4E7KA

Pfv integrase target capture complex (tcc-mn), freeze-trapped prior to strand transfer, at 3.0 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
366
structure length
366
Chain Sequence
b'DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 96
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7kA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7kA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7kA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7kA03
5FRNA 5HRRA 3LDSA 4KHUA 1RTIA 2L89A 3E01A 3ZSYA 1CZBA 1IKWA 1KVAA 4O44A 4IG3A 4Z4FA 4DU3A 4BDPA 1DTTA 4B9SA 1S1VA 2G8FA 1X1PA 2Z1IA 2DIQA 1BIUA 1JLQA 3OYGA 1YTAA 1RBSA 1JL2A 4B9MA 4CK3A 1TKTA 3D0PA 1RT7A 3ASMA 4Z4HA 4PY5A 2EQJA 3OYCA 3SQ1A 1JLFA 3U3YA 1SL2A 3GOXA 3DLEA 3LP1A 1WJSA 2EQMA 3ME9A 3LAMA 2B5JA 5KGXA 4M3YA 1S6QA 4NCAA 1WSJA 1J9AA 2PYJA 3TARA 3HO1A 4OKJA 2CKKA 2O4IA 4CEBA 3WNFA 3IS9A 4DSIA 4O0JA 3ZSOA 3L42A 4N4HA 1HPZA 4HTUA 4IUVA 4J2AA 3VQBA 2X4XA 1QSYA 1YT3A 4B08A 1HYZA 4B9UA 2P5GA 3UT1A 3NGYA 4M41A 4EP5A 4TSXA 4CGDA 3SZ2A 3S3OA 3SQ4A 3CQ8A 3RRHA 3KD5E 2VG6A 2WOMA 4DQRA 2AJQA 4IURA 3L3VA 1N6QA 3WNHA 4XIUA 3TANA 3LAKA 4H4OA 2XY6A 4CF0A 3SCXA 2R7YA 1BI4A 3MP1A 4HUEA 3PNWC 3KK2A 4BE0A 3O4NA 4FVMA 3RWUA 3KLIA 5J2NA 2RHXA 1XHZA 1KLNA 3C94A 3NGIA 1SV5A 5J1EA 1MU2A 1T8EA 1HYVA 3T3FA 3OYFA 2W42A 5J26A 4JLHA 1OI1A 3SV4A 5EU7A 4ELUA 3HJFA 3G0ZA 4DFMA 2DIGA 1VSMA 2D0BA 4N47A 3ISNC 4F2RA 2RJCA 1U4BA 1C6VA 3C6UA 1UA0A 3QIPA 1NKBA 4FK0A 2ZQBA 3ALYA 2KFZA 4B9NA 4ZTFA 3KLFA 1RT2A 2HQXA 2HHQA 3L2RA 4PA1A 3VA3A 4CEEA 3PV8A 3SUOA 4C8KA 2HVHA 3DB4A 1XHXA 4I2PA 1RI0A 4C5HA 3HSTB 4DG1A 2RI2A 1KSPA 5IN1A 5KRTA 1UA1A 4KV8A 4GY5A 4BE2A 3AVJA 3C95A 3DLHA 4CGJA 4FJ9A 4DFKA 4C5GA 3K5NA 3U6FA 4HVJA 2YKMA 2K3XA 3ZT4A 3DRPA 2O4XB 3ITHA 4FZZA 5J2QA 5HRNA 3DLBA 3ULDA 3LP2A 4F2SA 3ZSRA 3V9UA 3V6DA 4FW1A 3TAFA 4FLYA 4JRQA 1Y97A 4FJHA 2IS3A 2G8HA 1W0HA 1HYSA 1D8YA 3PUFA 3BGRA 4H4MA 3AA5X 4CECA 4CFCA 3LPTA 4FJ7A 1S1TA 3QKJA 2BKDN 3QJ6A 1ZBIA 4PUOA 1HNIA 1F21A 4ZHRA 1DTQA 4AHRA 4HCCA 3VQ7A 3OYBA 2IAJA 3I0SA 4FZXC 4H8KA 4Q5VA 1EP4A 3AO1A 1XNIA 3HPHA 3M8QA 2RF2A 4ZTJA 4FJ8A 1Q9YA 2VG7A 1RBUA 1SL1A 2D5RA 3HXMA 5J2MA 4EZ9A 4A4FA 3LP3A 2YNGA 3THVA 4OPKA 3VQ5A 3NE6A 4KB1A 4KTQA 2YNFA 2XDPA 4K8ZA 1TAUA 3AA4A 5K14A 3LZIA 4DTMA 2LDMA 4BD3A 1U47A 2X74A 3ZEHA 4HCBA 1L3SA 5HLFA 4B3OA 3RR7A 2DFFA 4E7JA 3MEVA 1HJRA 4ELVA 4W5OA 3KTQA 3L3UA 3OS0A 2VWJA 4DQQA 3OMGA 3VN5A 2HHWA 3AVIA 1LAVA 1QSLA 4E7HA 3DLRA 1T03A 3C6TA 1WJQA 4CCHA 1KTQA 2FBYA 4QW2A 2YRVA 3V9WA 1S1XA 4QAGA 3HM9A 1JLCA 4DTNA 1BCMA 5C24A 4CE9A 3MAQA 3EY1A 4X34A 2G8UA 4FLXA 1JLAA 4PWDA 2R5AA 4QQDA 5KTQA 4CJPA 3SNNA 1HNVA 2OZSA 4M3ZA 2VG5A 5KH6A 1RBRA 3HT3A 4F3TA 4FJIA 3VQQA 3RRGA 5T7BA 4E0DA 3QLHA 4O55A 4CJRA 3CEYA 4CHNA 4OVAA 2HNYA 2M0OA 1IH7A 4CEZA 4I9QA 3M8PA 4GVMA 3SPZA 2EKOA 1VSEA 3TAEA 1LWEA 3G10A 4DTXA 2KQ2A 3JYTA 1Z25A 3QNNA 4DQPA 3KUFA 1BIZA 1LAWA 4KHYA 1LWFA 2OPPA 2QQRA 3KLEA 4JS5A 1OZ2A 2HNZA 2DAQA 5C42A 1TK0A 1CLQA 4DLGA 4CFBA 3AO3A 5KCHA 4FM1A 3DLGA 4W5QA 5HBMA 4AILC 2Z1JA 2R57A 3CG7A 1RCHA 3K5OA 1WNSA 3OYMA 3DOLA 1J5OA 3K2PA 3D45A 1LW2A 4DTPA 4DU1A 4KHNA 4KHWA 3META 5CZ2A 2RHZA 4QCLA 3MEAA 1CXQA 1S1WA 1RTDA 2XRIA 2WACA 2F96A 2GV9A 4AHSA 1EXQA 3F70A 5DK5A 4M3UA 3BDLA 3KKSA 4HUGA 2G8VA 4BWMA 3NF9A 1N27A 4FLZA 1RDBA 4CGFA 4OGEA 2VYTA 3MO8A 3ZSZA 4M3RA 1TGOA 2ETJA 3HPOA 1L3UA 1J53A 1JLGA 3IRXA 3MEUA 3TAQA 1SKRA 2IGIA 3QINA 3PX0A 5CZ1A 4KTWA 3QESA 3OYHA 1G15A 2OPRA 3QEXA 1WN7A 2JLEA 3LLRA 2QKBA 4E89A 3RR8A 2QKKA 4CHOA 4Z0UA 3CM5A 3ZSXA 4AHVA 2RJEA 3NFAA 1NOYA 4R5PA 4DTRA 4DFPA 2R5MA 3V1OA 1QE1A 2MWOA 1NK5A 1B9DA 3P83D 2RKIA 3HK2A 2HHVA 4C8OA 1WAFA 3FLGA 1VK0A 1TL3A 4Q0BA 5KE2A 1JLEA 3MP8A 3OVNA 3NHGA 4RW9A 1U48A 1RNHA 4Z4EA 3MP6A 2P1JA 1WSFA 1K6YA 4N41A 4FK4A 5FDLA 3DB3A 3LWMA 1RDDA 3AVFA 4KHSA 1C0MA 3MECA 1UOCA 1L5UA 3AVAA 3M8SA 3OS2A 1A5XA 3OYIA 1A5VA 3LH0A 3OA6A 4DSJA 3DLKA 1NJWA 4AH9A 3C4SA 3L8BA 3SD4A 2HVIA 4CEAA 4CJWA 4B9VA 1A5WA 1VSDA 3PO5A 4DSLA 3I0RA 4FJKA 2JGUA 2G3RA 3CFPA 2Q3SA 5J39A 1YVUA 2BIVA 1ASWA 2EHGA 3PFSA 1TAQA 2IC3A 3ZT3A 4M3TA 3O3FA 4AHTA 4BDYA 4LH4A 4Z4CA 3F73A 5HRSA 1WSIA 5C6SA 1KVBA 4DS5A 2ITGA 4WE1A 1ZYQA 2HQEA 3KD1E 3L2VA 3K58A 3QEPA 1HQUA 4CFAA 3SQ2A 3QEVA 1UAXA 1GOBA 3SUQA 3DM2A 1CZ9A 2E6MA 4E1MA 3MEEA 4N56A 1KVCA 1NK8A 2QQSA 5HP1A 1WLJA 2Y1IA 3NTIA 1TKXA 3TI0A 5CY4A 3SPYA 3P1GA 3KKRA 3QETA 4AHCA 1BL3A 4FK2A 1D5AA 3ZT0A 2GFUA 3RMAA 4DTSA 3VQPA 4FLVA 2R58A 3S3MA 3V9SA 4L8RB 4YFUA 4CJ4A 1WSEA 4CK1A 4FXDA 1X9SA 3OYDA 4CF2A 3O3HA 3VQEA 2EQKA 2RJDA 3OY9A 3ZT2A 3HYFA 1NK0A 4Y1DA 3LANA 2L8DA 1J54A 4OPJA 4ICLA 4DTJA 4FM0A 1UWBA 4II1A 4DF4A 2B4JA 2PY5A 3UWNA 2KTQA 4NYFA 3T19A 3MXJA 4IUUA 2NLUA 5IAYA 3LX7A 3VQ4A 4FJNA 1DLOA 1EETA 4IKFA 4B9LA 2B6AA 3EZ5A 2D9TA 3LP0A 2YHAA 1NK6A 3KIOA 5E41A 4N4GA 2K3YA 1FKOA 3MEGA 4DSFA 2QK9A 5KGWA 4NS5A 5SWMA 3MEDA 4HHTA 3TR8A 4CK2A 3P5JA 4DTOA 2XK0A 3MEWA 4HUFA 1ZBLA 4KPYA 4I2QA 3OYKA 1BCOA 2O4XA 1WAJA 2HW3A 4CJVA 4K8XA 5JS1A 4PLLA 1RILA 1FKPA 1SUQA 4J2DA 