3OS2A

Pfv target capture complex (tcc) at 3.32 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 96
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os2A03
1ASVA 1X9SA 2HVIA 4CGFA 4DFPA 1C1BA 2IDOA 5CY4A 2HHQA 5J2MA 1D8YA 4CJ5A 3P8DA 2FHDA 2BDPA 4R5PA 2P0KA 4B9XA 3VQ7A 3HJFA 5KRSA 3WNHA 2ETJA 4DTOA 4CHOA 4FM1A 2VG7A 4DTUA 2GBZA 1Q9YA 3MP6A 2RI3A 3D45A 2IS3A 4HUFA 4YFUA 4OLBA 1CXQA 4J2DA 4B9TA 3SPYA 1RDDA 1S1VA 3CM6A 3V81A 1WSEA 1S1WA 4KPYA 3WNGA 2ITGA 2X78A 3ZSXA 3NH0A 1J5OA 1IG9A 3E9GA 3SJJA 3LGLA 1QHTA 4N4HA 1XI1A 3U3GA 5DMRA 4CEEA 1WSJA 4DQSA 1I39A 2E6LA 1C1AA 2YNFA 3V9WA 3HYFA 4FM0A 1KLNA 2Q3SA 4FCYA 4CEQA 2OPRA 1MHNA 1UAXA 3AVKA 3MXJA 3ITHA 2EQJA 3HK2A 4CJUA 3NAEA 4ICLA 3AVFA 4FJ7A 3OYCA 3K57A 4EDUA 3WNEA 1LW0A 2FBVA 4WE1A 4CFDA 5M9OA 3DLBA 4N5SA 3OYEA 3OYAA 1KVCA 4B9SA 3MEUA 1SV5A 1VSEA 1TK8A 1A5VA 3KD1E 3RMDA 4OPKA 4C8MA 4LD0A 3QESA 4B08A 4AHRA 3LLRA 3SD4A 4OKJA 2RN2A 4N41A 2BIVA 3LP1A 4B3OA 4C8KA 4JLHA 2PYLA 3M9QA 3V1OA 4ZTFA 1CZBA 5T7BA 3DLHA 2X35A 4CGGA 4KI4A 3TAPA 1KVAA 3QEVA 1U48A 4M45A 1RCHA 2YKNA 3K58A 3ZSZA 3F70A 1TKDA 1WSHA 3AVCA 3E9FA 3K2PA 4W5RA 1TKTA 2B5JA 3IS9A 3MEDA 4E19A 2GV9A 3UT1A 4DSFA 3HP6A 3PFSA 3V9SA 3BGRA 2LVMA 1OYXA 4K8ZA 4YNQA 3JSMA 2RHIA 5D6WA 1RBRA 3DI6A 4I7FA 5CYMA 1H3ZA 1F21A 4CEFA 4LSLA 2P5OA 1QS4A 3OYFA 3TAGA 4DTRA 4N76A 1Z25A 5D6XA 1RDAA 1LW2A 2HHUA 4B9UA 3ZT1A 3UIQA 5KCHA 1S9GA 4CF2A 1BQNA 1ZBHA 2OPSA 3AA5X 3CEYA 1RT6A 2JGUA 2EX3A 1UA1A 4F8RA 3VQQA 1CLQA 4CEDA 4QAGA 3AA3A 4CERA 1RDBA 1MU2A 3HPOA 1KFDA 3OS2A 5I42A 4B9MA 4CGIA 1UOCA 2HHTA 4JS4A 4A4EA 1SL0A 1ZBFA 1I3AA 3H08A 4E7KA 1JLQA 4IUTA 4O44A 2RJDA 3ULDA 4DTXA 1BIUA 4N4IA 3C4SA 3RTVA 1BCMA 4CIFA 2QKKA 2OPPA 4Z4IA 4G1QA 1NJYA 2IGIA 1G15A 3LH0A 3S3OA 3LAKA 2GUIA 4Q5VA 4FK4A 4ZHRA 3ASKA 4FJKA 3AA2A 3KTQA 2X6SA 1KLMA 1S1TA 4CJFA 1L5UA 3SV3A 2M16A 1C1CA 1B9FA 1BHLA 2OYQA 4B8CA 4Y1DA 4A4FA 3ZT2A 1U45A 3K5LA 1VSDA 4RG8A 3BDLA 3HL8A 2R58A 3DB4A 3QO9A 1XC9A 1T8EA 1BIZA 1BI4A 4C8OA 1TL1A 1CXUA 1T03A 5C0MA 1Y97A 3HVTA 1W9HA 2YKMA 1HJRA 4AILC 4AHUA 2R57A 3I0SA 3PMTA 3HO1A 1HPZA 2KFZA 3VQEA 3KKRA 4CJ3A 3OJSA 1ZBLA 5IAYA 1IKXA 3MECA 2ZE2A 3B6PA 2O4XA 3DB3A 3AVMA 5J2PA 4C5GA 1D9DA 1J53A 4CJTA 5EU7A 3QKJA 4C8NA 4CECA 1NK5A 4DTMA 2ATQA 4RW6A 3OYHA 3S3NA 4LH5A 4BACA 1S1XA 3KK1A 4CGDA 2PY5A 3LP2A 1RTIA 4DS4A 4JS5A 1KHCA 2BKDN 3LWMA 3MEAA 1TK5A 3PX0A 3SPZA 1SKRA 4W5NA 1ZBUA 4Z4GA 2EKOA 3DLEA 1Q8IA 3QNOA 2FBTA 2EQMA 1C0MA 3LZIA 5J39A 2KW4A 3KLFA 2ZD1A 1BQMA 3SV4A 4KV8A 1Q9XA 2PQWA 3TR8A 2RO0A 4RW8A 4NCGA 1RNHA 2HVHA 3AVLA 2F5KA 1ZBIA 3QLHA 4OKEA 2QQRA 3HPHA 3O3FA 1REVA 3ZT3A 2MWOA 3Q1JA 4DU3A 2Y1IA 4CJVA 4CJPA 1JLBA 4F3TA 3DLKA 2A1SA 2GFAA 3PO4A 1NKEA 3V6DA 1IKWA 3KK3A 4HVJA 3AVHA 2DIQA 5FDLA 2I5JA 1SL2A 3QINA 2VG5A 1NK0A 4E7HA 3TANA 4OGEA 4CF8A 2GF7A 3UWNA 4CF0A 5HRPA 4Z4EA 1QSYA 4CEZA 3TI0A 2D5RA 3FLGA 4KHYA 2LCCA 1LAVA 1HNIA 1KVBA 2G8UA 3NCIA 4FZYA 5J2QA 2HHVA 1HMVA 3AO3A 3OYKA 2RJFA 1HRHA 1HNVA 3LANA 4KTWA 3CFPA 2WONA 1KFSA 4PWDA 3C94A 1NJZA 3RMAA 5KRTA 4II1A 4HTUA 1WJQA 1X9MA 4W5OA 5C42A 3OJUA 1NJXA 1NK9A 2VYTA 4OGCA 2EQKA 2X6NA 3DLGA 3HT3A 3F73A 2W42A 3DOKA 3KIOA 3IRXA 4AHSA 3ZT4A 1WLJA 1T7PA 5SZTA 4E3SA 1C6VA 1YTUA 4CHPA 3C95A 3CYMA 3HM9A 1DTTA 3SQ2A 1WGSA 3ME9A 3ZSVA 3QIPA 4DS5A 1RTHA 4KKOA 1XNIA 2EQUA 4MFBA 1N6QA 1A5XA 4I9QA 4JRQA 4CEBA 5FRNA 3DLMA 1OZ2A 4CJKA 4IG3A 4LSNA 2RJCA 3KLHA 5KH6A 2KZZA 3VN5A 4Z4HA 3AO1A 5FRMA 1VSJA 2F8TA 1U04A 3OYGA 1J54A 4CHQA 1WSFA 2JZ2A 1QE1A 5KI6A 4HUEA 3H8ZA 2Z1JA 4M3YA 2F96A 4FJ9A 4M3TA 4I9LA 2XRIA 4KAZA 5JS1A 1KSPA 3SUPA 3NH2A 4QCLA 1S9EA 3PMIA 3T3FA 3VA3A 4Q5WA 5KTQA 3NDKA 4KFBA 2OA8A 1EX4A 3VQ8A 3TAQA 3OS1A 1U49A 3P5JA 1QSLA 4KB1A 1YVUA 4A4HA 3THVA 2KQ2A 4KHNA 4TSXA 3OYIA 1NK4A 3RWUA 2L89A 2RI5A 3O8VA 4CK1A 3BDPA 3OVNA 3QIOA 4IKFA 4FJNA 4J2AA 1L3VA 4KHUA 2A1RA 4LD6A 3D0PA 1KTQA 2K3YA 3RR7A 3LPTA 3OYDA 4IFYA 1BISA 4FZXC 3OYNA 1FK9A 3SQ1A 3QIIA 2MWPA 3VQBA 4IUPA 3K5MA 4FJIA 3IG1A 3VQ6A 1NKBA 1TK0A 3G0ZA 4QW2A 3O4NA 1EKEA 3TARA 2D0AA 4CFAA 4DLGA 3NTHA 4C5EA 4QOZB 4BWJA 3CFRA 1VRUA 1B92A 2P51A 4L8RB 4OKKA 2KTQA 1RTDA 3NH1A 4FK0A 3GOXA 1NK8A 1LWFA 3NF8A 1XHZA 4HHTA 4FLWA 2O4IA 1TKXA 2FBYA 1JLAA 2XDPA 3LGFA 1TL3A 2XHBA 4QQDA 3O3HA 2G8WA 2Z1HA 3NBPA 1NOYA 1WAJA 4NCBA 4CESA 4OJRA 4HCBA 4DFKA 1VSKA 1TAQA 1BL3A 1ZYQA 3EZ5A 4PY5A 4AHCA 3ALYA 3T1AA 3FFIA 2LRQA 4EP4A 5D3GA 1EP4A 3NGYA 3S3MA 4B9VA 2VWKA 3RMCA 3QNNA 4KI6A 3SUOA 4PA1A 4ELUA 3F9KA 1JL1A 2CKKA 3DM2A 2HNYA 5HP1A 1C0TA 4CJLA 3AVIA 5KE2A 4B9NA 3O3GA 1WAFA 2G8HA 3H6ZA 3VQCA 3PV8A 4FJ8A 2LDMA 4DQPA 5CIUA 1S6QA 3K5NA 3OMCA 4Y1CA 3KLIA 3P8HA 1IKVA 3EYZA 1VSHA 4FZZA 4RW7A 4KTQA 4OPJA 4CHYA 4NS5A 4FW1A 3ZSOA 4FVMA 5KE3A 1JXEA 4DTNA 2DIGA 4IUUA 3L2RA 4QVZA 4C5IA 2PZSA 3K5OA 1RT3A 1JLFA 5CYQA 4W5QA 2HNZA 1R0AA 4LH4A 5HBMA 4M3RA 2R5MA 4DQRA 4C5HA 1RDCA 3ZSRA 2XY5A 3EY1A 1EETA 4CK2A 2BE2A 4M3WA 3LZJA 1JL2A 2RPIA 3MO8A 2Z1IA 2KFNA 1JLGA 3MEVA 3M8QA 1NOZA 1YTAA 3MEWA 1RBTA 1OZ3A 5SWMA 4NZGA 4M42A 1HQEA 3NHGA 