4B21A

Unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
207
structure length
207
Chain Sequence
SKDSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE DNA-3-METHYLADENINE GLYCOSYLASE 2
publication title Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase/dna
total genus 77
structure length 207
sequence length 207
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4b21A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4b21A01
3I0XA 1PU7A 1EBMA 4B21A 1WEGA 3I0WA 5CHZA 1KQJA 3N5NX 3S6IA 3N0UA 4PIIA 4UNFA 4HSBA 3CVSA 1WEIA 2JG6A 1MUNA 4EJZA 2NOLA 1RRSA 1MUDA 3F10A 1M3HA 3CWUA 5KN9A 1N3CA 4B24A 2OFIA 4YOQA 1MPGA 5KN8A 2NOIA 3D4VA 1KG7A 1XG7A 2YG9A 2YG8A 4E9GA 4EJYA 1NGNA 1ORNA 1YQMA 2NOHA 4OFAA 2I5WA 2JHJA 1M3QA 4E9EA 3FHFA 1YQLA 1KG5A 1KG3A 4B22A 5AN4A 4E9HA 1YQKA 4OFHA 3CWSA 1P7MA 3CW7A 3IH7A 3CVTA 1XQPA 1N3AA 2XHIA 1VRLA 4EW4A 1LWYA 2OFKA 1KG4A 4AIAA 1KG6A 4AI5A 3KTUA 1LMZA 3F0ZA 2NOZA 3CWAA 4YPRA 3OH6A 2NOEA 1P59A 1WEFA 1NKUA 1PVSA 1N39A 1YQRA 1KO9A 3G0QA 1PU6A 3OGDA 4AI4A 3OH9A 1LWWA 4DK9A 3CWTA 3FHGA 5DPKA 4B23A 1MUYA 4E9FA 1HU0A 4UOBA 2ABKA 2JHNA 4EW0A 4EVVA 4EA5A 2H56A 1RRQA 3IHOA 1KEAA 1DIZA 4YPHA 2NOBA 2NOFA 1LWVA 1FN7A 4OFEA 3FSPA 1ORPA 1KG2A 1PU8A 1XQOA 4EA4A 3KNTA
chains in the Genus database with same CATH superfamily
3OYDA 3OYGA 3I0XA 4ZTJA 1PU7A 1EBMA 4E7JA 4B21A 1WEGA 3OYMA 3I0WA 5CHZA 1KQJA 3N5NX 3OYNA 3OYKA 3S6IA 3N0UA 4PIIA 3L2RA 4UNFA 4HSBA 3CVSA 1WEIA 4ZTFA 2JG6A 1MUNA 4EJZA 2NOLA 1RRSA 1MUDA 3F10A 2W04A 1M3HA 3CWUA 5KN9A 1N3CA 4B24A 2OFIA 4YOQA 1MPGA 4E7KA 3L2QA 5KN8A 2NOIA 3S3NA 3D4VA 1KG7A 3LCNA 1XG7A 2YG9A 2YG8A 3L2UA 4E9GA 4E7LA 4E7IA 4EJYA 1NGNA 1ORNA 1YQMA 2NOHA 4OFAA 2I5WA 2JHJA 1U84A 1M3QA 4E9EA 3FHFA 1YQLA 1KG5A 1KG3A 4BE0A 4B22A 5AN4A 4E9HA 1YQKA 4OFHA 3CWSA 3OYAA 4IKFA 1P7MA 2V75A 3CW7A 3VW4A 3IH7A 3CVTA 1XQPA 1N3AA 2XHIA 3OYFA 4BE1A 3OS1A 1VRLA 4EW4A 1LWYA 2OFKA 1KG4A 3OYBA 4BACA 3S3MA 3OYIA 4AIAA 1KG6A 4AI5A 3OS2A 3KTUA 3L2VA 5FRNA 1LMZA 3F0ZA 3NNQA 4BDZA 2NOZA 3CWAA 4YPRA 2JPSA 3OH6A 2NOEA 1P59A 1WEFA 4E7HA 1NKUA 1PVSA 5FROA 1N39A 1YQRA 4BDYA 1KO9A 3G0QA 1PU6A 3OGDA 4AI4A 3OYJA 3OH9A 3R2XC 1LWWA 5FRMA 4DK9A 3CWTA 3FHGA 5DPKA 4B23A 3OS0A 1MUYA 4E9FA 1HU0A 4NZGA 4UOBA 2ABKA 4BE2A 2JHNA 4EW0A 4EVVA 2W03A 3OYHA 4EA5A 2H56A 3OY9A 1RRQA 3IHOA 1KEAA 1DIZA 4YPHA 3OYCA 2NOBA 2NOFA 3OYLA 1LWVA 3L2WA 1FN7A 4OFEA 3OYEA 3FSPA 1ORPA 1KG2A 1PU8A 1XQOA 4EA4A 3S3OA 3KNTA
chains in the Genus database with same CATH topology