4Z02A 3S3NA 1G5VA 4O0IA 4ID5A 4RG2A 4RW4A 4E7LA 2ZD1A 3O4QA 3OYJA 2XHBA 3AO2A 2RHUA 1ASVA 1S6PA 3OQ5A 1IKVA 3PO4A 3SUPA 4CF9A 3IG1A 2RHIA 1RTJA 3KJVA 4FJLA 1NJZA 3ASKA 1I39A 3L2UA 2RI3A 2HHTA 3LPUA 2ATQA 3TWHA 1LWCA 2BANA 4N76A 1LW0A 1TKZA 3WNEA 1GOAA 3FEOA 4E1NA 4DQSA 1VSLA 2G8KA 4CJ3A 3V9ZA 1O1WA 3L2WA 3SJJA 1IKXA 4CFDA 2D0AA 4RW7A 4BWJA 4W5RA 3RMBA 3CFRA 3K5MA 4RW6A 3T1AA 3VQ9A 4C5IA 3SUNA 2RHYA 4FLUA 2HHXA 4CGIA 3BDPA 2DTUA 4CEDA 4M45A 1VSIA 4CIEA 3L2QA 2X6NA 4NZGA 3B6OA 3NCIA 3H8ZA 3MXIA 1KRPA 3QIIA 3S9HA 1VRTA 4IFYA 4IDKA 2LTOA 3O3GA 3AA2A 4CESA 1FXXA 2L3RA 1IO2A 3AVKA 1KCFA 4GW6A 2E5QA 3NH0A 4EDUA 5DMRA 4CGHA 4FJMA 2GBZA 4B9TA 3KK3A 1NK9A 3HP9A 3SYZA 3V4IA 3OMCA 4CJEA 4O5BA 3LGFA 3NH1A 2A1SA 4Z4IA 2MWPA 4UC4A 1FK9A 5JS2A 3QERA 4IFVA 2YV0X 1C0TA 2BE2A 4KHQA 3P8HA 3OYLA 2D0CA 1JL1A 2RJFA 5FRMA 1I3AA 1ZBUA 4KI4A 2VWKA 2HNDA 4M42A 2DFHA 3AA3A 3S6WA 2YNIA 4CJQA 4M3WA 3F9KA 1X9MA 4LY7A 3WNGA 4DQIA 1EKEA 5C25A 1U04A 1VRUA 4FJGA 4DSEA 3HVTA 1C1CA 4N4IA 3AVHA 2KW4A 4J2EA 2YNHA 1S9EA 4W5TA 1ASUA 4UQGA 3HPGA 2E6LA 4E19A 4F4KA 4KI6A 2HB5A 4FZYA 3AVNA 1OZ3A 1TV6A 5I42A 3VQ8A 2LCCA 2X35A 1OYXA 2P0KA 1RDCA 1ZBFA 3AVCA 1REVA 2RPIA 1R0AA 2I5JA 3DYAA 3OS1A 3RMCA 3HVRA 1ITGA 2M1HA 2DY4A 1TL1A 4FLWA 3OB9A 4NCGA 1RT3A 1BI4B 2Z1GA 1CXUA 2IOCA 1SKWA 4O4GA 3AVBA 2NUBA 2G8WA 1L3TA 3PMIA 4KKOA 2HMIA 1C1AA 4IUTA 1VSJA 3AO5A 2JZ2A 4DU4A 2RI5A 4C8MA 2FBXA 1D9FA 4FCYA 3PMTA 4QQ6A 3DMJA 3NF8A 3UIQA 4OLBA 2HHSA 1BISA 1L3VA 1C1BA 4I7FA 4JRPA 5SZTA 4DWIA 4E3SA 4A4EA 3NTHA 4FJ5A 4FW2A 1HRHA 5HROA 1IKYA 4F3OA 1Q8IA 4PQUA 1C0UA 3PX4A 1QTMA 3OJSA 3NTKA 1H3ZA 5CYQA 4FM2A 4OLAA 4YNQA 4C8LA 2XO7A 5KI6A 4Q5WA 5M9OA 4MQ3A 4CJ5A 2YHBA 3DRRA 3ZSWA 5CYMA 4NCBA 4CEOA 1TK5A 2A1RA 1T7PA 1EX4A 5D6WA 4QOZB 4CJLA 4B8CA 1JXBA 4OJRA 1NJXA 3I8DA 1X9WA 3E9GA 4BE1A 3AV9A 3SI6A 3PY8A 5J2PA 3ZSVA 3RTVA 2FBVA 3NH2A 2XY7A 2E6NA 3LALA 3IAYA 4DLEA 4CF8A 2JTFA 3TAMA 2FHDA 4CIFA 3FFIA 3FDRA 3DI6A 3V1RA 4CHQA 5FROA 3LZJA 1NOZA 2OYQA 1JKHA 4JS4A 4A4HA 3M9QA 4DMNA 1B92A 4KRFA 1SKSA 3TABA 4MFBA 4LD6A 4A4GA 2OPQA 1VSFA 4C8NA 3EYZA 2KZZA 4CJKA 5HRPA 3H08A 4Z4GA 3OYAA 4BDZA 4CJFA 1IG9A 3NDKA 4IBNA 2BDPA 3OYEA 3LWLA 3E9FA 3SQ0A 1B9FA 3AVGA 4CHZA 1ZBHA 3DLMA 3CYMA 4LH5A 4PLIA 3NF6A 3FC3A 1TKDA 4OGCA 3VQ6A 3VQDA 2PYLA 3HL8A 5D3GA 3M8RA 1RT1A 2X6SA 5KE3A 5KCOA 2E4LA 1WJRA 2XY5A 3ZT1A 4DS4A 2GUIA 1RDAA 3QIOA 1S5JA 2RN2A 3KLGA 5D6YA 1TVRA 2LSNA 3V81A 2HHUA 3VQCA 4Y1CA 4KB0A 1BGXT 2EX3A 4M3XA 4FLTA 1QSSA 4OKKA 2Z1HA 2BGGA 3K5LA 1U45A 3P8DA 1BQMA 4CERA 4W5NA 1S9GA 4ELTA 2RO0A 2F8TA 3DOKA 3QNOA 1XI1A 3KLHA 1Z26A 4BACA 1T05A 4CJUA 3OYNA 4PL6A 2IG0A 4B8AB 2OZMA 2M16A 2Y1JA 4IUQA 3V9XA 4DF8A 1RT5A 1WSHA 1VSKA 2BUDA 4EP4A 4CRIA 4I9LA 3QO9A 1NKCA 1QS4A 3NF7A 1JXEA 4CJSA 3HP6A 4KREA 1RT4A 3K59A 4CHPA 1D9DA 1W9HA 3LYIA 2EQUA 1XC9A 2LRQA 2P5OA 3V1QA 3CM6A 4ID1A 1GOCA 3QEWA 3PX6A 3MXMA 1QHTA 3TAPA 4CGGA 3TAGA 3NGZA 4J2BA 3VQAA 4L59A 4C5EA 1KHCA 4N5SA 4GMJB 3Q1JA 4KFBA 4IG0A 3NAEA 1HQEA 4KAZA 3U3GA 3SV3A 1BQNA 4LSNA 2G8IA 2KFNA 2B8AA 2PZSA 4RG8A 3B6PA 4B9WA 1KFDA 1U49A 3K57A 3LGLA 1TK8A 3NNQA 4G1QA 4OKEA 1KFSA 1KLMA 2IDOA 1QQCA 4CIGA 2XY8A 4E7IA 1JLBA 2ZE2A 1SSFA 4FU6A 3EAEA 4F8RA 4LD0A 1RTHA 3DRSA 4FJXA 4DFJA 4RW8A 4FJJA 4E7KA 1BHLA 4DTUA 4NYNA 3JSMA 5CIUA 2YKNA 2X4YA 3KK1A 4CEQA 1N5YA 1MHNA 1WGSA 1NKEA 1RT6A 3AO4A 2X78A 4LSLA 4HCZA 1NK7A 1SL0A 2LVMA 1RBTA 2P51A 3AVMA 2X4WA 2FBTA 1WSGA 4QVZA 2KZMA 4CHYA 2FC0A 3QBYA 3NBPA 2O4GA 3A2FA 4AHUA 3H6ZA 4IUPA 5KRSA 2OPSA 1YTUA 3CFOA 4B9XA 3AVLA 1NK4A 4EZ6A 1NJYA 3RMDA 4QQGA 1LV5A 4KTZA 4OVLA 2QXFA 4DSKA 4KO0A 3O8VA 5C0MA 1HMVA 3QEIA 1XWLA 4FL6A 2EFIA 2PQWA 2DFEA 3ZCMA 4CJTA 2WONA 1RBVA 3VA0A 2GFAA 3OJUA 1Q9XA 1VSHA 5D6XA 5I3UA 4FYDA 4CEFA 2F8SA 2F5KA 4CF1A 1S1UA 2GF7A 3ZSQA 2OA8A
chains in the Genus database with same CATH superfamily
1P92A 3SBGA 1KC8U 1WXUA 3TTDA 1KJWA 2L89A 4CD3A 1ZAOA 2K9MA 4C8QD 1IKWA 1WOQA 3C2HA 3L4QA 5AFUH 2FZCB 4IG3A 1YP5A 4Z4FA 3IL2A 3ZQLA 3KEYA 5AQHA 2DXCA 4BDPA 2R93J 2EFPA 2L7FP 2V9VA 1XCVA 1N77A 2AQFA 1X1PA 3EE8A 1V1CA 1Q7YU 1BIUA 5IOZA 1YTAA 1JL2A 2DMTA 2LFBA 2VGMA 4J5YA 1ZG5A 3D0PA 1WJFA 1RT7A 4EMKB 2HDAA 2JHJA 4I6MA 3OYCA 3SQ1A 2O8KA 4X9DA 4C2TA 1SL2A 3GBGA 5BQTA 1VQOI 2PEXA 3DLEA 3LP1A 3PVQA 1WJSA 5LJ5f 2B5JA 1FBUA 4M3YA 1SFXA 1ENHA 1W5CC 4HEA2 4FO0A 2YHXA 2X1EA 1YJ9I 2KRHA 2HL3A 4Q48A 5GMKi 4B1UB 3WNFA 4DSIA 5AZIB 4CI6A 4N4HA 4MTDA 1YITN 1VQ4T 1EO1A 4X6AJ 1KG3A 3K0SA 1QSYA 2A07F 4HAMA 4HVUA 4M41A 2XAJA 2X4HA 1LNWA 2X6WA 2KIMA 4P5NA 3DXKA 3S3OA 4IQJA 3QMLA 3QP5A 4QIWN 4OX9K 3CESA 2NUPB 3VYTB 4BQQA 1PSEA 3VDXA 2KT8A 5FKKA 3TW6A 2HSTA 3HDDA 4FETA 2WOMA 3P9IA 2AJQA 4EJOA 4XIUA 2QUFA 3JAMK 3LAKA 2XY6A 2XVCA 1MWMA 3L00A 2QWQA 4Y3OA 4B23A 1BA5A 1ZG1A 4KDPA 2ISZA 1FLIA 5DD4A 1YF5L 2E1HA 5C4JJ 3PIPF 2RHXA 1KLNA 3JB9G 4K43A 4BR7A 2RK1A 1PWTA 1MU2A 2YU9J 2A69F 4M7DF 2RVCA 2B0LA 3VW4A 3JRGA 2I7PA 4YHHK 4JLHA 3O9QA 2TRTA 2P4WA 5F04A 2DIGA 2BY1A 1U84A 1XOVA 1MDMA 3QFUA 3T69A 2QYOA 2O6GE 1P6RA 5EY4A 1YI2T 3W6VA 3F6OA 3MZYA 4UY8O 