTA 1K73U 3FDRA 3CD6A 2H09A 1JUMA 4N76A 1BI4B 2VQFK 2DMTA 1X9SA 3ZQLA 2CV0A 4H4OA 3KZYA 3TP3A 2J6FA 3CCMT 2RF0A 4JD2B 1HYOA 5ICEA 4A4GA 1ILYA 3GBGA 1P8ZA 5DM7L 2V9KA 3SFMA 2E2JJ 2I7NA 1B9FA 1G15A 4CJLA 3CMAI 1HJDA 1GV2A 3EL2A 4WQ4A 5GAMf 3C4SA 3T1BA 3ZMZA 3JB9J 2P9IB 3AAQA 4ZDLA 4J01A 2DD4A 2CW0F 2RJDA 2LK2A 5K1YA 2N8GA 4WYBA 3A8GB 2KPMA 2RHUA 4C8QG 1UDLA 2QCOA 3J7YP 2PX9A 1CZAN 5F1JA 2YPRA 3O9TA 4KUIA 1U78A 3OSSC 2YRCA 4NLBA 2NRRA 3CD6Q 4B4CA 4VUBA 5AQFA 1VSEA 3JCMg 3RKQA 3NH0A 3CCVI 4FJXA 4M7AB 2JN0A 1AWWA 4FHTA 3SCXA 1WJEA 3TQNA 5HRPA 2GWKA 3ULDA 3S32A 1U8RA 3NH2A 5M9OA 3D6RA 4RTTA 4BC3A 4EGYA 1MUZA 1O4XA 4G8XA 2OCCH 3IAM2 3U21A 1VQKA 4BR0A 3WTSC 1WXBA 3LYIA 2D5RA 3TAMA 5AN4A 4F7UF 3SQ0A 3DXJF 4JJBA 3S8PA 4C92E 3I4NJ 1PRLC 2QG9B 4BJ5C 4OPAA 2X48A 2KBTA 2JTFA 2LX9A 1AKHA 1ZBXA 2CP7A 4BDZA 1RBRA 3S1QJ 3VYTB 4V2FA 4FOIA 2XDVA 3JRDA 4BL0B 1JCFA 1T3LA 4JHDA 4PFPA 4G7ZF 3R3LA 5M1QA 4IXAA 3LAJA 3CMEI 3CJBA 1IB8A 3LP0A 3BTCA 1LV5A 5EZHA 4CHNA 5H6QA 4B3XA 2AQEA 1D1AA 5KGWA 1N32K 2O8EB 4Q47A 4KBMB 1P9QC 3SYZA 3MZYA 1IV8A 2DM1A 1MMSA 4XLCA 3CBOA 4CE9A 5J1EA 1IN4A 1EH7A 5IP9J 2FNPA 1UJ0A 3U3YA 3PIPA 4C23A 1K78B 3JXUA 1WRJA 4BY6C 2A08A 2LH9A 5TGTA 1Q81C 1KHIA 3K2ZA 5KE2A 1UB4A 4LF8K 1BU6O 1ARKA 3QJYA 3NGZA 1YNZA 4B48A 4KNYA 1X69A 3R6SA 4GY5A 5GAEP 5GMKj 5LBQA 1IBLK 2F2WA 1WGXA 2A41A 3OYFA 3KP5A 5CZ1A 3CCLI 3H8ZA 5FPNA 5J2PA 3CC2T 1XQHA 1X3ZB 4IL6C 1K7AA 2W57A 2YHXA 3G6EI 3F6VA 4IPAA 1PUFA 1YQMA 1V3FA 4UVAA 5LL6Z 1Q86U 1NK9A 3LFKA 4DU4A 3KD5E 4OF1A 3JCUC 4FLXA 3KXTA 4I2QA 1LFBA 2LKSA 4N4NB 3K9JA 2V7YA 4XIDA 5E84A 5IH2A 4CBWA 4FT2A 3KLFA 4LLLA 1N8RR 1BQNA 3KHYA 1SAXA 2OZUA 1NGBA 1U2VB 1W0TA 4UUSA 5KN8A 3SNNA 1S5JA 1A04A 2YNIA 2LF8A 4ZDOA 4Y91A 3ENOA 2P5VA 2DFUA 4ZYDA 1QW1A 2E5QA 4OKKA 1YI2A 4CYCB 3C7NA 3H92A 3R6NA 1QLYA 2CZ1B 3WXJA 3SWNB 4LY7A 2NZTA 1YFNA 3GTOJ 1E4FT 2E1MC 1JLFA 3THKA 2YV0X 2DILA 1MPGA 3R61A 4EMKC 3OS0A 3H41A 2O88A 1M1KR 4ITVA 4M7DF 1EX4A 3VPRA 4PQUA 1ATSA 2QWMA 2OBPA 3COAC 2IBDA 3NGIA 3G1OA 1LWFA 5FU7C 1IRFA 2CS7A 1QRYA 1X3NA 3M59A 1SL2A 2EB7A 1YP5A 1T3VA 3HGYA 4A4EA 4BR9A 1TYQB 2Q31A 1B6AA 1MJBA 1WHHA 4AVPA 1OZ3A 4EP5A 3RBBB 1V4TA 2GQQA 3FEOA 2L9RA 1N8RC 2ECZA 5BN9A 2ZD1A 2YJFA 4CUGA 2L7KA 1B9DA 4MDWA 5C12A 4F7UG 2X3WD 4DTXA 1VFCA 2M4KA 1L3SA 3FHFA 1M8MA 2KQRA 2E6LA 3QB0A 1HNZK 3LPUA 2XAQA 4CEBA 4XLAA 1AKHB 2BZXA 4DSKA 1UGPB 3VETA 2P4TA 4HV6A 3SI6A 5D4RA 4JI8K 5HRSA 2VQGA 3CCMQ 1KD1U 2NYXA 2V9PA 3FRNA 3V1RA 1VQ4I 4FIBA 1ACMB 5KK1A 3SQNA 5J3BA 2E5NA 4AIDA 4FWMA 4GVEA 1N9SA 3HL8A 3ZX2A 1Z7LA 4M71A 1M2VB 4DBHA 3LFUA 3T69A 3MP6A 1KQSM 3I4MJ 4JI3K 4CF8A 2R0QC 2DOFA 1RAIB 4GNIA 1YG2A 3GLXA 4MDAA 3ZLJA 1MDMB 2A68F 2CREA 1BBZA 2HDWA 2F6CA 2FBKA 3CCLT 4FU6A 2OX7A 4DTMA 5I42A 2WY7Q 3ZSRA 1LW0A 3DAWA 5C42A 1NG9A 4HUGA 1ENHA 5AQLA 4BB7A 2JHJA 3QWXX 2IOCA 2B86A 5JLHA 4IZ9A 1ON1A 3JRCA 1Q81O 2O4IA 4A3CJ 1PD0A 4BBSJ 1I39A 3MO8A 3GO5A 3HKZA 2DD5A 1VRTA 4QS9A 3EHRA 4XN3A 3EFOA 4FJJA 3KPHA 2BANA 4EJYA 2LF7A 3ECHA 4DR1K 4A5MA 3MECA 1BCMA 4QPQA 2LTPA 2V1XA 3M8FA 3CXCM 3RQ4A 3J80Z 5FKOA 2CSQA 2DBMA 2VL8A 2AZSA 5IHKA 3I0TA 1M90C 3BFMA 4IOAL 1S1VA 3LLRA 4QKUA 1PYVA 5LD2C 2RPNA 2QW9A 3LGLA 1TWFJ 1GXIE 3TDUC 4OMFB 2NUBA 3ULEA 3QEWA 2CP6A 4E7ZA 4A0YA 3LSTA 1N33K 3AVMA 1MKMA 2X6XA 3ABKH 3R9PA 2V52B 