4CGJA 4O0IA 1W0HA 4CJSA 1RT1A 1VSLA 4FLZA 1D5AA 4X34A 2YNGA 4AHVA 1RI0A 3NNQA 1SUQA 2RF2A 4GY5A 1YT3A 2XY6A 1SL1A 3K59A 2Z1GA 4LY7A 4FLVA 1BI4B 4CFBA 1U47A 3AVBA 2IOCA 2YNIA 5CZ1A 3V4IA 1ASWA 3FEOA 4E0DA 2X74A 2O4XB 3KK2A 4JRPA 4FJMA 4A4GA 2EHGA 4B8AB 4NYNA 3MXMA 5HRNA 1VSFA 2BANA 4GMJB 1TKZA 1IH7A 1CZ9A 3NTKA 3NFAA 2L8DA 1LWCA 4CFCA 2HQEA 1LAWA 3DYAA 4FJLA 3C6UA 4BDPA 3HPGA 2DFFA 3M8PA 3OQ5A 3NGZA 1BCOA 4KTZA 1EXQA 1FXXA 2HW3A 5K14A 2DFHA 3S9HA 1SKWA 4RW9A 2YHBA 3LAMA 4CJRA 3LP0A 2OZMA 4DQQA 4IURA 4DFJA 3VQ5A 1QTMA 4KHWA 3KD5E 2D0CA 4FLXA 3HP9A 4OLAA 1WSGA 4OVAA 1FKOA 4IBNA 2KZMA 1RILA 2B8AA 3C6TA 1L3TA 1O1WA 2YHAA 3META 4ID1A 3OYBA 2LSNA 4DSLA 1J9AA 3L2QA 1NKCA 4FK2A 3U3YA 4FJGA 1WSIA 2XK0A 2YV0X 4E7IA 3DRPA 4F3OA 3OYMA 2HHXA 1TV6A 4HCCA 4FL6A 4Q0BA 2IC3A 1D9FA 5KGWA 3ZSWA 3ZCMA 4EP5A 4W5TA 1TVRA 4Z02A 2R5AA 2DFEA 5HLFA 4L59A 4MQ3A 4BD3A 2HNDA 4UQGA 3RMBA 3VQPA 5J2NA 3PO5A 4FJXA 2Y1JA 2IG0A 2RHZA 1RT2A 4FJHA 4DSIA 4DSJA 4M3ZA 1FKPA 5HROA 1L3SA 1L3UA 1RTJA 3KUFA 2QKBA 4DSKA 4B9WA 1JLCA 3LP3A 2JTFA 5E41A 4BDYA 4Z4FA 1B9DA 3L3UA 1X9WA 3V9UA 2WACA 3SYZA 2IAJA 2D0BA 4M3UA 3DMJA 4J2BA 3O4QA 1OI1A 1JLEA 4AHTA 3L8BA 3NF9A 3NF7A 1SKSA 3MEGA 1Z26A 3V9ZA 1VK0A 5HRRA 3L42A 4FM2A 5JS2A 4KREA 3LALA 4CK3A 4FYDA 3QBYA 4CJWA 4CJEA 3P1GA 1VSMA 3DOLA 4CIEA 3QJ6A 3AV9A 2E6NA 4OVLA 2HHWA 2E5QA 3ZSYA 2G8IA 2D9TA 3OB9A 3ZSQA 2E6MA 4PL6A 3ZEHA 1K6YA 2P1JA 4FU6A 2VWJA 2YRVA 2OZSA 1LV5A 5FROA 1BGXT 4FLUA 2P5GA 2QK9A 5C25A 3QETA 3OMGA 2RI2A 4PLLA 4KB0A 5CZ2A 3RRHA 4KRFA 1KCFA 3A2FA 4CHNA 4N47A 3TWHA 4DTJA 1RBUA 3KLEA 4F4KA 4FJ5A 2DY4A 3SQ0A 3PY8A 3HSTB 4BE2A 4KO0A 4K8XA 5J26A 3VQDA 1WNSA 2EFIA 4CJ4A 4DSEA 3AVNA 3L2VA 1UA0A 1S5JA 2OPQA 4DU4A 3KJVA 4DF8A 3TAEA 4BDZA 2BUDA 2RJEA 2G8FA 1XWLA 1DTQA 4FXDA 2DAQA 4NCAA 3HVRA 3NF6A 1WJRA 1N5YA 2M0OA 1C0UA 1JXBA 3DLRA 2RHXA 4CEAA 1VSIA 2AJQA 2X4YA 3CG7A 1T05A 1GOBA 4GW6A 3OYLA 2FBXA 3AVJA 4AH9A 1NK6A 3L2UA 3MAQA 2G8VA 3LYIA 3MP8A 3IAYA 3OY9A 3L3VA 2B6AA 3M8RA 3VQAA 3AO4A 4RG2A 4HUGA 3DRRA 4DG1A 2NUBA 3AA4A 4RW4A 3SZ2A 2RKIA 3QERA 3TAMA 3TABA 2F8SA 2HMIA 3QEWA 3VQ9A 1G5VA 4M3XA 1HYVA 4FW2A 4Z4CA 3T19A 3MP1A 3PNWC 1ITGA 1IO2A 1GOCA 3VQ4A 4DMNA 4H8KA 1RT4A 2XY8A 4E7JA 2PYJA 3OS0A 3NTIA 1XHXA 3CQ8A 4I2QA 2LTOA 1IKYA 4H4MA 4F2RA 1RT5A 4O55A 1RBVA 3B6OA 3FC3A 1JKHA 5KGXA 4BE0A 5D6YA 4IFVA 5DK5A 3PUFA 3I0RA 1ASUA 2E4LA 3E01A 2NLUA 1N27A 4CHZA 1LWEA 3LWLA 3V1QA 4EZ9A 1WN7A 3VA0A 2G8KA 4QQGA 3OA6A 3WNFA 3ASMA 2HB5A 3S6WA 4IUQA 2X4WA 5IN1A 3G10A 4NYFA 2R7YA 5I3UA 4CRIA 5HRSA 2YNHA 3MEEA 4IUVA 4E1MA 3CFOA 1KRPA 1NJWA 1VRTA 4I2PA 3NGIA 4N4GA 4PUOA 4DTPA 1QQCA 3PX4A 3DRSA 4DU1A 1S6PA 4PLIA 1RT7A 3V1RA 2M1HA 3QEXA 1U4BA 3CM5A 5J1EA 3RR8A 2O4GA 4O4GA 3AO2A 4ELTA 4E1NA 4ELVA 2RHUA 3PX6A 3AVAA 3AO5A 3V9XA 4O5BA 4CE9A 3RRGA 3LDSA 1X1PA 3SUQA 3ZT0A 1TGOA 3KLGA 1GOAA 3P83D 1HYZA 2QXFA 4GVMA 4H4OA 2K3XA 2QQSA 4HCZA 2HHSA 4CF9A 4C8LA 4CF1A 3I8DA 4O0JA 4B9LA 3NE6A 4N56A 2GFUA 4J2EA 4F2SA 2JLEA 3LX7A 2VG6A 4FJJA 3QEIA 3KKSA 4CJQA 3LPUA 3JYTA 4UC4A 4IG0A 4BWMA 2FC0A 4CGHA 1WJSA 4ZTJA 1TAUA 3EAEA 2XY7A 4CEOA 3SI6A 1HQUA 3MXIA 4XIUA 5C6SA 2ZQBA 2G3RA 3HXMA 3M8SA 3OYJA 5KCOA 4DFMA 3SQ4A 4DWIA 4E7LA 4E89A 2RHYA 4IDKA 4EZ6A 4FLYA 1QSSA 4Z0UA 1DLOA 1A5WA 4PQUA 3U6FA 3L2WA 1UWBA 4M41A 1NK7A 1SSFA 1S1UA 4DTSA 2HQXA 4CIGA 3QEPA 4BE1A 3FDRA 2DTUA 4DQIA 3ISNC 4DF4A 4KHQA 1HYSA 4DLEA 3AVGA 4FLTA 2WOMA 3SCXA 5C24A 1RBSA 2B4JA 2X4XA 4ID5A 4KHSA 2L3RA 3TAFA 2BGGA 3SNNA 3SUNA 4CCHA 2XO7A 4QQ6A
chains in the Genus database with same CATH superfamily
1YJ9I 3EQLF 3BY6A 1X9SA 2LMDA 1JJ6C 4DFPA 3S41A 1XOVA 2NZTA 4BAYA 5HLGA 5J2MA 3M8JA 2NRRA 1B3QA 1L3LA 3KEQA 4ZZDA 2BDPA 4R5PA 4D6WA 5LBQA 1XNRK 3KP5A 4HQMA 2XF5A 3PL8A 1W36C 1YO5C 2ETJA 4DTOA 4CHOA 1REPC 2COYA 1NGDA 4RB3C 3CXCS 1V3FA 4HDUA 2CGHA 2GBZA 4J83A 3MP6A 2A5WA 3D45A 1W4MA 4B48A 2IS3A 1IXDA 5CVVA 1ATSA 5ICCA 2ZJRF 4DR6K 1JKOC 4BRIA 3O80A 4B1UB 3CCUQ 4RMNA 5AQRA 2KZGA 4C2MJ 1MUNA 1M1GA 3HOUJ 3PGGA 1E3PA 2ZXJA 3OBYA 2X48A 2QGUA 2P9KB 3CCUT 1YIJN 2LNBA 3GTQJ 3V81A 2GZWA 4EA4A 4AVZA 1PM3A 5ILSA 3TP3A 3EG1A 3NH0A 1J5OA 1U9NA 4HTLA 3ENBA 2E2PA 3LGLA 3LFKA 1T08B 4XR6A 2PJRB 1WSJA 1IBLK 3L7WA 4G9YA 3THXA 3CBPA 4DQSA 2BZ8A 1VQKN 1I39A 4GFBA 1HNZK 3CHWA 1E0EA 1VF9A 3W6VA 2ITMA 4C8QE 3J8AA 2X6YA 3GLXA 3FHGA 1C1AA 2ZSHB 2DMOA 4OFAA 2H8RA 1SAZA 3RSEB 2V1QA 2RQTA 2OPRA 4FT2A 3AVKA 2NLXA 5EJCA 3CJTB 3MXJA 1W1FA 1WI7A 4CZEA 2CP7A 2WY7Q 4KH4A 3HK2A 1F4KA 4CJUA 1I6XA 1YE9A 3AVFA 3ZN0A 3SZGA 4UUTA 3EFOA 2J06A 4H5TA 2FRWA 4K41A 1IBKK 2CWEA 2FBVA 3VYRB 3QHSA 4WE1A 4CFDA 1TQPA 4CZHA 5FD5A 2OA4A 1MMGA 4X65K 3FX3A 3VMFB 4IWVA 1R0BG 2K2MA 1DP3A 4E7SA 2JA7J 3MCZA 1NEGA 4AHRA 2X1EA 4GLMA 4C92G 3SD4A 3GBGA 1LWWA 4KGVB 3D2FB 4XRSA 1X2NA 3VJPA 3LP1A 2GQVA 2CSQA 2LJ1A 4XQ3A 4CBXA 4FSSA 2VQFK 1X2KA 1A31A 4BB7A 2E1MC 1U3EM 5IT9O 2X35A 4CGGA 3RPQA 4B3TK 4KI4A 1M4ZA 3QEVA 3F8FA 1RCHA 1MNMC 1CKAA 4C92F 4A61A 1BJZA 1QZ5A 4ETSA 5CKEA 3CCMQ 2OTLA 5CHZA 3CCQQ 4FOIA 5KYYA 1AA7A 1RKTA 