4BE2A

Pfv intasome with inhibitor xz-259
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords PFV INTEGRASE
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be2A03
2K3YA 4DFMA 4DU3A 5C6SA 4FJLA 5J39A 3C6TA 4KRFA 4I2PA 1CXQA 3E9FA 4FJGA 1RDDA 4CJEA 4BE0A 4TSXA 2WACA 4AILC 2LTOA 3F70A 4IBNA 3V6DA 4KPYA 2FBVA 3TAMA 1IKWA 1RT5A 4CGGA 3OJUA 2XY7A 1C0TA 1H3ZA 1GOCA 3SQ4A 2VWKA 4CK3A 4QCLA 2R58A 1HYVA 2PYLA 4J2AA 2HVIA 3NGYA 4IFVA 4AHUA 4IFYA 3AA3A 4M41A 2VG5A 4FL6A 4JRPA 2DIGA 1BL3A 3CYMA 4LH5A 4OKKA 3ZSZA 3TAPA 1KFSA 4KHQA 5SWMA 1K6YA 4DSIA 3RMAA 4KREA 3MP8A 3AVGA 2FBYA 4OKJA 2YNFA 2YNGA 3NF9A 2VYTA 1X9SA 3HK2A 3CFOA 4DTNA 2D5RA 2XRIA 4OLBA 3OYMA 4CERA 4OPKA 1KHCA 1RBSA 2RI2A 3V81A 3L3VA 3OYBA 2MWPA 1BGXT 4MQ3A 3FC3A 3K5OA 1FK9A 1QQCA 1SL1A 1Q8IA 4M3XA 4W5OA 4O0JA 4DSFA 4DQQA 1XI1A 3LWLA 3V1OA 4J2BA 2OPQA 4CJRA 2W42A 3EYZA 3TAQA 1A5WA 1NOYA 4ELTA 4N56A 3BDPA 4FK4A 5FRMA 1RI0A 1R0AA 3MEVA 2B4JA 1FXXA 4CEBA 3A2FA 4CEQA 3I8DA 4AHVA 4FJMA 4CGFA 1KCFA 1KVAA 2IS3A 3DLKA 3MECA 3VQ9A 3P1GA 2GF7A 3TWHA 5CZ2A 5JS2A 4FJKA 3HPOA 2AJQA 3AV9A 4B8CA 3OQ5A 4HTUA 1S1WA 4A4HA 3G0ZA 1KLMA 3S3NA 3FEOA 1TKTA 3OYNA 3SZ2A 1LV5A 3LYIA 3P5JA 1N27A 4CHZA 4CIFA 4CFDA 4KB0A 3ZSYA 3EZ5A 3WNHA 4BDYA 1JL2A 3L2WA 1IO2A 1VSIA 4X34A 4NYNA 2BANA 3K5LA 3H8ZA 4IUTA 2OA8A 3BDLA 1YTAA 3TARA 3NTIA 4Z4IA 3KLEA 4HCZA 3DRRA 2YHBA 2FHDA 4A4FA 4DTJA 2RHIA 4FCYA 3MEUA 2P0KA 4KTWA 3NGZA 3DLMA 3L2UA 1RDBA 2XY8A 3DOLA 2Z1JA 4HHTA 5KCHA 4PY5A 4W5NA 4HUGA 1U45A 1RTHA 1S1VA 4KTZA 4CESA 3S3MA 3ZT4A 4CFCA 2Y1JA 3PNWC 4KI6A 3DMJA 4M3YA 2QQRA 1O1WA 2HMIA 4HUFA 3F9KA 4FK2A 3AVFA 4M3UA 5KRTA 2HHUA 4MFBA 3NH1A 1U47A 4FJXA 3LH0A 4M45A 1QSYA 3M8PA 4BDZA 2QQSA 3CEYA 1FKPA 2A1RA 3MEDA 2KTQA 4CJVA 2BUDA 3NBPA 3AA4A 3P83D 3QEIA 3OS0A 3LALA 4DLGA 2BIVA 5D6YA 2QXFA 1I39A 2CKKA 3D45A 3DOKA 3MXJA 4DG1A 1XWLA 4CHQA 2XHBA 2P51A 4DTSA 5CY4A 1IKXA 1WSEA 3NF8A 4OLAA 1REVA 1RBUA 4DFPA 1RTJA 3OYDA 1HQEA 3OYJA 1CZ9A 4GVMA 5FDLA 5C0MA 5J2QA 5KH6A 1JLQA 5HLFA 2KFZA 4DTOA 1QS4A 2MWOA 1HJRA 3H08A 3HT3A 1EP4A 3K5NA 4E1NA 3UT1A 1X9WA 4FU6A 3THVA 3OYGA 3IRXA 2OPSA 3EY1A 4PUOA 3MEAA 4KTQA 2HHXA 3L2RA 3QNNA 4O55A 2O4XB 3WNFA 4K8ZA 1C6VA 1CXUA 2EKOA 1ZBIA 2EQKA 3E9GA 3DLHA 2HHQA 2Q3SA 4CJTA 2G8VA 1NJYA 1BCOA 3DRSA 1MHNA 2Z1HA 4ELUA 3L2QA 1XHXA 3PFSA 3AVBA 3L42A 4E19A 4CHNA 2BE2A 4DLEA 4E7HA 1KLNA 4DF4A 4B9NA 2B8AA 1UOCA 3NNQA 1C0UA 1F21A 2XK0A 1TKZA 3GOXA 4CEOA 3HM9A 4RG2A 3HXMA 4I9LA 4KAZA 4LY7A 3QEPA 1IH7A 3RMCA 1JLBA 4CIEA 3OB9A 4DF8A 4KKOA 3P8DA 5HRRA 5J2PA 1BCMA 5HRPA 4KFBA 1CZBA 1WSHA 3SQ1A 1DTTA 3VN5A 4O44A 3TAFA 2KQ2A 3QEVA 2X78A 3AVHA 4Q5VA 4B9LA 4Z4EA 1S1TA 3S6WA 1HQUA 2GV9A 4WE1A 1IG9A 4BD3A 1RT7A 1G5VA 1WJRA 2L3RA 1Y97A 5KE2A 2Z1IA 3FFIA 2RI5A 4CJUA 4DSEA 4DU4A 1KRPA 2RJCA 2ATQA 4ELVA 3MEWA 4JS5A 3HL8A 3KKRA 5KGWA 3RRGA 4CK1A 3KJVA 1W0HA 1JKHA 1LAWA 2OPPA 2RN2A 4LH4A 5T7BA 1OI1A 2E4LA 2LRQA 3CFPA 4FLUA 4CECA 1Q9YA 3V1RA 1EXQA 1VSJA 4LSLA 4FJ5A 2QKBA 3RRHA 3NH2A 5I3UA 2OZSA 1Z25A 4FW1A 4KV8A 5I42A 3MAQA 2VWJA 1D8YA 3HJFA 1I3AA 1RT2A 2E6NA 5KCOA 3VQCA 4OGEA 4O5BA 4FYDA 1NK7A 3NCIA 3SV4A 2RHUA 4OPJA 1KVBA 2DIQA 3SQ0A 3QBYA 4E0DA 4CF0A 3KD5E 2G8IA 1JLFA 4Z02A 2IOCA 3AVAA 3U3GA 5KRSA 1WSIA 3NFAA 1EX4A 2WOMA 4N4IA 2EQUA 4ZHRA 1D9FA 1VSDA 1BQMA 1J53A 4KI4A 5DMRA 4N76A 2HHWA 4M3ZA 3VQ7A 3PX4A 4KO0A 1DLOA 4CFAA 2LSNA 4W5QA 2HVHA 2R5AA 2RI3A 1GOAA 1YVUA 3DLBA 3O3GA 3PO5A 4KHSA 4M3WA 5HBMA 4LSNA 4KHNA 3ZT3A 3FDRA 2X4WA 1QHTA 2X74A 3H6ZA 1OYXA 3L3UA 2JZ2A 5J2MA 1SV5A 3HP9A 4C5GA 1RDAA 3BGRA 1RBTA 4H4OA 3T3FA 4DTUA 1A5XA 1VRUA 4Z0UA 1Q9XA 2QKKA 4FJIA 4UC4A 3P8HA 2ITGA 4GMJB 3D0PA 3SPZA 1RCHA 3DYAA 1U49A 3LP3A 3AVCA 3QINA 1NKCA 4Y1DA 4DFJA 2NLUA 2LVMA 1LW2A 2G3RA 2O4XA 2E6LA 2RKIA 4QQDA 4IDKA 3MEEA 1T7PA 4CHPA 2YRVA 3DRPA 3SUNA 4FXDA 3RMBA 4FLVA 3PMTA 4N41A 1J54A 1SKRA 1CLQA 4BWJA 1VSLA 4HVJA 3LDSA 3HVTA 1VSHA 3QESA 1EETA 3AO5A 3PX0A 1X9MA 1QE1A 1RT1A 1SKSA 1WNSA 3K59A 2M0OA 2NUBA 2P1JA 2OPRA 4E7LA 4CJFA 5C25A 3PUFA 3KLHA 2G8FA 4B9TA 1FKOA 3LPTA 3S9HA 2D0AA 4DQPA 1NKBA 1T8EA 3ZSQA 1ASWA 2FBTA 3DI6A 4C8NA 2XY5A 3LLRA 2F8SA 3L8BA 4F4KA 3LP1A 3VQPA 2L89A 4E7JA 3S3OA 5JS1A 2YV0X 1NJZA 1S1XA 2D0CA 2RF2A 4NYFA 4FLYA 3RTVA 1ASVA 3VQEA 1QTMA 1KTQA 3AA5X 4C8LA 4HUEA 3C95A 2HW3A 4QW2A 4PWDA 2IAJA 3QETA 3QEWA 1WSGA 2YHAA 1D5AA 3ME9A 1HNIA 1J9AA 1SUQA 4QAGA 2DAQA 4E89A 5J1EA 3O3FA 3META 3K58A 4KB1A 2KZZA 1JL1A 3LAKA 3LAMA 2PQWA 3KTQA 4FM0A 3SUQA 3OMCA 3TABA 3ZEHA 3OYIA 2DFEA 1JLGA 5D3GA 1TGOA 4BACA 4I2QA 2X6SA 3VA0A 1LWCA 3V9ZA 1TKXA 4B8AB 4XIUA 4IKFA 1T03A 3UIQA 4UQGA 3IS9A 4DWIA 4KHUA 1HPZA 4CFBA 4DMNA 4Z4FA 3MP6A 3PX6A 2X35A 4IUQA 1B9DA 1RILA 3HVRA 3TAGA 3MXIA 1J5OA 4BDPA 2HHSA 2BKDN 3KK1A 5HP1A 3QERA 1DTQA 1S9EA 1UWBA 1U4BA 3OJSA 3OA6A 1U04A 4BWMA 1TK8A 4EP4A 4CF1A 4M42A 2B5JA 4DTPA 2X4YA 2D0BA 3LZIA 4M3RA 4B9UA 3NTHA 3VA3A 3OYAA 3SCXA 3AO1A 1ZBLA 2DTUA 4CGHA 3KIOA 4Q0BA 3OYFA 3AVKA 2HNYA 4PA1A 4CJ5A 3QNOA 2Y1IA 2G8KA 2JGUA 3RR7A 4OVLA 1ITGA 1UAXA 3HO1A 1NK9A 