3OS2A

Pfv target capture complex (tcc) at 3.32 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords Integrase
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 96
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os2A03
4JS5A 2ATQA 3HP6A 4FJIA 3UIQA 4II1A 3V9SA 3L2UA 3I0SA 4IKFA 2LTOA 4IUPA 3META 4DTMA 4B3OA 4LD0A 3LALA 5DMRA 4QW2A 1WSFA 3MEWA 2YNHA 3C95A 3OJSA 5HRSA 2O4GA 3K59A 4CF9A 2YHBA 4PY5A 1ASWA 3VQBA 2X4XA 3QIPA 2Z1IA 3SZ2A 2Z1JA 3VQ4A 4CRIA 3DLEA 2BUDA 4CEBA 3DMJA 5J2MA 2OPRA 2FC0A 3OYNA 3DYAA 2WACA 3L42A 2CKKA 4DTJA 4E19A 5CYQA 3IRXA 4DFKA 1UAXA 2G3RA 4I7FA 3P1GA 2EQUA 3TAMA 2ITGA 1XHXA 2HB5A 5FROA 3SQ0A 3QEPA 3ZT2A 3RRHA 4DTPA 2YNFA 3SJJA 1RT7A 5HBMA 2JGUA 4CIFA 3OYIA 2OPPA 2PYLA 1J5OA 2P5OA 1UWBA 4HCZA 1C0MA 4DQSA 3OMCA 2AJQA 2IC3A 5HROA 3H8ZA 3MEVA 4DQPA 3NBPA 3WNEA 4N56A 1MHNA 4ZTFA 4Y1DA 3AO5A 3B6PA 2HNDA 4AH9A 2Y1IA 2RJCA 1DLOA 1FKOA 1O1WA 3TAQA 1WJQA 2XDPA 4OVAA 5EU7A 4BACA 4FXDA 4FVMA 1TAQA 3K57A 2JTFA 4N4HA 5CZ2A 4B9TA 4B9SA 3G0ZA 4KI4A 1RBUA 3L2WA 1BIUA 3OVNA 3ZSRA 3BDPA 2Y1JA 2P0KA 3OS1A 1HNIA 4C5EA 4NCGA 4FLYA 1WN7A 1RBTA 1ZBHA 3MXJA 4CECA 1A5WA 1LWCA 3F70A 3HVTA 4OKJA 5D6YA 1HYSA 4LD6A 4DSFA 3K5OA 4FW1A 1VSLA 1TAUA 2YNGA 4KKOA 2E6MA 5E41A 4GW6A 3LWMA 4B9VA 3JSMA 1RDBA 4UQGA 2BKDN 3MO8A 4FLZA 2R7YA 2LCCA 3G10A 2KW4A 4JRQA 3SUPA 1TL1A 1EX4A 4DFJA 4J2BA 2EHGA 3PO5A 1JLFA 4RW6A 1RDDA 4CF1A 2YKNA 5J1EA 4Q5WA 5I42A 1A5XA 4ELVA 4KHSA 2VG5A 1CZBA 4C8MA 4CERA 1RCHA 1ZBIA 2RHUA 4C8KA 4FJXA 1JLEA 4CE9A 1LW2A 3VQ6A 5HRPA 3DLBA 1ITGA 3KK3A 1QTMA 3AO4A 2YKMA 1S1WA 2IG0A 3KTQA 4IURA 4N41A 1CXUA 1RT5A 3RMDA 2B6AA 3QEWA 2BGGA 3U3GA 5C25A 2L8DA 3C94A 1NOZA 2MWOA 4J2EA 4ELUA 3E9GA 1BCMA 4RW7A 2QQRA 1XHZA 2HVIA 3M9QA 1W0HA 2RF2A 1TKZA 1D8YA 3ZT3A 3OYGA 4FK2A 1VSIA 1KHCA 3V9UA 4HVJA 1JLAA 5J2NA 3MAQA 3E01A 1NKEA 1VSEA 1WJRA 3V9XA 1X9WA 3CM5A 4KHWA 4DLEA 1LV5A 2RJFA 1TK8A 2R58A 4DFMA 3TWHA 3P5JA 3P8HA 3QO9A 1VRUA 4FJGA 2RI3A 3AVAA 4DTRA 4AHCA 3L8BA 4OKKA 1NJZA 3DRSA 1ASVA 3NF9A 4HCCA 2OYQA 4KREA 4O5BA 3MP1A 4ICLA 4M45A 4E7HA 3KKRA 3SQ4A 4IUVA 3M8RA 4E0DA 4O55A 4FL6A 2KFZA 1L5UA 1Z26A 3LAKA 4BE1A 3IG1A 3DI6A 4F3OA 2HHSA 2VWJA 1G5VA 2P1JA 1NK8A 3MEUA 4A4EA 1B9FA 4AHSA 3WNFA 2R57A 4RW9A 4FJNA 1ZBUA 3PMIA 4OPJA 3HL8A 5J2QA 4FU6A 4Z4GA 4WE1A 1N5YA 4KHUA 4CJQA 4FJJA 2X74A 1XC9A 2X6NA 4DQRA 4C5HA 4G1QA 4Q5VA 4CEQA 4CFBA 2B5JA 1BI4B 3V1QA 2O4XB 4BDZA 4CHZA 4DQQA 2JZ2A 1S6PA 4KI6A 2RHXA 2ZD1A 4I9LA 2OZSA 4O0JA 4IFVA 1JKHA 3OQ5A 1NK6A 3PUFA 1GOCA 1WAFA 4W5NA 2RN2A 4KPYA 1KVBA 4CEOA 4DU4A 3EYZA 1U04A 4E1MA 2FBYA 2LDMA 5IAYA 4DSIA 1C0UA 1YT3A 3AVFA 4M3UA 2GFUA 4JLHA 4CJ5A 3FC3A 4B9LA 5J26A 5KTQA 3LYIA 4M3YA 1OZ2A 1D9DA 3TAPA 3KLIA 1S9EA 2B4JA 4DU3A 1S1VA 1BQNA 1KTQA 4B8CA 3LPUA 3TAFA 3S9HA 3DM2A 5FRNA 4PA1A 3SUQA 4DSKA 3S3MA 1RDAA 1NOYA 1T7PA 4CJSA 5HRRA 4AHTA 5JS1A 3T1AA 4DLGA 3DOLA 1L3SA 4B08A 3HPOA 2GV9A 4CIEA 4N4GA 1IKYA 4FJ8A 4FLVA 3TARA 4W5OA 4CF2A 3O3GA 2BDPA 2RHIA 4CK2A 3NNQA 1JLQA 3V81A 1UOCA 4KTQA 4AHUA 3KK1A 4MQ3A 3MP6A 1QHTA 2X4WA 2KFNA 3V9ZA 3DLHA 4QQDA 3AVNA 4ID1A 1SKRA 4OLAA 1HPZA 2M0OA 4CESA 2X35A 1G15A 4CHQA 3CFOA 5D6XA 3HK2A 4FK4A 3DOKA 5J39A 4DTOA 5C6SA 3FDRA 4FK0A 3WNGA 2IGIA 2XY7A 1KLMA 3NTIA 3NTHA 4PQUA 3ZSXA 3QBYA 3WNHA 1EKEA 4FCYA 2EQMA 4PL6A 2R5AA 3AA5X 3EY1A 4CJ4A 4E1NA 3T3FA 1NK4A 2O4XA 2RJDA 4DTSA 1TL3A 4KHQA 3O4NA 1NJXA 4EP5A 3CQ8A 4F8RA 1XWLA 2G8HA 5CIUA 4DMNA 4J2AA 3OA6A 2NUBA 4C8NA 1UA0A 4N5SA 4JRPA 2YNIA 3QNNA 4GY5A 2XK0A 3TI0A 2HW3A 2RHZA 2GF7A 1TK0A 3SI6A 4YNQA 1LWEA 2QKBA 4EZ6A 3C6UA 3M8PA 3SUNA 2HNZA 4N76A 5KCOA 3KLFA 4NYNA 4CJVA 3ZT4A 5KRTA 3NAEA 5KRSA 4HUEA 3VQDA 1VSFA 4HHTA 4E7KA 4Z4FA 3AVIA 1VSDA 1SKWA 2F96A 2D5RA 1RNHA 3VA3A 3SCXA 3ZT1A 3O4QA 4OPKA 3P8DA 4FJ7A 3CYMA 3B6OA 4CJFA 2DIQA 3AA4A 1RILA 4XIUA 1D9FA 4H4OA 1D5AA 4FZYA 4ZTJA 1BHLA 4B9MA 1U48A 4CF8A 3HPGA 1YVUA 1DTQA 5KE3A 4Z4EA 2PY5A 5IN1A 3I0RA 2RJEA 4Z0UA 1HNVA 1OYXA 1Q9YA 2HHQA 3RMBA 1ASUA 2WOMA 4FLTA 1B92A 4M42A 3BDLA 1XNIA 4GMJB 1RTHA 4CEFA 1TKTA 4FLUA 4FJ9A 3PMTA 3TAEA 4IDKA 3V4IA 1TGOA 3LLRA 3AVGA 4CGGA 4BD3A 3KD1E 2A1SA 1QSLA 5C42A 3HYFA 3OYEA 3CFPA 1LW0A 3AA3A 3NGIA 2XY8A 3VQCA 4LH5A 4Y1CA 4CJWA 1RTIA 4O0IA 1TK5A 1JLCA 1SL0A 4LSLA 2YRVA 3RMCA 4IUTA 4DTNA 2IDOA 2O4IA 1WSEA 4A4HA 2A1RA 3AO1A 4PUOA 1VRTA 1S5JA 1QS4A 1RI0A 3NH2A 3NFAA 5C0MA 5DK5A 1S6QA 1RT2A 3HO1A 4QQ6A 3OYBA 4I2QA 4NCAA 2B8AA 4IBNA 2QXFA 1GOBA 3P83D 1DTTA 3KLEA 4Z4HA 4FYDA 1IO2A 2KZMA 4FLXA 2P5GA 1HQUA 3KUFA 3AO3A 3MEGA 1SV5A 4ZHRA 3OYHA 3DLRA 2E6LA 3IS9A 1L3VA 4BWJA 3QEXA 3OYJA 4RG2A 3A2FA 4C5GA 4CGJA 2F8SA 3MEEA 1WNSA 1C6VA 1ZYQA 4PLIA 1WAJA 3LP1A 5HP1A 3S3OA 2L89A 1HQEA 2WONA 3E9FA 4FM2A 4M3XA 4RW4A 3OJUA 4Z4IA 1C0TA 2F5KA 1S9GA 1W9HA 1X9SA 3ZT0A 2KQ2A 1WSHA 4ELTA 3ZSVA 4OLBA 1KFDA 3TR8A 3OB9A 4C8OA 1FXXA 4OVLA 4FJLA 1VSKA 4K8XA 2EQKA 3T19A 1Y97A 3ZSWA 5SWMA 4DSEA 5SZTA 1MU2A 2EKOA 3NGZA 3LH0A 3AVLA 3D45A 2RI2A 3U3YA 2K3YA 4NYFA 3LAMA 3MEAA 2HNYA 1UA1A 3DLKA 2YV0X 1C1CA 3UWNA 2E6NA 1RBSA 4PLLA 1L3TA 