4E7KA

Pfv integrase target capture complex (tcc-mn), freeze-trapped prior to strand transfer, at 3.0 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
366
structure length
366
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 96
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7kA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7kA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7kA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7kA03
2GBZA 3DLGA 3L2QA 2LRQA 4ZTFA 4HCZA 5KGXA 4B9XA 2Y1IA 3PX4A 1HRHA 4M3RA 2HHVA 1FXXA 2Z1IA 3VQEA 4CEZA 5J2NA 3QESA 2B8AA 3UWNA 1F21A 3NFAA 4OVLA 4AHVA 4Z4HA 5J1EA 3LWLA 1I3AA 2R7YA 3SUPA 1NKEA 1NJWA 3TARA 1KFSA 3OA6A 3PV8A 1TAUA 4YNQA 3ZT3A 1KCFA 2E4LA 4E19A 2IS3A 5KRTA 4M3TA 3K58A 1B92A 3M8RA 4B9TA 4M41A 3K5LA 4M3XA 3ZT4A 1L3TA 4KAZA 2HB5A 2P51A 4C5HA 4O5BA 4DSKA 1D9FA 3KLFA 4OJRA 1A5WA 1KVAA 1KTQA 3ME9A 2D0CA 3P8DA 3KK3A 4C8LA 2YHBA 5I42A 4FJ5A 5T7BA 3RR7A 1XC9A 3Q1JA 4EP4A 4Z0UA 4DTMA 4FZXC 2JZ2A 2FBXA 3LDSA 3LLRA 3EZ5A 3LZIA 4DQQA 4CESA 3DYAA 3PX6A 1NK5A 4B9SA 2CKKA 1NOYA 4FJIA 1SL2A 1VSKA 4KHUA 2AJQA 3DLRA 1C6VA 4E7IA 1OZ3A 1VK0A 4LD0A 2RHIA 4K8ZA 4CJFA 3OYAA 5KE3A 3I0RA 1WSEA 4FLZA 3B6PA 3PO4A 4Y1CA 4C8MA 4FK0A 4FCYA 3MEWA 3KK2A 2GFUA 4LSLA 2HNDA 1T7PA 1Z26A 3WNEA 3DOKA 1C0MA 3M8PA 4N4HA 3HPGA 3WNGA 3SQ0A 3HM9A 4KHSA 3AO1A 1RDBA 3ZSXA 4RW9A 1UAXA 3OS2A 2HQXA 1JLEA 2RF2A 3CFRA 3EAEA 3V6DA 2G8HA 4AILC 2KQ2A 3ZEHA 1C0TA 2OYQA 4F4KA 3VQ4A 4M3ZA 3IG1A 3QIIA 1VSFA 2FBYA 4BACA 4I9QA 3V1OA 4KPYA 4FJ8A 2LDMA 1K6YA 2MWOA 4QQ6A 4CF0A 4CF1A 4DMNA 3O8VA 3O3HA 4CHYA 1UA1A 4LH4A 4QCLA 3SUQA 4O0IA 1U47A 4A4HA 3PMIA 1IO2A 2DFHA 4Z4EA 2EHGA 1CLQA 5D6XA 4DLEA 1LV5A 2QKKA 3HO1A 4LH5A 4Z4IA 1RCHA 3NGZA 3MXIA 3QBYA 3ZSWA 4RW6A 2P5OA 4J2AA 5C6SA 4HCBA 3U3GA 4E0DA 3BGRA 2XO7A 4B9VA 3HPOA 3ITHA 1NJYA 2R5MA 4M45A 4DS5A 2PYJA 4C5GA 2RJDA 1BIUA 1IKYA 3T3FA 4FJLA 4CRIA 4DSEA 3MEAA 3DI6A 2X4XA 4CF2A 4CJEA 4J2DA 1KVCA 1XHXA 2NLUA 3QERA 4IG3A 5HRNA 1JLGA 2ZE2A 5FDLA 1QTMA 3VQ9A 3ZSYA 3NTIA 1W9HA 1EXQA 4A4EA 4DFJA 2PY5A 2R57A 3FFIA 5SWMA 3RRHA 1REVA 2RI2A 3AA5X 4O44A 3CFPA 2RKIA 4FU6A 4DQIA 4CGDA 3HPHA 4ELTA 4CF9A 4CJ3A 3OYMA 3QNNA 4CK2A 1W0HA 4CFCA 1L3UA 4HUEA 3V4IA 2XY6A 3OQ5A 4KHYA 1HJRA 1LW0A 1WSJA 2ETJA 1QS4A 2Z1GA 2BANA 4NCGA 3KLEA 4N41A 3PY8A 4CJLA 3CG7A 4FL6A 3V1RA 1C0UA 3VA3A 4FJJA 5FRMA 5KE2A 4M3WA 1JKHA 2OPSA 4E1MA 3DMJA 1HPZA 3AO4A 3QKJA 2XHBA 3VQAA 4WE1A 3SQ1A 4CEAA 1TGOA 3RMDA 3MP6A 1RBRA 1U49A 4DSIA 4IKFA 4B9WA 3PNWC 4GVMA 3L2UA 2W42A 2D5RA 3BDLA 4CFBA 3EYZA 4O4GA 3OMGA 5D6WA 3AVNA 4KTWA 4AHUA 3OYIA 4Q5WA 4CGGA 4DU3A 1N5YA 1TK0A 4DSJA 1Q9XA 4L8RB 2YRVA 3MEGA 2B5JA 3MXMA 1TKTA 4N4GA 3LPTA 4Z4FA 2OZSA 1BIZA 1BGXT 1J5OA 4PUOA 3RMCA 1L5UA 4AHRA 4DQRA 3MECA 4DU4A 4CE9A 4CJVA 3RTVA 3ULDA 3HSTB 3QEWA 1Q9YA 4QQDA 4DSLA 3L2VA 5CYMA 3LZJA 2WOMA 4DF8A 4BWMA 1A5VA 3E01A 1NK9A 4H8KA 3DLMA 2ATQA 2XRIA 4ELUA 3AA3A 2IAJA 4DFPA 1NK0A 4C8OA 1KFDA 2DIGA 1GOCA 3VQQA 4JRPA 3TAFA 3DRPA 3TR8A 1EKEA 2HNYA 3C4SA 3AO3A 4A4FA 5JS2A 3NE6A 1BCMA 4FJMA 3DLHA 3OS0A 3NHGA 3OY9A 2D0AA 2HQEA 2VWKA 4LD6A 4CIFA 3NH1A 4DFMA 4FJGA 2BGGA 1VSHA 4CK3A 3CQ8A 3RRGA 4CFAA 4BDPA 3T19A 3OYEA 4IG0A 4HUGA 5DK5A 3AVGA 1WN7A 1TL1A 3AVCA 3IRXA 3M8QA 4ZHRA 3LWMA 3DOLA 5CIUA 4DLGA 2E6NA 4PLLA 3AVHA 3TAPA 1C1AA 3HJFA 3LP2A 1OI1A 4IBNA 1N6QA 4FVMA 3A2FA 1J53A 3OMCA 2OZMA 3UIQA 5KH6A 3VQ8A 3T1AA 3TAGA 3S3MA 3AO5A 3DLKA 4CEBA 5IN1A 1NKCA 4ELVA 4KHWA 4W5OA 3PO5A 1YVUA 3H8ZA 2X6NA 2P5GA 2HMIA 2XK0A 4CCHA 5FRNA 4Z4GA 3OB9A 2DY4A 3H08A 3NF7A 2DIQA 5CYQA 2XDPA 4DTOA 1TAQA 2RJCA 3LX7A 2O4GA 4DU1A 2KFZA 1EX4A 2RN2A 2HW3A 1JL2A 5M9OA 1QE1A 1VSDA 3ZSRA 1ZBUA 1XWLA 5CZ2A 3VQ5A 2YNFA 3L42A 4KRFA 3CM6A 4FM2A 4DTPA 3OYBA 3SV3A 3TANA 3F73A 4B9NA 1WLJA 1WNSA 4OVAA 1O1WA 4RG8A 4CJWA 1RT2A 1VSIA 4HUFA 1NK6A 4N4IA 1QSLA 1WSHA 4FW2A 2L3RA 3O3GA 4RW4A 3NGYA 3F9KA 4DFKA 3LPUA 5HRPA 1B9FA 4ID5A 4OKKA 4C5IA 3AVBA 4I2QA 2KTQA 4OGCA 1WSIA 3I8DA 4KB1A 4IURA 1WJQA 4CJRA 3V9UA 4LSNA 4BDZA 1S5JA 2I5JA 1G15A 3E9GA 1LWFA 2O4IA 4FK2A 3I0SA 5KI6A 4OLAA 3PFSA 3NNQA 2G8UA 3OYFA 2HHTA 3DB4A 2Z1HA 2ZQBA 4B8CA 3DB3A 4E1NA 3K5NA 3MEDA 4CJSA 1S1VA 4H4MA 4M3UA 2OPQA 1RBSA 5HLFA 1BISA 3H6ZA 2QQSA 4DTXA 3VN5A 2XY8A 3O3FA 4AHCA 2NUBA 2JLEA 1WAFA 3DRRA 3AVMA 4UQGA 3HYFA 3QEXA 2G8WA 2LSNA 4FW1A 2RO0A 3V1QA 4CGHA 4IUTA 2IGIA 4EP5A 3HT3A 2BKDN 3OJSA 1JLFA 1RT3A 2FHDA 3KK1A 4KFBA 5J2MA 4QVZA 2DFFA 2EQMA 3DLEA 3NBPA 1VRTA 2VYTA 1S6QA 1IKVA 1HYZA 1TVRA 1RDCA 2GV9A 1KLMA 4FLVA 4B8AB 3E9FA 4IDKA 2A1RA 1NK4A 4FLTA 2JTFA 2GF7A 1SKRA 3SUOA 5D6YA 4CHPA 4PWDA 3NTHA 3VQBA 4CIGA 2VG7A 3LYIA 4C5EA 1UWBA 4JLHA 1QQCA 1TV6A 3L8BA 1ZBIA 2RI3A 3P5JA 3P8HA 1A5XA 4I2PA 1ZYQA 2XY7A 2DFEA 3MP8A 2YNGA 1XNIA 2E5QA 4RW8A 3HL8A 3SQ2A 4W5QA 4E7LA 3NDKA 4W5TA 2QQRA 3THVA 2X4WA 1KRPA 5EU7A 5HP1A 1VSLA 4F3OA 4II1A 4DG1A 5I3UA 1SL0A 1IKXA 1L3SA 4DTNA 4FLXA 3D0PA 5IAYA 4KI4A 3ZT0A 4FJ9A 1RDDA 4O0JA 3K57A 3UT1A 3VQCA 4B08A 3MXJA 3FLGA 2EX3A 4IUPA 3LGFA 3CFOA 3LGLA 4IFVA 4QAGA 4CECA 4FJNA 3TABA 3ZSQA 