4E7KA

Pfv integrase target capture complex (tcc-mn), freeze-trapped prior to strand transfer, at 3.0 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
366
structure length
366
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 96
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7kA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7kA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7kA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7kA03
4BD3A 4CF0A 1UAXA 3EZ5A 1RTJA 4EP4A 2IS3A 1ITGA 1HQUA 4F2SA 4DTPA 2QKKA 1NJZA 4IUUA 3VQCA 3HYFA 4HUGA 3M8QA 1L3SA 3ULDA 1T8EA 1BI4A 3O4NA 4DLGA 3K5OA 3PO4A 4W5RA 1VSMA 4W5NA 1LWFA 1NK5A 1KCFA 1NKBA 2X6SA 4NS5A 2A1RA 4N4HA 1DTQA 2RPIA 1CXQA 1HYVA 3VQ8A 1JL1A 2D9TA 5K14A 4F3TA 2E6LA 4QOZB 1HQEA 1U45A 4BACA 1UA0A 3TR8A 4DTSA 2HW3A 1S1UA 2G8UA 4C8MA 1VSEA 3KK3A 2YNIA 3NGZA 1HYSA 1SSFA 4CFAA 3VQBA 3RMDA 3HM9A 1QSSA 4CJ3A 4QCLA 4KI6A 1EP4A 2VG5A 1JL2A 4CGFA 4CGGA 2X35A 3P83D 2M0OA 1JLAA 1S1TA 4FJHA 2YNHA 2EFIA 2RJCA 3O4QA 2Z1GA 1ZYQA 4HCCA 2PQWA 4HTUA 3HL8A 3RWUA 4NYNA 1LW0A 4BWMA 1WAFA 4CHOA 2OA8A 4O0IA 4Z0UA 3OYNA 3LP3A 3HT3A 3VN5A 1TK5A 3G0ZA 1K6YA 2YNGA 4IG0A 1RTIA 1XHXA 4A4HA 4E7HA 4PQUA 2HHUA 3U3GA 3OYBA 4JS5A 1ZBHA 3VQPA 3VQDA 2O4XB 3OYGA 2GUIA 1QTMA 3WNFA 4CHPA 4IDKA 4E1MA 1NJXA 4FXDA 1C1CA 3KKSA 1XHZA 4FU6A 4FM2A 1X1PA 5IAYA 3NNQA 3NE6A 3SZ2A 3AVBA 4DF4A 2DIQA 5C0MA 1TV6A 4Z4IA 4CEDA 5C25A 1SL0A 3NTHA 4DMNA 1S6PA 4BDYA 3S3MA 3SV4A 4NZGA 3QBYA 2DY4A 2RI5A 3SUNA 4CHZA 1SUQA 1RBSA 4PLLA 2ETJA 2BKDN 2HHXA 1OI1A 5D6WA 4N47A 2WONA 2HHWA 2BANA 5KH6A 2EQKA 4M3TA 4C8LA 4G1QA 2DIGA 1NK4A 3FDRA 1SKSA 4CFCA 2ZD1A 5KRSA 3ZT1A 1J5OA 3EYZA 3I8DA 3LAKA 3KD1E 4B9LA 4M3YA 2G8HA 4DS5A 4DTRA 3VQ5A 3NHGA 1B92A 3CM5A 1ASUA 3SYZA 1I39A 1LAWA 3SQ4A 3HVRA 4FVMA 3AO1A 5KI6A 3IRXA 4CJPA 2P5GA 3RTVA 4QQDA 3DLGA 2YKNA 1BCMA 3B6OA 1XC9A 3HPHA 1SKWA 4KFBA 1VSFA 4HHTA 1QSLA 1HJRA 3LPTA 4HCZA 2B8AA 1VSKA 4CJUA 3MXMA 1RT3A 3V9XA 4DQQA 2X4WA 4E0DA 3NGYA 4CEEA 1TK0A 3AVNA 3C6TA 1BIUA 3NF9A 4CHQA 3DRSA 4CJQA 4IUVA 4CEAA 1A5XA 2OPPA 4FYDA 5J2PA 4CRIA 3B6PA 2XHBA 3M8SA 2JLEA 3ZSZA 4EZ6A 1WJQA 2FBXA 1B9DA 1F21A 4FLWA 3PMTA 4W5OA 3C95A 3NH2A 3L3VA 3MEEA 4KTWA 1YT3A 1W0HA 3AVLA 1YTUA 3MXJA 1VSHA 1A5VA 1XNIA 2XRIA 1S9GA 2LSNA 4J2EA 1S1VA 4FLUA 3ZEHA 2RO0A 2E6MA 3TABA 3E01A 4PA1A 4FJNA 4Q0BA 2DTUA 2M1HA 4Z4HA 1BI4B 2Z1JA 4J2AA 4FLYA 1U48A 4L8RB 4FZZA 