4M74A 1I1SA 4E89A 3OJSA 3C1DA 1P2FA 1IN8A 2I5WA 1R0BG 1BB9A 3ZT0A 4I9QA 3CQYA 1KG3A 1L3UA 2PZSA 2LMJA 3S16J 3GBTA 1VQON 1J5EK 5AYFA 1U0JA 1QHGA 3KKRA 4ZZDA 4OLBA 3NRVA 1VQ6N 4UUVA 4CHPA 2HXOA 4PJOA 1KVCA 2ATCB 3OTOK 2EX3A 4F7UE 1PNJA 2PYLA 5AQMA 4KICA 4ZYHA 2IP2A 1T05A 2DJQA 2V1QA 2QKBA 3PLAA 1O3SA 1WSFA 3RTRA 4CHOA 2XSJC 3M7GA 4RLQA 4F3TA 1MW7A 5GAGJ 2P5KA 4E9FA 3PX4A 3TP0A 4XMYA 3LSGA 1TC3C 3TR8A 4CERA 2Z33A 3JAMO 3WVEB 5LMNK 4OAYA 1TUGB 4W5QA 2VUMJ 5AIQA 2D4WA 1S6LA 1XMOK 2RD1A 1MMNA 5DLOA 3QO3A 3NHGA 4MIMA 4M3DA 4DR4K 1LPQA 1KTQA 3OV8A 1RT2A 4EJZA 1PSFA 1VQOI 3DKXA 1IRZA 2G6FX 2P7CB 3QINA 1FYKA 2EJRA 5GMKm 4K42A 1AOYA 1QSLA 2BH1A 1UHWA 4A3GJ 4Y13A 1FSHA 2R7UA 1VQ7I 4JJCA 4O0IA 1PM3A 1EWRA 4ZHRA 4BG8A 4BY7J 5AQTA 4DQQA 5HODA 1YRNB 4IOAF 2E1YA 1YQAA 4AT1B 2IGMA 2FPEA 3RSEA 4DQSA 2ZC2A 4TVRA 1R9TJ 1UGQB 3CMMA 3M07A 1S72Q 2CQNA 3FFKB 4M78B 4CJWA 1WJAA 1BKBA 4I76A 2QA4Q 2FQ4A 4LC9B 3VEYA 3O8VA 3MAQA 2QYZA 2RHKA 3M4YA 3HSTB 1FSEA 1TG0A 1GL5A 4MZMA 2GXGA 2DL5A 5FKNA 4H5RA 1Z9CA 4H5TA 5CYVA 1YHQN 1W2BA 4BY9C 2KT0A 1RUNA 3P83D 5FKLA 4BQZA 2Y9ZA 2VODA 1VIFA 4NYNA 2LR8A 2DXIA 2BTTA 1TLHB 2VIXA 2P8TA 4XSZF 4Y7NJ 3OSFA 1YI2T 4AFZC 4N4HA 2HQNA 2CQ7A 1Y97A 1JUPA 2UXXA 4E9GA 3ZCOA 3PIOF 4CJKA 2RQPA 1XDUA 1LDDA 2ZJPL 4QPOA 1SFOJ 1LVKA 4HUFA 4CFBA 4G6DA 1JKQC 2M0YA 2E2QA 2R7DA 3ULEB 2I5JA 3S15J 3SK3A 3H0HA 5IT3A 4XTYA 1J75A 3MN9A 4ZYGA 3BLYA 2D2WA 2M8GX 2HBKA 2BUDA 3CDLA 4RM2A 2B5JA 3RSEB 1M2VA 4Y52J 5HY6A 2DETA 1Q7YO 1N77A 3GFMA 3KYLA 3VS1A 1S72N 1BOAA 1C0FA 3VYRB 4AC0A 2ZKZA 4EM1A 2CGKA 1RAAB 1TQMA 2HWVA 1ZGWA 5IPAA 2X1CA 4RB3C 3QIOA 1N8RO 1LJOA 3EE8A 3FXMA 4OP0A 3DLAA 2VUBA 3VQ9A 3QWLA 4KH4A 3INZA 4NCBA 3ZR8X 3L42A 1R1UA 1XHXA 4XU1A 1FT9A 4RUGA 4CHUA 3BR3A 1JT6A 1KYWA 2P9LB 5FGMA 1OR7C 4GVMA 2WB1N 3OYAA 3TAQA 2K9GA 2O3FA 2FRYA 5CKFA 4KRFA 1S9EA 3MMVA 4CD3A 3K4NA 2DT7B 4JI6K 4KGXB 3QU6A 2KHMA 5M1OA 3K58A 3VSLA 1JL1A 4DTRA 2GQIA 3REOA 4XTUA 2NOIA 3QPHA 3DRRA 3RKYA 1G8XA 3A5NC 4AHSA 2F8SA 4HX7A 3G1LA 5FLXE 4NHJA 3SEZA 2KIUA 4Z4EA 4RAGA 4BH9A 4RA2A 3SYTA 2IA2A 1V29B 3MEEA 5AQJA 4NUBA 2F5FA 2HF3A 4G6QA 2JMAA 2Z1HA 4CIFA 2L3PA 1RABB 1LNXA 1NK8A 1DDNA 1L3TA 2DTIA 3E9OA 3KD1E 3AVFA 1J54A 4JDSA 5A2QK 3KZIC 5KYXB 1Y64A 3NVKA 4V2SA 1SFXA 1X1PA 1JCGA 2RM4A 3EPZA 3P9IA 5K5RA 4BHCA 3CQTA 1GLJO 3OW2A 3IS9A 4EJTA 4O55A 3FDYA 1Z6TA 2P9PA 5KTQA 4EATA 4XKWA 4FW1A 2FSJA 4RGSA 2L54A 1T39A 3CMAN 1WIEA 2CUDA 3KK2A 2O03A 3HFOA 3V4IA 4F04B 2NOHA 1ZKGA 2BHYA 1X1AA 2QSHX 3K6GA 4L9JA 3GFLA 2L8DA 1Q82O 4MZPA 1K83J 2EJ9A 1JB0E 4HWIA 2RI3A 1R00A 5CR4A 4FLTA 3E6BA 1F1ZA 4BS9A 2YX4A 1W70A 5LRSA 4AM6A 3EYYA 1IGUA 5HOOA 1RT1A 3EGUA 2RI2A 1FYMA 1NMNA 3H0FA 1WH5A 4HNTA 1JT0A 1P6RA 2H8HA 2XC7A 2FBVA 5KYUB 4OMQA 3RR8A 3LWIA 1U5TA 2AS5F 4BGDA 4C8QE 3UB5A 2XAUA 1EZZB 1HNIA 3QEIA 4BY1J 1Z3XA 1PJRA 2P0QA 3CC2N 1XHZA 3VYSB 2QWWA 2BY3A 2CYZB 3D2EA 3LWHA 2PUKB 2PU9B 2E1CA 3BDDA 5DEQA 1BR1A 5C6SA 3DB4A 4CJUA 4JN4A 4DV0K 3IHUA 3S2DJ 2Y30A 1PP7U 3KTQA 3I56I 3E5XA 4N0AC 3VSKA 1TQPA 2P9KA 2F5VA 4WFNL 4AI4A 5HS7A 1V1CA 3HM9A 1W1FA 1RADB 3F5TA 1ZG1A 4IRHA 2HI3A 3URGA 5GMKe 3DLKA 1UWBA 4FWKA 1DLOA 3ZX3A 1TUUA 1ETKA 2K9MA 4Y1DA 3REBB 3EGDB 3PM1A 2O8EA 3OYLA 2NOBA 1FPQA 2CGPA 1QWEA 3UKUA 3LSMA 4LLNA 4DS4A 3FWEA 1MBHA 2JTVA 2NUTA 3O08A 2DDBA 