3KVGA 2ESWA 1N3AA 1TWGJ 3F8MA 3I55A 1KA8A 1PCXA 5L3BA 3AAPA 2XICA 4B9NA 3M4YA 1MBJA 1P8ZA 4PA1A 1FX7A 3SUOA 4YIIA 4U0WA 1S72Q 2HVHA 1OX9A 4A6DA 3VGMA 3HSTB 1OR7A 5GAOm 4DG1A 4C2MJ 4G7ZF 3J7AF 2ZGWA 3CXCA 1N75A 5EYRA 3S1RJ 2BZ8A 4BXFA 4FVUA 3N97A 2UXNA 4OFAA 1ESVA 4A3DJ 2FA5A 1VQNQ 3TBIA 1X2QA 4IOCL 4KV8A 2CYZB 3GFLA 3CWTA 2VQFK 2DL4A 3RYPA 3VF6A 1IJWC 2YKMA 3O3KA 1SFEA 2O4XB 3FFKB 4ENKA 3RTRA 3CCQI 3R2XC 3F6VA 1BW5A 5J1UA 3DLBA 1XS9A 5E26A 5J1RA 2RF0A 4F2SA 5CLSA 3ZSRA 4KICA 4OINF 3V6DA 2V1UA 4FW1A 3SFIA 3S32A 1Y97A 3CJAA 4UB8C 2G8HA 1W0HA 2LQNA 2MSYA 1KFZA 1MDUB 2P9NB 3AA5X 5DM7R 5FLVA 2FPFA 4F55A 3QU3A 1YJWI 4J9FA 2EV6A 4Z88A 3J8AA 2R92J 4PUOA 4EVVA 3SWNB 4XTUA 4EV0A 3LSTA 2Y0SA 2HDCA 4HCCA 4LDYA 3JB9D 2HQNA 4FZXC 1EP4A 3HPHA 1UG2A 4ZTJA 2LCSA 2TDXA 3G71A 3S17J 4XLPF 1QA6A 5J2MA 4EZ9A 4PGHA 3FXRA 3E7LA 2YNGA 3JCMP 4FWLA 2K5FA 1UGPB 5AQZA 1ERDA 3JCMc 3JB9H 5K14A 2VE9A 1KQ1A 1UGQB 2VOOA 3BPVA 5HS7A 2RV8A 3I0TA 3FZHA 1UDLA 3Q9VA 3ZEHA 4B3OA 1TQPA 3RR7A 3CMEA 4ESFA 1LOJA 3ZX0A 1E6HA 2UWMA 2ZSHB 3GWZA 2OCCH 5GMKm 3CD6T 2HVSA 2DOAA 2VASA 4EA5A 5LJ3f 2GBYA 4W5OA 1YQMA 4H0VB 3OS0A 3VN5A 3IWZA 4AIKA 2GEMA 2HEQA 1OVQA 5BPIA 1NYFA 1J6ZA 4QS7A 4CCOA 3DLRA 1T03A 1PU8A 1KD1R 3T8TA 3LSKA 4AM3A 1WJQA 3IUCA 1KD1O 4E4HA 1ZA2B 4QW2A 2D1HA 3V9WA 4QAGA 3A0HC 3UB5A 3CMAI 1BCMA 2QGGA 5C24A 3N4MA 2A41A 1UMQA 3EY1A 1IDYA 2BZYA 1V5GA 1JLAA 2W24A 4QQDA 4CCLA 5HOOA 1SAZA 4QS8A 4M3ZA 4GFBA 1U2VB 2A42A 1N25A 4C8QF 2M9HA 4DV0K 2OZ6A 4MO4A 3JRIA 2V26A 3BUZB 5H2FC 3DPTA 3RRGA 2DNUA 4E0DA 3VEVA 1SEUA 1TW2A 4CJRA 4DUYK 4ETSA 2EWSA 3M56A 3P4IA 5ICEA 2HNYA 1BR1A 5LGUA 1IH7A 2HF3A 3H6EA 4W97A 2HF4A 4IX7A 3O80A 3OWTA 2VUMJ 3TAEA 1LWEA 3QO3A 4I0AA 4M72A 1OPKA 3CC7I 1OU9A 3J7YP 3QNNA 3KUFA 1BIZA 5GAMg 1M3BA 1J59A 2HU9A 1LWFA 3CETA 2NS7A 4C92G 5EOYA 2HQHA 3EPZA 3VWBA 1M1GA 1D3BA 4BC4A 3N4PA 1TK0A 1M90C 3HJEA 2DFIA 1OX8A 5E3LA 1V76A 5CO7A 3DLGA 3A5NC 2CSQA 3IH4A 3K5OA 1EF4A 3E1SA 3UKUA 3VS5A 4YOTA 2HFHA 2MC3A 1VQ9N 1D1AA 3DOLA 4OPHA 4GBQA 4CO8A 1D0YA 3VYHB 3FXOA 1DKGD 2VXDA 4DTPA 2L0AA 1VQPA 4IOXA 4E47A 5KAIC 3DXMB 4J9HA 4KHNA 4MFEA 5CZ2A 3M1EA 2FQ4A 4JKAA 1RTDA 2H6CA 2IVNA 3CLOA 3QPHA 4M3UA 4KH4A 3I0XA 3NPFA 3NF9A 1RDBA 5IYDJ 2VWFA 4OGEA 2BXZA 4E1JA 3S8PA 2VYTA 5I2MA 4AIAA 2ZBKA 2OTJN 2KMUA 1J53A 2YLBA 3IWFA 3MEUA 3DLLF 3TAQA 2C06A 2YSQA 1NEGA 3HZJA 1ZK8A 2IA0A 2HBMA 1YNZA 2W6LA 4KTWA 2E20A 1JGSA 2HXOA 3X25B 1G15A 1Q95G 1WN7A 4PKHA 2KYBA 1M1EB 2YX6A 3THWB 2ZCFB 2KFDA 3H3NO 3JTHA 1WEGA 3RR8A 5KQDA 3KZBA 2RQUA 2XAGA 3ZSXA 3ATUA 2RJEA 3NFAA 1YN8A 2QEXQ 5E3OA 3GLLA 3JCMg 4JUVA 5AQKA 3V1OA 5LJ5j 4BQLA 4GRIA 3P83D 3VERA 4ZYEA 2LZ6B 1X9JA 4G12A 1SD5A 1X1CA 4OIRF 1XG1A 3QBXA 3MP8A 3NHGA 4RW9A 1N8RU 5JFRA 1NE8A 1WBBA 4PHTX 1WSFA 4FK4A 3BZCA 4B3SK 1N3CA 4J9EA 3W6KB 4FISA 3AVFA 1C0MA 4D5FA 4JK9A 5CCAA 1UHMA 3QPLA 4LF5K 3CCRN 1PP7U 5K7HA 4JKDA 3AVAA 2XKOA 4J7IA 4YPRA 1E4FT 2CUDA 2MIOA 3G1OA 2KGTA 1A5XA 3C0CA 1B07A 4DSJA 1NJWA 4JV5K 2RAEA 3L8BA 4CJWA 1AHJB 4LF6K 4B9VA 1A5WA 1VSDA 4EFHA 3ONQA 4RAYA 4U88A 3EO3A 3JB9F 2G3RA 1PSFA 2BIVA 3PFSA 5LGTA 2IC3A 2IAIA 1Y56A 1GCQC 3QZ9B 5AZJB 3C3WA 4U67L 1WEFA 3CCMI 1DU6A 5HRSA 1IN5A 2EPFA 1AEYA 3DP7A 5C6SA 1U78A 4EMKA 3PTAA 4BI4A 1U8BA 1Z7LA 4DOZA 2F5CA 1ZRFA 2XDBA 5CVJA 2OTLT 2DI3A 4CBWA 2Q0RA 3FXKA 4C0FA 3M8EA 4BEHA 2HQEA 3UPUA 3KD1E 2NNWA 3QEPA 1HQUA 1Q7YO 2JQ7A 1NLVA 2VONA 2QAZA 5AQNA 3SQ2A 2F4OB 1R49A 4XR6A 2EGAA 4QKUA 5AQYA 4QVDA 3HIFA 1KVCA 3CQZJ 1YJ9N 2EIKH 1F5TA 4IRIA 4KH0B 2VN2A 3HTSB 5HP1A 1EV7A 1M3HA 1PP8F 1GT0C 3HRSA 1VQ8Q 1IZ6A 3JSCA 2MBFA 4EM1A 2A61A 1GUUA 2DL5A 4XLHA 3CPWS 3CC2I 5TISC 1D5AA 3RMAA 3HBLA 2QWNA 1B1BA 3S3MA 1O7FA 3GYHX 3V9SA 3IFRA 1K9MU 4GV3A 5DM6F 2EYYA 3UKRB 1FT9A 4CJ4A 1WSEA 1RAFB 1MMNA 4EM0B 3H9GA 2ASMA 2GIVA 2LVSA 5EGOB 1S1NA 4DUZK 5L3GA 3N0UA 4PJOB 4DOWA 4PKGA 1PUEE 4UNFA 2P9KB 4LDWA 4CUGA 4B1XB 1VQLA 2ISYA 3IKVA 1QZZA 3RSEB 2RQRA 3P38A 1VQ6Q 4BY9C 1W4SA 2BBYA 1SRLA 2LRDA 2HBLA 4ICLA 1EA3A 5IXBA 2P7VB 1UWBA 4II1A 3O9RA 2EH3A 3GXOA 4EQQA 2JMWA 5CKEA 1OKJA 3IAS2 2W82A 2KTQA 1Z0XA 4NYFA 1U0JA 1AHDP 1HD3A 2NXNB 4ANJA 4S04A 2AP1A 5IAYA 1KQSA 4M7AB 3VQ4A 1QO0D 5K5QA 2EJFA 2L3QA 2ICWG 2W0ZA 4D1QA 2D9TA 1EFNA 4EJVA 3WTUC 2F1LA 1O9SA 3OA9A 3ASNH 2K6DA 2D1XA 3E9PA 1NK6A 2WAQA 1C0WA 1ZR4A 4RB3C 4OFHA 3VYSB 2K5IA 3UA6A 4UHTA 3LFKA 4DSFA 2M8EA 3JREA 2ELJA 4NS5A 4WQ4A 3MEDA 2NOBA 4CXFA 5BS6A 2QQ9A 2Y90A 2BOLA 1T39A 1UE9A 2IBDA 2XK0A 4QWQA 3BY7A 1ZBLA 2YU3A 5LJ3j 3WGHA 4IWVA 4I2QA 2DRMA 4BNCA 2O4XA 4K8XA 5JS1A 4IJAA 1R58A 3AAFA 1VQOA 2E2NA 3BDDA 3TEEA 1FKPA 2V8KA 1QPIA 4J2DA 3TSWA 2JA2A 3EG9A 3QYBA 3S3NA 2P6TA 4HPQA 3JAMZ 1NU0A 3CCQN 1G5VA 4RG2A 2JVGA 3F23A 4MIMA 2LYCA 3BG6A 4E7LA 1NLOC 2DYSH 2JPCA 2HMAA 2P9NA 1FSEA 3DBHB 2BTTA 2XHBA 2RHUA 1ASVA 1IG8A 3CC4I 2R7OA 3PO4A 1NH3A 1I1SA 2XKPA 4LJZF 1BI2A 3VRYA 1IN6A 5DEQA 1I39A 3T1HK 5LRRA 3ABTA 2UV1A 1YAGA 4JYKA 2OCEA 2TCTA 4KJZA 3HFNA 3GLXA 1NJIU 2FQ3A 4E1NA 1FYNA 2XF7A 3C1DA 1O1WA 4M7YA 4D7NA 3SJJA 3KTUA 3R9PA 3TU5A 3VSLA 4CFDA 4JLIA 2R7SA 3CQTA 1I3QJ 3KFWX 