3THVA 4J2BA 5CZ1A 5KGWA 2KTQA 1T7PA 4F8RA 3TWHA 5DMRA 3AA3A 1WSJA 1RCHA 1JLFA 1J54A 3SQ2A 1WSEA 1Q9YA 2YHAA 3HP9A 1NK0A 5J2QA 2QXFA 2Q3SA 3ZSRA 1KTQA 2RHYA 3LP0A 2QKBA 4Q5WA 4F4KA 2XY5A 2P5OA 3PFSA 3U6FA 1KVBA 4RW6A 4CJVA 4BDPA 3V9SA 4CEOA 3T1AA 4H4OA 1RT5A 4KRFA 4OKJA 1JXEA 3DYAA 4QQGA 3SI6A 1RT1A 1D5AA 1D9DA 1DLOA 3L2VA 4DTOA 1KLNA 3DMJA 5J2NA 4CF9A 3SCXA 3SV3A 2X4XA 4F3OA 3HPGA 2LTOA 2IOCA 1BQNA 3DLRA 3LZIA 4FLZA 2R58A 3H6ZA 2EQUA 3DB3A 4FJMA 2OPSA 2OPRA 4M3UA 1RT2A 4FLTA 3S6WA 2X74A 4N76A 3OB9A 1U49A 1SL1A 4F2RA 4B9VA 4KI4A 3O8VA 4OLAA 1Q9XA 4ELTA 2Y1IA 2KZMA 2P1JA 2LVMA 2KZZA 4FJ8A 1YTAA 5I42A 1Z26A 4DSFA 3VQ6A 4ID5A 3KKRA 4TSXA 3ZSYA 1ZBLA 1RT6A 3K5MA 4CHNA 3LANA 1OZ3A 3L2RA 4PUOA 5CYQA 2WACA 3KLGA 3NF8A 4M45A 3P8HA 4DTUA 3H08A 4AHVA 1QS4A 4DWIA 1UA1A 3K57A 2O4GA 1JLGA 3AA5X 4X34A 1B9FA 3VA3A 2QQRA 3OVNA 1BHLA 3ZSVA 1W9HA 4E7JA 4XIUA 3KLEA 3K59A 1ZBFA 2G8IA 4DSEA 4FLVA 1S1XA 2XY7A 2JTFA 2WOMA 4ID1A 3ASMA 1HYZA 3HK2A 3OYAA 4AH9A 1HNVA 5KTQA 3UIQA 3ZT2A 1I3AA 3OYDA 3E9FA 4Q5VA 2HHVA 3OJUA 3HJFA 3V9UA 3H8ZA 4B8AB 2EQMA 3EY1A 4CEFA 3GOXA 1BL3A 2ZE2A 1RNHA 3HXMA 1IKVA 2HHTA 3L2QA 4C5GA 4FJXA 3PUFA 2A1SA 1G15A 2IDOA 4K8XA 4LH4A 4I2QA 1QE1A 3V6DA 5HBMA 4C8OA 1G5VA 4M3ZA 4FJGA 2OYQA 1ZBIA 5HRSA 4O0JA 3LH0A 3AO4A 2CKKA 1Z25A 3KJVA 5HROA 3NTIA 3O3GA 4CEQA 4PL6A 3ZCMA 2MWOA 3IAYA 4Z4EA 4B9SA 1JKHA 2RF2A 3VQ7A 2HB5A 3KLHA 1GOBA 1GOCA 4CF2A 3QERA 2EQJA 4OVAA 4RW7A 4ZHRA 5T7BA 4AHRA 4J2DA 1KHCA 2XY8A 3KD5E 3QEWA 1TK8A 4LD6A 1NK6A 3RR8A 4DU4A 4CIGA 4O55A 4LY7A 3FLGA 1NKCA 1RTDA 2L3RA 3SNNA 2GBZA 3IG1A 4EDUA 3LPUA 4CJTA 4CJ5A 3V81A 4OGCA 4FK2A 4RW9A 2VYTA 1C1AA 4CJKA 4PLIA 3TANA 1IKYA 2DAQA 3AA2A 4FZYA 1C6VA 4N4IA 1IH7A 4IUPA 5KCHA 4I9LA 2OZSA 4W5QA 3WNEA 1QQCA 1KSPA 4NCBA 1U04A 3MP1A 4B9NA 3C94A 1VK0A 1WSHA 5FDLA 2YRVA 3K5LA 4CF1A 2LCCA 1WGSA 3FEOA 4CF8A 3QNNA 4DTXA 4KHNA 3AA4A 5J39A 1C0TA 2VWKA 5I3UA 2K3XA 2VWJA 3CYMA 4CJRA 4Z4CA 4C5HA 1X9MA 4N41A 4RW4A 4DFJA 3QKJA 1D9FA 4E7KA 2X78A 3SUQA 4II1A 4ELUA 3LGFA 3P1GA 3OY9A 3V1OA 3L42A 3TAGA 2KFZA 4CFDA 4M3XA 4EP5A 1LW2A 4CK3A 1U4BA 4DQPA 1HMVA 4KPYA 4HUEA 3V1QA 4B9MA 4KREA 4DF8A 3OYEA 4ELVA 3NGIA 1UWBA 3ITHA 3ZT4A 3LZJA 2AJQA 3OYFA 1T05A 2KQ2A 2P51A 3ZT3A 4GY5A 1FK9A 1RI0A 1ASVA 2F8TA 3ZSOA 1HRHA 5CY4A 4CHYA 2IGIA 3VA0A 2BGGA 2RHIA 3QINA 2O4IA 4FLXA 3NF6A 2R5MA 3QJ6A 3TI0A 1VRUA 1DTTA 5SWMA 3DRPA 4FW1A 3MP8A 4HCBA 4CK2A 4FJLA 