1VSEA 4PL6A 2EKOA 4EZ6A 4KREA 2VWJA 4J2BA 1ASUA 3QETA 2PQWA 3KJVA 3AVAA 3TAQA 2ZD1A 3FC3A 1OYXA 4KKOA 4QQGA 1NK7A 4K8XA 2A1SA 2Y1JA 1S1UA 3MAQA 1BHLA 1S9GA 3K5MA 4NS5A 3ZT1A 4HTUA 2E6MA 4RW7A 2GFAA 3NH0A 2IC3A 4RG2A 1UA0A 2QK9A 3NF6A 3OYLA 3ASMA 4W5RA 2O4XB 4CGFA 4F3TA 3LP0A 4KHQA 3OYJA 1SSFA 3AA2A 2PYLA 4CHZA 1S1WA 3IS9A 4CFDA 3V9WA 4G1QA 1DLOA 2YNHA 4PQUA 3OYNA 3SNNA 4PA1A 1UOCA 1VSMA 4IFYA 4FLYA 3RMBA 4BE2A 1H3ZA 3P83D 3SPYA 2OA8A 4KI6A 4BWJA 4FJKA 1L3VA 4E7HA 4BD3A 1TKZA 2HHWA 4UC4A 1RDAA 2KFNA 3RMAA 2L89A 3SI6A 1I39A 4CHQA 5HRSA 1BQMA 5C25A 5KGWA 3EY1A 3SZ2A 3AVKA 1T8EA 2HVHA 3ZSOA 3LANA 2RHXA 3C6UA 4FLUA 2D9TA 3NGIA 4EDUA 2OPPA 1QSSA 1GOAA 3CYMA 1U4BA 3O4NA 1RBTA 4AH9A 4DQPA 4OPKA 4PLIA 4DTJA 2EFIA 4X34A 4L59A 1YTAA 3SV4A 3O4QA 4CJ5A 3HP6A 1NJZA 1IH7A 3QLHA 4BDYA 3RWUA 2ITGA 4CGIA 2R58A 1BI4A 1CXUA 4KO0A 4CEQA 3DLBA 1FKPA 5HROA 3S6WA 3VQDA 4R5PA 4OLBA 1ZBFA 4F8RA 2YHAA 2HHXA 4FM0A 1U48A 1JXBA 2HHUA 3F70A 2M16A 4Y1DA 2RHZA 3KUFA 4LY7A 2FBVA 4CIEA 3QEPA 3OS1A 4KTZA 3WNHA 3AA4A 3LP1A 3SCXA 1T05A 4I9LA 1BQNA 4BE0A 3LH0A 1LAWA 3WNFA 1EP4A 1JLQA 1WJRA 3CEYA 1JXEA 1SV5A 4FJHA 2F8SA 3HK2A 4DTUA 3ZCMA 4CEEA 2YNIA 3KTQA 2B4JA 1Y97A 5HBMA 4E7KA 5SZTA 4JS5A 3VA0A 1T03A 1YTUA 2Z1JA 3OYCA 1HQUA 2X78A 5KCHA 1ITGA 4CJQA 1FKOA 1N27A 2YV0X 3G0ZA 2RJFA 1B9DA 1SKSA 4IUVA 4FK4A 2B6AA 3SJJA 2F8TA 3M9QA 5C42A 3OYDA 3KLHA 2OPRA 3TAMA 4FXDA 3L2WA 2Q3SA 3VQ6A 4AHSA 4CERA 4CF8A 1EETA 3OYKA 1WAJA 3AVIA 4N56A 1S9EA 4FM1A 4KHNA 1DTQA 3V9XA 1SUQA 3MEEA 3KIOA 2QXFA 3HP9A 3JYTA 2HHSA 3MEVA 2BE2A 5KRSA 1C1BA 3VQPA 1S1TA 3AVJA 3FDRA 4XIUA 2G3RA 1JLAA 1J54A 3S3NA 1LW2A 1MU2A 4IUUA 2P1JA 4ICLA 3L3VA 1JLBA 4MQ3A 1LWEA 4KB0A 1BL3A 1RI0A 3HVTA 4CK1A 5J2QA 4N47A 1TK8A 4QOZB 5KTQA 3V9ZA 3CM5A 3KLIA 3LP3A 2K3XA 2RHUA 4E7JA 3LALA 3VQ7A 1IG9A 3KKRA 3NAEA 4FJ7A 1X9WA 2X6SA 2VG6A 2O4XA 2HVIA 3M8SA 1U45A 1RT5A 1XI1A 1WJSA 2IDOA 1KVBA 3K2PA 1HMVA 4NZGA 1FK9A 3OVNA 3PUFA 4H4OA 2X4YA 4E89A 5DMRA 4N5SA 2G8IA 2RHYA 1Q8IA 3AV9A 2F96A 3AO2A 2G8KA 4CJKA 5E41A 1CXQA 1WSGA 4HCCA 1BI4B 4Z02A 1TK5A 1X9MA 3V81A 3DM2A 1S1XA 3D45A 4I7FA 1ZBLA 3QJ6A 4DQSA 1NKBA 4B9LA 2EQUA 4C8NA 4DS4A 2P0KA 3ZSZA 4M3YA 3FEOA 1RBUA 4EZ9A 5C0MA 4NYFA 1X9SA 2DAQA 2K3YA 4DTSA 2F5KA 3KD5E 4B9UA 4OKEA 3TWHA 2IG0A 2X35A 2QKBA 4PY5A 3HVRA 5HRRA 1NOZA 2IOCA 2XY5A 4NCBA 2KZMA 1LAVA 2KZZA 1RT4A 3NCIA 1WSFA 2FC0A 4ID1A 4CHOA 1YT3A 5J39A 1RBVA 3SPZA 2HHQA 4HHTA 2X74A 4HVJA 3RR8A 3SD4A 3QIPA 1LWCA 3QO9A 3NF9A 3BDPA 3DRSA 1TL3A 3P1GA 1XHZA 3ASKA 3MO8A 3IAYA 3ISNC 3OJUA 2VG5A 3KKSA 2MWPA 1RILA 3K5OA 1HQEA 4O55A 1MHNA 2YKNA 4OKJA 4CEDA 4FLWA 3PX0A 1WGSA 1VRUA 5JS1A 4OGEA 4GMJB 3OYHA 1C1CA 1KLNA 1VSJA 4YFUA 2LVMA 2E6LA 1JL1A 4DTRA 3G10A 4B9MA 1D5AA 4NCAA 1ZBHA 3ZSVA 4ZTJA 1RTDA 4A4GA 4DWIA 4B3OA 1CZBA 2YKMA 3U6FA 4W5NA 4GW6A 4Z4CA 3HXMA 1RT1A 1Z25A 4CGJA 3C6TA 3TAEA 3U3YA 1SL1A 3L2RA 4Q5VA 5CY4A 1G5VA 1HNIA 1KSPA 2GUIA 1RTJA 2JGUA 4CJTA 3S9HA 4FZYA 2LCCA 4DSFA 4Q0BA 3L3UA 5K14A 4E3SA 1D8YA 4CJUA 4FZZA 2BIVA 2WONA 3QINA 3JSMA 1SKWA 1QSYA 2RJEA 3AVLA 3QEIA 2G8FA 2PZSA 3LAKA 3SYZA 5CZ1A 4CJPA 3K59A 2LTOA 2HNZA 4DF4A 4JS4A 4MFBA 2WACA 4CJ4A 3V9SA 3QNOA 1RT7A 3TI0A 4CHNA 4C8KA 3KD1E 3GOXA 4KV8A 1CZ9A 3MEUA 4JRQA 1NK8A 4J2EA 2FBTA 5J2PA 4FYDA 3AVFA 1HYSA 2EQKA 1HNVA 2RPIA 2M0OA 3SUNA 4KTQA 1RTIA 3KLGA 3OYGA 1BCOA 1RNHA 1DTTA 1RTHA 4IUQA 2KW4A 1R0AA 2RI5A 3ALYA 1D9DA 4F2SA 4M42A 2L8DA 3META 3LAMA 2D0BA 3C94A 4NYNA 4TSXA 1NJXA 3NH2A 3NF8A 5KCOA 1U04A 4FJXA 4QW2A 1KHCA 2R5AA 1JLCA 4F2RA 1GOBA 1QHTA 2DTUA 4GY5A 1RT6A 1S6PA 1X1PA 3S3OA 3ZT2A 1TKDA 2BDPA 1J9AA 3PMTA 2EQJA 1ASWA 4CEOA 2G8VA 4CEFA 3NTKA 1OZ2A 3B6OA 4AHTA 2BUDA 3C95A 5FROA 5D3GA 1IKWA 5C24A 1ASVA 4N76A 3QIOA 1TKXA 3QEVA 3SQ4A 2M1HA 5J26A 4BE1A 4OPJA 3MP1A 1HYVA
chains in the Genus database with same CATH superfamily
1KQJA 3O2PE 3KE2A 3QZ9B 2MF2A 4DBFA 2SRCA 5KPTA 1Z7UA 3QUIA 2I0NA 3TP3A 2R0QC 1HBXG 1X4PA 2E2IJ 2ZFWA 4FJ5A 4AM6A 2DD4A 5AQSA 1VQ8A 3M6GA 1BJZA 5AQFA 2GNCA 4CVNE 4B9SA 4BJ5C 4KHUA 4IJAA 4E7IA 4K8ZA 2R5YB 3VEWA 3DXMB 4FLZA 4FISA 2DJNA 3J7AF 1VQ9N 2H6CA 1LUJB 3SZGA 3GBGA 2EZHA 1WZ2A 1NZ9A 1C0TA 3A02A 2VODA 2DPNA 4PL8A 1O4XA 1IO2A 5DYMA 1Q18A 1O7LA 4K11A 2ELHA 1OVYA 4LITA 5I22A 3G71Q 3VENA 2M1BA 1R5GA 5L3EA 1FIPA 2X4XA 2DODA 4M77F 3SAFA 2PX9A 5AQRA 1JLGA 1B7TA 4A4EA 3FFIA 3IRQA 2LT4A 3CLOA 3J81E 5ILUA 4X9CA 1DGWY 3QNNA 2P5VA 3MAJA 3TOAA 2IPQX 2KLOA 2XY6A 4DYQA 1GLDG 2DBKA 2ME0A 3KLEA 2CUEA 2NOHA 4Z89A 2QENA 1R9TJ 1AVZC 3L0QA 1IC8A 4Y92A 5KE2A 2P9SA 2DOAA 2F9TA 3D0SA 3G25A 4Z94A 3GVAA 3ASOH 3TGNA 1XN7A 4MZTA 4CFBA 1N5YA 1GFCA 3E7LA 2DA6A 1Y64A 2ZNYA 1BGXT 4PUOA 3UNGC 1L5UA 2P9PA 2DMPA 1BIBA 2HQNA 3KYCB 3QDFA 3HOWJ 2CT4A 5D5WB 2EWSA 4PJOB 2Y1IA 3HZ6A 4CIFA 3CO6C 4E9HA 3OYEA 3IRXA 2L02A 1IG7A 5GANh 4CD3A 3IRRA 3K9TA 3OMCA 3SEQA 3DTKA 1GLLO 4PKHA 3VQ8A 3S3MA 2L3PA 1K8KA 2XDDA 1YVUA 5E84A 1UHSA 1PUFB 3CJQB 3LX7A 3P31A 1Z9CA 2DXTA 4BR5A 4KRFA 5GMKh 4NXNK 4OVAA 1E4FT 1B59A 3INZA 3MN6A 4JP0A 1NK6A 2CFOA 4OP0A 3F9KA 5E3NA 4OGCA 2JM9A 1BOAA 