3ECOA 2FZCB 1U78A 2GV9A 3PO3J 3UT1A 1W70A 3CCMT 3BGRA 2W25A 2LVMA 1YF5L 1OYXA 4YNQA 4K42A 2YDLA 3IV5A 3I53A 5F1RA 2Q0RA 1RBRA 2LD5A 3D5LA 3EL2A 2RKHA 2AKLA 1F21A 2YX4A 4CEFA 2P5OA 2QKLB 1PUEE 5IT3A 4I6MB 2KT8A 1K4US 5LHIA 1R1VA 2W4SA 2HQHA 4N76A 2O3FA 2IBDA 3VOEA 1LW2A 1VIFA 1ZUYA 3ZT1A 5FPDA 4M7DB 1VZ0A 1DU6A 1KC8C 1XMQK 3JB9F 2EINH 2OUMA 1ZBHA 4CBUA 3AA5X 3T7ZA 1MH3A 3CEYA 3OA9A 2JGUA 2JK3A 4JP0A 3CMAN 4RTXA 4ELZC 1VQ6Q 3CPWA 5D5XB 3VQQA 1CLQA 4QAGA 1WNLA 1X75C 3OH9A 1MU2A 1VQOI 3H9NA 1VQ4A 1UOCA 2E4HA 1YAGA 5A0LA 1YI2N 1XQHA 2XMFA 1QQOA 3H08A 4Y7NJ 4E7KA 1ULYA 4IUTA 2FF6A 3LCNA 5GAOp 3C2HA 3FHZA 3DBRB 3A02A 2E7WA 1BCMA 4MEYF 2E2QA 2HL5C 1R7JA 4C30A 2QKKA 4C8QB 5DLOA 1V55H 2OPPA 4EFHA 2RNGA 4G1QA 1NJYA 1Z6RA 4P96A 1G15A 5E18F 3LH0A 2NOLA 3S3OA 2GUIA 3TTDA 2ID6A 2YUOA 1MNDA 5L3EA 1YITA 3FXRA 4YPHA 2XPVA 3LL7A 1NGAA 1WQ2A 1NJIU 4JZ3A 3SV3A 5FKOA 2M16A 5HS9A 4RTTA 5JI6A 4B8CA 4RDUA 1NH3A 2KDOA 3A1PA 4A4FA 1K9MU 1VSDA 2X3XD 4KUDK 2M0YA 4ILHA 4OMMA 2R58A 3DB4A 2HDDA 2COMA 4ITVA 1AU7A 1UG0A 4N9HA 3CCVQ 1RI9A 3ZQCA 1E17A 3DPLC 1TL1A 1VAZA 1TQMA 5D8KB 2A37A 1T03A 2LCSA 2FLOA 1EH8A 2VQLA 1W9HA 2O8FA 3CCVT 1S7AA 4AHUA 2VB6A 4PL7A 2EK5A 5IHIA 2R57A 1B59A 4XRFA 3I0SA 3BJAA 1IN8A 3CVSA 2F69A 1OCTC 3P31A 3MECA 2ZE2A 3B6PA 4XU1A 4KITB 2OJ2A 2B63J 1IW7F 4HKEA 1JJ2A 4CJTA 4O8UA 1BN5A 5EU7A 5I2MA 1XUPO 3ABMH 3WHBA 4DTMA 1X4OA 4UV8A 1QWEA 2I5UA 3LDQA 4RW6A 4LH5A 4HX7A 1D8JA 3Q9SA 1U5SA 3MFKA 3DLAA 3H41A 4AM6A 2RN7A 5CVRA 3LP2A 2O8CA 1RTIA 1RNLA 1SANA 4GV3A 2LNVA 4HAMA 3VGLA 4DV6K 1ZBUA 4Z4GA 4WK8F 1TLHB 2EQMA 1C0MA 1GVJA 2KW4A 2VC8A 4PJMA 1V5FA 3KLFA 3JAMO 5KPZA 2DF6A 3CQXA 3FMRA 5GAN6 4RW8A 4RKUE 3AVLA 2A68F 2QQRA 1TXQA 2MWOA 3Q1JA 4RGRA 1EWQA 1KU7A 4DU3A 3NWTA 2BZXA 4KMUX 3CJCA 2Y1IA 4CC2A 2GFAA 4I0AA 3VRYA 1KYWA 4OAYA 1IKWA 3KK3A 2M4GA 4HVJA 1KA8A 4JPBW 1VQ7A 2DIQA 1SL2A 4XTYA 2VG5A 4DR5K 2ADUA 1UG2A 1MJAA 3UWNA 1PHTA 4BQOA 5HRPA 3KP2A 2DJQA 2J6KA 5BPLA 3E9PA 2FPEA 3FLGA 4M9XA 4RTZA 3CCQN 1KVBA 3ER0A 3NMUA 1GXQA 3D6RA 3M8EA 2L3QA 3KLNA 3NCIA 2OCCH 3H1CA 2FSKA 2X6WA 3J7AY 3GZ5A 2ISYA 1E3HA 3A0HC 3V7RA 1N3CA 4XKVA 2LK2A 2RJFA 1KG3A 4PNOA 5BREA 1HNVA 3CFPA 2HVRA 3RMAA 1WSUA 4AYBA 4KBMB 5JVGF 5FU7C 2L3DA 1ACMB 1X9MA 4W5OA 3SXYA 4J9DA 4ZJZA 2R7TA 2D2WA 4C8QD 4OGCA 1H0MA 3DLGA 3HT3A 1WYXA 5LGNA 3F73A 2NRAC 1IGNA 2RC4A 1VQMN 4Y13A 3THKA 2GXAA 2WADA 3CVTA 3ZT4A 1MMNA 2E2HJ 1WLJA 1T7PA 3TOBA 1C6VA 3ECHA 5JHUA 3C95A 3CYMA 1VQ6N 3HM9A 1DTTA 1FPQA 3QQAA 4FYYB 3CCJN 4ZGJB 4JKCA 4F52A 1ETYA 2JT1A 1XNIA 2GIZA 2ZPHB 4LFCK 1A5XA 3AGRA 4ZH4F 2E1NA 4J7FA 3G71Q 3OIQA 4P55A 2BY1A 4CSWA 4CEBA 1QQJA 1OZ2A 2D1XA 4PSWA 2RJCA 3TSWA 2KZZA 3G71T 2LBFA 3AO1A 2MMPA 2AHJB 5IWAK 4V2GA 5FRMA 1VSJA 1AOJA 3RDVA 2P7CB 1AWJA 1SFXA 1PUFB 1NLPC 1M8VA 4YIRX 4YOUA 4HUEA 3K1PA 3WGIA 3RZDJ 1SFUA 3H8ZA 2DD4A 1OX9A 2XAJA 1U1TA 2O9SA 3S93A 5KNLA 1SKUB 1BOAA 5CR4A 5IYBJ 2JPCA 5E8IA 2CDTA 4FJ9A 4I9LA 1K73O 4KAZA 4FYVB 5L3DA 3F23A 3NH2A 1VOMA 4IEEA 2DJNA 3PMIA 2OANA 4Q5WA 2DDAA 3GPLA 3VF6A 5KTQA 1F1ZA 5FLVA 2O8BA 3AKZA 2BH1A 3I4NJ 4B44A 2P9SA 2GTOA 4XTZA 3E9OA 3VQ8A 1A0NB 3P5JA 2ZCWA 4ABZA 1QSLA 3RYRA 3FMSA 3C2BA 1ZQ1A 4TSXA 3OYIA 5M1PA 3PIOF 2L89A 2E6ZA 2Y9YA 4CK1A 1EQYA 3A5OC 2M4KA 2PJPA 4IKFA 1MV3A 4UHTA 2DDBA 1FYMA 2E3HA 2ESNA 2XG8D 1BI0A 2A1RA 4LK1F 3D2FA 3O9UA 4LD6A 4XTUA 4JI5K 1H3HA 3JW4A 1J0RA 3QWYA 4BRAA 1OH6A 1Q95G 4JNEA 3I0TA 4FZXC 2DOEA 3E19A 1BA5A 1KU3A 3UKUB 2VUMJ 3KP3A 5JVGL 4IUPA 4NHJA 1MA9B 3CP2A 3N4MA 3K5MA 5C15A 1LE8B 2FQ3A 2HGCA 3VU3C 4ZN3A 4BY1J 2Y0SA 3G0ZA 4QW2A 1EKEA 1VQ9N 3IFRA 3IH4A 2H3EB 1OULA 2WTUA 5CKHA 3D5SC 1MDUB 3EKSA 5AZIA 4CFAA 3NTHA 3IWFA 3TVTA 5HNFA 1WJEA 4R8HA 1VRUA 5A2QO 2LF7A 1YJWN 5HS8A 3LDLA 1B92A 5GAGP 3X20B 2EFWA 4MDXA 2PQ8A 3IDHA 4EMKA 4BQNA 1M1KC 1Y1VJ 4AQYK 3CXCA 5DLQE 2VXDA 5HS7A 3HB9A 2BE7D 1BJAA 2FA5A 1N78A 1TKXA 1GLDG 3E1SA 5IY5H 2HEQA 2J4RA 4PUSA 2V1UA 2XDPA 2RREA 3CD6I 1I3QJ 4A69C 4BR9A 3H5RA 5AQLA 4JEPA 1ZN2A 4XBFA 1PRMC 1TTHB 3O3HA 5IXBA 5B5EC 1WAJA 3S32A 1ZSZA 2FZGB 2W82A 1UGVA 3RR6A 1TAQA 3EUKL 1ZYQA 3AG2H 4RAYA 1GDTA 1IC8A 5F6FA 4AHCA 2G0EA 3PVQA 3ALYA 1WEIA 3ATUA 3JCMg 5D3GA 2Q1ZB 1ETXA 5EEHA 4B9VA 2AZSA 3WODF 1PP8F 3QNNA 1WB9A 1G3YA 1N9RA 1N8RU 4PA1A 2UZKA 1XS9A 4MGRA 3VDXA 1LPQA 2LDUA 3F9KA 1RUOA 1HLVA 1M90U 3C1DA 1C0TA 2V8IA 2CMPA 3NARA 4C8QA 1LMZA 5BNGA 1SMTA 3TEEA 2E41A 4DR4K 2G8HA 3H6ZA 5F04A 2XPUA 3JREA 1TUCA 3OSFA 1WPKA 1MPGA 2VJ4A 4IFEA 3VUZA 2PU9B 1KD1O 5BQTA 1IRGA 3K5NA 3JB9H 3ZMDA 1MV0B 4YEJA 3X28B 4IL6C 1E3MA 3UPUA 4FW1A 3G4SN 4FVMA 4DTNA 2Y0MA 1W1WE 4IUUA 3W6JB 2P5VA 4QVZA 4BY6C 2OTJN 2P4RA 2GUPA 2ASOA 2WAFA 1FNNA 1JLFA 4BROA 1S3XA 1TQIA 4B1ZA 5HBMA 3TSUA 3B6CA 1FOXA 2F9TA 4M3RA 1EF4A 1SC7A 4F7UA 1SFKA 4C5HA 3PTAA 1RDCA 2KRCA 2MCNA 3ZSRA 3LL3A 1KHIA 1KONA 3WGGA 4B1YB 4JKAA 1EETA 4ATOA 2W84A 3H3UA 2BE2A 4M3FA 4XM3A 1GXIE 2P9LB 1USTA 3MO8A 1VQ8I 2DBBA 2KFNA 3HOVJ 3M8QA 5C12A 5TKWA 1G3TA 3LSKA 3T8TA 4EMHA 3CQYA 3MEWA 1XSDA 3I33A 4NZGA 4I6ZA 4I99C 4A5BA 1W0HA 3I9QA 