3OS2A

Pfv target capture complex (tcc) at 3.32 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 96
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os2A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os2A03
3MXIA 2BGGA 4IBNA 4N41A 1YVUA 3ZCMA 4E7KA 3K5OA 1KFDA 2W42A 1TVRA 4L8RB 3FEOA 4K8ZA 2EQUA 1BQMA 3V81A 3V9ZA 3LANA 3CM6A 2FBVA 2GV9A 4E0DA 1RT4A 3H08A 3MEWA 5IAYA 1VRUA 1BI4B 2EFIA 2NUBA 1RDCA 4FJMA 3V1OA 2ZQBA 1WN7A 3OYJA 2OZSA 4CGGA 4F4KA 1CXQA 2JZ2A 2RJDA 4DFMA 3LZJA 3FC3A 1J5OA 1QSLA 2G8FA 4QQDA 1Z26A 4BACA 3C6TA 4CJEA 3LALA 1O1WA 1RT1A 4GY5A 2D0AA 4LD6A 3DYAA 4NYNA 4DG1A 4FLUA 2BE2A 4KTWA 3DLMA 1IG9A 2DIQA 3TAMA 1C0TA 4UC4A 3UIQA 5KGWA 3LGFA 1JLFA 1S1UA 4OGEA 4BWMA 4CJRA 3HYFA 3QEIA 5DK5A 4CJVA 4CGJA 1RDBA 1RBSA 4DTOA 2HHXA 3AVGA 3AO1A 2OPSA 1HPZA 1LW2A 3QESA 4DS4A 2D9TA 4JRPA 4HCBA 4OVAA 4CF1A 5CIUA 2HHWA 3C95A 4B9NA 4CHQA 3TAEA 2DTUA 5K14A 3VQ6A 4OVLA 3K2PA 4FCYA 4C8NA 4C5EA 4FW1A 5CZ2A 4B8AB 4KO0A 3L2WA 3LLRA 4CGFA 4Y1DA 1NK9A 1BGXT 3KIOA 4B9VA 4QQGA 1NK7A 1SKSA 1HYZA 4DQPA 1SL1A 2QKBA 5CY4A 3AO5A 1EX4A 3V9WA 4F2SA 3SV3A 1NKEA 4RW6A 1WSJA 3PUFA 4CFCA 2FHDA 1SV5A 4ELTA 1JLGA 4KHWA 2X74A 2YNGA 1BIZA 4NYFA 2GFAA 4B9UA 1SL2A 4Z4FA 1C1CA 3KJVA 4FLVA 3PO5A 5C42A 3EYZA 1B92A 1IH7A 3AVIA 3ASMA 4CK3A 1W9HA 1UAXA 1KHCA 4KV8A 1ZBIA 3QETA 2KZZA 3OY9A 3OS0A 4M3RA 4CJQA 4DFJA 2L8DA 1CZ9A 1S6QA 3MEDA 2B4JA 4IFYA 2B6AA 2E6LA 1U48A 4FJGA 1WAJA 2HHVA 5D6XA 4TSXA 1TGOA 1QSSA 2RO0A 4BDZA 2QQSA 3NGIA 3SPYA 4N4GA 4I7FA 5KE2A 3PY8A 4DSJA 1T8EA 4KFBA 3ZEHA 2RHZA 4DFKA 2HHTA 1MHNA 2QK9A 4IKFA 1KVAA 2RN2A 3E9FA 1CZBA 3HPHA 4MFBA 3DB4A 5JS2A 4CJWA 3ZT3A 3RMDA 3NTIA 4Z02A 5HRNA 3B6OA 4EZ6A 1SL0A 4DTPA 3U3GA 3O3HA 2Z1GA 3ALYA 3D45A 3M8SA 3ISNC 1LWEA 3VQPA 4BE0A 4OLBA 4KREA 3CFRA 2Y1IA 1ZBUA 3ZSOA 3ZT4A 3DM2A 1TKZA 1W0HA 3QO9A 3F73A 3MEEA 2E6NA 4DU4A 4CGIA 1F21A 2ATQA 3V6DA 1X9MA 2Z1IA 1UA1A 5HRRA 4BE1A 4IG0A 2HQXA 3PV8A 4O0JA 4YNQA 2P1JA 3AA4A 2L89A 2HVIA 3WNEA 4W5NA 4CF8A 3CEYA 1Q8IA 4A4EA 3K57A 4PWDA 4M41A 4O0IA 3NF8A 4F8RA 4CJKA 4IUPA 4HTUA 4PA1A 3TI0A 4FU6A 3ZSXA 1N27A 5E41A 4N5SA 4H4OA 3MEGA 1J54A 4FJ9A 2HVHA 4AHVA 3SNNA 2RI3A 2RJCA 1VSHA 1UWBA 4LSLA 3LPUA 3DLGA 2E4LA 2NLUA 2YKNA 3U6FA 1C1AA 2E5QA 3TABA 1G5VA 5KTQA 1SSFA 2D5RA 4CEOA 1ASUA 5D3GA 5DMRA 3AVNA 3LP0A 3HJFA 4CEZA 2WONA 3M9QA 2O4IA 1LAWA 4DFPA 2AJQA 1WSGA 5I3UA 5KH6A 4CJ3A 3OVNA 1OZ2A 1WGSA 3VQ9A 2ETJA 2D0BA 4Z4IA 3MP1A 5KE3A 3OYNA 1VSIA 1C6VA 1RNHA 1VSKA 2IGIA 4B3OA 3S3OA 1N6QA 3OA6A 3EAEA 3SD4A 2P51A 1NKCA 4FXDA 3DLHA 3LYIA 3OYAA 3S9HA 3HP9A 2YNFA 4C8OA 2HB5A 2HMIA 4KB0A 2VWKA 1NJZA 1DTTA 2RHYA 4DLEA 3QEPA 4O5BA 2JLEA 4G1QA 4IURA 4C8KA 1RTHA 3P8HA 4FK0A 1G15A 4DMNA 1JLEA 3DOLA 4Z4GA 1RT7A 5J2NA 1SUQA 1R0AA 4KAZA 4FLWA 2RHIA 1SKWA 4ICLA 2VWJA 1TKTA 3AA3A 4B9LA 1JLAA 2EQJA 4C5HA 5HP1A 3TAFA 1UA0A 3S6WA 4EP4A 4O44A 3SJJA 2BANA 1TV6A 4DTUA 1LV5A 2A1SA 4X34A 3I0RA 1EXQA 5D6YA 4AHUA 2DFEA 4CJUA 3MECA 3NTHA 1NOYA 2B5JA 2P5GA 4FJIA 3AVJA 1TKDA 3QLHA 1RT6A 3SUOA 3BDPA 5CZ1A 4DSFA 3OS1A 1RDDA 3NFAA 3V9SA 1C1BA 1L3VA 4E1NA 5KRSA 1U4BA 2R5MA 3HPOA 4FJNA 4OPJA 1S1XA 2X35A 3LWLA 3O3GA 2KTQA 1SKRA 2G3RA 2FC0A 4AHCA 4CJLA 1HJRA 3V4IA 2DIGA 4KPYA 4Q5VA 4L59A 3K5MA 1HNVA 3P8DA 2HNDA 1FK9A 2YHAA 3LGLA 4KRFA 5HROA 4DSKA 3TAGA 3ZSQA 2DFFA 3DRRA 3P5JA 1Q9YA 1TK0A 2HQEA 4OJRA 1HQEA 4DS5A 4RW4A 2F96A 4CEQA 2IAJA 3MP8A 4ZTJA 4IUUA 3OYCA 1WNSA 1XWLA 5J2PA 3GOXA 4CHYA 1RBRA 3SUNA 5J1EA 4YFUA 1B9FA 4W5RA 3DRSA 2VG7A 2L3RA 2G8WA 2XO7A 4DQRA 2R5AA 4KI6A 2X4YA 3K59A 1T7PA 5KI6A 3RR8A 4CJTA 3OMGA 4FL6A 1VRTA 1RT3A 3HXMA 1YT3A 1DTQA 1L3UA 4C5IA 4DSLA 1S9EA 4KKOA 3Q1JA 3HL8A 1XHZA 4ZHRA 4K8XA 1VSMA 3QERA 3QEVA 2YNIA 2XY5A 2F5KA 2BDPA 4CIEA 4ID1A 5CYQA 4JLHA 4CEDA 4NS5A 3KLGA 2M0OA 1J9AA 4O4GA 3PMIA 2KZMA 4FJXA 2XHBA 5FRMA 3DLEA 1N5YA 4F3OA 3ZSVA 4BD3A 4CJPA 2K3XA 2OA8A 4CGHA 3META 3AVCA 4CJFA 4DTNA 3HPGA 3ULDA 3K58A 3LP2A 1TKXA 3KKRA 3VN5A 4CF2A 4M3WA 3IRXA 4I2QA 5I42A 4Z4EA 4M3TA 5C24A 3H6ZA 3S3NA 4IUVA 1VSDA 4C8LA 1S1VA 2VG5A 1L3TA 5C25A 4I9LA 2D0CA 3TR8A 1QE1A 1BQNA 3HM9A 3NF7A 1TL3A 2O4XB 3HT3A 3I0SA 1GOAA 1DLOA 3K5LA 3ZSYA 1TL1A 2BUDA 2Z1HA 2KQ2A 2IOCA 2HHSA 2F8SA 1JXBA 4CEAA 4OKJA 4Y1CA 4F3TA 3NE6A 4HCZA 1EETA 1FKPA 1Y97A 4W5QA 3L2RA 1KRPA 2LRQA 3QIOA 3OYMA 2XRIA 3DB3A 3C94A 1XNIA 4IG3A 2RJFA 1VSFA 1X1PA 4DTSA 1WSHA 2RI5A 3OYDA 1T05A 2P0KA 4IUTA 3SQ0A 4QOZB 1BI4A 4Z0UA 4FK4A 5HBMA 1JXEA 1KTQA 1UOCA 3VQ8A 2Q3SA 3ZSZA 4QAGA 1XI1A 2EQMA 3SUQA 3KK3A 1J53A 4RW7A 4A4GA 3S3MA 2B8AA 4AHRA 4KHYA 4N76A 3NBPA 4OLAA 2YRVA 4OPKA 3L3VA 3P1GA 3IAYA 3QEXA 1JKHA 3VQBA 4CGDA 2RHXA 5HRPA 3AO3A 2FBYA 1RTDA 4AILC 4E7HA 4FYDA 2JTFA 4DU1A 3OYEA 2G8UA 3JYTA 2R58A 2WOMA 1NOZA 3OJSA 3LH0A 3AA5X 2Y1JA 1T03A 1NK5A 3SI6A 3NTKA 3LDSA 3MXJA 4BE2A 4GVMA 3ITHA 3DMJA 3PX4A 5IN1A 1ASVA 3TANA 3RMAA 1REVA 4N4IA 2XK0A 4ELVA 1JL2A 2LVMA 1BIUA 4Z4CA 4C5GA 3VQCA 1LWFA 2G8VA 4EP5A 4KTZA 4DSEA 3KLHA 3OYGA 3T1AA 3M8PA 3KTQA 2PYLA 4KHNA 1NKBA 2X78A 3WNHA 3HP6A 3K5NA 3LWMA 4DQSA 3OJUA 