5EEGA 1XCBA 4KIBA 3I0SA 3PNYA 3PFSA 4RA2A 3VS4A 3A8OB 4CJSA 1LCKA 2W03A 3BG7A 4BU2A 1ZN2A 4PJOG 3MWTA 2FX0A 5TGTA 3BG9A 4BVPA 3HYFA 1KC8C 4X6AJ 1PCXA 3GPLA 4CGHA 4MTDA 3IQLA 4C1NK 4J9DA 4FLVA 5KYYB 4LG0B 1T95A 1NM7A 1A6QA 4RB2C 1V76A 1OKJA 1H0MA 3FMSA 4FLXA 2VXDA 4FJ9A 3E97A 1FWZA 3UT1A 1S7EA 3SDBA 5BN9A 3TAQA 3PO2J 5FPEA 1H9TA 3Q7BA 1UA0A 3KFWX 3AA2A 3CPWM 5AQPA 2L3QA 2ITMA 1R6RA 2R7XA 1ZGJA 4AFQC 2VV5A 1L0OC 4CHUA 2VVKA 2QYOA 4FWNA 2KFNA 5HRSA 3I4MJ 2COMA 4JI5K 1ZRDA 1JU5C 1AD5A 3O4NA 2JWKA 4OPAA 4XBFA 2G9WA 2AHQA 1M2OA 3G71I 1BI4A 4KO0A 1WNLA 5DD8A 4EPCA 5GTIC 4PJOD 5BPMA 2J5PA 4XU2A 3FRNA 5GP9A 3VF4A 1WJDA 4KH5A 2F8SA 4FJHA 1Z9QA 4UUSA 1ZG1A 3UF4A 3OYCA 1OR7C 1R4MB 4JYKA 1SVLA 3SJJA 3D4VA 4CF8A 3MCZA 1DTQA 3ZMZA 3SHWA 3A5LC 2BE2A 1SVOA 4BHBA 3BROA 3DP7A 1E3MA 2FPFA 3JRIA 2DNUA 3VTIA 3VQ7A 2BEOA 4M7AD 2V6EA 5LJ5g 2K5IA 2PMUA 1KVBA 2QK0A 4N5SA 5H6QA 2P8TA 4PJ0C 4CJKA 3ASNH 1APLC 2H27A 5AQMA 3CMYA 1TTHB 3BPXA 4XN3A 2DA4A 2D8JA 2NVTJ 4RS8A 7AT1B 3AARA 1N33K 5DS9A 1BR2A 3HEFA 5AQKA 3N5NX 4H4KC 3QP6A 5AQYA 1WH5A 4PJOA 4CW7B 1KXPA 3BY7A 4KISA 3ISNC 1YJNI 4PDKA 4KH1B 2KIQA 2XB5A 4Q4ZF 1IJWC 5CCAA 1VSJA 2O6GE 3IAS2 3W2WA 4BKXA 1CZBA 4OAZA 4Z4CA 4J00A 4C8QE 4A53A 5KAIC 3KEYA 2RQQA 1SKWA 2WONA 2OTJT 4GBQA 2G8FA 3TSZA 3KLOA 1C0FA 5CKEA 4DF4A 2V8IA 5A2QO 4I0AA 2W57A 3E19A 3CQXA 1YI2T 5GAEJ 3R6MA 4DV7K 2O3FA 3TDZC 1YJ9A 2E3IA 3VYSB 1C6VX 4TSXA 4M72A 4EIAA 2WADA 4L9NA 1KHCA 4WCEL 2ESNA 4NQWA 3M8FA 3THYA 3CPWA 3SMPA 4N76A 5J26A 2HBJA 2AO9A 2LRQA 2QGGA 2FRYA 2GTOA 3SUPA 1YITN 1TAUA 3LCNA 1VQ6I 4XU0A 1Q81C 2NS7A 1NMNA 3AGRA 1QWEA 3EO3A 1D9FA 3A8YA 1MIJA 3PIPA 4OO1J 1R1VA 1CGPA 4Y0WA 1Q7YC 1C6VA 2RHIA 4NHJA 4WWCA 1H88C 1M90R 3TVTA 1T6SA 2D45A 2NRVA 1ATNA 1WRJA 4JX5A 2DERA 2DLPA 1M1GA 2GOMA 4KHSA 1UAXA 3EAEA 4FWPA 2KQ2A 2Y9ZA 2LVSA 2OCEA 2WSEE 1HX1A 2LDMA 5BPNA 3O3HA 2MC4A 4CHYA 1UA1A 4X66K 4DR5K 4F92B 4EEFG 2P5OA 3ULEA 1UELB 5EZGA 3FSPA 4E0DA 3U1DA 2IGNA 2B9SA 4C5GA 2DEUA 3VS2A 4M75B 1ONVA 2R7RA 1U8BA 3DXKA 1W9HA 2HEQA 1AOJA 3HPHA 3EDPA 1MKMA 3LM2A 1L3UA 5JLHA 3H9NA 1YQKA 5F1RA 4DV5K 4JKGA 2EGAA 3V1RA 1PC0A 1W0UA 2F4IA 2W00A 3EGDA 4KIFA 3U8XA 5HL7L 4DK9A 4LJZF 3EYYA 2K7LA 3A1YA 3NGPA 1VQKT 5EEHA 3BFMA 4ZGEB 1K4TA 3H35A 2YLBA 2OQGA 1AHDP 1YJWA 4LFBK 5F04A 3RTVA 1YITA 1FJLA 2F4VK 2GXBA 4C8OA 4EM0B 4LUEA 2XSDC 1LVAA 1NJIC 4AVPA 2AQEA 4LUDA 5KYWA 5FPDA 3AVGA 3LWMA 3DOLA 5CIUA 3AVHA 3TW6A 2RN8A 3OS5A 4AT1B 3LP2A 3RBBB 4B24A 3IL2A 1NH3A 3QPTA 3CJTB 4A6DA 1CKBA 3JB9F 3VEYA 2MFZA 4R0KA 2XK0A 2E35A 1X58A 4DYCA 4BUPA 3OH6A 3VQ5A 1PVSA 3AAFA 1VQ7T 2IS4A 3TANA 1WNSA 4M75D 3ATVA 2CP5A 5LJ5h 4RTUA 3AVBA 4M6VA 4KB1A 4D7NA 4LGWA 3DB3A 4H4MA 4HX8A 3LW5E 1QRYA 4IHTA 1B8IA 2NUBA 1ORPA 3AVMA 4IHYA 3CCVN 4QIWN 1OCZH 5AR0A 1Q82O 4BQOA 5D5XB 1HYZA 3ZQFA 1M27C 3A01A 2FB7A 1XOVA 3SUOA 2K9LA 2ETHA 2QQ8A 4BRKA 1HK9A 1TV6A 3E6MA 2DEQA 3VV0A 5FKOA 1FTZA 3KP7A 3MP8A 1Z77A 1LDJA 1JJ8C 4IWVA 4D5CA 1OPLA 1W7PD 2MLKA 4BY1J 1YYVA 5LL6Z 5IAYA 1LE8A 1P90A 3QDRB 3WT0A 2E60A 1YJNA 4JI7K 1VQ4I 5AZJB 4LLGF 2OTJI 3JCMd 2LT1A 3ELKA 2IP2A 2NOZA 3EGUA 3ASMA 4F3TA 3T1YK 1GT0C 2QA4N 1ZRCA 4M6YA 3J80Z 1WFWA 1VSMA 2XIDA 2DDAA 2V1RA 4F7UB 1UFMA 3ABLH 1I39A 1M8MA 3NMZC 2HVHA 2V9VA 1MJBA 4W1UA 4DBQA 3NGIA 2OPPA 1JJ2S 3AAPA 4AH9A 2D1XA 5J3LA 4PLIA 2FZCB 2YWWA 2JUGA 1HKSA 3HUGA 1NNEA 2V26A 5HROA 2W40A 4F8RA 4Y1DA 2QSHX 4J6WA 4CIEA 5GAMg 1RI7A 3BR0A 4C92G 3RPUA 1U0JA 5FLXZ 3I55N 2ELKA 1JXEA 5SZTA 4FASD 1YTUA 1HQUA 3TABA 3LQRA 4V19S 4FXDA 4LG3A 3M07A 3F3XA 1J0RA 3DEWA 1SS6A 5LJ3d 4G9YA 1JLAA 4X1EA 5JVTA 1KJWA 5B1BH 2D1HA 3QYHB 3FM5A 1BN5A 2RN7A 1NGEA 2HVIA 4PCQA 3GFIA 2ACJA 2ZSHB 3LSMA 4HCCA 1IB8A 3I56T 4CCNA 2K2MA 3I56Q 4Z2YA 1VQMN 2YG8A 1GLCG 2PBDA 3SAHA 3TDUC 4ESRA 4B3RK 1E3PA 1U5SA 1H9GA 2K9QA 5CKTA 1WSFA 4A62A 2EYQA 3JRBA 1VQKQ 1VQ5N 3R61A 1R58A 4L0ZB 4GMJB 5EEAA 3F8MA 4B9MA 4C30A 3M3YJ 2DYRH 1D5AA 2NRHA 3G10A 2JOYA 3A8LB 4EJVA 1QVTA 2D1VA 3HOTA 4Q5VA 1FMWA 3U9DA 4M9ZA 1YHQI 1YQLA 4Q0BA 2DT6A 1OV3A 2E10A 3LQQA 3O1BA 1ZHFA 2NYSA 1QQNA 3AVLA 1WEIA 2HNZA 3ZQGA 4DIQA 3T8TA 3SMSA 2EQKA 1RTIA 4KT6A 3HHTB 4F16A 3JAMK 4M3DA 5KCOA 1U04A 1FOYA 1RT6A 4IX7A 3S2DJ 4QT7A 1RAAB 1OZ2A 1VFCA 2L0AA 1TKXA 3CC4A 3CCJT 4IHWA 5BPLA 3S1MJ 3S41A 1FXXA 4QCLA 1W0TA 3TARA 4LD9K 2QWOA 4UOBA 2YRDA 3K5LA 3CJ9A 4BRGA 2LCLA 2FSNA 5FJ8J 1S8NA 3KK3A 2ASOA 2OTJQ 4HT9A 3LDSA 1ZHIA 2R3SA 3NMUA 4ZJZA 3JRDA 4YFNF 2QAZA 1STZA 5D8LB 3I8BA 1YXQA 5KYUB 1WSEA 4C8MA 4FCYA 2FJ1A 2FF4A 2HNDA 1OH8A 4XKWA 1TXQA 4B3AA 2KIFA 1ZGAA 1QGPA 2FPDA 4XK8E 1W2BP 2Y0MA 1Z7LA 1BG3A 4KGVB 4JI1K 2C0OA 1JKRC 1U47A 4A4HA 3CXCA 1CLQA 3EFOB 1KAZA 4CZEA 4W97A 5FU7B 1WGXA 1WBDA 5L8RE 3EFSA 4I02A 3ZRGA 3U3GA 1GV5A 4K2EA 1WH7A 4RTFD 4DS5A 4TVRA 3MEAA 5KYXA 5AQUA 3J7YP 3TSQA 4J9HA 2ZNZA 5HRNA 4YOQA 4XTWA 2ZE2A 3VYTB 1IRZA 1XDUA 1VQPT 1XGSA 4CFCA 2RA2A 4FOIA 2WY8Q 2KVQG 1HJRA 2QM1A 4NCGA 3AG4H 3KEQA 2QEXN 3DFGA 3PY8A 1W97L 4BXXJ 2X6YA 2RE2A 4JYAK 4F55A 4CI0C 4KHPK 1KG1A 4F7UG 4DA4A 5LJ3e 1YLFA 4IKFA 2QQ9A 5KYYA 2HKXA 3WTSC 5I9EB 2NOBA 1WJ5A 