1VSLA 3DF8A 1Z77A 4O5FA 1PSFA 3EFSA 1MWKA 3CPFA 1WKMA 4X34A 3NNQA 1RI0A 4BI8B 1SUQA 4GY5A 4OMPA 1RAEB 4XRMA 3M56A 1XMKA 4EVVA 2P81A 4EMKC 4LY7A 3HI0A 3AVBA 5DEQA 2YNIA 2HBWA 1D1AA 1N34K 1SPKA 1J75A 1NMNA 1HCRA 4FETA 2YU9J 3OYYA 2V1DA 2O4XB 4JAXA 2DU9A 2HCKA 4JRPA 4FJMA 4A4GA 2EHGA 1Y39A 3S2WA 4UUSA 4UOBA 1CZAN 2W6LA 2WAQN 1ZSZC 4QTRA 4XLHA 2QBYA 1N3AA 1UG1A 2MD5A 2CGPA 2K7AA 2JTEA 1CZ9A 1YHQN 3CJBA 3NFAA 3HBLA 2L8DA 4PDKA 4CFCA 3HL2A 1B1BA 4ZDLA 3DYAA 2CFXA 3HTRA 3C6UA 1K1ZA 3E66A 5ILUA 1RC9A 3S1RJ 3AG1H 4NNJA 2VJIA 1IXRC 3OQ5A 5F1XA 3A4CA 3ENHA 5D4RA 4WX9A 4EJTA 4XH4A 3JCMf 2HW3A 3MZ8A 1XQOA 4K25A 1ETQA 5HODA 2Y48A 4J01A 4RW9A 4RB0A 2HNHA 2L4MA 1HX1A 3LP0A 3VS7A 3LAPA 1NK3P 2OZMA 4DQQA 4IJAA 4IURA 1VQPN 3Q0WA 4DFJA 5JR3A 1LOJA 4NQWB 5IT9Z 2FBKA 3CC4N 4FLXA 4YOVA 2VT3A 2Z5UA 3FXUA 4OLAA 1WSGA 2EV5A 1OH8A 4OVAA 2L9RA 3QPSA 1YP5A 2KSSA 2B8AA 3C6TA 3KETA 3R6MA 2XB5A 3OW2S 3HFNA 1JB0E 2B86A 2HZTA 2XKOA 2QQ9A 2KY9A 4DSLA 2CQNA 1JUSA 4FK2A 2PAVA 5DYMA 4M75E 1PD0A 3E6MA 3CCLN 4E7IA 3IH3A 2C0TA 4B24A 2KP6A 2K9SA 1PYVA 4O6JA 1U3OA 3WVDB 3R3LA 2CYZB 4C3IJ 2K3BA 3JB9D 2DI3A 2FNAA 1ABOA 3HGGA 4BVPA 3VYGA 4A54A 2RAEA 4FWOA 3HRGA 1XMXA 4G12A 5KGWA 2L02A 3ZSWA 3J81E 2JVVA 2QEXA 2P9IB 3K1MA 1VQLN 1JCFA 1W2BM 1ZLJA 3P38A 2EYWA 1B9MA 5AQFA 1R1UA 4KIFA 2IS4A 5L8RE 3VTIA 2RNJA 3IHOA 5FPMA 2FEZA 2ZPEB 2TDXA 4KULA 4KT6A 2M0MA 2VONA 3M58A 3VQPA 1J6ZA 3MCPA 3WEEB 2Y1JA 2O7OA 3RJPA 1YJNA 2H27A 1PUFA 5LJ3f 4EMGA 1RT2A 4E6KG 1WEFA 3ZMZA 2O2OA 5HROA 2O9VA 5CKTA 2BY0A 1PU7A 3OV8A 2YRDA 4DSKA 2L54A 4B9WA 4JYAK 3F0CA 2JTFA 1D5VA 3CMYA 1KSWA 1T8IA 3CC2Q 3GF2A 3L3UA 2BYVE 5LJ5h 1Q81U 4PFPA 4IQ4A 3V9UA 3I4PA 3H5NA 5GAMg 4OB1B 5GAOl 3SYZA 4MDBA 3CCRT 3URGA 4FWNA 3R60A 5I21A 3F5TA 4WCEL 1OI1A 3CMEQ 4AHTA 3L8BA 2XPWA 2CGLA 4JZ4A 2PLYA 3FDYA 1H641 3KZYA 4KGZB 3M5RA 3MEGA 1Z26A 5M3FJ 3CMET 3P9KA 2CW0F 3R1XA 4AFUC 3O5ZA 3ULEA 2ESHA 1RETA 2M9HA 1ENHA 6AT1B 2W41A 3NAUA 1OV3A 4B1WB 3BUZB 3C7JA 3HOTA 2HHHK 4FYDA 1KIKA 2GGRA 3P1GA 2K5LA 3QJ6A 4UNOA 4GYGA 3UB5A 3V7SA 3UKUA 3KP4A 2SEMA 3HXLA 1IAWA 3CC7Q 4IPAA 1UGQB 2DMTA 4BJ5C 3CC7T 3L09A 4E4HA 2P5GA 3CESA 4C0ZA 3QETA 1KG6A 1QP2A 3RRHA 1H9GA 3SQNA 4KRFA 4CHNA 2M45A 2FL7A 5E8GA 5DM7F 4XN3A 3O9QA 1N32K 2K86A 2EJ9A 1RBUA 1ETVA 1VQNN 4A62A 1RAIB 3BE3A 1JE8A 2HBMA 4BVOA 4FJ5A 3QO3A 2QGGA 4QS8A 4MTDA 5IH2A 3SQ0A 3HSTB 2I10A 2I8DA 4KO0A 3G1LA 4DV4K 5GAOm 2XKOC 3VTHA 5H20A 3RYPA 4CJ4A 5D5WB 3G6EA 4KIGA 1HDDC 5IP9J 4JJCA 4OMNA 3AVNA 3HKZA 3I58A 4M75B 1UA0A 2OPQA 2AT1B 1L0OC 2HNIA 2JS0A 1YI2I 5AYFA 2BEOA 2HXOA 2M2EA 3FR0A 4FXDA 2DAQA 1YJ9A 2KKZA 2V9VA 4NCAA 2EIMH 4ELYC 3VF4A 2HDWA 1N5YA 1Y96B 1MBGA 2RMOA 2H56A 1HSJA 3O08A 2QA4N 4C92A 4CEAA 1T05A 4AIKA 1Q7YU 1XGSA 2ABKA 3OYLA 4MEXF 2FBXA 1BOBA 2NYSA 1VQKA 4YY3K 5DY9A 2MFZA 3EG2A 1P59A 1FOKA 4OMFB 4IO8A 2N8GA 3HRTA 1W7PD 2DK3A 2KROA 3JCMe 1FOYA 1HNWK 3THWA 2GWJA 5LJ3d 2RQRA 1TWGJ 2RKIA 3SZ2A 2EIKH 1YUWA 2DXBA 1FWZA 1WGXA 2HMIA 3ZOBA 2OV7A 3CCUI 1EBMA 3VQ9A 2CG4A 3TU5A 4FW2A 1MBFA 1WPYA 5HL7L 4JKGB 1GOCA 4DMNA 3W2VA 4H8KA 3TEDA 3W2AA 5C3EJ 5ICEA 3EYIA 4A5NA 2NVUB 2CUDA 5K5RA 3TQNA 3OS0A 1T6DA 1WVRA 3NTIA 3FLCO 1XHXA 2HWVA 2FF4A 4OOIA 2KEAA 4S04A 1RT5A 1YIOA 1QVGS 4PJOG 1S72N 3CCET 1A6QA 1ARKA 1IO6A 2QWWA 3T69A 3CJAA 3K4KA 3QU3A 2K9NA 1Y0UA 3OW2M 5BOXA 3O5BA 5DK5A 3PUBA 1ASUA 2E4LA 1NJIR 2NLUA 5GANg 4CD1A 1N27A 4HNUA 2NOFA 2KK4A 1FJGK 1VQ5N 2FRYA 3CPWP 5CVIA 2NOBA 5DM7R 3V1QA 5B66C 2V7FA 5AN4A 1K9MR 3CJ9A 5ED4A 4B9QA 3OA6A 4PJOF 3ZQQA 5GMKe 3WNFA 2NAZA 3ASMA 2OTLQ 2HB5A 3CLOA 3R6OA 1B7TA 4IUQA 5IN1A 2QAZA 3J80Z 4A3KJ 1OFCX 2YU3A 3KE2A 4UB6C 3CFOA 2ZXHA 1KRPA 4UY8I 4E9GA 2XAQA 1MBJA 1NJWA 1VRTA 4I2PA 3OHRA 5L3CA 3NGIA 1Z91A 1QKXA 2E2OA 4FWPA 1AT1B 1ATRA 3PX4A 1S6PA 4KT5C 1IHWA 2EWSA 1B6AA 3DPUA 2W10A 1HNXK 2OI3A 2O01E 4JKDA 1X3NA 3CM5A 1K76A 3RR8A 1CKBA 3AO2A 4ELTA 5LHGA 3QAHA 4ELVA 3PX6A 3IAS2 3V9XA 2R5YA 4O5BA 1MUDA 2M5WA 1UDLA 3J7AF 3LDSA 2IVOA 4XN0A 1PRLC 1FSEA 1TGOA 3BPXA 1OYIA 3QWXX 1VYVA 2E5ZA 1JXSA 3E0JB 3CWUA 1NM7A 3TBIA 2E20A 2A08A 1B34B 3JRGA 3HYIA 2D0NA 4IJNA 1UJ8A 3CCQI 3D7EO 4C92C 4J7IA 2XDVA 3I55Q 4O0JA 3B73A 1Y6IA 2JLEA 3M1FA 4HW0A 3TCJA 4XL9A 3I55T 4Q48A 4CJQA 4FO0A 2G7UA 4UC4A 3JYTA 2YJEA 2X51A 4BWMA 2FC0A 1R77A 3HHTB 3H0DA 1JUPA 4C23A 4E70A 3CDHA 5F27A 2DA6A 3FFKB 2PEXA 3ZN1A 1H89C 1TZLA 2NNNA 1YITQ 2YSQA 1Y0NA 3SI6A 2YHTA 5CYVA 4XIUA 3H5AA 4X1VA 1DUXC 4NQWA 3E5XA 4Z6YA 2PX9A 2DYIA 2OCEA 1P90A 2BVMA 3JRHA 2MABA 5CAIA 4DWIA 5J1YA 4E89A 5KQ8A 4IDKA 1VQ6I 4UV9A 4FLYA 3VETA 1ABQA 2CV2A 3BR3A 3R8EA 1LNWA 4Z0UA 1WQWA 5FLXE 3U9ZA 4IIMA 3D5RC 4LF8K 4PQUA 4AT1B 1TT5B 5A2QZ 3L2WA 1UWBA 2JNGA 1ESVA 2P7VB 3VB2A 4DTSA 3QEPA 1W5TA 4BE1A 3QUIA 4M7AG 1DGWY 1DKGD 1ZK8A 1NGCA 2BE9B 1X9JA 3K0LA 2A41A 2CH0A 4LB5A 4DLEA 1W7PA 1Z7LA 1A36A 2DFIA 1YCYA 1OCZH 4BRDA 1RADB 4FT8A 2KDZA 3H9QA 5C24A 4AWXB 3THYB 2D1VA 3K4CA 3TO9A 4N0AA 4ID5A 4KHSA 1TW3A 4KGXB 2LY1A 4U0WA 5EEAA 2BGGA 4QSHA 3K10A 2DLPA 4JI4K 4M7AF 3CCYA 4E6RA 2XO7A 2HKNA 