3PFSA 4FJMA 1WSGA 1IG9A 4HUFA 4F4KA 3SQ2A 1IKWA 4DF8A 1RT6A 3CEYA 2EQJA 2ETJA 4F3TA 3ZEHA 4CF0A 3QETA 3TABA 1C1AA 3HT3A 3VA0A 4LH4A 4FLWA 2QKKA 3VQ8A 4E7IA 2DIGA 4CIGA 4C5IA 3HVRA 1X1PA 1CZ9A 1GOAA 2GFAA 4A4GA 2XY6A 4CGDA 3SQ1A 1TVRA 1RBVA 3KKSA 4H4MA 1OZ3A 3MEDA 2PQWA 1A5VA 4CJPA 3MXMA 3U6FA 1BQMA 1U45A 4RW8A 2G8UA 1OI1A 4CGHA 1NJYA 2XHBA 4CFCA 4BE2A 2F8TA 4DSJA 5HRNA 3S6WA 2RO0A 3AVBA 3MECA 1EXQA 2HHTA 1RT3A 5K14A 1H3ZA 3AO2A 5D3GA 1R0AA 3NH1A 3M8SA 1QSYA 1IKXA 2ZQBA 5I3UA 3QERA 1N6QA 1HYZA 1BISA 2D0BA 3VN5A 3NF8A 1RT1A 2DY4A 3TANA 3C6TA 4TSXA 1BIZA 1X9MA 3L3UA 4KTZA 3OY9A 3PX4A 2GUIA 3MP8A 4DS4A 4KB1A 3SPYA 3PX0A 1T03A 2IS3A 5CZ1A 1J9AA 1S1UA 3NCIA 3LP3A 3L2VA 1IH7A 1T8EA 3LANA 4EDUA 4ID5A 3L2RA 4B8AB 2HVHA 2RKIA 2L3RA 3V6DA 3FLGA 3AVMA 4FW2A 3OYLA 3FFIA 4I9QA 1VK0A 4CJKA 2OZMA 4KO0A 3QLHA 1HJRA 4CGFA 1Q8IA 3NF7A 1BI4A 1NKBA 3ME9A 2NLUA 4FJ5A 3I8DA 4HUGA 4CK3A 4DFPA 4IG0A 4AILC 4M3RA 1KFSA 1NK5A 3GOXA 1QSSA 4NCBA 2OPSA 4UC4A 3OS2A 4CHYA 1J54A 4L8RB 3AA2A 3QIIA 4CHNA 1SL1A 3MXIA 1SUQA 1LWFA 3AVHA 4X34A 2DAQA 1EETA 4CJTA 1FK9A 3SD4A 3LP0A 4MFBA 3H6ZA 2XRIA 1L3UA 5JS2A 4KAZA 3FEOA 3RTVA 3VQQA 3HPHA 3OYCA 3ZSYA 4J2DA 1EP4A 2VYTA 2BANA 4OGCA 3SYZA 3CG7A 1K6YA 4NZGA 3AVJA 1CXQA 4CEAA 3PX6A 2DFHA 3SV3A 2HHVA 4QOZB 3LGFA 4DWIA 2LSNA 3D0PA 4O44A 5KH6A 4N4IA 3NHGA 2PYJA 1U47A 5KE2A 3KLGA 3OYAA 4CGIA 2P51A 1SL2A 3PY8A 4KRFA 3ITHA 1TKXA 3QKJA 1NKCA 4B9NA 5FRMA 1CLQA 3QINA 4CHPA 1F21A 5D6WA 4BWMA 4F2RA 2G8WA 3IAYA 3L3VA 4KFBA 1ZBLA 2VWKA 3SPZA 3TAGA 4KB0A 2G8VA 1JL2A 2MWPA 3ZSOA 3DB3A 4F2SA 4IUQA 4CJLA 4Q0BA 4HTUA 1KCFA 2HHUA 2HHXA 5J2PA 2D0AA 4RG8A 3VQ9A 1NK7A 4LY7A 3LZJA 2OPQA 2D0CA 1SSFA 2VG6A 1I3AA 3DRPA 4W5TA 1NK0A 1RBRA 3OS0A 3C4SA 1RT4A 3HXMA 4QQGA 3OYFA 3JYTA 5CYMA 2HMIA 4DF4A 4CK1A 2QK9A 2FHDA 4CJUA 3KD5E 5T7BA 2LVMA 2JLEA 4DS5A 3V1RA 1WLJA 3DB4A 5KI6A 2HHWA 4DTUA 3H08A 4CEEA 4CCHA 4FZXC 1Z25A 4IG3A 1N27A 3AVCA 1JLGA 2KTQA 3ZCMA 4FM0A 5KCHA 4QAGA 2DFFA 1QE1A 1HYVA 4FM1A 2IOCA 2E4LA 3VQEA 4OGEA 3QESA 4BDYA 3VQPA 3UT1A 3NTKA 3Q1JA 1JLBA 3PNWC 4BE0A 4N47A 4E7LA 2D9TA 1U4BA 4PWDA 1LAVA 2KZZA 3LDSA 3RR8A 3O8VA 2G8IA 4EZ9A 3HP9A 1TKDA 2G8KA 1J53A 3BGRA 3KJVA 4M41A 1Q9XA 4DQIA 4R5PA 4FJKA 2RPIA 4E89A 3KIOA 2EX3A 4OJRA 5CY4A 1KSPA 4M3ZA 4CEZA 4KV8A 1VSMA 3LX7A 3CFRA 4K8ZA 1LAWA 3NF6A 5FDLA 4DTXA 3VQ7A 1B9DA 3SV4A 3SUOA 2BIVA 3ISNC 2X4YA 4B9XA 4B9WA 1YTUA 4JS4A 3VQ5A 4M3TA 3ASMA 1KLNA 3PO4A 1WSIA 4FZZA 4CJRA 2IAJA 1QQCA 1VSHA 1KVAA 4E7JA 3O3HA 3QNOA 3DLGA 1SKSA 2RI5A 4CJ3A 3L2QA 4DU1A 4GVMA 3F73A 2DTUA 3OYMA 4W5QA 4DSLA 4KHYA 1KRPA 4KHNA 4DG1A 4Z02A 3LWLA 1NJWA 4YFUA 1I39A 1BCOA 4Z4CA 3ZSQA 3OYDA 3K5LA 4B9UA 1REVA 3F9KA 2X78A 4IFYA 4HCBA 1YTAA 1BGXT 4CJEA 5KGXA 1JXEA 4O4GA 3NGYA 4H8KA 4LSNA 1S1XA 3ULDA 2K3XA 3K58A 3NDKA 2M16A 2YHAA 4I2PA 3K5NA 4FJHA 2G8FA 4A4FA 5C24A 3HM9A 5HLFA 1RTDA 1HMVA 3OMGA 1FKPA 3KK2A 2GBZA 2VG7A 4IUUA 1VSJA 1S1TA 3K2PA 2EFIA 2OA8A 3ASKA 3QEIA 2W42A 2E5QA 2M1HA 1WSJA 1IKVA 4OKEA 3LP2A 3THVA 3RR7A 1KVCA 1WGSA 3HSTB 4AHRA 3CM6A 3RRGA 4QVZA 3PV8A 2DFEA 2HQEA 3LGLA 4C8LA 4QCLA 3NE6A 2XY5A 4M3WA 3AV9A 1WJSA 1JXBA 4NS5A 3LPTA 2FBXA 3AVKA 1RTJA 2Z1HA 3HJFA 2Q3SA 4CEDA 1HRHA 3QIOA 2RHYA 3EZ5A 3NH0A 3VQAA 3QEVA 3RMAA 1U49A 1BL3A 3V9WA 5KGWA 3V1OA 4CHOA 2HQXA 3SNNA 4EP4A 4AHVA 3S3NA 2XO7A 4E3SA 3EAEA 2ZE2A 3ALYA 1JL1A 1RDCA 2QQSA 3KLHA 2R5MA 4L59A 4CFAA 2I5JA 3K5MA 2FBTA 3OYKA 1ZBFA 1NK9A 2PZSA 2Z1GA 5M9OA 3M8QA 3LZIA 3QJ6A 1C1BA 3RWUA 3DRRA 3ZSZA 3DLMA 4W5RA 2BE2A 3O3FA 1XI1A 1TV6A 2FBVA 2LRQA 4CFDA 4KTWA 2X6SA 4BDPA 1T05A
chains in the Genus database with same CATH superfamily
1F4KA 3MKLA 3R3LA 4JS5A 2GA1A 5EOYA 5D5WB 3A01A 1Y57A 3CO7C 3HP6A 4FJIA 2R7ZJ 3UIQA 4D5FA 1NYFA 1NG9A 3OOUA 4HLXA 4C3IJ 1X1BA 5KQ8A 3SEZA 3META 3CD6Q 5K5QA 1ZSGA 1BYMA 1VQ4T 4IPAA 1W36D 2HQHA 3LALA 3MX5A 6PAXA 3MEWA 2F9TA 2D5VA 5LGNA 3C95A 1QRYA 2CP0A 3OJSA 2BEOA 2EBIA 3K59A 2GIVA 1WX6A 2CH6A 2K5IA 4CF9A 4PY5A 2OBPA 3JB9D 3K6GA 1YQMA 1RRJA 5J1YA 1ZQ3P 1ONVA 4WCEL 4L6V5 2LG4A 1YYVA 2GX9A 1FTZA 2IIRA 5FW9A 3UR3C 2MBFA 3DPTA 4N9IA 4D8DA 2DYBA 3KZIC 2WACA 2CKKA 3QP6A 2VCPA 3WE3A 4UVBA 3IRXA 1W5SA 5B1AH 3MHXA 1X1CA 4PJOA 1ENHA 1LEAA 3HM5A 2HB5A 2BTTA 2CMPA 5FROA 3CHWA 3SQ0A 3QEPA 4HA8A 3R61A 1M90C 3LSKA 2EJ9A 3GBTA 1QU3A 3BW1A 2YX4A 1HBXG 2JGUA 3CLOA 1SVLA 3SWNC 2PYLA 2P5OA 3U1DA 4DQSA 2GCXA 2P81A 1G3SA 3H8ZA 1Z6RA 4OIRF 4M77A 5DPKA 2JRMA 2DK8A 2NUZA 5LGUA 2L2PA 3X20B 3AO5A 2W1OA 2HNDA 2GWJA 2V1NA 1H8KA 4AYBA 4Z89A 1Q86C 1DLOA 5F1RA 8ATCB 1FKOA 1O1WA 1VQ7Q 2XDPA 1G2BA 5HLTA 1XCBA 2BVLA 2ASPA 4C8QE 3JCMX 4N0AC 1TAQA 2JTFA 2Z5UA 3SWNB 4B9TA 4QPQA 2B7EA 1EJ9A 1CKAA 1NGFA 3HTVA 1I81A 4CVNE 2HXOA 2FBKA 3MKDA 4A3GJ 1BIUA 3OVNA 3ZSRA 3CETA 2LKPA 5ICFA 3HGYA 4NCGA 2LJ1A 1RBTA 4IOXA 2HF3A 1N8RR 4EJWA 2O8FB 1H9TA 3EG9A 3JSCA 2JK3A 4OKJA 5GJWB 1UELB 2RAEA 3H0IA 2KJCA 2EAYA 4J9IA 2VBWA 2ZJ2A 5EYRA 3MN2A 3CPWA 2IGOA 3Q9SA 4KITB 1Q7YC 4Y0WA 3U9GA 1O3QA 4B9VA 1MMAA 3JSMA 3CCLN 4BUGA 1N8RO 2BKDN 2W04A 3MO8A 4X66K 3X24B 