1BW6A 3CDIA 2FXUA 2XVCA 1FEXA 2HQEA 3FXLA 1VHXA 2DDAA 2WY8Q 4G12A 2MBFA 4HVJA 2E70A 1VAZA 4LD9K 1VOMA 4JYKA 1F1BB 4K11A 5LGTA 4KMFA 1TOVA 1Z3YA 3A8LB 3V42A 1KG5A 2EIFA 2RHXA 1SPKA 4QAGA 2JA8J 1M27C 1SHFA 3CCUN 1SVMA 4PZJA 1EV7A 3C6HA 3BDPA 3QYFA 2CUJA 1X9WA 4CH7A 4DTNA 3UATA 1RBUA 1D0XA 3O5BA 3S2HJ 2XD0A 4BUGA 3QKJA 1ZELA 5LFAA 1B4AA 3JCMP 3CD6T 5E3LA 2EAYA 3CJ7A 2M9HA 4CBUA 2KRMA 2ZXHA 1E3MA 3ZQ7A 4EMGA 3E5UA 4RAFA 4FM4B 2MH9A 3BY5A 5EJCA 4RS8A 2ROLA 3ENHA 1NYGA 3RPUD 2E6MA 2NVTJ 2EFNA 1M8VA 4H03B 2DIQA 2VBYA 3F8BA 2OPSA 3MEWA 4HSRA 1R77A 3ZFJA 2DMPA 3OIOA 4DMNA 3T5XA 2R7QA 4XN0A 4A6DA 1TL8A 3UIQA 1LEAA 3J7ZO 4A2UA 1K0SA 3RI4A 1NGHA 1S72A 3QOEA 4LLGF 4DUYK 1KXPA 5EEHA 4KGVB 2XI9A 4GBQA 3IUOA 4ETSA 2D0BA 3VQEA 2JNGA 4IFEA 4ZYEA 5GJWB 1RBTA 2DZCA 3QRFF 4P9FA 1S9HA 3WHBA 4D8DA 1KLNA 2ETJA 4KV8A 3SV4A 2PQ8A 1SL1A 5B5EC 3K1MA 3DOKA 3REAB 4J2DA 3CCSI 4DEXA 2DBBA 4BQOA 4I0BA 5CJ9A 3CM6A 3WT0A 1DPRA 4KH0B 3PO4A 3SEQA 1YRNA 2WBNA 5B8HA 4Z4IA 4AIAA 1GLCG 3CC4T 4EJWA 1X3WB 3BG9A 5M5YJ 4B9TA 3ZT4A 2RQVA 4OB0B 3S6WA 3VW4A 3ZMDA 4HF0A 3PX0A 3E3VA 2LBFB 2GXBA 2ZJQL 1R23A 4C0ZA 1FOYA 1X3MA 2CQQA 2HYFA 3C18A 3A0IX 5H2FC 3RMSA 1ZBLA 4A3JJ 5GINA 1TYQA 3CC7T 2YR2A 1WZOA 1C1BA 2FYKA 4CEZA 4I6MB 2R7TA 4M63C 2L7ZA 3HOXJ 5EDNA 1YJNA 2KIQA 2CDTA 3E6DA 4X9DA 1H1VA 3EG3A 4BWJA 3PUBA 1B8IA 4H0VB 2QTDA 4KI4A 3PVQA 4CCHA 3F23A 1AEYA 2FZKB 1VQ6T 3G71N 2Y0SA 4A2BA 2IIRA 1S7EA 2M7AA 4N9HA 5GANh 1XNQK 1BIUA 3RSNA 2HVRA 2NVXJ 4H0TB 4IQ4A 1YW7A 4DCHA 4HEA2 4ILGB 1CLQA 1JJ2M 4D7MA 1GLEG 3VF2A 4E47A 4RGUA 3FB9A 4XQFA 4XH4A 4XNFA 2QAZA 4B9MA 4P9UA 1SC7A 5SWMA 1Z67A 1HLVA 1RRQA 4MDBA 3FHGA 2G7HA 2M1BA 3O4NA 4FJGA 2LTOA 4GDFA 1XN7A 2KXCA 3HB9A 4PCQA 1QVFP 1TUDA 3GYHX 4LIVA 2X6NA 2PMUA 2WAFA 3RMCA 4DZJA 1NJWA 5KQDA 3L8BA 2HB5A 1MDMA 1X6OA 5FKMA 3A5ZB 2F5KA 1N6QA 1I5LA 1RTDA 5J1YA 1E0EA 3H45C 4BRLA 4M3UA 2HSTA 2MFZA 4FISA 2K7AA 3TCJA 1JUSA 2KMUA 1KJWA 4YFKF 4HAMA 4BJ6C 3FC3A 4FOEA 4GLMA 3LSJA 2HNDA 1G2BA 3CPWS 1ZK8A 1W4SA 4JQFA 3CF5L 4TV7A 1O57A 3NFCA 4DOWA 5JLXA 2QZ8A 5LHHA 3BR0A 5C10A 2IPQX 1QZ5A 2HSEB 4IOXA 2QWPA 2VWJA 5DCMB 3O9UA 2P6TA 3O2PE 4D1QA 2KISA 2D1HA 2VQLA 4CJRA 2R58A 4FJ7A 4BXFA 4J00A 3DQVC 2QM1A 1G2HA 1U1TA 5GTIC 3S1NJ 1V76A 1DEJA 2W6KA 4A0XA 5M1KA 2LVMA 3LX7A 3R2XC 3SFIA 2NUTB 2F4OB 3M8JA 4OMZA 1Q7YU 4M7AG 3GTJJ 1M3BA 2QKLB 3PSFA 1X1BA 4JI0K 1G3WA 3LDNA 2O0YA 2AQFA 3R0AA 4BDYA 1WJBA 1VK0A 2ZF5O 4EHTA 1N27A 1DKGD 3FJPA 2DI3A 3NGYA 2DTRA 2H8WA 4DU3A 2QQAA 2FRWA 4PFZA 3S14J 1NGEA 3CIPA 1D8JA 1EKEA 5GIPA 3HM5A 1OVQA 1K4US 3LWFA 1IJJA 2PZ1A 3TTFA 3MN6A 3ZQFA 4YDUC 1X9MA 3IAYA 1U45A 1TK5A 4R1HA 3CMYA 2PEXA 2R5ZB 3SV3A 2OF7A 5AQHA 4CZEA 3TSWA 1ZX6A 4DSJA 2PBDA 2KVQG 4QSHA 1JBMA 1T95A 1UJ8A 1CF7A 2HHWA 1L3LA 3CC7A 4CFDA 3THYA 3G71I 4QVCA 1YITN 1FMKA 3VENA 2IS3A 3OBWA 3QNOA 1J7KA 3M8PA 2X9HA 4CJTA 4U7BA 6AT1B 4Y17A 3I35A 1Y1VJ 3X28B 2VG6A 4DR2K 3FZLA 2V1DA 5LJ3h 2YS9A 1SUQA 5EOYA 4ZGDB 4PJJA 4YELA 2HS5A 1I5OB 4M9XA 2AHJB 2DXUA 3HRSA 4GO1A 2QA4I 4JI1K 3EY1A 3M54A 1J0RA 1XB4A 3BG5A 1IAWA 1PCXA 3Q7BA 1ZRCA 3MCPA 4OWRB 5ED4A 2HZDA 4YOTA 4OOIA 1ZG5A 5GAOr 3FZKA 5IWAK 5B1AH 3RYPA 4BHPA 1KG2A 4M77E 3SPZA 5D6XA 2E12A 4M7AD 3OMCA 2CT4A 3R1XA 1QVFS 2Y0SN 1WB9A 1YCYA 4PSXA 2P9SB 1RDUA 3DPLC 3CW7A 5CVRA 3VEPA 2ETHA 3ISPA 2MD5A 