3AVFA 4FJ5A 3HSTB 4E19A 1A5WA 3OYFA 1X9SA 1QSYA 1S1TA 3KD1E 1H3ZA 1TAQA 2EQKA 1ITGA 4I2PA 3NH2A 3KD5E 1X9WA 4FZXC 1B9DA 4FZZA 1NJYA 3OYLA 3OQ5A 1D9FA 2EX3A 2I5JA 3KLEA 3G0ZA 3VQAA 1RT2A 3L8BA 4OKKA 2RF2A 4CJ5A 3KK2A 3CG7A 3MEAA 4DTJA 1I39A 3PFSA 2HNZA 1VSJA 4B8CA 4W5TA 3QNOA 3L2QA 3CFOA 3SQ1A 3MXMA 2RHUA 1TK5A 1YTUA 1RTIA 3RR7A 2MWPA 5FROA 4DTMA 3UWNA 4F2RA 4RW9A 2R7YA 4H8KA 1IO2A 2M16A 4DTXA 5J2QA 1LW0A 4FVMA 4PY5A 2DAQA 3SCXA 2DFHA 4E89A 3ME9A 4B08A 3JSMA 1A5XA 4CHNA 3V1RA 4BDPA 1NK4A 1HQUA 3VA3A 4N56A 2GBZA 2OZMA 3FFIA 1OI1A 3RWUA 2GFUA 2HHQA 1S6PA 1ZBHA 1D5AA 2KFZA 4CEFA 4KHUA 3MAQA 1VK0A 2PYJA 3PNWC 3M8RA 3B6PA 1NJWA 2LCCA 3SYZA 4JS5A 4FM2A 4PUOA 2JGUA 4LSNA 5KRTA 3P83D 4FK2A 3VA0A 3E9GA 4KHQA 3L42A 5C0MA 1VSEA 3QIPA 1BCMA 5SZTA 1HYSA 2YKMA 1IKWA 1C0UA 3VQ4A 5KCOA 2QKKA 1RTJA 3E01A 3KKSA 3CYMA 1IKYA 1VSLA 2Z1JA 4JS4A 4DF8A 4E7LA 1WSFA 4FJ8A 4WE1A 3EY1A 2IC3A 1IKXA 4M45A 1K6YA 3TWHA 1U45A 2LSNA 4M3XA 4NCBA 4Q5WA 1JLQA 1RDAA 1WJSA 3NH1A 2XDPA 2IS3A 3QIIA 3OS2A 3V9UA 3DLRA 4CRIA 4CFBA 4NCAA 4E1MA 3NH0A 2E6MA 2QQRA 3DLKA 1JLCA 3QKJA 2XY8A 3MO8A 2G8IA 2FBTA 3VQDA 4B9TA 3AVAA 2OPQA 3DI6A 3ZT1A 3NDKA 1S1WA 4A4HA 4M3ZA 2ZD1A 1XHXA 3VQQA 2OPPA 4CEBA 4CF9A 4CK1A 1CLQA 4CHPA 1TK8A 1ZBLA 4ELUA 4AH9A 4NCGA 3AA2A 4IFVA 3AVLA 4DQIA 1KSPA 1U49A 1KLMA 3T19A 3AVMA 1I3AA 2X4WA 4B9SA 1QQCA 4DTRA 2WACA 4E7JA 4O55A 4CIFA 3SQ2A 3MEUA 3IG1A 1RILA 3OYHA 4E7IA 1S5JA 3IS9A 1NK6A 4II1A 1WSIA 4A4FA 4C8MA 3NCIA 1KVCA 4OGCA 3AVBA 2LDMA 5HRSA 3L3UA 2QXFA 1Q9XA 3SPZA 2F8TA 3EZ5A 1GOCA 4FZYA 2RPIA 4KTQA 5KGXA 4GMJB 4QQ6A 4CHZA 4BDYA 3BDLA 1U47A 3LP1A 3A2FA 3OYIA 4DU3A 4XIUA 5J39A 1GOBA 4H4MA 1D9DA 2EKOA 4LH5A 2OPRA 1Z25A 3KLFA 4FLTA 1KVBA 2EHGA 4AHTA 3SQ4A 1WSEA 4CEEA 3LAKA 4KI4A 2X6NA 2FBXA 4CFAA 4W5OA 1U04A 2PQWA 3ZT0A 4DLGA 3NNQA 4FW2A 4LY7A 3NAEA 3CFPA 4FLYA 5J26A 4DSIA 4FJ7A 3OYBA 1RBVA 5M9OA 3LAMA 1NJXA 3M8QA 2A1RA 2PY5A 3CQ8A 1WJRA 2VG6A 1ZYQA 2XY6A 4CE9A 3HVRA 2ZE2A 1JL1A 4PL6A 1BCOA 2RKIA 4Z4HA 4DWIA 3O4NA 3AVKA 3F9KA 2YHBA 3D0PA 3RMCA 2M1HA 3RRHA 4DF4A 2CKKA 2R57A 3ZT2A 4DQQA 5SWMA 4CCHA 3AO2A 5EU7A 1RBTA 1IKVA 4CECA 4CFDA 2HNYA 4EDUA 3KUFA 2LTOA 2YV0X 4FLZA 1L3SA 4B9MA 4PLIA 3QEWA 3TAQA 3QNNA 4CF0A 3THVA 4M3YA 5KCHA 1RCHA 4PLLA 4KHSA 4J2AA 5HLFA 2G8HA 4RW8A 3SUPA 2BKDN 4CHOA 1JLBA 4LH4A 3TAPA 1ZBFA 4HHTA 4ID5A 4IUQA 3LP3A 3DLBA 5FRNA 4B9XA 2X6SA 1HMVA 3BGRA 3TARA 3C6UA 3NF6A 3ZSRA 4FJKA 1OZ3A 4FJJA 2MWOA 3DRPA 2PZSA 4HVJA 3CM5A 1A5VA 3KLIA 4AHSA 3G10A 1WLJA 1RT5A 3V9XA 3OB9A 2KW4A 3C4SA 4HUEA 3L2UA 1BISA 1BL3A 2VYTA 3LZIA 2OYQA 1FXXA 4CIGA 2BIVA 4HCCA 4FLXA 3AVHA 4QW2A 3MP6A 3WNGA 4FJLA 3QJ6A 4CJSA 3LPTA 3RMBA 3RTVA 3NF9A 1HNIA 1KLNA 3U3YA 1YTAA 1L5UA 2GUIA 3HK2A 4RG8A 1QTMA 1RBUA 3I8DA 3FLGA 3UT1A 3VQ7A 1QHTA 4JRQA 2XY7A 3PX0A 4RG2A 4FJHA 4J2EA 2GF7A 2HW3A 3SZ2A 2RJEA 5FDLA 4J2DA 2G8KA 3PO4A 4HUGA 4B9WA 3O3FA 4M42A 2P5OA 4CESA 1KFSA 4MQ3A 3HVTA 3LX7A 4CJ4A 3PMTA 1ASWA 1NK0A 3OMCA 3WNFA 1RI0A 4BWJA 3MEVA 3ASKA 1MU2A 3PX6A 2KFNA 1C0MA 5D6WA 2ITGA 2IG0A 1XC9A 1QS4A 1FKOA 2X4XA 2YNHA 4OKEA 1TAUA 4GW6A 2K3YA 4HUFA 1WAFA 3DOKA 5C6SA 5JS1A 1BHLA 4PQUA 3L2VA 5T7BA 3HO1A 1LWCA 4QCLA 3OYKA 3VQ5A 1OYXA 3NGZA 4ZTFA 2RI2A 4N47A 3AV9A 4QVZA 4UQGA 2IDOA 3FDRA 4J2BA 3AO4A 1HYVA 4FM1A 4N4HA 1S9GA 2DY4A 3F70A 2HHUA 3VQEA 3NGYA 4IDKA 3V1QA 1LAVA 4Q0BA 3T3FA 3QBYA 2O4XA 5CYMA 4CK2A 3SV4A 3QINA 1EP4A 4LD0A 5J2MA 1D8YA 1HRHA 1NK8A 1KCFA 4EZ9A 4R5PA 3ZSWA 4NZGA 4CERA 3O8VA 4FM0A 3KK1A 1WJQA 1EKEA 3O4QA 4E3SA 1CXUA 3NHGA 3H8ZA 3RRGA 4KB1A 4I9QA 2O4GA 4M3UA
chains in the Genus database with same CATH superfamily
2BGGA 5I2SA 3AG4H 1U78A 4U7DA 3GP8A 2V8JA 2EV0A 2GTJA 1MD0A 5LJ5g 3WTZA 2CT3A 1KFDA 1D3YA 2WUSA 4I0BA 2ZJRF 2GQVA 2DZ9A 5BNGA 2LC4A 3CD6N 1U06A 3G4SN 3H5AA 1BQMA 1JCFA 2LJ0A 3CJ7A 3E9LA 5BPLA 4FYWB 4JI5K 1QVFS 3W3DA 1OX9A 2GV9A 1M90O 2YWWA 1VQPA 2RQRA 5AN4A 5IXFA 4BGBA 2GLOA 4OB2B 5GANf 4IL6C 4M7AF 4BREA 3M58A 3TTCA 3ID8A 2EFIA 2Q1ZB 2NUBA 5GANe 1B72A 5AR0A 3H3UA 1JCEA 4GYGA 2DYRH 1RDCA 3PTAA 2KPMA 1WN7A 2OZSA 4CGGA 4JK7A 2PZ1A 1Y96A 5HY6A 1ZN2A 5BPDA 3LZJA 4V2FA 3ZMZA 1J5OA 4JKEA 2ZPIB 4WTOB 1D0XA 1U8BA 5JVGF 1RT1A 3G6EQ 1WHKA 2ZNYA 5K5RA 1NWKA 3E5XA 1OQKA 4LD6A 3DYAA 4X9DA 4NYNA 1TW2A 2WTUA 2BHYA 4BRKA 2BE2A 1WEFA 2JM9A 2HEQA 5FJ8J 2QVOA 1LPQA 3A4CA 1KU3A 3OW2M 3L1PA 3LGFA 5GAOl 3S1NJ 4A6DA 5HNFA 1B1BA 4BWMA 1FMWA 5LJWA 4BVOA 3CCMQ 5ILSA 5DK5A 3S6IA 4LITA 3L00A 1WSUA 1RBSA 1HKTA 5CKEA 4KH5A 2JUFA 2HHXA 2VB6A 3B8AX 3CP8A 5DYMA 2OPSA 5BPIA 4BRNA 5D6FA 5LGTA 1TWHJ 1NJIC 3DXKA 4HCBA 4OVAA 5KYXB 2HI3A 2GIZA 1VQ6Q 3BR2A 1UHSA 3CC7I 1O7LA 2PMZA 2H1LA 2ZB9A 1ILYA 4BXXJ 2E2QA 2IEKA 3CCJA 3QRFF 1MBGA 1T39A 4C8NA 2QBYB 3VODA 4F52A 1DDNA 1KQ9A 5CZ2A 4DV1K 4KO0A 1MJ9A 5EVZA 3CETA 2LMDA 1IG7A 1J9IA 2QW9A 4CGFA 4Y1DA 5LHGA 2FRYA 1LB2A 3GTQJ 4M77B 3BR6A 4CYDA 2HBKA 1LVAA 4XTXA 4V19K 2L9SA 4DQPA 1NH3A 2X3XD 2J06A 3T8TA 2RNJA 4JRIA 1H8KA 1AEYA 3U9ZA 3CD6Q 1ZG3A 3G4SQ 1VQLA 3N97A 4IOCF 3SV3A 1NKEA 3RDIA 3QDFA 4RW6A 2RDPA 3TREA 