2WAQN 2YRVA 3MEGA 2B5JA 3LPTA 3OMYA 1YJ9I 2QBYB 2VJJA 3KWGA 3HSTB 2VJ5A 4IHVA 1W1WE 3CHWA 4DFPA 2JZYA 4NC7A 1B34A 3RR6A 4M75F 1HKGA 2UXXA 2XB0X 2XI9A 1LFBA 1X19A 1YFNA 2VWKA 3NH1A 2E1YA 4GFBA 1LJ9A 3G2BA 1KYZA 2K02A 4WK8F 4PLLA 5GMKm 2HMPA 3IV5A 5AZJA 4V19K 3HJFA 3DU5A 5DCFA 2DILA 4C2UA 3HSEA 3J7AY 3CCSA 4CBWA 4H5RA 4CCHA 1OYWA 3H6EA 2R7QA 1VQ9T 4LF6K 4YPRA 3BJAA 2J05A 3IP4B 3G4SA 4M6XA 4MHGA 4F7UA 3DWLE 1O1WA 3H5AA 1YHQQ 2RDPA 3RKWA 2G0EA 3O3GA 3TU4K 2O5RA 4BR2A 3GNFB 1DKGD 5BMZA 1WJQA 2QGFB 2EJFA 1TT0A 2DMUA 5KI6A 3K5NA 1LMZA 4LD5A 2XAGA 4BQAA 1PNJA 2QQSA 2GWJA 4OMPA 1ZGWA 2IA1A 1WI7A 4IUTA 1RR8C 4PJNA 4KFBA 3BR6A 2EQMA 2VYTA 4XU3A 3CXCM 1K73R 4MO4A 1M3BA 2Z2SB 4LDVA 2HBKA 1QQCA 4BI8B 5AQLA 3P8HA 1EFNA 1PUEE 2YNGA 2P5LC 3WGHA 4J9EA 3PUBA 4L18B 1SL0A 3QZ5B 3ZETB 4KI4A 1KD1U 1D09B 2E2PA 3CFOA 2RQPA 2P9IA 3Q9VA 3GX4X 1FYLA 5LGTA 1ERDA 1UHFA 3W3CA 2DYIA 4KDPA 4NS5A 1VYUA 2PUKB 1D0YA 1N9RA 1U9OA 2C06A 3O5BA 3LA7A 2H94A 3BC8A 1RNLA 3SNNA 2ICWG 2IJLA 2YU3A 1YQRA 4EJWA 1OEBA 2ZPIB 3UPUA 2HHWA 4UC4A 5IH2A 3EY1A 1JUPA 3NEUA 4EDUA 1BC7C 3WTWC 1YJNQ 1QO0D 4CJ5A 2H3JA 1YI2Q 3UB5A 3RPUD 2JS2A 1VQ7A 3S6WA 5E26A 4R5PA 4A3LJ 3G1MA 3ABMH 1U48A 5HDKA 3CCSI 2LX7A 4M75G 4Q5SF 2YSRA 1ON1A 2DBMA 3LP1A 3F8FA 3CCMN 3JXUA 2EW3A 1LAWA 4MMKA 2JUFA 4CEEA 3BG3A 1KD1R 2JNGA 5HVQC 2PVGB 3LDQA 1FKOA 4FK4A 4XTUA 2FSKA 1IBLK 2VGMA 1ENHA 3OSVA 4PHTX 3AHUA 4M71A 4PGHA 2EB7A 4G8XA 4A3DJ 3PVQA 1C1BA 3FDRA 2K4YA 1GXIE 4N9IA 3V9ZA 4HYEA 2K3XA 4FJ7A 1VQ5I 2B86A 5L23A 2DMQA 4C3JJ 5M1FA 2EYXA 3DPTA 3HRUA 5DMRA 1ZBXA 2G8KA 2DVJA 1LOJA 4PFPA 4BG8A 2P9IB 3N4QA 2O8FA 4B9LA 4C8NA 4BEHB 2RK2A 3DQVC 3CCEQ 5HRRA 2IOCA 1RT4A 2KYBA 4ID1A 2HHQA 2VKHA 4DV4K 3P1GA 1IN7A 4LE9A 4A5NA 3LMMA 2MBFA 3K4CA 2CH4A 3M4OJ 2E6LA 3LDLA 5IXBA 1DT9A 1T8IA 3K2AA 4CGJA 2UWMA 1CQTA 2K27A 1HW1A 2XAUA 2I5UA 2HS5A 2MG4A 2R5YA 2ZO4A 3ZR8X 2M5WA 2CG4A 4A61A 4EGZA 1RT7A 4JK8A 3J7YJ 1YOVB 1RAEB 3VEVA 1SHFA 1YNZA 4YOXA 1RTHA 5LJ3j 1DTTA 1SEUA 3IC7A 2D2WA 3TO6A 4FJXA 3L00A 2NUTA 2R5AA 4F2RA 4GY5A 1K9AA 1S6PA 2PFUA 2BDPA 1QKXA 4IFEA 3SQ4A 1V4SA 4CD1A 4MLEA 1YW9A 4HCZA 1MMGA 1HRHA 4WCGA 2Z1IA 3CC2T 2DLLA 3KETA 1WHJA 4C0ZA 3OA6A 2E4LA 1G2BA 2FNAA 2WB1N 4XQ3A 4ASNA 1W2BA 5EY4A 2M0MA 4LK0F 1QLYA 3HZJA 3O3KA 3ZXSA 4S0HB 3JRFA 3WNGA 5J40A 2HOAA 3CFRA 3BQZA 1I6XA 5B1AH 3V6DA 1IN8A 1ZSZC 4ZYEA 4FJ8A 2LKSA 1WHUA 4MO7A 4EMGA 2RHKA 4A3JJ 2M8GX 1D8KA 5D8KB 4B48A 3QJYA 3JCUC 5DTDA 4L5JA 2CUBA 4Y4RA 3KYDB 1M3HA 4KN7X 2JVGA 4IG3A 3K9JA 3HM5A 5FDLA 1VQMT 2ZPGB 1IGQA 4N0AA 2E88A 4UY8O 3U1KA 1I81A 2XDBA 3M3ZA 3H1QA 3S15J 2HPMA 2LFBA 4DV6K 1W7PA 2F2EA 1LPLA 2E34A 2FVUA 3MHXA 3JTGA 1I6HJ 3DMJA 3AO4A 1Q81O 1JUSA 4N4NB 1VQNT 2L2OA 1MNEA 4OB3B 4BY6B 3DKWA 4XNFA 2TCTA 4C0DC 1BR1A 4BGBA 2RQVA 2OZSA 4HLYA 4AHRA 3BR2A 3I56N 4UVCA 1V55H 2DO3A 2IGOA 4M74A 1VQNA 1WX6A 3QPSA 3GTOJ 1NLOC 5F27A 1B8IB 4H8KA 2ATQA 3ECHA 3AA3A 1W1FA 3FZHA 5DV5A 3CERA 3DKYA 3JSCA 2GQQA 5JS2A 1K9MO 2L7FP 1ZARA 4DFMA 3IMXA 1RDUA 4CK3A 3LDNA 2E70A 4NLBA 4DLGA 5GAN4 2ABLA 1C1AA 5GAMd 2IS2A 2QASA 3M1EA 2IVMA 3TAGA 4CEBA 3A5OC 4PFOA 3B73A 2DO7A 2X85A 2Y0SN 4LDXA 1Y56A 3BG5A 3H08A 1TC3C 2HW3A 3FBNB 1IXDA 2AZSA 1TUGB 3LDOA 3KPHA 1J6ZA 2PMHA 3RI4A 1K8KB 1RT2A 3K69A 2VUBA 3UR3C 2Y90A 5FKNA 4J8OA 2HTJA 1FY7A 2DZ9A 2J6FA 3I35A 5BRDA 1T0JA 2PZ1A 3J80E 4M3UA 2CP6A 1AWOA 2XY8A 2HKOA 3UKUB 1YQAA 3V1QA 2BKDN 3KK1A 4IDKA 1WHKA 1VRTA 2GV9A 4DEYA 3E9FA 4CA0A 3IWZA 3CMAA 4PJJA 2HOSA 2O8BB 2W10A 3VRZA 4X65K 2OX7A 1O3RA 3LSTA 4FE7A 1P7IA 1XQPA 4XRFA 2JA7J 2Q1NA 5HP1A 1ETXA 4DTNA 5EGOB 4XR6A 2DPUA 4O0JA 2HYJA 2EX3A 4CI6A 3LGFA 4QAGA 5B8HA 5FKMA 2DA9A 1ASUA 2K85A 1I1GA 2A1SA 2K9GA 1S1UA 1VQPN 1ACIA 3JREA 2GFAA 2AIRB 3IKTA 2E3HA 2A6HF 3CCMI 3LP0A 1DLOA 2WBMA 5H20A 3BY5A 4OMFB 3RMBA 2JN6A 4RGUA 1OH7A 1RDAA 2DQLA 3HOYJ 1GOAA 2CZ1B 4BAYA 4OPKA 2EFIA 4IJNA 1J59A 4MMLA 4KT0E 3EG1A 3ROUA 4CGIA 3MFKA 2KIUA 3VEPA 2P4TA 2Y75A 4B44A 4M7DF 1ZH5A 4AFZC 3WTZA 1QHGA 2XPWA 1K76A 2JTEA 2OJ2A 1WHGA 2FBVA 1OLTA 1Z67A 4BE0A 1KG2A 4U0YA 1H8AC 1U8RA 4EMKB 3VA0A 1DDNA 2Z1JA 2V75A 4BRQA 2RJFA 1JB0E 1RC9A 2CH5A 3CCUQ 1IV6A 3TAMA 2X4HA 3L2WA 2EBIA 3MX5A 2DPPB 4R55A 4KHNA 1JUMA 1JHFA 2IS1A 2VGNA 2QXFA 2K5LA 3MDQA 3M54A 4AWXB 3RVCA 1GUUA 3AAQA 2BV6A 5JLFA 4D7MA 1JLBA 4WX9A 1RI0A 2QTVA 4CZKA 1X69A 5LHIA 4X0GA 1HC8A 4MQVA 2VI6A 2XVCA 2VG6A 3OR2C 4RB0A 4E9FA 3VGKA 1VQ5Q 2DW4A 4NL2A 2HL5C 5EXWA 1POGA 2E6ZA 1T6CA 3AV9A 1CXQA 3LFKA 3FXOA 2A07F 4A3FJ 2W6KA 4CO8A 2HHHK 2EQUA 1ETKA 4M3YA 3BTCA 4EZ9A 3K9KA 5D6FA 2HF3A 2OAUA 4RGXA 3TWHA 3K1MA 1U2VA 1B6AA 2QKBA 3HVRA 4M7DC 4AU7A 3WG9A 4M78D 4C8QB 5DM7R 3CCMQ 4BRIA 1X3UA 4XK4A 1TH7A 4HHTA 4KRTA 1HUXA 1TL3A 1QVGA 3ASKA 3OJUA 1RILA 4BH9A 2ZFUA 2Z0WA 4OGEA 2QQAA 2HF4A 1FZPB 3H9JA 4ZYDA 1TWCJ 2D0PA 3KP5A 1W70A 4ESBA 3HXMA 2VJIA 3U3YA 2NRZA 3G6EI 3LM9A 1RKTA 2DXUA 2LR8A 1TWFJ 2BIVA 2CYYA 3I59B 1QP3A 4M77A 3K59A 3QYGB 1S3XA 2FQ4A 2XKOA 1SSHA 4KTQA 3OV8A 4DJAA 1R5HA 4F2SA 3RUXA 3LAMA 5AQTA 1HYOA 1SHGA 4YFXF 2EBPA 2EQRA 3A5NC 3IHUA 4BREA 2E20A 5J8FA 2BUDA 1YJ9T 