2VG6A 3QLHA 2RJEA 3JYTA 2KW4A 3SPYA 3NTKA 3TAEA 3KLFA 4DFPA 2VG7A 1IKXA 1RT4A 3LP2A 2XDPA 4AILC 2K3YA 4ZTJA 2ITGA 2BE2A 1NJWA 4DTJA 3TAFA 3MO8A 2I5JA 4NYFA 3PY8A 3OYLA 4CGHA 4RW8A 3SQ1A 1QHTA 3L8BA 1X9SA 3SUPA 4OLBA 2HNYA 3ZSQA 3KLIA 4OJRA 4Z02A 4FJIA 4BWJA 2FC0A 3O3HA 4FJ5A 3ME9A 5C6SA 1N5YA 4KKOA 4CJEA 4KB1A 3VQ4A 1TL3A 3AVMA 4OVLA 3MEWA 1KFSA 3META 2JZ2A 5CZ2A 1D8YA 3D45A 3QO9A 3JSMA 5JS2A 4I9QA 3K58A 2FBTA 3KIOA 2L8DA 4Y1DA 1C1BA 3DLKA 1XI1A 4KAZA 4M3RA 2HNZA 3AO2A 4OKKA 4Y1CA 4DG1A 1L3TA 2GV9A 3V4IA 4W5TA 4OPJA 3AVCA 1SV5A 3RMCA 1XWLA 4YNQA 2R7YA 4B9UA 4FM1A 3VQ9A 3F70A 1RDCA 4R5PA 5JS1A 3PO5A 3L2UA 3SJJA 3ISNC 4A4GA 5DK5A 4DU1A 1NK9A 4KHSA 1GOAA 2BIVA 2PY5A 3G10A 3OMCA 1ZBUA 3CFPA 4FZXC 1SL2A 4AHTA 4DFMA 1FKOA 3LAMA 1N6QA 3KTQA 4CGJA 4FK4A 3HVTA 4PWDA 3S3OA 1ASWA 1TGOA 5KCOA 2FBVA 4UQGA 1SKRA 3OYJA 1WJSA 2NUBA 1IO2A 4OGEA 1RDBA 4AHSA 4DSLA 5SZTA 4QAGA 3BDLA 4I7FA 4LH5A 3OJSA 4CFBA 2QQSA 1CXUA 3WNHA 3NCIA 2KFNA 5D6YA 4BE2A 2YNFA 4IUTA 1EETA 3LX7A 4KHYA 4CJFA 4H8KA 3MAQA 4GVMA 3MXIA 3M8RA 4GW6A 3OYKA 5J26A 4OPKA 3AV9A 3QETA 1TVRA 4CJ4A 3OYMA 1WLJA 2HHSA 1UOCA 5E41A 4CESA 1WSIA 2D5RA 2DFFA 4DQSA 4IFYA 3QIIA 1H3ZA 1L5UA 2F96A 4UC4A 4FJ9A 4QVZA 3MP6A 2Y1JA 4DSKA 1REVA 4M3WA 4MQ3A 3OYCA 4MFBA 4KTQA 3RRHA 2E4LA 2X6NA 3NAEA 4FW2A 4CJWA 2YKMA 4C8NA 4FL6A 1OYXA 1A5WA 3WNGA 3LYIA 5KGXA 2RI2A 2DFHA 2EX3A 1JLCA 4M41A 4BE1A 4E7IA 2MWPA 2PZSA 4KB0A 3V9ZA 3U3YA 1RDDA 4CJLA 3DM2A 3QIPA 4B3OA 1BCOA 1LAVA 1Q8IA 3ZT0A 4DFKA 3DLEA 4Z4GA 1OZ2A 2RHZA 2JGUA 2HQEA 3K2PA 1L3VA 3QESA 4IFVA 1RILA 3QEIA 4JRQA 4LSNA 1RBVA 1C0UA 3CM6A 3KK1A 2Z1HA 3QEVA 4N56A 2RHUA 2HMIA 1BQMA 3AVHA 1QSYA 3CFOA 1RBUA 4B9TA 3MEUA 4A4FA 4A4EA 1FXXA 1S9EA 5CIUA 1TAQA 2XK0A 3CFRA 1VSDA 3OS2A 1TKTA 4CERA 4IUQA 3PV8A 4DSJA 4DQIA 3OMGA 1JXBA 1S6QA 1TKXA 1WNSA 3QIOA 2IAJA 2G3RA 1IKWA 1VSLA 1WAJA 2RHXA 4KHQA 3AVFA 3VQAA 3FC3A 2YHBA 1LWCA 2BUDA 2NLUA 1N27A 3PMIA 4L59A 3OYIA 3DLMA 5KRTA 3T19A 4WE1A 3AVIA 3O3FA 3LGLA 3Q1JA 1TKZA 5FRMA 3NF7A 4KHWA 3SD4A 3KK2A 4RG8A 1S5JA 2D0AA 3MEVA 3F9KA 4AHCA 1C0MA 1MHNA 4E1NA 2ATQA 1KRPA 2M16A 2EHGA 3SPZA 3C6UA 3KUFA 4YFUA 4DQRA 3MEAA 4C5IA 5C24A 3OS1A 3P5JA 1HNIA 3I0SA 1Y97A 3IS9A 3PX0A 1EX4A 5C42A 4FCYA 3TAMA 1EXQA 3FFIA 3LP1A 2GFUA 3K5NA 5J1EA 4CIFA 3EAEA 5IN1A 2HNDA 3M9QA 4OKEA 4DU3A 1L3UA 3ALYA 4QQ6A 3NFAA 4ICLA 1KLMA 1WSGA 1NOZA 3A2FA 2FBYA 4O44A 3P8DA 4IBNA 2HHQA 1BISA 1VRTA 