2NRRA 3CFRA 2ATCB 4DR4K 3T1AA 4XM3A 1JUSA 3SUNA 4K25A 2JSCA 5I2SA 1QVFS 1OLTA 2M5WA 5GADJ 1LEAA 2HHXA 4CGIA 4C92F 5I11A 1SANA 4BR4A 4M9SA 2JJ9A 2IGOA 2VPRA 1K4SA 1UHCA 1YI2I 2P0QA 3FJPA 3CCEA 4I7HA 1QVGM 2DW4A 4XAXB 4KH6A 2ZJRF 2LREA 2X6NA 3S2DJ 4PL8A 4A53A 2QWLA 3A8HB 3WVEB 3S9HA 3JAMO 4N0AA 5JLXA 3RVCA 1VUBA 1Z3YA 2LTOA 4MFDA 3O3GA 3AA2A 4OMFB 5CQEA 3K70C 3VTIA 4IIOA 1YFNA 1JXMA 1JJ2S 2W04A 4XKVA 5DLOA 3V7RA 4EDUA 3PUBA 5HLHA 4QPQA 3X2QH 1VOMA 2PAVA 4DR3K 4FYWB 3JRDA 1HKTA 5AT1B 1NK9A 1A31A 1KG1A 4F92B 2P0PA 1U2VA 2A7YA 1RI7A 1VQKA 2MWPA 4H0XB 4UC4A 1HUXA 2HMPA 4IFVA 1IRGA 3H3ZA 4ZJZA 4PSXA 1C0TA 4KHQA 3P8HA 3QWXX 4XRSA 1RAIB 3WEEA 1TUCA 2VCPA 1JL1A 2RJFA 1I3AA 5FRMA 2VJJA 5F6FA 3CUQA 3RKXA 1WJDA 5FKLA 1HNWK 4XSXF 1NG7A 1M9SA 4CJQA 1QMCA 3F9KA 5E8GA 1X9MA 1QZEA 3OOUA 1BR2A 3O9SA 1YJNQ 1U04A 1OCPA 2QI2A 5GANh 4O3MA 1TUYA 3QBWA 4DSEA 1LPQA 3WE2A 2J05A 4M77B 4ISFA 1YJWA 4J2EA 3ZMDA 3BCBA 2A5WA 1ASUA 2I10A 3HPGA 4B1VA 3HOWJ 3GTPJ 3VUBA 4HNVA 1K8AU 3AVNA 1OZ3A 2NZTA 2FBHA 3S15J 3F22A 4A93J 3WVDB 3MKLA 3EGDB 2FMLA 4K41A 2LCCA 2DZ9A 4B3MK 4PZJA 1T3SA 3CMYA 4AG1C 1ZTRA 1V3FA 1Z9QA 3SZGA 3TSQA 3I71A 3AVCA 3W2WA 3SZTA 3QP6A 1M1KR 3DXMA 2I5JA 1QKXA 3ZPLA 5GAN6 2FBKA 1S3XA 2E4HA 1MBKA 3AG3H 4JHDB 3EUHC 4AFSC 1WXBA 4LF4K 2QTXA 3JRAA 1RT3A 1K4TA 2MABA 1VIFA 2FE3A 1MSEC 1CXUA 5L3FA 2IOCA 1SRMA 3CWSA 3PMIA 3V8JA 4L5EA 4B3RK 1ZQ1A 3AO5A 3EHRA 4XH5A 2OU2A 2EV0A 5BPNA 2RI5A 2CH5A 2DMPA 1F36A 4BRAA 4XH1A 2LG4A 1HYOA 3JCMJ 4RB1A 2KR3A 5C12A 4XTVA 1QQJA 1AA7A 3CMAA 1C1BA 1H88C 1BB9A 3FZVA 1FOXA 3THWA 4FOEA 4E3SA 2G6FX 4FJ5A 1Q1HA 2GZWA 2BY0A 3KZYA 1HRHA 2GTOA 4F3OA 2KKZA 4PQUA 4MTEA 1ILYA 2E5ZA 1JI8A 1GXQA 2KK4A 5DY9A 2RQTA 3J7ZI 4BVPA 1QTMA 3CCVN 1XSXA 3H36A 1E2XA 4NHJA 1VQ5N 3IH2A 2EQIA 2VKEA 2W25A 5FPDA 1B9NA 3CF5F 2PVDB 1N36K 1IB8A 4Q5SF 1JQQA 1CQTA 2CZ1B 4CJ5A 1QVTA 2XROA 2EFWA 2VOPA 3ZSWA 1ZARA 2HOEA 2VI6A 2Y69H 1P90A 3ENHA 3H0IA 3F0CA 2RN7A 3CCUT 3A1PA 3M53A 5JR3A 1YIJA 3BG3A 1EX4A 4LE9A 3ZQ7A 2KRMA 3PIOF 2M0YA 3TTCA 4J00A 4B1WB 3CC7A 3J80K 2FSJA 3FM5A 1TUGB 1FJGK 3TDZC 2GA2A 1NJXA 3I8DA 1LPLA 3AGKA 5HNFA 2KRCA 3E9GA 2E2IJ 3GFJA 3AV9A 4Y7NJ 5CYVA 1Y8QB 1LCKA 5KQ8A 2RPNA 2E60A 1POGA 5BR9A 1UB4A 4PJLA 1AOJA 3CQXA 4JK8A 2E6NA 4OO1J 4ZN3A 2JTFA 1S72I 5C3EJ 2RN8A 3TAMA 3M58A 2GCXA 1HKGA 2L3SA 4CHQA 5FU7B 3LZJA 3KETA 2Y9YA 3GFMA 4RCCA 1Z6RA 1Z7UA 1ATNA 4FYVB 4U7BA 1SKSA 2E41A 5ERIA 1VQNI 2MOXA 1Z91A 4C8NA 3CCSA 1Z67A 1IBMK 1FW6A 2LF7A 4M73A 4XTZA 3AL0B 3DTEA 1M8VA 4K0KK 3OYAA 2V8IA 2MLGA 4CJFA 3J7YJ 1EWRA 4HKEA 4WF2A 2Z99A 1S29A 2YS9A 3E2UA 4I01A 3SMSA 3MEXA 4X0GA 3GTJJ 3OYEA 3CCMN 3X28B 4CHZA 3PNYA 1YOVB 2JUCA 1LVKA 5CK9A 3CYMA 4PLIA 2VYPA 2LNVA 1BBYA 4RLFA 1TKDA 3VQ6A 4AIDA 2Z0WA 2O3FA 5D3GA 1YJNT 3V42A 4BG8A 2GNCA 2A5XA 5KE3A 2KDSA 3IV5A 2E4LA 3CJBA 1KG6A 3BJOA 1G3TA 1ON1A 4X9CA 2GUIA 5GAOl 1S9HA 3QIOA 1LJOA 3CUOA 2DXIA 2DFUA 4Y28E 4ZN1A 5D6YA 1W6XA 2EYXA 4KB0A 4B1RA 3VRZA 4FYXB 1X6BA 1D3YA 3RZOJ 4M3XA 3RBBB 4KT5C 3O9TA 4OKKA 2BGGA 1DP3A 3K5LA 3CCJA 2PMZA 2HKNA 3UKRA 4LIVA 3HI0A 3C18A 3CC2N 4FWMA 4A3JJ 4JI1K 1B6AA 3DOKA 1MMDA 1RPWA 1ZGAA 1RUOA 4GYIA 5EGOA 1XI1A 3KLHA 4D5CA 3K1PA 3CLQA 4DV1K 2YPRA 1WHJA 4A3BJ 4BACA 1T6SA 2CT3A 4PL6A 3D7EO 2VXZA 2M16A 4LUDA 4I0BA 5ED4A 1K9MO 4DF8A 2R0QC 2YI1A 4ME7A 3RSEA 1X3ZB 5DYMA 4KH1B 2JWTA 3WU2C 1O3SA 1TWFJ 2O9SA 4I9LA 3UA7A 5LJ5g 1NKCA 3G3ZA 2O8BA 1JKRC 3HP6A 4KFCA 4V19K 5GMKh 3H0FA 4B47A 2PFBA 3CBMA 5ADXA 4ESJA 4MMLA 1YYVA 3HTVA 1RT4A 3K59A 4CHPA 2LKPA 1KD1C 1D9DA 3A01B 2G0EA 4DQ8A 2ZPEB 3LYIA 5IHNA 2LRQA 3V1QA 3CM6A 1ACIA 1M90U 4HTLA 5IT9Z 2VBXA 4JX6A 2XB0X 3QEWA 5FFXA 4QVCA 5LEJA 3TAPA 3K4JA 5LBQA 2Y48A 1BA0A 2K9QA 4W1UA 3Q1JA 4L3QA 4KFBA 3NAEA 4KAZA 3LSPA 1BQNA 4A59A 5D6FA 3DPLC 3M8JA 3RPUD 2H6BA 2K5LA 1R5GA 3CERA 2X85A 4G1QA 5FGMA 5AQSA 2IDOA 2DK8A 2JHNA 2DTRA 2JMCA 1QQCA 3OSVA 2Q0UA 2E2PA 4L5JA 4FTHA 4L9NA 4E7IA 1YX5A 1LB2A 4FU6A 1VQMQ 4H0PA 2NRWA 1WJCA 2IGMA 3DRSA 4JBAA 3T9NA 2HI3A 2VC0A 4XK4A 4FJJA 4IJNA 2QWOA 4B3TK 2OQGA 1VQ4N 3DTKA 2YKNA 2VC8A 1ACMB 4O8UA 4MO5A 2CO5A 2Y2ZA 3CPWP 4KH5A 3CCLT 4GGGA 2MK5A 1U5TB 1RT6A 5GAHP 3AO4A 3K70D 4LSLA 4MDXA 2CH4W 1FIPA 1NK7A 2LVMA 2M1BA 2IIRA 2RE2A 1FY7A 5CVIA 3CBOA 3AVMA 4CZCA 3W3DA 4OIPF 1WSGA 4ITVA 3Q0WA 2KZMA 2OTJQ 5IT9O 1IJJA 3H1QA 1YLFA 1LFBA 1YHQT 4F9OA 1TLHB 3QBYA 1OVYA 2E19A 2JM8A 1W7PD 4O6JA 3A2FA 2DLLA 4CBUA 4AHUA 1UAAA 2HYJA 4IO8A 1QCFA 4IUPA 2YUQA 5KRSA 3DAWA 3SHFA 3JAME 2VKHA 1N33K 1RABB 1YTUA 1NJIO 3CFOA 1RACB 2CV0A 3AVLA 2K7AA 3HHTB 4HDVA 3CXCS 1NJYA 3G6EA 1LV5A 3FZMA 1NGDA 4OVLA 2DA5A 3I9V2 4DEYA 3I56T 4B1YB 5EG0B 4ZYHA 2KHOA 1LWVA 3NVMA 1SAXA 4JI8K 5B5EC 2EFIA 3HC7A 2PQWA 1J2XA 4L18B 4BJTA 1YI2N 2DFEA 2ZJRL 2DM1A 4EMHA 3VPZA 2X6XA 3A4CA 4CJTA 1MKMA 3LWIA 2WA0A 2O8EB 4NQWB 3KP3A 3VA0A 1L3LA 5LD2C 3OJUA 3IQLA 3QG1A 1VSHA 2JS2A 3ISPA 2R7XA 3CBPA 2F8SA 4DR7K 5FPMA 3TOAA 2QEXI 1WFWA 2QA4T 2CJJA 2GF7A 2HL5C 1QHAA 5JLFA 3OS5A 1PD0A 2HDDA 4Y92A 5FRNA 4F52A 1M3AA 3VF4A 2BYVE 4DYQA 2W00A 2LNHB 3CCRQ 1U6ZA 3E9LA 4M7XA 3PVLA 3CWUA 