4B9VA 4QVZA 4I7FA 2M1HA 2LDMA 2LCCA 1RT6A 2EHGA 2GUIA 3OVNA 4EP5A 4DU1A 4DS4A 2XY6A 3ZSRA 1LWEA 3AVLA 4E3SA 1UA1A 3OYHA 3AO4A 3MEGA 3UWNA 1JLCA 1KSPA 4DSKA 4CEEA 2RHYA 4Z4CA 2I5JA 3ITHA 1TAQA 2P5GA 5FRNA 5EU7A 3NHGA 4CJWA 3SUPA 3QIOA 3IG1A 4NCGA 3T1AA 4IUVA 5M9OA 3AO2A 5J2NA 3DB4A 2IGIA 4B9SA 3I0RA 4CEAA 2RHZA 3SPYA 1WJSA 1NJXA 2PYJA 2X4XA 1TV6A 2BGGA 4N5SA 4K8XA 2R57A 3VQ6A 1RTDA 1RTIA 1TAUA 4C5IA 5IAYA 3PO4A 1WAJA 3U6FA 1TVRA 3DB3A 4FW2A 1BI4B 1RDCA 4H8KA 4YNQA 4A4EA 4ZTFA 1S5JA 3PV8A 4DSJA 2K3XA 4QQ6A 2RPIA 3G10A 2YKMA 1NK4A 4FJJA 2VG6A 1TK0A 3CM6A 2JTFA 4CF9A 1NOZA 4AHTA 4EDUA 4CJQA 2ZE2A 3V9WA 4AH9A 2EX3A 3NH0A 3O8VA 4CEZA 3O4NA 4PLIA 3CFRA 4ZTJA 2XDPA 3QKJA 3QIIA 4NCBA 3OYEA 1OZ2A 1BHLA 3ASMA 3QO9A 3WNEA 2G8UA 4KHWA 2F8TA 4M3TA 3CM5A 3DM2A 3B6PA 3QIPA 3TR8A 3ZT2A 4CJPA 1WSJA 4W5RA 2GFAA 4JLHA 3KLFA 4F8RA 1VSMA 3NGIA 1YTUA 2PY5A 4FLXA 4NZGA 2GFUA 4E7IA 2R5MA 3C4SA 1WAFA 3LANA 3NE6A 3LZJA 4JRQA 4FVMA 3RR8A 1C1BA 3AVJA 2EQMA 3SJJA 1OZ3A 4FM2A 1XHZA 5HRNA 3V9UA 3HPHA 4C5EA 3QLHA 4H4MA 4GW6A 3SNNA 1TKDA 3FLGA 1NK6A 2D9TA 2YKNA 5C24A 1XNIA 5CYQA 4CJSA 4PQUA 3B6OA 2XO7A 4B9XA 1ZBFA 4BE2A 4RW8A 2FBXA 3LP2A 3I0SA 2G8WA 4QOZB 4IURA 1ZYQA 3ULDA 1N5YA 5CYMA 1YT3A 4JS4A 3QEXA 1IKYA 1LWFA 2G8HA 2M16A 4CJLA 4CE9A 1UA0A 1SL0A 3NDKA 5C42A 4W5TA 3OS2A 2HB5A 3LPUA 5KI6A 3ZSOA 3VQ5A 4CF8A 4CJKA 3C94A 4DQRA 2PZSA 3NF7A 4R5PA 4CEDA 1HRHA 4DTRA 4IG0A 3SI6A 1ZBHA 3ZSXA 4CJ3A 1LW0A 1L3TA 3M9QA 2EFIA 4RG8A 5KE3A 1BI4A 1JXBA 1MU2A 1HYZA 3VQ4A 2R7YA 4FLWA 1VRTA 5K14A 3PY8A 4F2RA 1VSKA 3AO3A 3NAEA 3CQ8A 3ALYA 2GBZA 3K2PA 2IG0A 4B9WA 1C0MA 3M8SA 3RMDA 2E6MA 2BDPA 3M8QA 4HCBA 1VK0A 4CGIA 4O0IA 1JLAA 2QK9A 1QSLA 4BE1A 1QSSA 4E7KA 1GOBA 3OYCA 1VSFA 3VQ8A 1HYSA 3NF6A 2KZMA 1WSFA 4HCCA 2B6AA 3V9XA 1WLJA 4Y1CA 3KK3A 3SV3A 5SZTA 3RWUA 4N4GA 5CZ1A 4CEFA 4OJRA 4FLTA 1JXEA 3LWMA 5HROA 2RO0A 4RW6A 3HP6A 1WGSA 3LX7A 4ICLA 2ZD1A 4CRIA 2KW4A 4RW9A 2ZQBA 5CIUA 5E41A 4EZ9A 4FJNA 3HSTB 2A1SA 3TAEA 4FJ9A 1LAVA 4FK0A 4RW7A 3TANA 1HNVA 2DY4A 3MXMA 4N4HA 2L8DA 5D6WA 5KTQA 3F73A 4OKEA 4E1MA 1BQNA 3LGFA 3KK2A 2P5OA 2O4IA 3Q1JA 1C1CA 4FZYA 4PL6A 1G15A 1JLEA 5KGXA 2HHTA 3KKSA 3ISNC 4ID1A 4LD6A 1NKEA 4CCHA 2X6NA 4G1QA 4KHYA 2O4GA 4B08A 5J26A 3K57A 4I9QA 3DLRA 4DTXA 1NK8A 3KD1E 3SUOA 4DTMA 2RJDA 4PLLA 3HPGA 2RJFA 1A5VA 1L3UA 4Z4GA 4C8OA 2HNZA 3ZCMA 5IN1A 3OYLA 1WN7A 4CK2A 1TL3A 4DQSA 2VG7A 3NTKA 2YNIA 3L2VA 1TK5A 4DQIA 4Z4HA 3JYTA 4FJ7A 2EQJA 1BIZA 3ZT1A 4AHCA 1RT3A 2JLEA 3AVMA 1TL1A 5FROA 3ZT0A 4FZXC 4GY5A 1L3VA 3AVIA 1SKWA 4OGCA 4EZ6A 3EAEA 4RW4A 1C1AA 3MP1A 1B92A 3LP0A 2HNDA 4C8MA 4F2SA 5DK5A 4IUPA 1SL2A 4B3OA 4IUUA 4J2EA 3VQDA 4NCAA 4L59A 1S1UA 4FJHA 2F5KA 3C6UA 3KLGA 4FZZA 4DFKA 3V4IA 1KVCA 4FM1A 3DLGA 3HYFA 3O3HA 2IC3A 3VQQA 4IG3A 1N6QA 4F3TA 2RHXA 5D6XA 2IDOA 3VQBA 1RBRA 2WONA 4LD0A 2E5QA 3VQAA 3ZSWA 4AHRA 1NK5A 1U48A 1S6PA 4Q5WA 2DFHA 3DLEA 1NJWA 1ZBUA 1S6QA 4QQGA 1HMVA 4B9MA 4F3OA 3SYZA 1T05A 2HQEA 3MO8A 1RNHA 3ASKA 3KLIA 4C5HA 1L3SA 3E01A 4C8KA 2HHVA 4L8RB 3M8RA 3TI0A 1EKEA 1RT4A 3JSMA 4O4GA 3IAYA 3O4QA 3U3YA 2HQXA 3KUFA 4CIGA 4II1A 4AHSA 3QJ6A 5HRSA 4CJ4A 1L5UA 3AVNA 3OMGA 1IKVA 3T19A 2F96A 2FC0A 3LGLA 1Z26A 4CGJA 1D9DA 4NS5A 1B9FA 1SSFA 1VSEA 2OZMA 2YNHA 3OYKA 4CGDA 1NK0A 3SD4A 3K5MA 4DSLA 4J2DA 2Z1GA 3CG7A 1X1PA 3AA2A 3WNGA 3SQ2A 4FLZA 1W9HA 2KFNA 2RJEA 1ASUA 4DS5A 3OS1A 4CHOA 2OYQA 4ID5A 2DFFA 4YFUA 1BISA 4FJ8A 4OVAA 1WJQA 4CF2A 4CHYA 3V9SA 3V1QA 1RBVA 1BIUA 1KFDA 3ZSVA 4N47A 1XC9A 4A4GA 1S9GA 3PMIA 3OY9A 2ETJA
chains in the Genus database with same CATH superfamily
1BW6A 2IPQX 2CGJA 4IOAF 4BY9C 3SK3A 2PZ1A 3DLLA 3I59A 3TVTA 3VSLA 2MMPA 4OO1J 4HAMA 1V5GA 4CBWA 3VPZA 3OWTA 5EGOA 5F1JA 2DIGA 2MI6A 3JCMf 4E70A 3K4LA 1J7KA 1PVSA 1W2BP 1X9SA 2R5YB 2HPIA 4M71A 3FMRA 2J5OA 2NNYA 2EW3A 3FC3A 1VQLI 4XRFA 1M2VA 1BWFO 4Y92A 3IH3A 4XLPF 1RUNA 2P9UA 3CCQQ 1NGNA 4FJKA 1YJ9Q 2L3DA 2L2OA 4AG1C 3H9JA 3TREA 5AJ3K 3EZ5A 3KCCA 1ZX6A 1PJRA 5IP7J 3K5LA 1NGDA 4NXNK 4IFEA 4DTJA 3FXJA 1MDMA 4S05A 3ZPLA 1RAFB 1IXRC 4Z2YA 2YX7A 3F9KA 2HHUA 3EHQA 2WFBA 2W7NA 2XGEA 2QXFA 1OU9A 3LA2A 2Y90A 8AT1B 4YELA 2VE9A 5CY4A 4A62A 4DFPA 4GXOA 4O5VA 1XTDA 3EFOB 2UZKA 4MMLA 3NFCA 4MFDA 4JKDA 1BA0A 1TW3A 3PL8A 1RZ4A 2XSDC 3CCMQ 1ZGAA 1DP7P 4FOIA 2HHXA 3KLNA 2N8GA 3HBLA 1XHXA 5HLHA 4E7HA 1HK9A 1E7OA 1TKZA 3I33A 1OULA 2IRFG 2TCTA 3FWEA 1LQ1A 4KMFA 5HCKA 2RMOA 4KFBA 1WSHA 1D0XA 2CUZA 2I8DA 2OCCH 5FFZA 1PRLC 1HPMA 1WX6A 3J81O 4O8KA 3K10A 4Q5VA 4KJZA 1Z3XA 4DSEA 4B3MK 1G99A 2CFOA 1Y56A 2K3BA 4CCMA 1AWWA 2FG0A 5DD8A 2G9WA 3D0SA 3DKWA 2QKBA 1EXQA 3RRHA 1D8YA 2O3FA 2BE9B 2Z5UA 1C0FA 1UHCA 1X2KA 2L9VA 3FBNB 2DA2A 2P7CB 4IHTA 3LQRA 1W2BS 5AQHA 4M7DG 4Y33A 1WSIA 3O8HA 5ED4A 4J7IA 4N76A 2QG9B 2VKHA 1DLOA 1VYUA 3JCUC 1YHQQ 2R5AA 1NG9A 3TBIA 4KHNA 1O57A 4RUGA 3L3UA 4RM3A 3OIPA 1TSFA 4H4OA 2O2OA 4BKXA 2QKKA 3X20B 1HNXK 3LP3A 2EYWA 5HDGA 3VOEA 2JWTA 3CMEN 2EH3A 1CLQA 1SKSA 2AO9A 1RAAB 3LFUA 2ELJA 2CUFA 4F91B 5GANh 1HJDA 4XICA 3G6ET 5LJ3e 4IPAA 4BXFA 1S1XA 3RTVA 4B9TA 