1NOYA 4K8ZA 1WJRA 2G8WA 5D3GA 3HP6A 2IC3A 1JLEA 1TAUA 4FJ7A 3LLRA 4EZ9A 2G8VA 1U47A 3NH1A 4O5BA 1FKPA 3AVKA 4NCAA 3ASKA 4IG3A 3DB4A 3ZSWA 3MEDA 2R5AA 2F5KA 3HPOA 3D0PA 3ZSXA 3DOKA 3AO3A 1VSJA 2PYLA 3LWLA 4N5SA 4DLEA 4E3SA 3UWNA 4BE0A 1T03A 2RN2A 2FHDA 4CEBA 1R0AA 1CZBA 4B9WA 2GF7A 1YVUA 1X9WA 3AVAA 3NBPA 3TARA 1RBRA 4FJKA 3RMAA 2BDPA 1EKEA 3MEGA 3LDSA 1LWEA 2R57A 4CECA 3TAQA 2DFEA 4PY5A 5M9OA 3F73A 2PYJA 3S3NA 5KE2A 3DRRA 4CGDA 3PNWC 3DOLA 2IG0A 2L89A 1BGXT 3C4SA 4JS4A 1MU2A 4KTZA 1WN7A 2RI3A 3VQEA 4NCGA 3DI6A 2ZQBA 2XO7A 2O4XA 4JRPA 1O1WA 3BDPA 1CLQA 2E5QA 4ZTFA 3QEPA 4B8CA 3AVJA 4CJSA 3OA6A 2G8KA 1CZ9A 4CK1A 1TL1A 1JLBA 4LD0A 4C5EA 1BIZA 2GFAA 3TAPA 4CGIA 2Z1IA 3DLHA 3DLBA 4E89A 4I2PA 1HPZA 4HUFA 4C8KA 3LALA 1RDAA 2E6NA 2D0CA 4JLHA 4RG2A 2HVHA 1RBTA 1IG9A 4H4MA 1S1WA 1J53A 5D6XA 2HQXA 4CIEA 4CE9A 4CEZA 3RRGA 3L2WA 3M8PA 4LSLA 4FJJA 3V9WA 1RT7A 5FROA 4IURA 4O4GA 3VQQA 5KE3A 2P0KA 3QEXA 5FRNA 3CG7A 2X4YA 3BGRA 3I0RA 4E19A 4DS4A 4QW2A 2LRQA 2W42A 4FM0A 3V1RA 3OYHA 4CCHA 4E7LA 4IKFA 4GMJB 4AHUA 3SQ0A 5HLFA 2RJFA 2OZMA 4FK0A 5EU7A 1J9AA 1NK7A 3AVGA 3HO1A 2F8SA 2RJDA 3HSTB 1WSFA 3MECA 3S9HA 2OPQA 1JLQA 4KV8A 3UT1A 3L3UA 2RKIA 2D0BA 3AO5A 3OQ5A 5HRPA 1LV5A 3T3FA 1KFDA 3NDKA 5CYMA 4DTNA 3NH0A 4HVJA 3QNOA 2EKOA 4N4GA 3PX6A 5HP1A 4B9XA 4B08A 3SUOA 4DSIA 5HRNA 4BDZA 2B5JA 3RMBA 1VSIA 4DTMA 3PX4A 2LDMA 1TKDA 2HVIA 3CQ8A 2XY6A 1NK8A 3CEYA 1RTHA 5J2MA 3RR7A 3LWMA 2B6AA 5HRRA 1NKEA 1KVCA 2YV0X 4Z4FA 4KHUA 1NJYA 1KVAA 2G8FA 3E9GA 4M42A 2QK9A 4KO0A 3OS0A 2B4JA
chains in the Genus database with same CATH superfamily
2CYYA 3LQRA 4F7ZA 2DOAA 1YWPA 2KY9A 5B1AH 2A5XA 2DAOA 4KGXB 2QKKA 5KPZA 3BZ6A 2ZPBB 5H6RA 3CC4A 3WVDB 3MHXA 4K2EA 2EPDA 3IKTA 5L3FA 4XLPF 1OISA 3O4NA 3UATA 5IYCJ 3K5OA 4UXNA 4OFEA 5ILVA 5LJ5g 3HRGA 2A0FB 4IIOA 2QM3A 3EDPA 1X69A 2FF6A 1SD6A 2RPIA 1CXQA 1HYVA 1QVFP 2COBA 1GRIA 5K14A 3C0BA 4F3TA 2QWRA 3BPXA 2GX9A 4QOZB 4M3BA 4M75D 1Y71A 3RDVA 5GANg 1YJ9N 4DTSA 2HW3A 1S1UA 1Y6IA 1YVNA 3CWAA 2G8UA 2M34A 3J80K 2KT0A 1SKUB 3R0JA 2KYBA 1STZA 1MPGA 4V2SA 1XMAA 1R22A 4L5EA 1S5LC 2K85A 1M8MA 4PJOA 4KI6A 2ASOA 3TSPA 2VG5A 4B1RA 2KZVA 4RCHA 2DL8A 4CGFA 5IY5H 3CXCA 5L3BA 4CH7A 2X35A 1S1TA 2CH5A 2O8DB 1YQLA 3ZBDA 1N8RU 3GYHX 1E17A 2EFIA 3O4QA 1W0TA 3PT9A 2LLKA 5F08A 1RUOA 4A53A 5EC7A 4NYNA 4NDLA 2VQEK 1U78A 3G4ST 3AHUA 4BG9A 3JRGA 3CCJN 4DUYK 5BR9A 2R5YA 5F2RA 1EBMA 1TUGB 5IP7J 2LQWA 