2LCCA 3G10A 2ZPBB 3SUPA 3TP3A 1EX4A 2QI2A 3R60A 2IA2A 3M5AA 3F0ZA 3OIQA 2LJ0A 1TQIA 3B6AA 2Z3YA 4CF1A 3PSFA 2BHZA 1VYUA 2YKNA 1TWFJ 4H5RA 3M0QA 2X1CA 1QVGP 2E64A 1ILYA 4H5NA 4XN0A 3CP8A 1P7JA 4OAYA 4OIOF 4ELVA 4IEJA 3BF3A 1GBQA 2QKLB 1WCMJ 4I6ZA 2KT8A 3JB9I 2MOXA 1X9JA 2DMTA 2E7XA 2M8EA 2J7IA 1HSTA 1S72N 2O88A 5GADP 3CCUA 3VQ6A 2JPCA 5HRPA 2A6HF 1KQ1A 1IV6A 4DV5K 3EG2A 5LJ5g 4CYDA 4BQNA 4CCOA 3KK3A 1OYYA 3GTOJ 3INZA 2NOEA 2YKMA 1RNLA 3BWGA 3H36A 4IURA 4I6MA 2BZ8A 1RT5A 3ZMVA 4M6XA 2B6AA 1SVOA 3JRIA 4KH5A 1M1KC 4ON0A 3HRGA 3PNVA 2KBTA 3KP7A 2JUCA 4RW7A 1CZAN 3BPVA 4BJ6C 1VSIA 5AQMA 3CDLA 3ZETA 3S2HJ 1V5EA 2E3IA 1JLAA 3MAQA 2SRCA 5EZGA 4M7DF 1NKEA 2VWBA 2YUOA 3I56A 3CPWP 1BOTO 1QZ5A 2ED0A 1U9OA 1WJRA 3V9XA 2ME0A 2DA7A 4A57A 1Z7LA 3COAC 2Y0SN 1MZBA 2XAQA 1RFQA 4BRMA 5E1WA 3G6EQ 1LV5A 2XF5A 2R58A 4BNCA 4PJOD 3P5JA 1IRGA 1GCQC 1LDDA 1U2VB 4XSXF 1OLTA 1VQOA 3H9JA 3DRSA 3NF9A 4KREA 2JT1A 1K8KA 2AO9A 3MP1A 2XKOA 1VNDA 4A2AA 3SQ4A 2LNVA 4JHDB 4JRKA 4LK0F 3HRUA 2KFZA 3FXOA 5GIOA 4GRIA 3ENBA 4M78D 1YI2N 4M7DA 4UB6C 4LLLA 2AQEA 1BJZA 3JCMP 4BE1A 3QWYA 4M77D 4TVRA 2RE2A 1G5VA 1X58A 1NK8A 4KISA 3HOZJ 1HKQA 1R23A 2QWWA 3CWSA 1OH7A 3BR2A 5JMVA 3HHHA 4FU6A 4Z4GA 2K2MA 5FPNA 4KHUA 4FJJA 3VF6A 1BKBA 4XTYA 2X6NA 2WSFE 4C92G 2FU4A 2HMAA 4RCBA 4IIOA 3CCVI 3URGA 4CFBA 3M59A 2RVCA 2P9UB 5IOZA 3OH9A 2NRRA 4CHZA 2R5YB 4DQQA 2GWKA 2CW8A 2JZ2A 3TDUC 2RHXA 3JAMZ 4O0JA 1YBYA 4H0OA 1KD1C 3MDQA 5D4SA 4CZCA 3DXMB 3GLLA 2QGFB 1BM9A 1WAFA 3KXTA 2RN2A 4FWOA 4CZIA 2DETA 4FPAA 4DU4A 4BRKA 2L9SA 1LFBA 2FBYA 3EKSA 2LDMA 5BREA 2EIKH 4JI0K 4Z2YA 1UDLA 5A0GA 1NU0A 2GFUA 3AGKA 4B9LA 3K4NA 5J26A 1TW2A 2KIMA 3LYIA 1OV3A 1YCYA 4A3CJ 2CUJA 4C1NI 1SC7A 3G71T 1PD1A 1OZ2A 3L4IA 5C0YA 2MA3A 1RRSA 2CDTA 5CKEA 3KLIA 1S1VA 2HVQA 4YDUC 3HKZA 1IAWA 3S9HA 3CCEN 2K86A 2VT3A 1QHGA 4PA1A 2E34A 3R6MA 4KULA 4GCVA 2P4TA 4PJJA 3IRRA 1KYWA 3SFIA 4CJSA 5HRRA 2E1HA 3CMMA 1PWTA 3DOLA 1P7MA 2GV9A 4QPOA 1YLFA 1YIJA 3KHYA 1R0CB 1WJBA 1HA8A 4BY6C 4QS9A 2RHIA 4JJCA 4YOYA 3NNQA 1JLQA 4BY1J 1UOCA 3FX3A 4KTQA 4AHUA 3CC2I 4M73A 3WXJA 1Y96A 4MQ3A 3MP6A 2CQ7A 2L9VA 1IGUA 1MIJA 4GXOA 2VVKA 2X4WA 2KFNA 3V9ZA 4EJTA 3AVNA 3TSPA 1OU9A 1SKRA 2E2NA 2CSOA 4XU3A 3GUDA 1NLOC 5LHGA 4J6XA 2VKDA 3ZQFA 2FMYA 1G15A 3LW5E 3M1CA 1W0TA 4N4NB 1FLIA 3DOKA 2M3AA 4Q47A 3O6WA 4DTOA 3BCAA 5C6SA 3WNGA 1XMKA 1X3MA 3AHUA 3M4GA 1X69A 1VQ4A 4RAZA 3NTHA 4PQUA 3JB9J 1ZUYA 4EMKA 3ZSXA 3O9TA 4IZ9A 3WNHA 3JCMc 1WFXA 3RMSA 4EMGA 1OFCX 5B8HA 3K4MA 5JI6A 3CCJN 3CQ8A 3VETA 1WNLA 2FPFA 3FWEA 1UB9A 1NK3P 1VZ0A 1DT9A 1I5LA 2YI1A 2J5OA 3OA6A 3QPSA 2JXBA 4N5SA 4HSRA 4RB1A 2EGCA 4HX8A 2YNIA 5CJ9A 3QNNA 2HW3A 2VL8A 2YRDA 1JRIA 4IHXA 2X51A 2K4BA 3DTEA 2IVWA 3K10A 2WADA 2VWFA 2RDPA 4P9FA 3O1BA 3QG1A 4RB0A 3ENOA 1AWOA 3OV8A 2B9SA 2WB1N 4H03B 2PN6A 2E20A 1DPUA 3KLFA 2FNPA 2ZJRF 4NYNA 3IC7A 5GAN6 5KRTA 1WI3A 3F8MA 3NAEA 4WXHA 1VQPQ 2JN0A 3T69A 3OL3A 4HUEA 1KSWA 1VSFA 4HHTA 1UHWA 1GV5A 1D0XA 1LCKA 1RNHA 1PP7U 2D1XA 2IS6A 1M4ZA 2HNHA 2W85A 5IY5H 1HDPA 3VSKA 4H0VB 4C3HJ 5HOOA 1VQ9N 4FJ7A 1IW7F 4IJNA 5AQWA 2YSQA 2DIQA 1P4AA 2MH2A 3EE9A 4ZTJA 5TRDA 4DV4K 4V2FA 1B9NA 3ABUA 3FKJA 2DBKA 4CF8A 3WU1B 4MZTA 1DTQA 1W36C 2CH5A 4DR7K 1ZG3A 4M75C 4C2UA 4Z4EA 3G3ZA 5CHIA 3VERA 4G9ZA 4EEFG 4LB6B 4Z0UA 1HNVA 4U0YA 2XG8D 1AWWA 3RESA 3WG9A 1IV0A 2D1KA 4GMJB 1RTHA 2DM1A 2B86A 3FXKA 1TQPA 3FIFA 4OIQF 1OCPA 1C0WA 1KONA 2N8GA 1RKWA 2EWSA 4C9YA 1SFEA 3TDZC 1W2BM 1TGOA 3AVGA 4CGGA 3M5RA 4XKVA 2A1SA 2V1XA 3NQOA 1QSLA 3HYFA 3THYB 4M75B 1O7LA 1Q82R 1X75C 5H1SQ 4LH5A 3W2VA 3QDFA 4O0IA 2J06A 3E5UA 4DKWA 1BC8C 2KPMA 4HQMA 1HU0A 1T98A 1ETQA 3FHZA 1KU9A 3BTJA 2DK5A 4BGBA 4P9UA 4CO8A 1TTYA 1UFFA 1Q82O 4IHTA 1Z3XA 3H45C 1BW5A 4A4HA 2HPMA 3GFIA 1LPQA 2PJRB 4RUGA 3AO1A 4PUOA 1B3QA 4RDUA 2ZB9A 3PGGA 1MMDA 5M5XJ 1RI0A 4FE4A 2ZJRL 1JHHA 2LR8A 5FWBA 3E9LA 1XOVA 1Y56A 2A3SA 3HOUJ 1Y6IA 2DMUA 4LN2A 1Q95G 1X4PA 3G73A 1M3AA 3VEZA 4NNJA 3CCRT 3FIWA 4L5GA 1BU6O 4QQ6A 4I2QA 1ARKA 4JV5K 1OKRA 3WQUA 4RAYA 3P83D 3DLLF 2IBDA 3C2GA 4ISGA 3P39A 3K4BA 1U8RA 5HNFA 4LD5A 4ESJA 1IO2A 2OJ2A 4OPAA 4LIUA 3HYIA 4FLXA 3QP5A 4XSZF 5HLIA 4JJDA 3DKXA 2NOFA 4AYBN 1N25A 3AO3A 2E5LK 3HSBA 3CBPA 2UUZA 4F04B 5TISC 3DLRA 2QA4Q 3E6BA 3CCSQ 1LWYA 4ZGJB 3U4LA 4U87A 4WXDA 4HVWA 2O8EA 3VU3C 2NRTA 2NVTJ 1VYVA 4B23A 2X4JA 3CD6T 3DLAA 1WAJA 4Y33A 5HP1A 2A69F 1K8AU 2P5LC 2LP5A 4PKHA 4M3XA 5C15A 4RW4A 5EX5A 2V6EA 4UUSA 3ESWB 1QQJA 4MHGA 4JKGB 1S9GA 3JR9A 1X9SA 5EEGA 3DLLA 5EG0A 2KQ2A 2R7XA 1WSHA 2LF8A 3ZSVA 1U8BA 4OLBA 2NOIA 3I59B 4C30A 2ASMA 4C8OA 3JCMf 4OVLA 1X2MA 2EQKA 4NLCA 1SSHA 4LMYA 5LHIA 3UKUA 1RAIB 2XAHA 3LDLA 2CQNA 1XQOA 3FISA 4LLGF 2EKOA 1MU2A 2DE0X 2E1YA 5AQTA 2XGDA 4CBUA 3VKIA 4BR0A 4II3A 1OH8A 2DXCA 2E2JJ 3TTFA 1QA6A 2A0FB 1KQ2A 2XHCA 3OR2C 2NWMA 4JK1X 4BEHA 2VJIA 3MEAA 4Y13A 3CCLQ 2HNYA 3CMEI 1I94K 3F9MA 1JJ2P 3DLKA 4ISFA 4IEEA 4J01A 2YV0X 2OTJI 2E6NA 3H3ZA 4PLLA 2Y30A 3BOQA 3L1PA 4XORA 4B3XA 4KIBA 3PFSA 3U21A 4A3LJ 1WSGA 4HUFA 4F4KA 1U78A 1UJYA 1KQ0A 1RT6A 3DLLL 2VBZA 2M7AA 