3M56A 2FBIA 4PJMA 4AHRA 4DTPA 3HPHA 1VF9A 1A6QA 3V8LA 2DOAA 2K3PA 2DA4A 4AHVA 2W41A 4RTYA 3L00A 5GAN8 5LMUK 1ORPA 2OTLQ 3LA2A 4M3YA 1WXUA 2E1HA 2CW8A 3AA5X 4M78E 1MGQA 2GM4A 2JVHA 4B3SK 2MMPA 4CIGA 1MV3A 4DK9A 3AY9A 1Q8IA 3ECOA 3EGXB 2H3JA 3JB9D 4NC8A 4L5JA 2LMDA 2NNNA 4F14A 4BRCA 3LDQA 4C8OA 3BC8A 2RMOA 2QKKA 1ZR2A 3LAMA 3DYAA 1S1NA 4E7IA 4PNOA 1QWFA 1MNMC 5DM7F 4LUDA 3NQOA 2RI5A 1Q86R 4DHYA 4FJ9A 1KU7A 4DBRA 3O9QA 4XR6A 2O8DA 3JCMf 4O8UA 3FXRA 4L6V5 2M30A 4C92B 2JM9A 4M7AA 3FE1A 3NPFA 2L2OA 2NOLA 2BGCA 1RAEB 5ECAA 1QVGS 4O5FA 1SD4A 3SD4A 4RTFD 2JHNA 1RDAA 1R1TA 1HA8A 4CK1A 4Z2YA 4BBRJ 3OWTA 2DIGA 4CDGA 2BZTA 3SFZA 1I0CA 4K41A 1Y96A 1YUWA 4FLZA 4HSTA 1Q86O 1R4MB 3DTEA 1R58A 4WXHA 4CGGA 3P31A 4IHYA 2HPIA 1NGGA 3ZOBA 1M3QA 2PI0A 3SAFA 3ENBA 5AQNA 3JAMZ 3PQJA 2VXEA 4B08A 2KNBB 1WLJA 4B1XB 3AO3A 3ZBDA 5LJVA 4V2GA 4UB8C 2R92J 4M7AE 5EF6A 1IUYA 4EZ9A 5AQOA 1X6GA 2IVNA 3WXIA 5KRTA 1QGPA 2LCLA 1UHSA 1QO0D 1BIZA 2YLBA 2FLOA 4FJIA 5E8GA 3TU5A 3CCJI 1JGSA 1UHCA 3HTRA 1B72A 4JAXA 4XK8E 4A3KJ 4OMMA 3TMOA 3HYFA 3M53A 3GTPJ 1C0MA 1V4SA 5HK0A 1YLFA 2MD0A 4N0AA 1KD1C 3CCEQ 4XTXA 1G59A 3VS0A 1P92A 5AFUH 4Z02A 2LT4A 1JXMA 3CLOA 5F2RA 2HOAA 3L2VA 2Q0OA 5FPEA 4J9FA 1BG3A 1BOTO 1WDXA 1SD7A 4CZLA 3CC7N 3QOPA 1Y71A 4Z4HA 3TO9A 1Z25A 5E41A 4C5HA 2ZSHB 4JK7A 2VGNA 4BGBA 5L3GA 5DYMA 2CH4W 2CP5A 3HP9A 5HS9A 2IS1A 3I9QA 3I9V2 1K73O 4RCHA 4X62K 4NYFA 3G25A 1WI7A 5JR3A 2XG8D 3H0DA 4E6KG 1PKTA 5LJ5f 2EKOA 4YNQA 2HAXA 2FHDA 4U0VA 1I4K1 2I8DA 2R7WA 1KEAA 3O9SA 5DCMA 3LANA 3CJ9A 3W2WA 4E7LA 1JQQA 3BZ6A 4ZN3A 2V7ZA 2IDOA 2RHZA 1BWFO 4CGDA 2OD5A 5BPDA 3NE6A 3MHXA 2JT1A 3ERED 2AO9A 4M7DD 1ZAOA 3A8YA 2BW3A 1ZLJA 1VIEA 3MKZA 2VBXA 4EJOA 4CGJA 3TSUA 4FLUA 2DL4A 2LOOA 1XC9A 5BN8A 3K4JA 4CI6A 5LJWA 1MBFA 3C6TA 3I59B 1WVRA 3EZWA 5J4YA 5CQEA 1VQKT 2W6LA 1AA7A 5J2NA 2RN7A 2KHOA 3DXMB 2R93J 4ESFA 1D9DA 2E6NA 4QCLA 4ZZLA 3IWFA 2BGGA 3JCMd 3AL0B 3MEDA 1KZHA 4YFNF 1QQNA 1BA5A 3L2WA 2P9UA 4H5VA 3AV9A 1JKPC 1VSLA 1X3UA 3AT1B 5ERIA 5F6FA 2O8XA 1ZG3A 4JRQA 3CCQQ 2H6CA 3EG1A 1O7FA 3DRSA 2K9QA 2RAEA 2KI7A 3UWNA 4B3TK 5JICA 1VYVA 1XD7A 5CLSA 3TGNA 3SJHA 2P84A 4BRDA 1Y0NA 2VQCA 4X0GA 3UA6A 3G10A 3PY8A 1K61A 2ZPFB 4MFDA 1N34K 1KVBA 2VE9A 3L0QA 3HP6A 2W42A 3SHFA 3F9KA 5D6YA 3EGDA 4KIBA 1YJWI 1RLPC 2B4JA 1ORNA 3DBRB 1YJ9T 4XLPF 3OR2C 3IAS2 3D5SC 2JJ9A 5K14A 3RNJA 1VQ6A 3IV5A 3WG9A 2YHAA 1DGWY 1ABOA 3CMAT 1ZBFA 2DT5A 3LCNA 1LW2A 4G9ZA 1U6ZA 3KEQA 4YFXF 5GAOl 3I64A 3CJRB 5JS1A 1S22A 1CZ9A 1XQPA 5HS8A 2DYBA 4PJOE 3P8DA 2GX9A 1SKWA 2KYBA 1APLC 2FUG2 1MA9B 1WQWA 5HKCA 2D6FA 3ZEHA 4E6RA 2ZPGB 1MH3A 4A93J 2XDBA 2MC4A 3GNFB 1Y0UA 1A5VA 4B9SA 2YG9A 2Y4XA 1WSIA 1YIJA 1Y39A 2Y1IA 1RUOA 2IPOB 4AMCA 1EFNA 3E1YA 3IC7A 4FE7A 3JRGA 3KUFA 5J1UA 2HEQA 1TTHB 2Y9YA 4JS5A 1FBQA 3X2QH 3SHWA 4HF1A 2UXNA 1FOWA 2RQQA 1ZQ1A 1WJQA 5KHDA 1ZHFA 2H8RA 4HTUA 2E1MB 4EA5A 3SQ4A 4BVOA 1MD0A 2EYQA 4FK2A 3FX3A 5C2FA 4IUPA 4JLHA 2CQXA 2I10A 3Q0WA 2Y4YA 1TWCJ 1KQ9A 1HYSA 1P7MA 2KDOA 5AQQA 4EMKB 1SEMA 4Z88A 4AG2C 1HKQA 3FZVA 2I7PA 2P5GA 3VEOA 1ZN2A 1OOTA 3ZSOA 1XMKA 1Q7YC 4O0JA 1LCKA 1Z9QA 1WJSA 1H3HA 4LDVA 5KYWA 2HDDA 3MQ0A 4ZNXA 3QZ9B 2LX7A 4J2AA 1KFZA 3CCQN 3VS7A 4BI3A 2WAQN 4OFAA 3NFAA 2IEKA 1XCVA 2P9PB 2QEXN 2D1KA 2YRDA 3CXCP 2RK2A 2ASOA 1VQLT 3MCZA 4KO0A 4PKCC 1PD1A 