1LDJA 2GQIA 2DBKA 3HT3A 3VN5A 1RABB 1TK5A 1K6YA 3IP4B 5IYBJ 4DKWA 1RTIA 3EGXB 4E7HA 1W36D 2HHUA 4DEXA 4ZYGA 1WHMA 4LLGF 2R7VA 4LITA 1R77A 1TOVA 2KRHA 2KZGA 2BE7D 4KA4A 2DMPA 4EV0A 3MCZA 9ATCB 2EIFA 1MBHA 1QTMA 4OAZA 3WNFA 1YJNQ 4OFHA 3JCMc 1RR7A 2PX9A 4IDKA 1AA7A 4W1UA 4KUDK 4C0FA 3MZ8A 4F16A 1SFXA 1C1CA 2VKVA 3HM8A 3LAJA 2JMWA 1IRFA 4BRFA 1KG5A 1X1PA 4DZJA 2LCLA 4BRMA 3SZ2A 3RDIA 3AVBA 1D5YA 2P9SA 1HU0A 1XDUA 4DBQA 2DIQA 2L3QA 1ILYA 1KG6A 1X1AA 4CEDA 2M9UA 1CKBA 2XF6A 1KIKA 1QVGA 3WQUA 4OINF 4Y4RA 2OTLT 4DMNA 7AT1B 2K79A 2Y75A 5CKDA 3HM5A 4A59A 4JI2K 4WQ4A 4ESJA 2C0IA 1C0GA 4C3HJ 3H5NA 4AMCA 3QWXX 5D6WA 4IQ4A 2V8KA 1X1BA 2IA0A 2DYRH 6PAXA 2HHWA 4M3TA 1BK2A 4E2FB 3HFOA 3DEUA 3F6VA 5FLXZ 2CYZB 4DW6A 3SAFA 1IO6A 1SKSA 3CCET 2A40A 5M1OA 3CP2A 3HSEA 2QASA 4EHTA 4GGGA 3I3LA 4L5JA 4LMYA 1J5OA 2DJQA 4QVDA 3P7NA 4M3YA 5KYNA 1Y64A 5K7ZA 1W0UA 3F0CA 3KZBA 1QP2A 5LEJA 1LAWA 1JTXA 2H6CA 3HVRA 3BQZA 5KI6A 4CJPA 2EFWA 1K9MC 4M7AA 3GEZA 4CCLA 3RTVA 2QKMB 3OW2M 4QQDA 1WZOA 3DKYA 3CHWA 2DA4A 1U84A 2E5KA 4YIRX 1XC9A 2EFPA 4C8QE 2NLXA 2FOWA 1QSLA 5DTDA 3KP6A 4CBWA 4PJOD 1VSKA 4KJZA 4CJUA 2V8IA 2P4RA 4M72A 3V9XA 4DQQA 3MQ0A 3GMEA 3I59A 3ENOA 4E0DA 1TK0A 3DTIA 3AVNA 1ZUYA 1V3FA 3C6TA 1HR0K 1V5FA 2VXFA 1T95A 2A5YB 3CCVN 3DRSA 2X3WD 1RI9A 3URGA 5IH2A 2IIRA 1GFCA 2NOEA 5KYUA 5JLFA 1AOYA 2WA0A 2MIOA 2DMTA 3B6PA 2XKPA 3CCMN 4WFNL 1DQUA 1T0FC 5KYXA 1KAXA 5HDNA 2HQHA 2G9WA 3KXTA 2JLEA 3CCSI 3ABTA 1YIJT 3EETA 3E6CC 2Z16A 4II2A 3QODA 1MUNA 1B9DA 1DIZA 4X1VA 2GWJA 1G99A 3L3VA 2XROA 1T3SA 5HS8A 3I54A 3MEEA 1BR4A 4F52A 2WTEA 3AVLA 4E9GA 1KQ8A 4OB2B 1GV2A 1A5VA 1XNIA 2OJ2A 1GCQA 3GCMA 3S1RJ 1HKCA 2Z5UA 3BC8A 2A3SA 3FWEA 1UECA 2I7NA 1U2VA 1LFPA 5EOYA 4J2AA 4XK8E 1UMQA 2A3LA 2DFUA 4I7HA 3THVA 1LEAA 4J2BA 1QVTA 2DXUA 5KGWA 1FWZA 3TL4X 2BXZA 2H56A 3O9SA 3TWHA 4FWMA 3WTUC 1XS9A 1RCHA 1V76A 2UUAK 2P9IA 2HBWA 4M3FA 4J9BA 1YQMA 5J2QA 2W84A 3A8GB 4NXMK 3OIPA 2Q3SA 4ZGEB 2E19A 3O6WA 2CO5A 1KTQA 2VE9A 2IP2A 1Y8QB 2O3FA 1JXMA 4B3XA 1W7PA 1XG7A 2P5OA 3U6FA 2HZDA 4GY2B 1MSFC 1JJ2A 5EEAA 3SDZA 1GXIE 4A2UA 1KQSA 3I55N 2NOLA 4G7OF 4AT1B 1VF9A 1UHFA 1RAFB 4BY1J 4M74A 3SWNA 4KRFA 1KONA 2K7LA 1TWAJ 5FD6A 1LE8A 3TTFA 4XORA 1RT1A 4OIRF 3WODF 1ZKGA 3DLAA 2LX7A 2V8JA 4F14A 1W1WE 3L2VA 3ZEUB 5L23A 3T8RA 1TUCA 4Y17A 3BR6A 5JI6A 4M7AD 2YCHA 5J2NA 4MEYF 4LNPA 3LM9A 1GL5A 4CF9A 3SEMA 2R7XA 3EZWA 2DBBA 2DPPB 2AHQA 4HAMA 3HPGA 