1RNLA 1DU0A 3S1NJ 2HOTA 2Y9ZA 1V54H 2O9LA 3D6RA 1S1VA 1KQ0A 1DIZA 3SYTA 5KCMA 2Z1IA 4GDFA 1JLQA 3HKZN 5L23A 1G6NA 2RQPA 5GANe 1X1AA 5GJWB 4CHUA 1GLAG 1XMOK 2P0WA 1KU9A 2ZZDA 3ASMA 2GTJA 4HZFA 2EQJA 2W03A 3GOXA 5LJ3g 2P5LC 1ZQ3P 5KYYB 2DK3A 5CKTA 2EQMA 1NBEB 4C9YA 3ESWB 2XSJC 3ME9A 1RGIA 2DOFA 3QRFF 2LDUA 3HGYA 3CC4A 4OF1A 5A0DA 2K2MA 1IW7F 1J9AA 3ML6A 2JRTA 2M4GA 1GVDA 2LBFA 3TARA 2IEKA 4OP0A 3H1CA 1T0JA 4A0XA 1YTYA 2O4IA 1FJLA 2XGXA 1W1WE 4G6QA 1HKCA 3EYIA 2DTIA 3FGUA 3L42A 1NGCA 1HPZA 1JT6A 3U8XA 2X4XA 1YT3A 2ZMEB 4KMFA 2XD0A 1ETWA 1OPLA 3EUAA 1MPGA 2QQBA 3NGYA 2DL7A 3EGDA 3SZ2A 4OAZA 1KC8R 4M3GA 3SQ4A 1FSHA 4LDUA 1QVFP 3CQ8A 3WTTC 2KMTA 2NRXA 1YJ9Q 2NAZA 3ID8A 2PJRB 4U7DA 2LH9A 1JGGA 2J7IA 1IZ1A 4DQRA 2UXBK 1XMQK 2K02A 4IURA 3L3VA 4JHDA 3CP8A 1N6QA 1WI3A 3RPQA 1KONA 5FKMA 3TANA 2AHQA 4XK8E 3EGUA 3KZIC 4C3JJ 2HAXA 4BC2A 3KK2A 3O4NA 4EMSA 3CD6N 1R7JA 4MEXF 1OULA 4YEJA 1TT0A 4HRIA 2R5ZB 1SV5A 5J1EA 3EGXA 2RM4A 3OYFA 2YUNA 3L9FA 4DV6K 2IIMA 4CZZA 1PVEA 2WAFA 5DUIA 1VQ8I 4KBOA 4BR0A 1FOKA 5EU7A 5D5XB 3M0SA 5M5YJ 3HJFA 4DFMA 4N47A 3MPUB 4XICA 3ZP5A 3EL2A 3JCMW 1C0GA 2W10A 1UELB 3VMFB 4FT4A 4N4NB 4HV6A 4JI7K 4O5FA 2V51B 3CIPA 1KG5A 4EJZA 2F2EA 2HBKA 2UUCK 5AIQA 1K78B 2F2XA 1OCZH 2R3SA 1XGMA 2V8JA 4OMOA 1UA0A 1YW7A 2P81A 3QIPA 4EMKC 3DBRB 4OMNA 2ZQBA 2KFZA 2CUEA 4KBMB 2CQNA 3KLFA 3V8LA 2J4RA 2L9VA 3LL7A 3A02A 3VA3A 2A37A 2DA6A 3PV8A 3DB4A 2MYSA 1RI0A 4FPAA 2FJ1A 4BJ5C 1VQ6I 2V9PA 3K1MA 1K79A 2MAMA 3FE1A 1DGRM 5KRTA 2VLAA 4MMKA 2E2OA 1NZ9A 2HQRA 4GY5A 1QVPA 2XGEA 3C95A 4CGJA 4FJ9A 2ADUA 4F7UE 3QYEA 4DFKA 4HVJA 3ZT4A 3GZNB 2UXCK 4NL2A 4KGVB 2DA9A 5E3MA 1HSJA 4FZZA 5J2QA 4WYBA 1C6VX 4YOXA 2VQHA 3LP2A 4JRIA 1QVGA 2IS1A 3V9UA 2VUBA 1MV0B 3DTIA 3DKXA 4FLYA 4LF7K 3HUGB 3PIPA 1HYSA 2DXTA 4E7ZA 1D8YA 1IF1A 4EW0A 2XRNA 2CZ6B 3FZLA 3LSGA 3V4GA 4M7DA 3TP3A 4FJ7A 3DLAA 3KNTA 5HS8A 4A3LJ 3BY6A 3CCQQ 1QZ5A 3WTSC 1RUNA 1HNIA 1OYWA 4ZHRA 1DTQA 2EV5A 3VQ7A 2BXYA 4KN7X 4H8KA 4ZZDA 2R7DA 3VEZA 2RF2A 3WTXC 4C1NK 2E88A 2AT1B 2O8DB 2VG7A 3VS0A 2E64A 1TSFA 4GKKK 3LP3A 1XUPO 3VQ5A 4KB1A 3VS6A 1TZLA 1Q81R 1AT1B 1Q81O 1X27A 2CGJA 2NRVA 2X6OA 1I07A 1XMXA 3G4ST 1HDPA 2E5KA 2P9UB 3PM1A 1FN7A 5HLFA 1X6OA 4BS9A 4UB6C 3WHCA 1GXPA 3MEVA 3EG3A 1HJRA 2QKLB 3FHFA 3ZLJA 3KHYA 3OMGA 3FLCO 2HHWA 1YQKA 2D0NA 2VIXA 2LX7A 1IXDA 1KTQA 2Z16A 3BCAA 3J80Z 2YRVA 1BW6A 1R1UA 4ATOA 1S1XA 4RTXA 2JJ7A 3HL2A 2Q2RA 4BAYA 4FSXA 4M9XA 2XC7A 4CD1A 1VTNC 4C30A 5DCMB 1AZGB 3A1YA 3J7AO 5KTQA 1W2BP 2IPQX 3GVAA 4S05A 4XU3A 3FMSA 1HNVA 2OZSA 2KHMA 4YFXF 5KH6A 3ZX2A 2MG4A 3QHSA 2ZXHA 4UUVA 4FJIA 4J9CA 5GMKe 2EZIA 3QSUA 3LFUA 4PJOE 3SWNC 1NBWA 3CEYA 2ETHA 1VRLA 4BROA 1MUNA 2EFNA 1GLLO 1Q82R 4CEZA 4I9QA 4BR5A 3M8PA 4RTFD 1Q82O 4F14A 5GAMe 1B34B 3KE2A 2M45A 3SPZA 1ATRA 2KXCA 4BRCA 2YG9A 4E6KG 2M34A 4DTXA 4BHBA 2VJIA 3M0PA 2KQ2A 3AARA 4M78B 3A01A 4EA4A 2DJIA 3CJTB 1J9IA 4C92B 1S72A 1I50J 2XF6A 3KLEA 2K5CA 1OZ2A 2HNZA 7AT1B 1CLQA 4PL7A 5IH2A 3TPQA 2LMJA 2KYMA 2BEOA 1HW2A 1VQNA 3KP6A 3TOBA 1WKMA 5KCHA 4FM1A 5GAN5 3J80O 4RCBA 1TT5B 3TL4X 5HBMA 2Z1JA 5E20A 4BQOA 4IO9F 4YDUC 1ZHFA 2FRHA 2QSGX 5AFUA 1BJZA 2FSWA 3K2PA 3MDQA 3CQYA 1BOBA 1I5OB 2OTLN 3L2ZA 4M75E 5LFAA 1TH7A 3H0HA 3ECHA 4N0AC 4BI8B 3GTGJ 3C0BA 1YJNI 1OJLA 3MEAA 3ABMH 2XRIA 3OW2M 4S0HB 3S1QJ 2WACA 4UXNA 2GV9A 2RDPA 4C8QA 3I58A 1EXQA 5IT9E 3KKSA 2G8VA 2R7UA 1YW9A 2D45A 1XC3A 3H0DA 1D4XA 1I8FA 4BY1J 5ICGA 4I6MB 2XASA 4KUDK 2F5VA 1U5TA 1VYVA 1TGOA 2MCNA 2JTVA 1D8JA 4AQYK 2ETJA 1BM9A 1L3UA 1JHHA 3IRXA 3HOSA 2L5QA 1MUZA 1USTA 3HPWA 5BPLA 3RJPA 2CRGA 2NUTA 3M7GA 4PKIA 1OCTC 5GPAA 2ABKA 2AZSA 1KQSS 2L01A 4IDHA 4BG9A 4UV9A 5AQOA 1JB0E 1K0SA 3OYHA 5JHUA 1FZPB 1DT9A 4ENMA 1NM7A 2PBDA 4L6V5 1RESA 4QTRA 2JLEA 1Y0MA 3D7SB 3LLRA 3JCMe 4YOUA 3P9KA 2GOXB 4E70A 1ETYA 4CC4B 3I4MJ 2JA6J 3Q3SA 5EF6A 5M5WJ 1HKSA 3PQJA 4YOQA 2LP5A 3H92A 4CHOA 4Z0UA 1M1KC 3CM5A 3FIFA 1N78A 3ZMSA 3T7ZA 2ZFWA 3QDRB 3G25A 4R5PA 1DPRA 1J5YA 4DFPA 3CTAA 4H5WA 2AO9A 1QE1A 3FKIJ 2HZTA 1NK5A 1Y7XA 4N0BA 5GAN2 1B9DA 4XLCA 1Z77A 5EG0A 2HHVA 5GAEP 3CCVQ 1Q86R 2EYWA 1KYZA 2XPWA 4K11A 1VQ5Q 4FWSA 4U0VA 1Q86O 4XTYA 1WAFA 1VK0A 4Q0BA 3X20B 5KE2A 2UYTA 3FKJA 4NXMK 1K8KA 3OVNA 3NMUA 1U48A 2KRFA 2ZGYA 2OANA 4LLLA 2DJZA 2O8EA 4NQWA 3TSZA 3CWAA 4Y52J 1H641 2VBWA 2WTUA 5FDLA 3LWMA 1QNTA 1RDDA 2V1NA 1VA7A 1HSQA 1I6HJ 2HZDA 4RGXA 4CA0A 1BWFO 3CPFA 1PHTA 4ON0A 3LM9A 2OI3A 2JA7J 3W2AA 3CMEQ 2F5DA 1PC0A 2DT6A 4QPOA 3DKWA 1FEXA 5HODA 2HVIA 4CEAA 5GINA 3DLLA 3GNFB 3PT9A 4JKBA 3I53A 1PVSA 3R6OA 3PO5A 2PMZN 3CJRB 1E3HA 3QPTA 5ILSA 4H5RA 2Q3SA 5J39A 2WY8Q 1Q1VA 1X3UA 4G9ZA 1USSA 3MMYB 3FMRA 5JLHA 2RKHA 1AVZC 2RB6A 5EZHA 1IHVA 5LEKA 3LW5E 1NPRA 3FIWA 4R79A 2YRDA 1I6XA 2ITGA 4IOCF 4WE1A 5KYYA 4WFBL 1MNDA 4HNTA 3V8KA 3L2VA 3K58A 2KQRA 4CFAA 4YFKF 1B3QA 2RC4A 1GOBA 3V7SA 3DFGA 3WTWC 2OD5A 3SHWA 2E6MA 4E7SA 4NB4A 5CR2A 3VS2A 1ZC6A 3W6JB 3MEEA 2UXDK 1KK7A 1MBGA 4N56A 4Z2YA 3NWTA 4EVIA 1ETOA 4M77E 1NK8A 2ZMEA 4HSRA 1G3YA 4EIAA 1SMYF 1MZBA 4II2A 1WLJA 4JAXA 3NTIA 1SS6A 3P1GA 1IN4A 5D6EA 3BTCA 3CXCP 