4CD1A 1YWOA 4ENJA 1JEGA 3Q0UA 3AKZA 1JHHA 4ON0A 2MI6A 2H3GX 2HHUA 4QTRA 1BIBA 4JKDA 1D0YA 5T7BA 4M3FA 3H36A 1LB2A 4GFBA 3TREA 2SEMA 3VODA 4LD0A 3W6KB 4CZJA 1GT0C 4IRIA 1HPZA 1M2OA 1TVRA 3GDQA 2M1HA 1PVSA 1MH4A 3QLHA 3ID6A 3RPUA 2RQWA 3AGKA 4U87A 4F4KA 2RHIA 4M9ZA 1LOJA 3ZSVA 2VOOA 3CM5A 4P5OA 1NKCA 2QEXQ 4YRVA 3OYDA 4C92A 1WWXA 1H0MA 2P51A 1GLLO 4ELYC 5LJ3j 1Y7XA 4XU0A 2OAWA 4BRMA 3S3MA 2OFIA 3OL3A 3RMDA 4XK4A 3THYB 4FLVA 2G8WA 3KTUA 1C0GA 1VYTA 2LLKA 2FA5A 4ID1A 1IRXA 4YPRA 1S1TA 4A4FA 1NGAA 4JV5K 4HDUA 4UOBA 4LFCK 1Y1WJ 4FYVB 1VQ9I 3MXJA 4U67L 3HHHA 1UFFA 1VQLN 3WGIA 3HOUJ 3CCRI 2QVOA 1JCEA 2FF6A 3SWNA 5LJ3g 1WUAA 4BXUA 1UECA 4CGHA 2IGKA 5EVZA 3EUHC 2GWJA 3SLCA 1BO5O 4C8NA 1VQ7A 3Q7CA 3F10A 1I8FA 2NS0A 3TABA 2H56A 4EVIA 2VT3A 3KVGA 4NQWB 2DTOA 1OCCH 1TWBA 5HNHA 5CKDA 2HVQA 1G99A 4AQYK 4WE1A 1P7IA 3PSIA 2F48A 4ESBA 3F21A 4Q4ZF 4DV4K 2XAHA 2XKOA 1ODDA 2CH0A 4L8RB 3M1FA 3RWUA 2M2EA 5IY5H 2NUPA 2BHZA 3RYRA 3EKUA 2VGMA 4FZXC 2W85A 1UHMA 1V5GA 4FYDA 1OX8A 3CCLQ 2IS6A 3EQLF 5DM6L 3IKTA 3CFOA 2OAUA 2W4SA 2OC6A 1RTHA 2IGNA 1WHJA 2OZ6A 2RE2A 1H641 3CC4Q 1NK2P 2FU4A 2G3RA 3HFNA 4H5WA 2XPWA 4A54A 5AQSA 1Z26A 1T8EA 2IVPA 3FK7A 3VWBA 2OA8A 3W2AA 4V19K 3CF5F 5E17F 1ERDA 4KHYA 4OMYA 5LL6S 1YITT 3EG2A 1R8OB 2G9WA 2FZGB 1M1KU 2E8AA 2EFWA 3A8OB 2KLOA 4EV0A 2QTXA 4IUVA 2NLUA 2W40A 3AO1A 4O44A 1BI4A 1YYVA 3CCJT 4M75A 4U88A 4IOCF 4FPAA 5HROA 5JI6A 1USSA 4L9VA 3FXKA 4FWLA 1K8KB 3O5ZA 2GNCA 4EGZA 2NAZA 1F4KA 2Q97A 2RJCA 1FXXA 1VQMN 5GIOA 4CGZA 1R71A 4QLCU 5A2QE 3KWGA 2K4YA 2LCCA 1YXQA 3LDPA 1RT7A 4CZIA 3KE2A 3S2WA 3RVCA 3AARA 3RR7A 5SZTA 3MZHA 5E8IA 4CW7B 3HZ6A 3BQZA 3M55A 3EAEA 4LDYA 3I55N 4JOMA 4CIEA 3CPWA 1V5EA 3ZRGA 2DO7A 1F36A 4ASNA 3ZMSA 1IXDA 5CK9A 4Z4CA 3I58A 4CO8A 5HRRA 2PLYA 2O6GE 3M57A 4CYCA 1QP2A 3C7NB 2BZYA 2JZ2A 5KPTA 1K8AR 3SDBA 5GTHC 4TSXA 2NRVA 2DXCA 2QEXA 1KG7A 3B6PA 2ZJRF 3QERA 4MGRA 4PDKA 3K4KA 1MUYA 4HX8A 5GAOm 3V9ZA 3PIOA 4I0AA 3VMFB 2OTLN 1NLVA 4GV6A 3BW1A 4KISA 4X1VA 3I0RA 4H5NA 1X1DA 2PJRA 1K6OA 2E3HA 2YUPA 4J2EA 1D3BA 2VKVA 1QQMA 1FW6A 2K6DA 2ZJQF 4ANJA 2G8IA 5HLIA 1W4MA 5CVUA 2HVHA 5LGUA 4IIMA 4II2A 3WHCA 2NS7A 5BRDA 2ZXWH 2BV6A 4BWMA 1RBSA 1IZ1A 4BDPA 4CCMA 2YRVA 2JA7J 1KLMA 3DLHA 3TTCA 1I27A 3EYZA 3CF2A 2DTHA 4DR5K 5FB2A 5HCKA 1UELB 2FL7A 1VQLA 4AWXB 2YG8A 3O8HA 1XSDA 1SD5A 1HNXK 5BPLA 3H3OB 4KT6A 1POGA 5E18F 4JKBA 2QKMB 3TOAA 5GAMe 1Z0XA 3BDLA 2WSFE 5D3GA 2E36A 2CYYA 1W1WE 1VQNA 1GLAG 1N25A 1VQKQ 3GBQA 3KK7A 2YHYA 4PKIA 2XPVA 4HQMA 3GTLJ 4AM3A 3NH1A 1S1UA 1VQ8I 3CCUA 3VQ8A 3K70D 3S3NA 1J9IA 1BI0A 2E5LK 3SUPA 1HPMA 4BNCA 3NDKA 1UUEA 2P9IA 1IRGA 4B1UB 1VQ9T 1T6DA 2RPIA 4CK3A 1FOXA 4XEIA 3H5RA 4C5EA 4FYYB 2HTSA 3SAHA 2R5AA 1OCOH 1FOKA 3VS5A 4C0DB 3A98A 3W3DA 1XGSA 2MA3A 2V8IA 3CHWA 3IG1A 4RW7A 1DP7P 4HYEA 1X19A 4O8KA 3F8FA 2YX6A 2W03A 2K5LA 1TKXA 1IBKK 2EV6A 3C3WA 4ELVA 3I3LA 1B8IB 4B43A 4GV9A 2Q0UA 4R0KA 4OPHA 1ZXOA 1WJDA 2ZXJA 1FTTA 1RRJA 4MLHA 3LL7A 1EF4A 1J9AA 4PJOC 4JBAA 2EHGA 3LNQA 4A4KA 3E7LA 1ZH5A 1W5TA 2LQ8A 4IHSA 2PAVA 2P0KA 4IJNA 2DK5A 5CE3A 5BPMA 4Q5SF 3EUHA 1RDWX 3L2UA 4L5GA 1RETA 2OYQA 3CO7C 3CCRN 3FLCO 1NK6A 4B8AB 2P6SA 3GTQJ 1BCOA 4XBFA 1RTIA 4D0PA 1HW1A 4DTOA 3LP1A 4DQPA 3QESA 1MGTA 5AR0A 4LJZF 2FPDA 5GJVB 4UVBA 5AQYA 3TO7A 2GFUA 2YT6A 3TSQA 4HXJA 2JPBA 3NCIA 