2IOCA 1R49A 2CP0A 3DLRA 2QA4T 3VEXA 1BN5A 2P7CB 3FX3A 3CBPA 3F72A 4M3UA 1RT2A 1PVSA 3PSFA 4JEPA 1H88C 4XTWA 1O3RA 2X6XA 3LFUA 2B86A 3WGGA 3FHFA 1WPKA 4ZDPA 2LP0A 2JTEA 2DTIA 4ELTA 2UUBK 1Z9ZA 4D8DA 1JTYA 2OC6A 2Z2SB 2B0LA 1KQ2A 3AL0C 4JKFA 2Y1IA 4W97A 5FFZA 3TTDA 1RIOH 4DUZK 1V4RA 2NVXJ 4YOTA 5BNGA 1UHWA 5J1RA 3O4WA 4F3QA 4X62K 5GAMd 5CQXA 4DSFA 1J2XA 1N36K 4ID5A 2AA4A 3O1WA 4J6WA 4RB0A 4MO4A 2P0QA 3CC4Q 2KMTA 4XU1A 4UUVA 4DOZA 1RT6A 2JOYA 3K5MA 2V6EA 2M0MA 3S14J 4FQGA 4ATOA 3IRQA 2ASPA 3HOVJ 1EWQA 5CYQA 2UXCK 2O9SA 1VQMT 1QS4A 2WBMA 2W1OA 4AIHA 1G2BA 1ZGWA 2CW0F 5E20A 1JLGA 4HDUA 4X34A 1B9FA 3VA3A 3K0SA 2QQRA 3BFMA 2J6OA 3M8JA 2VB6A 1W9HA 3O5BA 4JJCA 2ASMA 3F6OA 2LNHB 1FT9A 2A36A 1UG2A 4FLVA 1N34K 5L3GA 1BIBA 3Q0WA 1M4ZA 1UGQB 2WOMA 4JX5A 1J5EK 4ID1A 3ASMA 5C44J 3HK2A 3D2FA 2KDOA 2ZMEC 5TGTA 1GLLO 2LBFB 4CZIA 2XDDA 3THXA 3BR2A 5CYVA 4UOBA 1KQ9A 3FDYA 5HNHA 3ZT2A 3FKIJ 1FJGK 3E9FA 4Q5VA 1IZ1A 3FHGA 4IHWA 1S1NA 5MLCQ 2EINH 4B8AB 3ZX0A 3EY1A 1UJYA 1TQPA 3TW6A 3BY7A 5LJ3g 3GOXA 2DDBA 3A1PA 2Q97A 3E6BA 2CQQA 2ZPHB 4LB6B 3G7ZA 2HHTA 1NJIC 5F27A 5GAN6 3ZMVA 1W7PD 5FU6B 5B5EC 1GUUA 4AYBN 2R7RA 3HOSA 1TSFA 1W70A 1G15A 5J1UA 4Z2YA 5CKEA 1Q81U 2IDOA 5EJCA 3EUKL 2VKEA 3CCRT 1QE1A 3C2HA 5HBMA 4FX4A 4C8OA 5FW9A 3Q3SA 2JUCA 4HV5A 5J8FA 2OYQA 4X6AJ 3A8MB 1OPLA 3U9DA 5HRSA 1G8XA 3SEZA 2DXCA 3C3WA 5HROA 3NTIA 3O3GA 3I0XA 3D7SB 3EYIA 4ENJA 3J7AO 3ZCMA 2CH4A 4ON0A 1HW5A 1QW1A 4Z4EA 2HSPA 3JCMV 1JKHA 1T8IA 2HB5A 5IT9K 5FU7B 2V52B 3V7SA 3QB0A 2HVQA 3QERA 2EQJA 4OVAA 4JDSA 4LDWA 3KE2A 5FLXE 2P9UA 1KGSA 4IOCF 2F48A 3KD5E 3WGHA 4XLCA 4LD6A 1M1FA 1NK6A 3WE2A 3RR8A 4DU4A 4HVUA 4CZEA 2NUTB 4R1HA 4LY7A 5EG0A 3FLGA 1NKCA 3ABMH 3SNNA 4NC6A 4ABZA 5ILSA 1M1KC 5GJVB 2Q36A 2ZF5O 2HL5C 1XMQK 4CJ5A 2PEXA 4XM3A 3V81A 2JK3A 1Y96A 3H9NA 3RCOA 5J3BA 2L9NA 2YG9A 4JX4A 1IKYA 3AA2A 2DNUA 4GFBA 4N4IA 4IUPA 2K4BA 4A69C 2QSHX 1XUPO 1U04A 3HBTA 2K5CA 3BW1A 1VK0A 2IIMA 4KN4X 2RF0A 1ACMB 3M07A 3E19A 2YRVA 3PQJA 3BJ6A 1NBEB 2LCCA 3V7RA 4M3GA 3F5TA 5IHIA 3Q0UA 1QKWA 1D1AA 4DTXA 4KHNA 4AU7A 2P84A 5J39A 2K3XA 2VWJA 3BROA 1SEMA 3RSNA 4CJRA 4EMKC 3JB9I 3VMFB 1X9MA 3QYEA 3BCBA 1W2BA 1OVQA 2YJFA 3J7AF 3M1CA 4LF4K 1D9FA 2J7IA 2FF3B 4II1A 5EZHA 2IS4A 4HSBA 4ELUA 1QHHD 4Q48A 4JKHA 1ATSA 1UG0A 2F5EA 3G71T 3QICA 4Z94A 4U88A 4BGAA 3H1VX 2E1MC 4CBUA 4NB4A 4FIBA 5DEQA 2AHJB 3V1QA 4KREA 1YI2I 3OYEA 1Y0UA 3MCPA 3NGIA 5AQNA 1UGPB 