2O8CA 2WB1N 2X48A 2Q1ZB 1M27C 1WVRA 4CC7A 1X4OA 4FLVA 2R58A 3E9OA 4B48A 2KP6A 4A3FJ 2DZCA 4YFUA 5D8LB 4LFAK 3BTIA 3D5SC 6AT1B 4FOIA 4HVWA 2M7AA 4CK1A 1LWYA 4LMYA 1B7TA 4FXDA 1X9SA 3NFCA 3OYDA 3MKWB 2M3AA 5KYNA 3I55T 4Z94A 3O3HA 4MZPA 3WXJA 5GAHJ 2XIDA 5M1OA 3OYYA 2KI7A 5C4XJ 4GLKA 1NK0A 3GF5A 4KUMA 3LANA 1CZAN 3Q0VA 1IGUA 2X51A 3H9QA 2X6YA 3G1JA 4DTJA 5C2DA 1X1BA 4YG2F 5M1FA 3GUDA 1VQ7A 2YHTA 2PY5A 3UWNA 3CJNA 4G6TB 2NRZA 3JRFA 4A3MJ 3GP8A 1KD1U 3VU3C 2EAYA 4CH7A 2NLUA 2BY2A 2RNGA 2I5WA 2G7UA 5IYCJ 1K78A 2QEXA 4ZZLA 2QZ8A 2FVUA 3Q9SA 1EETA 3A5OC 4B24A 2B6AA 2QTVA 1WI9A 4ASNA 1XB4A 4BRIA 2ED1A 1SSHA 3B02A 5C10A 2K3YA 4Y13A 3KZZA 2Z9OA 2J5OA 3HYIA 3PQKA 3QODA 2XSDC 4HHTA 3U9DA 3TR8A 4FPBA 4DR5K 2D1KA 4JQFA 4RAFA 4DTOA 5M5XJ 1TC3C 4HUFA 2KXDA 5ILVA 3H35A 3JCUC 3IRQA 4J6WA 2MC4A 1N9RA 1GVJA 4JK7A 2JSPA 3G71T 4PLLA 1KGSA 2M8GX 2FF6A 3MZ8A 4WXCA 4A2UA 4O0IA 3HUGA 5K7FA 1GBRA 5E84A 4RW4A 4AYBA 5M3MJ 1W97L 2EBPA 5GAN7 1QWFA 4E9GA 2QENA 3O4QA 1LQ1A 1S6PA 4B3AA 1UZCA 1YO5C 4JX4A 3NHNA 3KLNA 3SUPA 4CF9A 2DKGA 2XPVA 4PJOC 1ZBJA 2JN0A 4C2UA 3CMET 1IO6A 3GE1A 2STWA 1VQ4Q 2HHTA 3LPUA 3URGA 4DYRA 2ATQA 4YY3K 3M07A 2WFBA 1LW0A 3WNEA 5JVGL 2ZPGB 2A28A 1QVUA 3DJCA 2QKMB 1PRLC 3PGGA 3RESA 4OMPA 1VQMI 2Y30A 1VSLA 2DL8A 3LDOA 3OHRA 2G8KA 3I3LA 5J3BA 3K69A 1LOTB 3L2WA 2CH6A 1IKXA 5HVQC 3JCMV 3D2EA 3MWPA 2E2JJ 2D0AA 4RW7A 1NG2A 2QGFB 4M7AC 1C0FA 2VJ4A 4J8FA 5L3DA 2NVYJ 1WH7A 1GDTA 1KG7A 4CEDA 2HBPA 3QYGB 2P9IB 4LITA 5FPEA 1SQKA 1NNEA 2FPEA 4AC0A 1VSIA 2BUPA 1VQ8A 4C23A 3UR3C 2XRLA 2K3FA 3F5TA 2M2EA 1RADB 3WQTA 1GLDG 4OB1B 3L2QA 1G59A 2NWMA 4XU0A 3QUIA 1TWBA 3S93A 1KRPA 2VKDA 1X6GA 3HKSA 2DPUA 2OTJI 4IDKA 1WHGA 4PJMA 3MN2A 3WXLA 4WX9A 3SLCA 4CESA 3LA2A 3T0YA 2M51A 1A6QA 3OL3A 3KWIA 1YI2Q 1KCFA 3THYB 2E5QA 3WUHA 5DMRA 5DCMA 4CGHA 1TWCJ 1NK2P 1YUWA 4BGBA 4Z6YA 4PFOA 3L0QA 2IP2A 5FD5A 3FR0A 1H0MA 1ZGWA 3MFKA 4DA4A 2BHZA 3HSEA 4KIFA 1VQ6A 3J7AY 4HOBA 4Z4IA 3T5XA 5JVHL 1FK9A 2D4WA 2MI6A 3N4QA 2CMPA 5HLTA 4M3DA 2YV0X 5GTIC 3CCUN 2V4JC 4F16A 2JXBA 3OYLA 5AYFA 3SEMA 1ZXOA 1K73R 1MJ9A 2H94A 1E3PA 1ZUYA 2VWKA 2CUFA 2G9WA 2DFHA 4B09A 3AA3A 1ZSZB 3BR3A 2MH2A 3J80E 2E34A 2M30A 5GAMd 2FB7A 4LY7A 2VQCA 3WNGA 1M30A 1P2FA 2QWMA 3FK6A 3HXLA 1VQPT 4C92A 5C25A 4XLNF 2HYFA 4FJGA 2IS6A 2Z2SB 2CG4A 2PMHA 4K42A 2QW9A 5M1NA 3AVHA 2GA1A 1VQLQ 4HSTA 1DGKN 3CCRI 1S9EA 3OGDA 1JJ6C 1IRXA 2KVQG 3RKWA 1QRYA 2COZA 5F0CA 2LTPA 5LMNK 4E19A 5F08A 2V6CA 4KI6A 3IHUA 5K7ZA 2NOHA 2I8DA 1D5VA 2CP5A 2CQXA 1TV6A 3VQ8A 4JD2B 1TYQA 1SFUA 1JTYA 1J3TA 2EGCA 2F48A 4U87A 1OYXA 4RBOA 2P0KA 2F4VK 1RDCA 1ZBFA 1LUJB 1N32K 2RPIA 1R0AA 3S2HJ 1S7EA 1OCCH 3HRTA 2EYZA 3WXIA 1W2BM 1EWQA 1P7JA 3HVRA 4A63B 1ZH5A 4X1EA 2V9KA 2K4YA 4F7UG 4DR6K 3OB9A 5CQXA 4E2FB 2SEMA 3C12A 2KE9A 1YJNN 2HR3A 1BI4B 4RS8A 2Z1GA 1SKWA 4O4GA 4LF8K 3AVBA 3L1PA 1UGSB 3R3LA 3CVTA 2HMIA 4PKCC 3K0LA 2LK2A 4WCGA 3L4IA 3O5ZA 4XKWA 3SFZA 3I5RA 1SVMA 5CJ9A 4C8MA 2ESHA 3Q5FA 4ZGEB 5GANg 4BEHB 4FCYA 3CD6Q 1ZUUA 1WPKA 3UIQA 1XC5A 3J81K 3BR2A 1U6GA 1Y6IA 3UDCA 1WJAA 4L9TA 2RNJA 3VKIA 1L3VA 3CDHA 1ZRDA 4EIKA 2W40A 3C65A 2ROTA 1SKUB 3JCMQ 5GJVB 3M6GA 3H1VX 1GFCA 4WK8F 1PG5B 2NVXJ 2DA2A 1JBMA 1MBHA 2X1DA 2YUOA 3RKQA 2VL8A 3DEUA 1K8AR 2DO7A 4R1HA 5HROA 1IKYA 3M3ZA 2DU9A 5DDGA 3JCMd 1C0UA 1TNTA 4P5OA 2JA5J 2GWKA 2HWVA 1A35A 3G2BA 4LFBK 4HBLA 3OJSA 3A0IX 4FM2A 4XMYA 3O1WA 3DWLA 4M77C 4LC9B 1Y64A 2H8RA 1X2MA 3HOYJ 4J8OA 4YNQA 3FXQA 2XO7A 4PUSA 1P59A 1XGNA 4Q5WA 1T0FC 1I4K1 2W85A 2EA2A 3O6BB 5CYMA 4NCBA 4I09A 1IXSB 1R36A 4CEOA 4WXDA 2V1DA 4RCHA 3CJ7A 1TK5A 5AQJA 4OMZA 3VPRA 4DEXA 5E18F 3M59A 4CJLA 5AQIA 4DR1K 5L3EA 2A08A 1G3WA 4DZPA 3CDIA 3KXTA 2VVKA 2NNYA 1X9WA 3SI6A 3O1BA 2CGPA 5J2PA 2QVOA 2NYXA 5GAMf 4IRHA 1WA7A 2ZJPL 1W7AA 1UB9A 2XY7A 1X2NA 4IOAL 4HG2A 2ZXIA 1YWPA 3CHWA 5DM7L 1HNZK 3IAYA 5CVVA 4CIFA 3CCEQ 4II3A 3FDRA 1WFXA 3DI6A 4JI0K 2AK5A 4XL9A 1NOZA 2OPTA 4MZMA 4BQZA 4ILHA 4A4HA 3M9QA 4Z89A 1U1SA 3EG0A 4LD6A 4A4GA 1ZELA 1FOWA 4RMNA 2KZZA 5HRPA 3ZXSA 3H08A 4Z4GA 4BDZA 1T3LA 4J9DA 1WUAA 3G73A 4X66K 4A57A 4MZTA 4PJOG 1KYWA 3LWLA 3E9FA 2V6EA 1B9FA 3AVGA 5CAIA 3MN5A 3KYDB 3DLMA 3I54A 2AA4A 3RMSA 6PAXA 3CCLN 3MWMA 1TL8A 2DBMA 3FC3A 1YFHA 2LC2A 2DA7A 3HL8A 4KULA 1RT1A 1H9GA 5KCOA 3BG7A 3EG9B 5FD6A 2A05A 2XY5A 2AKKA 1MA9B 3PIOA 1YITA 3MKZA 2O5RA 4DS4A 2WSEE 2ZWHA 1VQLT 1JT0A 1S5JA 4C1NI 1MBFA 4KT6A 4A3KJ 4CYDA 1YHQN 3C2GA 5AQWA 3V81A 2XMFA 3VQCA 1BUPA 3R0AA 3H9JA 4Y1CA 2FMYA 2YWWA 1SFKA 1BGXT 3GBQA 2Z1HA 1KQ8A 2FX0A 2DQLA 1BQMA 4RKUE 4CERA 1YVNA 3VUZA 4W5NA 3L2CA 4ELTA 5LHIA 3VYRB 4KNYA 3I56N 1V5FA 4M75G 1W36D 4OMYA 3HOUJ 3K4LA 3JCMf 1Q81C 2KZVA 2CUJA 1SF9A 1WSUA 3D5LA 5LJWA 2L2OA 2IG0A 3FHNA 5LJ5e 5AQMA 5D7UA 1BK2A 5L8RE 2CUBA 3QB0A 1QW1A 1W0UA 3ZEUB 5FU7C 3HSFA 3ZOBA 3OW2A 4IZ9A 4CRIA 3QO9A 2XAUA 3PSFA 1QS4A 5KPRA 3NF7A 2ID6A 4CJSA 5FW9A 4CGZA 2D8HA 3WTZA 3FZKA 5EVZA 4KREA 1UHSA 3AL0C 4IHSA 2QA4N 2JNGA 4CVNE 3HB9A 4FWNA 1W9HA 2ZPHB 4LLGF 1VQOT 4PJOD 2B9SA 2P5OA 3MN7A 2CSIA 4BHCA 3BG9A 3MXMA 2HOAA 2HXIA 1JTXA 2EVRA 5GAEJ 1JO8A 2YT6A 1BI1A 