2HW3A 1VQKA 5AQFA 2LKXA 3M4GA 4F7UA 2BY1A 4M7AB 3FKIJ 3LAKA 1YW7A 3LAMA 2LSOA 4L5JA 2P5VA 3MCAB 5GADP 1TK0A 3HGYA 1Y07A 2LCSA 2NRRA 4B3SK 3G1MA 3VGKA 3HB9A 1TT5B 2K3FA 4AM3A 4UVCA 1J5OA 5HP1A 3E2UA 3F3XA 2COBA 4M42A 4CJ7A 5LL6Z 3IMXA 3LZIA 3OYAA 4FETA 2DTUA 4OVLA 1RT6A 2GUIA 1KG3A 1YWPA 2PTKA 3ZSRA 1Q7YU 2WV1A 2P9IB 4LF4K 1H1VA 3NHGA 2KR3A 4CEAA 3FIWA 3EG9B 2PYJA 1QVFA 3SDBA 4C5IA 1RABB 5LEKA 1WAJA 1K9MO 1ZG1A 3E1SA 3PV8A 4PCQA 4F93B 1NK2P 1JXSA 4FJJA 3HRSA 1JT0A 9ATCB 2ADUA 2A3SA 3HPWA 2ZJPF 3NH0A 2LCLA 3H5AA 3FIFA 2G8UA 3PVQA 3TR8A 2GFAA 2P0QA 1VSMA 1K78A 4PL8A 1O75A 3ZFJA 3NE6A 3HHTB 4UB6C 3U1KA 4JRQA 4E7ZA 2EQMA 3K9KA 5I11A 2KBTA 3IWZA 2XRNA 1B72B 2CO5A 3SNNA 2Q2RA 3TSUA 2O5RA 5I2SA 1IXSB 4JS4A 2B63J 1LWFA 3WTYC 1NNEA 1P7IA 3NF7A 1WI3A 1HRHA 4FHTA 3N05A 3ZSXA 3H46O 2FPEA 1VQPT 1D1BA 4ILHA 3JAME 1SS6A 2E20A 2VWBA 3JB9D 3D2FB 4PJOE 1GOBA 4B3XA 1VQ4I 3FMQA 1WLJA 4EMKB 2R5YA 3SV3A 5DEQA 2LC4A 4N4GA 1VQ4Q 4FLTA 3LWMA 3CD6A 4BH9A 3R6MA 2KW4A 1MJBA 4JKEA 1GFDA 3LCNA 3BJ6A 2QTDA 4B3TK 4Z8AA 4E1MA 4KBMB 2COYA 2P5OA 2D6FA 3K57A 2IVPA 3HUGB 1YW9A 4ZN1A 4EGYA 2A61A 3PNYA 3OYLA 3BOQA 4IVNA 3CCLA 2VJJA 4LLGF 2YNIA 2YHXA 1ZHFA 2V8JA 3GL1A 4N4OB 2DQRA 4C8MA 1VQOT 3WGHA 1ZLMA 1BUPA 4IUPA 4JDSA 4C8QC 2MH2A 5KQ8A 2KRSA 1WI9A 1RLQC 2GA2A 1T33A 4UY8O 3LFKA 3VQAA 1VQ6A 5JLXA 4RWTA 4C8KA 2KMTA 4C5HA 4O4GA 3KUFA 3VJPA 4II1A 4CIGA 1F36A 5HRSA 3AVNA 4H0VB 3TTDA 3SD4A 3D2FA 4EV0A 4MLEA 4CHOA 4CZIA 2P8TA 1N25A 5J1EA 3COAC 4CK3A 4AM6A 3ZX2A 4AILC 4M7YA 1VQ6I 2W10A 2MA3A 3EGUA 1H92A 1SRMA 4LDYA 2EQRA 2VG5A 4LH5A 2V1RA 1ETWA 1VQNQ 5KYWB 5CR2A 1FX7A 4DV7K 1DGWY 3NVMA 4AIJA 4HT8A 1E4GT 1QQCA 3SEZA 3IDHA 2L3PA 3H0FA 3TOBA 3TAQA 1FYNA 3SAFA 3EE9A 4H0OA 3FFKB 1W70A 2QM3A 2Q36A 2DA6A 1IO6A 2NNNA 4Z4IA 4HCZA 2FOKA 3S17J 2P0KA 2P4WA 3KP4A 3JSCA 3L1AA 4JKHA 1TYQB 2H1LA 4VUBA 5LEJA 3FZVA 2NAZA 2ROLA 4DG1A 4CYCA 5EJCA 4DTSA 1K73U 1MD0A 4GDFA 2K7LA 3HSFA 4KT0E 1HQEA 2HTSA 5C0MA 1UGPB 1U5TB 2E64A 4QWQA 5E79C 3OYGA 2OPSA 4G94A 3G73A 1AVZC 4F92B 2O4XB 1YP5A 1C6VA 4XH5A 3I4NJ 5KYWA 1T2KA 1WEIA 3CCJI 5K7FA 4EHTA 2EIKH 2NOJB 2JWLA 3SFZA 4HTLA 4CEOA 2AHJB 4AYBA 1IH7A 3AHUA 1QZYA 3ZQIA 2QKMB 3BG3A 2W6KA 4QSHA 3GEZA 4KA4A 4FSVA 5DUIA 1YJWI 4A3IJ 1G5VA 2NS0A 1WBDA 3AGKA 1K9MR 2FRHA 1TUGB 3HL8A 1A0NB 3RRGA 4CK1A 2LNBA 4LH4A 4UVBA 1O7FA 4KV8A 2R5ZB 3K9JA 4XKBA 1UG1A 1J75A 1K73R 4A54A 1T3LA 1ENHA 3MWMA 3TDZC 4ZHRA 4KI4A 4EJTA 3LDPA 2ACJA 4BVPA 1SANA 1SC7A 4A4KA 4P5OA 2PUOB 3ZT3A 3VRYA 2X74A 1N75A 3K9TA 3S2WA 1Q9XA 4Z0UA 4PJNA 2K4YA 1U49A 3QG1A 4HLYA 5BQTA 1ZUYA 2QW9A 2ECZA 3V8KA 4ZYDA 4BR5A 3CCLT 3A5OC 1PP8F 2XI9A 4LB5A 3QESA 1X6OA 5TKYA 3JRIA 4JYKA 2JS2A 1YHQT 1Z91A 3VGLA 2FZKB 5JS1A 3KZIC 3VQEA 2H56A 1XS9A 5F1RA 3UA7A 3QEWA 2XPWA 4LE9A 2KKOA 1REPC 2CS3A 4QAGA 2P81A 4DEXA 1JUSA 2DA1A 3A4CA 2KLAA 1ZREA 1LOJA 2B7EA 2H3JA 5AIPA 1MGTA 1VQ7I 3PX6A 5H2FC 2EA4A 4CUGA 4RGXA 3REOA 3FLCO 2BKDN 1EZZB 5KAIC 3CCRT 1JXMA 3I56T 1S7AA 2B5JA 3C2BA 2KQRA 3ENOA 2MIOA 1ZBLA 1O3TA 2EPDA 4IX7A 2JN6A 2Y2ZA 1K9MC 3ATUA 1K73O 4LLLA 4R56A 1FJGK 3EPZA 1KSPA 5CYVA 4CC7A 4CEEA 2RHYA 2BZYA 3Q9SA 1D3YA 3V7SA 1GL5A 2OTJQ 3C1DA 4I6MB 3T1AA 2ZKZA 4PK4A 2ABLA 1AWOA 2BGGA 1EV7A 3MZYA 2OJ2A 1NJIU 1I3QJ 3JCMg 2O0YA 2QBYB 1TQIA 4ZTFA 4DSJA 3G10A 4KIFA 3EKUA 3CM6A 1NOZA 1YITQ 4CJQA 5LGNA 4LF6K 3ZMSA 3KP6A 2E2QA 4LFAK 1BHLA 3S14J 2P5KA 2DERA 1UE9A 5GAN5 1T08B 2I5WA 3FGUA 4FVMA 4H5RA 3K2ZA 3ABLH 2KL4A 2M0MA 3E97A 5CYQA 4CJSA 1MV3A 4BE2A 3R6NA 4CSWA 3ULDA 3TO6A 4A3BJ 2MW8A 1N3AA 3NDKA 4W5TA 2HB5A 4DYQA 3JAMK 1BJZA 1DUXC 1ZBHA 2QM1A 1LE8A 3EUHC 4XTWA 2O8DB 4PJLA 1GCQA 1KC8R 2IG0A 3RMDA 1HNWK 4D8KA 4MIMA 5FKNA 3OR1C 3KK3A 2LR8A 4RW9A 4EZ9A 3S1NJ 3CERA 4OFAA 3IH2A 1NEBA 2QASA 1MMNA 3Q1JA 3VS4A 3J8AA 4JRKA 2GOXB 2DTRA 4R1HA 1OU8A 2XMFA 4ISGA 2RJFA 4Q5SF 2HNZA 2IP2A 3WG9A 4J9BA 3JYTA 4FJ7A 1EH6A 2BY3A 5IY5H 3M53A 1BU6O 5FLXZ 3VQDA 2O7OA 1X75C 1A36A 5DS9A 3LAPA 3DXMB 4BJ5C 4FM1A 3DLLF 2NUZA 4OF1A 1SSHA 1DDNA 3VQBA 1RBRA 4AHRA 5GANe 3DLEA 4CCJA 2DYIA 4B9MA 1TLHB 1ZAOA 3P8BB 1QO0D 1M3QA 3GZ5A 3G7ZA 5DYMA 1BOBA 3OMGA 4HPQA 4RS8A 1FSEA 1B9FA 2VXDA 3WXJA 2ZSIB 5IOZA 3WNGA 2Z99A 1B8IA 5BPIA 1ZRDA 2A42A 1B6AA 1LWWA 1MH4A 3QBWA 2ZAEA 4DV1K 1CXQA 2R7WA 3E9FA 1RDDA 1VQ8Q 3FR0A 2LTOA 4RB3C 3TAMA 4A5AA 1GOCA 2R58A 4DBQA 4JRPA 4FL6A 2EQIA 3O4WA 4KHQA 3CMET 1R0BG 4OKJA 5J1RA 2Y30A 4OLBA 2XRIA 1B1BA 2LDUA 2RI2A 2Y0MA 5GAOn 1ZG3A 3J7ZI 3CCRA 2ZCFB 3CCJN 1WZ2A 2OTLQ 3VF4A 4P96A 1XCBA 4CZGA 4DJAA 2W24A 2DJQA 2Z16A 3I55T 2XAUA 3S3NA 3OYNA 3RKWA 3CCSQ 1UJ8A 3L2WA 1IO2A 3ZMDA 1RNLA 4FWLA 5IOYA 4I0BA 3FKJA 3G25A 3KLEA 3P9KA 3DRRA 4BRDA 4HF2A 3L2UA 4MTDA 4G7OF 3QPSA 2E2HJ 4FE4A 5HLIA 1S9HA 2RHKA 1QSYA 2QQSA 1MH3A 2RM4A 3OMYA 3AA4A 3KEQA 1P4WA 2BIVA 3LSJA 1MSFC 1ZG5A 1IKXA 1VQ9N 3KTUA 1QVGP 1WSEA 3CXCP 1YJ9I 1U5SA 1CZ9A 5FDLA 4JI7K 1VQ7Q 2XDBA 3VS2A 1TL8A 5FU6C 4D7NA 4E1NA 1HSTA 1YLFA 1VQPA 5E18F 1NJIC 2F1LA 1CXUA 2Q3SA 4ELUA 4RGSA 1VQLT 3AVBA 4EIKA 1HJOA 2WB1N 2DI3A 3HFNA 2ZJRL 3BJAA 1PD1A 