2EQJA 2ETJA 3G4SN 4CF0A 3CXCM 2HSEB 2HEOA 1VQ7T 1KO9A 3ZOBA 4B3RK 1S72Q 3CJBA 2CZ1B 2UV1A 5LGTA 4RA2A 2DIGA 3A01B 1IHWA 4C5IA 4Y28E 1X1PA 1CZ9A 1ZYRF 1GOAA 4XTWA 1R59O 4A4GA 1YJWN 3MZYA 2IW5A 3BTIA 3W0LA 4ZC3A 5DCFA 4CBWA 3PLAA 5IT9Z 2DI3A 2FXAA 2OPTA 4PJOC 3LH5A 5FKNA 1PVEA 4FL9A 3UKGA 3MEDA 2UYTA 1K79A 5GAMd 3MXMA 2CRGA 4LE9A 4C92E 2WFBA 2G8UA 5F0HA 3I56N 4CGHA 2L01A 1D09B 2XHBA 2K02A 5LFAA 1LMZA 3WG7H 3VESA 3BJAA 1FMKA 3E6DA 2GM4A 3JCMe 3G71A 4BR4A 4ZYGA 4C0FA 4AMCA 2RO0A 3PL8A 4M77C 3K0LA 1D1AA 2DJNA 1TTHB 3CDIA 2L54A 2NVUB 1TG0A 4XRFA 1ZR4A 1MH4A 5AT1B 3WHCA 3A8GB 2ZXIA 1IG8A 2FQ3A 3QAHA 2XU8A 2AIRB 3FXJA 3M8SA 1QSYA 1Q82C 1YJNQ 3G1OA 2LQWA 5I3UA 3QERA 3HUGA 4X0GA 2HBKA 5AQPA 2VXEA 5JICA 4OOIA 1VQKN 2ECBA 3KP2A 1JCGA 4BHPA 2LT1A 2ROLA 4GFBA 3M7GA 1ZREA 1UGQB 1R1TA 3IDHA 4ZGEB 1YJ9N 1N33K 4A69C 4DOVA 4LGWA 1KG3A 4Z88A 2Y48A 1QP2A 1YI2Q 2NOJB 3VYRB 3GMEA 4J9FA 1Y0UA 3F0CA 4W97A 2LQNA 1S1UA 3NCIA 1HNWK 3FMQA 4FM4B 3SZTA 4EDUA 3X28B 2K9LA 4JK8A 4B8AB 5DUKA 4G7HF 5BPDA 3QJYA 2L3RA 1MDMA 4P96A 1VQ5N 3AVMA 3R8EA 3RYRA 4FW2A 3ABLH 4OO1J 4XRSG 2QKMB 3H92A 3D4VA 1HJRA 1DGWY 3PIPF 4ZYAA 1BI4A 3CCQN 1J75A 1R1UA 2P9IA 2VIXA 4K42A 3CO6C 1X43A 4HUGA 3QZ5B 1MBGA 3D2FB 4DFPA 2JWTA 2BW3A 4M3RA 2CQKA 2O8CA 1Z67A 3EG9B 1A04A 1VTNC 5ICGA 3OS2A 4UC4A 1HW1A 4ENMA 1HR0K 1P92A 1KQSM 4PFOA 4MLHA 1T33A 3FDYA 2XRLA 1A6IA 2F9WA 1VQ8N 3AVHA 3KFVA 1EETA 3HBTA 5FKMA 3G6ET 5IP9J 5GPCA 2NS8A 3ECOA 4AM6A 2RPNA 1KQ8A 3BT9A 2W41A 2XUBA 4BR7A 2OI3A 1MUYA 1L3UA 2EJRA 2F5CA 4CC4B 4KAZA 2M45A 2W10A 4KFCA 4EATA 3PIPA 2I5WA 4IDHA 3O80A 4UVAA 3RTRA 4J00A 3CCEQ 2PMHA 1JKQC 3FRNA 1YHQQ 4RM3A 2LKXA 5EGOA 1L0OC 3LDOA 2OTLQ 2ROTA 1CXQA 1UHCA 4RAGA 1OCRH 1JXMA 5CKHA 4FQGA 4Y17A 1XGOA 4GKKK 1MGQA 2XASA 2PMZN 2JA8J 4QOZB 5AQRA 1PUEE 3NFCA 1UTIA 4V19K 5LJ5d 2CP5A 3FB9A 2PI0A 4IQ4A 4IQJA 1U47A 1DU0A 1SL2A 2F48A 3PY8A 3ITHA 4JZ4A 2QEXN 2EV5A 2K79A 2OA4A 5FRMA 1VIFA 5DD4A 5B3SH 2KHMA 1W97L 2H1KA 3QOEA 5FLVA 2MD5A 3HOXJ 4RTFD 4LFCK 3EO3A 3I55Q 1QVTA 2QM1A 2EINH 3L3VA 2O31A 4KFBA 3ZETB 5BRFA 3BR6A 3VV0A 3PIPL 2WV1A 1O7FA 3SPZA 3MKZA 1R49A 2FXUA 2XKOC 2MWPA 4LDYA 1X2NA 4FVUA 3DWLA 4XKBA 3ASNH 3KEYA 2HL3A 4HTUA 3CMAQ 1KCFA 4M7DC 3GFMA 2COMA 2F4IA 2P7VB 1K73R 4NHJA 4EMHA 2W57A 1FBSA 3DRPA 4L9JA 1NK0A 3ULRB 1MUNA 4BYYA 3KP3A 4BRHA 2HHHK 4M3GA 4EJUA 1Y8QB 5CYMA 2O8DA 4KRTA 4XLEA 1IBLK 2ICWG 3M0PA 4DF4A 2GLOA 1VQ6T 4CK1A 2QK9A 4GNIA 4IVNA 4NL2A 4FETA 1K8KB 4J7IA 3KEOA 1K73O 2DQLA 2XIDA 5F0FA 3V1RA 1TYQA 4HOBA 1WLJA 5KI6A 3D2EA 1R4MB 1LWWA 4CEEA 4CC3A 4CCHA 2OCCH 3KEQA 4M7DB 1N34K 3L2ZA 1MJBA 5DM6L 3CCRA 4ZDOA 3AVCA 2E5KA 1JLGA 1IBMK 4M7AA 3GNGA 3ZCMA 5KCHA 3TW7A 4RS8A 5BRDA 2DFFA 1RR8C 2O0YA 3VQEA 3QESA 4OP0A 3VQPA 5E20A 4RBOA 2XHIA 1YITT 2JUGA 1VQ9Q 3M56A 2EZLA 2HDAA 2QBYB 3DCFA 4BY9C 1JLBA 5M5WJ 3T8TA 5HK0A 5GAOn 5CKFA 1G4DA 3GG4A 4MO4A 3ZXSA 4E7LA 2HBMA 1X19A 1WIEA 4Y4RA 3S1RJ 3H9GA 1X1DA 2KZZA 3RR8A 3QQAA 4EJOA 1HK9A 1VQPI 1JGSA 4EZ9A 4DQ8A 4BG8A 1TKDA 1J53A 3P31A 4YTLA 3CD6A 3DKMA 5GAMh 5I2SA 3LMMA 4LOCA 1PNJA 1PVSA 2M4GA 2NS0A 3KIOA 4JYKA 2ZWHA 2EX3A 4WXCA 3AARA 3ZLJA 3RKYA 1M1FA 3EL2A 2ZGWA 3BEXA 3QPTA 5DUIA 1IV8A 4I2OA 3P4IA 2KMUA 2X3WD 5E8IA 4XK4A 2EYYA 1R4NB 4FWMA 2MC3A 2DXUA 4B9WA 1W0UA 3CF5L 1YTUA 2NRHA 3F21A 1BW6A 3DBRB 4MTEA 1KLNA 3PO4A 1WOQA 3GX4X 1MPGA 2BHYA 1QVFP 5GIPA 1GLJO 1HDDC 1QQCA 1BO5O 4E7JA 2CJJA 1IRFA 2RQTA 2JUFA 2RI5A 2F5DA 4CJ3A 3JRBA 4MMKA 4C8QA 3LL3A 4DU1A 1JB0E 4DSLA 3NGPA 1KRPA 3M9AA 2DKGA 2LT4A 1AZGB 1GV2A 4IO9F 4C1NK 3SAGA 3QFUA 3LWLA 2FF3B 1T0HA 2IS4A 4B47A 3ZSQA 4ETSA 2A6AA 3TSZA 5IYCJ 2DBMA 3IL2A 1HYOA 3K5LA 4B9UA 4JD2A 1JXEA 4EMKC 2H09A 5GAEP 2FSNA 4LFUA 4UNFA 2F7TA 1SF9A 3TEEA 2P9SA 1XD7A 2ZXHA 2E2QA 4DHYA 4DUZK 3PO2J 2MH9A 3ULDA 3AKZA 1VQ7A 2YRCA 4J9GA 4QS8A 1TW3A 4FJHA 3F6OA 2QM3A 3SBTA 3GL1A 4A4FA 4FX4A 4AI4A 3HM9A 1XG7A 1UGSB 4IHVA 4HV5A 5EEAA 3HOWJ 2XHKA 3VGKA 2O8XA 2VG7A 2VV5A 3MPUB 2QXLA 2IA0A 4IUUA 1ZAOA 1VSJA 1S1TA 3K2PA 3W3DA 5FD6A 2EFIA 3ASKA 1HNZK 1IKVA 3K4KA 4EMKB 3LP2A 3THVA 3MWMA 3RR7A 5I9EB 1ETYA 1O57A 3OW2M 3HSTB 4AM3A 4AHRA 3CM6A 4QVZA 4YIFA 5FLMJ 2HQEA 2VC8A 1R5HA 1ZH5A 4U7BA 2XY5A 2HQAA 3AV9A 2VJJA 3QYEA 4CZZA 4E6KG 2DRKA 3ER0A 3THXA 4XH5A 3WODF 3CCSI 2M0MA 5CCAA 1ABQA 1H0MA 4CXFA 2KP6A 1IZ1A 2ELHA 1VQNQ 3H0DA 3JREA 2H3EB 1HD3A 1NGDA 3EZ5A 2R0QC 4YOTA 4LDXA 1YUWA 4XMYA 2YUPA 2UUBK 1BL3A 4XU0A 5KGWA 2A61A 3VODA 2ZBKA 2Z0WA 1Z7UA 1SANA 1VF9A 3RDIA 2DL3A 4KN4X 2HQXA 3K2AA 4CC7A 4M7AD 3S3NA 2VKEA 2A07F 5LJ5h 5F04A 4ZGDB 1QKXA 4QVDA 4E3SA 1HLVA 2ZMEB 3CC4I 4BUPA 2PJPA 3ALYA 1NBWA 4XBFA 5CVUA 1OX9A 2LNHB 2O01E 1A36A 3UPUA 4HT9A 1K4SA 1ZBFA 3H3OB 2BZYA 3QODA 2Z1GA 3M8QA 3JXUA 1IO6A 3WXMB 2PTKA 4LDWA 2QA4T 3O3FA 4HYEA 1TV6A 2KIQA 2FBVA 2L3QA 1XMXA 4XU2A 3E6MA 4HQEA 3G4SQ 1WPKA 2X6SA 4A4KA 2FZGB 4BDPA 4KUMA 1T05A 3ELKA 2QENA 3ZQHA 1D8KA 2FEIA 2L0AA 3VEYA 1SQKA 2ATQA 1WJEA 1SD7A 3JW4A 2D1HA 3V9SA 3M1FA 3I0SA 5L3GA 4O6JA 3JRDA 1OKJA 3EH1A 2PVDB 2YHYA 4BS9A 3JRFA 1YJWQ 2DMNA 4HSTA 1WH5A 