1A5JA 2D0OA 4LG0B 2HVQA 1KG4A 4N5SA 3DU6A 1FTZA 1BOAA 2BW3B 3EFSA 3CXCM 2G8IA 2B8AA 2PZSA 2W84A 2BTFA 1RZ4A 4AM7A 3JCMX 4DBQA 1U49A 1B8IB 4BYYA 3K57A 3FX3A 4BU2A 2DAOA 2DPNA 4UY8I 4BRKA 4OKEA 4M7AD 1IUYA 3RDIA 1Z05A 2FBIA 1RLPC 3VGLA 2JN6A 4WF9L 2F9WA 4IPAA 1Q82C 3EAEA 4F8RA 4LD0A 2MA3A 5EDNA 1A0NB 5EX5A 3G0QA 3UNGC 4EJTA 4FJXA 4FT2A 3WEEB 2HKQB 2HZYA 1RAAB 2OTLQ 2LNBA 2FEZA 4JI4K 4A69C 3CUQB 1HLUA 4E7KA 4B3XA 2EQRA 4DTUA 4NYNA 5H1SQ 4M75D 2X4YA 3KK1A 3TDUC 4A12A 3WODF 1XSVA 1WGSA 1JKPC 2KT1A 1NKEA 1YXQA 3RERA 1UJYA 5BRFA 1YIJQ 5IHIA 3JS6A 3B6AA 1LVAA 4G8XA 3CCET 4GO1A 3KP4A 2LKXA 3GOIA 5M1QA 2ZFUA 4FQGA 1RBTA 3EH1A 4QVZA 2COYA 4JP0A 2VKNA 3IMXA 4M4ZA 1Z9ZA 4CHYA 4BHPA 2L7KA 2FC0A 1XGSA 1AKHB 1PYVA 1OCRH 5E1ZB 2CDTA 1YQRA 3K1NA 1VQMN 4BB7A 5HLGA 3TU4K 2OPSA 1PRMC 2EK5A 2A40A 3KX2A 1WZ2A 2Y75A 4QQGA 4BKXA 1HDDC 1Y1VJ 4BGAA 5IT3A 2P9IA 4KO0A 5C0MA 3CCSQ 2ITMA 4DZJA 4H5NA 3ER0A 1WDXA 5FB2A 1NMDA 1VQKT 4XEIA 4FL6A 4IHVA 2DRKA 1JCGA 5M1KA 1DJ7B 3MVPA 2QBYB 3H9NA 4BUGA 3MKYB 1QVGS 1LNXA 2L54A 1LFUP 3BQYA 3Q7CA 4M77G 1ITYA 5FPNA 4XONA 4RMOA 5D6XA 1R4MB 5I3UA 3THYA 4FYDA 3A8MB 4CEFA 3EZWA 2F5KA 1RFQA 2CW7A 4ORZA 4DOVA 3ZSQA 2E1NA 4F7UF 2OA8A 4D0PA 5FWCA 4KHUA 2DMUA 2X9DA 5KPTA 2OJED 3ZQCA 2P9PA 2HEOA 3E01A 1WXTA 2V52B 1YJWT 3CCVI 3H5AA 3M54A 1CZBA 1IRFA 1ZN2A 3OH6A 3JSPA 1QQOA 2ECZA 1VQ5I 5AQUA 2E1MC 1JRIA 1JU5C 4DU3A 1XDSA 3TO7A 3THXB 2HSPA 1DTTA 4A62A 3VB2A 4CZKA 4CZGA 1U5TC 3MJXA 2DIQA 4B6MA 5LJ3e 4BQAA 1Q86C 1CF7B 1IG7A 4JN4A 1RBSA 1ZSZA 4G94A 1B4AA 1TKTA 1EZZB 3EETA 3RUXA 5AIPA 4Z4HA 4PY5A 2HQ5A 1JLFA 3ABLH 3CMEI 4L5GA 3LAMA 5KGXA 1S6QA 2PX9A 2H8HA 2LR8A 4NCAA 4Q4ZF 1YW8A 1UUEA 1PNJA 3HO1A 4M78E 1KAXA 4OKJA 2E12A 2O8FB 2CKKA 1MNMC 4CEBA 3IS9A 3LCNA 3HOVJ 2RQVA 4O0JA 3ZSOA 2RHKA 1VIEA 1HQCA 2UU9K 2FRYA 4HTUA 3H0GJ 2COBA 3QDKA 4J2AA 3VQBA 2DXBA 4JD2A 3A98A 3ECOA 2GUPA 2P5GA 3BFMA 3UT1A 4EP5A 4CC3A 4TSXA 4GV6A 4CGDA 2XV4S 5AQGA 2JWLA 4DHYA 1VQ9A 4D7MA 3KP2A 1RLQC 1ZSGA 4J6XA 3MWTA 3G4SN 3CMAT 3LSMA 5DCFA 4LD5A 2EPDA 4M77D 4P1WA 1WIEA 4MGRA 2R7YA 1BI4A 3FDYA 2HPMA 5E17F 2KQWA 3MP1A 2JOYA 2D2WA 2XI9A 3VETA 4BE0A 2RNAA 1I5ZA 3RWUA 4M63C 2WADA 5GAMj 5HL7L 4B21A 2CGHA 2DMOA 1BI3A 1LKXA 1CGPA 2ZAEA 3C94A 3NGIA 4CZHA 2XDVA 1T8EA 2RQWA 1HYVA 3T3FA 4JLGA 2ECCA 2CU7A 2W42A 5EEHA 2DEQA 4BL0B 2H3EB 2GELA 2OTJA 4ELUA 3QDFA 5IT9K 3G0ZA 1X19A 1VSMA 2D0BA 4BRQA 3DCFA 3VOEA 4KISA 2W7NA 2VODA 9ATCB 1QP3A 3HRMA 4F2RA 1U4BA 1C6VA 3C6UA 1YIJT 1FBSA 1JKOC 3CC7T 4P55A 3ULQB 2ZO4A 5LL6S 4PJOF 1NKBA 4FK0A 3ZGKA 1T6CA 2WTEA 3ALYA 1OMIA 4ISEA 3I35A 4ZTFA 1UFMA 3I64A 2KISA 2HQXA 2HHQA 2QWRA 3FXLA 2CGKA 4A3EJ 2O9VA 4XH4A 5B1BH 4CEEA 1J5EK 4C8KA 1MMAA 1D0XA 1TTYA 4I2PA 2P7CB 4XSZF 2Q2EA 4OWRB 3LL3A 2RI2A 1KXPA 2E3HA 4JKCA 2VQGA 1X3NA 1VQPI 5IN1A 1UA1A 2EGEA 4BE2A 3AVJA 3DLHA 2ZMEC 3U6FA 2K3XA 3CCST 2BZTA 2K57A 5DUKA 4AMCA 1OH5A 8AT1B 3E5UA 2YR2A 4RM3A 5E1WA 3LDLA 2LCLA 3SAFA 3K4BA 5B3SH 5JICA 2O8BB 3PUFA 2VXEA 4H4MA 2FF4A 5LY3A 1MGTA 1RKWA 4CECA 1XQSC 3JRCA 4BY7J 4M75F 4NBQA 3LPTA 2HNHA 3OSGA 2CP6A 2FSNA 4FE7A 3QFPA 3QKJA 3ULEB 1K61A 2RK2A 3QJ6A 1ZBIA 2DX1A 3F72A 2R7ZJ 4AU7A 2FD5A 4AHRA 3C7NB 4DJAA 3OYBA 2L7ZA 1JCFA 1QHGA 3I0SA 5IP9J 4FHTA 2R7TA 1DQUA 4XQ3A 3J81Z 2QWWA 1ZBSA 5AQFA 2E5NA 3M57A 3N5NX 5IPAA 2F6CA 4FJ8A 5HDNA 2D5RA 2HYGD 4A4FA 4PCQA 5AQVA 4OPKA 1UHWA 1AU7A 4XNFA 4H0OA 2B7EA 2XDPA 4BY6B 4GVEA 4ZYAA 3LQRA 2PLYA 3MN9A 5FLXZ 3AA4A 1F43A 3LZIA 4DQ2A 4DTMA 3CCJT 2LDMA 1Y96A 4BD3A 3RIRA 2X74A 5GAOq 4A5BA 3V7CA 3CVSA 2LOOA 4DW6A 4HCBA 1L3SA 2P5KA 3RPUA 1N39A 2DFFA 4RUGA 4Y15A 1VQ4I 4ELVA 3KTQA 3L3UA 1YJ9A 2VWJA 3ZCOA 3EFRA 1S7OA 1FIAA 1YCSB 3AVIA 4XIDA 5GAN8 1LAVA 4E7HA 2EJGA 3VSKA 1OU8A 4XTXA 1R4NB 4CCHA 2EWNA 2K9SA 3M8FA 5D8KB 3ZN1A 3F2KA 3PO3J 1TBXA 1JKQC 2R7WA 2ID3A 4DTNA 4EW4A 4CE9A 4X62K 3MAQA 3HTRA 4X34A 4FLXA 4PWDA 1R1TA 3MX2A 2R5AA 1RDUA 1ORPA 2PBIA 3SNNA 3J81O 1MJAA 2DPDA 4XORA 4H5TA 1W5SA 1RBRA 2DCEA 4F93B 3HT3A 1HF0A 1W2BA 2FG0A 3K7AJ 1TS9A 1BJAA 4OIOF 5AJ3K 3ZEUA 5LJ5d 5A0GA 1HJDA 3VQQA 1ZYRF 1R8OB 3BTLA 2P8TA 1B59A 5T7BA 3QLHA 4CHNA 2EYQA 2FU4A 4RB2C 1SFOJ 1W7PA 3PNVA 3JRBA 1SD4A 2QM3A 1RRJA 5FLXO 4GVMA 4LB6B 3CCUQ 1MMGA 3BY5A 3G10A 3SDGA 3R61A 4GY2B 1FTTA 2EIJH 3REOA 1NGBA 1Z25A 4IHWA 4DQPA 1R0CB 1M2VA 4IHXA 1LAWA 3CZ6A 2CP2A 2OPPA 5LRSA 2JPBA 3M0QA 4ILGB 2FXAA 3QXEB 2ME6A 2BE7D 5KYWA 4LG0A 1E3OC 1ON2A 1XPXA 4MQ9F 2RQQA 1BC8C 2BW3A 3IH3A 1STZA 1RCHA 3DBLB 2GQQA 1P7IA 1WNSA 3BZKA 5I21A 3BE3A 4KMUX 3OYMA 1B8IA 3HBTA 1WQ2A 4Y91A 2DERA 4MLEA 2AXTC 3D45A 1BA1A 2WY7Q 2DBBA 1LW2A 1IN8A 2HKOA 5C44J 2H27A 2DQRA 4IQ4A 4DU1A 4KHWA 3META 2K3BA 1K73C 4M77F 4QCLA 3OBWA 1CXQA 2FNAA 4P96A 2HNIA 2JG6A 2ZGZA 2IVWA 3CCQA 1VQLI 2M7BA 5DD8A 3AAQA 5J3LA 3BDLA 1D0ZA 4BWMA 4FT8A 1NEBA 3EHQA 1T8IA 2W57A 1REPC 4WFAL 3G6ET 3MO8A 3LSJA 1KIKA 1QHHD 3E6CC 3VYGA 2Z3YA 2NOLA 3TO6A 3HPOA 1U2WA 1V4RA 2K27A 1NGIA 5A2QK 3EDPA 2KRNA 4IEEA 1SKRA 4B9QA 4HF1A 1G2HA 5BNGA 1K1ZA 1MGQA 2IGIA 2LBFB 1QQNA 4BXXJ 5CZ1A 2H56A 1XG7A 2CZ0B 3VJPA 2OPRA 3QEXA 1AKHA 3W3CA 