4C92D 3Q0VA 3BPXA 1JJ8C 1E4FT 4KHWA 1XGSA 1ZR2A 4RGXA 2GFAA 3DBLB 2K3PA 4F9OA 1SL2A 3SAHA 3QYHB 4FLVA 2EAYA 5C42A 5I21A 2ZPEB 4B48A 2RGVA 5HDNA 4J8FA 5M5YJ 4CK3A 1W9HA 4KV8A 3M1CA 2QYOA 5F6FA 2PMHA 3QETA 5LJ3h 4XU2A 4F7UF 1MUNA 4KBOA 1ESVA 3KZZA 3OS0A 4KUMA 2JA2A 5GANd 1FX7A 3K0SA 3NEUA 2B4JA 3AG3H 3RJPA 4OB0B 2C0TA 2M7AA 4PCQA 2K6DA 1JTXA 1D3BA 3JW4A 1BW6A 1AVZC 3A5LC 2BEOA 3OIQA 1Z7LA 2COBA 5GMKe 3EGDB 1TT5B 2OAUA 1YWPA 1TGOA 2LBFA 1S3XA 3SFIA 2RO0A 1JKRC 1YCYA 2QLZA 4BDZA 2QQSA 5DM7F 5A0GA 4C92F 1JJ2M 2DTHA 1PRMC 2MF2A 4XH5A 1FTZA 1WJ5A 4KIBA 3VRYA 4KFBA 4O5VA 3CESA 2NRRA 2V8KA 1X6GA 3IP4B 4J7IA 1VQ8N 1YJWT 4NC8A 2EIKH 3HPHA 4MFBA 3DB4A 2IGOA 3HHGA 4CJWA 3J7AY 4MTEA 5KYYA 5E17F 1OR7A 3FZVA 3P39A 1KXPA 4XRFA 5C0YA 4I99C 4DTPA 2QYZA 5IT9Z 1P92A 1IBKK 3LM9A 2QF7A 2Z1GA 1UE9A 1R49A 3F3XA 5LJVA 4BE0A 4KREA 2V51B 2AZVA 4EHTA 4M75D 1XS9A 1BI1A 3FIFA 1TKZA 1W0HA 3QDKA 3F73A 1Y96B 3MEEA 1W2BP 2K2VA 2ATQA 3AL0B 4A5NA 3TSUA 1X9MA 5FLXE 3DKYA 2RQQA 4HV6A 1RZ4A 1YNZA 2XPVA 3AA4A 1BOAA 2L89A 3ZP5A 3RKWA 1T0FC 1Y39A 3R1XA 1JXOA 1TL8A 5FLXK 3O2PE 2FVUA 3CEYA 4XH4A 1Q8IA 4A4EA 2ABLA 1EA3A 3PQKA 4M41A 2C6YA 3NF8A 1VQ5T 3HG9A 4CJKA 1R23A 2FBHA 3KZBA 1GT0C 2VXFA 2WSCE 3TEDA 3GPLA 3J81Z 3GNGA 4FE7A 1PD0A 4N5SA 1XSVA 2E3IA 2ISYA 3S1QJ 2HS5A 1EIFA 1HYOA 1SG5A 2Y2ZA 1ZGWA 2GM4A 3A1YA 2DD5A 4M75F 4Y33A 3N4MA 4D7MA 3E1SA 4CEOA 4LG3A 3JRGA 3DXKB 5D3GA 4P9UA 2O03A 3GTGJ 2J5PA 2O9VA 2E1YA 2YR2A 3HJFA 2JMWA 2WONA 1SKUB 3DTIA 2O01E 2EKHA 1IGUA 1LAWA 3M0PA 4G94A 1X1DA 3TO7A 2O8CA 4ENKA 4G12A 1TXQA 2EK5A 2ETJA 4V19S 1NPRA 3VGLA 2JG6A 4F7ZA 3HPWA 2Y69H 3MP1A 5KE3A 4M6YA 1C6VA 4QPQA 4CCJA 2VE9A 1RNHA 4EJTA 3CC4Q 1RAIB 2IGIA 2QTXA 3S3OA 1E3PA 3TEEA 3B6AA 1VHXA 1R58A 2HL5C 1N6QA 1D5YA 3OA6A 2ECZA 1YW8A 1VQ8Q 3I55N 3L2ZA 4R79A 1X01A 4PJJA 5HLTA 2XHCA 4KB0A 5M1NA 2BYVE 3BZKA 2XUBA 2VWKA 1NJZA 2RHYA 4DLEA 1I6HJ 3W2WA 4EW4A 4EA4A 3C12A 4XONA 4FK0A 2CUJA 3DEEA 4BVPA 4DMNA 1YQRA 5GMKh 5AQPA 3JV3A 4A3EJ 2YS9A 2QM1A 1JLEA 4P5OA 1TUYA 3J7ZI 4Z4GA 3J7YP 3MWPA 1WDXA 4HXJA 3HB9A 1ABOA 1R0AA 4FLWA 4OB3B 4FWKA 5HS8A 1FOYA 3R61A 2A69F 1WHJA 2EQJA 4C5HA 4A2AA 2K5IA 2PNIA 3TAFA 3SK3A 2OTJA 4JI8K 2BANA 2KJBA 2ESWA 4KISA 1FSHA 5D4SA 2A1SA 5CLSA 1UHCA 3KEOA 2KYMA 3I0RA 4UY8I 1JKPC 2DFEA 1XJWB 3AVJA 3QLHA 4J19A 4KH6A 1IBMK 3I0TA 3UKUA 1BIBA 5CZ1A 4RTTA 2F4VK 1FT9A 3OS1A 3J81E 2AK5A 2QKMB 1RDDA 3NFAA 3BQYA 4E1NA 2B7EA 1U4BA 3WHBA 1XNQK 5GAOr 1QCFA 2YSRA 2L9NA 4IXCA 1ZBSA 1GCQC 2KTQA 4GYIA 1IJWC 3LDNA 4IJAA 4E6KG 2XAUA 2DIGA 4A3KJ 3WGHA 5FLXO 4A62A 2DJNA 4KPYA 4Q5VA 4KJZA 1KQSA 5ILVA 2WFBA 1MMGA 2NOEA 4ESBA 1XCBA 3BPVA 1YITQ 2HNDA 4LB5A 4RB3C 2F5CA 1FIPA 2YHAA 1Q95G 2WAFA 2G9WA 3IHOA 3OSVA 3CBMA 4IHWA 3LMMA 5HROA 2JHNA 4MHGA 1TWAJ 1Q81U 4X1EA 2DFFA 2O8EB 3CCJT 3DV8A 1MWKA 2VN2A 1V5FA 1ZH5A 2HQEA 2JWKA 5HLGA 1HQEA 4RW4A 2QK0A 2IAJA 4IUUA 2XGEA 2LOOA 1IJJA 2X6OA 1GLAG 4WF2A 3GOXA 5J2PA 2R93J 4CHYA 3W6VA 3CVSA 1LFPA 2VQEK 2XGDA 4YFUA 4M3FA 1B9FA 2R7TA 4RB0A 5F2RA 1MV0B 4W5RA 2L3RA 1H92A 4KI6A 2LH9A 5A2QK 4OMLA 4CJTA 1AWJA 1MMNA 3OMGA 5IWAK 4UUSA 3HUGA 3SHFA 1M2VA 3GFLA 3Q9VA 4ZH4F 1DTQA 1K9MU 2YUSA 2XRNA 4JHDB 2K4JA 3Q1JA 2K9GA 1UG2A 5AQLA 2WTEA 5L8RE 4ZHRA 3HOSA 4K8XA 1I50J 4B1YB 4XLPF 2LKPA 1E3MA 2DILA 1H1VA 2BDPA 3TOAA 3CC7N 2K79A 1R36A 3CPWP 2P9IB 1OH5A 2QGUA 5EGOA 4NS5A 2M0OA 2HTSA 1NEGA 3A8YA 4O4GA 1BA5A 2CT4A 3HL2A 2DU9A 1QWFA 1KEAA 3TQ7P 2W04A 3IH4A 3CF5F 4FJXA 2XHBA 1YS7A 1YBYA 1N5YA 1V3FA 4LD5A 3OTOK 1TUCA 3THKA 1X3UA 4OMFB 3P38A 1PUEE 1KFZA 3AVCA 1X69A 5GANj 3BY5A 1APLC 2PUKB 2XPUA 1RLPC 3H9QA 1QP2A 1VYVA 5LL6S 2ZGYA 2UXCK 2EILH 4LE9A 4DQ2A 3IRXA 4XU0A 4XAXB 3KP3A 3H6ZA 3S3NA 2V9VA 1DKGD 1T6SA 1T0HA 1PSEA 1ETVA 1KC8U 7AT1B 2L4AA 3I56T 4WX9A 3EPZA 1VZ0A 3GEZA 4B1RA 3X26B 4CC3A 4BQQA 4JRKA 3V4GA 3TR8A 1QE1A 4JP0A 2KDZA 3RPUA 4EVVA 4ISFA 1GOAA 3ZSYA 4EM2A 1SFKA 1TL1A 4DW6A 3ZXSA 2O61A 2HHSA 2K5FA 2F8SA 4DUZK 2OI3A 4BJTA 3WU1B 3MKYB 3WU2C 3AY9A 2VQCA 4RM3A 4Y1CA 5GAN8 2E4HA 2E2PA 3BR5A 1D5VA 3VESA 4BQNA 1XQOA 3CXCS 3LAPA 1R8OB 3BDUA 4YOQA 1KG2A 1TLHB 4M78E 1XMXA 4DR1K 4W5QA 1Y07A 5DD8A 1K4US 2LRQA 2XRIA 3C94A 1XNIA 2IA0A 4ZYDA 3DPTA 1MGQA 2DOAA 1VSFA 2EJGA 2E5KA 4DTSA 3JCMX 4OFHA 4M77D 5EEAA 1T05A 2P0KA 1RESA 2A36A 1OEBA 1ETWA 4JD2A 1HQCA 1QHHD 2EW3A 3EL2A 2EQMA 3SUQA 4KDPA 1J53A 2DERA 2CDTA 2ZXHA 2B8AA 4AHRA 3LSTA 2JWTA 4N76A 4BL0B 3VGKA 1J5EK 5AQXA 4DIQA 2QEXI 4AFUC 5IH2A 1MUDA 4UY8O 4PJOE 1JKHA 1SAUA 3KHYA 1YJWI 4AFQC 3EUHA 3I33A 1I1GA 5IYCJ 2PN6A 3H5RA 2R7ZJ 2PG4A 3OYEA 2G8UA 2BHZA 3WUHA 2O8FB 1HUXA 2NLXA 1F1BB 1PU8A 1NOZA 4N0AC 1YX3A 1I27A 2DJQA 5AIPA 2DTIA 2CGKA 2Q2EA 2Y1JA 1NK5A 4CDGA 2VUMJ 1T33A 1QQOA 1VQ4Q 3EQLF 1X1CA 3MXJA 1E2XA 4GVMA 4PSXA 3PX4A 1QMCA 3IC7A 2M0CA 1OKRA 2FBIA 5F08A 1OV3A 1HLUA 2LLKA 2XK0A 4M77F 1RGIA 3P9IA 3DLLF 1HKCA 4M7XA 1LEAA 1IXSB 4XSZF 3RSEA 2PJRB 5LRSA 4KMFA 2JWLA 3ABUA 1YJ9Q 2NZTA 1KQSS 2X78A 1X2MA 4DQSA 4E70A 3TCJA 1GLNA 4CZHA 1FYLA 3RCOA 2LP5A 1X9SA 1BR1A 2L2PA 4UV9A 3MQ0A 4KN7X 2NUPB 4FWNA 