2XU8A 1MBKA 1OULA 4FE4A 1KZHA 1XMXA 4DMNA 4OPJA 4M78E 2RQTA 2JQ7A 2CSIA 1K8AC 5CHIA 2LREA 6AT1B 3WXMB 1KCFA 1CF7A 5KRTA 1GLNA 1B92A 2CO5A 4DYRA 4CZGA 1VQMQ 3EE8A 1QNTA 4UHTA 3P8DA 4JOMA 2IEKA 2K4BA 2CJJA 1Q86O 3DXJF 3F8BA 1YHQA 1I4K1 1UHMA 1QZEA 1VQON 2CGPA 4XLCA 2OTLN 3D2FB 1TUDA 1T7PA 1PU8A 1JKOC 2AXLA 3G73A 4PJMA 4FWQA 1ETQA 4M7AG 3X24B 4JQFA 3N4MA 2RF2A 5IWAK 2DRMA 2Z99A 4M75E 3NFCA 1VSFA 2X9DA 1K6YA 1MUDA 2JK3A 4O0IA 1FP2A 5LL6S 5LJ5j 1ZUUA 4HSBA 2Q36A 3HO1A 4KA4A 1RCHA 2NUZA 1WXTA 2E1CA 2QA4A 4UUTA 1M4ZA 1NG6A 2QWQA 3DI6A 5AIQA 3CJRB 3CPWP 1KVCA 3TTDA 1K83J 3WE3A 1QTMA 5GAHP 1GBQA 1KC8U 4O44A 2LTPA 1XQHA 4CF9A 3H0DA 4HT8A 3O9TA 3OQ5A 3H3OB 3WEEB 1QVGM 3SYTA 2KJCA 2YCHA 2EA4A 3OH9A 2XHBA 4U0VA 4XEIA 2F5VA 3GTQJ 4JZ3A 1TYQB 4CGGA 2BE9B 4JAXA 4PFZA 3RMCA 2LNHB 3OHRA 1YJWT 1UG1A 5CYMA 1PJRA 4NOYA 2BY3A 3CC7A 2WSFE 4AUXA 3C4SA 4A4FA 4FJMA 2Z3YA 2D0AA 2DJIA 4BDPA 1KGSA 2CH0A 1KEAA 1ZX6A 1UEBA 3TAPA 2QZ8A 4F3QA 1JO8A 1SFOJ 1R36A 2O8FB 4CBXA 1MMNA 1NKCA 5D6EA 4AIDA 2V7YA 1HDPA 2DIQA 4HV6A 4ESJA 1X3ZB 2RN2A 1ZBUA 3RPQA 5B66C 3L42A 2KLAA 4HUFA 3FIWA 3RSEB 1QSLA 4ISGA 3VGMA 3M57A 2DMOA 4OKKA 5JVGF 4ME7A 3CMEI 3V9UA 4CH7A 3I5RA 3IH2A 5AQQA 4LXCA 3O9SA 2K86A 1LWFA 2E5NA 1WSUA 2JHJA 3VFZA 4DUZK 4IQ4A 2HXIA 2K3FA 3EZWA 2GXAA 2YXYA 1XD7A 1KG6A 4A54A 3A8HB 1ATRA 1LWVA 1ARKA 1I1SA 3GO5A 2DFFA 3DLEA 1P4WA 2K9NA 4ZGJB 2UUZA 2PQ8A 4OOIA 1WPYA 3NTHA 4MFDA 3NWSA 1U6GA 1T2KA 3CC4T 4MDXA 3BLYA 1RAIB 3SLCA 1XDSA 3S8PA 4AFUC 1HQCA 4KUMA 4B08A 3M0TA 4F7UE 5I11A 3WE2A 3ZQCA 2OD5A 2PQWA 3CCSN 4J6YA 5GAMj 1ON2A 4QQGA 1NG7A 1KD1C 1N39A 1BHLA 2E1MB 1CF7B 2QK9A 4W5RA 5DY9A 2PYLA 3FHFA 1A0NB 1RDWX 2CP2A 4IF4A 4LFUA 1Q1HA 4A4KA 3CCRQ 1H3ZA 4A5MA 4OIRF 2JPSA 2FSJA 1Y1WJ 2X6WA 3ZQQA 3ZQHA 1T0FC 3CC7N 1MSFC 4XH4A 4XTXA 4FWRA 4AC0A 2OC6A 1HLVA 4CBUA 2Q0OA 3F70A 1BYMA 5CYVA 4BBSJ 3SCXA 3A5ZB 4B3SK 3L9FA 2NVUB 1YIOA 3WEEA 2EPFA 1UGRB 2YNIA 3MKLA 4E7KA 1VQ8N 3PM1A 5DCMA 2K5FA 1VQ6A 4M7AA 4IUVA 2L7KA 4ON0A 4GCVA 2B6AA 1R71A 4CERA 3JB9G 3VS3A 1X2MA 4M3FA 2C0TA 2HHSA 3CMMA 4LB6B 1VQOQ 4D8DA 4HVJA 4YIIA 4KB0A 1XGNA 4GKJK 4M78F 3CPEA 4F04B 2O4XA 4QWQA 4FM4B 1G59A 3IKMA 4NZGA 1X3WB 2YI1A 4Y15A 2CH6A 2BE7D 1D3BB 1XGMA 1PUFA 4FWSA 4YELA 5F1XA 1TG0A 2CQXA 4CGZA 1WKMA 4B3XA 5C0MA 3TBIA 2K3YA 3KD5E 2E64A 4B9UA 4OKEA 2MD5A 1VQLI 2JA5J 5LJ3h 1FSEA 1NGJA 1LWCA 3QO9A 1MWMA 5JHFA 4OB0B 1XHZA 1MD0A 2MWPA 3WXJA 4ZYGA 1VRUA 1VQ8T 5JS1A 5CK9A 2MSYA 1I5LA 2M0CA 3C65A 2XF6A 2P6SA 3LSIA 4C92C 2CRGA 3EH2A 4FWLA 1QHHD 1OCCH 5DLQE 3CCLQ 5K7ZA 2PZSA 4RM3A 3TL4X 5GAOp 3BG6A 4PSWA 3K4KA 1B07A 3MMVA 4IUQA 4HW0A 3ZEUB 2DTRA 2CT3A 2Y4XA 1D9DA 1MBGA 3MKWB 1QPIA 3ENBA 3N5BB 3FLCO 5KPZA 1IO6A 3RESA 3GLXA 4XOTA 4E7ZA 2HZDA 3CF5F 5LJWA 1K78B 2ITGA 3MP1A 1HYVA 2ZCFB 1W5SA 3DLGA 4ZTFA 2KDZA 3BCBA 3MVPA 4YDUA 2NUTB 2HNHA 2WWYA 2UXCK 2UUBK 4DSKA 3TTFA 4D8KA 2EPDA 1XC9A 4AG2C 4HVUA 3LLRA 1YW8A 3LZIA 3DYAA 4FJIA 3BZCA 1HKBA 2D1KA 2A3LA 1KQ0A 3H3NO 5KE3A 1B3QA 4C92A 1X6OA 5CKHA 3JCMc 1PKTA 3CUOA 2L7MP 2HYFA 1IDZA 1N75A 4N4HA 3HHGA 2OBPA 4IRIA 1N32K 4CYCA 3MKYB 3A01B 3CJBA 4I9QA 2FBYA 4JHDA 5J47A 2W6LA 2EWNA 1VQ6Q 4H0OA 3SJHA 2J06A 2VQCA 5B3SH 5D6XA 5KN9A 4LH5A 2X9HA 1TUUA 3H41A 3EL2A 3WVEB 2RKHA 1ATSA 2AQFA 3QERA 4EVVA 3V8LA 4FX4A 4LF7K 2HYGD 3ZSYA 1EXQA 3DBHB 5D5UB 3NQOA 4CZIA 1TP4A 3DLAA 1WHLA 4M7DD 4ELTA 3O6BB 4CJ3A 3JCMP 4LF4K 2CSOA 1YE9A 4KHYA 2OZUA 5IXFA 2L3SA 3OSGA 3EFOA 5GANj 2VKDA 2GTJA 1C0UA 3VA3A 5FRMA 2HSEB 2N8GA 3EG2A 3RMDA 3CCEA 1MMDA 1U49A 5F0FA 1VQ6T 2NS8A 3U9GA 3F21A 2QWMA 1VQLN 3QBXA 5BR9A 2FO0A 4AHUA 4L8RB 3OYYA 4XM3A 3MECA 3QEWA 2WOMA 3TU5A 1E4GT 3UKUA 2MD0A 1JXSA 1I1JA 2P9LA 3CCLT 2VQFK 2HNYA 1OFCX 5LLQA 4FL9A 3U23A 3GCMA 3RTRA 2YT6A 3DPUA 2COYA 3CQ8A 4AG1C 2RK1A 1IN4A 2VXEA 4WFBL 2ZMEA 2L54A 1QZYA 3CVTA 1Y39A 1ZUKA 3E0JB 4G7ZF 4H0TB 3ZMDA 3LFUA 1NLVA 4O5FA 3CC7Q 3H8ZA 1GLFO 5LJ5d 5CYQA 4IIOA 3WU1B 1MDMB 4BEHA 2EGEA 1ZQ1A 4RG8A 2W4SA 1RUOA 4N4IA 2JMWA 1IZ6A 3OIOA 1BKBA 2JT1A 4S05A 4JJNK 1AKHB 1UAAA 4CJRA 5HKCA 5E20A 1G15A 2YPRA 4CC4B 2A3SA 2Z1HA 2YX7A 2E7WA 1TWGJ 3H6ZA 2NUPA 1WAFA 2GXGA 3QP5A 5J1UA 4B1WB 2H56A 3L6QA 2IGIA 4IXAA 2DD5A 1YJ9N 2FHDA 2YUNA 3J7ZI 4KGXB 2JTFA 2YUQA 2CZ7B 2AHJB 5CQEA 4CSWA 3A0HC 2RI3A 4BQQA 2YDLA 4FQGA 5TISC 5DM6F 2QQRA 2X4WA 4FYVB 1X9JA 2E2OA 3G3ZA 5CE3A 2HCKA 3K57A 3K10A 3B02A 1KG4A 4IFVA 4UB6C 4P9UA 5FWCA 2ZSIB 4ILHA 5TKYA 3T1BA 4ESFA 2A61A 2ZGZA 3NF6A 3OYLA 3N4PA 1XS9A 3WTXC 1MJAA 1GLEG 4HDUA 3JR9A 3OYNA 1RR7A 4BRAA 4BE2A 3JB9H 1E7OA 5L3CA 3ZSOA 3C6UA 1I5OB 5FWBA 1YIJI 1YRNB 2MABA 4YORA 4DUYK 1BU1A 4DTJA 3R3LA 3O4QA 3ERED 5IHKA 1ETWA 1WCMJ 4XLAA 2BZTA 3VQDA 3JCMW 4FM0A 3DLLL 5H1SQ 3TW7A 1XJWB 4ISEA 3BTIA 3P9IA 2LBFB 2K79A 2IGMA 5LRSA 3C6HA 3X25B 1BQNA 3G4SI 2KDOA 1TNTA 3I5SA 3OW2S 3KTQA 4OMLA 2NYXA 3PTAA 1A6IA 4CJQA 3K4JA 3FHNA 1N27A 2F8TA 4O3MA 4E4HA 1CKAA 4IEIA 5IT9Z 3HFNA 3ABTA 4H5TA 4U67L 4J7FA 5IT9O 5GAMh 2O2OA 4IEJA 3VQPA 3VS0A 1LFUP 2P1JA 3L3VA 4G7OF 3PSIA 1E3HA 3CM5A 3KLIA 2GLOA 4EMHA 2ENMA 2LMDA 1OOTA 2IDOA 5IPAA 3TSWA 4XL9A 2RHYA 