5J2PA 4LF8K 4EVIA 3WQUA 5E3LA 3AVHA 2UYTA 2QQ9A 3WG7H 4RTXA 2X48A 2KIUA 4MEYF 2QA4Q 1IW7F 4EEFG 4J9DA 1Q9YA 5A0LA 4KT5C 1OISA 2QYOA 4XKWA 4OPJA 1VQ8I 4M4ZA 3OW2S 1ZARA 4CF0A 1IHWA 4NB5A 4OWRB 1R77A 4GY2B 2QQBA 3NFAA 2WY8Q 5AFUA 1Q82O 1ZHIA 3TTFA 3CC4T 1NG7A 3OHRA 2X6XA 2DFUA 5GINA 2STWA 3CCSA 2Y31A 2WTUA 1H8AC 2HEQA 5AQMA 2KHMA 4YOYA 3T8TA 4MNUA 4J8FA 3SPZA 5E3NA 5LGUA 3JB9J 4A6EA 2NRTA 3AVCA 5B66C 3O8GA 1KAZA 1ZSGA 2W48A 2PUKB 4QQDA 2YSRA 2CZ1B 2DYSH 2EV0A 2A5YB 1QE1A 4XAXB 4EQQA 2DT7B 4DQPA 2JZYA 4B1UB 1KU2A 2CJJA 3HEFA 3N5BB 4KB1A 2DRKA 2LX9A 4AIAA 2LD5A 3TABA 1FLIA 3CBPA 3HRMA 1TGOA 4BACA 1AWJA 5GANj 3V9ZA 3ULEB 4ANJA 2ESHA 3HKSA 5F0XA 4NB4A 3BJOA 4ZJZA 5C3EJ 1VQ4N 2OBPA 1PU7A 4B4CA 4Q0BA 3CCUA 1IDYA 1TOVA 3CXCA 4KGVB 1WI7A 2M1HA 2IVNA 4PJMA 2CGLA 1LWEA 3AVLA 3F8FA 2VKVA 2I5JA 2P5GA 5K5OA 2CGPA 1ETYA 2QXLA 4DK9A 1LCKA 4H5NA 2RHZA 3SPYA 5BOXA 2P9LA 2YU9J 1MMAA 3F21A 2XKOC 2JTFA 2PNIA 2VKNA 4OU0A 3HTVA 2KAFA 1SD5A 2EV5A 4FWNA 1D4XA 2QGGA 4NCBA 2MSYA 3QO9A 3QIPA 1WSJA 4L0ZB 1XUPO 4E47A 4F8RA 2PY5A 2JA2A 3MMYB 3E0JB 2XHCA 1HD3A 3CDIA 5L3CA 5HRNA 1H8KA 2OA4A 4KT6A 4C92E 2DXBA 2D9TA 1X2QA 1OH8A 4G12A 3VMFB 4IURA 3AL0B 4YDUA 3WHBA 3IQLA 5JVGL 3RPQA 3F9MA 5KI6A 3E5UA 3C94A 2V9PA 4CJ3A 3JB9G 4J9FA 5GANg 4F2RA 1VQ7N 3NAEA 2E6MA 1I8FA 2LF7A 4BE1A 3ZN0A 5C0YA 4I02A 3M1EA 4HCCA 3JRHA 3CCSI 4V2SA 3LMMA 4RTYA 4PJ0C 1MBEA 1MIJA 5CIUA 1IG7A 1A04A 1P90A 4XKCA 3HSTB 2A1SA 2G0EA 4JRIA 5AN4A 3OBYA 2O4IA 4FZYA 3CC2A 2DTIA 2LQKA 5DM6F 1WFWA 1DJ7B 1I81A 1WOQA 2E6ZA 1W5TA 2HZYA 3NMZC 1PD0A 4M6VA 3QU3A 1G59A 1YFNA 1TK5A 3JAMZ 1JE8A 1BIZA 4ON0A 3AVMA 4GY5A 2O8XA 3PGGA 4OGCA 2X51A 2HNIA 3LP0A 2OTJT 1KD1O 4HSBA 1KG1A 2CH6A 5AQIA 1MBGA 5I21A 3CJBA 4E9EA 1JUPA 3DLGA 4WFBL 1W5CC 2AXLA 5J47A 2E5QA 4FPBA 1WJ5A 2MF2A 4PUSA 1HMVA 3R6OA 3E01A 1LWVA 3U3YA 3HOXJ 2A5WA 4CH7A 3DFGA 4ELYC 3TKYA 1L5UA 1YBYA 1IUYA 4B1ZA 3VKIA 1SSFA 2FEIA 2DYBA 2R7FA 4XU1A 5ICEA 4EJZA 3DXKB 3MKDA 1XC9A 1N8RO 2MC3A 1NM7A 3HRUA 1IC8A 5L8RE 3U4LA 1U2WA 5FU7B 2RE2A 1W1FA 5M1OA 3UA6A 1Q1VA 3CCLQ 3M9AA 1JJ6C 4FWRA 3OYBA 3JRZA 4XN3A 1NOYA 2YG9A 4N56A 2B4JA 1KXPA 4CEQA 1KCFA 4M75B 2OU2A 2IEKA 5GJVB 1LCUA 3MN5A 4CFDA 1WPYA 1Q81C 2QYZA 2E5NA 1BIBA 3IH4A 1GXQA 1NJIO 3BDLA 4B9QA 2ZMEC 4BNCA 1HA8A 5ILSA 4C30A 2AXTC 4AQYK 1RTHA 4C92G 2QQRA 2HNHA 1RAIB 1DPRA 4XLHA 4FJXA 2L7FP 3MEDA 5GAGP 2BUDA 2K02A 5GAOr 1QHHD 4K43A 3EG2A 3EG0A 3VUBA 1M5Q1 5J4VA 2DPDA 2P51A 4CDGA 4CZEA 3SAGA 4NOYA 2JN0A 1XSVA 1YYVA 3H08A 3I56A 2HVRA 4HRIA 1QA6A 1RAGB 5LY3A 4JBAA 2PU9B 3MEAA 2K5IA 3CJRB 3TSQA 1BOAA 1M8VA 4JKBA 2LJ1A 2GGRA 2V7FA 1NJYA 3R0AA 3M58A 5AQKA 4KDPA 3H3NO 3QDKA 3TSWA 2B8AA 1WBBA 2ZMEA 4IXCA 1ZTRA 1OQYA 2LREA 3FHFA 3QP6A 5HRPA 1YUWA 4LD9K 2NVXJ 2ICWG 4QVCA 4EMSA 1JQQA 1WJRA 3A8GB 1AHJB 1KRPA 3MEWA 2ZFWA 1QVTA 5D5XB 1IJWC 2OPPA 2RN2A 2PMUA 1WHMA 2JG6A 3C2GA 1Z05A 3GVAA 4O5BA 4LD5A 3VETA 2E5ZA 1AOJA 1K0XA 1ETQA 4IOCF 3ZETB 5GIPA 1UG2A 4M77G 2H3GX 3MWTA 1N39A 1O3QA 2MBFA 2DD5A 2F2WA 1OMIA 3RMQA 1OEBA 2MLGA 4J7FA 4JJDA 2HOTA 1ORKA 2D0QB 4M7DC 2OZUA 3A98A 2HBWA 3RQ4A 5EG2A 2X1EA 1JHHA 4JI0K 1I07A 2FSKA 3MPUB 4OMQA 2LVMA 1T7PA 4YPRA 3SUNA 2YRVA 4FLVA 2CRGA 3PSIA 4NQWB 2E1CA 2J7IA 1NK5A 2P1JA 2HAXA 2G8FA 5IYDJ 3CC7Q 4Z94A 5CQGA 3HYIA 5JI6A 5GMKm 5HLGA 3VEPA 3ENBA 1JHFA 2A69F 3S3OA 2ED0A 2RF2A 4JX5A 3E6DA 4M9SA 1ASVA 1OCZH 5BPLA 2QQ8A 4QW2A 2P9UB 4PWDA 1WSGA 1FOKA 4B21A 1WVRA 3EH2A 5GPCA 4GLKA 2KZZA 3FM5A 3JV3A 2LP0A 4OIQF 5J6XA 1U8BA 1XGOA 1WHHA 4Z4FA 1BI1A 3NPFA 1FEXA 4BVOA 3WE3A 3M0PA 1HC8A 2V8IA 2NOZA 4KH6A 1SG5A 1A6IA 5DCMB 3AO1A 4B47A 3M7GA 5C4XJ 2HNYA 4CVNE 1U5TA 1MNMC 4QVZA 2H27A 2E7WA 3THXB 3OVNA 4DS4A 3OYHA 2NVYJ 5AQNA 4Z4CA 2KK4A 4C92D 1R49A 2ZJRF 2YUOA 1YITI 4B9SA 4K41A 1T0FA 3R1XA 3LAJA 1RTIA 1J0RA 5AQJA 5LHIA 4M78B 2JWKA 4F52A 1IZ6A 5AQTA 4ESBA 4F7ZA 4CF9A 3H35A 3FK7A 3C12A 3O4NA 3D2EA 1M3AA 1GVDA 2XF7A 2F8TA 4KHWA 3DM2A 1IBLK 2PJRA 4JLHA 2Y4YA 1LMZA 4XU2A 5L23A 2KVQG 5GAOl 3CJAA 4PKIA 1XHZA 3I4PA 3U9DA 1WHJA 4PQUA 1LPQA 1VZ0A 5CPRB 3CD6Q 4HKEA 4XKVA 2M16A 4JPBW 4CJLA 3IKTA 3RVCA 4CI6A 1VQLQ 3QJYA 4DQRA 3MZHA 3TEEA 5KE3A 1Z9ZA 4BY7J 2KRCA 1T6DA 3HM5A 3CCEN 3JSPA 3JS6A 3M6GA 2AIRB 5CZ1A 2ZJ2A 2QGUA 4CD1A 5F2RA 4DUZK 5KK1A 2ZD1A 2L02A 4RW7A 4JI1K 1QGPA 4B44A 4M77B 3K1PA 3C18A 3OYYA 3CMYA 3G3ZA 4I9QA 5DPKA 3E7LA 3RPUA 2QWMA 3ZGKA 1STZA 5IWAK 5FPMA 1G3TA 1QCOA 4FT2A 3ZEUA 2IW5A 4CZMA 2KZVA 1G3SA 1YJWA 1Q82C 2HMPA 2GQIA 1BYMA 1B92A 1TG0A 1NBEB 3CD6N 4OMYA 1YTUA 1X01A 1GFCA 3VQQA 4JX6A 2WSEE 2P0WA 5J1YA 2LF8A 1PSFA 1RR8C 2R7ZJ 2HQXA 4FX0A 2H3EB 2YUSA 2DMOA 4AWXB 2FSNA 3WU0A 1YHQI 4MGRA 3KVGA 2PVOB 1VQOQ 4M75D 4H0PA 3OS1A 3M8FA 4OOIA 3OSFA 2W41A 4OVAA 1YJNA 4M7AG 4N47A 4A4GA 1S9GA 4DV2K 1OVYA 1M1KO 1OCCH 4RLFA 3L2ZA 3M59A 4R79A 3C6TA 5HODA 4JK1X 1X3UA 3FHGA 2E10A 3HRTA 2R7UA 4JNEA 4XTVA 2PYLA 3ECHA 3AA3A 2OI3A 5FWCA 4DSIA 5HK3A 1AOYA 2VYTA 2Z1DA 1HKSA 4BR0A 2K3PA 2QA4N 2RGVA 1W0TA 4MQ3A 1D8KA 1SAUA 5HKCA 5F27A 1ON2A 1SL1A 3CCVN 1I4K1 3EUKL 1S6LA 3NWSA 