4B21A

Unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
207
structure length
207
Chain Sequence
SKDSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords PROBABLE DNA-3-METHYLADENINE GLYCOSYLASE 2
publication title Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 77
structure length 207
sequence length 207
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4b21A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4b21A01
5KN8A 2JG6A 2ABKA 3FHGA 3KTUA 3N5NX 1WEFA 2NOZA 1KQJA 5CHZA 4E9EA 4EA4A 2NOBA 3OH9A 3CWTA 1YQKA 3OH6A 1KG4A 4OFAA 1FN7A 4EJZA 4E9GA 2NOEA 1WEIA 1PU8A 3D4VA 1LWWA 2JHJA 3FHFA 4EJYA 1KG3A 1MUDA 1N39A 1PU6A 2JHNA 4AIAA 3CWAA 1YQLA 2NOLA 3FSPA 2NOFA 4HSBA 4YOQA 3G0QA 4AI5A 1ORNA 4AI4A 1YQRA 4B24A 3S6IA 3OGDA 1KG2A 1PVSA 2H56A 2XHIA 4B22A 4OFEA 1HU0A 1LWYA 3CWSA 5AN4A 4DK9A 4YPRA 4B21A 1EBMA 1NKUA 2YG9A 1ORPA 4EW4A 5DPKA 3IH7A 3F10A 1KG7A 4E9FA 1KG5A 3N0UA 4YPHA 4EVVA 3CWUA 1KG6A 1NGNA 1M3QA 4PIIA 1YQMA 1RRQA 2OFIA 1VRLA 4EA5A 1N3CA 1N3AA 4EW0A 1PU7A 5KN9A 4UOBA 1LWVA 1MUYA 4E9HA 1XG7A 3I0WA 3CW7A 1P59A 2NOIA 1KEAA 1XQPA 1MPGA 1LMZA 2OFKA 1DIZA 3CVTA 1P7MA 1XQOA 1RRSA 2NOHA 1M3HA 1WEGA 1KO9A 4UNFA 2YG8A 3CVSA 2I5WA 1MUNA 3IHOA 3F0ZA 4OFHA 4B23A 3KNTA 3I0XA
chains in the Genus database with same CATH superfamily
5KN8A 4ZTFA 2JG6A 2ABKA 3FHGA 3KTUA 3OYIA 3N5NX 1WEFA 2NOZA 1KQJA 3OYKA 5CHZA 3OYFA 4E9EA 4BE2A 4EA4A 2NOBA 3VW4A 4BACA 3OH9A 4ZTJA 3OYLA 3CWTA 1YQKA 3OYGA 3OH6A 1KG4A 2V75A 4OFAA 2W04A 3L2UA 1FN7A 4EJZA 4E9GA 2NOEA 1WEIA 1PU8A 3D4VA 4BDYA 3S3MA 2JHJA 1LWWA 3FHFA 3OS1A 4EJYA 1KG3A 1MUDA 1N39A 4E7IA 1PU6A 2JHNA 4AIAA 3CWAA 1YQLA 2NOLA 3FSPA 3L2QA 3OYCA 4E7LA 2NOFA 4HSBA 4YOQA 3G0QA 4AI5A 1ORNA 5FRNA 4AI4A 3S3OA 1YQRA 3OYNA 4B24A 3S6IA 3OGDA 2XHIA 1KG2A 1PVSA 1U84A 2H56A 2W03A 4OFEA 4B22A 1HU0A 1LWYA 3CWSA 3OYJA 4E7HA 5AN4A 4DK9A 4YPRA 4B21A 3OYDA 5FROA 3OYMA 1EBMA 1NKUA 2YG9A 4BE1A 4BE0A 1ORPA 4EW4A 4BDZA 5DPKA 4E7JA 3IH7A 3F10A 1KG7A 4E9FA 1KG5A 4E7KA 3N0UA 3L2RA 3L2WA 4YPHA 4EVVA 3CWUA 3L2VA 1KG6A 1NGNA 1M3QA 4PIIA 1YQMA 3S3NA 1RRQA 2OFIA 1VRLA 4EA5A 1N3CA 3OYEA 1N3AA 3OS0A 4EW0A 5FRMA 1PU7A 4IKFA 5KN9A 4UOBA 1LWVA 1MUYA 4E9HA 1XG7A 3R2XC 3I0WA 3CW7A 1P59A 2NOIA 1KEAA 1XQPA 1MPGA 1LMZA 2OFKA 1DIZA 3CVTA 1P7MA 3OY9A 3OYHA 1XQOA 3OS2A 3OYBA 1RRSA 2NOHA 1M3HA 1WEGA 3LCNA 1KO9A 4UNFA 2YG8A 3NNQA 3CVSA 2I5WA 1MUNA 4NZGA 3IHOA 3F0ZA 2JPSA 4OFHA 3OYAA 3KNTA 4B23A 3I0XA
chains in the Genus database with same CATH topology