3E1YA 4A3KJ 2ELKA 3W2AA 5HRSA 4D9JA 2YHBA 1ASWA 4KICA 3G6EA 2KKOA 4I76A 1H3HA 4Y3OA 3GFLA 4CRIA 1WPYA 4CEBA 3DMJA 4II2A 5J2MA 2OPRA 4G7OF 4MEXF 1WHHA 4B1VA 4RTUA 3VYUB 4MZPA 2K57A 5CYQA 4YOXA 4O3MA 4M75G 4HWIA 4XRMA 5CQYA 1K8AC 4JJBA 1LB2A 3CCLT 2ITGA 4LXCA 1LEBA 5CLSA 4AIAA 3JB9G 3C6AA 2WSCE 3LSIA 3Q5FA 3MKWB 1O3SA 3RRHA 2AHJB 5AQLA 4X9DA 3HI0A 2OPPA 3VFZA 4M7XA 2H56A 5GPAA 3SJMA 1IDYA 1BDGA 2DOFA 1J5OA 3TBIA 2CV1A 4HF1A 2DT5A 5BS6A 4V2SA 5D5VB 5B1BH 1A0NB 2CGJA 2IC3A 2EIMH 2D0PA 5HROA 1R5ID 2JW4A 5F1XA 2PBIA 1V4RA 3WNEA 1XB4A 4N56A 4Y1DA 4ZTFA 1OULA 3ULEA 3B6PA 5AQSA 2WUSA 1XC5A 2K9SA 3UDCA 4DOWA 4AH9A 1S72T 5E3LA 1MGTA 3TVTA 3TAQA 3GFJA 2NNWA 1YVNA 2EBPA 5KN9A 4FVMA 4UV9A 5AQOA 1A35A 2DT7B 3TU4K 2H27A 4N4HA 2MMPA 1J5YA 3K4JA 3KLNA 4B9SA 3G0ZA 2H8HA 1JCEA 3OSGA 1RBUA 1K4US 4DYRA 3H5NA 5EG0B 3CJ1A 2NNYA 1EWRA 2Y1JA 4MMLA 5BN9A 4G94A 3CUQA 2P0KA 4M9XA 5CVJA 1D0ZA 3B02A 3OS1A 1PCXA 4BJ5C 4DQ2A 4C5EA 3I8BA 5DD8A 2XPVA 2KT1A 3MXJA 2FBHA 1A5WA 5IXBA 1LWCA 3UKUB 3H5RA 1M3CA 2W03A 3CC2N 2HBPA 1LVAA 4LD6A 3K5OA 1IUYA 2K2VA 2RC4A 5J1RA 3LWIA 2KQRA 3IUOA 5JLWA 2I8DA 3H3NO 1K9MU 2A3LA 5E41A 3SJHA 3FM3A 4MDXA 1RDBA 3TW6A 1PU7A 4FLZA 3I0XA 1ON1A 2R7YA 3A0BC 1YJNT 2C6YA 1S9HA 1EA3A 4XLNF 5GMKe 5FKLA 4DFJA 2KYBA 2LP0A 4BEHB 4J2BA 5D7UA 3M3YJ 1Q81R 2HKOA 5AR0A 1PYVA 4BC5A 5CQXA 2OAZA 4A3BJ 4CD3A 4X1EA 5FU7C 3EN9A 4DV3K 1G83A 1UJ8A 2KRHA 3SDBA 4KHSA 1BU1A 4PFZA 2VG5A 1QVUA 1KQJA 4PDKA 1YITA 1Q81O 3KCCA 4BC2A 3EGUA 1YI2T 1ZBIA 4U67L 2RHUA 2FVUA 2DXIA 1JLEA 4CE9A 3SXYA 1FNNA 3GTQJ 1LW2A 4LUEA 3DLBA 3PIOF 4I01A 1SD4A 5BNGA 4M4ZA 3FKIJ 3SHFA 1M3BA 2KIUA 3M55A 4N41A 1ZTRA 3QFPA 3RMDA 4BC4A 4B1RA 5IHKA 3QEWA 2BGGA 5C25A 1JKOC 3C94A 1NOZA 2DJQA 4MLOA 2MWOA 4S05A 4LUDA 5GAN4 3E9GA 4YEJA 5KPZA 1OMIA 3F22A 2ZGZA 1KG7A 3L2CA 1MNDA 3A0HC 3CCMI 1XMAA 2STWA 2RF2A 2QEXQ 3H1QA 1D8YA 3KNTA 5M5YJ 3OYGA 4FK2A 4U88A 3F8BA 3V9UA 4HSBA 1I50J 2ZXWH 4FPBA 3ZX3A 5TKYA 3E01A 1QZZA 1LJOA 5FGMA 3LCNA 5EF6A 3QDRB 4AU7A 2K40A 3WGIA 5GMKj 4X62K 4WQ4A 1D1BA 2JRTA 3WHBA 2GQIA 4KHWA 2O8FA 2F2WA 2RJFA 1TK8A 2AKKA 2QDYB 4MDWA 1N75A 3SK3A 1ITYA 3P8HA 1MUZA 3FR0A 4JKHA 2RI3A 2SEMA 3SAHA 4AHCA 2V9KA 2A3ZA 4OKKA 3HUGB 4HCCA 1OEBA 2OYQA 4FE7A 5BPNA 3VOEA 3HFOA 3KKRA 2DA3A 3CCET 2DPUA 4IUVA 1WZ2A 1YHQT 4E0DA 3L6QA 2OTLT 3KZYA 4G6TB 2FUG2 2Q1ZB 3CCRN 1Z26A 2GOXB 2LZ6B 1WHMA 3LAKA 1WBBA 2HZDA 3IG1A 3DI6A 2NOBA 2QQAA 2P1JA 3K9JA 4YOUA 4DV2K 1NE8A 1K0SA 4PJOG 2DODA 2RM4A 2NVXJ 1KAYA 3VGLA 2BE5F 3WNFA 2IEKA 2MCNA 3ZX0A 4RW9A 4FJNA 4RKUE 1TWHJ 3PMIA 3FLCO 2C0OA 3HL8A 4C0GA 2ZPEB 1OYIA 1MDMB 3PIOL 1WI9A 2VE8A 4RTZA 3EYYA 1XPXA 9ANTA 1VQLI 4C5HA 3W6VA 4Y52J 3OYYA 4M78G 4G1QA 4Q5VA 2DU9A 1BI4B 3L1AA 2P9IB 1Q7YU 3I55T 4M77G 4A61A 3KK7A 2M9HA 2O4XB 2CT4A 4BDZA 1NGCA 5CHZA 3PJRA 1QVGM 1T6SA 1UG2A 4RTXA 2L7MP 2OZSA 2DYRH 3MCPA 2D0OA 4C2TA 2O8CB 4K41A 4JJNK 3CMAT 3O3KA 2HBLA 1S7AA 5F27A 4I7HA 2E88A 3FE1A 3EYZA 3MCZA 2CQQA 2DDAA 3I35A 4M72A 2J6FA 3NARA 3EH2A 4G6QA 1Z77A 3CCJT 3IHUA 2HDCA 4YY3K 4UVCA 2WBNA 1EF4A 3OMYA 4D5CA 1WRJA 3ZGKA 5LLQA 1Z91A 3RSEA 4M3YA 1J09A 2ME6A 2LDUA 2NVYJ 2HVRA 3JSOA 1D9DA 2O9VA 3E2UA 2E2OA 2DJZA 1RDUA 2IGKA 3PQKA 3CERA 5FRNA 1Q1VA 2D4WA 3CBOA 3SUQA 4DNCA 2ESNA 3EFRA 5EGOB 1M1KU 1NOYA 2E10A 1QBJA 1U2VA 4AHTA 1M3HA 3I53A 2JVVA 5E79C 2KGTA 4DLGA 4X6AJ 3HPOA 2FL7A 4N4GA 3D0SA 3TARA 2KRMA 2WBMA 4JHDA 3CPWM 5D6FA 1U0JA 1VQ9T 4CK2A 5GAN3 1RAAB 2KFDA 3G1MA 2VXZA 2JJ9A 4KHPK 1GLBG 3KK1A 2QA4A 1Q81C 1VQ7N 3FHFA 1ORKA 5IP7J 1YIOA 2QQ9A 2IRFG 4ELZC 3CWUA 3E7LA 2M0OA 2EKHA 2FG0A 2X35A 1X6OA 1AOYA 4WFBL 4KN7X 2DLPA 1JKPC 4FK4A 1GXQA 2VJ4A 1IREB 3J7AF 1KAXA 3D1NI 1X01A 1BWFO 3HG9A 4PIIA 2XY7A 1IUFA 5F0CA 1X27A 4NBQA 1G6NA 5C3EJ 3KP4A 5HS7A 3QBYA 1YO5C 4EHTA 3AA5X 1NK4A 2CFXA 4DTSA 2R5YA 4KHQA 2HSPA 4EP5A 3R4KA 4C92F 2K5FA 4M7AC 5GAGJ 4C8NA 1DJ7B 1MNEA 4CCNA 1HSQA 3I64A 3GLXA 1BIBA 4CGZA 1GLLO 4A3DJ 3HTSB 2QSGX 1SKUB 5BN8A 3JCMW 3GYHX 1FJLA 4AD9A 2DO3A 2HNIA 2GF7A 4EGZA 3O5BA 1WHLA 5AQNA 1XSDA 1TYQB 2JMWA 3C6UA 4LFBK 4A53A 2FE3A 3D2EB 3CCLA 3EHQA 2D1VA 4J9DA 2GWRA 5GAHP 4CJVA 1NGAA 4IHYA 3ZT4A 5KRSA 3IP4B 3ZMTA 1ZN2A 1W7AA 3HB9A 2ZKZA 1XGNA 4K2EA 1P2FA 2KL4A 1SKWA 3JAME 2D5RA 3C12A 3VA3A 3ZT1A 4NUBA 4D1QA 3S15J 4C92A 4G6DA 3EUHA 4HAMA 3CYMA 4CJFA 3V7CA 1ZGJA 1D9FA 4FZYA 1JU5C 4LDUA 3JRCA 1VQ6I 1CQTA 3NMUA 1K0XA 2J5PA 4PKCC 1R8OB 3OW2A 1S72A 4BI8B 4IL6C 1S5LC 5KE3A 2RH2A 8AT1B 3MCAB 3REOA 5KYXA 1RIOH 4DOZA 3I0RA 1ESVA 4KUDK 3KFWX 2E7WA 4JKFA 1P6RA 4FYVB 3FJPA 1NNEA 4C8QC 1R36A 2BZTA 3MZHA 1JT6A 3ML6A 4DV7K 2QWMA 1N3CA 4FJ9A 3PMTA 2K5LA 2A28A 2OFKA 2X1DA 4PSWA 4J83A 3V4IA 4XNFA 4NOYA 2VXDA 4BD3A 3IWZA 1N8RU 2LFBA 4XQFA 4OFAA 5D4RA 2AZSA 1H1VA 1LW0A 2RNGA 4J9BA 3NGIA 4WQ5A 3OWTA 5GMKi 3CMYA 2ELJA 3TTCA 3T1HK 1XDSA 2BOLA 4XTZA 1JLCA 1I6XA 4E2FB 2FOWA 4LSLA 2YRVA 1U6ZA 3C0CA 1JTYA 2UZKA 5K1YA 4C8QB 2CG4A 4UV8A 1VQNT 1N36K 2CZ0B 4F55A 3J7AP 2JTVA 2Y0SA 4RGXA 1BUPA 4DTNA 5ILVA 2JA6J 2NS7A 1WSEA 2L3DA 3GWZA 1YJNA 2Q31A 5HKCA 2CREA 4BRNA 5DLQE 