4FZXC 2KKOA 2BVLA 2LT4A 4G7ZF 3OYLA 4BRDA 1D9FA 5GMKj 2HDAA 2I5JA 3KLEA 1VQ5I 2AO9A 1K8AR 4UUSB 4H0TB 4PHTX 4WFAL 1Z6TA 5FKKA 3RYPA 2ELJA 2R7SA 3URGA 4IJNA 1Y1VJ 3W2VA 2WC9A 3TSPA 1I39A 2HNZA 4ILHA 1RDUA 2VGNA 1WJFA 3TW7A 1BM9A 1LJ9A 4IIMA 2RHUA 1TK5A 1G2HA 2CQ7A 2P9KB 2CZ1B 3REBB 4DTMA 4LC9B 5C12A 2L0AA 2KNBB 2NS0A 3UWNA 5F0XA 4F2RA 5CHIA 4H8KA 1QVGA 5JVTA 1Q82U 1IRZA 5J2QA 1KQSM 1LE8A 1FZPB 1LW0A 3ZL7C 3DWLE 3JAMZ 1N5ZA 4OWRB 3M7GA 3MKLA 2RQVA 3ME9A 9ANTA 2RMOA 1RKTA 3RZOJ 4JLGA 5EX5A 1NTCA 1L3LA 1Y56A 2E19A 3ULEB 3G1JA 5AZJA 3CCUT 2DA9A 1ETYA 4G7OF 2A5YB 3VA3A 2JS2A 1SFEA 5JLFA 2DLLA 4WYBA 3IWFA 3A0HC 4PJ0C 4AIDA 3HOVJ 2XAHA 1MDMB 1B34A 1U9NA 3HBTA 2HHQA 2J6KA 3MDQA 4Q47A 2CUDA 1NBEB 1NG7A 4CEFA 2KHMA 3G0QA 1R71A 2ZJ2A 4KHUA 4XTUA 2PYJA 1VYUA 1NJWA 8AT1B 2UXDK 3IAS2 1YRNA 3SYZA 1E0EA 2V26A 3K4JA 4FM2A 2OX7A 2X3WD 4PUOA 4LSNA 2SEMA 4FK2A 1UDLA 1J0RA 2KJCA 4LLLA 1PNJA 4DEXA 2A40A 2V1XA 2ESNA 2BY1A 4U87A 3BTIA 2CS3A 1VSEA 1UHMA 3MD2A 1O7FA 1ZGAA 3QBWA 1E3OC 1BCMA 2QWOA 5SZTA 1ODDA 3FFKB 2JMCA 3NARA 2DD4A 2RV8A 9ATCB 3TKYA 3KKSA 1IKYA 1VSLA 5D5WB 2HXIA 5HKCA 2FRWA 3WVEB 2H3EB 1W97L 3CW7A 2FE3A 4H5VA 2D5VA 1MMAA 4M45A 4R55A 3TWHA 2LSNA 4M3XA 4NCBA 4XM3A 2HZTA 1Y6IA 1K83J 2RA2A 5AYFA 2AXLA 3BWGA 1D0YA 2L02A 2ACJA 1RNLA 3V9UA 3THXB 3P7NA 1YXQA 3C6AA 4CRIA 4L9JA 2X4JA 4WQ5A 4C8QG 5C3EJ 4XK4A 5E3NA 2HNIA 1VQ7A 3MO8A 1Q7YU 2QA4N 3THYB 2ME0A 2X9HA 4UV8A 3VQDA 4B9TA 3GOIA 2LP0A 4JQFA 1U0JA 1T3LA 4XRSA 1YYVA 2OPPA 2PVGB 2VBYA 1HNWK 2W40A 2LQWA 2HHHK 2EPDA 1AKHA 5F1JA 1ZBLA 4ELUA 5M5XJ 4BUPA 3UKGA 3JAME 1RDWX 3AVLA 5FU6C 2HKQB 1YQAA 5M1OA 1I3AA 3L09A 3ZETB 3PJRA 5GAN2 1QQCA 3CCJI 3X25B 1KAYA 1KU2A 3RKXA 2NVUB 1S72A 4HT9A 1YHQA 4XNFA 1QZZA 2A6TA 3IG1A 3DP7A 4L0YB 3OYHA 4KFCA 3J80E 5LMNK 1NK6A 2F4MB 4IHXA 4A4FA 4A0YA 5CO7A 2E1NA 3ULQB 2M9UA 2CZ0B 3AVBA 5HRSA 4O5FA 3L3UA 2QXFA 3KP6A 3WGIA 1TNSA 3J80K 4DV5K 4B9QA 4FYXB 5CKHA 3LSJA 2PJPA 3O8GA 3A01A 3F23A 2Y75A 2HF4A 4ON0A 1V55H 3C7JA 5HK0A 1JUSA 3O6WA 3A2FA 2LFBA 2ATCB 4E6RA 2ECBA 2M3AA 1FTTA 4C0GA 1BA1A 4MZTA 3X20B 4H4MA 1VQMA 4M7AC 4B8XA 3CMYA 3KLFA 1YI2A 2FQ4A 5FLMJ 1KVBA 3G25A 3J8AA 2F5TX 2A61A 1KO9A 1IXDA 3VPZA 4FSXA 3P4IA 1IGNA 1ZR4A 2FBXA 1T98A 1P59A 5TRDA 2EYWA 1KQ8A 2KIFA 3ZT0A 5C10A 2Q0RA 1VQNA 1CQTA 2CFXA 2E5NA 4F16A 2NOLA 2FF4A 3V42A 5FLVA 4KIGA 2OTLT 3BF1A 4IO9F 2OQGA 2D1XA 3RR6A 4UUTA 1NJXA 2CQXA 3WG9A 2PY5A 2L3PA 3OR2C 1W7PA 4MDWA 4CXFA 4NXMK 1ZYQA 4RM2A 5J47A 2ME6A 2GUPA 4HLXA 3F5TA 4A61A 3QOEA 2HPMA 3CWUA 1WHHA 4Z4HA 4E47A 4DWIA 2BOLA 1MH4A 1K8AC 2GTOA 3RRHA 1FJGK 2R57A 4JDSA 4CCHA 2FA5A 3AO2A 1QVGS 2Z2SB 4AMCA 3G1MA 3M0UA 3FWEA 5I2MA 4CECA 3QQAA 2HNYA 3M6GA 3KUFA 2IW5A 2PLYA 4C3JJ 3PNYA 1HOMA 4BKXA 2JZYA 4FLZA 4CCNA 1NGHA 4BY1J 3TP0A 1TUGB 4PLIA 3QEWA 1OX8A 3QNNA 5LL6Z 3ERMA 3THVA 1EH6A 5J40A 2JM8A 5IOZA 4KHSA 4B21A 5HLFA 4EIAA 4RGSA 4ZC3A 4LH4A 3VEYA 4DA4A 3IL2A 3PUBA 2M8GX 1R1UA 3KETA 3QMLA 5FRNA 2F2EA 2DLPA 3EE9A 3DTEA 1R6RA 4LD9K 3HEFA 1ZHFA 1X27A 3QWYA 3TARA 1IREB 3EUAA 1T6CA 4FJJA 2MWOA 3CMEA 3DRPA 2KIQA 3KLIA 1FN7A 4S04A 1YW7A 4C9YA 1QVGM 4CZFA 4AHSA 4KIFA 3GUDA 1WLJA 1RT5A 4XQ3A 1OFCX 4PDKA 5JR3A 4BHBA 2VOPA 4HUEA 4Y28E 2DMQA 2QEXN 1IN5A 4M7DE 2MH2A 3PO3J 5EZHA 2C0IA 4JOMA 4AUXA 2LX7A 2DL8A 4V2SA 3THWB 4CIGA 4OIRF 2IAIA 4GLKA 5B1BH 4ORZA 1TYQB 2PI0A 4QW2A 3MP6A 1A6QA 1E3HA 4TVRA 1NK3P 4Y7NJ 4CJSA 1FYMA 2XVCA 1VFCA 2L4MA 2CUBA 1ZYRF 1FBSA 1YJNT 2QWWA 4RAZA 3CIPA 3ZQLA 1HNIA 1QP3A 2IA1A 2NYSA 3TPQA 3ABKH 1JUMA 1JRIA 4C0DB 1TH7A 4EMKB 2YX6A 3KLNA 1RBUA 3J80O 1AZGB 2E5ZA 2P6TA 5GAOn 1NK2P 3FLGA 1GLCG 2EBIA 4DK9A 2HGCA 2XY7A 2M9HA 1YAGA 2MBFA 2OPTA 3FMSA 3SZ2A 1X3ZB 3TW6A 4CICA 4L0ZB 4OB1B 3O9RA 2K9SA 3VEOA 2HVQA 3AAQA 5GAOp 2EB7A 4M42A 1KJWA 1OCZH 4PJLA 4DV2K 1OMIA 1W6XA 4MQ3A 2B63J 3B6CA 2DMUA 1SRMA 1QCOA 2QM3A 3H1CA 4PGGA 3LSKA 3OMCA 2YI1A 2Q2RA 2E65A 3MEVA 3S17J 1GCPA 3OW2P 4IOXA 2HQ5A 5DY9A 4C92C 1XX5A 1V5GA 1VQ5N 2GXGA 4M74A 1HK9A 4JJCA 1UB4A 4GLMA 3RVCA 1XC9A 2O8BA 3VENA 2KT8A 2VQGA 4GW6A 2K3YA 1JT0A 3KTUA 2ZSHB 2CUZA 5C6SA 2I10A 4LF7K 4BNCA 4PQUA 3K7AJ 2NNWA 2EGCA 2NS8A 3S1MJ 3GFJA 1PVEA 1IV8A 1SD5A 1SVLA 5A2QZ 1SVMA 3CCLT 1KGSA 3IHUA 2COMA 3NGZA 4N47A 4QVZA 3K70C 1V5EA 3I9QA 2V9KA 1E6HA 2NXNB 3QBXA 1GBQA 2QUFA 1MGTA 5GAN3 3WEEA 3GFMA 1K8KA 4JJDA 1BOTO 3K6GA 2DY4A 3F70A 3QPLA 3INZA 3VETA 3V1QA 1UGSB 1VQOA 4M3BA 3T3FA 4BRIA 2DCEA 4ESFA 5D5XB 1KONA 2KP6A 1NYFA 3I5RA 3QINA 2W6KA 2ZBKA 2XHIA 3K4LA 4MDAA 1LFBA 1O75A 5J2MA 3KNTA 3LQRA 1FIAA 5ADXH 1USSA 1MUZA 3ERED 1YJWQ 1LEBA 4ASNA 2V8IA 3RQ4A 1UAAA 2JXBA 4NZGA 3ZX2A 3BLYA 4CERA 3CCUI 3HOWJ 3BC8A 2J05A 5J8CA 3KK1A 4BQAA 2NRHA 3OGDA 3CCYA 1ZKGA 1NGCA 1M1KU 3NHGA 2EYQA 1HKGA 3PGGA 2HWVA 4E7SA 1EH7A 2O4GA 3MXIA 4FSSA 4BI8B 1I5OB 4OMMA 2W25A 3KP2A 2AQEA 3CCSA 3ZCMA 1R00A 2VJ4A 2XDDA 4BRHA 1YF5L 1RACB 2W42A 2Q36A 3ZMSA 3ZX3A 1KG5A 5F0FA 1X3WB 3OH6A 1V76A 3BF3A 1NGGA 2YU3A 1GLJO 3A8LB 4G9ZA 2DRMA 2K2MA 4FTHA 1TW3A 4FM4B 2VE8A 4E0DA 2X6YA 2LRDA 1NGBA 1PC0A 3H08A 2LR8A 2LT1A 