4D7NA 5FO5A 2E1CA 1ASVA 2QWMA 2O0YA 3BR5A 4EJVA 2ZGWA 2F5CA 2HHQA 3VRZA 3RKWA 2YLBA 4CJ5A 2PMZA 5EVZA 1UJ0A 2D1HA 3VEZA 1U5TB 3N4PA 2W6KA 3D2EB 3TDUC 1M1FA 2L2OA 3BR2A 1MW7A 1FY7A 3WTWC 4Y91A 3R61A 3CCVI 2ZMEB 4ORZA 3WQUA 1R8OB 5GMKj 3PNTA 4MZTA 4FM1A 3H9JA 3IL2A 1NTCA 3JXUA 1TH7A 2NUTA 2VBYA 3SEQA 1I50J 2V1NA 2D8HA 4OLBA 2Q0OA 3MMYB 4J9GA 6PAXA 2D0PA 5GAMe 1CSKA 1BKBA 5GJWB 4B9TA 4M78G 3CM6A 1S1VA 2V4JC 2OPTA 1EWRA 2E1HA 2F6CA 1WSEA 3VOVA 3N4QA 3AL0B 2X78A 2J6FA 4EM2A 1RRSA 1PU6A 1S29A 2EFOA 3SJJA 2OTLN 1QHTA 4N4HA 4CC4B 3F8BA 3DQVC 1VQOT 3U3GA 5DM6F 5DMRA 2GAUA 3A01B 1G83A 2FU4A 4M78F 3RCOA 4Z8AA 3C7NB 3HZ6A 1GFDA 4BRCA 2RQQA 4A0XA 4M77G 3RESA 5E3LA 4JDSA 1I6HJ 3FM3A 3HYFA 4EIAA 2EGCA 3W2WA 2Q3SA 4JK7A 3IKVA 4LUEA 4BJ6C 4F04B 3LOCA 4J8FA 4P5OA 2WA0A 1SVMA 2OC6A 1TW2A 1OVQA 3Q7BA 4UB8C 1XG7A 4M6YA 1IB8A 3PIOA 4EDUA 3TL4X 4M77F 4M74A 3RZOJ 2DBKA 3OW2A 3P9CA 4OFHA 4N5SA 1FMVA 5DD4A 5FKLA 3OYAA 3HSFA 1KVCA 3SZPA 2IS2A 2A42A 3MEUA 1SV5A 1VSEA 4BR5A 5CVUA 5IPAA 3RMDA 2LQWA 1MUZA 4OPKA 3E6DA 4MDAA 1R71A 1VQ4N 4ENMA 3QESA 4B08A 2Y9ZA 2Q2EB 4DV5K 3JCMP 1PSEA 2M1BA 2TCTA 2O8EB 2RN2A 1Y96A 2ZPBB 5DPKA 3RKYA 2BV6A 5D5UB 2VBXA 2WFBA 4N0AC 1P7MA 2KPMA 2CUJA 3QZ9B 4ZTFA 1CZBA 5T7BA 2EYQA 1QGPA 3DLHA 2HBLA 3D0SA 1KVAA 2IIMA 3QBWA 1ORNA 4M45A 4JX5A 1DIZA 1BA0A 1UHCA 4M3BA 1YITN 3F70A 1HJOA 3GTLJ 3E9FA 3K2PA 4W5RA 1TKTA 4E19A 3CJRB 2EJRA 1JJ8C 2E35A 3HP6A 3V9SA 4HSTA 2KLOA 1KC8U 1V29B 2F5TX 4NB4A 1GVDA 5HDKA 2RHIA 4DEXA 4J6YA 5GTIC 1MNEA 1IJWC 2AIRB 1Z25A 1OPLA 4ZNXA 5D6XA 3QODA 4JI3K 3G25A 3UIQA 5KCHA 4GNIA 1M90R 5DM6L 5C10A 4I7HA 4BBRJ 3CXCP 2M87A 1HKTA 2EX3A 2E8AA 1UA1A 3C18A 3M3ZA 5AONA 3AA3A 2JHNA 2V79A 1FT9A 1RDBA 4BQQA 1HYOA 1AEYA 3HPOA 3OS2A 4RWTA 3FM5A 2M8EA 1K78B 1G2BA 1ZREA 3QWLA 3J81K 1AOYA 2A07F 3S2HJ 4J6WA 4KH5A 3C3WA 1WHGA 1TWFJ 5D6EA 5LFAA 2DK5A 1IZ6A 3FZMA 4JI8K 5GAMj 3ULDA 2VKHA 3ERMA 3R0AA 2DBMA 3ABUA 1BIUA 4N4IA 3OIOA 3RTVA 3GFJA 3QXEB 3ONQA 4LF6K 4H4KC 3UATA 3QOPA 3W6KB 2I0NA 4NXNK 4I76A 1RESA 1MGTA 2GIVA 1ZC6A 4CZKA 4FK4A 5H2FC 2AKKA 1N5ZA 1R5ID 3E1YA 1ONVA 1QKWA 2CT4A 2DILA 1XDSA 3X2QH 3KTQA 1KLMA 5AFUA 1S1TA 4CJFA 1DU0A 1L5UA 1Y8RB 1B9FA 2OYQA 3OGDA 5J6XA 4PIIA 4Y1DA 2BTFA 1U45A 2DQRA 3QRFF 3MK6A 1IREB 2EW3A 2FXAA 1XG1A 3QG1A 3EKUA 4QPQA 1WJCA 1UGSB 2IA0A 4RAGA 4LK0F 2DFUA 2VC1A 1ZLKA 4MTEA 2EYZA 2Z33A 1VQ7N 3KFVA 3AY9A 2VASA 5C0MA 2NS7A 4UNFA 3HVTA 1HJRA 2RH2A 3S2DJ 3EGDB 2VBZA 4M7AE 4LF4K 3HO1A 3M0SA 2KFZA 1LUJB 3IH2A 1ZBLA 3AGKA 1KQ9A 3CW7A 1IKXA 3HDDA 1BC8C 3DB3A 4DOVA 3AVMA 5J2PA 4C5GA 2ELJA 3M0UA 4LMYA 3QKJA 4C8NA 1I1SA 4IZ9A 1X2QA 3OYHA 3CF5F 2WC9A 3DV8A 1HW5A 3GBQA 2M7BA 3MX5A 3OS5A 4A2BA 1XCBA 4AYBN 4RGXA 5GAGJ 3G7ZA 4JD2A 4JS5A 3LWMA 1TK5A 3SPZA 1SKRA 2EKOA 2UYTA 3VSLA 3DLEA 2DL4A 3QNOA 4RUGA 4R79A 4DQ8A 3EE9A 5HOOA 5E20A 2GWRA 1BQMA 4M6VA 4KV8A 1Q9XA 2KIQA 2PQWA 2FSNA 4NCGA 5I22A 1YS6A 1DGRM 2STWA 1W6XA 3E97A 1ZBIA 2QQ8A 4MMKA 5DCMA 1REVA 3ZT3A 1NJIO 5FKKA 2LF8A 5CVJA 4CYCA 4PK4A 2KRNA 3EFRA 3DWLE 1WDXA 2WV0A 2IW5A 1C6VX 1JLBA 4F3TA 5DUKA 4XICA 3O1BA 3PO4A 3RBBB 5LJWA 4E9EA 2AXLA 4JHDB 2FZKB 1P8ZA 4M78E 1AKHB 1ZRFA 1TS9A 5FDLA 4O8KA 4WQ4A 3LDNA 1QVFS 2JM9A 1ETWA 2EH3A 1ATNA 3F2KA 4CF0A 2L0KA 4Z4EA 2DTIA 3TI0A 2D5RA 4KHYA 1Y7XA 4LLLA 1X58A 2Y2ZA 4B1VA 2ROTA 2WB1N 2P4TA 3MKWB 3HSBA 1LNXA 4FZYA 4BC4A 1KU2A 4X9CA 3S8PA 2P0WA 2HHVA 2DMUA 1ZRCA 1HRHA 3KWGA 4L5GA 4A93J 4KH0B 4M77E 4DNCA 1ZBSA 3LANA 1U5TA 4KTWA 4XLEA 4PWDA 3C94A 1EJ9A 1NJZA 5KPTA 3D4VA 3WE2A 1Q86O 2XB0X 2ZMEA 3L0QA 2L3SA 1NGEA 4PL8A 2W0ZA 3QU6A 2F5DA 3OJUA 1NJXA 2LLKA 4ENJA 2K4JA 1O13A 2R4GA 5FFZA 2B9SA 3GTPJ 2BUPA 3DTEA 2R0QC 2W42A 2E36A 1MSEC 3KYCB 4BL0B 2LT1A 3KIOA 1ETKA 2P9UA 1KQSS 2K57A 4E3SA 3SQ2A 1VQ8A 2A6TA 1I8FA 3ME9A 3ZSVA 2E1MB 4XSZF 4ASNA 3CF5L 1ODDA 2HPIA 4Z89A 4DS5A 1WH7A 1RTHA 4KKOA 3AT1B 2DA9A 2CYYA 2XI9A 3CD6T 4I9QA 2LT4A 2OZUA 4JRQA 5GIOA 2W1OA 3F21A 2LKPA 1W0UA 5FRNA 2Y0SN 3HOSA 3M9AA 4CJKA 1WFXA 1Y56A 3KLHA 4FX0A 2WSCE 2Y90A 4BEHA 3VN5A 4RLQA 4Z4HA 4YFXF 1HOMA 3ENOA 1O3TA 5LEKA 2F8TA 3OYGA 3GF5A 1J54A 4CHQA 3C7NA 4M3DA 3FIWA 4BRMA 5KI6A 4LF9K 1C0WA 2PN6A 5JICA 2ZJPL 2Q0UA 2F4VK 1X1AA 2CUZA 3K9JA 2DA7A 3SUPA 1GT0C 2K27A 1S9EA 3VA3A 4KFBA 4RS8A 1V76A 1EX4A 5EGOA 4AMCA 1NPRA 3A5ZB 1OR7A 1DGKN 4PJ0C 4KB1A 2JPSA 1YVUA 3JCMb 2EQRA 2DMQA 1AWXA 4FSVA 2QA4I 1UMQA 2JW4A 2Y69H 5DD8A 2RI5A 1M5Q1 2DRKA 4CZFA 2M3AA 3JRCA 2DX1A 3OSVA 4J2AA 2QQBA 4AM3A 3HRSA 2O8EA 3THXB 5K7ZA 3CPEA 1JTYA 4AIHA 2X9DA 3D0PA 1KTQA 2G6FX 3SAGA 2K3YA 2JG6A 2FYKA 3OYDA 3LPTA 1FBSA 4IFYA 3GTJJ 4WQ4C 3HOZJ 5AQNA 1K8AO 1IRFA 1K4TA 3OH6A 2M7AA 1YJNQ 2GM4A 4BUPA 3VQ6A 1HLUA 5IP7J 4YORA 3O4NA 4NLCA 2MF2A 3NMZC 3J7AO 3KVGA 3LM9A 1R36A 1QQIA 4A4KA 2ZNZA 3K69A 1MZBA 3GYHX 3KP7A 2MK5A 4C5EA 3QOEA 5IXFA 1U5TC 1WJBA 2ZMEC 5F0HA 2GXGA 2P51A 2HI3A 4L8RB 4OKKA 4G6QA 3FMQA 1RTDA 2H8WA 2CUFA 2DA3A 2EIFA 1LWFA 4RGUA 1I81A 4WCGA 1H88C 4FLWA 3JTGA 3NWSA 2O4IA 4FT4A 4WXCA 3I0WA 5FLXK 3RPUA 1WUAA 5LHHA 5BR9A 2RHKA 1ON2A 1JLAA 4KICA 