4FWKA 3KVGA 3F23A 1X2KA 4Z6YA 2ZGYA 2AK5A 1O7FA 1NKBA 3CCEN 1PSEA 3URGA 2VPLA 1PVEA 2F5KA 2JXBA 4M75A 2NRRA 2CW7A 2EIKH 4DGWB 2XY5A 5FLXE 3RERA 4EGYA 3NCIA 4RMNA 5J39A 3VKIA 2KP6A 2X74A 4HZFA 3SD4A 1IHVA 3EUHA 3CCQI 3KKSA 1SAZA 2Q2EA 4E1JA 4OKJA 2KK4A 3GLLA 4EA4A 1IG8A 5J8CA 3OYHA 1OU9A 3OIQA 5HLTA 5GMKe 2Z5UA 3JB9D 4UVAA 1U3EM 2NOFA 4CZZA 1RT1A 1M1KO 1NGHA 4MDBA 2L4MA 2KQRA 3RKQA 1VQ4T 2EA2A 1PM3A 3E5QA 3FZKA 5GANe 1YP5A 3KD1E 4KV8A 2HZYA 2KW4A 1IXCA 4IZZA 2DOFA 4Q47A 4DKWA 3NF8A 1NGCA 3FXLA 2DVEA 2M9HA 4J9CA 2O8EB 3VSLA 3L1PA 4XH5A 3QIOA 3IFRA 1TZLA 5HOOA 5D7UA 3LWLA 3NFAA 1QZZA 1YCYA 1KFSA 3Q9SA 1UDLA 1HJDA 1T3VA 2V7FA 2P51A 4OWRB 1ZG5A 3PFIA 4PSXA 1JJ2A 4FZXC 2F2XA 3PIPF 2GQVA 4JKAA 2AJQA 2LG4A 2DTZA 1O3SA 1Q7YO 3IUOA 1NK2P 3BR3A 2QA4I 4WF2A 3M8EA 4FK0A 3JRCA 3ZMUA 4LSLA 1JXMA 3G6EN 3WNEA 1B1BA 4JRIA 3LWIA 3AL0C 1M1FA 1IAWA 3ZMVA 1F43A 1UG2A 4FPBA 5KCMA 4KPYA 4IRHA 4MO5A 1NG9A 3U21A 3Q0WA 5FPNA 1C0WA 2HOEA 3A8MB 2GBQA 4B9QA 1P6RA 1NEGA 1RPWA 4RW6A 1R0CB 5C6SA 4HCBA 2VASA 1X3NA 2RJDA 3T3FA 5BOXA 4AD9A 1ACMB 5JMVA 1D1CA 3QFUA 1F1ZA 4HQMA 3CQZJ 2HVQA 4FU6A 4JJDA 4E70A 3OYMA 1EZZB 1Y0NA 3TEDA 3WTVC 4N41A 5LJ5f 2DK3A 4CC2A 4D1QA 2JA8J 3LNQA 2UYTA 4JI0K 5JI6A 4M3WA 1T44A 1RRJA 1KQ1A 3ZEUA 1VI0A 2FG0A 3GWZA 2XGCA 2GCXA 3BDLA 4O4GA 2XG8D 3Q0VA 2ECCA 1Q86C 1TKTA 3HIFA 1QW1A 5KN8A 5M5WJ 1WXBA 1S5LC 4JI6K 3H5RA 3VUZA 4B1XB 4LLNA 4J9IA 3DRPA 3CMEN 3DLHA 3OY9A 3KTUA 2BGGA 1VSHA 3P8BB 2HBMA 3CD6I 2CGHA 2LD5A 4XKCA 2FD5A 2NRTA 4EVIA 5FW9A 2BUPA 1OPKA 4BG9A 4J9GA 4CXFA 3IUCA 5E17F 4KBMB 1H92A 1RLQC 4W5OA 4AMCA 3HFOA 3TP0A 5FRNA 3CJ7A 3FKJA 4NQWB 3CCRI 1VNDA 2MC3A 5M9OA 3SV3A 3FJPA 1KQ2A 1Q86U 3SWNA 1ODDA 5KPRA 2DZCA 3E9OA 1HD3A 2E1MC 1RRSA 2NNYA 4LIUA 4ID5A 1QPMA 2M87A 5EJCA 2VBWA 4RB1A 4XN0A 3JCMV 3NNQA 2CDTA 3G71T 5GANd 4RTZA 3HXLA 1VIFA 5HLFA 1JE8A 5GAN5 3KCCA 1PDNC 4ZDOA 4UQGA 2O8EA 4EP5A 1GLBG 4H5NA 2CFXA 1KG5A 1RT3A 1NK7A 2QSFX 3VF2A 2O03A 1WJEA 4BRNA 1U2WA 3HOSA 1ZA2B 2ZBKA 3ECOA 1G83A 4C0DB 1GCQA 3SJMA 2I10A 1ZYQA 4DV0K 1MSEC 4C92D 3CCLN 3S1NJ 3MN9A 5EOYA 2VBXA 4RW8A 4HAMA 2V9KA 3S2HJ 2ZPFB 2FXUA 2W82A 3FGUA 4M77G 1RDDA 1YI2I 4E47A 4IUPA 2LMJA 4J2BA 5FD5A 5CPRB 5FB2A 4MEXF 4IO9F 2KAFA 3ZT1A 4LNPA 4HOBA 4N9HA 2KKOA 1V29B 3PE0A 4C0GA 3OYJA 2G7HA 3BOQA 3RKYA 1BW6A 1ZELA 4BHCA 1VQ5T 5GJVB 2VJ4A 2Q1ZB 2YHXA 1MBJA 2PEXA 1YBYA 1IRXA 4HA8A 1QU3A 3UDCA 4BY9C 3RMAA 4CHQA 2VB6A 3BW1A 5KGWA 3WVDB 1U4BA 2AKLA 3O9UA 3AG1H 3SV4A 1NJZA 1YIJQ 1IH7A 3QLHA 4BDYA 5HNFA 3R8EA 3TO7A 4LDYA 3OOUA 3FXJA 2EK5A 3NAUA 2RQRA 2HHXA 1MJ9A 2EAYA 2RHZA 4KMUX 5GAEP 3QEPA 5C2DA 4KTZA 2YHWA 1Q7YU 2DA1A 5KHDA 2KDSA 1SV5A 3V7CA 4M9SA 4PK4A 3X28B 2VONA 4NO7A 2M30A 3UKRA 4I99C 3T1HK 1PG5B 2QQBA 1YIJT 1DPUA 2R7WA 1EH7A 3AVJA 2F5FA 1MU2A 4ICLA 2CGLA 4G6TB 5DCMB 1LWEA 4UXNA 5LY3A 2ZXIA 3TTCA 4TV7A 2ZF5O 2ID6A 1D5VA 1QHAA 2WAQA 4RLFA 1RT5A 3CJ1A 3K2PA 2LY1A 4L6V5 4H0EA 3REOA 1Q8IA 3V8JA 4YG2F 1YITQ 2X1EA 2OTLI 2Q0RA 2PVOB 4MLOA 3J80O 4DS4A 4JI2K 2DXIA 3VOEA 3DXKB 2F69A 4I6ZA 2KROA 4YOYA 4CCLA 4L3QA 2P7CB 1U1SA 3JAME 3COAC 3QBWA 2A6AA 1S7OA 3J7ZO 3MO8A 4WXHA 3IAYA 4AFSC 1IUFA 2EZLA 3CCQQ 1C1CA 3PO3J 5GAGJ 1TSFA 3FE1A 4JDSA 4F93B 4A4GA 2H09A 3QXEB 4GW6A 2LH9A 1T98A 2P9SB 1YWPA 2LOOA 5CY4A 3IH4A 2V8JA 2F9WA 1U2VB 2GUIA 4GV6A 3THWB 4Y7NJ 2E2QA 1LVKA 3HSFA 1L3LA 3THXA 5ADXH 5IT9K 2FZGB 1FOKA 3FXMA 2X0LA 4MFBA 1IGNA 3CC2N 4JRQA 2PMZN 5J2PA 1HSQA 5FKKA 1IHWA 1GLAG 3BTJA 3LAJA 1J5YA 1Z9ZA 1JLCA 3G6EA 2EH3A 3DLLA 3C7NB 4OB2B 5GADJ 4FPAA 1VQ9I 1VQNQ 4CCMA 1VOMA 3I0TA 2A42A 2GBZA 2E36A 2XPVA 2NRWA 2J7IA 3CCJA 2UV1A 4I0BA 3VQEA 3QESA 4OVLA 3C7NA 4H0VB 3KWIA 3SZTA 3I0XA 5AQHA 1NYGA 3P7NA 2YUPA 5LFAA 4B9TA 2IW5A 1L3TA 3F6VA 2ZPEB 1VUBA 4O5BA 4BRCA 3JRZA 1N78A 5IOYA 2P9LB 4DQQA 2HSPA 4CESA 1XSDA 5LMNK 1SL2A 4ETSA 1VK0A 5E18F 2FEZA 2GWRA 2MK5A 1RFQA 4HV5A 3HPGA 4UV8A 3JB9J 2K40A 4RTTA 6PAXA 1KSWA 4RW9A 1YS7A 3CVSA 3KBGA 1SFKA 1E2XA 2DQRA 3GUDA 3FDYA 1ORNA 2M4GA 1LQ1A 3I4PA 2EHGA 2IIRA 3CWAA 3ID8A 1VQ4N 4BRFA 3VS6A 9ANTA 2O8DB 3U2RA 4RBOA 3NPFA 3ERMA 1W4SA 3K70C 2R5MA 1XQSC 4M45A 5ELZA 2VUMJ 1RESA 4CF2A 5E79C 5ECAA 2ZJQL 4OMNA 2HBWA 3LWFA 1SEMA 2YJEA 3CFPA 2RKIA 1WHHA 2GELA 2ZJQF 3PNVA 5JVHL 4HUEA 3NHNA 2PMZA 2FPEA 3CG7A 4M7DA 4I98B 1JKHA 3JCMX 3FR0A 4CEAA 2C6YA 4R79A 1DEJA 3LSPA 3EYZA 4P1WA 3S14J 1G3SA 2EJ9A 3EUAA 3CD6T 3Q3SA 1NPRA 1BK2A 4B1VA 2JPCA 3E01A 1AWWA 5GANf 3A5MC 1N5ZA 2NWMA 4FM1A 5E1ZB 3W3DA 1BCMA 2DK8A 2ZWHA 4G12A 2CUDA 2PFBA 2OANA 5C2FA 5JICA 4C92E 4FVMA 4O8KA 3CMAQ 2E5ZA 2ADUA 5IN1A 4XSXF 4ELVA 1YHQT 1DJ7B 2JMAA 2P9NA 3CC2Q 4Z4GA 1QCOA 3ABKH 1QVFM 4WXDA 4DU1A 1DU0A 4II2A 3F22A 3WUHA 2DKGA 3B6AA 3MN5A 3NRVA 3QG1A 2QGUA 1WSHA 3VEOA 3SEMA 4RW4A 1IBMK 1BDGA 4A0XA 2HAXA 4DFKA 1KFZA 1VHXA 3I55A 1YHQN 2LRDA 3D5SC 3DB4A 3UKRB 1PU6A 4IDHA 4BC5A 3C0BA 4U7BA 3JCMh 2LSNA 4IHSA 2DBBA 1MGQA 2DPDA 4QVZA 3GDQA 1S6QA 1RGIA 4JV5K 2WSCE 4QSHA 3VUBA 2MOXA 4GRIA 1UGPB 4K41A 4CIGA 2MCNA 3M4GA 3ULRB 3NDKA 4OIPF 2DT7B 4ZZDA 1KRPA 1VQLT 4EJUA 1UGSB 2KT1A 1IDYA 1XNRK 2KYMA 1EIFA 