4B21A

Unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
207
structure length
207
Chain Sequence
SKDSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE DNA-3-METHYLADENINE GLYCOSYLASE 2
publication title Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase/dna
total genus 77
structure length 207
sequence length 207
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4b21A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4b21A01
4B23A 1PU8A 2NOHA 2JHNA 3FHFA 5AN4A 5KN9A 2NOBA 5KN8A 1YQMA 1FN7A 5CHZA 1KG4A 1WEFA 4EJYA 1LWYA 1NGNA 1YQKA 1KG2A 3CVTA 3D4VA 1N3AA 1M3HA 1KG5A 1HU0A 1XG7A 2YG9A 4OFHA 4EJZA 2NOIA 4UOBA 1N3CA 1KO9A 4DK9A 3CVSA 2JHJA 4EVVA 1XQOA 4AIAA 3N0UA 4E9HA 2NOLA 1YQLA 1M3QA 4OFAA 4AI5A 2NOEA 1KG3A 1MUNA 1ORPA 1LWVA 1P7MA 4YOQA 1P59A 1KQJA 4AI4A 1KEAA 3CW7A 4EA5A 1MUDA 2I5WA 2OFIA 1RRSA 2YG8A 4EA4A 1YQRA 3IHOA 1WEIA 2ABKA 1KG7A 2XHIA 1MUYA 3CWSA 1N39A 3OH9A 3CWUA 1VRLA 4E9GA 3N5NX 1XQPA 4B24A 3CWTA 3IH7A 1NKUA 4B21A 4E9FA 4EW0A 3I0WA 3F10A 3KNTA 4EW4A 3FSPA 2NOFA 3CWAA 3FHGA 1DIZA 1MPGA 4PIIA 3S6IA 1PU6A 4YPHA 5DPKA 1LMZA 3KTUA 2NOZA 4OFEA 1EBMA 4B22A 4E9EA 4UNFA 3I0XA 1PU7A 1PVSA 1WEGA 1ORNA 2JG6A 2H56A 1LWWA 3OH6A 3G0QA 4YPRA 3OGDA 1RRQA 3F0ZA 1KG6A 2OFKA 4HSBA
chains in the Genus database with same CATH superfamily
4B23A 1PU8A 3S3MA 2NOHA 2JHNA 3FHFA 5AN4A 5KN9A 2NOBA 4IKFA 5KN8A 1YQMA 1FN7A 5FRNA 5CHZA 1KG4A 1WEFA 3OYKA 4EJYA 1LWYA 1NGNA 3L2VA 1KG2A 1YQKA 3CVTA 3D4VA 3S3NA 1N3AA 3OYCA 1M3HA 3OY9A 1KG5A 3L2UA 1HU0A 1XG7A 3OYIA 3OS1A 2YG9A 1U84A 4OFHA 4EJZA 2NOIA 4UOBA 1N3CA 1KO9A 4DK9A 3CVSA 2JHJA 4EVVA 1XQOA 4AIAA 3N0UA 4E9HA 4ZTFA 4ZTJA 1YQLA 2NOLA 1M3QA 4OFAA 4AI5A 2NOEA 1KG3A 1MUNA 3OYGA 4E7HA 1ORPA 1LWVA 1P7MA 4YOQA 1P59A 1KQJA 4AI4A 2V75A 4E7KA 1KEAA 3S3OA 3CW7A 2W04A 4EA5A 3R2XC 1MUDA 4BDZA 3NNQA 2I5WA 2OFIA 1RRSA 3L2WA 2YG8A 4EA4A 1YQRA 3OS0A 3IHOA 1WEIA 2ABKA 1KG7A 2XHIA 3OYBA 3OYMA 1MUYA 3CWSA 5FRMA 1N39A 3OH9A 3CWUA 3OYFA 1VRLA 4E7LA 4E9GA 3OYDA 3N5NX 1XQPA 4B24A 3CWTA 3OYEA 3IH7A 1NKUA 4NZGA 3L2QA 4B21A 4E7IA 3LCNA 4E9FA 4E7JA 4EW0A 3I0WA 5FROA 3OYLA 3OYAA 4BDYA 3F10A 3KNTA 2W03A 4EW4A 3L2RA 3FSPA 3VW4A 2NOFA 3CWAA 3FHGA 4BE2A 1DIZA 1MPGA 4PIIA 3S6IA 1PU6A 3OS2A 4YPHA 5DPKA 4BE0A 1LMZA 3KTUA 2NOZA 4OFEA 4BE1A 4B22A 4E9EA 4UNFA 1EBMA 3I0XA 1PU7A 3OYJA 1PVSA 4BACA 1WEGA 1ORNA 2JG6A 2H56A 2JPSA 1LWWA 3OH6A 3G0QA 4YPRA 3OGDA 1RRQA 3F0ZA 3OYNA 3OYHA 1KG6A 2OFKA 4HSBA
chains in the Genus database with same CATH topology