3LWLA 4B1RA 2OAUA 2K7AA 3CJ9A 3HGGA 3VQ9A 3ULQB 5CK9A 1VQOI 1S1WA 5KYUB 3P5JA 2JMCA 1K78B 2QCOA 1IGUA 2L3SA 3SZGA 3HG9A 1A5JA 4OB2B 2FHDA 4FCYA 1WYXA 1YJNI 1MBHA 5KCHA 3GNGA 4XNFA 3ZT4A 1GVJA 2BY2A 3QYBA 4FK2A 4QPQA 4RB1A 1P8ZA 2IVMA 1IXCA 4CJVA 3W3DA 5KPRA 3PE0A 4B1WB 4UV9A 5GMKe 3LDNA 5TISC 2LKSA 4E4HA 5GMKl 2KFZA 4KN7X 4J9EA 3HT3A 4BBRJ 3PNTA 3S1MJ 1ZSZC 2DK3A 2DT6A 2ASPA 1I1JA 3BW1A 4JK9A 2QAZA 1K1ZA 3IUOA 1A35A 1BO5O 4E19A 2DM1A 4M7DF 4DUYK 3I56Q 2CP2A 1F21A 3GOXA 3CCQI 1YJNQ 2GEMA 3MMVA 4EGZA 1DTTA 4BC5A 4Z4EA 5DM7L 1S1TA 4UNFA 4C92C 1NG6A 3AGRA 3LSHA 3VEXA 1QVFM 2H8RA 2O03A 1XG1A 5J8FA 4A3EJ 4FYVB 2DL8A 1S72Q 3NH2A 3H41A 5EDNA 2EFQA 2DL5A 2D2WA 4I09A 2MGQA 1UJYA 4I98B 4FE7A 2WV0A 4CCNA 2R93J 2G6FX 2G8IA 3K6GA 3DEEA 4Z02A 2KDSA 1W2BM 2QZ8A 4AU7A 4M7AF 1HKCA 3VS7A 4CYCB 5IHKA 1D5VA 3O3GA 4B6MA 1QVGS 1EH7A 5J2MA 2CUDA 1V55H 4JKGA 3E6CC 2PLYA 2VC1A 3EYIA 5AQZA 4Y52J 3CF5L 4C92A 5JMVA 4B3AA 4FPAA 4JI6K 1EETA 1RT1A 2M0OA 1VQ5Q 2CSOA 4FT8A 3JRBA 1IRGA 2FBHA 3BTCA 1SFOJ 2FQ4A 4A0XA 4DR4K 3H9NA 4HSRA 4G9YA 3UR3C 4J9HA 3BDDA 2DX1A 4JEPA 2M0YA 1UFMA 4UY8I 3C7JA 4C8QD 4BEHB 5JLWA 3J80K 3A2KA 5D3GA 3OOUA 5LJ5e 4I2QA 3HIFA 2COWA 2HSTA 1EWQA 4F7UE 2XG8D 4EM2A 4C2TA 3MP6A 1XMOK 5LJ3g 3CW7A 3JB9I 2CWEA 4IRGA 2I7NA 2QWPA 3H0IA 1NTCA 4M7DA 3KYCB 4CF1A 2QEXI 2VKEA 4CGHA 2BV6A 3EG1A 4V19S 3HO1A 1H89C 2A7YA 1SQKA 3E5XA 2XAGA 1M90C 1TAQA 5BRDA 3SMPA 3L2CA 4EMGA 3OIOA 5D5WB 2NLXA 3AO2A 4IHSA 1HKTA 1KQSP 1BI4B 2LFBA 2J4RA 2YKMA 3Q0VA 3CXCM 5DM7R 2EX3A 4KGXB 2XDPA 3QKJA 1I27A 2DDAA 1OZ2A 2NOLA 4A59A 2COMA 3RNJA 2Y4XA 1WAFA 1MJ9A 3HOTA 5B8HA 4XLEA 1WRJA 2HDWA 3K1MA 5GTIC 1WQ7A 2DN0A 1OZ3A 2W57A 2OTJI 4FM2A 2OPTA 2UXXA 1S3JA 1VQMA 1FNNA 1PU8A 3DKYA 1JU5C 3F5TA 3TTCA 4NC8A 2LQ8A 5IPAA 3NQOA 2DO3A 1AA7A 4RA2A 3D7EO 5IH2A 1BI4A 1MU2A 5EZHA 1VSKA 5EGOB 2RQTA 4O0IA 2KXDA 3CQXA 3B02A 1YQAA 1TWCJ 2NUPA 1QSLA 4YOUA 3CXCS 2FX0A 3MZ8A 2KZMA 5DM7F 3HRGA 5GP9A 3QYHB 2KGTA 3GP8A 2P9IA 3HOSA 1W2BA 2EJGA 4W1UA 4ISFA 8ATCB 4XOPA 1HNVA 1JJ2M 3CJNA 1OX8A 1M1KC 2GTOA 1C1CA 4LLNA 1G15A 3KK7A 4BQNA 1VQNI 5KGXA 1CSKA 1W0UA 4KHYA 1FMWA 2HYFA 4BXXJ 2O4GA 4IDHA 2JSPA 1DIZA 1WQWA 5C2DA 1B8IB 3HPGA 5KYYA 2KT0A 2HQNA 4WCGA 4FISA 1HUXA 1TL3A 1WFXA 3L2VA 2FMYA 1QCFA 2E36A 3CLQA 3H0GJ 5JHUA 2DA4A 3WTZA 3LW5E 5DV5A 2RN7A 2ROTA 1GCQC 3SYTA 3FHZA 3V4IA 3MN9A 3HYFA 2DAOA 2FZGB 3CCLN 5GAMj 3O9QA 4L3QA 4A3DJ 3SJMA 2CQ7A 3CF5F 2HSEB 3MO8A 1X4PA 1Z9CA 4L8RB 1DEJA 1RT4A 1WLPB 2FU4A 4LG3A 4RAFA 4C0DB 2QSFX 3IRRA 3BROA 3D4VA 7AT1B 4AHSA 2HMAA 4BAYA 2F96A 3TSPA 5KCMA 4CGJA 1XD7A 1I1GA 2GZWA 2OZMA 2LH9A 3WU2C 2XAHA 5F0CA 4HV5A 5HNHA 2D0NA 2OYQA 2L3QA 1BIUA 2E1OA 3I54A 1VI0A 1YS6A 5K5RA 4UV8A 4OMMA 3OW2A 1Z7UA 4KRFA 3B73A 4Z6YA 2XF5A 1KK7A 2BW3B 1FTTA 4KFCA 3SQ4A 1R1TA 3NGYA 4M41A 3EHRA 4BRHA 3RMAA 2YNFA 4A6DA 4EJUA 1MUNA 2HU9A 3CCVQ 1ZSZB 2AZVA 2MD5A 1KD1C 4JLGA 1S22A 1DQUA 5ILVA 1FYKA 5IT9Z 4UB8C 4ELTA 1PUEE 2RD1A 2CUJA 3JRDA 4AHVA 2EFPA 2FO0A 4OMLA 1UMQA 1N27A 1U3EM 4IEEA 3A0IX 3CI5A 4X34A 1QMCA 5FPDA 2J05A 3GIBA 2ISZA 2HFHA 3I53A 3CPEA 3GCMA 2Z33A 2ZPIB 3MEUA 3HHGA 3DOLA 4NLCA 4CESA 4BXUA 4CBXA 4EW0A 2VV5A 3MDQA 1RL2A 1TWGJ 2L4MA 3HSRA 1R1UA 4BGDA 3GF5A 1FP1D 2FF3B 2HVQA 2E5LK 5D6YA 2CKKA 2IXSA 1NHAA 1XWLA 1RR7A 2XHBA 1G3WA 4HVVA 1M90U 3LSRA 2EILH 3G4SN 5IT9E 1QS4A 3BR5A 2MWOA 2EA2A 2L7ZA 1YHQA 5HDKA 2HD0A 3THVA 1P59A 4KHPK 1ZLJA 3DXJF 4G9ZA 3DLHA 1I50J 5ILUA 2W85A 1QPIA 2MCNA 2Z1HA 2BE2A 3PIOL 4E7SA 1R6RA 2ZF5O 1NPPA 4LITA 1JKRC 3ZBDA 1VQ7T 3QEVA 2EWSA 2EFOA 5L3GA 3JB9H 2DA3A 3KJVA 2GWRA 3CFPA 1TH7A 1OI1A 4FK0A 4KISA 1I3AA 3MQ0A 3CCMI 2X1CA 2HL5C 3QBYA 3HOYJ 2JTVA 1E3HA 1XC3A 4A5BA 2WB1A 3AVAA 2VE8A 1CKBA 5AZJB 2FVUA 1IV8A 3NARA 2DTZA 1LWYA 3BZ6A 1X1CA 3SLCA 1QHTA 2ELHA 2EYQA 4M78E 1WXUA 5BN9A 4WQ5A 1XG7A 1YX5A 5LMNK 2DMUA 4M75C 3P38A 3A8YA 1WNSA 3M57A 3KLHA 2F5FA 1FKOA 1NKBA 1T8EA 1ACIA 1T0FC 2W04A 2P84A 1TU0B 1BJAA 3CLOA 3HTUA 4D5CA 3ME9A 1SUQA 3O3FA 2XAJA 3E19A 2GIVA 3OMCA 3GO5A 5IXFA 3VA0A 1Y6IA 2FD5A 1B7TA 4OAZA 1ZA2B 2BTTA 4KHUA 3FB9A 1EWRA 4M74A 1PNJA 1MGQA 3QERA 2ME0A 1TK8A 2D1HA 3EYYA 2YHTA 3NTHA 2LT1A 3HOWJ 1X3NA 4PA1A 1UAXA 4XRSG 4I7FA 3MD2A 3KWIA 4NLBA 3PO4A 2P9PB 4XQ3A 1A6QA 3WEEB 2FYKA 3RDVA 2QI2A 5GAN7 2F48A 1SD4A 3KZYA 5EU7A 4CJWA 1BA1A 2R7OA 1YI2A 2CP0A 1ATSA 3DB4A 3U21A 2X4XA 4N5SA 3VQ6A 3T7ZA 4RCBA 4J83A 4AUXA 2JXBA 4PZJA 4EJOA 4O8UA 2K3XA 5A0GA 2DEQA 2PMZN 5BRFA 4AHTA 3V9WA 4MHGA 1JUMA 2XPVA 2Q97A 1BC8C 4W5RA 2VBYA 2FPFA 3V7CA 4FLXA 3JCMe 4PY5A 1HSJA 2DZ9A 3IUCA 3SQNA 1PWTA 3LDQA 4H4MA 5L3BA 4Q4ZF 5C24A 1I6HJ 5CKEA 3THWB 4HG2A 2H09A 4B1XB 4EA4A 1IKYA 3E9LA 1K9AA 3VRZA 1SL0A 3BTJA 1HW2A 4RDUA 4CEDA 4M7DB 3M9QA 2HR3A 3VQ4A 3G4SQ 2E65A 3FJPA 1AKHA 4XH4A 2O31A 4MFEA 3M0RA 3BG6A 4H5VA 1GV2A 4E7KA 1VSFA 4LGWA 4BUPA 2YUQA 5AQPA 4JOMA 3ML6A 3OW2P 2X6OA 1DGKN 2Q2EB 1KONA 1M30A 4MLHA 4RW6A 1WGSA 4JD2A 1D1AA 2DZCA 3FF5A 1Q7YO 2P9KA 4BY1J 2UUZA 3BPVA 3F73A 5GAEJ 2R7RA 5AQXA 2IVOA 5LJVA 1TWHJ 1IF1A 1EA3A 3VS3A 1IDZA 1S29A 