2P4TA 2AJQA 2L3DA 3OYFA 1T05A 3OIOA 4GY5A 1K8AR 2P9LB 2W6KA 3FZVA 1YJ9I 2F8TA 1N32K 3ZSOA 4YFKF 1HRHA 5CY4A 5KYYA 3SAGA 2HXIA 1W4SA 2ECZA 2VASA 3VA0A 2JN6A 2ZGYA 5BN9A 2RHIA 3DXMB 3VPRA 2I5WA 2YHWA 3PNYA 5GAOr 1DGRM 3NF6A 3RKXA 5SWMA 3HEFA 4FW1A 1KU7A 3S32A 4FJLA 3EGUA 3CCLA 4LIUA 4MNUA 3JYTA 2VT3A 4S05A 1T0HA 2KW4A 4A0YA 1DGWY 4BXUA 5C2DA 1ORNA 3NTKA 3TAEA 4C3IJ 3ZQQA 4DFPA 5IT3A 1YI2A 1OYIA 2VG7A 1RLQC 1RT4A 1XJWB 3J81O 2PMZA 2EGAA 4AILC 3CCJI 2K3YA 2QQ8A 2BE2A 1WH5A 1NJWA 1XD7A 3G4SN 4DTJA 4C8QF 1QZEA 4NYFA 4OB3B 2XD0A 4EIKA 4PK4A 1RESA 3SQ1A 3L8BA 5CKHA 1X9SA 2BOLA 2GNCA 2XF7A 1ZAOA 2EIKH 1ZELA 4EJTA 4EJWA 5A0DA 1PG5B 4IO8A 5H2FC 2F6CA 2Q0OA 2JQ7A 4JKGB 1JBMA 1U0JA 2CP5A 4FJ5A 1QKXA 1AWCA 3ME9A 1Q82R 3J7ZI 2XGDA 4M9SA 1N5YA 5GAHJ 3AVMA 2NS7A 1ETVA 1OCPA 4OVLA 2UU9K 2YXYA 4RGRA 4XTYA 5BPMA 3CW7A 1GXPA 1ZSGA 2HMAA 5LJ5h 1ZK8A 3D45A 2XAUA 5JS2A 3VPZA 2JT4A 3K58A 3MMYB 3K0LA 2XB5A 3GIBA 3VESA 5JHFA 1XI1A 2OTLN 4KAZA 3I0TA 4M73A 3WTSC 3AO2A 2L9RA 4ILJA 4Y1CA 4G94A 4XRFA 4KYWA 2CT3A 3AARA 1TW3A 1KZHA 2DCEA 3NQOA 2F2WA 4CUGA 4M77F 1F1ZA 3ZMTA 1G4DA 5AQIA 5LMNK 1W7AA 3ZETB 4ILHA 2Q0RA 2XAJA 2HDDA 2P9NA 5JS1A 3CVSA 2LX9A 3CBMA 2DRKA 1RI7A 3L2UA 3OW2P 1LWWA 3ISNC 4M7DA 3FZLA 4HKEA 3CCEN 4JKDA 2PY5A 5DM6L 4F04B 3OMCA 2DBMA 3KNTA 1LCUA 3LAMA 5IP9J 4E9EA 3HTVA 3H9GA 2EBPA 4HYEA 4PL8A 1ASWA 4BC5A 5H20A 5FKMA 4XAXB 4JRKA 1JUSA 1M90R 1SKRA 2P4WA 2RHKA 1RDBA 4LFBK 4DV6K 3I33A 3JCMd 4LG0A 4I0BA 4XL9A 2DZCA 4F55A 5AQWA 4XLHA 4XH1A 2B63J 1M3AA 1JT0A 2O9VA 2D0QB 4XTUA 4JKBA 3FZMA 4IUTA 2DMQA 3LX7A 2FQ4A 5DDGA 1IUYA 2UV1A 5M1QA 3TKYA 4JJNK 2XRLA 3OYKA 1NM1A 4OPKA 3CCMI 5FWBA 5FKKA 4CW7B 4FE7A 1R00A 3AKZA 2FZCB 3S15J 3I5UA 1EH6A 3OYMA 1WLJA 1LOTB 2MBFA 4ZC3A 4RA2A 3D5RC 1E4FT 2XGCA 1XGNA 1WSIA 1R6RA 5HNFA 1Q7YC 3RKWA 2KAFA 5LHIA 4M3EA 4BROA 2E65A 2FRHA 1D4XA 4KGVB 1OLTA 2L7ZA 1H3ZA 5IP6A 1HQCA 3TSWA 5I11A 2LNVA 5GAN7 3MP6A 2JVHA 3RPUA 1LMZA 4KITB 3KZZA 4KTQA 2STTA 4BRDA 4XTXA 4FW2A 3MX2A 4CJWA 3M8FA 3E97A 1VQLT 2E10A 2M9HA 1VA7A 3PIOF 1OYXA 3WNGA 3VOVA 1SPKA 2RI2A 2EX3A 4CC4B 2DODA 2DA3A 1N33K 4KT5C 4E7IA 3RESA 2IRFG 2PZSA 1WHLA 2R7FA 1UEBA 4GYIA 1G3WA 2ZPIB 4B3OA 1IXCA 3HUGB 1B34A 5GAN8 4RAYA 4E70A 2CP2A 2FVUA 1X01A 3CDIA 4BJTA 4DFKA 1HKTA 3LSTA 2A08A 5B66C 4Z4GA 3VU3C 3KP7A 4MO7A 4TV7A 5GP9A 1PP8F 5LJVA 1YITN 4G9ZA 1VQ8A 3FHNA 2W6LA 3K2PA 2E1YA 4IFVA 4DIQA 4JRQA 3KEOA 4LSNA 3UE5A 