4M7DB 4IXAA 4JKDA 3O5BA 3BTJA 2VASA 3H3VK 4CZZA 1YWOA 1WRJA 1YIJT 3SWNC 4K41A 5FD5A 3CJCA 3T69A 4KGXB 3M0RA 3E1YA 1I6XA 5L3GA 2HOSA 4BRMA 3V1OA 1P7IA 4F4KA 1V1CA 3PIOA 1CXQA 1VQ5Q 3HJEA 4L5IA 4DFMA 1JJ2P 4Y17A 3DPUA 4AFSC 2DO3A 5CYVA 1EJ9A 4I7HA 3RBBB 1ZHIA 1WLPB 2HBWA 2RD1A 3L2CA 3KEYA 5AQMA 1VYTA 1RRSA 1B6AA 2HZDA 4M78D 2DXCA 1LQ1A 5A0DA 4DG1A 4FLUA 3ZQCA 1XGMA 4M3GA 1IG9A 4H0YB 1XN7A 2WSFE 1I1SA 1QCNA 2IA2A 4UC4A 4M7AA 1X2QA 2JJ9A 3FB9A 3TMOA 1K78B 1O3SA 1JLFA 4XKVA 4NB4A 1FY7A 4Y13A 1ARKA 1PYVA 1SEUA 4CJVA 5K5QA 4A2UA 3BG6A 1YI2T 1C0FA 4DTOA 3TQNA 1N36K 2R7VA 3M53A 3AO1A 2H3JA 2PMZN 2KKZA 1HPZA 4IX7A 2FSWA 4RCCA 1ZX6A 3L1AA 4EW0A 3SFMA 4AIKA 1IG8A 3CCJN 4DS4A 2NVYJ 1ATNA 3CBOA 5IPAA 1ZBJA 4ZN1A 3I4PA 1A31A 2RK1A 4B9NA 5ICCA 4C30A 1OISA 3TAEA 2DTUA 4CCLA 3FXQA 1WXTA 3I5UA 2I2LA 2HQAA 3VQ6A 3HC7A 4R1HA 1RC9A 4M78F 4C5EA 2MABA 4NC7A 3RQIA 4KHPK 4NQWB 1P7MA 1VQLN 4BR7A 2ZFWA 1YFNA 3LLRA 1JI8A 1NK9A 1BGXT 4ILGB 3JRIA 3CMAQ 2GWRA 1SKSA 3QPHA 1OKJA 2HZYA 1HYZA 2FPDA 3CC2A 2FSJA 2GQIA 5CY4A 3JS6A 3H1VX 3QFUA 2LD5A 2D1KA 1GLEG 3FRNA 3EFOA 3P8BB 1RFQA 3NMUA 4XKCA 3CLQA 4A3CJ 3PUFA 3FGUA 4BRQA 1ITYA 5D8KB 3MZYA 4CFCA 2FHDA 5CPRB 1SV5A 3A0BC 5GINA 1JLGA 2CYZB 5FFXA 2YNGA 1BIZA 4NYFA 1R7JA 3KE2A 1ZA1B 5IOYA 4K2EA 2JTVA 2K57A 2WA0A 1PVSA 1C1CA 3KJVA 3K10A 3PO5A 3EYZA 3M57A 4PJOF 2NUTA 4MMLA 3ZQIA 1B92A 3ZQHA 3QU3A 2HKXA 1W5TA 1Z9CA 3WTSC 4RTXA 5GMKl 2KZZA 4CH7A 3RZDJ 4XLFA 4X6AJ 4XKBA 4OMOA 1NEBA 2W6LA 4A57A 4H0PA 3CCRA 4M3RA 2R5ZA 2OTLI 4GKKK 2QENA 2L7ZA 1S6QA 3VYUB 3CWAA 4DUYK 4IFYA 2B6AA 1HW2A 2UXBK 3RNJA 4J9GA 2GELA 1PRLC 1VNDA 1NGAA 2HHVA 1R0CB 3TU4K 3MVPA 2EJRA 2YXYA 2FMYA 3VYHB 2KAFA 1QSSA 4KNYA 2NWMA 1Q81R 3GNFB 3NGIA 3SPYA 4N4GA 3U9GA 2HF3A 5AQTA 1SFXA 1OPCA 4GV3A 3PY8A 1LKXA 5K7FA 1U5TA 4NHJA 2LMJA 2E7XA 4JBAA 5H1SQ 1WHMA 2DN0A 3E6CC 3VPRA 1N6AA 3JRAA 4F7UA 3TTDA 4YIFA 2O0YA 2RN2A 3E9FA 4YORA 1CZBA 1GLFO 5JS2A 4ISEA 3ZN0A 1JEGA 1EF4A 3ZT3A 3M4YA 1QZEA 4F91B 5E84A 2JRMA 3RMDA 3NTIA 3BTLA 1UMQA 3EHQA 3EKSA 3B6OA 1SL0A 3CJRB 3CCQT 3U3GA 1WCMJ 1K9MR 2H3GX 3RSNA 4RTUA 3ALYA 4WCGA 2HDDA 3ZQQA 4C2TA 3VQPA 4L3QA 1H0MA 2HAXA 2DPDA 1BI0A 3BE3A 4JX6A 4HF1A 4JUVA 4C92A 2Y1IA 3ZSOA 3ZT4A 3CCET 1M8VA 2E6NA 1F21A 4IRGA 3LWIA 3V6DA 3EYIA 1H9TA 2BV6A 1NMDA 3FMQA 4KMUX 2W41A 3KP7A 1UA1A 4XBFA 1K73U 1ZBXA 5HRRA 4A5BA 4O0JA 2YSQA 3I3LA 1VUBA 3OMYA 5CR2A 1M90C 2DZCA 3TO9A 1TOVA 3VEPA 3LAJA 5L23A 1MBKA 1HA8A 4PJMA 1KG4A 4F8RA 2W1OA 2YLCA 3UF4A 3O9UA 4IUPA 5CKFA 2IVOA 4HTUA 4PA1A 4B3XA 4FU6A 4WQ4A 2RN7A 1YJNI 4I6MA 4MLHA 4RB1A 1XTAA 5E41A 3OOUA 1AWCA 3R6OA 2F2VA 4F14A 4H4OA 1JHFA 3FKIJ 1KC8R 3VEVA 2RHKA 4XLHA 3SNNA 1VSHA 2CS7A 4AYBA 2DF6A 2R7XA 3LPUA 3DJCA 3QYFA 4FE4A 4B24A 4PJNA 1VQOT 3AAPA 1BWFO 2DX1A 4R8HA 3TABA 1ZUYA 1G3SA 4LUEA 3LL3A 2CH5A 2YX4A 3CMMA 3I55T 2NVXJ 1I07A 4WF9L 1OCRH 3GTLJ 1FC3A 4LFUA 3I56Q 4OINF 1OCTC 2RAEA 4HVUA 2DBMA 3VYTB 5KH6A 1UELB 1HKQA 1WGSA 1KD1U 4PKGA 2CP2A 1K8AO 4O8UA 1UECA 2D0BA 3LSMA 5FKMA 1DT9A 2IS4A 1FP1D 3PL8A 5DLQE 2CREA 2KMUA 3F8CA 4PSWA 4UB8C 4R0KA 3EG1A 4B3OA 2A6EF 3CBPA 1IDYA 2FEIA 2NVQJ 1KU7A 3EAEA 3W2AA 3A5MC 4FXDA 3G6EA 4C1NI 5AFUH 3DLHA 4LF5K 3LYIA 1E4GT 5EOYA 5AQJA 4BI4A 2OV7A 2RNAA 3CCST 3KFWX 2HB5A 2HMIA 2UUBK 2A6AA 4MO4A 5J6XA 3JSOA 2HD0A 4M75A 4I02A 2ZXWH 5GMKi 3DXMB 3FZFA 4Z89A 3CCLI 5H20A 1RRQA 4G1QA 2BUPA 4IURA 5J4VA 4XICA 3H92A 2ZM6K 4OMQA 3SWNA 3HHTB 4A3BJ 4EJVA 1T08B 4LDYA 3SMPA 4JKHA 4Q4ZF 2OU2A 3DF8A 1S8NA 1GFDA 2OTJN 4EMHA 1VQ9Q 4BEHB 4A3JJ 3E6BA 5GAOm 4B3SK 4M77C 3N5BB 4G7HF 2SRCA 1TQMA 4ICLA 1RABB 5EDNA 2EQRA 5JICA 4B9LA 5BR8K 5BOXA 2P0QA 5CK9A 1ZSZC 2QGGA 1UA0A 1BBYA 4WXCA 3S6WA 1RAFB 2GOXB 4X62K 2EINH 2C0OA 2UXXA 1FBQA 4FX4A 3UPUA 4X34A 4RB2C 2BTFA 1QO0D 4D5CA 3FZHA 2IVNA 4J9EA 3NTHA 5K1YA 3AAFA 2P5GA 5E26A 4FJIA 1TKDA 2EV6A 5EC7A 2XROA 2C06A 3BDPA 4A54A 4DSFA 5CVJA 3E97A 1RAAB 3NVKA 3LA3A 3CD6A 5KRSA 4B3TK 3G4SA 2KK4A 3FSPA 3M55A 3IUOA 3HPOA 4FJNA 4OPJA 2FOWA 3WTYC 2X35A 3TDZC 3LWLA 2R7OA 2PBDA 3O3GA 3OBYA 2F1LA 2G3RA 2FC0A 4AHCA 4CJLA 1HJRA 1MMDA 3V4IA 1FMVA 1SMYF 2LNHB 2VVKA 4L59A 1HJOA 5KPTA 1H88C 3CDHA 3GLXA 3H41A 1GVJA 3K5MA 3P8DA 4EJZA 5E18F 1FK9A 4QTRA 4DR4K 1YIJI 2Q31A 1J7KA 5DCMA 4OPAA 2CSIA 4M63C 3E3VA 4NL3A 1T44A 3S2DJ 2R7DA 2K3BA 3DRRA 2OQRA 2A7YA 2DNUA 4RAFA 1TK0A 2VGMA 2FD5A 2DOFA 4OJRA 2P9UB 3MP8A 4ZTJA 4YRVA 3GCMA 1Q82R 4G8XA 2PTKA 1RBRA 3UB5A 3SUNA 1MBHA 2ZGWA 4EJYA 3QG1A 2JT4A 5J1EA 1NJIU 4BBRJ 3D5SC 4L5GA 2OANA 2R3SA 4CSWA 2VG7A 5F1RA 2K9LA 2MPXC 1RI7A 2R5AA 3WXLA 4WXDA 3K59A 3RR8A 4U67L 3WE2A 1ZGJA 1WFWA 4YFKF 3HXMA 2KYBA 3N0UA 2RQWA 3GW2A 3CWTA 1L3UA 2E2OA 2VODA 4MEYF 4C5IA 3BT9A 4EV0A 3MZ8A 3UATA 2Z9OA 2JTEA 2ENMA 2P9LB 2A5WA 1DEJA 2CUEA 2NRZA 1YI2I 1ORKA 4M7DD 3QERA 2YNIA 2UUZA 3JB9J 2ABKA 1C6VX 2I5UA 1S5LC 4DEYA 5CYQA 2FPFA 6AT1B 2OF7A 2VYPA 3L9FA 2EYZA 3CCUQ 2ID6A 1HCRA 4JLHA 1VQNI 1Y0UA 1RI9A 3KLGA 4EPCA 3NRVA 1LNXA 5GAN5 5H6RA 2KZMA 3FX3A 1OU9A 5IHKA 3DLEA 1M30A 2MC3A 2Z3YA 4F3OA 4CJPA 2K3XA 2I7NA 4C3HJ 5FGMA 