1GDTA 3ME9A 1BJZA 4CJSA 2ID6A 1T33A 5LJ3e 4FK0A 5GAN4 4CJVA 1J5YA 3VOVA 2Y75A 1VQ4T 2GF7A 4QQDA 2M3AA 4EJVA 3ZQGA 1IZ6A 1DU6A 1NOZA 3BE3A 3WTWC 3X25B 3U9GA 3M0PA 3JR9A 2CGJA 4ZDPA 5LJ3d 5IAYA 2J6KA 3FXOA 4F2RA 4J8OA 1IG7A 3LP2A 4UQGA 5F0HA 3OYIA 2X0LA 2R7FA 3V7CA 1O3RA 3OSGA 4NXMK 3TANA 1GOCA 2P7VB 2GUIA 5CVVA 1JKRC 4IG3A 4B23A 2NVUB 3M0TA 2JLEA 4H0OA 4QIWN 1MJ9A 1WCMJ 4M3RA 3M1EA 7AT1B 3QUIA 4J9GA 1JLBA 4RTWA 2QK9A 3G0ZA 3S9HA 1WHKA 2FVUA 1GCPA 4II3A 1NK0A 4PWDA 1X2NA 1AHDP 3DEEA 1ZBHA 1G4DA 1W0UA 2YUOA 4RWTA 2HXIA 2ELJA 3FKJA 1VQPQ 2ABKA 4GXOA 4V19S 3WTYC 4A4HA 2XK0A 2IGIA 3M0RA 1SQKA 3CTAA 5GAHP 5ICFA 4CSWA 3H3NO 1VQ8N 4U0YA 1HKSA 9ANTA 1OKJA 3QBXA 4IUQA 2X6OA 3LSPA 3B02A 5J6XA 4WFAL 2P4WA 4WQ5C 4ILHA 2GTOA 1A35A 4H0PA 3PGGA 2LNHB 3JCMJ 2IC3A 4OFEA 4Z4FA 5C15A 4E1NA 3EUKL 2E2PA 4D5CA 2X6SA 2VWBA 1X4OA 2DA6A 1BBYA 1KVAA 3GP8A 1OCZH 1ZR4A 2VC1A 3HUGB 2CGLA 1T0HA 4DLEA 4C0GA 3BR1A 3PMIA 4PL8A 2Z1JA 5GMKl 3F0CA 4RDUA 4MMLA 4E70A 2KYMA 1PU6A 3L6QA 1LCUA 4CEOA 3BTIA 1QMCA 1HLUA 4IIOA 4F16A 5L8RE 2XASA 3CCYA 1SRLA 2OANA 3H35A 3L2CA 4HZFA 2LP5A 4ZH4F 4M78F 1TH7A 4H0XB 2ECBA 4M72A 5F0FA 3JCMV 2BYVE 2M7BA 3ATUA 4O4GA 3P39A 3ATVA 3ZT2A 2XV4S 4DG1A 1NGDA 3SEMA 4AVZA 5CHIA 2JOYA 1QCNA 1B59A 3J80O 2HHQA 1PU8A 1TWHJ 3CWTA 4NDLA 1B1BA 3FXJA 4JKEA 3IUCA 5A0DA 4GYGA 1NPRA 3WNEA 2AA4A 4B9NA 2O8FA 4PLIA 3LSIA 1U1SA 4BRQA 2WONA 3CCJN 4WK8F 3ZETA 4BRFA 3ZN1A 3JCMc 2F4VK 3HO1A 4LB6B 3DKWA 3OYEA 1XPXA 4N4OB 3N5BB 2V26A 5D6FA 5I9EB 2BY0A 3CWAA 5FFZA 2ZCFB 5L3DA 1D8YA 2Q3SA 5EU7A 2AK5A 4IRGA 5E3NA 2CUBA 1DP3A 3M4GA 3U1KA 3EUAA 2VJ5A 3K57A 2ELKA 2MWPA 4DLGA 4CA0A 2J5OA 3DI6A 4LFBK 2QDYB 4F52A 4I9LA 2UYTA 1VSHA 3L3UA 3CCRT 4ELUA 4Y15A 2L7MP 1VI0A 3TAGA 3EFSA 1TGOA 1JJ8C 4RM3A 4LOCA 3KLGA 4LD5A 1AZEA 2HKNA 1XMXA 3U6FA 3EFOB 2OV7A 1X2MA 2K7LA 4FE4A 3ONQA 4DNCA 3H0GJ 1EXQA 3N5NX 3OW2P 4MQ3A 3MZ8A 3V81A 4ELZC 1HSTA 5EG2A 4J9IA 3BCBA 3CCSA 3U3GA 5GANe 3C2GA 5D5WB 1JU5C 2GOXB 1P90A 4NLCA 1XQOA 4X9CA 3MEUA 4CCLA 4E4HA 3CCVT 3ZQQA 4E0DA 2E2IJ 4OLAA 1NBEB 1HC8A 1ATNA 1A0NB 4AHTA 3JRZA 1KU3A 4C8LA 4OGCA 5CQXA 3UT1A 4CEQA 4MTDA 2A0FB 2EZIA 1LE8B 3HYIA 2E10A 2EV0A 1D09B 3KWIA 3M8SA 1QHHD 4GGGA 4DV2K 3T8TA 1FKOA 4DEYA 3TEDA 3PO3J 3GFJA 5KH6A 2KJBA 4BR2A 1P7JA 4L0YB 1WN7A 2DZ9A 1XQSC 2AJQA 4AG1C 2O9LA 4N5SA 1BYMA 1RLQC 3N0UA 1WOQA 2K9NA 4CFAA 2UXDK 3PV8A 3OGDA 2E71A 2A61A 1M90U 5E1ZB 3CCMI 3V8KA 4YOVA 4JD2A 3CYMA 1R7JA 4L5EA 2ABLA 3MPUB 4P96A 3ERMA 2ZNYA 1NM7A 2X4WA 1JLAA 1NZ9A 5AJ3K 4BI4A 3QODA 4EVVA 1Y8QB 1TWGJ 2MSYA 4Q5WA 3D1NI 1OPKA 2TCTA 1GCQA 4YIFA 2ITGA 2XROA 4ISGA 4Q5VA 2IVWA 3VJPA 3BG3A 3JTGA 2EGAA 1KQ0A 1VQOA 2Y69H 1IKVA 2DLPA 5DM7R 3O3FA 1N5YA 5I11A 2HKXA 5IHNA 3CETA 2W04A 3ZQIA 3P8BB 4IDHA 2E1NA 1BQMA 5FDLA 1W5CC 2R7RA 2ME0A 1RCHA 3U1DA 2CRGA 3QU3A 4UHTA 4JKCA 3O4QA 3CP2A 5D5XB 5LRRA 2F9WA 3VYUB 3JTHA 1TNTA 1TK8A 2KTQA 3MKYB 4R5PA 2ZM6K 4IEEA 3OYMA 4OPKA 4CJ4A 1HRHA 3N4PA 4HG2A 3K7AJ 1SFKA 2NRWA 2QDLA 4FZYA 1V54H 3AVKA 2E60A 2YSRA 2ZGWA 1WXTA 3CPEA 1N36K 2EGEA 4CEFA 2EKHA 1RFQA 4C8MA 2RC4A 5FW9A 1MNEA 5TJJA 1RAGB 3OH9A 4JLIA 3CUQB 1U84A 3UA7A 1FJGK 1R5GA 4OINF 4F2SA 1CXUA 3CCSN 5ADXA 4OMLA 2L0AA 1Q9XA 5KAIC 2VBWA 3FLGA 3JSCA 4PHTX 2AT1B 2HCKA 1M90O 2NRZA 4FJLA 2M5WA 3C6UA 4M6VA 4YY3K 5LEJA 3ASOH 2FNAA 