3I0XA 1PU7A 1EBMA 4B21A 1WEGA 3I0WA 5CHZA 1KQJA 3N5NX 3S6IA 3N0UA 4PIIA 4UNFA 4HSBA 3CVSA 1WEIA 2JG6A 1MUNA 4EJZA 2NOLA 1RRSA 1MUDA 3F10A 1M3HA 3CWUA 5KN9A 1N3CA 4B24A 2OFIA 4YOQA 1MPGA 5KN8A 2NOIA 3D4VA 1KG7A 1XG7A 2YG9A 2YG8A 4E9GA 4EJYA 1NGNA 1ORNA 1YQMA 2NOHA 4OFAA 2I5WA 2JHJA 1M3QA 4E9EA 3FHFA 1YQLA 1KG5A 1KG3A 4B22A 5AN4A 4E9HA 1YQKA 4OFHA 3CWSA 1P7MA 3CW7A 3IH7A 3CVTA 1XQPA 1N3AA 2XHIA 1VRLA 4EW4A 1LWYA 2OFKA 1KG4A 4AIAA 1KG6A 4AI5A 3KTUA 1LMZA 3F0ZA 2NOZA 3CWAA 4YPRA 3OH6A 2NOEA 1P59A 1WEFA 1NKUA 1PVSA 1N39A 1YQRA 1KO9A 3G0QA 1PU6A 3OGDA 4AI4A 3OH9A 1LWWA 4DK9A 3CWTA 3FHGA 5DPKA 4B23A 1MUYA 4E9FA 1HU0A 4UOBA 2ABKA 2JHNA 4EW0A 4EVVA 4EA5A 2H56A 1RRQA 3IHOA 1KEAA 1DIZA 4YPHA 2NOBA 2NOFA 1LWVA 1FN7A 4OFEA 3FSPA 1ORPA 1KG2A 1PU8A 1XQOA 4EA4A 3KNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0X A;  1PU7 A;  1EBM A;  4B21 A;  1WEG A;  3I0W A;  5CHZ A;  1KQJ A;  3N5N X;  3S6I A;  3N0U A;  4PII A;  4UNF A;  4HSB A;  3CVS A;  1WEI A;  2JG6 A;  1MUN A;  4EJZ A;  2NOL A;  1RRS A;  1MUD A;  3F10 A;  1M3H A;  3CWU A;  5KN9 A;  1N3C A;  4B24 A;  2OFI A;  4YOQ A;  1MPG A;  5KN8 A;  2NOI A;  3D4V A;  1KG7 A;  1XG7 A;  2YG9 A;  2YG8 A;  4E9G A;  4EJY A;  1NGN A;  1ORN A;  1YQM A;  2NOH A;  4OFA A;  2I5W A;  2JHJ A;  1M3Q A;  4E9E A;  3FHF A;  1YQL A;  1KG5 A;  1KG3 A;  4B22 A;  5AN4 A;  4E9H A;  1YQK A;  4OFH A;  3CWS A;  1P7M A;  3CW7 A;  3IH7 A;  3CVT A;  1XQP A;  1N3A A;  2XHI A;  1VRL A;  4EW4 A;  1LWY A;  2OFK A;  1KG4 A;  4AIA A;  1KG6 A;  4AI5 A;  3KTU A;  1LMZ A;  3F0Z A;  2NOZ A;  3CWA A;  4YPR A;  3OH6 A;  2NOE A;  1P59 A;  1WEF A;  1NKU A;  1PVS A;  1N39 A;  1YQR A;  1KO9 A;  3G0Q A;  1PU6 A;  3OGD A;  4AI4 A;  3OH9 A;  1LWW A;  4DK9 A;  3CWT A;  3FHG A;  5DPK A;  4B23 A;  1MUY A;  4E9F A;  1HU0 A;  4UOB A;  2ABK A;  2JHN A;  4EW0 A;  4EVV A;  4EA5 A;  2H56 A;  1RRQ A;  3IHO A;  1KEA A;  1DIZ A;  4YPH A;  2NOB A;  2NOF A;  1LWV A;  1FN7 A;  4OFE A;  3FSP A;  1ORP A;  1KG2 A;  1PU8 A;  1XQO A;  4EA4 A;  3KNT A; 
#chains in the Genus database with same CATH topology
 3OYD A;  3OYG A;  3I0X A;  4ZTJ A;  1PU7 A;  1EBM A;  4E7J A;  4B21 A;  1WEG A;  3OYM A;  3I0W A;  5CHZ A;  1KQJ A;  3N5N X;  3OYN A;  3OYK A;  3S6I A;  3N0U A;  4PII A;  3L2R A;  4UNF A;  4HSB A;  3CVS A;  1WEI A;  4ZTF A;  2JG6 A;  1MUN A;  4EJZ A;  2NOL A;  1RRS A;  1MUD A;  3F10 A;  2W04 A;  1M3H A;  3CWU A;  5KN9 A;  1N3C A;  4B24 A;  2OFI A;  4YOQ A;  1MPG A;  4E7K A;  3L2Q A;  5KN8 A;  2NOI A;  3S3N A;  3D4V A;  1KG7 A;  3LCN A;  