4CJFA 4DTNA 3T7ZA 3HPGA 2DBKA 3I0WA 3ULDA 5B1AH 2IS6A 1NLPC 1TKXA 3HOYJ 4CF2A 2Y31A 3NHNA 4M3WA 1VRLA 1VQKT 2WAEA 1YO5C 1UG1A 2VG5A 3B73A 1J6ZA 2D0NA 1KYWA 5C25A 4I9LA 2D0CA 4IOAL 4M7DF 5TISC 1EBMA 2D1VA 5E3LA 2DPNA 1LFUP 2E5LK 3HM9A 3Q0UA 3N05A 1HSTA 3T9NA 3VOEA 1PU7A 1QVFA 3RUXA 4BY7J 1S22A 3K5LA 1KQSP 2PUOB 2Z1HA 2YPRA 3IWZA 4CC2A 4N9HA 2V1NA 1JXBA 2DA4A 4CEAA 1S6LA 4DZJA 2PX9A 5HS7A 4HW0A 1Q7YR 2WB1A 2OTLN 1MH3A 4A0ZA 5J1YA 4IRIA 4DBRA 1NMNA 4LDXA 3CPFA 1WIEA 2UUCK 2HTJA 1F1ZA 5BQTA 2IGNA 2XG8D 5J1RA 2YCHA 2R7QA 4OP0A 3CMEI 5EYRA 2XIGA 3L2RA 3FXRA 3PIPF 4J9DA 2W0ZA 3OYMA 1IGQA 5DV5A 2F9WA 4YTLA 4OMYA 5LJ3g 1IF1A 1N39A 1S7AA 4MLOA 2QI2A 1X19A 2IGMA 1WSHA 2RI5A 4CZEA 1M3CA 3E2UA 1V29B 2F69A 3A8OB 3LWFA 4IUTA 1WGXA 4LF9K 4QOZB 4OFEA 2AT1B 3AFHA 3NQOA 3VQ8A 3ZSZA 4QAGA 3CC4A 3VWBA 3KWGA 3KK3A 4JX5A 4HEA2 4RW7A 4A4GA 2PBIA 1VQ8A 4JI6K 5FPMA 3NBPA 4OLAA 5CAIA 2H27A 2DA7A 1XUPO 4B47A 3TSQA 2HYFA 4XL9A 1IB8A 4DV6K 3FXUA 5HRPA 4LDWA 4C2UA 2Q8KA 2R58A 4A3DJ 2WOMA 5B8HA 3FZKA 2O8DA 4U88A 3HM8A 2XB5A 2E8AA 3LH0A 3CCQI 4E1JA 4J5YA 3SI6A 3CQXA 3NTKA 1OOTA 4FIBA 3H3OB 1QVTA 2JPSA 4DV7K 3UE5A 1BU6O 2PQ8A 4Z2YA 4PFOA 2LY1A 4MEXF 3TANA 3RMAA 1REVA 1M1FA 1JL2A 2LVMA 1BIUA 5JVHL 3EHRA 3GIBA 2G8VA 3CCEI 1ERDA 3ROUA 4J00A 5HL7L 2VOOA 4KTZA 1NZ9A 4DSEA 3KLHA 3OYGA 4DYCA 4KHNA 1SFOJ 3LWMA 5AZIB 3OJUA 4E19A 3ECHA 1A5WA 4AVZA 3OYFA 5CR4A 1QSYA 1H3ZA 4D9JA 1ITGA 4CD3A 3HRGA 3IV5A 3KD5E 3JRFA 2QQBA 3Q7BA 2GGRA 1B9DA 5BRDA 3HOTA 3SQNA 4CC4B 1YJNN 3QPSA 3ZQGA 2E41A 3OQ5A 2XHKA 3G0ZA 2PVDB 1RT2A 3FK6A 3L8BA 2P81A 3FZMA 3HZJA 2RF2A 4CJ5A 2QBYA 2D0PA 4FWMA 2BY3A 4YOXA 3KK2A 3MEAA 2IXSA 3V8JA 1E17A 4XN3A 4ZDLA 1I3QJ 2OTLQ 3CCMT 3JCMJ 4GBQA 4I98B 3IH2A 3L2QA 1N8RU 4M77A 2M5WA 1M1GA 3VS7A 1Z7UA 3DLLA 3MXMA 1UJYA 3EGUA 1D8KA 1YTUA 1RTIA 4FT8A 2IVWA 3RR7A 2QKLB 5FROA 2L3SA 1YVNA 1VQOI 1FSEA 1SHFA 4UHTA 2EZIA 1YITA 5BN9A 1IO2A 1K0SA 3I55I 1VQ6T 3I53A 1IC8A 4FVMA 2DAQA 1Z0XA 2M4KA 3M0TA 3NMZC 4A3FJ 1Q82C 2D1HA 2M87A 1VI0A 4CCOA 3LCNA 4CHNA 2EFOA 2DKGA 3U4LA 4A59A 4HNTA 3UA7A 4HX7A 1X43A 2YJEA 1OQYA 5GAMg 2KRNA 1XMQK 4AG1C 1BA0A 2COZA 1Q1VA 4N56A 4N4NB 2OZMA 4AD9A 1OI1A 3ATUA 2NVTJ 3CCLN 3CCSI 3RWUA 2GFUA 4B4CA 1SAXA 1S6PA 2KFZA 1BYMA 2VKEA 3EKUA 3ISPA 1ETQA 2YJFA 3EGDA 1VAZA 3M8RA 3B6PA 3OOPA 2I0NA 3EGXB 5LJ3f 4JS5A 1WI3A 1W4MA 3OHRA 1MWMA 3P83D 3HFOA 2DYIA 5LJ3e 1H89C 4XIDA 1S1NA 3CERA 5GAN7 3KP4A 2NOZA 3E9GA 5C0MA 1WXBA 4YOYA 1TTHB 3VYRB 4BC5A 2YKMA 1W5CC 3O9QA 5K7ZA 5KCOA 2QKKA 2DA2A 3F8NA 1LDJA 4CBWA 3CYMA 3CO7C 4IFEA 2Z1JA 4JS4A 2P4WA 4DF8A 1FJLA 2EPFA 4FJ8A 3PVQA 5TKWA 3H35A 1WZ2A 4FPBA 3EY1A 1WKMA 2QA4T 3SDGA 1YJNQ 4LDVA 4ELYC 2E71A 2JW4A 1J75A 1VQ7N 1RDAA 4H0EA 2IS3A 4RTYA 5KQ8A 4C8QE 4YEJA 1MKMA 4CFBA 3NH0A 4ANJA 2WAQA 3DLKA 2G8IA 1VIEA 3LSRA 5IHIA 3AVAA 3EN9A 3GE1A 4BRLA 2OPQA 1WI7A 1QKWA 2VBWA 2WWYA 2ZJQL 2UWMA 3NDKA 1S1WA 2IP2A 3RYRA 1OVQA 4M3ZA 3VQQA 5EY4A 1XC5A 1YIJN 3F72A 4CK1A 1CLQA 2O8DB 2KL4A 1I5ZA 4EGYA 1FYKA 4AH9A 2IGKA 4FYVB 1GXQA 1QVGP 1QVFM 4UVBA 4IFVA 4M9SA 3FXKA 3MCZA 2KDSA 1MJAA 1EFNA 4DTRA 1K0XA 1X75C 2WACA 2VONA 4E7JA 4BGDA 4O55A 3SQ2A 1PD1A 1Z91A 5DD4A 3CCLQ 3EH2A 3H5NA 4II1A 3ZMDA 4IZ9A 3O5ZA 3NCIA 1KVCA 2DODA 4OGCA 2LDMA 1W0UA 4Q48A 1Q9XA 3SPZA 2F8TA 2YX7A 3LQQA 5LEKA 1GOCA 1U9OA 4FZYA 4KTQA 3E6MA 3PNTA 1YI2N 5EXWA 4QQ6A 2OAWA 4CHZA 4BDYA 2KT1A 1YQKA 1RR7A 5C15A 1U47A 5GAOq 5DM6L 1G3YA 3RMSA 3U23A 3ZEUB 1M1KR 5CHZA 5GADJ 4OAYA 3JCMV 5I9EB 1VQNN 4MZPA 1ZG5A 1A0NB 4FLTA 4AHTA 3SQ4A 5FU7C 1NG2A 1WH7A 4CCKA 2MLGA 3H1QA 3E0JB 5LJ3d 5GAMf 4LFCK 4KI4A 1Q1HA 3CJBA 2BW3B 3WTVC 1ZSZB 1VQ4A 2LX9A 5GAMe 3O6BB 2F4OB 4LY7A 1B8IB 4E9HA 3CFPA 2TRTA 4HX8A 1JT6A 4DSIA 5GAGJ 4K0KK 2NRTA 4FJ7A 2E60A 2QDLA 3FM3A 3MN2A 3DFGA 2GAUA 2XY6A 3LWHA 1JL1A 4B6MA 1BCOA 4QVCA 4B1UB 3WXKA 4LLNA 1YJ9A 3W6JB 1IRXA 2E1MC 3CC4T 1XDUA 1E6GA 1H641 1GLLO 4DF4A 1R1VA 3I4NJ 1C0WA 5E1WA 2R7FA 1YFHA 1QNTA 3G71T 5SWMA 2UU9K 3K70D 1VQKI 2V52B 5M3FJ 3QB0A 2JUGA 4YOTA 1CZAN 1U2VB 2HQNA 2GXAA 1AHJB 4BG8A 2IS1A 4EDUA 4XQFA 2DEQA 1MA9B 5HDKA 1L3SA 3F6VA 1N3CA 4BJ6C 3ABLH 5DDGA 4B23A 5JFRA 2V7FA 2ZGZA 4A3IJ 4M3YA 1XC3A 1UG0A 3K0LA 5KCMA 1Q86U 3GTOJ 4DYRA 1WI9A 5FB2A 4RW8A 3CMEN 3TAPA 4V2GA 3K2AA 3A2KA 4C8QB 4ID5A 2LQKA 4ESJA 2QEXT 3DLBA 1J5YA 1HMVA 1Q81O 1F36A 3CPWS 3PFYA 3NF6A 3ZSRA 4FJKA 4M78C 4XTZA 1QWEA 2ZPBB 4BXUA 4HVJA 1X2NA 1A5VA 3QJYA 3U8XA 4J8OA 2AHQA 2EIMH 1IN6A 4AT1B 4XSXF 3EUKL 2FBKA 2O2OA 2DL3A 4JK9A 3V9XA 4C3IJ 3OB9A 1M9SA 3MCAB 2KW4A 1GFCA 4B1WB 4MFDA 1N33K 4F7UE 2VCPA 3L2UA 3HSRA 1BL3A 4CD1A 4LUDA 5CJ9A 2VYTA 3FXLA 1SS6A 2W85A 5AQOA 1FXXA 2K9QA 2ZJPL 2O8EA 1HXDA 4A12A 2OAZA 1D1BA 1IHVA 1PP8F 4FLXA 4HSRA 3AVHA 1Y8QB 1Z9QA 4FJLA 1IW7F 3ZOBA 1BU1A 1D8JA 4F92B 4L18B 3MEXA 3CCQN 4PJOC 2NS7A 3U3YA 4HV5A 3WXJA 1QTMA 4JNEA 1G59A 4NC6A 2V9PA 2YLBA 5DLOA 2ZMEC 3VQ7A 4LDUA 2ZFUA 2D6FA 1I5LA 1QHTA 5C2FA 4ZYAA 3PX0A 4CI6A 4OIOF 2DDAA 2UYTA 2D2WA 1HNZK 3CCEN 4L9TA 5JHFA 2L54A 3IKVA 4IEIA 4J2DA 3LA7A 3C0CA 4JHDA 5GAMd 2HYJA 4BU2A 