2CREA 3A0BC 1X3ZB 1BWFO 2D0QB 4JLGA 1M9SA 1HUXA 4OJRA 3V8JA 1U8BA 4Y52J 5FU6C 4PY5A 2ELHA 2A05A 1XSVA 1K78A 4X64K 1R1TA 5F08A 3FFIA 2IGOA 2LRQA 1F9NA 4EP4A 3KLOA 5KYYB 4DR1K 1RUNA 4DR3K 3GZNB 2KGTA 3S3MA 2EAYA 4LDYA 3SAHA 4L9TA 3SUOA 2ENMA 2RV8A 3CC2I 3RUXA 5LJVA 1X3MA 4WF9L 5IT9E 4ELUA 2CKKA 4LD9K 2WWYA 2M51A 4B9NA 2XHIA 4XAXB 4M7AD 4BBSJ 4IHYA 4M7XA 2KRMA 4AD9A 2F7TA 4FYWB 3K4BA 3CMEI 1R00A 4A63B 1IG7A 1MSFC 4EW0A 4Y4RA 1S6QA 5TISC 3ZMUA 3KLIA 2HXIA 1J7KA 2NWMA 2YHXA 3EYZA 3N97A 5AQKA 2DD5A 3W3DA 1VSHA 1Q82U 3VS6A 3LH5A 5CPRB 2FOKA 4OPJA 4NS5A 2QKMB 1WXTA 3F72A 1Y71A 1SFOJ 5KE3A 1JXEA 4PKCC 2HYFA 1OR7C 2XSJC 2GTJA 3MD2A 3PIPF 1J09A 3I56A 3K5OA 2CUBA 1YIJQ 4AIAA 4W5QA 2HNZA 4OWRB 4M3GA 4G7HF 3WXLA 2CH4A 1GHCA 4LH4A 5C2FA 2YUSA 5A0DA 5KK1A 3CC7I 1YIJT 3CJQB 5CKBA 1Y0MA 4GLKA 4BRKA 1XNQK 3EGXA 3UNGC 1GBRA 1ZBXA 3MN6A 1NEBA 4KJZA 3U9DA 4CK2A 1R58A 1VQKQ 1NJIC 4ILGB 2JZYA 4EGZA 2LYCA 3LZJA 2KKOA 5EZGA 1DQUA 5HDNA 1JL2A 3T8RA 3GFIA 1JLGA 3CCSA 1H8KA 1VQKT 1K9MC 3RMSA 1NOZA 4EEFG 1RBTA 2Z1DA 1J9IA 4Y28E 1HF0A 4CHUA 3IKTA 2P5KA 1JXOA 1HD3A 3PNVA 1ZYRF 3FKJA 2E65A 4M78D 4WTOB 2X1CA 4L3QA 1SAUA 3WG9A 1O3QA 5B1AH 1ZG1A 4LDUA 3EHQA 4HT8A 1N8RO 4P5NA 2X0LA 2Q36A 2DO7A 3C6HA 4X0GA 2XY6A 2FJ1A 3ZCOA 4XKWA 3K59A 1ON1A 1KO9A 3QP5A 1AHJB 1U47A 5AT1B 3BR6A 3FWEA 4HWIA 4GO1A 2COWA 3ZQHA 3NVMA 2VN2A 3EN9A 2CP3A 1KEAA 1I5ZA 2XIDA 4XSXF 1S72A 5FWCA 4M77D 3K4MA 3K0SA 5GADP 2QEXN 2GOMA 3LWIA 2VXZA 4FVUA 3FXMA 1Q1VA 2CH4W 1A04A 1D1BA 2V7YA 2V6EA 1RAGB 4PJJA 4NYNA 1BO5O 1VSFA 1W2BP 1J5EK 2XHCA 4GMJB 3CPWM 1R4MB 2A36A 1TKZA 2ZO4A 2NNWA 4JHDA 2A40A 4LN2A 2X9HA 2YRCA 1UEBA 1P4WA 1OYYA 3T1HK 1ZHIA 2Q97A 1YJNN 3SDZA 1D4XA 3NGZA 1BCOA 3GTMJ 1ZRDA 2RVCA 1EXQA 2VBWA 4BJTA 1YRNA 4FOEA 4G94A 5GMKh 4XOPA 1FXXA 4JUVA 3KEOA 3S9HA 4UVBA 1VUBA 4KBOA 1SKWA 1UHFA 4AFQC 4Y0WA 2RDPA 4O3MA 4CJRA 3OSSC 2AS5F 5LJ3h 1TWBA 2P9PA 5GAOr 1K73R 1S7EA 1LB2A 1A35A 3QFUA 3O8HA 2K40A 3PNYA 4R1HA 3F10A 2EZLA 1TU0B 3JV3A 1RILA 4M7YA 1O1WA 3JRDA 2JA8J 3JAME 1PKSA 3LA2A 4DCHA 1O7FA 1ZKGA 3CMAQ 4L0ZB 3SFMA 4FJGA 1WSIA 2LP0A 3WU1B 2XK0A 2YV0X 4B3MK 3Q9VA 1WWXA 3GFMA 3GMEA 3CMAT 3J7YP 2D6FA 3RKXA 1HSTA 2YJFA 1RACB 1JTXA 2OFKA 3KYDB 1IV8A 1DPRA 1R5HA 3DKYA 4HCCA 2IEKA 2OTLI 3SAFA 2NVQJ 3E5UA 4IVNA 3ZEUB 4Q0BA 4M7AA 1D9FA 2QYOA 1YI2T 1PDNC 4DOZA 2ICWG 4EP5A 5BMZA 1X01A 1M3AA 4HBLA 2DFEA 4CC7A 1M2OA 5HLFA 2QM3A 3COAC 1Z9CA 2HNDA 4A3LJ 1X6OA 5M5WJ 1JJ2M 3CCEN 2IXSA 4MLEA 5J2NA 4LJZF 1WI3A 1BIBA 1LDDA 3DLLF 4QKUA 3EYYA 2IG0A 2RHZA 2VI6A 2QQAA 4DSIA 4M3EA 1PCXA 1FKPA 4B4CA 1ZH5A 1L3SA 1L3UA 2ED1A 2OFIA 4LGWA 3KUFA 2QKBA 3A0IX 1OH7A 1XQPA 2RN8A 3NPFA 2VT2A 3G6EN 1WRJA 1B9DA 1D1CA 4H5NA 3HKZN 2K02A 4WF2A 3OWTA 1WX6A 1I5OB 3M59A 2IAJA 3UE5A 2D0BA 1SD4A 4M3UA 1VQ4I 3CCMA 1ZQ3P 2KI7A 5FD6A 2RQUA 1JLEA 3I55I 1Z1DA 2F9WA 1FIAA 1YJ9N 3M8FA 4JJDA 3OOUA 1SRMA 5KYXA 5AQXA 3V9ZA 1XPXA 3DWLA 2KT1A 1G6NA 5AQQA 4FM2A 4EHUA 1J59A 2LBFB 4G7OF 2Q8KA 1U6GA 3IQLA 2EQIA 4M78A 4CJWA 1YITI 1B72B 4AFSC 1GLCG 1V4SA 1DEJA 3PT9A 4OVLA 2QTVA 2HHWA 3P8BB 1N39A 2L7MP 4XRSG 2G8IA 5BPMA 1QVFA 2D9TA 1I94K 1V54H 1KQ2A 3Q0UA 3HG9A 3ZSQA 3FZLA 1K6YA 2FSWA 4FU6A 3VS1A 3X25B 2YRVA 4MLOA 1F36A 2QM1A 1UECA 1IXCA 5C25A 3U8XA 2O8BB 3HSCA 1AZGB 2B7EA 2P9SB 2A3SA 1KCFA 3A2FA 3WUHA 2PBIA 4HNVA 4N47A 5FPEA 2CSIA 4M77A 1KD1R 1ZARA 4DTJA 4A53A 4BY6B 4RCBA 1QA6A 4JBAA 4F4KA 2HDAA 2E88A 4KN4X 1FJLA 1AHDP 2DTOA 1QCNA 2DRMA 2BTTA 4M71A 3DEUA 2YHYA 2O31A 3KPHA 4S05A 2HEOA 3I71A 3KNTA 1TP4A 1ACIA 3FSPA 2VGMA 4AI4A 1WNSA 5AQPA 5E17F 3A8MB 4C0GA 4HRIA 4F7UE 3HSRA 1RAFB 1S5JA 4DU4A 2R92J 3KJVA 3QDFA 4DF8A 4M4ZA 3ABLH 2BUDA 2RJEA 1Z9QA 5KYWB 1T56A 2AQEA 4XOTA 2XASA 1KQSA 1Q81O 4C3HJ 3DLLL 3OW2P 4HLYA 2NOJB 3WGHA 4M7AC 2KYMA 4J19A 2IGKA 1WJRA 4XNFA 3SK3A 2DTRA 2O5RA 1S7OA 3WTXC 2NUPA 4DR7K 2AJQA 3O9SA 3R9PA 2W7NA 3TU4K 3CG7A 4GCVA 2HR3A 4E47A 5AZIB 3BG9A 1WJAA 4V19S 4D7MA 4F16A 3MAQA 3CCVA 3CCQT 3VEXA 2IT0A 4J9CA 2L5QA 3L3VA 4NC6A 5IOZA 1MMAA 2QWQA 2BBYA 4EMKB 5C44J 3O9TA 4HUGA 3EPZA 2L9SA 1ZR2A 3DXMA 3N05A 2ASPA 4GY2B 2LRDA 1IGQA 3QERA 5FKNA 3TAMA 3GVAA 5BN8A 2CRGA 1X1BA 5A2QE 3QEWA 4M3XA 1VQMQ 4Z4CA 3T19A 4JRKA 2O03A 5F2RA 1YQKA 4EIKA 5A0GA 1VQMT 1ZSZB 3CCJQ 1VA7A 2XY8A 3CERA 2DMPA 2PYJA 2KYBA 2NUZA 1VQ6T 2VE8A 3ZFJA 4CVNE 1XQSC 4F93B 4I2QA 3CCJT 2E5NA 1M90C 2VQEK 1LQ1A 3ISPA 1YLFA 3ML6A 4O55A 3ZQ7A 2MI6A 5DS9A 3FC3A 2LSOA 3U2RA 4RMOA 2ECBA 2CFOA 2D0OA 4FISA 4ZYGA 4HEA2 3TW7A 4M78C 4D1QA 2DPPB 2C06A 2WY8Q 4UUVA 2XGXA 3I0RA 1IN4A 3WTTC 1WCMJ 1WHUA 1LWEA 1NGHA 3LWLA 1EA3A 3HHHA 4QQGA 3Q5FA 2BXZA 1WZ2A 1OQKA 2IVWA 5B3SH 5FPNA 3QPLA 1E4FT 3MPUB 1FBUA 3G10A 4I02A 5KN8A 2YNHA 4R56A 4E1MA 4IUVA 2W03A 3LQQA 4JI7K 1Q7YO 1O3SA 3VV0A 4M77C 2ZJ2A 4YPRA 4HOBA 2EILH 2PUOB 1F5TA 1U0JA 3QP6A 1QQCA 4YDUA 4R55A 1RT7A 1IG8A 2KZVA 1SG5A 4XK4A 2QK0A 3JRIA 4M9ZA 5F1JA 5KAFC 1X19A 4DV3K 4A0YA 4F7UB 3RTRA 4ILJA 1RZ4A 1ETOA 1HW1A 4O4GA 3CXCM 1NKUA 4E1NA 2HBKA 3N0UA 3JCMJ 1TBXA 4CE9A 3RRGA 4UXNA 1X1PA 3NHNA 4BGBA 3SUQA 