2K9QA 1A5VA 3C3WA 1L3UA 4Y7NJ 2RC4A 4C8OA 2ZC2A 4D1QA 2HL3A 1SHFA 4DQSA 2VG7A 3NTKA 2DA7A 1JCEA 1VQON 3ZT1A 3BQZA 2BYVE 5FROA 2ZBKA 2LG4A 3EAEA 3VV0A 2IA2A 3DBLB 5DK5A 1N9SA 4B3OA 3QWXX 1YI2Q 1U6GA 4L59A 2VKDA 2VT2A 4IJNA 1YJ9A 3PO2J 3LQQA 2DFHA 1I6XA 2O01E 1S6QA 1KO9A 1T05A 2HQEA 4YOWA 2HHVA 3G1LA 4M3DA 5GAOm 1EKEA 3O4QA 4BRAA 4EA5A 1V29B 4HDUA 2F4VK 1TTHB 3HTRA 4F16A 2XHKA 3BR0A 4CZCA 4DS5A 2XUBA 1Q81R 3ENHA 1R5ID 4FJ8A 1KFDA 2E12A 2QTVA 2HMIA 3O9RA 2V4JC 4IZ9A 4DU3A 4I2PA 4M7DD 1BBYA 4BE0A 2DVJA 3SB2A 5J4YA 1TS9A 4DHYA 1RT5A 2CMPA 2VWKA 3ONQA 1K8AR 2ZXIA 1FN7A 1KQ1A 3GLXA 4KH0B 4KREA 2O88A 3MP8A 2K4JA 1Y0UA 3HK2A 2D5RA 3VENA 2O8EB 2YPRA 1RBSA 3DQVC 1BDGA 3K5OA 4DSFA 4JV5K 1N34K 2EYZA 1ON1A 2KTQA 2JW4A 3S2HJ 1PCXA 3BY5A 4NDLA 3BR6A 3G0ZA 4IIMA 3K1NA 1LV5A 3MKLA 2NS7A 3LYIA 3EEQA 3WTTC 1B34A 4DNCA 5BN8A 3NTIA 3CCMN 4LG0A 2PMHA 1S7OA 1S1VA 2FXAA 3PNWC 1WHGA 4M3FA 4EFHA 1W97L 3NBPA 2W4SA 4DBRA 4FM4B 1K73C 5M1FA 3DOKA 3T1HK 3M0SA 3OSVA 4JAXA 3NF8A 1KAYA 1YX3A 3OYJA 2QENA 5HLFA 3LSGA 5BRHA 1MSEC 1BM9A 3WXLA 2IIMA 3N4QA 3CO6C 3K5NA 4FU6A 3M3YJ 4C8QF 3VYUB 1MBJA 2E19A 3TMOA 2CZ6B 3GTQJ 1M4ZA 2DBMA 3FISA 5ELZA 1KLNA 2M02A 5H6QA 2OTLI 2HDCA 1P92A 1B72A 2CU7A 3V42A 2NNWA 1XSXA 1K4TA 3J80E 1E4FT 1H9TA 4B9LA 3QYEA 1R00A 4JJNK 3S6WA 1Q18A 4KH4A 1ZGJA 3FFIA 1Y97A 4DU4A 2HYJA 3WTVC 1UECA 2RJCA 1X3WB 2CH5A 4D7MA 5D6EA 4CCKA 2LP5A 2HI3A 2DL4A 1JKHA 3WTUC 1LAWA 4CCHA 4LF5K 4BRMA 4CECA 4ATOA 4FW1A 4PJJA 5F6FA 2E6NA 4OGEA 3M4OJ 5HLTA 2HPMA 5KRSA 2R7TA 1RLPC 4C0ZA 5DM6L 2I7PA 4M3ZA 3VQ7A 5D8LB 1TZLA 1VQPN 2F9WA 1S3XA 2HGCA 4MEXF 2WBNA 2RI3A 5BPMA 2XPUA 1YVUA 5HBMA 1OH6A 2H94A 3W6KB 1RRSA 1OCTC 4H0EA 2KEAA 4K11A 3LWFA 4M7DE 4DTUA 4KITB 2CQXA 2V7ZA 4J01A 4FSXA 5EEHA 3I3LA 3IAM2 1X2MA 2G3RA 2K9GA 3RMSA 1VQ9T 4C23A 1Q86R 1WJCA 4TVRA 1ZYRF 3LDSA 2RH2A 2D1VA 2VODA 4D8DA 5FFXA 4YFXF 5JLFA 2K85A 6PAXA 1KEAA 3CCUQ 3AA5X 4AT1B 4C8LA 2FUG2 4HSTA 4HW0A 4IIOA 1S72A 4BRGA 5IT9K 1APLC 4YOQA 1HPZA 4CFBA 5HDNA 3REAB 1U4BA 4EM1A 3OA6A 4BWMA 3WXMB 4IXAA 4EP4A 5L3DA 3VERA 5AZJA 1VQPQ 1OH5A 2FQ3A 2LT4A 3WQTA 5LFAA 4V2GA 2HQRA 1HW5A 1V76A 1G3YA 3RR7A 2LDMA 2QQAA 2VXZA 4XQFA 2IS1A 1A31A 1JLCA 2Z0WA 3ITHA 2QGFB 3KX2A 1HNZK 4R0KA 2KROA 1JCFA 4LDXA 2CSIA 4I99C 3U6FA 3O9TA 4A3LJ 1ABOA 1FYMA 1NK4A 3PIOA 3EN9A 2WC9A 5M3FJ 1YF5L 3CM5A 4IOAL 3MX2A 3KLFA 1SAZA 4C9YA 5K5QA 4NZGA 3BY6A 4BG8A 2EGAA 2DO7A 1VF9A 2O8CA 1TKDA 4KULA 4CZKA 2UXDK 1OQKA 2FA5A 4RW8A 5B5EC 2FBXA 3IC7A 4ENNA 2J6OA 2FF6A 2G8WA 2ECCA 3CMMA 2XU8A 3UKRA 3SDGA 3ZSOA 2X1DA 5IHNA 1UTIA 1BL0A 3M8SA 1CF7A 5C4JJ 3FE1A 1WIEA 1T0JA 1WXTA 3DWLA 3NF6A 4DR6K 1DU6A 4NL3A 1BKBA 4CEFA 3FDYA 3VESA 2YT6A 3RR6A 2NYSA 5HNFA 4Y15A 1DKGD 1XSDA 3O1BA 2DCEA 1DU0A 2QEXA 1ZBXA 4OMFB 3ZN1A 1IV0A 2XRLA 2P5LC 1VQ8A 3SEMA 2BVLA 2P4RA 5J26A 3TQ7P 4C2MJ 3UKUB 3ULRB 2KMUA 2WAQN 1GLNA 2JQ7A 3ZCMA 4QLCU 2QEXQ 1G4DA 1JEGA 2XKOA 4WX9A 2K9SA 3HUGA 2L7KA 4WFNL 1TQMA 2GOMA 1Y71A 3HFOA 1IRXA 3CCRQ 4FZZA 2DMTA 1KVCA 2ED1A 3QDRB 4E9FA 3A8HB 2R7SA 2E88A 1SAXA 3L09A 5D6XA 2K40A 4Q5WA 2YRCA 2HOAA 1B59A 4PJOB 1SHGA 4UUVA 1SVLA 3M8RA 2AQFA 2E35A 2L0KA 1O3RA 2M4GA 4DR2K 1OCOH 2FC0A 4M7XA 3OSGA 5GAMg 1AZEA 2YX6A 1J5EK 5HK0A 4IHVA 2KT8A 2EAYA 3E5QA 3A8MB 3VTIA 1XQHA 1BR1A 3ZOBA 1V4RA 3OY9A 2ETJA 4DFMA 1ETOA 3IHUA 4ZNXA 4BRFA 4MLOA 1Y39A 4KPYA 3OJUA 4J2AA 1YFHA 4ESJA 2OTLT 3R9PA 1QVFS 3O2PE 1Q7YR 1XMAA 4YIRX 4G8XA 5HS9A 1QP2A 2MWPA 2HF3A 2F9TA 2OX7A 2FMLA 3CUQC 1EFNA 1Q8IA 3VF6A 2OPQA 4FX4A 2W42A 3OW2M 1MMGA 4W97A 1RI0A 5LMUK 1LJ9A 4CGFA 1KVAA 3MECA 3TWHA 1R9TJ 3DKXA 4ILGB 3HPOA 3EGXA 1VIFA 2LY9A 1VSIA 3HL2A 3FX3A 3CCUT 4MDXA 2V6EA 3FZMA 4GNIA 3CCYA 2RHIA 3CO7C 1RDBA 2XY8A 2Z1JA 4HNTA 3BPXA 3TQNA 4PGGA 1B34B 2M87A 2Y1JA 3BC8A 1SF9A 3FXKA 3D5SC 2OUMA 2CV2A 2OC6A 4CICA 3QODA 3I56N 4G6DA 2O9SA 4MTEA 5LJ5d 4DLGA 2CV0A 3R61A 1Q81O 5FKKA 1YJNN 1AD5A 2R7QA 5ICGA 2DEUA 1WJEA 2AQEA 1WPKA 1REVA 4A3FJ 2M30A 2NWMA 4E1JA 1RI7A 5J2QA 4QKUA 1X3MA 2IGMA 3N5NX 3GTJJ 3LSTA 5EVZA 2DMQA 4PKHA 3WXKA 3V4GA 1SFXA 5D4RA 4QS9A 1BCOA 4B24A 1MHNA 3PFSA 2GUPA 1KG5A 3HZ6A 5CVRA 4A2AA 4XK4A 2XK0A 3TPQA 4LY7A 4PGHA 3TW7A 2JMWA 2JOYA 3CQYA 3OB9A 1GXIE 3VOVA 1U78A 3CETA 2GXBA 4BD3A 4AI5A 3BR1A 3AFHA 4JS5A 3FZLA 5KGWA 3QOEA 2IS6A 1W0HA 2LRQA 2RQQA 4U0WA 4OMNA 4LSLA 3V1RA 4TV7A 4FYWB 1I5ZA 3I58A 1B9MA 4PJOA 4BI3A 4N4IA 2JHNA 2X4HA 5I2MA 4HDVA 1QW1A 3THKA 2FNPA 5KVRA 4DYCA 2I10A 1YJ9T 4LSNA 3MCPA 4IHWA 3HP9A 1LDDA 1VRUA 2Q0OA 4X62K 3KP2A 3EG9A 1FT9A 3MKZA 1NGIA 1NKCA 4Y1DA 2GA1A 2B0LA 2YLCA 1YN8A 4CXFA 1M1GA 2O4XA 2E6LA 3H6EA 3UKUA 4YTLA 5JVGF 4AFZC 3CWTA 2F4OB 3AO5A 2HDAA 4PHTX 2DETA 2QUFA 3K59A 3MN2A 3LPTA 2M7AA 1POGA 3CCRN 1ONVA 6AT1B 2LJ0A 4C8QG 2XY5A 4PFZA 3K4BA 4E7JA 1UHWA 3ELKA 1KTQA 1J59A 3C95A 1IRZA 4JI5K 4ZDPA 1WNLA 3M8JA 1VQKT 3ECOA 2A36A 5GAHJ 4A53A 4RKUE 3GOIA 1JL1A 1UG0A 2X6WA 1SEMA 4OX9K 3DP7A 3OYIA 3ZMVA 2HKNA 3FSPA 1LWCA 3RQIA 3A01A 3TCJA 3H36A 2BBYA 4ZDOA 4F7UB 5CKFA 3KK1A 1U04A 2F4MB 1KSWA 4MO4A 4WWCA 4U67L 2FBIA 1K83J 