4B23A 1PU8A 2NOHA 2JHNA 3FHFA 5AN4A 5KN9A 2NOBA 5KN8A 1YQMA 1FN7A 5CHZA 1KG4A 1WEFA 4EJYA 1LWYA 1NGNA 1YQKA 1KG2A 3CVTA 3D4VA 1N3AA 1M3HA 1KG5A 1HU0A 1XG7A 2YG9A 4OFHA 4EJZA 2NOIA 4UOBA 1N3CA 1KO9A 4DK9A 3CVSA 2JHJA 4EVVA 1XQOA 4AIAA 3N0UA 4E9HA 2NOLA 1YQLA 1M3QA 4OFAA 4AI5A 2NOEA 1KG3A 1MUNA 1ORPA 1LWVA 1P7MA 4YOQA 1P59A 1KQJA 4AI4A 1KEAA 3CW7A 4EA5A 1MUDA 2I5WA 2OFIA 1RRSA 2YG8A 4EA4A 1YQRA 3IHOA 1WEIA 2ABKA 1KG7A 2XHIA 1MUYA 3CWSA 1N39A 3OH9A 3CWUA 1VRLA 4E9GA 3N5NX 1XQPA 4B24A 3CWTA 3IH7A 1NKUA 4B21A 4E9FA 4EW0A 3I0WA 3F10A 3KNTA 4EW4A 3FSPA 2NOFA 3CWAA 3FHGA 1DIZA 1MPGA 4PIIA 3S6IA 1PU6A 4YPHA 5DPKA 1LMZA 3KTUA 2NOZA 4OFEA 1EBMA 4B22A 4E9EA 4UNFA 3I0XA 1PU7A 1PVSA 1WEGA 1ORNA 2JG6A 2H56A 1LWWA 3OH6A 3G0QA 4YPRA 3OGDA 1RRQA 3F0ZA 1KG6A 2OFKA 4HSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B23 A;  1PU8 A;  2NOH A;  2JHN A;  3FHF A;  5AN4 A;  5KN9 A;  2NOB A;  5KN8 A;  1YQM A;  1FN7 A;  5CHZ A;  1KG4 A;  1WEF A;  4EJY A;  1LWY A;  1NGN A;  1YQK A;  1KG2 A;  3CVT A;  3D4V A;  1N3A A;  1M3H A;  1KG5 A;  1HU0 A;  1XG7 A;  2YG9 A;  4OFH A;  4EJZ A;  2NOI A;  4UOB A;  1N3C A;  1KO9 A;  4DK9 A;  3CVS A;  2JHJ A;  4EVV A;  1XQO A;  4AIA A;  3N0U A;  4E9H A;  2NOL A;  1YQL A;  1M3Q A;  4OFA A;  4AI5 A;  2NOE A;  1KG3 A;  1MUN A;  1ORP A;  1LWV A;  1P7M A;  4YOQ A;  1P59 A;  1KQJ A;  4AI4 A;  1KEA A;  3CW7 A;  4EA5 A;  1MUD A;  2I5W A;  2OFI A;  1RRS A;  2YG8 A;  4EA4 A;  1YQR A;  3IHO A;  1WEI A;  2ABK A;  1KG7 A;  2XHI A;  1MUY A;  3CWS A;  1N39 A;  3OH9 A;  3CWU A;  1VRL A;  4E9G A;  3N5N X;  1XQP A;  4B24 A;  3CWT A;  3IH7 A;  1NKU A;  4B21 A;  4E9F A;  4EW0 A;  3I0W A;  3F10 A;  3KNT A;  4EW4 A;  3FSP A;  2NOF A;  3CWA A;  3FHG A;  1DIZ A;  1MPG A;  4PII A;  3S6I A;  1PU6 A;  4YPH A;  5DPK A;  1LMZ A;  3KTU A;  2NOZ A;  4OFE A;  1EBM A;  4B22 A;  4E9E A;  4UNF A;  3I0X A;  1PU7 A;  1PVS A;  1WEG A;  1ORN A;  2JG6 A;  2H56 A;  1LWW A;  3OH6 A;  3G0Q A;  4YPR A;  3OGD A;  1RRQ A;  3F0Z A;  1KG6 A;  2OFK A;  4HSB A; 
#chains in the Genus database with same CATH topology
 4B23 A;  1PU8 A;  3S3M A;  2NOH A;  2JHN A;  3FHF A;  5AN4 A;  5KN9 A;  2NOB A;  4IKF A;  5KN8 A;  1YQM A;  1FN7 A;  5FRN A;  5CHZ A;  1KG4 A;  1WEF A;  3OYK A;  4EJY A;  1LWY A;  1NGN A;  3L2V A;  1KG2 A;  1YQK A;  3CVT A;  3D4V A;  3S3N A;  1N3A A;  3OYC A;  1M3H A;  3OY9 A;  1KG5 A;  3L2U A;  1HU0 A;  1XG7 A;  3OYI A;  3OS1 A;  2YG9 A;  1U84 A;  4OFH A;  4EJZ A;  2NOI A;  4UOB A;  1N3C A;  1KO9 A;  4DK9 A;  3CVS A;  2JHJ A;  4EVV A;  