2MSYA 4XMYA 3ZQIA 4AIJA 1XX5A 4II2A 3P83D 1HYZA 4Y17A 3O9RA 4DR2K 1Q86U 3KX2A 2MG4A 2K3XA 4NBQA 4LD5A 1K0XA 5E79C 3I4MJ 5BS6A 4K11A 2DA1A 4HV6A 4M9SA 4HNTA 1RR8C 4C3JJ 4CBWA 4N56A 2GFUA 3RERA 1QCOA 3LX7A 4FJJA 1VQ9Q 4DBQA 2JJ7A 2VKVA 3CLQA 2O8XA 1WA7A 3O1WA 3TW6A 3L4IA 4YOYA 1VQ9T 2PMZN 3CETA 3BP8A 1OPCA 1WJSA 3S17J 1YJWQ 4IXCA 2OZ6A 4B23A 2PVGB 3EAEA 1H9TA 1IF1A 1APLC 3G71A 1YJWT 5GAHP 3ZGKA 3M8SA 1POGA 2Z16A 1BL0A 3OYJA 4JI0K 2DLLA 5KCOA 4HVUA 2EGEA 4HSBA 1AZEA 1WOQA 3SQ4A 4ZDOA 2FNPA 1JT6A 5LJ5g 1LDKB 3QDKA 5KHDA 4RCHA 4XLFA 3OBWA 2RHYA 3LSIA 2YS9A 2R7SA 4EZ6A 1IN6A 2DYRH 4UUSB 1QSSA 1DLOA 2QBYB 1SRLA 4H0OA 2A3LA 1X2MA 1RAAB 2ECZA 1DP7P 4PJNA 1YX3A 1NG6A 1IUYA 4CIGA 3FDRA 3CF2A 1GV2A 4DQIA 2K2VA 4DF4A 5FFXA 4HF1A 5BPIA 4OAZA 1E6HA 3SHWA 3QSUA 3DBLB 2O61A 3ZEUA 1GLJO 5JHFA 1HDPA 4LXCA 1FIPA 1QW1A 2BE5F 2VWFA 2DE0X 3BJ6A 2QZ8A 4LF7K 1Q18A 2LP5A 2L3RA 2FD5A 3H6EA 1J5YA 4RM2A 5LRRA 3SUNA 4CI0C 3A8LB 3TGNA 1R49A 1BI1A 2IGNA 3MQ0A 5IT9K 2L9NA 1M27C 2HVIA 1WLPB 1TUYA 2L9VA 4IO9L 1U8RA 2IDOA 4LG3A 3JSPA 1XCVA 1QHHD 4IRIA 3QICA 3A2KA 3P8DA 3V8KA 4RA2A 1CQTA 3G4SQ 2R5ZB 2P0KA 1M3HA 5I11A 2ELKA 3LNQA 1M30A 3X26B 3VQ7A 1OYWA 4RGSA 4YDUC 3HJFA 3H45C 4KH1B 2LNHB 2OTJQ 3D1NI 3G4ST 1K8AU 2VG7A 4ISEA 2PFBA 1FTTA 5LY3A 2RPNA 2YR2A 1E3OC 4YOWA 1Q9YA 2COBA 1JBMA 2OTJT 4D8DA 2KMTA 4J9HA 3EEQA 1IRXA 4EJOA 2BHYA 3MN9A 3J80O 4HUFA 2W00A 3LSGA 1EH7A 1PJRA 1FTZA 4YFUA 3GOIA 4C92E 2VCPA 4B22A 4AFZC 3M0PA 5EY4A 4GRIA 5J1UA 2VUBA 2MPXC 3S1MJ 4NC7A 2VQHA 3PQKA 2Q31A 3WNGA 1B72A 2YCHA 1OX8A 5C2DA 5H6QA 2K5IA 3A5MC 1U2WA 4H5VA 4QWQA 3ERED 4B6MA 1W4SA 3VPZA 1ZA1B 1XI1A 2WB1A 4EQQA 3WXJA 4CEEA 2DVEA 3M57A 1Q1HA 5B1BH 2KDSA 3ZQLA 2ASMA 2GWKA 1BR2A 4DW6A 4FM0A 4DUZK 4FCYA 3UDCA 5AQTA 2ZKZA 1MHNA 2V6CA 1VIEA 2VKNA 3S16J 3RQ4A 1FZPB 3NAEA 4ICLA 2DKGA 4FJ7A 3K57A 5AQZA 1TWHJ 3C2GA 2Y4XA 3WNEA 3ULEB 1ZLMA 5M9OA 4JK8A 2H6CA 3I8BA 3DLBA 3VW4A 5LJ5f 2HYGD 1KU9A 1LEBA 2H3GX 3OYEA 2JSPA 4ESJA 2MLKA 3PJRA 4B9SA 2P9NA 5M1FA 3KD1E 1A5VA 1YHQQ 5KYWA 3M1EA 2OAWA 3INZA 3TREA 3LM2A 4LD0A 1O9SA 2HOTA 1KGSA 4BHBA 3FXQA 4M7DG 3FGUA 1YHQT 3MWTA 2ZBKA 1G59A 4OKJA 1KQ8A 2BIVA 4EM0B 4KT0E 4B3OA 5GPCA 4JKBA 4XTVA 1S22A 2YI1A 2PYLA 1TWCJ 2OBPA 3EUAA 2M02A 3HEFA 3TAPA 2HKQB 1U48A 2F4OB 3R6SA 4HZFA 2L4AA 1VQPQ 5FJ8J 4XH5A 3G3ZA 4M7DF 3O4WA 1TKDA 1KAXA 3CC4Q 1W5SA 2BY3A 4DB3A 3KEYA 4W1UA 2B5JA 3F9MA 3IS9A 3FRNA 2AP1A 2NVTJ 5KVRA 1VQPT 1WZOA 2Z0WA 2QWRA 4M6XA 4LDWA 3CC4T 3PFSA 4NC8A 4MZPA 4M72A 1TOVA 4C8QG 3ATVA 1LWYA 2WV1A 4K8ZA 1E4GT 3EG9B 4MNUA 4LLNA 3JSMA 4AU7A 3JCMW 3FZKA 5E1WA 5L23A 3WVEB 3DI6A 5M3MJ 4D8KA 1MMDA 4H5RA 5TGTA 3HKSA 4LSLA 3CCLQ 3LSTA 1JCGA 2XVCA 2ZPIB 1HKGA 1RDAA 4H0TB 4O5VA 3JAMK 3ZL7C 2QENA 3VEPA 2HHUA 4FWKA 4S0HB 4B3RK 3CCLT 2M34A 4C92B 4ZDPA 4N0BA 2CQQA 2QTXA 4C8QF 1S9GA 1ZSGA 4QVDA 2KXDA 4NO7A 1ZHFA 3SMPA 5ADXA 4LFBK 2MH9A 2O88A 1VQLQ 2KRHA 4DIQA 3KHYA 2CP2A 3NFCA 2Y4YA 2UXCK 4CERA 5EG0A 1FSHA 1VQLT 4FM4B 2L01A 4FYXB 1KFDA 4BNCA 3M1CA 4E2FB 5I42A 3GO5A 2NRTA 4CGIA 2PFUA 2HHTA 1SL0A 1Q82R 1I3AA 1YYVA 4CZZA 3IH7A 3THWB 3P7NA 5DDGA 2HF3A 3FIFA 4O44A 2CQXA 2KXCA 2HSTA 4DTXA 3C4SA 4H0VB 1J2XA 1RGIA 4L9JA 2JMCA 2W24A 2LY2A 2PUKB 4MZMA 2XDBA 1GLFO 4ZHRA 1GLAG 1YN8A 1DT9A 2F2WA 2GLOA 1ZX6A 2PVOB 5LMNK 3AA2A 2X6SA 3PIPA 4WFNL 5IHKA 2PBDA 1C1CA 1OKRA 3ZT2A 1IHVA 1YCSB 5AJ3K 2CGKA 3FXLA 3GFLA 3LFUA 2XV4S 4MIMA 4XLCA 4RG8A 4YIIA 1TG0A 3QO9A 1U9OA 1KC8O 2PVDB 1XC9A 1T8EA 1BM9A 1M8MA 2O8DA 3FZVA 2DYSH 1F1BB 3HOYJ 1PKTA 4AG2C 1YJNI 1BI4A 4D9JA 5EC7A 2X1DA 3H36A 3LWFA 4U0VA 2L7KA 4M63C 2QG9B 1H8AC 1OPKA 3VQEA 3H3NO 4PHTX 1UHMA 3GNGA 5AQVA 1D3BA 3VS4A 3I3LA 4FWQA 2MH2A 3HM5A 3FHNA 2F4IA 1J53A 1T2KA 4W97A 4A3MJ 1VQNQ 3IC7A 4BACA 3NEUA 1V4TA 3T9NA 4DS4A 1BR1A 1KHCA 3DKWA 1VQNT 1QBJA 3MEAA 3VGKA 3PX0A 2CP5A 1Z7UA 2MOXA 3ZQGA 4C0DC 2AO9A 3K2ZA 3MWMA 2RA2A 2W40A 4H0YB 2R5YB 4BXXJ 2FBTA 2K3PA 1RLPC 3LZIA 4ENKA 4Q47A 5J39A 4RTUA 1HKQA 4LDXA 4FE4A 2VKEA 5L3FA 1HU0A 2FBIA 2QUFA 5B8HA 1M3QA 1HKSA 1VQ8N 3HBTA 2K9GA 3I56Q 1XDUA 1IN5A 4ZZLA 2EZHA 2KL4A 1C0GA 4OKEA 2CT3A 1RPWA 1WJFA 3J7AP 3HPHA 3BTIA 1M2VB 5LJ5e 3O3FA 4WFAL 2VJJA 1EV7A 3M4YA 2QA4Q 3NVKA 3CCRA 3ID6A 4A6DA 2ZPFB 4BH9A 2OF7A 3EG3A 4CJPA 5J40A 2A1SA 4CW7B 2QA4T 4YHHK 3S6IA 3CIPA 5BRDA 1NKEA 3V6DA 3I5UA 2UUCK 3RI4A 3CMEA 2I5JA 3GX4X 3QINA 2DA5A 2MGQA 1NK0A 4E7HA 4C92D 3TANA 4OGEA 4CF8A 2E5LK 4OB3B 2I7NA 1WFWA 2HMPA 2K4YA 1LAVA 1HNIA 4DBFA 3G6EI 5ERIA 4PKHA 1QZEA 3VUBA 2UXXA 3FK7A 4V19K 2YT6A 3IUCA 2OQRA 3ZPLA 2BXYA 2YG9A 3PE0A 2XUBA 2UU9K 4CCKA 5GAOq 2RD1A 5J2QA 2GA2A 2R7QA 1HMVA 3AO3A 2PG4A 3FZHA 2R5ZA 3JCUC 1YIJI 1K73C 3BR1A 1KFSA 2WONA 3UA6A 4C1NK 4II1A 3CC7A 1WJQA 2NOGA 3R0JA 3JB9J 1WBBA 5BN9A 5CQYA 1ZUKA 5E1ZB 5A2QK 5C42A 3MKZA 2EQKA 1YW8A 1W7PB 1S5LC 5ELZA 1S72Q 3TMOA 3L6QA 4RBOA 3TSPA 1W0TA 4CZGA 4AHSA 1VQKI 3SLCA 5SZTA 2LREA 2QSGX 1S72T 3CP8A 1IGUA 1T6SA 1V5EA 2MYSA 3L1PA 3AAFA 5K1YA 4DKWA 2XU8A 3ULQB 4A3JJ 1QMCA 3HOXJ 1VQ5Q 1MWMA 4IHSA 2DW4A 2EQUA 4IRHA 3I59A 3DLLA 