3ASNH 1EBMA 2YLBA 3WTXC 1FJLA 3Q0WA 2EHGA 2LQNA 1Q86C 3BZCA 3LL7A 3QWLA 1IV6A 4CO8A 2CZ0B 3GF2A 5DUKA 2ABKA 5FLXO 2EYXA 4QT7A 1NGHA 2FE3A 3P9IA 4JJBA 1TVRA 4A4EA 5KPZA 3QBXA 2PVDB 4KIBA 2KSSA 3T69A 5CVUA 4MQVA 3SZTA 2OTLA 4M3TA 4HWIA 3B6PA 1SMTA 4RAGA 3P4IA 4NC6A 1MUDA 2GFUA 4E7IA 1M8MA 3LANA 4QVDA 3F0CA 4DV5K 2JT4A 3THYB 2DNUA 3MHXA 3DBRB 4HNUA 3QFPA 2KIMA 2A41A 4OIPF 3B6OA 1ZBFA 3K4JA 3CMAQ 1OX9A 4J00A 5CAIA 3E9PA 1TQPA 3RI4A 1YT3A 2J6KA 4X64K 5GIOA 4EMKC 2F2EA 3JCMJ 1Y57A 3SI6A 4OPAA 2GAUA 2EFIA 1HYZA 4L5IA 2RNAA 4OFHA 3K2PA 2ITMA 2WAQA 1YJ9N 2DU9A 4DA4A 4WYBA 1K4US 3OYCA 1Y8RB 5CVJA 3D7SB 3O6BB 4CRIA 1WCMJ 1U5TC 1MZBA 4PJOD 1T44A 1X4OA 1ZC6A 4B22A 4DB3A 3NMUA 4HX7A 1UJ0A 4ID1A 1N8RU 2JA8J 4P9UA 5FKMA 4PFPA 1MWKA 1ATRA 5E20A 4AVPA 1LB2A 4JK8A 2UWMA 4A69C 1E2XA 5HL7L 3JRGA 2Z3YA 1NLOC 3KP3A 1M2OA 2EKHA 2ZFUA 3RSNA 3H3ZA 1RT3A 2XV4S 1SKWA 5CJ9A 4JZ3A 5F1XA 4LDWA 4HOBA 3CC7N 2XDDA 3LL3A 2JVGA 3A03A 1TTYA 4KN4X 4N4NB 5M5YJ 1QNTA 3LM9A 1NJWA 2JM9A 4QQGA 1LFBA 5C12A 3QZ5B 1D1CA 3CCJA 3CPWS 3CWSA 2MC4A 3LM2A 5BREA 5KAFC 2A68F 3O1WA 4XTXA 4FVUA 3CBOA 1D9DA 1OR7C 2MH9A 2V1DA 3DBHB 4FLZA 5E3MA 1M90O 2XROA 1F1ZA 2LY1A 5H6RA 4F55A 1T6CA 3A0HC 3CC7T 4KRTA 2A08A 1OPCA 3H9GA 5AONA 4FJLA 4CZLA 1K8AO 1LDKB 3F8CA 2EJRA 2YR2A 1UGQB 4JHDA 4PIIA 2CV1A 2ESNA 1TBXA 3CCQN 1DGRM 3ZXSA 1VQ4T 2ELKA 3MK6A 1KFSA 1UELB 1VQMQ 5LRSA 3JCMV 5J3BA 4B3RK 1LJOA 1U1SA 3MX5A 3U2RA 4BQOA 1BGXT 3L3VA 1VQLA 2ZCWA 1NKUA 4PDKA 3TGNA 3N97A 2M9UA 3EYZA 4FK4A 4BI4A 1X1AA 4BRCA 4Y17A 1UZCA 3A2FA 3FXRA 2QWRA 1HKGA 1GLLO 5CKTA 3DU5A 2BHZA 3T1BA 1NH3A 1VYTA 2KYMA 1JGGA 3CVTA 2OA8A 3HSCA 4C0DC 1PRMC 3QPHA 2VBWA 2VJ5A 4OMOA 4HUFA 2BZ8A 4M45A 3RKQA 1FTZA 1M90R 4F04B 1XGMA 4ZYEA 4ISEA 4M7AD 2CW8A 1VQKQ 4BQQA 2QSHX 1RTJA 1T95A 3EL2A 4DTOA 3WXIA 2A40A 4WCEL 1P4XA 3R4KA 4IQ4A 2O8EA 1ZBIA 4A5NA 2E1ZA 3W6VA 1AWXA 3DRSA 3QZ9B 4B9NA 4JP0A 2Y9ZA 2O8BA 3OBWA 4LOCA 2O8KA 1XOVA 4RG2A 2EZHA 3QEPA 2VOOA 2MAMA 4DF8A 4KKOA 4EJWA 2K5LA 4CC3A 2QA4T 1YITT 1MA9B 2X78A 3A02A 4XONA 1LVKA 2Z1IA 2ATQA 1M3CA 1YJWQ 1PKTA 2JA6J 2EFNA 2OFKA 1X27A 1YHQN 1FBUA 2Y69H 3VODA 1Z25A 3AAFA 3LSMA 3FMSA 1RT2A 2NOGA 3J7AO 5C10A 1KIKA 2YHWA 2EYYA 3H3VK 1WWXA 4BHBA 1Z9QA 2DJIA 1KC8U 3OL4A 1YIJA 2KDZA 1MUZA 3VFZA 4J8OA 3GW2A 3CD6I 1HDDC 3PO5A 1ZKGA 1XQPA 3QICA 1SV5A 3BGRA 4DV0K 4RGUA 1SD6A 4Q48A 1CZAN 1I5OB 4FOEA 4A5MA 2RKIA 3DRPA 1QU3A 1XMXA 2P9LB 2EK5A 5AQYA 2LK2A 1AWCA 2R92J 2EPFA 3JCMh 3LA7A 3F22A 1IB8A 1AZGB 3DI6A 2RQWA 3VQPA 4RB0A 5GAGJ 3Q5FA 1N33K 2FF4A 3QETA 3RBBB 4E89A 2DAQA 3CCEI 1MNEA 2PQWA 3KTQA 5AIQA 3DV8A 1GUUA 2YCHA 4ZN3A 2K9NA 2E8AA 1J3TA 3EDPA 4HX4A 1RILA 5CLSA 1S9EA 2FRWA 5IP6A 3OOPA 4M3RA 1X19A 3ZX0A 1OVQA 3VA3A 1XTAA 4WQ5C 3PIPL 5D4SA 2W6LA 2GBQA 1FP2A 4ESFA 3VS1A 3PQKA 1W4SA 1BA5A 1JGSA 4RTTA 1KJWA 2DRMA 1NGJA 3KWGA 4KH5A 4M75E 1P6RA 1PU6A 1WJSA 2UU9K 1TV6A 5D6FA 3F10A 4JLIA 2BXYA 3PFIA 5IAYA 4M77C 4FW2A 4YNQA 4M9XA 4V2FA 2CYZB 2OCEA 1VQKN 2VG6A 5AZIB 2UXNA 4LDVA 4AH9A 1MBKA 4MQ9F 4U88A 2O9LA 2NUTA 2D0OA 2JT1A 2DL3A 3ASMA 1YE9A 2NVTJ 1KQ0A 3L1PA 3V8LA 3AVJA 1RC9A 5ICFA 4YFKF 2ID3A 3A8OB 1T6SA 1CGPA 1UGSB 3LP2A 3FHNA 5MLCQ 2IVWA 4IHXA 1XCVA 5J3LA 2BXZA 1PG5B 2LX7A 2W25A 4MZPA 5FB2A 1E3OC 4J5YA 1ZR2A 3BR2A 1U9NA 2GBZA 4B9WA 4G6QA 3AAQA 2FOWA 3V9XA 4BY6B 1QCNA 1YJNT 4KYWA 2LNHB 4CC4B 4OJRA 2EBPA 2LOOA 2LTPA 5IP9J 3BWGA 3MEXA 2NUPB 1FZPB 3G4ST 3ERMA 1R36A 1U84A 2PFBA 2YSQA 4EIAA 3HJEA 2DJNA 2HHTA 3GLLA 4LD6A 1JO8A 3H1VX 1TXQA 2RREA 3DTKA 3JCMc 2O6GE 2L7MP 4BUGA 3PVLA 2P9NA 3MKYB 2V75A 2KIQA 5TRDA 1WN7A 4NO7A 2OAZA 1BK2A 1YJWT 2PN6A 4EZ6A 2KRHA 1C1AA 2VGNA 1P7MA 4HVWA 3RIRA 3KD1E 1OPLA 4IG3A 4G6TB 4E9GA 2WONA 3ZEUB 1U48A 5FO5A 1S6PA 2Y48A 4D5FA 3QWYA 3SYZA 5ERIA 2VJIA 3GZNB 5LJ3f 3TI0A 5LJ3h 1IN7A 3PM1A 5I9EB 4M63C 2LBFB 4JYAK 2UXBK 1Z26A 4QS8A 3WU1B 3LDOA 4J2DA 2ZXHA 1W9HA 5IHIA 2RJEA 1XMKA 2DFFA 1W5SA 3VSKA 4A3JJ 3LSPA 2E3HA 5C6SA 4FJGA 2ETHA 3SBTA 4HQEA 3SWNB 1YAGA 1I94K 1C0TA 1H3ZA 1RAHB 4RTUA 1IREB 3CCQT 4XRSA 2FBYA 3I0TA 4OPKA 4XOTA 3W2VA 5EEAA 2CDTA 3JCMQ 4M3XA 2YJFA 1K61A 4DCHA 1F43A 1QLYA 4J2BA 3CC4N 1D0ZA 3GTLJ 2E4HA 2YDLA 2QWLA 2ZXJA 1D0YA 4H4KC 3FXQA 3OH9A 4CEBA 4JI4K 3P1GA 2AJQA 4I0AA 1Q7YC 4HTUA 1VQNA 3SZ2A 4CHZA 1KQ9A 2V79A 4CA0A 3GXOA 4ZZDA 3CC7I 4YOTA 3SDZA 2BVMA 2XB0X 1RIOH 2CP7A 1VQPI 3DLMA 2VYPA 2D4WA 2C0OA 4X9CA 4BI8B 4M73A 3ZL7C 2ZJQL 1T3VA 2A6AA 1Z0XA 5KRTA 2J06A 2VGMA 1Y96B 1MWMA 1U47A 3LH0A 4GVEA 5FKLA 2IA1A 4BDZA 5LBQA 3UKGA 5AQVA 3P83D 3QEIA 4KICA 4J6XA 1GRIA 2KJBA 3HOZJ 1JLQA 2KE9A 4JD2B 3UT1A 1VQMI 1N77A 2ASOA 1ZN2A 2YI1A 2LYCA 2LY2A 4B8XA 4FIBA 2ZXWH 2EQKA 1ESVA 4GV3A 2HHQA 2KDOA 4P5NA 2L2PA 3VUZA 2LLKA 3L2QA 4BRQA 4CHNA 1M2VB 3QPLA 2D1KA 3NNQA 3EE8A 1H9GA 1ERDA 4I9LA 2PAVA 1JLBA 4G7ZF 4RTVA 3RCOA 5HRRA 1CZBA 3SQ1A 1VQ5A 1NPRA 1QZEA 3OS5A 2L3RA 4AC0A 3GFLA 1JJ2S 1KQSS 3KKRA 3G0QA 1JRIA 5T7BA 2E4LA 1WHLA 2HOEA 5I3UA 3J7AY 4II3A 5FLXK 3PSFA 1JTYA 3ZMTA 4OP0A 1P4AA 3LSKA 2WWYA 3ZQGA 4Y91A 4PL7A 1VSDA 2NOIA 3PX4A 4CFAA 