1TS9A 1PSEA 2D2WA 1VRTA 2HXIA 1BOAA 2Z9OA 1S5JA 3TKYA 3TGNA 1LPLA 1T6DA 2ZFWA 5JVTA 3UATA 4CSWA 1YF5L 4JD2B 2BE9B 3NH2A 1N6AA 1MD0A 2A08A 4A3MJ 2KJBA 1BG3A 2P9SB 3CCVQ 2HOAA 5C0MA 4KNYA 5DTDA 1XQPA 1YI2A 1S6QA 4LF4K 2Y75A 3ZEUA 3OYBA 3K70C 1FWZA 1X3UA 3ZBDA 3F8FA 3V8LA 4NXMK 1WEGA 5DY9A 4F16A 3RUXA 4FYDA 1X3NA 3KYLA 4NC8A 3DJCA 2KZMA 3QYHB 5JVGF 4A5NA 1YQLA 5LMNK 2P5GA 1M9SA 3KUFA 1MDUB 3IMXA 1SV5A 4ZHRA 3OYHA 3G4ST 2LY1A 2G0EA 2E6LA 1HNXK 1YW8A 1K7AA 2DL5A 3BG9A 4FTHA 3QEXA 4DEXA 4C5GA 5L23A 5KHDA 4FT2A 1ZYQA 4PLIA 3LP1A 2XVCA 1G3YA 1FEXA 4H0XB 3S3OA 2E1MB 1YJWT 2W6KA 5BQTA 3E9FA 3G1LA 2FF6A 3OJUA 4BL0B 3VPZA 2QGUA 3ZMDA 3KWIA 4BRQA 1EZZB 3DU6A 4IF4A 4OX9K 1W5CC 2F5KA 1KYZA 3OH6A 4LG0A 4ZYHA 5AZIB 3E97A 3KPHA 1FYLA 2EGEA 5BMZA 1H641 2ZC2A 4XM3A 1KFDA 3TR8A 2P9KA 4WWCA 4R56A 4JQFA 3SDGA 4HRIA 2CH4A 3LM9A 2CZ6B 1VSKA 4L5IA 5FPEA 3VWBA 4PL7A 2AZVA 3S2DJ 3ZSWA 4DUYK 3O9SA 5J3LA 2Y90A 2ACJA 4BRGA 2H6BA 3LH0A 5J8CA 3J80Z 3D45A 1CSKA 3CC2Q 2DTIA 1B34A 3JB9H 1NYGA 2E70A 2PFBA 3GW2A 3VYGA 3U3YA 3CCEA 1Y0NA 3K1MA 3KYCB 5IYDJ 3J7YJ 1YHQA 3BLYA 2GXGA 1BJAA 1YTYA 2OTLA 2PJRA 4ZYEA 2WC9A 3BG3A 1KFZA 4ZYDA 1JO8A 4FWKA 2VXFA 3D5RC 1A31A 2JVHA 1JI8A 2JT4A 5D5XB 1HJDA 2AQFA 2M51A 2ITMA 2P4WA 1VQKT 3E66A 4BKXA 4XTVA 1YJ9T 1VUBA 4JLGA 4B1YB 1I0CA 2R93J 4F3TA 3LDPA 3SZGA 2RHKA 3I4NJ 3QETA 1VQMI 1OISA 1UUEA 2J6KA 3AG4H 1KC8R 3TO9A 4P55A 4PCQA 5JVGL 1C1AA 3HT3A 3VA0A 3VEXA 3VQ8A 2RQUA 1TC3C 1RACB 4PHTX 5LMUK 2NAZA 4E7IA 3I55A 1OPKA 4CIGA 4B8XA 3QBXA 2L2OA 3N4PA 1ZARA 2GFAA 4GO1A 5KNLA 3WU2C 2XY6A 4EIAA 4PJOE 1VQ5T 3SQ1A 1KC8O 3HRMA 3QYFA 2A68F 2VQCA 1JHFA 3MD2A 4CW7B 3CVSA 2EQRA 4F7UG 3CMAA 2XICA 1RBVA 2LD5A 3KKSA 3CCQT 1NKUA 2DOEA 2HTJA 4OFHA 3U6FA 2FRWA 2E1NA 3A4CA 3CCJA 1R0BG 1Z21A 4M78E 1NJYA 5M1PA 4M77E 2JA7J 2F8TA 1MUDA 1FSEA 5HRNA 1W4SA 2LYCA 2UU9K 3S6WA 2ZPFB 2VQHA 1EXQA 1VQ8T 2MLKA 3W2WA 2FF4A 2LNBA 4UXNA 3AO2A 1VQPN 1QO0D 3LWHA 4B1ZA 4CZJA 2DPDA 2WB1A 1ZHFA 2VKNA 3NH1A 2KNBB 4XN3A 3FZFA 4JI8K 2DA2A 2RK1A 3H41A 5E17F 1NG7A 2CFOA 1HJOA 4BRPA 1E4FT 3ENHA 2V8IA 2KMTA 3X25B 3WU0A 4AQYK 3FZKA 3CC7I 3I4PA 3AL0B 3NF8A 2FPEA 1RT1A 4F3QA 2DTHA 2RQPA 3ZCOA 1VQ9A 4HV6A 3ABKH 4TSXA 1BIZA 1X9MA 2EYWA 1YAGA 3HTUA 3IAM2 4CA0A 3CUQC 1KA8A 2STTA 3RYPA 3OY9A 3J81Z 3MP8A 3SPYA 4E7ZA 2M87A 2Z33A 3GPLA 2FSKA 5CZ1A 1TUYA 5LJ3g 2LX9A 2HOSA 3LP3A 1J3TA 1GFCA 4WFNL 3GXOA 1TH7A 3ZP5A 2AXLA 3FLGA 4ZJZA 1X2KA 3OYLA 4I9QA 2YXYA 1VK0A 2NYXA 5K7ZA 1X3WB 3FZHA 1IRXA 2OZMA 3HKSA 4BI4A 1Q8IA 2QEXT 3BF1A 2ABLA 1JJ2M 4A3FJ 5GP9A 2RV8A 4BG9A 3CUQB 3K1NA 4BVPA 4FJ5A 2CV0A 1P90A 1G3WA 3NWSA 1PC0A 3LFUA 1WH7A 1H88C 1QHHD 1KFSA 1NK5A 2HEQA 4ENJA 4NCBA 2VQGA 4M75D 1NGNA 1J54A 4L8RB 3AA2A 3IHOA 3QIIA 5CAIA 4YPHA 2R7OA 1YCSB 1M8MA 3R0JA 4ZN3A 5GAMg 1J5EK 1JQQA 1YOVB 2YU3A 4CJTA 5KYUA 4ATOA 1FK9A 3LP0A 4MFBA 3HOYJ 1PKTA 3MKYB 2R92J 3K69A 3LM2A 4XQ3A 1FYMA 2IGMA 2QVOA 1TSFA 5F64A 1EWQA 3PM1A 2CO5A 2ATCB 1GDTA 4Y91A 2E5ZA 3VUZA 4RLFA 2P0PA 2YR2A 3HPHA 4KT5C 3OYCA 2YJEA 1VQOQ 3JSPA 1RGIA 5EJCA 5EEHA 1VRLA 2VYTA 2GTOA 4OGCA 3CG7A 4Z6YA 4YHHK 4E6RA 2V51B 4OMQA 3T8RA 1LDKB 2ZPIB 4ZDLA 3BR5A 4RTWA 3PX6A 4KH0B 3TQNA 5M1KA 3KYDB 1QVGA 4K11A 2W84A 2V9VA 1EO1A 2LSNA 4O44A 4R1HA 3TQ7P 2QA4N 3CCSN 1C0FA 3NHGA 3AG1H 3ERMA 1NGBA 3KLGA 4WQ4C 4A59A 4O8KA 3E6CC 2HU9A 3J7AO 2IGNA 3QKJA 2YSRA 3AFHA 3OGDA 2CH0A 1NKCA 3I54A 3FGUA 3NPFA 3QINA 4CHPA 2ZNYA 2R7TA 5D6WA 4MDBA 1TWGJ 1S29A 4BWMA 2ZM6K 2G8WA 4M3BA 2GGRA 4L9VA 2DTRA 1ZBLA 2NRVA 3FMSA 1Q82U 2ASOA 3G0QA 4KB0A 1JL2A 1B8IA 3ZSOA 2JPBA 3QO3A 1KC8C 4XLHA 1MWKA 4Q0BA 4CJLA 4KGZB 4I0AA 2FOKA 3ZX2A 1GRIA 2HHUA 5J2PA 2GBQA 2IJLA 3CMEQ 3D2FA 1R7JA 5DEQA 4RG8A 1NK7A 3VRZA 1VQNA 2OQRA 1RUNA 3LZJA 1HF0A 5J6XA 4QWQA 2VG6A 2OTJQ 3ZYYX 4FHTA 1TWAJ 4ESRA 3C4SA 5AZJA 2HVSA 1BR4A 5HDGA 1XUPO 2P5VA 3A5OC 3E5XA 3J7ZI 2ZFUA 4AC0A 1FTTA 4CJUA 5T7BA 2UXCK 4CUGA 2DJIA 2JLEA 4DS5A 3PT9A 1NGJA 3DB4A 4KGXB 4XLAA 4OWRB 4DTUA 2M0YA 3H08A 5FLXZ 4P1WA 3S1QJ 3I9QA 4CI0C 1WA7A 1GVDA 2Z2SB 1PHTA 5DLOA 4H0EA 5H2FC 4FM1A 1ATSA 2QCOA 1YIJQ 1X1AA 1RKTA 4CBXA 3Q3SA 4M74A 1T3SA 2NOZA 4DJAA 3Q1JA 2G7UA 2VE9A 3NAUA 4MNUA 3PNWC 1R71A 4BE0A 1JUSA 3Q0VA 4TV7A 3G4SA 2L7KA 2YUSA 4XLPF 5ILUA 2D8HA 1LAVA 5CR4A 4V2GA 2CP6A 2CGKA 1R6RA 1W4MA 1R58A 3VPRA 3QWXX 1LE8B 1EQYA 2GELA 1Q9XA 1FT9A 4DQIA 1N9RA 2RPIA 1LNWA 1YJWA 4JI1K 4OJRA 4M3ZA 3QYBA 4Z94A 2HKXA 3GOIA 2IS2A 4J5YA 4NQWB 3OBWA 3X26B 4KV8A 1OX8A 2GEMA 1GLAG 2YDLA 4CYCB 2GXAA 4YG2F 1MWMA 3VQ7A 1D3YA 2W0ZA 5GAOl 2OANA 4EJVA 2E41A 3ISNC 4LJZF 2X4YA 2HZYA 4JS4A 1GVJA 4XKWA 2IAIA 3ASMA 2E1ZA 1ERDA 1WSIA 1FOYA 4JZ3A 3JS6A 4KBMB 1BI0A 3RSEB 5KAIC 1PP8F 4A0ZA 3A5ZB 5AQUA 3ZQGA 1VSHA 1KVAA 3O3HA 5D8KB 1RZ4A 1NGHA 1SKSA 2O9SA 2LCSA 3L2QA 4NB4A 2CUZA 4GVMA 2HMPA 2EPDA 1QQOA 1X3ZB 1WI7A 1YJNN 3E9PA 1WJCA 4DG1A 3HHTB 2PAVA 4M6VA 4YFUA 5JLFA 2JTMA 1BCOA 1QMCA 5EY4A 4Z4CA 2PEXA 1MKMA 1W2BS 2VLAA 3G25A 1REVA 3F9KA 3WTXC 4GV3A 4HCBA 1YTAA 3VRYA 2XSDC 4CJEA 1W6XA 3GZ5A 1IN6A 2MC4A 1ZG1A 1VQKA 1XQSC 4B44A 3M8EA 