1XQO A;  4AIA A;  3N0U A;  4E9H A;  4ZTF A;  4ZTJ A;  1YQL A;  2NOL A;  1M3Q A;  4OFA A;  4AI5 A;  2NOE A;  1KG3 A;  1MUN A;  3OYG A;  4E7H A;  1ORP A;  1LWV A;  1P7M A;  4YOQ A;  1P59 A;  1KQJ A;  4AI4 A;  2V75 A;  4E7K A;  1KEA A;  3S3O A;  3CW7 A;  2W04 A;  4EA5 A;  3R2X C;  1MUD A;  4BDZ A;  3NNQ A;  2I5W A;  2OFI A;  1RRS A;  3L2W A;  2YG8 A;  4EA4 A;  1YQR A;  3OS0 A;  3IHO A;  1WEI A;  2ABK A;  1KG7 A;  2XHI A;  3OYB A;  3OYM A;  1MUY A;  3CWS A;  5FRM A;  1N39 A;  3OH9 A;  3CWU A;  3OYF A;  1VRL A;  4E7L A;  4E9G A;  3OYD A;  3N5N X;  1XQP A;  4B24 A;  3CWT A;  3OYE A;  3IH7 A;  1NKU A;  4NZG A;  3L2Q A;  4B21 A;  4E7I A;  3LCN A;  4E9F A;  4E7J A;  4EW0 A;  3I0W A;  5FRO A;  3OYL A;  3OYA A;  4BDY A;  3F10 A;  3KNT A;  2W03 A;  4EW4 A;  3L2R A;  3FSP A;  3VW4 A;  2NOF A;  3CWA A;  3FHG A;  4BE2 A;  1DIZ A;  1MPG A;  4PII A;  3S6I A;  1PU6 A;  3OS2 A;  4YPH A;  5DPK A;  4BE0 A;  1LMZ A;  3KTU A;  2NOZ A;  4OFE A;  4BE1 A;  4B22 A;  4E9E A;  4UNF A;  1EBM A;  3I0X A;  1PU7 A;  3OYJ A;  1PVS A;  4BAC A;  1WEG A;  1ORN A;  2JG6 A;  2H56 A;  2JPS A;  1LWW A;  3OH6 A;  3G0Q A;  4YPR A;  3OGD A;  1RRQ A;  3F0Z A;  3OYN A;  3OYH A;  1KG6 A;  2OFK A;  4HSB A; 
#chains in the Genus database with same CATH homology
 4B23 A;  1PU8 A;  2NOH A;  2JHN A;  3FHF A;  5AN4 A;  5KN9 A;  2NOB A;  5KN8 A;  1YQM A;  1FN7 A;  5CHZ A;  1KG4 A;  1WEF A;  4EJY A;  1LWY A;  1NGN A;  1YQK A;  1KG2 A;  3CVT A;  3D4V A;  1N3A A;  1M3H A;  1KG5 A;  1HU0 A;  1XG7 A;  2YG9 A;  4OFH A;  4EJZ A;  2NOI A;  4UOB A;  1N3C A;  1KO9 A;  4DK9 A;  3CVS A;  2JHJ A;  4EVV A;  1XQO A;  4AIA A;  3N0U A;  4E9H A;  2NOL A;  1YQL A;  1M3Q A;  4OFA A;  4AI5 A;  2NOE A;  1KG3 A;  1MUN A;  1ORP A;  1LWV A;  1P7M A;  4YOQ A;  1P59 A;  1KQJ A;  4AI4 A;  1KEA A;  3CW7 A;  4EA5 A;  1MUD A;  2I5W A;  2OFI A;  1RRS A;  2YG8 A;  4EA4 A;  1YQR A;  3IHO A;  1WEI A;  2ABK A;  1KG7 A;  2XHI A;  1MUY A;  3CWS A;  1N39 A;  3OH9 A;  3CWU A;  1VRL A;  4E9G A;  3N5N X;  1XQP A;  4B24 A;  3CWT A;  3IH7 A;  1NKU A;  4B21 A;  4E9F A;  4EW0 A;  3I0W A;  3F10 A;  3KNT A;  4EW4 A;  3FSP A;  2NOF A;  3CWA A;  3FHG A;  1DIZ A;  1MPG A;  4PII A;  3S6I A;  1PU6 A;  4YPH A;  5DPK A;  1LMZ A;  3KTU A;  2NOZ A;  4OFE A;  1EBM A;  4B22 A;  4E9E A;  4UNF A;  3I0X A;  1PU7 A;  1PVS A;  1WEG A;  1ORN A;  2JG6 A;  2H56 A;  1LWW A;  3OH6 A;  3G0Q A;  4YPR A;  3OGD A;  1RRQ A;  3F0Z A;  1KG6 A;  2OFK A;  4HSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...