3V7RA 4W5QA 3CMEI 1XDSA 4OB0B 3KZZA 3O9SA 1D3BA 4I6MA 4DZPA 4C5GA 1RBTA 3H0DA 4YPHA 4KUMA 1BR4A 1WJAA 3ATVA 1U1TA 3RZDJ 4IOCL 2HBPA 5IT9O 4HVJA 1X9MA 2RNGA 3RESA 2OPRA 4E7LA 3PUFA 3GTGJ 4ZYGA 2AK5A 2HEOA 2O8BB 3VEVA 3LLRA 2MK5A 4F4KA 2L89A 3VYRB 4MMKA 1KG4A 3HC7A 1LE8B 3O8MA 3B6CA 2PMZA 3JB9F 2ZPGB 1D5AA 1J9AA 1QZZA 3BZKA 4BR7A 1RAEB 3SUQA 4BJ6C 5DD4A 5GAMe 3A5MC 3CD6T 2XB5A 3CMEQ 4XIUA 4S0HB 4UQGA 1IN6A 2X35A 3ZX3A 3HVRA 2HHSA 4BDPA 3M0QA 2L0AA 3WGIA 1UWBA 3RTRA 1RGIA 1V5EA 5GAN4 1OPKA 3J7AF 1YQMA 1YO5C 3AVKA 3U9GA 1YIJI 4JUVA 4FL9A 1NU0A 4LNPA 4B9VA 1BI0A 4LF7K 4M78C 3IP4B 1WH5A 3UE5A 3MKWB 3UPUA 3TU4K 1YNZA 1UGRB 4XSXF 1V1CA 2P9SB 3CESA 4EMHA 5DLQE 3HZJA 3JCMd 5J2NA 3LDLA 5EOYA 1ZUUA 1T39A 2ZJQF 2KI7A 5KYXA 3LNQA 1OYWA 4EDUA 4LUDA 1I0CA 4ZTJA 4DOVA 2XD0A 5AQLA 3S2DJ 1C1BA 3CCVT 2EIMH 3UF4A 1X1DA 4EATA 1TWBA 2PJRB 1J5YA 4X0GA 2AP1A 2MLKA 3AG1H 2LMDA 3CCVI 1B4AA 3KXTA 4QOZB 1GLEG 2QA4I 2G8HA 1S1NA 3OSSC 2BUPA 4L18B 4DKWA 2A3ZA 2R7YA 3NRVA 3E6MA 4ZGJB 5K14A 4BR4A 4F17A 3ALYA 2OQRA 4ZGDB 3PNVA 2ZNYA 4DW6A 2NOHA 2GXGA 4RCHA 4HCKA 2CW0F 4C1NI 3A01B 1NG2A 4LFBK 4BG9A 4KH1B 1YOVB 3FK6A 1T38A 4JZ4A 5E41A 4E9HA 4EAHD 2RQRA 2G7UA 2F5VA 4FJNA 4FJ9A 1LAVA 1OR7A 2VPRA 3IKMA 5FPNA 3JAMO 4E6RA 1BQNA 5M1NA 2DFIA 3M56A 5J8CA 3RZOJ 2X6NA 4IO9L 4J9IA 2OANA 1EO1A 3VPRA 3MCZA 2RQPA 3N4PA 4Z4GA 2VL8A 2FSJA 2KLOA 1WJDA 3G2BA 4AYBN 2JJ9A 3S93A 2R7XA 3JCMP 3C6UA 2UUBK 1Y96A 2IC3A 5AFUH 2YRDA 3IKVA 4HT9A 3K0LA 2D5VA 4F3OA 1QKWA 5BR9A 3KLIA 4WXCA 1VQ8N 3W2AA 1TC3C 2D8JA 1GT0C 2KZGA 5K1YA 3W0LA 5CQYA 1XJWB 3QJ6A 3PIPA 3KPHA 1QQJA 3AG2H 3A5LC 2A6TA 3OYKA 5LJ5g 1X1PA 2RDPA 3AA2A 2P6TA 4JQFA 3LSIA 1YQLA 3V9SA 1FW6A 3PMIA 1KQ8A 4XU3A 2FXUA 3QP5A 1XGSA 3SJHA 2RNJA 5HS7A 3BEXA 3SBGA 2FJ1A 5GJWB 3WTSC 2DPPB 2FBVA 3BF1A 3MWPA 2JPBA 2K86A 1ILYA 2DXCA 4JI2K 2EWNA 3C0BA 4RMNA 1M1KR 1BL3A 1LOTB 3ASOH 1YJWN 4C92B 2Z9OA 5LLQA 3V8JA 4LMYA 3OYMA 4BQLA 4CGZA 2DXUA 3V81A 4L9VA 2GCXA 2LZ6B 4W5OA 3CHWA 3T8RA 3M1FA 3AY9A 2EFWA 3SMSA 3U8XA 1VQ9I 1FXXA 4IZZA 2KRNA 3QRFF 2IS3A 4KMUX 2GF7A 1HR0K 3CBMA 3AV9A 1Q86U 2Q0UA 3C65A 4L5GA 4NL2A 1LEAA 3FEOA 2WAEA 4ZYHA 3TO9A 3WNHA 2Q8KA 4OB3B 2WAFA 4PNOA 2QWQA 1WGXA 3KFVA 3Q7CA 3CCJQ 2E71A 2VCPA 1OKRA 3EH1A 2HQ5A 1KGSA 5LJWA 1Q82R 1X43A 4YHHK 3THXA 3GE1A 1UHFA 3DF8A 1Y8QB 1YI2T 2RQUA 4L0YB 1OV3A 4C0FA 3CWUA 2CH4A 3RUXA 1I39A 1X3ZB 3OV8A 3MXJA 1OH7A 4CHQA 3DEUA 1BI2A 3PTAA 5B1BH 3M55A 2JM8A 4EJYA 2M9HA 2HSPA 4WK8F 4Q47A 1RUOA 2IBDA 2CYYA 2K57A 2NZTA 5TGTA 2HBJA 4BGAA 4KTQA 4C2UA 1QQNA 4X1VA 1ZQ3P 1WHKA 1GLBG 5E1WA 4A12A 3R8EA 4AVZA 3HM9A 3KE2A 4BHCA 1SFUA 3P8DA 2O8FB 1T0HA 4M75A 2F5EA 3R60A 2EB7A 1NGCA 4WE1A 1RT7A 4ELVA 2KHOA 5AR0A 3G4SI 3LOCA 2VPLA 2JS0A 3T5XA 1BG3A 3EKSA 3S16J 3MAQA 5BNGA 2PFUA 2XC7A 1KQSA 2NRHA 3SV4A 2E2PA 5C15A 3MFKA 1S8NA 5CKBA 3SQ0A 4E0DA 1PUFB 4NNJA 1SEUA 1Y0NA 1J9IA 1EX4A 3FXUA 4A3KJ 2EQUA 1P9QC 1BQMA 1ODDA 1JBMA 3CCMT 1O13A 4GKKK 1NWKA 2GWJA 4KHSA 1QZ6A 4M3WA 1W36C 4Y4RA 2F69A 4RM2A 1N6AA 3CC4I 2E34A 2VC8A 2FB7A 1RDAA 2HXIA 1PDNC 2JMAA 3IWFA 2CS7A 4XIDA 3WVDB 2NYXA 1K79A 1X9JA 1YWOA 3RMBA 2ZPFB 2ZPBB 4UUSB 4DGWB 3DTEA 3E9OA 1PUFA 4M7AA 4IL6C 3IL2A 5JVHL 2YV0X 2FBKA 1NJZA 1LFPA 2VBZA 3BP8A 2FZCB 4HUEA 2W1OA 4M77A 1W7PD 3IRQA 1HNIA 4LIUA 3H5RA 3JTHA 4X9DA 4R8HA 4H0YB 5EF6A 1QHGA 2DFEA 2KRMA 1AU7A 1NM1A 5GAEP 1OFCX 3IS9A 5F08A 3P39A 2NVUB 2Q1ZB 3TAGA 3GX4X 3BT9A 3TSZA 4GYGA 1ZQ1A 4C92F 2PBIA 4U7DA 5E84A 4EHUA 3PIOF 2CQQA 2C0TA 1HCRA 3KIOA 3QNOA 4K2EA 1KD1U 4X6AJ 3ABMH 2RK1A 1UFFA 1VRLA 4DSKA 3DCFA 2CG4A 2XASA 4CC2A 2JUCA 1VTNC 1JTXA 3TO7A 2JA7J 3ZYYX 2JNGA 2ESWA 3CJ1A 4H0XB 4DBHA 2Q0RA 5TKWA 1SVOA 3KZBA 4K8XA 3S32A 3DB3A 2H8WA 3OL3A 5EEGA 1HX1A 3GPLA 1IHVA 3F8NA 1UCRA 1PYVA 4CCLA 3L4IA 5LL6S 5E8IA 5FLVA 1JT6A 2NXNB 1B9NA 2V1UA 4CJPA 2LVSA 3ZT2A 4ENMA 5D5VB 2HZDA 4L9TA 5E26A 5M3MJ 3F6OA 4ESRA 5FD5A 3CC2N 1FPQA 3FLGA 1BBZA 1YIJN 3H5NA 1XNIA 2ZPEB 4YIFA 1VAZA 5M1PA 3BG5A 1HXDA 1IG8A 3X25B 4M78F 3CMEA 4CE9A 4N9IA 4U87A 3OJSA 3OS2A 1R0CB 2VXFA 2ZNZA 4R5PA 4NHJA 1LW0A 4FLWA 1C0MA 5GAOp 2Y9YA 1X69A 4UXNA 1Z3YA 2MG4A 2HS5A 2B6AA 5FJ8J 2E3IA 3M1CA 2RO0A 1UEBA 4MDAA 3NGPA 3PT9A 3FXMA 5M5WJ 4GRIA 2K6DA 5I22A 3UATA 3J81K 1ULYA 1R5GA 2GTJA 4ZZLA 3TU5A 3MXMA 2GWKA 5KTQA 4OKEA 2W82A 3LGFA 3UNGC 3KKSA 4AM7A 4DR3K 3Q0UA 2H8HA 3GG4A 2UUCK 4PLLA 1S5LC 4A61A 1QHAA 2X3WD 3PIPF 4U0VA 4YDUC 4CK2A 1XN7A 2P9SA 2JRMA 4AHCA 2HBKA 2V26A 3R0JA 4A3MJ 3AVIA 5DTDA 1EJ9A 4IUUA 3WODF 1S1UA 2ZPHB 4NCAA 5AQRA 2YG8A 3BY7A 3O3HA 3IAS2 2QSGX 2RHXA 1ZBUA 3CP2A 2KISA 2F2VA 5CKHA 5GAN3 3IAYA 4C8QB 1ZR4A 5JR3A 1LPLA 3CPFA 2CSQA 4BC4A 4DSLA 1R4NB 3O08A 2Z1GA 3SQ2A 2LJ3A 4ID5A 4CZHA 1Q86O 1WJQA 3V1QA 1G8XA 4M3BA 3ESWB 4CJEA 3CC7A 3P9CA 2F7TA 2YUPA 3V6DA 1E3PA 2XY7A 2NS8A 4EPCA 2HVIA 2X0LA 4IFYA 1R59O 1J2XA 2HCKA 2R7DA 5HS8A 4OKKA 3ZSZA 3S8PA 1N9RA 1VFCA 4FWMA 1X1BA 1RESA 3NEUA 4RMOA 2L5QA 2VB6A 2QTXA 1VQMN 4R55A 2X4JA 1VQNT 1MDUB 1XI1A 3CP8A 1N36K 3V1OA 1ATNA 2STTA 1HYOA 3GTKJ 1A5WA 1YTYA 3ZMUA 1R0AA