4YOWA 3O3FA 4CESA 4P1WA 1KFSA 2JSPA 4IZZA 3ATVA 1WQ7A 3CCVT 3FHNA 4CJ4A 1ASWA 1NK0A 3WXIA 3RESA 1RI0A 4BWJA 1IRFA 3GTKJ 2X6XA 2L01A 4GKJK 4Y52J 4BQOA 1Z6RA 5LY3A 2P9IA 4J6XA 1C0MA 3FXMA 2ELHA 5D6WA 1QVPA 2X4XA 2YNHA 4OKEA 1HR0K 3DXJF 2H8HA 4FQGA 3I59B 4LFBK 1T6DA 1U1TA 4EJUA 1TBXA 1HW5A 5EZGA 5GAMh 2YHTA 3DBRB 5KQDA 3TGNA 5JS1A 2CSQA 1RIOH 1WB9A 3L2VA 2JA5J 3GDQA 1S7OA 3E5UA 4K42A 1LWCA 1XPXA 3OYKA 5AQYA 4DB3A 2P9PB 2Z16A 3CCMI 4RTFD 3RKYA 1VQON 2YHWA 3MN9A 2IDOA 3AO4A 3REOA 3LFKA 3CXCA 4K25A 2DT7B 2HSEB 3IH7A 1X4OA 4N4HA 2HEOA 5EG0B 3K9JA 2LF7A 3BR0A 3VQEA 3NGYA 4A0XA 2DPPB 1CSKA 3CJ9A 4FWLA 4BB7A 1UJ0A 1VQ6I 4Y91A 1WFXA 2P5LC 3SV4A 1U2WA 4FETA 3S16J 5IT9E 4LD0A 1REPC 1VQPT 4WCIA 4WWCA 5E8IA 2KLAA 4X66K 4G9YA 4YY3K 1QKXA 4R5PA 2JPCA 1HX1A 2DK8A 2KISA 5IT9K 3FXJA 4M75E 3CCSN 1OCPA 2XGCA 2KQRA 2R5YB 1EKEA 3O4QA 3CUQB 2GA1A 3SDZA 4BGAA 1CXUA 5AQIA 3FJ5A 4RTWA 3RRGA 3CCQQ 2LZ6B 3CJTB 3PSFA 4I9QA 3HRUA 1NE8A 3M4OJ 1M1KC 4N41A 3O1BA 1K73R 3IH3A 1YVUA 4E7KA 4MO7A 2GQQA 4EATA 1SRLA 4LK0F 1NM7A 2FO0A 1WYXA 1TVRA 3FEOA 2XAJA 2HR3A 2EQUA 1FP2A 3J7AO 3V81A 3CCEQ 2HBLA 1GL5A 3CM6A 2FBVA 2JA6J 3DKMA 5D7UA 3EEQA 3ZMUA 2V75A 1ZLMA 2QZ8A 4KH1B 1RT4A 1PUFB 3TO6A 1YUWA 4J9FA 4ZGEB 4UVAA 5IAYA 2W48A 1BI4B 2A37A 1PU6A 2QWNA 1JGSA 2HNHA 1IN8A 3C18A 3VSLA 3J81K 4FJMA 3OL4A 3OYJA 2O8FA 1WPKA 4PKIA 2J6OA 1D0ZA 2JZ2A 3O8MA 3GXOA 2FNAA 4ITVA 3D1NI 4X0GA 2QA4I 2XICA 2DL4A 3FC3A 2W24A 2G7UA 4KULA 4LOCA 4B3MK 4QQDA 4JI7K 3C6TA 2OC6A 2Y0MA 3SAGA 3LALA 3K4MA 3LNQA 3HKZN 4GY5A 5AQSA 4DGWB 2D0AA 4O6JA 4KH0B 3MMVA 3TTFA 1QRYA 3PIOL 4KTWA 3DLMA 4RCHA 4PNOA 1KD1R 2JRTA 3G73A 2DPUA 4OFAA 2IIMA 2PJRA 1C0TA 4Y3OA 5LGNA 3S41A 3UIQA 5KGWA 3I55Q 3ESWB 3CQTA 4WCEL 1XMKA 3M8EA 2DL7A 2ZJRL 4ZZLA 2Z0WA 2E1CA 3HYFA 1WOQA 1F43A 3ML6A 4JI4K 5AQZA 3AVGA 1WJCA 4NNJA 2NUPA 3H9NA 4J6YA 2QGFB 2COWA 4AIJA 2GEMA 3QESA 3QYGB 3VS4A 1VQLT 2KRMA 3KVGA 3QYBA 4JI0K 1VQ4T 4YFNF 4XRSG 2D9TA 4JRPA 2RH2A 3D2FB 1Q82O 2DJZA 4CF1A 1YE9A 3KLOA 5CIUA 2HHWA 3SBGA 5LJ3j 2M4GA 3HTRA 1SQKA 3C95A 3SBTA 5AQQA 2GX9A 1G6NA 2E35A 2XF6A 1NLOC 5K14A 3T0YA 2LTPA 4ENNA 4HCKA 2P9KA 1Z9ZA 3K2PA 4FCYA 4DOWA 2VIXA 3A5ZB 4XTWA 3W3CA 4B8AB 2LYCA 2DTZA 1YJ9T 1YG2A 3L2WA 2Z99A 1RRJA 4C0DC 4EMKC 1WBDA 1YTYA 5JVGL 2D45A 1XSXA 4IEJA 4B9VA 2M34A 3KYDB 4QQGA 1NK7A 1SL1A 3TU5A 3VUBA 2I7PA 1R0BG 3ELKA 4PFZA 1WBBA 5GTHC 4HBLA 1EX4A 4F2SA 4JPBW 3MN7A 2L9VA 1WSJA 2E36A 3R60A 5IT9O 3ULEA 4ZGJB 4CHUA 2X74A 4BQLA 2DW4A 2EFWA 3ZLJA 1WEIA 2MI6A 4Z4FA 4HNUA 1B9NA 2O6GE 3CCRN 2H8RA 4ELZC 4HX4A 1HKSA 1IH7A 4W97A 1UAXA 5B5EC 1O9SA 1KHCA 1MDMA 4M78A 2QSGX 2Y30A 2HBPA 4M6XA 4KT6A 3JCMP 2L2OA 4CJQA 2V6CA 2L8DA 1CZ9A 4DFJA 5L3FA 2HBMA 4I01A 2E6LA 1ABQA 1OVYA 2P5VA 3S1RJ 3EG9B 1XGOA 4XLEA 2DTOA 1N78A 2D8HA 1VQKN 4TSXA 4OF1A 3CC4I 1ZA2B 2CG4A 2PMUA 2K9MA 4A3LJ 1KG1A 3J81O 2V7YA 2D8JA 4KITB 3G71I 1DPRA 1JB0E 4I7FA 4DOVA 3HM5A 5KE2A 3ZGKA 4UNFA 4DSJA 1TUDA 1T8EA 1XB4A 4HF0A 4QIWN 1Q7YO 4IOCL 1ORNA 3ZEHA 3J7ZO 4ZYGA 1LCKA 4RMNA 2HHTA 1MHNA 2QK9A 1T0FA 5F64A 1KVAA 3ZYYX 5LGUA 3S2WA 5HLIA 1NJIR 1IUYA 3B02A 3SAFA 2BZYA 2DA1A 1KYZA 3K69A 3K1NA 2XKOC 3BUZB 1X1BA 3QWLA 2QQ8A 3WHCA 3THXA 5HRNA 4EZ6A 4L6V5 4JI3K 3DU5A 3O3HA 2DA5A 4JLIA 1EWRA 3P9CA 1QZ5A 4A2BA 3D45A 3M8SA 3THYA 1LWEA 4DCHA 3I0XA 1PDNC 4OLBA 2P9SB 4CYCB 3CC7Q 3OSFA 3CXCM 1LUJB 1ZBUA 3DM2A 3ZFJA 4QS8A 3F0ZA 5BRHA 4DU4A 4CGIA 4ZNXA 4IIOA 5GAMj 2OUMA 3L4QA 3QODA 4ZYHA 1ZK8A 1YJWA 4BE1A 1KQ2A 4IG0A 2HQXA 3GL1A 2JS0A 2P1JA 5TKYA 3WNEA 5DM7L 4CZMA 3ZETA 3JB9G 1M5Q1 1K6OA 1PG5B 2ASOA 4M7DC 3K57A 1BK2A 1ETOA 4QT7A 4AYBN 3QUIA 2WBMA 2WC2A 3TSZA 4DV3K 3E19A 3TI0A 4IHYA 4J9BA 2JVGA 1N27A 5FU7B 5CKDA 4H0OA 2VC8A 3N4PA 2CGHA 3H9JA 2FXAA 1M1EB 1J54A 4FJ9A 2HVHA 2LY9A 2QTDA 4AHVA 5HLHA 2RJCA 4C8QD 1UWBA 3RMQA 3DLGA 2E4LA 2DMNA 2EIJH 4NUBA 3OV8A 1G99A 3QHSA 2YKNA 4BC4A 4UXNA 3A98A 3L0QA 3U1DA 3U6FA 1B7TA 1K76A 4J9IA 1KU9A 3DWLA 5KTQA 1SSFA 2D5RA 4HVWA 3JRCA 4FX0A 5J3LA 3AVNA 4CEZA 2F5DA 1VQKQ 4DBQA 1CGPA 4E2FB 4DFPA 2AJQA 1S9HA 1WSGA 2EYXA 3CCVI 5AQWA 3G6EN 2E1MB 1ATRA 1OZ2A 3OVNA 1VQ5A 3VQ9A 1MJBA 2DVEA 1SVOA 4WK8F 1U5SA 1BR2A 3RPQA 2X1DA 1VSIA 1KD1C 4LXCA 4GY2B 5CQXA 1VSKA 3EG3A 5LBQA 1ON2A 2R7UA 2J7IA 3SD4A 2P51A 1NKCA 2DK5A 3DPLC 4DV0K 3OYAA 4AC0A 3UNGC 3S9HA 3J7AP 4F17A 1XD7A 3CCMN 2OTJT 3U1KA 5FKNA 2A68F 3A0IX 4FSVA 3TSWA 4C8QF 3QEPA 5CVIA 2JLEA 4YIIA 3WVDB 3C1DA 3P8HA 3HTSB 4DYQA 4JKFA 2CGLA 3BEXA 3QP5A 1VQ6N 4PIIA 1JUPA 1GCQA 2X0LA 3T1BA 3KXTA 4M78B 3I8BA 3NWTA 3CQYA 5J2NA 2CH6A 1LJOA 3PLAA 3KZYA 4KAZA 2EA2A 5GADP 1KZHA 2VWJA 1KQJA 1SKWA 2KRSA 1NNEA 1D1AA 5AFUA 2X51A 2F7TA 1VQPI 1W1FA 3WTWC 5HK3A 3JREA 4LG0B 3SJJA 4Q5SF 2UV1A 1TV6A 4DTUA 1LV5A 1XNRK 2KE9A 4XOPA 2YRDA 1EXQA 2JA7J 5D6YA 2P9NB 2CMPA 1ZXOA 2W82A 5GAGP 1LNWA 3CMAA 3OWTA 3SUOA 3OW2S 2D0OA 4B09A 3E5QA 1NGNA 2YHYA 2MSYA 1K61A 4PJOB 2CV2A 1C1BA 2HOAA 1L3VA 4JJBA 1BKBA 2R5MA 3D5LA 1P4WA 1R22A 4A5MA 1TC3C 4ESRA 2ZMEB 1DGRM 1SKRA 3M9AA 3EFRA 4YG2F 4JKGB 1AZEA 1SF9A 3WG7H 1UZCA 4PKHA 1WPYA 