2Z3YA 2JWLA 5BR8K 3TAEA 1WI3A 2EA2A 1KSPA 4FJMA 1S29A 3VGLA 3WU0A 4ELTA 4CBXA 4M7DB 4Z89A 1R22A 1HYVA 4XTZA 3G6EQ 3CDHA 5LLQA 2JUFA 2O9SA 1VQKI 4LIUA 4DSEA 2IA0A 1DIZA 2L3RA 1ZA2B 1VQ8T 1YFHA 1SS6A 1AZGB 1XTDA 3VYGA 2CQKA 1ZSGA 2LDUA 2HMAA 3G71A 2LQKA 1HQUA 3H9NA 2VXFA 2DEUA 2KE9A 3KP2A 1S7OA 4CZGA 3P5JA 4PY5A 1QVUA 2LJ1A 3LM9A 4OB3B 4FJ8A 2QQ9A 4Q0BA 3HPGA 3GE1A 2AXLA 2FSNA 4YEJA 2DT6A 1M1EB 5E26A 5FD6A 1ASVA 2HU9A 3OYCA 3HUGA 5I3UA 2A1RA 2DCEA 3IKMA 4N0BA 1D3YA 3DEUA 2D9TA 3ELKA 2HNIA 2IJLA 2FMLA 2RJEA 4NL2A 4XQ3A 2O8CA 1NJXA 4IO8A 1OCRH 2C6YA 3GIBA 2DMNA 1T0FC 1PRMC 4QOZB 4ENKA 1QZ6A 1QCOA 3CBPA 3WXLA 3DMJA 1HJOA 2IAJA 3I56Q 3J81Z 2VKNA 5BRHA 1YHQQ 2QWQA 4M3GA 4XTWA 4J9BA 1M3HA 1V5FA 4DV3K 1EH6A 5CZ2A 3JAME 3IH4A 4DOVA 1XX5A 3L1PA 3A8HB 1KO9A 2GGRA 2LY1A 1IKWA 1J53A 3WE2A 2NRHA 3CJQB 4CF2A 4JKGB 4M78C 1WEIA 1VSJA 2V75A 3CWSA 3O8GA 3DOLA 1JJ2P 1WJCA 2VPLA 4YDUA 2GTDA 2EQJA 5J3LA 1MZBA 3J80K 3C95A 4M7DC 1VQPN 2COMA 4BC5A 3THXB 2E4HA 3SBTA 3WQTA 4M7DE 4RB2C 1C0WA 3QBYA 1OYXA 2KKZA 1I5ZA 2PG4A 4NO7A 4P55A 3M0QA 2HQ5A 2ZGZA 2KRNA 1YI2Q 3BR6A 1MU2A 1B3QA 1FNNA 4A57A 1RC9A 4IUUA 4FZZA 4WCIA 2HR3A 5HBMA 3LA7A 5JFRA 4LITA 4CHQA 5HP1A 2JWTA 2LD5A 4FO0A 2GTJA 4F93B 5AQUA 3UF4A 4CJEA 3HXLA 5BREA 1VQMT 4IDKA 4LN2A 2LQNA 4WTOB 1JJ2S 3C0BA 2F5TX 3K4CA 3RKXA 4KREA 3CCET 3I71A 4XSXF 4M78A 3H3ZA 5DCFA 2CSOA 4F7UB 1NTCA 1T38A 2QWRA 1NJZA 5JHFA 2DLLA 4A62A 5E79C 1C1CA 4NC7A 1XGNA 3KFWX 1IO2A 1QSSA 3H9GA 2QYOA 1ZUYA 4BE0A 4J83A 4NS5A 4J6XA 4B1VA 1ZRFA 1WYXA 2A36A 2XF5A 3KEOA 3OB9A 3NTHA 4DBFA 5DLQE 1Z9ZA 1F21A 3OOPA 1PUFB 3D7EO 1N78A 4AYBA 5GAMg 2E1ZA 1N75A 3CD6N 4F17A 4ZGJB 1XGMA 2VXZA 2COBA 3FM5A 1SSFA 1Q82R 1MIJA 4JX4A 3DXKB 1K79A 2W00A 2CS3A 4KAZA 3FHZA 1IV0A 5EC7A 1S1WA 3BG6A 2X6YA 1HU0A 3KNTA 4D6WA 1ZC6A 4RG8A 1G3TA 5I2MA 4K2EA 2IVOA 2DA2A 1E3HA 3WTZA 2BZ8A 1GLBG 4YFUA 1G3SA 1S6PA 3V8JA 4MMKA 6PAXA 5FLVA 4N41A 2G7UA 2Q2EB 1W97L 1NLPC 3DM2A 4RG2A 1JXBA 4LNPA 3U9ZA 3GPLA 1VZ0A 2MW8A 4DWIA 3MX5A 5FLMJ 2CH6A 1ZQ3P 4LDXA 3DXKA 1T6SA 2E34A 2XGCA 3HHGA 2DQRA 5GAN7 1WEGA 4LB5A 4KYWA 4J6WA 1RI9A 1YWPA 1QVGM 3PQKA 3A0BC 3RJPA 3JRAA 1VQ5N 3EO3A 1UMQA 1ITYA 1UZCA 1EBMA 4RB1A 3JCMh 2YHTA 1GV5A 2X4HA 1T44A 3IH3A 2A69F 2E7XA 1TKTA 5KYNA 4EAHD 2XPUA 4DSIA 3OHRA 4DSFA 2QA4T 1JO8A 3Q9SA 2HZTA 1BI1A 1VA7A 1W7PD 3JCMe 2PMHA 1IHWA 3CCVQ 1RIOH 4BVPA 1XDSA 1LE8A 3GEZA 2F2XA 1W2BM 1H3ZA 2KQ2A 5FD5A 2X4XA 3FMSA 1OH7A 2VWKA 3ZQCA 5LJ5h 1XG7A 1UB9A 2X78A 5KRSA 3I0XA 4NNJA 1BW5A 4KITB 4BY6B 2X6WA 3TU4K 5F27A 2NOZA 2HW3A 1IH7A 3NF6A 3VKIA 3QBWA 1A5JA 2Y0MA 3LSRA 3CO6C 4JHDB 4J19A 5KVRA 3VS4A 3M0UA 5ILUA 5C0MA 3BROA 3QEXA 2OFKA 3CMAQ 3KBGA 3BGRA 3F9MA 2DY4A 3J7AP 3DBHB 3EYIA 4YPHA 2NWMA 1QS4A 4WQ5A 1KG6A 1AT1B 4M3WA 2PBIA 4HCCA 3ZCMA 1EP4A 3GW2A 1PC0A 3NAUA 1VQLI 2O9VA 4LG0B 1PP8F 3TSPA 1FLIA 2MCNA 2RNJA 3EG0A 4OMNA 2H3EB 2ZB9A 1U5TB 4QVDA 1RKWA 1Y0MA 5CVIA 2XB0X 4HX4A 1NMDA 3MKWB 1RRSA 4DYCA 1R4NB 3CCEA 3H0IA 4HT8A 2HD0A 2C06A 4UVCA 4OFHA 3PX6A 3CCUQ 4BC2A 4C8QC 1AD5A 4CC7A 4LF7K 3LH5A 2B8AA 1XUPO 3T1AA 3AA2A 2F2VA 4FWSA 1MWMA 3HT3A 4WCEL 2P0PA 2QTVA 2XF6A 3WQUA 4K8XA 2A5XA 5GAOn 2EWSA 3I56T 1QKXA 3NMUA 3V9UA 4GMJB 2FPFA 2FEZA 3FJ5A 5FU6C 3DLLA 5AT1B 2BIVA 3A02A 3MFKA 1NYFA 4A3LJ 5EY4A 4IURA 3VN5A 3OJUA 3DLLL 4Y1CA 