4OMFB 2LJ3A 1GLEG 2ZGYA 4CICA 2EWNA 3A5MC 1YJ9A 2P6SA 5HLGA 3IKMA 1R1VA 3UA6A 2E2IJ 3JRGA 2LQ8A 3I33A 3SLCA 1IHVA 3K58A 2M16A 1TUCA 4IRHA 2XDVA 2UWMA 3NVMA 4QKUA 2EA2A 2JM9A 1HMVA 3OMGA 1FKPA 3GTGJ 2QBYA 4ILGB 2GBZA 1S1NA 2EYZA 2R3SA 4CZKA 4B3MK 1BI2A 1ZBJA 2O61A 2AHQA 1VQ5A 2MK5A 2PMUA 2GOMA 3QEIA 4XL9A 1M1EB 1GLNA 2ZPGB 5GANg 4XH4A 5J1UA 1FOWA 4J7FA 3CCQA 1SZ2A 1WGSA 1NTCA 4E9HA 3DPUA 1VI0A 2OC6A 1S6LA 5LD2C 3SMSA 4ZN1A 4CZLA 1LVKA 5GTHC 4C92C 5F0XA 3EUHC 4OAZA 3ULQB 2FBXA 3CPEA 3FBIB 5IPAA 5GAN5 2VJ5A 1ETVA 1BOBA 4U0WA 3A03A 5HODA 2HYJA 1NMNA 1VQ8A 1UE9A 4BQQA 4JI5K 4CEDA 1HRHA 3WGHA 4F7UE 1W7PA 1MBFA 3NRVA 2ENMA 3CW7A 3AAQA 3ABTA 4Y15A 2VOOA 3N4MA 1FMVA 4HXJA 1FBQA 4CHOA 2GBYA 3NVKA 3W6KB 3CP2A 3BPXA 2CYYA 3SNNA 1YHQN 1RPWA 4EP4A 3EHRA 4C92B 1U5TA 3CCVT 2DA4A 5HY6A 1WQ2A 2OTLN 2EFQA 3F8CA 1N8RC 1G59A 2XO7A 2F1LA 2G9WA 2R4GA 1B72A 2BYVE 2EH3A 1MV3A 5J8FA 2BZXA 4OB0B 1ZLKA 1WJDA 5GTIC 4IEIA 3KLHA 2HI3A 2I5JA 1QVFM 4FWLA 1MJAA 3Q0UA 1Z05A 2PMZA 2FBTA 3OYKA 1YWOA 5KYXB 3MN7A 1IN8A 3AY9A 4WQ5C 3D5SC 1RLQC 1C1BA 3RWUA 3I71A 2P9LA 3DLMA 1XX5A 1LQ1A 2BE2A 3J80K 2X9HA 2ZXJA 4M7AG 2VONA 2Y4YA 2OAWA 1Z9QA 2LRQA 1M5Q1 4CI6A 4CD1A 1K1ZA 3RI4A 3ZMUA 3I55N 1FIAA 1JBMA 2QEXA 3WE2A 5GAMf 1FOXA 4Y7NJ 4A5MA 3IRQA 1TLHB 1OH5A 3SZPA 2WTEA 3MFKA 4B21A 1P8ZA 2LTOA 4IUPA 1V4SA 4DTMA 4B3OA 2R5ZA 3CMAN 2R7DA 2K3FA 4AWXB 5E18F 4QW2A 3U9ZA 1HXDA 1WVRA 4EM2A 2DZ9A 4DYCA 3HGGA 1VHXA 2OUMA 4MQ9F 3VQBA 3QIPA 3EG0A 2Z1IA 1I27A 2O3FA 1WB9A 5ICEA 3CXCS 3SZ2A 2Z1JA 3DLEA 4KBOA 3F3XA 3VTIA 2Y9YA 1SRMA 3OYNA 5ECAA 4YORA 3HOTA 2ZAEA 3CC2T 4CHUA 1DQUA 2F5TX 1YN8A 3DYAA 5E84A 3QB0A 1ATRA 1WFWA 4DTJA 1XG1A 3L0QA 4B9QA 4GYIA 3V42A 4OB3B 1LWVA 3P1GA 3CQXA 3VS3A 3DU5A 3CJAA 2JSCA 2A41A 1I4K1 2NRWA 1O4XA 3ZT2A 4DTPA 3S1NJ 4MLEA 4LF5K 4C8QG 2MFZA 4HKEA 4M7DD 3NEUA 3ZEUB 2DX1A 4NC6A 1D1CA 2Z16A 2VT2A 3VF2A 3C7NB 2QWRA 1QWEA 3OMCA 2FZKB 1FN7A 2AJQA 5BR9A 2CW7A 3MEVA 1Z9CA 2ZMEA 2DFIA 3NBPA 1TT0A 1CF7A 3OS5A 1WSUA 4B3SK 4AG2C 2QWQA 3BUZB 3A02A 1W70A 1FBUA 2Y1IA 1STZA 3BG6A 1YE9A 2CYZB 1UGVA 1QLYA 4OVAA 2JG6A 1VOMA 4ELYC 5J4YA 1VA7A 5EU7A 3KVGA 4RTYA 4FXDA 3BR0A 2W7NA 1ORPA 2GTDA 3RZDJ 1JJ8C 3TO7A 5CZ2A 2KI7A 2RN7A 3PFYA 5GAMe 1U3EM 4KI4A 2L4MA 3DAWA 5A2QZ 4LG0B 5K7HA 2LLKA 4HF2A 3BDPA 3LOCA 3GTJJ 3J8AA 5AQXA 2XF6A 1D5VA 2P9KB 4FLYA 3J81K 3HTRA 1K73U 1OPCA 2HKNA 1WN7A 1XJWB 3CCUI 3ZFJA 1GXIE 5ADXA 1UECA 2HF4A 1PRMC 1UHMA 3THWA 3F70A 4JX4A 4R55A 3Q9VA 2DD4A 2ECCA 2IP2A 4F7ZA 5TKWA 1B07A 5D6YA 1RAFB 1N3AA 4JNEA 1HYSA 1SD5A 4OPHA 2OF7A 4DSFA 4B1UB 1G8XA 1TAUA 3H9NA 5J47A 1VSLA 1LKXA 3G71Q 4DEYA 4HTLA 5GAOm 2YNGA 1B34B 2DA5A 4M7YA 3BZKA 5LRSA 4BRLA 4JOMA 5IXFA 4UQGA 1DUXC 1YW9A 1OOTA 2BXYA 2JM8A 2KW4A 3SBGA 4RW6A 2UXXA 1FX7A 3ECHA 2NUTB 4HVUA 4Z8AA 2KEAA 5LJ5f 4Q5WA 2V26A 1IRZA 4E9FA 3I56I 3H0FA 1MSFC 4C8MA 1JUPA 3MK6A 4CERA 3OSFA 1RCHA 3WEEB 2O6GE 2JMAA 2IS1A 1U1SA 1KQSS 4M75F 1U3OA 3RSNA 3GTMJ 4C8KA 1PKSA 1JJ2A 4FJXA 3LDNA 1ITGA 4H4KC 2WSEE 3JB9F 2P6TA 5GAMj 5C12A 3CCYA 3LDQA 1QTMA 2PZ1A 2KLAA 1ACMB 1S1WA 1BR1A 2IG0A 3KTQA 4DCHA 1VQOI 2LX7A 1DP7P 1ULYA 2BY0A 3HC7A 3U3GA 4R0KA 2GQQA 4ELUA 4I09A 2EZKA 3BJ6A 2JNGA 3QUIA 1VQKI 2QQRA 3EG3A 1XHZA 2DCEA 3RKXA 2HBWA 4LF8K 1YFNA 1OVQA 1YJ9I 3AAFA 3P9CA 2CWEA 2R7RA 2CSQA 1FC3A 1I1SA 4J6YA 1KIKA 5J2NA 1I8FA 2V7ZA 2O8KA 2ZJPF 3A1PA 1M90R 4NLBA 3L4QA 4OMMA 2W24A 2E3HA 2YG9A 4IOCF 3VYHB 1VSEA 3DPLC 1VQNN 5I2MA 3CC4Q 2A36A 1IDZA 1YW7A 3M57A 1E3MA 3V4GA 4XOPA 1USTA 4DFMA 1M90O 1N9SA 3TWHA 3DEUA 5IH2A 3J7AY 4FJGA 3AVAA 1XGSA 1Q86R 3L8BA 1NJZA 3QZ9B 2CGHA 4O5BA 4J8FA 1T3LA 4ICLA 4BR9A 4M45A 4E7HA 4ABZA 3M8RA 2D45A 1WBDA 4FL6A 3M0RA 1WEFA 3R1XA 2PFUA 1L5UA 5LJ5e 1Y8RB 4EPCA 1Q86O 4JKBA 2HHSA 3HOVJ 3FBNB 5GADJ 1MJ9A 5HS9A 2DA1A 1GFDA 3S93A 2YHWA 1N78A 5LJ3d 1ODDA 2VPRA 4EVIA 1BC7C 1KXPA 1B6AA 4AHSA 2R57A 4OPJA 5J2QA 1S3XA 1IG7A 1KG5A 2LMJA 2JQ7A 3ONQA 5CQEA 5CVVA 1S7OA 4CZGA 2W4SA 2X74A 3PSIA 1XC9A 4DQRA 1NJIR 2DL7A 2DXTA 3RVCA 3QYGB 5D8LB 3V1QA 1KG2A 4HNUA 5FLXK 3OR1C 4E1JA 3PE0A 2ZD1A 3D5LA 5D6EA 1YIJI 2KROA 1O3RA 3J81O 3OQ5A 1NK6A 1IB8A 1NJIO 4Y92A 3WXKA 4M71A 3QSUA 4A62A 4KPYA 4W5NA 4JI3K 1KVBA 5DM7F 3CMET 1Q7YO 3ZQCA 1YX3A 3IH3A 5IAYA 1X6GA 2KYMA 2OTJT 2ZF5O 4DSIA 1C0UA 2ZJPL 3AVFA 4M3UA 5KYUB 4JDSA 3K4LA 4A2UA 1N5ZA 2F2XA 2DERA 4OMOA 2IVMA 2GQVA 1GL5A 3PUBA 3QRFF 5DCMA 4DBRA 3O9QA 4RM2A 1LFPA 2VGMA 2PVGB 3K9TA 4PGGA 3MMVA 1S9EA 2I0NA 3EE8A 5LJ5j 5KYWB 4FASD 1KTQA 3IQLA 4B8CA 1ZC6A 2V7FA 2E1CA 1VQ4I 4IHWA 3N5NX 2VPLA 3CCVA 3VUBA 4DSKA 2QTDA 3GP8A 3S3MA 4S0HB 2JMCA 1RDAA 2KDSA 4JP0A 1OCOH 3CIPA 2EFPA 4AUXA 4ZDPA 4EA4A 1XSXA 1M1KR 3JCMJ 1AWCA 3T1AA 2EYQA 5L3EA 3ABMH 3C1DA 1NLPC 3A8LB 1L3SA 4B08A 4L5EA 3JRZA 4FLVA 3VYTB 4BXFA 3CWAA 2MD0A 4W5OA 3KTUA 4DR4K 2HYGD 2P9NB 2V1DA 3BG5A 2BDPA 3CLQA 2WV0A 3H1CA 3KP5A 5KK1A 2HL5C 5A0DA 5BPMA 1M1KO 1UJ0A 5FU6B 3BDUA 5E8GA 4ID1A 5DDGA 1IXCA 1HLUA 2LY2A 1HPZA 4CHQA 2DMQA 1MBJA 3CWTA 2XGEA 3HK2A 4EMSA 4UY8O 4IZZA 1WJ5A 2DBBA 3F72A 2E71A 2KT0A 4PJOF 2WAQA 2JWKA 