5KN8A 2JG6A 2ABKA 3FHGA 3KTUA 3N5NX 1WEFA 2NOZA 1KQJA 5CHZA 4E9EA 4EA4A 2NOBA 3OH9A 3CWTA 1YQKA 3OH6A 1KG4A 4OFAA 1FN7A 4EJZA 4E9GA 2NOEA 1WEIA 1PU8A 3D4VA 1LWWA 2JHJA 3FHFA 4EJYA 1KG3A 1MUDA 1N39A 1PU6A 2JHNA 4AIAA 3CWAA 1YQLA 2NOLA 3FSPA 2NOFA 4HSBA 4YOQA 3G0QA 4AI5A 1ORNA 4AI4A 1YQRA 4B24A 3S6IA 3OGDA 1KG2A 1PVSA 2H56A 2XHIA 4B22A 4OFEA 1HU0A 1LWYA 3CWSA 5AN4A 4DK9A 4YPRA 4B21A 1EBMA 1NKUA 2YG9A 1ORPA 4EW4A 5DPKA 3IH7A 3F10A 1KG7A 4E9FA 1KG5A 3N0UA 4YPHA 4EVVA 3CWUA 1KG6A 1NGNA 1M3QA 4PIIA 1YQMA 1RRQA 2OFIA 1VRLA 4EA5A 1N3CA 1N3AA 4EW0A 1PU7A 5KN9A 4UOBA 1LWVA 1MUYA 4E9HA 1XG7A 3I0WA 3CW7A 1P59A 2NOIA 1KEAA 1XQPA 1MPGA 1LMZA 2OFKA 1DIZA 3CVTA 1P7MA 1XQOA 1RRSA 2NOHA 1M3HA 1WEGA 1KO9A 4UNFA 2YG8A 3CVSA 2I5WA 1MUNA 3IHOA 3F0ZA 4OFHA 4B23A 3KNTA 3I0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KN8 A;  2JG6 A;  2ABK A;  3FHG A;  3KTU A;  3N5N X;  1WEF A;  2NOZ A;  1KQJ A;  5CHZ A;  4E9E A;  4EA4 A;  2NOB A;  3OH9 A;  3CWT A;  1YQK A;  3OH6 A;  1KG4 A;  4OFA A;  1FN7 A;  4EJZ A;  4E9G A;  2NOE A;  1WEI A;  1PU8 A;  3D4V A;  1LWW A;  2JHJ A;  3FHF A;  4EJY A;  1KG3 A;  1MUD A;  1N39 A;  1PU6 A;  2JHN A;  4AIA A;  3CWA A;  1YQL A;  2NOL A;  3FSP A;  2NOF A;  4HSB A;  4YOQ A;  3G0Q A;  4AI5 A;  1ORN A;  4AI4 A;  1YQR A;  4B24 A;  3S6I A;  3OGD A;  1KG2 A;  1PVS A;  2H56 A;  2XHI A;  4B22 A;  4OFE A;  1HU0 A;  1LWY A;  3CWS A;  5AN4 A;  4DK9 A;  4YPR A;  4B21 A;  1EBM A;  1NKU A;  2YG9 A;  1ORP A;  4EW4 A;  5DPK A;  3IH7 A;  3F10 A;  1KG7 A;  4E9F A;  1KG5 A;  3N0U A;  4YPH A;  4EVV A;  3CWU A;  1KG6 A;  1NGN A;  1M3Q A;  4PII A;  1YQM A;  1RRQ A;  2OFI A;  1VRL A;  4EA5 A;  1N3C A;  1N3A A;  4EW0 A;  1PU7 A;  5KN9 A;  4UOB A;  1LWV A;  1MUY A;  4E9H A;  1XG7 A;  3I0W A;  3CW7 A;  1P59 A;  2NOI A;  1KEA A;  1XQP A;  1MPG A;  1LMZ A;  2OFK A;  1DIZ A;  3CVT A;  1P7M A;  1XQO A;  1RRS A;  2NOH A;  1M3H A;  1WEG A;  1KO9 A;  4UNF A;  2YG8 A;  3CVS A;  2I5W A;  1MUN A;  3IHO A;  3F0Z A;  4OFH A;  4B23 A;  3KNT A;  3I0X A; 
#chains in the Genus database with same CATH topology
 5KN8 A;  4ZTF A;  2JG6 A;  2ABK A;  3FHG A;  3KTU A;  3OYI A;  3N5N X;  1WEF A;  2NOZ A;  1KQJ A;  3OYK A;  5CHZ A;  3OYF A;  4E9E A;  4BE2 A;  4EA4 A;  2NOB A;  3VW4 A;  4BAC A;  3OH9 A;  4ZTJ A;  3OYL A;  3CWT A;  1YQK A;  3OYG A;  3OH6 A;  1KG4 A;  2V75 A;  4OFA A;  2W04 A;  3L2U A;  1FN7 A;  4EJZ A;  4E9G A;  2NOE A;  1WEI A;  1PU8 A;  3D4V A;  4BDY A;  3S3M A;  2JHJ A;  1LWW A;  3FHF A;  3OS1 A;  4EJY A;  1KG3 A;  1MUD A;  1N39 A;  4E7I