5IP6A 1A6IA 1VQ5T 3A1YA 4M7DE 2A69F 1XB4A 2YG8A 2DL5A 1ITYA 3CWSA 3DLMA 4B3XA 2DM1A 3K4LA 4LSNA 3JB9I 1MBKA 2GNCA 5KH6A 2CU7A 1YG2A 2ROLA 2LX7A 3VKIA 4KUMA 2DETA 4BYYA 1YNZA 1WSFA 2R7XA 1QE1A 4N4NB 4TVRA 4HVWA 3CC2T 1EIFA 1BDGA 2YLCA 1P4AA 2F96A 2UUZA 2NUTB 3K70C 1NLOC 1T6CA 4M3TA 2FX0A 5JS1A 1OJLA 3GTGJ 3DBHB 4QCLA 3GTOJ 2G7HA 3QYBA 2LR8A 4E9FA 3T3FA 4ISGA 4DZPA 3M0RA 2H8HA 1PVSA 5GADJ 3OS1A 4A2AA 4BRGA 1D09B 4FE7A 4Y3OA 1QVUA 4E1JA 4A4HA 3KZBA 3WT0A 3WE3A 2DL3A 3THVA 3OIPA 1NGIA 3TPQA 3MJXA 2KQ2A 2YUNA 2DAOA 2LQKA 3SMSA 5EG2A 2B0LA 1NK4A 3K9KA 3O8VA 2W85A 4NLBA 2ZC2A 4EMSA 2D4WA 4FJNA 4BR7A 2HQ5A 5HNHA 2JHJA 5CKDA 3GIBA 4QS7A 4GDFA 2CS7A 5J3BA 4GGGA 3F6VA 3RR7A 2ME6A 1O75A 4XEIA 1OCCH 3EUHA 3CCEA 1TUGB 3SQ1A 5LJ5j 4DJAA 3JCMd 2MWPA 1XSXA 3VQBA 4LG0B 4FJIA 2L7ZA 2R7WA 1K61A 1YQRA 2IVNA 5FLXZ 5K5QA 3IG1A 2DTHA 1NLVA 2NOHA 1TK0A 5AIPA 1D0YA 3U9GA 2LMJA 5AQHA 1B07A 3ASOH 2D0AA 4H03B 1Y1WJ 1KJWA 3M4GA 3CMAI 1QVFP 1IZ1A 4DLGA 4DYRA 4G7ZF 3CWAA 3IWZA 1KD1C 3MHXA 4BWJA 4J6XA 3MKYB 4F3QA 4XU3A 3EG9A 4RB1A 2DZ9A 1RR7A 4B09A 3VEVA 1U06A 3I56N 2KTQA 1P2FA 5J47A 3E5QA 4CA0A 3BDUA 2YUQA 3H0GJ 3J7YJ 3NH1A 4FK0A 2ZJRL 3M7GA 2GA1A 3JB9G 4BRLA 4G9ZA 5GAN7 2JWLA 4HHTA 4EJYA 4FIBA 4GVEA 2CH6A 2FBYA 4A2UA 2NOEA 1NYGA 1RI7A 1P6RA 4CCJA 2KFDA 4L5EA 3LSRA 1TL3A 1NGFA 3ZETA 3U21A 3S14J 4QQDA 4A3FJ 2G8WA 3NBPA 1U2VA 3MZYA 3FBIB 3WXKA 1NOYA 4NCBA 3GL1A 2NVXJ 5AQIA 3EZ5A 4A6EA 1XTDA 3CCSN 2EB7A 1KQSP 1QO0D 2VYPA 3NGYA 3L2CA 4CO8A 2VWKA 1ZR4A 3GWZA 2JM8A 3RMCA 2I7PA 2EWNA 4JV5K 1QRYA 1JL1A 5HP1A 1T3SA 2ZF5O 2LH9A 3MAJA 4CJLA 2P6SA 5KE2A 5KAIC 3O3GA 3OMYA 1HBXG 1X1CA 3REAB 3VQCA 3PV8A 3Q3SA 4V2FA 2LDMA 3I55A 4DQPA 3X24B 2FO0A 1GBQA 5CIUA 4YOTA 3AG3H 1JI8A 5GAMf 1GXPA 3P8HA 2FB7A 3C0CA 4FZZA 4KTQA 5TRDA 3GBTA 3VS5A 4CHYA 5GAN5 2CZ0B 2E64A 1M1KO 2A6AA 4DHYA 3Q7CA 1YVNA 1MKMA 2DCEA 1X6BA 5KPRA 2J5PA 4C5IA 5C0YA 4XU0A 3IMXA 1RT3A 2WAEA 2XGCA 5CYQA 3ZX3A 4EM1A 1MUYA 2R5MA 2VPLA 3ZP5A 2H09A 2LKSA 4CH7A 3BOQA 4KDPA 3LQRA 3CCUN 3VSKA 4IOXA 5L3BA 3EY1A 3MCAB 5GPAA 3KBGA 2X4JA 2KIMA 4QS9A 3K4NA 3EUHC 2Y30A 2OTLT 3HZJA 4MO5A 4M3WA 5CQEA 3KCCA 5CQGA 2F2VA 4L6V5 2ZWHA 1UGPB 2RPIA 4FWLA 5AFUH 1P7IA 1WJDA 3MEVA 3B02A 4CC3A 4P1WA 1SSHA 1YTAA 2COZA 4A3GJ 1MBEA 2QW9A 4GBQA 4M73A 2AHQA 2P84A 1BBZA 2YX7A 2F1LA 4M42A 4KA4A 3BG3A 3PO2J 3NHGA 4DV7K 2UXDK 4QLCU 3PVLA 2VKDA 4BR4A 2NYXA 2DNUA 4FLZA 1UGRB 1YFHA 2LZ6B 4OP0A 2XGDA 2ESWA 1Q86R 4GV9A 4AHVA 2RF2A 1YT3A 4CJ7A 4C9YA 1YW7A 1N77A 1K8KB 2Z1GA 4HF2A 1FYNA 1AWOA 2K3FA 4FLVA 2I5WA 3BY7A 4CUGA 4CFBA 3N5BB 2YXYA 2EIJH 4NL2A 5D8LB 1VQ4Q 1RIOH 1SD7A 1G3SA 5LRSA 1BBYA 1TTYA 3B6AA 3V4IA 1ZAOA 1ASWA 1HC8A 3VF2A 2FBHA 2ME0A 2FMLA 4U7BA 1M2VA 2EJGA 3MKLA 1VQ4T 1XD7A 3FEOA 4E0DA 2X74A 3DEEA 5AZJB 1KQ1A 4DV0K 1Q82O 4B8AB 3E6BA 3R2XC 2BANA 2F4MB 4EV0A 3NTKA 2HQEA 2HTSA 1LAWA 1T0FA 4FJLA 1JJ2P 4BDPA 3HPGA 4JD2B 4YRVA 4GXOA 1ORPA 5C4JJ 3KYLA 1UAAA 4KTZA 1YITT 1XTAA 2ATCB 3PLAA 3BG6A 2XHKA 1U6ZA 1VQMI 5K14A 1S8NA 2DJZA 5GAN2 1IUFA 2DL7A 2YHBA 5AQSA 3LAMA 1I27A 1OLTA 2HF4A 3VWBA 3CCJI 5GAOn 4M7DD 3UKRA 1VQOA 1Z3YA 3RQIA 5FLMJ 4X62K 4EAHD 4KHWA 2GX9A 3CCMN 3KD5E 3OR1C 2QI2A 5I9EB 5DCMB 3HP9A 1EO1A 1KAZA 2IJLA 1FKOA 1SZ2A 2FSJA 4ANJA 2NS0A 4LITA 4CYCB 2YHAA 2RK1A 4ID1A 1QZZA 2EZKA 5GAMd 1H92A 3HJEA 3QYHB 4U7DA 4FHTA 3I54A 5I2SA 4XQFA 1QNTA 2LSNA 1DJ7B 2QDYB 1BUPA 3SWNB 3U3YA 1KG7A 1K9AA 1PVEA 4CDGA 2ZGZA 2BVLA 4XONA 1RL2A 2PNIA 3FHFA 2VODA 2E70A 2GOXB 3WG7H 2IA1A 1UELB 5HLTA 1V5GA 3BTCA 3F8MA 2HHXA 2MAMA 1TV6A 4PFZA 5F0FA 4F7ZA 4FL6A 2IC3A 3CQTA 2MC3A 2RGVA 4WWCA 2XROA 5GANf 1TVRA 1OH5A 4E7ZA 2R5AA 3A5NC 1TC3C 3H3OB 1K8AR 4MQ3A 4BD3A 4UQGA 3RMBA 4BU2A 2P9KA 1S3JA 2KVQG 3PO5A 3S1NJ 1LWVA 4FJXA 1A5JA 3T1BA 2VWBA 4NL3A 3BW1A 4DA4A 4M3ZA 4IRGA 1NGBA 2LFBA 2FG0A 4I01A 3FZFA 4DQ2A 2LC4A 3QMLA 4XLNF 1JLCA 2PJRA 1QCFA 2P9UB 4BDYA 4Z4FA 9ANTA 4OIRF 2LTPA 2V1XA 3VENA 2CV0A 5JVTA 2JJ9A 2DXTA 1ZUUA 3DMJA 4J2BA 4IOAF 1XMOK 2FQ4A 1JHHA 2Z9OA 4OB0B 3O4QA 3RSEA 1VQ7Q 4MQ9F 5FU6B 1O3RA 4MQVA 1YQLA 4KHPK 3UKGA 3BTJA 4U0YA 3NF7A 1VQ9I 5E3MA 4QVCA 1VQ7T 1VK0A 3L42A 1OU8A 4BEHB 4M75G 2C0OA 3I5SA 4AF1A 5JS2A 4U87A 3JCMV 3LALA 5DCFA 1YJWI 5HY6A 3CCVN 3MX2A 4CK3A 1QVGM 2NS8A 3QBYA 2DXUA 4CJEA 3DFGA 3VS0A 1T0FC 3HUGB 3AV9A 4J9IA 2E6NA 1GV5A 1JGGA 3QB0A 1ZTRA 1GL5A 2E5QA 5M1OA 1IBMK 2QVOA 5J8FA 3ZSYA 4KUIA 4LG0A 2UV1A 2RK2A 4M75F 3OB9A 4DV2K 4PL6A 2CGJA 5GAHJ 2VWJA 4OIPF 2HZDA 1LV5A 2DJIA 2JTMA 4BUGA 1BGXT 4FLUA 3EE8A 2QK9A 2EKHA 1PWTA 3OMGA 4KB0A 5EGOB 1HA8A 2IPOB 3ZRGA 3VFZA 5BR8K 1PU8A 3ABTA 2WSEE 2EPFA 3PY8A 3GW2A 2Z2SB 1Z67A 4K8XA 5J26A 4CD3A 4A0ZA 2JUGA 2EFIA 2C6YA 4DSEA 4PJOE 1ZXOA 4Q5SF 5HDGA 1U84A 3TAEA 3HTVA 5L3GA 4RTWA 5AQMA 3SEZA 2G8FA 2AK5A 3QYGB 4ZGDB 2HSPA 2A0FB 2GTDA 4I6MA 1TNSA 2IA2A 5AQUA 3OSGA 1D5YA 1W2BS 3NF6A 4ON0A 4DEYA 2E1YA 1HKBA 1VRLA 2HYJA 1JXBA 3DLRA 2QF7A 4MMLA 4M7DA 3UF4A 2X4YA 2DXIA 1M3CA 1GOBA 3RDIA 4GW6A 2D1KA 3AVJA 5GANd 3G4SI 3KZZA 1GLBG 4AH9A 2DPDA 3L2UA 1W97L 3T1YK 4NUBA 4HX4A