3FLGA 3F5TA 1Q86R 2IVPA 3ZSQA 3KJVA 2ZJRF 3AVAA 3FC3A 4KITB 4DW6A 4AI4A 2GX9A 2IVWA 2PJPA 2Y4YA 4BHPA 1IRFA 2E12A 2LQ8A 3TQ7P 2L3DA 2FBIA 3CCUI 4IFYA 5M1OA 4FJKA 4A3KJ 5D5VB 1VQOT 2LP0A 2L89A 1WUAA 3AVKA 3LANA 1HSJA 1BI2A 1QP2A 1H3HA 1IF1A 4DQPA 1P4AA 3HL2A 1GVDA 1FBQA 4X34A 4RMOA 2V52B 1EWQA 3CWUA 1MUNA 1CXUA 4JX4A 4HX7A 1BA0A 2M16A 3ER0A 3LH0A 1IW7F 2ZPHB 1WHMA 4U88A 5GMKl 1TUCA 3KZYA 3GFJA 1AHJB 2GUPA 1B9DA 3HGGA 3MN7A 4NB4A 1U5TA 4J83A 1JCFA 1S6LA 2WUSA 2QBYA 2R4GA 4A57A 1TWHJ 3TPQA 4J2EA 4M7AB 1KU9A 4LIVA 5JLWA 3S17J 3HJEA 3RIRA 5J2QA 5BPIA 3IHOA 2DL5A 3T7ZA 2IRFG 3KKRA 1VQ7N 3M8SA 1JGSA 1OR7A 3EKSA 1RABB 3GF5A 4OMQA 1XI1A 1R8OB 1LDKB 1ITYA 3LSKA 3HGYA 3HKSA 2ED0A 4MZMA 1Z21A 4Z02A 2RNGA 3V81A 3PL8A 2P7VB 2COBA 4PGGA 2JA2A 1YIJN 3FEOA 1IN5A 1FYMA 3GTJJ 1R00A 1UZCA 1NOZA 2KZMA 3CC2I 3LA2A 2ME6A 3RJPA 5J4YA 4CHOA 1U5TC 3PQKA 3THKA 2W48A 4CEDA 3PX0A 4FLWA 2YLCA 2LVMA 2F7TA 5HCKA 3QYBA 2EJGA 2L7ZA 1Q95G 3S1QJ 2LYCA 1WLPB 3SK3A 2KRNA 4ATOA 1N3AA 1VIEA 5KYNA 1JEGA 2P9PB 2RJEA 2AKKA 4M78A 2LTOA 1W7PB 4JS4A 2QI2A 5AQJA 3BZKA 4YOTA 1BCOA 3S2WA 2L8DA 1G3TA 1X1CA 4J6XA 3F0CA 5ERIA 3WXIA 3J7AP 3BJ6A 2R5ZA 1GOBA 2VOPA 5A0LA 2W04A 3QDKA 1LDDA 3C95A 2GOXB 2DJZA 4F7ZA 1BC8C 2DFUA 4OB1B 1UGQB 1VQ9Q 1T0FA 1V4RA 3E5XA 4JKHA 2EZIA 3WGGA 1NJWA 1E6HA 1NWKA 2RVCA 3MQ0A 1KU3A 4L9TA 4KNYA 1TOVA 2OA4A 5FFZA 2Q0UA 2LP5A 2DRKA 1KVAA 3O8GA 1FSHA 2W85A 2P0WA 1F1BB 3KHYA 2XRNA 5AIPA 2CKKA 1NM1A 2LQKA 4J5YA 4NB5A 3DLRA 2PAVA 1WQWA 2E1ZA 3I0RA 3PO4A 3DV8A 5LD2C 1EWRA 3FXUA 4MFEA 1Y1VJ 2F5EA 4MEYF 2F2VA 2NNWA 3M8PA 4LF8K 3CCST 1VQKI 1Y0MA 2X1CA 1P7JA 5EZHA 3W6KB 5D4SA 4CF0A 4YTLA 2CH4W 2JS0A 1PRMC 1BM9A 2O8XA 2FNPA 2HEOA 1X75C 4DLEA 5GAMf 2R7DA 2COZA 2HVSA 4B9VA 3J7AO 2CMPA 4CJEA 5FPMA 1S1NA 1UMQA 3HOUJ 2CSQA 4DFJA 3HDDA 3CETA 4J9FA 4NXMK 2R7UA 4CGDA 1LE8B 1Y71A 1K8AO 2JN0A 2MI6A 2BHZA 3OGDA 1N36K 4M7AE 4B6MA 2LY9A 1XMKA 2D5RA 4DZJA 1PP8F 1Z0XA 3CIPA 2O0YA 4EW4A 3L4IA 3JB9I 4DU3A 4Z4FA 4H5VA 4FWMA 2F5DA 4DQRA 4DSLA 3LZJA 2IAIA 2A5WA 3ZPLA 3M4YA 2XRIA 1EH6A 3CDIA 4CYDA 2V6CA 3MKZA 2F2WA 3QHSA 3CCQA 5CVRA 1TL1A 2Z9OA 4AI5A 4NBQA 4L5IA 2XRLA 1OI1A 5AZIB 2ABKA 2QTXA 3A2FA 1J53A 4S04A 1S72N 2E19A 1UTIA 1TBXA 1JRIA 2Q97A 4KIGA 1HKTA 5E3OA 3K4BA 2XASA 3CPFA 2DY4A 2OF7A 3DPLC 2MPXC 3H36A 1SRMA 1EX4A 4M9XA 3ZSRA 1XWLA 3DKXA 1G3WA 2EVRA 3F73A 2Y9YA 5FU7C 3RDVA 4BC4A 2OAZA 5AQIA 3C1DA 1KC8R 1I94K 2LDUA 4A2UA 3LPUA 1B9FA 4FIBA 1S29A 1ZUYA 2I5JA 2GM4A 5EG0B 1ORKA 2O61A 3MMYB 3HTUA 1ZC6A 5HS8A 3G6ET 3FXQA 5EYRA 4XIDA 2JLEA 2BXYA 3ZETA 1HNZK 3V4GA 4HQEA 3GE1A 4RTWA 2BZYA 1R49A 3GBTA 3SEZA 4OIQF 4QS9A 4ZDPA 1RL2A 1SAXA 2VC8A 1SKRA 3KZBA 3HPWA 3VQBA 4JLHA 2PU9B 3P5JA 4U7DA 3VS1A 1XNIA 4W5QA 2A28A 1HR0K 4M7DG 5EU7A 5I3UA 1L3SA 1U06A 2YX6A 2TRTA 3VQCA 3I0WA 3I64A 4K42A 1E6GA 4PL6A 3UE5A 4PKGA 1YITT 3G1OA 4K8XA 2Y1JA 1MDUB 1VA7A 3EH1A 4HTUA 4C3HJ 1IUYA 2P84A 2NVQJ 4CC7A 3OSFA 2F5CA 2M3AA 3KK7A 2VKNA 1S1WA 4CFDA 4A0ZA 1X6GA 1QVUA 1UOCA 3VETA 3FHZA 1IV0A 5C25A 2RHXA 2D9TA 3T8RA 1HW5A 5GJWB 3LL7A 3A4CA 1SD5A 3CF2A 1X4OA 2R58A 4LDWA 2P0QA 2QWWA 3PJRA 2DX1A 5H2FC 3ISPA 1T05A 3M9AA 3H92A 3M0PA 1GRIA 2XD0A 1REPC 4EFHA 2X78A 1SD4A 3QWXX 1G99A 2Q3SA 2MIOA 4AHSA 1PD1A 1KAXA 1WAJA 3HC7A 3CJCA 3K7AJ 1Z6TA 5GADP 1X1DA 3FJ5A 2YSQA 4M4ZA 3V7RA 2KKZA 3F72A 1WJBA 3LP3A 5LEKA 2EQIA 2RNJA 5HLHA 4B1YB 1S72I 1U45A 4PKIA 1WJSA 2X4YA 8ATCB 1YG2A 2KT8A 1X9MA 2V4JC 1FN7A 1EQYA 5HS9A 1NBEB 4B23A 4XQFA 2ESHA 5AZIA 4YFKF 3O8MA 2HKNA 4A3EJ 4L0YB 3G71N 3GFMA 3VPZA 3EFRA 1K9MU 4GYGA 4RUGA 3FISA 2FQ3A 1UB4A 1BUPA 4PY5A 2A68F 2KZZA 3BF3A 3ENHA 2V1NA 3RR8A 3D7SB 1P4XA 3CCJI 3WGIA 2P4RA 2VG5A 1R0BG 2LZ6B 4GNIA 1BOBA 3K0SA 4KICA 1F9NA 3MCPA 2JPBA 2KE9A 1RTDA 3N0UA 1JJ6C 2PG4A 4XLHA 4L5EA 2M9UA 1TYQA 3TAEA 2P5KA 4C8QF 3REAB 3PIOF 1VQ6N 3QO3A 2FXAA 5EGOA 5K1YA 5E1WA 3JSMA 1QSYA 2DDBA 3QEIA 1QVFS 1RLPC 3FZFA 4VUBA 5F0CA 2UXNA 1I07A 1HYSA 4G94A 2RPIA 3IKVA 1DGRM 3M58A 4JUVA 3HB9A 1J75A 3C94A 3NH2A 4M7DB 2F48A 3U9ZA 3PMTA 1ASWA 4CEFA 3L2ZA 5CQYA 4AHTA 2KIMA 1JKPC 1EJ9A 1BW5A 5C24A 1YI2A 2M1HA 2K57A 2A40A 2QEXI 1WWXA 1JCEA 1M90C 4L5GA 1NKEA 2HMIA 4DZPA 3C6AA 3PV8A 1V54H 2LQNA 1LB2A 3P9CA 3M8RA 3ZT4A 2GZWA 4EIKA 1USSA 1KTQA 1YJNN 3C0CA 5C12A 2R92J 3Q1JA 1R5ID 2R93J 3CW7A 3PSFA 3CC4I 1W36D 1IZ1A 3MWMA 1T38A 3DCFA 2EFPA 3HOVJ 1HW2A 3AO1A 4QPOA 3VRYA 1G3YA 3KP6A 5CAIA 1FT9A 3VQ4A 3K4NA 1JT6A 2CZ0B 1Q1VA 1X1BA 2KMUA 3X20B 4WF9L 1GBRA 3HTRA 4BRPA 4EMKC 2A36A 4J2AA 1SF9A 5DUIA 1BIUA 1IKYA 5LMUK 5J1YA 2HDAA 3S16J 4HBLA 3QPLA 3P38A 2L2PA 2J4RA 3NTIA 4EHUA 4O5VA 3RRHA 2KXDA 3H1CA 3ULEB 1KU7A 1K73C 2I2LA 1GVJA 4KUIA 5HS7A 2BANA 1U1TA 2J5OA 4II3A 4C0FA 1VQMA 2LK2A 3MZ8A 1Y6IA 4PNOA 4A93J 2FA5A 1WJCA 1QMCA 2XAHA 2DMTA 3OMGA 5D6WA 3AVNA 3HRGA 3OYIA 1BA5A 1Y7XA 2X3WD 2BTTA 2W25A 3BCAA 3CCJN 2GQIA 4CE9A 3CMEQ 2P9KB 3M0SA 5J1RA 1NK9A 5BPDA 2IAJA 2NUPB 1VQ5A 3SDGA 2VBYA 2ZZDA 1YO5C 2DIGA 1EKEA 2O9SA 4P5NA 1J09A 2XKOC 3RRGA 4H0YB 2CS3A 5C10A 4DR6K 3K0LA 3CXCS 2E6NA 2NOEA 1N6QA 1ZLKA 3HUGB 3DAWA 4IOXA 4R56A 3KP3A 