A;  1PU6 A;  2JHN A;  4AIA A;  3CWA A;  1YQL A;  2NOL A;  3FSP A;  3L2Q A;  3OYC A;  4E7L A;  2NOF A;  4HSB A;  4YOQ A;  3G0Q A;  4AI5 A;  1ORN A;  5FRN A;  4AI4 A;  3S3O A;  1YQR A;  3OYN A;  4B24 A;  3S6I A;  3OGD A;  2XHI A;  1KG2 A;  1PVS A;  1U84 A;  2H56 A;  2W03 A;  4OFE A;  4B22 A;  1HU0 A;  1LWY A;  3CWS A;  3OYJ A;  4E7H A;  5AN4 A;  4DK9 A;  4YPR A;  4B21 A;  3OYD A;  5FRO A;  3OYM A;  1EBM A;  1NKU A;  2YG9 A;  4BE1 A;  4BE0 A;  1ORP A;  4EW4 A;  4BDZ A;  5DPK A;  4E7J A;  3IH7 A;  3F10 A;  1KG7 A;  4E9F A;  1KG5 A;  4E7K A;  3N0U A;  3L2R A;  3L2W A;  4YPH A;  4EVV A;  3CWU A;  3L2V A;  1KG6 A;  1NGN A;  1M3Q A;  4PII A;  1YQM A;  3S3N A;  1RRQ A;  2OFI A;  1VRL A;  4EA5 A;  1N3C A;  3OYE A;  1N3A A;  3OS0 A;  4EW0 A;  5FRM A;  1PU7 A;  4IKF A;  5KN9 A;  4UOB A;  1LWV A;  1MUY A;  4E9H A;  1XG7 A;  3R2X C;  3I0W A;  3CW7 A;  1P59 A;  2NOI A;  1KEA A;  1XQP A;  1MPG A;  1LMZ A;  2OFK A;  1DIZ A;  3CVT A;  1P7M A;  3OY9 A;  3OYH A;  1XQO A;  3OS2 A;  3OYB A;  1RRS A;  2NOH A;  1M3H A;  1WEG A;  3LCN A;  1KO9 A;  4UNF A;  2YG8 A;  3NNQ A;  3CVS A;  2I5W A;  1MUN A;  4NZG A;  3IHO A;  3F0Z A;  2JPS A;  4OFH A;  3OYA A;  3KNT A;  4B23 A;  3I0X A; 
#chains in the Genus database with same CATH homology
 5KN8 A;  2JG6 A;  2ABK A;  3FHG A;  3KTU A;  3N5N X;  1WEF A;  2NOZ A;  1KQJ A;  5CHZ A;  4E9E A;  4EA4 A;  2NOB A;  3OH9 A;  3CWT A;  1YQK A;  3OH6 A;  1KG4 A;  4OFA A;  1FN7 A;  4EJZ A;  4E9G A;  2NOE A;  1WEI A;  1PU8 A;  3D4V A;  1LWW A;  2JHJ A;  3FHF A;  4EJY A;  1KG3 A;  1MUD A;  1N39 A;  1PU6 A;  2JHN A;  4AIA A;  3CWA A;  1YQL A;  2NOL A;  3FSP A;  2NOF A;  4HSB A;  4YOQ A;  3G0Q A;  4AI5 A;  1ORN A;  4AI4 A;  1YQR A;  4B24 A;  3S6I A;  3OGD A;  1KG2 A;  1PVS A;  2H56 A;  2XHI A;  4B22 A;  4OFE A;  1HU0 A;  1LWY A;  3CWS A;  5AN4 A;  4DK9 A;  4YPR A;  4B21 A;  1EBM A;  1NKU A;  2YG9 A;  1ORP A;  4EW4 A;  5DPK A;  3IH7 A;  3F10 A;  1KG7 A;  4E9F A;  1KG5 A;  3N0U A;  4YPH A;  4EVV A;  3CWU A;  1KG6 A;  1NGN A;  1M3Q A;  4PII A;  1YQM A;  1RRQ A;  2OFI A;  1VRL A;  4EA5 A;  1N3C A;  1N3A A;  4EW0 A;  1PU7 A;  5KN9 A;  4UOB A;  1LWV A;  1MUY A;  4E9H A;  1XG7 A;  3I0W A;  3CW7 A;  1P59 A;  2NOI A;  1KEA A;  1XQP A;  1MPG A;  1LMZ A;  2OFK A;  1DIZ A;  3CVT A;  1P7M A;  1XQO A;  1RRS A;  2NOH A;  1M3H A;  1WEG A;  1KO9 A;  4UNF A;  2YG8 A;  3CVS A;  2I5W A;  1MUN A;  3IHO A;  3F0Z A;  4OFH A;  4B23 A;  3KNT A;  3I0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...