1TQMA 3E3VA 3GTPJ 2IGIA 4M3EA 2CU7A 3BZCA 2DEUA 1KLMA 4JK9A 2QQBA 2CP7A 1WYXA 1B8IB 2GNCA 2RA2A 2XKPA 4FCYA 1EKEA 4PL6A 4XTUA 3CI5A 2FD5A 5AQJA 3EY1A 4E1NA 2O4XA 2COBA 2KZGA 1NGIA 4M7AE 3O4NA 4JI2K 1OJLA 1XWLA 1H8AC 2GTJA 4M78F 1S22A 2XRNA 3M54A 3BR1A 2NUBA 5DM7L 4FISA 2EB7A 4JRPA 1KU3A 2NOHA 4M77F 2QTXA 3TI0A 2F5EA 4GY5A 5AZJB 1P59A 4QVCA 4CCMA 1RR7A 2RHZA 5MLCQ 4C2MJ 4KIGA 3CC2A 1IGNA 2GA2A 1J6ZA 1EV7A 3LSGA 1TK0A 2HPIA 1VQMN 4YNQA 1LWEA 3EQLF 3HSFA 2MLGA 3DFGA 3TP0A 1HQCA 3RR6A 2L3SA 4LFAK 1OCZH 3SUNA 2HNZA 3I4MJ 4N76A 5KCOA 3WTVC 1OCTC 2R7WA 4O5VA 2OX7A 3HOSA 3VQDA 2P9PA 3MAJA 4E7KA 1BBZA 3OW2S 3AVIA 3JAMK 5GANj 3O4QA 1REPC 3P8DA 2XGXA 2L02A 1QZEA 4H0TB 4M78A 3B6OA 1QQMA 3OHRA 1NGEA 1AWXA 3ZRGA 1RILA 5AN4A 3AA4A 3CCMQ 1TBXA 3KX2A 1KD1R 3DKWA 3M4OJ 2G6FX 4B9MA 2KZVA 1HKSA 3M1EA 3HPGA 1YVUA 2GAUA 3M07A 3BCBA 4DR3K 1ZLMA 4BRAA 4PJ0C 2MPXC 5FLXO 1OYXA 2HHQA 2JA5J 3RMBA 3K0SA 2JPSA 1KD1O 2COZA 4M42A 1RAHB 1D3BA 3BQYA 2KQWA 4B48A 4CEFA 2LTPA 5L8RE 3UKRB 2J05A 1H89C 1MA9B 3TAEA 2MGQA 2LOOA 4JI6K 4IDKA 3LLRA 1Y1VJ 2BE7D 2QWNA 3KD1E 5C42A 2DVJA 2NRAC 3RIRA 3OYEA 4RLQA 3CC7N 3T7ZA 3LWFA 2HWVA 3AA3A 2XY8A 1ZLJA 4CJWA 4Y1CA 1NJIC 2ADUA 1RTIA 4FOEA 3C65A 3N4QA 4B4CA 3HRSA 2XPWA 3S32A 4J8OA 2QWLA 1AOJA 4JX5A 5GAN7 2XI9A 2XMFA 1Q81U 2A1RA 2MF2A 3K2ZA 1QVFA 2JSPA 1ETKA 2KRCA 4EW0A 4JYAK 2YS9A 1C0GA 2WY8Q 4CZEA 2EA4A 1VAZA 1D5YA 2YG8A 4EJZA 2XGCA 3CJ9A 5LJ3h 2FA5A 1ACIA 1VQLQ 4I02A 2VN2A 2ZCFB 4I0BA 4FWPA 3E0JB 3TTDA 1RUOA 2OFIA 1KG1A 1RT2A 4FSVA 3HO1A 5CKTA 4NCAA 4B1WB 2B8AA 2ABKA 4IBNA 3IH2A 3WTYC 2QXFA 1GOBA 3X2QH 2DAOA 1UHSA 4R8HA 3CJCA 1PJRA 4Z4HA 5FPDA 2ZNZA 2HAXA 2LBFB 3S1MJ 1HQUA 3M8JA 4ASNA 3RMQA 2LKSA 4PK4A 3E19A 3MX2A 4BWJA 7AT1B 4RG2A 5FKOA 5GANd 4CGJA 3MEEA 1WNSA 1VIEA 2FZCB 4XR6A 2AKLA 4FYWB 3M8FA 3RPUA 2E2HJ 2L89A 2DEQA 2EJFA 1J7KA 3FK6A 2KLOA 3P9KA 3PVLA 3H0GJ 4LC9B 3IV5A 1U5TC 2HOTA 1W9HA 1T3VA 5HK3A 5JHUA 1J9IA 5AQFA 1G3TA 4HBLA 1SFXA 3AGRA 4AVZA 2E8AA 2XB0X 4FJLA 4K8XA 3T19A 1W1WE 1T38A 4VUBA 1V3FA 1W7PB 1Y97A 2QYOA 2M8GX 1FP2A 2JZYA 1Y71A 2DFUA 1A5JA 4DSEA 3V7RA 3NGZA 3J7ZO 3B8AX 1NM1A 4KYWA 1APLC 4JBAA 4J9HA 2KRSA 5J4VA 5IT3A 3JAMO 1U5TB 1ON2A 3JCMg 2Q0OA 1VQPT 5A2QK 1ZX6A 1OQKA 3UNGC 5CO7A 2Y9ZA 1UA1A 1B72B 2Z99A 1B9MA 1JTXA 4A3JJ 4BH9A 1RBSA 2IIMA 4MDAA 1IXRC 2P0QA 3RJPA 2DL4A 4BB7A 1L3TA 4FJMA 1GUUA 1IG9A 1I07A 5GINA 3G71I 3SQ2A 2P9LB 2ECZA 2O8BA 3CEYA 4BROA 4M3DA 3Q0WA 4WX9A 1P9QC 3ID8A 1WKMA 4FLWA 2QKKA 1U2WA 1FSHA 3V8KA 4GGGA 2IT0A 4KT0E 2ESHA 4BQLA 1PU6A 2CS3A 3W3CA 3TSQA 1SVMA 5KYNA 3DBLB 3WGGA 3EGDA 3RCOA 5LY3A 4BBRJ 4IWVA 4G12A 3ZL7C 2OD5A 4WF2A 1B59A 3P7NA 2R5ZB 2ZJQF 1E3PA 1JT0A 4WF9L 4UHTA 3A8YA 3CMEA 1FYKA 2WTUA 2LRDA 3M0TA 1A5VA 4CJPA 5J40A 4IXCA 2OTJA 4L0YB 1BQMA 1TWCJ 2BXZA 4D0PA 1OI1A 2QWPA 2A05A 3S8PA 4IRIA 1RUWA 1UEBA 5TJJA 4GV6A 1I5ZA 4BE2A 2F69A 5AZIA 2D6FA 4DSJA 4OMPA 4WFAL 1AD5A 1RRQA 3AAPA 2ZMEC 3MECA 5HDNA 1SPKA 2KISA 1OQYA 4OMLA 1RT3A 1UFMA 3SMPA 5JLXA 5K14A 1VQ6Q 3BTCA 3A8HB 3MWTA 5D3GA 4XLCA 2JWLA 2NRZA 2E2PA 2M9UA 3B73A 2H3GX 9ATCB 3FMRA 3GIBA 2ZQBA 3FSPA 4IO9L 1BISA 2R7FA 4KIFA 1LOJA 4C0ZA 3VN5A 2QASA 5KAFC 3GTKJ 1K73C 1VFCA 2YCHA 3TANA 5K5OA 4BRIA 2KAFA 1CF7B 4KTZA 4M9ZA 1YITQ 5CK9A 2QLZA 2KIFA 2GUIA 4DS4A 4HG2A 2FX0A 4JI4K 3BP8A 2IS3A 3PFIA 4EFHA 1J9AA 1JKRC 4DW6A 5AQQA 4K43A 2UXDK 3L2VA 4HZFA 1MNMC 1T8EA 2E65A 1LUJB 1SAXA 2OQGA 2HVHA 2RKIA 4BR2A 5DM7R 3J80E 3V6DA 2HYFA 3CCST 5GMKl 3HSCA 1P4WA 1Y7XA 3RPUD 1WDXA 1RLPC 5EZHA 3AG2H 5EC7A 3FFIA 4BGDA 4CJKA 3UB5A 2A6TA 4BY6B 3QLHA 3NF7A 3EG1A 3ME9A 4HX4A 3SQNA 3NWTA 2NLUA 4A63B 5GAN2 2COYA 3I8DA 3TMOA 3ZN1A 2ZJQL 1QHAA 2IPOB 2BY1A 2DD5A 4FOIA 4IG0A 1RADB 3ATVA 1YG2A 3VEPA 1Z6TA 4AILC 3BR3A 4ESBA 1M3QA 3D7EO 3THWB 3GOXA 1QSSA 1S8NA 3EGXA 3O8MA 2RB6A 2OPSA 2ISYA 4CHYA 4LF6K 1YRNA 3L7WA 3MXIA 3CC4T 5TGTA 2CUBA 1SUQA 4XONA 1LWFA 4X34A 2DAQA 4X64K 4C8QD 4F7UF 4KA4A 3SD4A 4CZHA 2HS5A 3EFOA 4ILHA 2F4VK 3H6ZA 2JA2A 5AYFA 3T9NA 3IH7A 5A2QO 4DV6K 5AFUH 1DU6A 1ZRCA 2F4OB 3HIFA 5FKKA 2X6XA 3VQQA 1WXBA 3DKYA 3GTLJ 3ZSYA 4JN4A 1QVGS 3CCVN 3GF2A 1VYTA 3R9PA 5IT9K 3L00A 3C7JA 4IXAA 4BREA 4JKEA 4BQAA 4KJZA 1UMQA 1KAZA 2BUPA 1E3OC 3SYZA 2QQ8A 3ISPA 2JS2A 3WTSC 1JGGA 4NZGA 2MABA 4F17A 4YFNF 3QOPA 4X1VA 4CEAA 1PDNC 3ZQLA 2DFHA 4LK1F 4KGVB 2Q97A 3LNQA 2HHVA 2HTSA 3LGFA 2E12A 1Y64A 5K5RA 4EIKA 5IHNA 4DWIA 2LSOA 4F7UA 3D0PA 1WEIA 5GANh 4JKCA 2CH4W 5KH6A 1F36A 5ILSA 4L3QA 4AG1C 2WY7Q 2PYJA 3FZMA 5KE2A 4DR2K 4CGIA 4HDUA 5BR8K 2EFWA 4LB5A 1SEMA 4CC2A 1OPLA 1TXQA 3ZQIA 1ETXA 1XTDA 4B9NA 3EDPA 2OZ6A 4HNVA 1ZRDA 1CLQA 4KH6A 1F21A 4E7SA 2P0WA 5DS9A 4JKAA 1N32K 2WAQN 4F2RA 4H0YB 1U6GA 3CCRI 3IAYA 3H1VX 5IOYA 5F6FA 1F9NA 3K70D 3N97A 1YFHA 4K0KK 3BJOA 5AONA 3TAGA 3FZVA 1X4OA 3SEQA 4F2SA 1HCRA 2Y69H 4PJLA 3CPWS 2M34A 2M0CA 2NLXA 2HHXA 1EIFA 2YPRA 3LSMA 3J81E 5M3MJ 1V76A 4UUTA 2F2EA 1SSFA 3IFRA 2VUMJ 2B0LA 3K1PA 4BC3A 1RT4A 2D0NA 5HCKA 2F5VA 1I6HJ 2I5UA 3GEZA 4FIBA 2A5WA 2R7SA 2RQVA 1AEYA 3DTIA 2HMIA 3CD6I 5JHFA 1KZHA 2QTVA