3THWA 3M54A 4C2MJ 1TYQA 3M8FA 1OULA 2L7MP 1JKOC 3IQLA 3WXMB 1PKSA 1MNDA 1X9JA 2UUAK 3LGLA 4Y4RA 4NL2A 4H0VB 3OL3A 2H56A 1N8RR 3TAGA 3FHGA 5ELZA 3PQJA 2ZXIA 3P5JA 4EMKA 3M0SA 1G3TA 3SFZA 2XDBA 2CSOA 1HC8A 2KGTA 2GZWA 2MD5A 2CP6A 3VEXA 3UA6A 2G0EA 2CGJA 5GMKm 2E70A 2F96A 1AWXA 2ZZDA 3OYCA 1CF7B 2E34A 2F4IA 2LG4A 1WNSA 2KZVA 2HSTA 3QYEA 3IMXA 1O4XA 2NAZA 3G7ZA 1ZTRA 1EV7A 5KYUA 3MKDA 2XO7A 2X4YA 4KGZB 1T7PA 3QZ9B 4FL6A 1VRTA 3JAMK 1WHUA 4GFBA 3OS5A 1RT3A 3GG4A 2JMAA 2A42A 4Y0WA 4DSLA 1S9EA 3M5RA 4KKOA 2K9NA 5KYWB 2HOTA 1LOTB 3HL8A 1SHGA 1QU3A 3AHUA 3KYLA 1XHZA 1Z05A 3W0LA 1AU7A 2DT5A 4ETSA 4M7AG 1VSMA 4BHPA 2R7RA 3QEVA 4WFNL 1VQLI 4KT0E 3MKZA 2P5KA 4ID1A 4NLCA 3BG5A 3HSFA 4I76A 4MIMA 1VQ4I 3HRMA 1UGRB 4CEDA 2RE2A 3FISA 2FRHA 2CV1A 3A5NC 5FLXZ 5AQNA 1ZLJA 2CH4W 4M72A 4CZCA 5FRMA 4YOUA 4OOIA 3P31A 1NKUA 3JCMg 4W1UA 1SMTA 2F5EA 4BC2A 3JCMc 1FMKA 4CGHA 2DXTA 1S7EA 3META 2JA8J 4RAGA 3FK7A 1YJ9I 3H0GJ 4JEPA 1M3HA 1QW1A 3K58A 1WJDA 2MOXA 1JJ2S 1BBZA 1M1KO 3VN5A 1PP7U 3UKRB 4RS8A 4I2QA 2CP3A 3FBNB 5C24A 3J7AF 2NRAC 4IUVA 1VSDA 4C8LA 1I4K1 1S1VA 8ATCB 2PVOB 4F04B 2W84A 2KRHA 3FHFA 4Y92A 1EH8A 2XKOA 4I0AA 3WE3A 3ZQ7A 1T3SA 2WB1N 1KHIA 1LPLA 3NF7A 2E88A 4AQYK 2PU9B 2O4XB 3SLCA 2WSEE 2FX0A 2K86A 3HT3A 4BY9C 3L7WA 4HOBA 5LJ5f 2BUDA 2KQ2A 2IOCA 2ZAEA 3SB2A 1R4MB 4RGUA 1AHDP 1HD3A 2EFPA 2QA4Q 3KWIA 3X24B 2VPRA 2H09A 3LDQA 5LJ5e 1LCUA 4F3TA 3NE6A 1R5GA 4HCZA 2JVVA 1EETA 5D6EA 3SEZA 1JQQA 5HOOA 4RGRA 2RQTA 1I0CA 1IN7A 2FLOA 4MLEA 3WODF 4N0AA 3D2EB 1BI2A 2ROTA 3CVTA 3CJNA 3CF5L 1KRPA 3QIOA 3FBIB 5GANh 3DB3A 2NRXA 4A5AA 2ASMA 1TWCJ 1R77A 3CC4N 3VB2A 1HLVA 3I56A 4IG3A 1V4SA 2I8DA 3FR0A 4DBFA 1KG7A 4IHSA 2CH4A 3G71N 3OYDA 4M7DA 2X6WA 2RPNA 3JRBA 1F9NA 2HQRA 3SQ0A 4Z0UA 2FF6A 5HBMA 1JXEA 1KTQA 3RI4A 2Q3SA 1DUXC 1B3QA 4KT5C 4EMSA 3BZ6A 1BR4A 1D4XA 2NOJB 3TDUC 4NOYA 4D8DA 1MMSA 4KHYA 2WBNA 4BR5A 1D09B 2KT0A 1R1TA 1T3VA 1OLTA 1SANA 5JLXA 2FZCB 1BUPA 2X85A 3QEXA 2JN6A 3VQBA 4CGDA 2RHXA 4JI1K 1B72B 3AO3A 2FBYA 4AILC 3W6KB 4E7HA 3MX2A 2ID3A 2JTFA 3KEQA 5F27A 2UXNA 3LSHA 4DU1A 4CGZA 3JYTA 1NPPA 1ZRCA 1NLVA 2QXLA 3PIPA 2XF7A 2EJ9A 3OJSA 4F7UG 3JAMO 2VJ5A 3BG7A 1SZ2A 3M59A 5D8LB 1M90U 4DR6K 3HGGA 5HODA 4FT4A 1ORPA 2O9LA 4XMYA 3LOCA 4ME7A 2O5RA 3R0JA 5CVRA 2ZWHA 1VQ9A 3ITHA 3DMJA 1K78A 2FU4A 2XD0A 2QQ9A 4L5JA 4KRTA 1ASVA 2R7WA 2A3ZA 4ELVA 3VERA 4A6EA 2CV0A 4C5GA 3VQCA 2CP7A 3E6DA 3VF4A 2XIDA 1BJAA 4PKCC 1QQMA 5F0CA 2P7CB 5FWBA 3GO5A 4NLBA 3BY7A 1WUAA 3V8LA 3T1AA 1QHAA 1FEXA 4L9VA 4AFZC 2PYLA 3KTQA 1B59A 4PL7A 1NKBA 3WNHA 3K5NA 4B44A 2QAZA 4C92G 1DIZA 5LHHA 2Q0OA 3HSTB 2OD5A 3S2HJ 2DBBA 1TAQA 2EQKA 4LIVA 4EFHA 1T2KA 1X9WA 3EUHC 3OIPA 2YUNA 1LWWA 3IKMA 1NJYA 3SZPA 5KYUB 2EX3A 1RAHB 5AONA 1H8AC 5LRRA 1HDDC 4OKKA 1YCSB 1ZQ3P 3EE8A 1QVFP 3JCMf 1RR8C 3CG7A 2FZGB 1FOWA 4NQWA 5GAHP 4DTJA 1RLQC 2O7OA 1VSJA 2K7AA 2XU8A 2L5QA 1YITN 3T5XA 1XTDA 3JCMe 3QNOA 1K1ZA 4HSTA 3EG0A 2TDXA 4CA0A 1U84A 5GAN6 4JK8A 2GXBA 1HU0A 2MWPA 1UTIA 5BR9A 2DMPA 3V7RA 1T8IA 1B07A 4XTVA 1N8RC 3NPFA 5LJ5d 3GLLA 4RW9A 3CCVN 2EZHA 1Z3XA 1ZRDA 2M16A 4DTXA 2AS5F 3G71Q 3VS2A 3BG3A 4DBHA 2LKSA 4PY5A 1ZRFA 3SCXA 4KUDK 2DQRA 2DFHA 1CKBA 1Q86R 4E89A 2DQLA 2K5LA 3DLLL 3QDRB 4B08A 4RDUA 3ZMTA 3JCMb 3V1RA 2D0QB 1ZUKA 4AM6A 5AJ3K 2E2NA 1MSFC 3UR3C 3SDBA 2KIMA 1NK4A 3WQTA 4BAYA 1HQUA 1IXCA 3CMAT 5LJ5h 4HWIA 1GV5A 3KYCB 4HT8A 4RKUE 2E1OA 2GBZA 3FFIA 1NGJA 5BMZA 4CUGA 2OTJI 3AG1H 4DQ8A 3ABTA 1SD7A 2QEXQ 5IT3A 1ZBHA 2DYBA 4EJOA 5E3MA 3HSBA 4F3QA 4LNPA 1IZ1A 4J7FA 4BQZA 3PNWC 3JTHA 2LCCA 1Z77A 3GTPJ 4DHYA 2XDVA 5AT1B 1NM1A 3HFNA 2JGUA 1UHFA 2X1EA 5KRTA 1D3BB 4M75G 4XU1A 1DPUA 4IQJA 2VXZA 3G1LA 4KGVB 2DA6A 4LGWA 1WHLA 3CF2A 1VQ7T 2GOMA 3L42A 2NUZA 3BFMA 3CCUA 1VQPN 2LBFB 2IPQX 2RN8A 3QIPA 1POGA 1FOXA 1HYSA 1IKWA 1BC7C 3VW4A 5KYNA 3CP2A 3VQ4A 2RM4A 1RTJA 4RMOA 1ZQ1A 1WXUA 3E01A 1ZC6A 2DVJA 3I9V2 5TGTA 3OSSC 4E7LA 1WSFA 4WE1A 3ASNH 4C0ZA 5ERIA 2IC3A 1GXPA 5GJVB 1IKXA 1K6YA 1K73O 1A36A 2WAQN 3N4QA 4Q5WA 2K5CA 2FL7A 4M73A 5J3BA 1WJSA 2ED1A 5KYYB 3NH1A 2XDPA 3H46O 2Y48A 3F8MA 3OS2A 3DLRA 4FHTA 3HHHA 3GF5A 2V1RA 1S72T 5GIOA 3ABMH 1YHQT 1OH7A 3MN5A 3JRHA 2CQQA 2MW8A 1BB9A 3QKJA 2XY8A 1AD5A 5C2DA 3SMSA 3C6HA 3VYSB 1BDGA 4JKAA 3ZQFA 3T1HK 3MPUB 2LDUA 2EZLA 3FXOA 3K1MA 1JBMA 1FOKA 3I58A 4A4HA 3AT1B 4D1QA 3SEQA 4JKCA 3CCVQ 1P4AA 4CEBA 4CF9A 3M3ZA 3JCMd 1DP7P 4GV6A 2O8KA 4CHPA 1TK8A 3K4NA 4JK1X 2QWLA 4QKUA 2A07F 5A2QE 5K7HA 4NCGA 4CZIA 3AA2A 4U0YA 2AHJB 1YS6A 2ZPFB 3K2ZA 1KLMA 3T19A 2IPOB 3BCBA 3CO6C 2NNYA 1Y57A 2X4WA 2ZCFB 3CZ6A 1BW5A 1TT0A 1VQMT 1KD1O 2CGPA 4CIFA 1ATSA 4M71A 4BRFA 3JR9A 1TG0A 2DI3A 1MDUB 1RILA 4EQQA 4HDUA 3JCMh 1NBWA 2KBTA 4ZZDA 2JOYA 1S5JA 4FPAA 4WQ5C 1K7AA 3IS9A 3CQZJ 5ECAA 2BE5F 1RADB 2GNCA 2NOGA 1VQNT 3VV0A 4PJOD 1EZZB 1LOJA 2FPEA 1UB9A 3HSCA 2A6HF 5GAEJ 3EDPA 3ENBA 2HMPA 4IWVA 4BG9A 2HDWA 1OPLA 5HS9A 2KY9A 1G8XA 1TS9A 5DUIA 1E7OA 2BXZA 5LMUK 3LP1A 3Q3SA 4J6WA 3JSCA 2VJIA 4HLYA 5J39A 1GOBA 2CP0A 4FWQA 1VQ4N 4G6DA 2L3DA 1VQPQ 1D9DA 4LH5A 3H6EA 2O8CB 4X9CA