1XG7 A;  2YG9 A;  2YG8 A;  3L2U A;  4E9G A;  4E7L A;  4E7I A;  4EJY A;  1NGN A;  1ORN A;  1YQM A;  2NOH A;  4OFA A;  2I5W A;  2JHJ A;  1U84 A;  1M3Q A;  4E9E A;  3FHF A;  1YQL A;  1KG5 A;  1KG3 A;  4BE0 A;  4B22 A;  5AN4 A;  4E9H A;  1YQK A;  4OFH A;  3CWS A;  3OYA A;  4IKF A;  1P7M A;  2V75 A;  3CW7 A;  3VW4 A;  3IH7 A;  3CVT A;  1XQP A;  1N3A A;  2XHI A;  3OYF A;  4BE1 A;  3OS1 A;  1VRL A;  4EW4 A;  1LWY A;  2OFK A;  1KG4 A;  3OYB A;  4BAC A;  3S3M A;  3OYI A;  4AIA A;  1KG6 A;  4AI5 A;  3OS2 A;  3KTU A;  3L2V A;  5FRN A;  1LMZ A;  3F0Z A;  3NNQ A;  4BDZ A;  2NOZ A;  3CWA A;  4YPR A;  2JPS A;  3OH6 A;  2NOE A;  1P59 A;  1WEF A;  4E7H A;  1NKU A;  1PVS A;  5FRO A;  1N39 A;  1YQR A;  4BDY A;  1KO9 A;  3G0Q A;  1PU6 A;  3OGD A;  4AI4 A;  3OYJ A;  3OH9 A;  3R2X C;  1LWW A;  5FRM A;  4DK9 A;  3CWT A;  3FHG A;  5DPK A;  4B23 A;  3OS0 A;  1MUY A;  4E9F A;  1HU0 A;  4NZG A;  4UOB A;  2ABK A;  4BE2 A;  2JHN A;  4EW0 A;  4EVV A;  2W03 A;  3OYH A;  4EA5 A;  2H56 A;  3OY9 A;  1RRQ A;  3IHO A;  1KEA A;  1DIZ A;  4YPH A;  3OYC A;  2NOB A;  2NOF A;  3OYL A;  1LWV A;  3L2W A;  1FN7 A;  4OFE A;  3OYE A;  3FSP A;  1ORP A;  1KG2 A;  1PU8 A;  1XQO A;  4EA4 A;  3S3O A;  3KNT A; 
#chains in the Genus database with same CATH homology
 3I0X A;  1PU7 A;  1EBM A;  4B21 A;  1WEG A;  3I0W A;  5CHZ A;  1KQJ A;  3N5N X;  3S6I A;  3N0U A;  4PII A;  4UNF A;  4HSB A;  3CVS A;  1WEI A;  2JG6 A;  1MUN A;  4EJZ A;  2NOL A;  1RRS A;  1MUD A;  3F10 A;  1M3H A;  3CWU A;  5KN9 A;  1N3C A;  4B24 A;  2OFI A;  4YOQ A;  1MPG A;  5KN8 A;  2NOI A;  3D4V A;  1KG7 A;  1XG7 A;  2YG9 A;  2YG8 A;  4E9G A;  4EJY A;  1NGN A;  1ORN A;  1YQM A;  2NOH A;  4OFA A;  2I5W A;  2JHJ A;  1M3Q A;  4E9E A;  3FHF A;  1YQL A;  1KG5 A;  1KG3 A;  4B22 A;  5AN4 A;  4E9H A;  1YQK A;  4OFH A;  3CWS A;  1P7M A;  3CW7 A;  3IH7 A;  3CVT A;  1XQP A;  1N3A A;  2XHI A;  1VRL A;  4EW4 A;  1LWY A;  2OFK A;  1KG4 A;  4AIA A;  1KG6 A;  4AI5 A;  3KTU A;  1LMZ A;  3F0Z A;  2NOZ A;  3CWA A;  4YPR A;  3OH6 A;  2NOE A;  1P59 A;  1WEF A;  1NKU A;  1PVS A;  1N39 A;  1YQR A;  1KO9 A;  3G0Q A;  1PU6 A;  3OGD A;  4AI4 A;  3OH9 A;  1LWW A;  4DK9 A;  3CWT A;  3FHG A;  5DPK A;  4B23 A;  1MUY A;  4E9F A;  1HU0 A;  4UOB A;  2ABK A;  2JHN A;  4EW0 A;  4EVV A;  4EA5 A;  2H56 A;  1RRQ A;  3IHO A;  1KEA A;  1DIZ A;  4YPH A;  2NOB A;  2NOF A;  1LWV A;  1FN7 A;  4OFE A;  3FSP A;  1ORP A;  1KG2 A;  1PU8 A;  1XQO A;  4EA4 A;  3KNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...