4Z88A 4RLQA 3I55T 2WY7Q 5IP7J 2X6NA 3OB9A 4F91B 1UFFA 3NF7A 1JL2A 2YNFA 2BTFA 2OTJN 1KU2A 4AM7A 4AVZA 2WV1A 3CCRT 4JI3K 2HQHA 2BHYA 2I8DA 1WSIA 3GL1A 4DNCA 5J3BA 2XAFA 1QZ5A 5EF6A 2HTSA 4E9EA 3VN5A 2X1DA 2JJ9A 5IHNA 1DU6A 1FP1D 1HKCA 2P9KA 4FW1A 1EBMA 2E41A 2E5KA 1VQLQ 2HQAA 4CC3A 2JMCA 3NBPA 1IKVA 1FBSA 4BNCA 1Y57A 2QEXT 4QS7A 4EJOA 3CC4N 2QEXQ 3BUZB 2DL3A 5D6YA 3VEXA 3LYIA 3O9QA 3I55I 2ISZA 2D0NA 1MDMA 5KVRA 2HNIA 2E71A 5KK1A 4Y28E 4GXOA 2ASPA 4CECA 1VSEA 2EKOA 2KSSA 5FO5A 2JWLA 4IXCA 3BY6A 4XOPA 2CU7A 3FIFA 2H6BA 4EHTA 3K5MA 3CWSA 4DV2K 3CCRN 2L9RA 1N6AA 2FU4A 3QWYA 2DA5A 2KRMA 1RAGB 4CZMA 2M34A 3HKZA 3LWHA 2YUOA 3SDZA 1TW3A 4BWJA 1L3VA 4E7HA 3HTSB 1NKUA 5FU6B 3C18A 5JR3A 2Y0SA 4M78G 3QSUA 3CYMA 3KLNA 1OISA 4AIAA 2P9UB 5AN4A 1I8FA 2EFOA 3M7GA 4XAXB 1XSVA 4CEQA 3CCUT 2WA0A 1XNQK 2NS0A 4DTUA 3CBOA 3O9RA 1T03A 1EO1A 5LGUA 3NVMA 4OAYA 5BN8A 2HOTA 3OYKA 1S72T 3AVIA 5L3FA 1SUQA 4BC3A 3KIOA 4E2FB 2EYZA 3ESWB 4XIUA 1VYTA 4IUUA 3CCYA 4BGAA 2L0KA 4I6MA 3R6SA 4M63C 2NZTA 4J19A 3EGDB 2XICA 2X6SA 1W36C 3I55Q 1USTA 5BRHA 4GDFA 4M77C 4RCBA 5EDNA 3LL3A 1WSGA 5BS6A 1JKQC 4AYBA 4ISFA 4I7FA 3ZOBA 1ZQ3P 2DAQA 1ZLJA 5A0GA 4CZHA 2VE9A 2DL4A 1JXOA 3ZQ7A 1NGFA 4KFCA 4JK1X 1NJIU 3CMET 4X1VA 1UB9A 4EJYA 5KQ8A 4YOWA 1K4SA 1HA8A 3HBLA 2GEMA 5E1XA 5IT9E 1HJOA 4R8HA 2KISA 3GF2A 2EIFA 1KLNA 5CO7A 2KNBB 2YKMA 4NLCA 1RRQA 2KY9A 9ATCB 1QVGS 1WEGA 5GAN6 1G5VA 1HNIA 5C4JJ 2XAQA 2LCCA 4JD2A 1D8YA 1E17A 2JM8A 3DXMA 3NVKA 1YW7A 1T33A 3LAKA 4JNEA 3WODF 1P8ZA 1P59A 2WACA 3MEUA 2OCCH 3W6VA 2M45A 3PQJA 5FLVA 2OI3A 4IIMA 2I7PA 4DV1K 2D0BA 1R4NB 2OUMA 5IYDJ 2FZKB 4MTEA 1MZBA 3CDHA 2R7ZJ 4B22A 2L9NA 4DQ2A 2YHTA 2HBLA 2XKPA 3THWA 1B9MA 5K7FA 1BR4A 2XGXA 3ZX3A 1YJ9Q 1QA6A 4CEZA 5LBQA 1F21A 3HG9A 2EKHA 1PYVA 5LGNA 1YX3A 4AIJA 2XUBA 3VJPA 4C5HA 4A3GJ 4CYCB 2PTKA 3W0LA 4EP4A 4Z0UA 3BR5A 3PX6A 3H1VX 2EYWA 1VSKA 2HI3A 1OZ3A 4D5FA 5LJVA 1X1AA 1LNWA 1XG1A 3DEEA 3IH3A 1K1ZA 3MX2A 3WTTC 4LC9B 5GAOm 2E2JJ 2BVMA 4AILC 2P9UA 3IG1A 3OW2P 4ELYC 5LHGA 3VW4A 4CF1A 2O8KA 1MUYA 4Z4EA 3DTEA 1LV5A 2D5VA 4G6DA 1QVFP 3IWFA 4DHYA 4Z4IA 3VMFB 3BGRA 3SFIA 2PJRB 4FJLA 2MYSA 1VZ0A 4HG2A 3P4IA 2O7OA 2IBDA 4G6QA 2LJ1A 4IO8A 3CJAA 4CCKA 1MBHA 1LW0A 1VQ8I 3MCAB 2Z1GA 5CR4A 2ECZA 3E5UA 1SMTA 1M3AA 3SBGA 1K8AU 1Z91A 2CP3A 4JKFA 1FJGK 2JVHA 4B9WA 3CBPA 1KA8A 1FOWA 2JJ7A 2KMTA 4M3GA 2XPUA 3M0UA 2K4JA 3M5AA 5E8IA 3JW4A 1J5OA 4DU4A 2E2NA 3ULDA 2FBHA 2YS9A 2HQ5A 1NTCA 4HNVA 1A36A 3TQNA 3VQQA 3AO3A 3I71A 3PFYA 2KRCA 3ABUA 1XPXA 1R1TA 3PIOA 4ZGDB 2VXFA 2HWVA 4IG0A 3MN2A 5TJJA 1JCGA 2CV1A 2NVXJ 2CW8A 2FF3B 3UIQA 3T1AA 5A0DA 3AO5A 1TNSA 1VQNI 2GA2A 1T39A 2K3PA 2DA7A 4E9GA 2ROTA 3OBYA 2CW0F 2XAJA 2O4GA 2RGVA 4YIFA 1TL8A 3W6JB 4RDUA 3D1NI 1V3FA 1I5ZA 2D0QB 4B9NA 3RZOJ 4BI4A 2VT3A 4FW2A 2QCOA 5IYBJ 2AZVA 3LDPA 3ZN0A 2Y69H 2QWNA 4DQ8A 2ROLA 5M1QA 4HSTA 3E9LA 2G8UA 4HSRA 2ZQBA 2K7AA 2DM1A 2ZGWA 5BREA 1S1VA 3EG9A 2VLAA 3OW2A 1KQ9A 1KONA 2OTLT 3QEXA 2ZXJA 3FF5A 3PIOL 3OJSA 4Y13A 1VQ8Q 3IAM2 3SQNA 1TVRA 2KXCA 1RDCA 2A1RA 3AY9A 4B8AB 4LN2A 1NK4A 3F8NA 4PWDA 5HDGA 3IDHA 3L8BA 1FC3A 2QWRA 5ICGA 4I2PA 4C8QA 4KGZB 3S1RJ 4OMOA 1Y8QB 5C3EJ 3A8GB 1M30A 3D5RC 1SG5A 3D0PA 2PNIA 3CCET 1OYIA 5GAOr 2RM4A 3M0RA 3H0IA 4EZ6A 3QETA 2ZD1A 4GGGA 3MAQA 3VPRA 3I9QA 4A3MJ 2GIVA 4CHZA 3RYPA 3V9WA 3RMQA 4PA1A 1T6DA 3P83D 1O9SA 1UJYA 4FX0A 4HEA2 3SI6A 5E8GA 3PLAA 1H8KA 4FLUA 5I2SA 2KRHA 2GA1A 1D0ZA 1MWKA 2M8EA 1W2BM 1V5FA 2ZC2A 2BZXA 2CP7A 2DF6A 3JCMQ 1OVQA 1ZBFA 4UY8I 5CR2A 2ZMEB 2JVVA 4N4OB 5M5YJ 3AA4A 2XF7A 1WJRA 4A12A 1TUYA 1SZ2A 1SKSA 3G0ZA 1JQQA 3H45C 2JRMA 3HKZN 4MNUA 1EETA 1SC7A 1YRNA 1SPKA 4KH6A 2X51A 4Y91A 1Y07A 1ZKGA 1S1TA 4O8UA 3KLFA 2FE3A 4MQ3A 2HDWA 1IXSB 4QOZB 2CREA 1X6BA 5CVIA 4E7JA 5F2RA 3NAEA 1X9WA 1BBYA 1VQNN 2CQKA 3CWTA 3PUFA 5GAHJ 4M7YA 4OMZA 1VRLA 1LKXA 1OJLA 4XTYA 3CJNA 4FSSA 1S1XA 3CD6N 3SFMA 4DTSA 4KUDK 1P2FA 3HHHA 1M8VA 1GV2A 2X48A 4DCHA 2BY0A 2X35A 1V4TA 5M1KA 1D8JA 4U0WA 2YRCA 2FC0A 3FHGA 1OH5A 3NF9A 4EATA 4BRDA 1V1CA 4O55A 2VQHA 1HQEA 3C7JA 1WGSA 3CCUN 4DTRA 2MA3A 1Q81R 1UE9A 1Z25A 3C6TA 4OMYA 5GAN2 1KSPA 2UXBK 1B4AA 2VBZA 4IOCL 1KK7A 1N25A 1Z05A 4A63B 5AT1B 4IOCF 3AG2H 3CCVQ 4CJPA 3J8AA 1WOQA 2O01E 1NK8A 4B21A 2ZXHA 4H03B 1VTNC 2YG9A 3OYGA 4JZ4A 4M77B 4NYNA 4M78B 4IPAA 1VQ7I 2PLYA 2DOEA 1BWFO 4FHTA 2HSTA 1G4DA 3L7WA 4IL6C 3L1AA 4IQJA 3QEVA 5EG2A 3L2QA 3TREA 4B9XA 3CD6A 2K2VA 3PX4A 1PWTA 2HKQB 2KQWA 2B8AA 3UWNA 2JWTA 5LHHA 4LFCK 4LFAK 3WQUA 4M3TA 4E19A 4HCKA 4FYXB 1MPGA 2NOJB 1FX7A 2E65A 4QS8A 4WFNL 3UA6A 1WEFA 4AQYK 1X2NA 3ME9A 2YHBA 4C92F 4HNUA 1WQ7A 3VEZA 2H3GX 2V79A 5GTHC 1NOYA 3CUQB 2JSPA 4LD0A 5CJ9A 1SRLA 4JLGA 3GG4A 2B0LA 4CJFA 3B6PA 2LQWA 1FNNA 5GANg 3MEWA 2O8CA 3VB2A 2QG9B 1Z26A 1IJJA 1TLHB 1UECA 4XONA 3OS2A 2QTDA 3R0JA 1JLEA 1N9SA 1WQ2A 2Y30A 3QOEA 5M1NA 4BACA 2Q8KA 3KFVA 1LOTB 4LH4A 5KYWB 1S7AA 3ZLJA 1U84A 3X2QH 3PMIA 3LSHA 2OQRA 3EGXA 3TSUA 3G7ZA 3CBMA 3MXIA 5DLOA 1Z6RA 4KYWA 2DAOA 2EIMH 5GMKj 2RV8A 3VQ9A 2DN0A 2HDDA 3CCVT 2MLGA 3V7SA 1MMAA 1V5EA 1EF4A 4MQ9F 4HF0A 3MWPA 1MW7A 4A69C