2RGVA 5HL7L 3GZ5A 1R49A 3SAGA 2ZCWA 3SPYA 4DR6K 4CRIA 4A5AA 5HLFA 3J81O 4FETA 1VQ4N 1ITGA 2ZPEB 2YHWA 3NAEA 3RR6A 3QIPA 3CPWP 3L2RA 1JGGA 3DB3A 3I8BA 1WHLA 3CCJQ 2E4LA 4LH5A 1QHTA 2AIRB 4KH5A 3SMSA 1ACIA 1ZBIA 2FF4A 1YJWQ 1HDPA 4IQJA 2Z0WA 2NXNB 1GVJA 3G0QA 3FK6A 2GEMA 2G0EA 2Q2EA 2VC0A 2BDPA 4B1YB 1YJ9I 3GZNB 4M4ZA 1IHVA 1T56A 3U9DA 3CC7Q 3OW2M 4AYBN 4DZPA 4FJNA 1IJWC 4JK9A 4FWQA 3L2ZA 3SJMA 5HLTA 2K2MA 3P1GA 2G8UA 2OUMA 2VB6A 4B1RA 2D1VA 2YNFA 2YWWA 3HTVA 4W5NA 1Z05A 3MVPA 1F43A 4RAZA 5AZIA 2MWOA 2HKQB 3MAJA 2E6ZA 1UHFA 1TKZA 3N4QA 3CCEN 4QWQA 1RGIA 4HCBA 4RGXA 2CO5A 2XKOC 4B3AA 1HX1A 1YW9A 4M77F 3HL2A 1K73C 2D8JA 2IW5A 3LQQA 4H0YB 5F0XA 4BRNA 2CFXA 4DQRA 4G9YA 3Q5FA 2AKLA 2VT2A 2JS2A 4I7FA 1VQ5A 2QENA 3E0JB 4XOTA 5LJ5d 1UGSB 2EYYA 2P81A 3HJFA 1M4ZA 4NQWA 1H92A 3LL3A 3WTTC 4BG9A 2Z2SB 4QQ6A 2HHTA 2HBPA 4I01A 5ILSA 5L3FA 1D3BB 4RTZA 4XU3A 4DV6K 2LP0A 1Q86C 1NJYA 2YU3A 3FM3A 2JSCA 2B0LA 3I59A 3JRIA 4XH5A 3F73A 3HK2A 3VF6A 2LDMA 3B73A 4JK8A 3FZFA 4WCGA 1P4AA 3N05A 1XWLA 1RNHA 1YF5L 3G4SA 5K7HA 2MYSA 2HFHA 4DFJA 3VEXA 2LY2A 2HYGD 4M6XA 1YTYA 1PHTA 2PJPA 1S6QA 3NWSA 3FISA 3MWTA 4S04A 1D4XA 3JSMA 3T9NA 1GXPA 1WBBA 5BRFA 2EYXA 4F9OA 3UKRA 5GAGP 1UG2A 4BQLA 3CC4I 5E3MA 1NPPA 3HRGA 1PUEE 3EH2A 2EZLA 1UJYA 4XICA 3CCST 4FLYA 4OKEA 3QXEB 2KDZA 3VS3A 2QWOA 1QQCA 4OPJA 4NXNK 4HNUA 3CCQT 1FYNA 5H20A 3KETA 1YCSB 1ASUA 2F5DA 1DPUA 2R3SA 2PFUA 4C30A 4OVAA 4C3JJ 1RAFB 1NK5A 4HRIA 3H6ZA 1SVLA 2STTA 3JCMX 4YOXA 3C0CA 3AAFA 1QP3A 3DJCA 3WEEA 4DSLA 1EO1A 1YI2N 1OFCX 1AHJB 2FE3A 4BR7A 3ZMVA 4KPYA 2K27A 2HNZA 4CZKA 3KLIA 2QSGX 4B21A 3QYGB 4L59A 2D45A 1ZSZC 2NYSA 2ZMEC 2DNUA 2UV1A 1BR4A 3HIFA 2O8BA 1OH5A 2JTEA 4X6AJ 4EFHA 1LKXA 3AVCA 1BN5A 2COYA 1Y07A 3H46O 2HHHK 2COZA 1YI2I 4EMHA 2HOSA 4DQIA 2PTKA 2VN2A 2V8KA 3RKWA 2VOPA 5IT9E 4RTXA 2GLOA 2QEXT 4HT9A 1I6XA 3D45A 1B34B 3BJOA 2RJFA 2ESNA 1SKUB 1CGPA 3G71Q 2IS2A 3A01A 3CXCA 2D0OA 2E20A 3E5QA 4XLFA 2F9TA 1NJIR 2JVVA 1NG2A 3HZJA 4C8QD 5FPMA 4M3XA 4HLYA 5C0YA 2HEOA 2DMUA 5IT9Z 4HA8A 5C44J 4EP4A 3FR0A 3K1NA 5AZJB 3CJTB 2K79A 3G6EA 1YOVB 1LAVA 2H1LA 2CH5A 3SUOA 3OOUA 3NMZC 2DAOA 1GOAA 5CY4A 1Z6RA 2W10A 1CZBA 4YIIA 4OB1B 4Y28E 3VQ6A 2DKGA 1WZ2A 3FZMA 3LM2A 1U3EM 1N3AA 2LYCA 3CXCS 4UUTA 3GTGJ 3D2EB 3CCVN 2KZMA 3GFIA 3KK3A 3SDGA 2GA2A 1ESVA 3CP8A 1BUPA 1OPCA 3PO5A 1YHQI 3THWA 4C8QA 2LKXA 2Y31A 1DGRM 1H89C 3F8NA 1Q9YA 3PMTA 4FVMA 2L3QA 4CECA 1WHMA 1EQYA 4CZMA 1NNEA 1FP1D 5CQGA 2G8VA 5J8CA 2OAZA 2DL7A 1FN7A 1XTAA 1OCTC 1K8KA 1VSMA 1E7OA 1SKRA 4KHQA 1NGJA 1TSFA 1U2WA 4DUZK 3ASNH 3F2KA 3SUQA 2WAEA 1XSXA 4OU0A 5AQVA 2EQRA 1RACB 3KZZA 4H4MA 2IIMA 4OO1J 4KJZA 2JMCA 2VI6A 4JRIA 2GA1A 4ABZA 2RO0A 2O8FB 2W24A 2EIKH 4JX6A 1DTQA 3J7AY 4YOUA 2KZZA 4CCNA 3K2AA 1IDYA 1AU7A 3BDUA 5DY9A 1YJNI 1NJIU 3OBYA 3U8XA 4UC4A 2P9UB 3OH6A 3AVGA 1R59O 3M5RA 2DAQA 2GBQA 3ZXSA 3H3UA 2NLXA 3D5RC 3K0SA 1IW7F 1O1WA 2L3SA 3OSVA 3R6OA 2XGXA 4AFUC 1LAWA 4CCOA 2XGEA 2JVGA 4ZN1A 2VXDA 1MSEC 3QNNA 2L9VA 1D0ZA 2HQRA 3CCMA 2YI1A 5E1XA 2KEAA 3R4KA 4LF9K 1XMAA 2GWRA 2E41A 2F96A 3WNFA 4MEYF 1OZ2A 3BG7A 1WKMA 3QYBA 2OU2A 1Q82U 4EW0A 3DKMA 1UEBA 4CCJA 1Q81U 4FSVA 1VQ8A 2KRSA 3AVIA 4FJ5A 1CQTA 2FZCB 4BEHA 4EMKA 2E2OA 3V9XA 1ETWA 4A3FJ 1QSYA 4EA4A 2RQRA 2ZO4A 5CO7A 3UE5A 1RT6A 4KULA 1B9NA 4PKGA 1ZA1B 1KHCA 2GUPA