1ZHIA 3R6SA 1KQ2A 1G2BA 3GMEA 5LLQA 2QKBA 3I55N 2D6FA 1MUDA 2QKKA 4M78C 2WSCE 1HKQA 3L1AA 2H3GX 1UJ8A 2OA4A 4AHVA 1XX5A 4C92C 1NOYA 3R8EA 4DTRA 4BH9A 2R5MA 2O01E 1IN7A 5E79C 1E0EA 1M1KO 4AD9A 2RKIA 2EBIA 2E2QA 5H20A 3ZQFA 4L9VA 3A03A 3DV8A 3M0UA 2YHYA 1TQMA 2EW3A 5CQYA 3CD6I 4CW7B 2NRHA 2DN0A 3VOVA 4DV3K 1TL3A 4RA2A 2F9TA 2QBYA 4C0DB 2IXSA 1RNHA 4A5AA 2L9SA 3MP6A 4I02A 3B6CA 1K6YA 4DIQA 4N41A 2OJ2A 3LQQA 1H3HA 3DB3A 1IXRC 3MKDA 3PJRA 3EGXB 1UFFA 2P6SA 3F8FA 2QDLA 5GADP 1L5UA 4YPHA 1OISA 2EKHA 1HJOA 1OQYA 1DP7P 2WBMA 3ZN0A 3S2WA 5GTHC 1A5VA 1LDJA 4HLYA 3OA6A 1K8AC 3C4SA 2WUSA 1PU7A 3SD4A 2HDWA 2L2PA 4H03B 3CC4T 3M4GA 2CS3A 2Y0SN 5ICFA 4MDWA 2VE8A 2JA8J 2L3PA 4OMQA 3THXA 2DLPA 1YVUA 1ASWA 3ZT3A 1GLCG 3G71N 1R71A 3VS1A 4AHTA 3HZ6A 3N05A 4Z4CA 3K4NA 1CF7A 1E6GA 1HA8A 2GAUA 3F73A 2HGCA 4DBRA 4NO7A 1WSIA 1Y8RB 2DODA 5LJ3d 3O5BA 2DD5A 1SEMA 1O4XA 3D0SA 4CZIA 4CI0C 3VF2A 2KJCA 4DS5A 4XLAA 3UKGA 3EUKL 1TQIA 2F4IA 3HOXJ 1ZYQA 2FF3B 4JI6K 3JTGA 2BGCA 3I9QA 5I22A 1PDNC 1UEBA 1IGQA 3A8LB 3GBTA 3CCEI 3QEVA 1UAXA 4A0YA 5AN4A 3SUQA 4IHYA 1CZ9A 4ZNXA 3RYRA 3CMEN 2O8FA 1U9OA 1PKSA 4RGSA 2DTZA 2STTA 1MWKA 4GNIA 4ZDLA 1PM3A 4PFPA 2WV0A 5KAFC 3CCLQ 5DV5A 2E70A 2QQSA 1R22A 4BRMA 2Y1IA 1U5SA 2VKVA 1TKXA 3VEYA 4DKWA 2WAEA 3HHHA 4M7DB 2QTDA 5GIPA 2F69A 3KKRA 3EH2A 2K9NA 1BL3A 1ARKA 3AG2H 4FK2A 3ZT0A 5A0LA 3MK6A 4M6VA 1WI7A 4IFEA 3OSSC 1YHQQ 4L8RB 4LFUA 2YJEA 3CO7C 2PJPA 1VQKI 1GCPA 2QWPA 1Q81U 4BRPA 4XN3A 4C0GA 2Q1NA 2B86A 2D5VA 2JVVA 1P4WA 1QVGP 3OOPA 3EKUA 2EQKA 2CT4A 1TUUA 2RJDA 1OH7A 3ZT2A 5AQXA 1U1TA 3HYFA 4UVBA 4Y1DA 3I56Q 4V2GA 5BPDA 1IXCA 2L8DA 4OPJA 3SMPA 3BR1A 1SHFA 4DF4A 2FUG2 2B4JA 2AQEA 5DS9A 4TVRA 5C0YA 3T19A 1D8KA 1WEIA 1XQPA 3LDPA 5AQQA 1WHLA 4FJNA 2H1KA 4IKFA 1JHFA 1QP2A 1OR7C 4YFNF 2IRFG 2YHAA 1A04A 3ABKH 3E97A 1FMWA 2QA4Q 4HQEA 3KIOA 3CCVA 4AVZA 3TW7A 4M74A 2V7FA 1VQ5A 4N4GA 2PG4A 4ENJA 4B43A 4MNUA 3MEGA 1HW1A 2COMA 2QK9A 5KGWA 2BHYA 4M3FA 1HW5A 4HX7A 2QQAA 3J7AP 4CK2A 4HCKA 2FZKB 3GIBA 1UJ0A 3MCAB 4MO7A 3K2ZA 3LDQA 3QJYA 4KPYA 4IEJA 2GXGA 3OYKA 1VQPN 1BCOA 1QCNA 4IVNA 1Q82U 3IC7A 1WAJA 2HW3A 2ZJQF 4CJVA 4GXOA 4FE4A 4O8KA 2IW5A 3EKSA 1JE8A 1OV3A 5GAN4 2KT0A 1RKTA 1LEBA 2QSFX 1RRSA 4Z02A 1WGXA 3FXJA 1X3WB 1R59O 1UTIA 4OB2B 2KLAA 4AWXB 1H8AC 1MD0A 3OQ5A 3W2VA 1GLBG 5CKDA 4IEIA 2OV7A 1IKVA 4FWOA 3ULEA 2GIZA 1ETKA 5HK3A 5F0FA 2Y0MA 5DTDA 3IG1A 2HS5A 3KJVA 1NJZA 5D5WB 1U8RA 3C7NA 1WLPB 1R6RA 1RAGB 3TSUA 4BBSJ 3K10A 3COAC 2BH1A 2WBNA 5IOYA 4KRTA 3ASOH 4WFNL 1T98A 3TWHA 3HRGA 2BANA 1ZRCA 4N76A 1TKZA 1GOAA 3RCOA 4BC3A 4DYCA 2XHCA 1HCRA 4EHUA 2GGRA 4CJ3A 3VYUB 2RREA 3GW2A 4GYGA 2OTLI 3H41A 4QSHA 3U1KA 3CCMA 4BWJA 4FSVA 4W5RA 3VQ9A 3RQ4A 4C5IA 4FLUA 2KIUA 2CQKA 3PSIA 3BDPA 3C7JA 2DTUA 4YORA 1O3TA 4DBHA 1QLYA 3MX5A 1E3MA 5IP6A 1YIJI 4DR2K 2DJNA 4P9FA 4UVAA 4CIEA 2E36A 4FX4A 3B6OA 3NCIA 4C8QB 4RGRA 3H8ZA 4M78G 3U1DA 1SVLA 3J81E 1V5EA 4YRVA 4XOPA 3QIIA 4MQVA 3FHGA 2HPIA 4AI4A 3K6GA 3VESA 1NGHA 1VRTA 4ZC3A 3WQUA 2K85A 2LKSA 1UGVA 2O8XA 4FWKA 4OOIA 2L3RA 1VHXA 3AVKA 1IBKK 2ZNZA 5EZGA 4JJCA 2ZB9A 5F1XA 4OIQF 4DV2K 2NUTB 2EINH 2GBZA 4B9TA 3ZL7C 5FLXE 3CC2A 1Y71A 2UUZA 3SYZA 3ERMA 1S72T 1VAZA 3V4IA 5GAOn 3TVTA 4O5BA 2F5EA 3LGFA 3CCSI 3VS4A 2P5VA 4JKFA 5JS2A 3QERA 4J01A 2OF7A 1YRNB 2F5TX 1VQNT 3EG1A 2BE2A 1Q86U 4O5VA 3WTVC 3M3YJ 2QDYB 3SEZA 2LQKA 1Y39A 3HGGA 4Y33A 5HDGA 4JYAK 2HNDA 1SD7A 2ZKZA 3P8BB 1XDUA 2N8GA 2EFOA 1XQHA 2VWBA 2VT2A 4R56A 1GLNA 1EKEA 2QQ8A 3RQIA 4A3IJ 2ASPA 1FMVA 1K8KB 1OOTA 1YQLA 2L9NA 4Y17A 1C1CA 1BG3A 3U9GA 4N4IA 2NLXA 3AFHA 3JW4A 3ID6A 4QT7A 3IKMA 4CZJA 2FLOA 4W5TA 2ZJ2A 3I59A 4WWCA 1F4KA 4UQGA 4FX0A 5JHFA 3BOQA 2E6LA 3T1BA 4X65K 1GV5A 2HB5A 4FZYA 4ILJA 1VQ7Q 3C6AA 3S41A 5I42A 3ZMVA 1JJ8C 5B8HA 3Q0UA 2YX4A 1G83A 4A2BA 2XHKA 3CCJI 1X75C 1WHHA 2DBKA 3LM2A 2X35A 3QZ5B 4M78D 5TKWA 1T08B 3K4MA 1DDNA 2R5YB 4AF1A 2PQ8A 1REVA 1FYMA 4C92D 1WJBA 4F7ZA 4F7UB 1N9SA 4IRGA 3DYAA 2XU8A 1TP4A 3RMCA 1G3SA 1ITGA 2HVRA 3KYCB 2LD5A 4Y0WA 1P4XA 3VTHA 5GIOA 3R6MA 4BRDA 3U9ZA 2PUOB 4BRGA 2WSFE 3G4SQ 1IV8A 3OW2S 1VQ4A 2NUBA 2PN6A 1C1AA 1VQLN 4IUTA 4LN2A 2CH4A 1X4PA 2JZ2A 2PNIA 1YCYA 1ZLKA 2LQWA 1D9FA 3TMOA 4HF2A 3NF8A 3HHGA 3BG5A 4OLBA 4B44A 1HLVA 4CCKA 3QYFA 1Z9CA 3GZ6A 1YQAA 1Z1DA 3IUOA 2ZM6K 4JRPA 4EJUA 5D4SA 2XGDA 3NEUA 4CSWA 4NC6A 3CDLA 2CP7A 3IKTA 3TEDA 1BOTO 3SEQA 2BV6A 1ZSZC 4FW2A 3WHBA 2L4AA 1Q8IA 3P9CA 3OIOA 4CBXA 1D1BA 3PX4A 2KAFA 5IXFA 1AWJA 2HBJA 3A8GB 5ILUA 2WAQN 1M1FA 3BF1A 3KEOA 1KC8O 1H3ZA 5CYQA 5FU6B 2O8CB 1S3JA 4HNUA 1IREB 1EQYA 3WU0A 1VF9A 4ABZA 4KIGA 4C8LA 5KI6A 3M55A 5AQTA 5ELZA 1FOYA 1Q7YR 3M9AA 5TGTA 2XKOC 1CSKA 1YI2A 4H0TB 1T7PA 2DYRH 2ZXWH 4QOZB 2EFQA 4KGZB 3HTUA 1VQON 2YHWA 3FISA 2IVOA 2LT4A 2K9LA 4AVPA 1HK9A 1JXBA 2E5LK 4OJRA 2AHJB 1PUFB 5AZIA 1JJ2P 2M87A 3PFYA 4R55A 2M4KA 4I99C 3GZ5A 5TKYA 2QGUA 2CUZA 1DGWY 3ZSVA 4DB3A 2FBVA 3BLYA 4BJ6C 4EGZA 3CPEA 3LALA 3A5MC 5EEAA 2L4MA 5DPKA 3ZMTA 1AWCA 4YTLA 2ZPFB 1MNEA 5FROA 2NUPA 2ROLA 2YLCA 1LMZA 2IJLA 3MN6A 1JKHA 1BL0A 3MZHA 4KT0E 1B92A 4KRFA 2J6FA 3TABA 2JT4A 2OPQA