1Z3XA 3CM6A 2EVRA 3M3ZA 2QWPA 5C12A 2MLGA 4EEFG 3OR1C 4N56A 2V1UA 4OMMA 4GNIA 3H92A 2A6HF 2YUPA 2VXEA 3JAMO 4WXHA 4M7DD 3HKSA 3I9V2 5GAMf 3HTSB 5K5QA 2EBIA 3M9AA 1S9EA 1XMXA 4IHXA 4H5WA 4PJOG 5CIUA 2BV6A 1XG1A 4KICA 3KBGA 4CERA 4IUQA 3JB9F 3PV8A 3OMGA 3QIOA 2EV6A 2W57A 2WB1N 3EUHA 3J7AY 4OMPA 3A0IX 2RQUA 1IRZA 1HJOA 1OR7C 4GKJK 3FC3A 4M78A 1YAGA 1LWCA 2PZ1A 2BUDA 1N8RC 2O8KA 3NMUA 4EGYA 3OYIA 4WE1A 3MEXA 3AVIA 3Q1JA 5FRMA 1HOMA 1P90A 3QHSA 1I3QJ 3RI4A 5GAOp 2XV4S 2QA4N 1S5JA 2D0AA 1QO0D 2BVLA 1QVGS 1GVJA 3KVGA 5AN4A 1QU3A 3KUFA 3J7ZO 5BPNA 5DM6F 1K9MR 2GTJA 4C5IA 3ULEB 4B1YB 1HNIA 4L9JA 2V1NA 5IYDJ 2DTHA 3VYUB 2HR3A 1NMNA 3G1LA 1T0JA 2DETA 4CIFA 3EAEA 1RDUA 4G9YA 4OKEA 1T3LA 2ROLA 3IH7A 3DEWA 2EQRA 2HBJA 5FLVA 3M0SA 4E6RA 1YJWI 3LWHA 5BPLA 1NK2P 4QT7A 1X43A 1NOZA 1Z0XA 3QU6A 2LNBA 2IVMA 4A3EJ 3GUDA 4IXAA 4LXCA 2VJIA 3JRHA 1P6RA 3PNVA 4JQFA 3MN5A 3ABLH 2LCSA 4PKIA 3G6EN 1HNWK 2G8WA 2FE3A 2LKSA 2EGCA 3HP6A 1JLEA 3D2EB 1QLYA 4WK8F 4FJ7A 2VCPA 2G8VA 4KT6A 5ICCA 2DYIA 1FKPA 5AQJA 4NCAA 4RGSA 4ENMA 1ARKA 5EF6A 4IG3A 2R5AA 1N3AA 2VQHA 3INZA 1WJCA 4B3SK 5E18F 1EO1A 1IC8A 3H36A 4B44A 3EN9A 1RC9A 4N5SA 1I1GA 1X4OA 1H641 4E3SA 2ME0A 2YHXA 2JTVA 4IEEA 2M45A 3T1YK 3CCLQ 5CR2A 2FF4A 2E41A 1YJWA 1ZA1B 4PL7A 3ZX3A 1WH7A 3AVAA 5CVJA 1YI2Q 2YRDA 1RBRA 5B8HA 1R7JA 1GLEG 4C92G 1LWEA 2C06A 2JM8A 3K70C 3W2AA 1RUWA 3L2ZA 3F73A 4B3MK 4HG2A 3DRRA 4CGDA 3EGXA 1MNMC 4OX9K 3JB9H 2L89A 2FOKA 3DOLA 2DOEA 3QPTA 4DBFA 4JS4A 2EWNA 3VQEA 4NCGA 1KAZA 3K2ZA 2ZQBA 2XO7A 1RFQA 4QKUA 4BNCA 1J6ZA 3SBTA 2Z9OA 1M3CA 2FZKB 1RADB 1OVYA 3OA6A 3VOEA 4NC7A 5LL6S 4CK1A 1D09B 1TL1A 1XCVA 4B1ZA 4M78D 3H3OB 5GAMe 2V9KA 3BTLA 2R0QC 4ELYC 4Y92A 3CO6C 2HL3A 5JMVA 1MMSA 1YS7A 1HPZA 3I4NJ 4CD1A 1RDAA 2E6NA 2CGLA 4B48A 2ECBA 2F5DA 2KP6A 2DI3A 2CQXA 2O8EA 4JLHA 1XQSC 2Z3YA 1RBTA 1I81A 1V55H 4Z8AA 1BJAA 1WFXA 3N0UA 3BF1A 4C0DB 4PDKA 3RZOJ 3QFPA 1RDWX 3D4VA 1SHGA 2BZXA 4DV1K 1SAUA 3V9WA 4DV3K 4IURA 3NARA 4JV5K 4BYYA 4O4GA 3CCST 5AQPA 3GTOJ 1TWBA 1X1DA 1SFOJ 2EA4A 4FISA 3F9MA 4ZDOA 2PFUA 4J9HA 4B4CA 4BBSJ 4HNVA 4BRLA 3BGRA 2ZPFB 4H0OA 1LJOA 5CAIA 4QW2A 1Q82U 2LRQA 3F2KA 5GTIC 2M3AA 1QA6A 1T56A 1YJNN 2LYCA 4IKFA 1JJ2S 2QGFB 2ELJA 1KQSS 4Y7NJ 4JNEA 2F2EA 3G1MA 4FK0A 2DLPA 1PCXA 5EU7A 2VC0A 3JB9J 4BRHA 1NJIO 1NK7A 4DGWB 4YOQA 1P7IA 3OWTA 4RAGA 2WAFA 5K5RA 1WSFA 1R1TA 3SMPA 2GQQA 3S9HA 2OPQA 1VQOI 2Z1DA 4X0GA 5EG2A 5E3NA 3UT1A 3P9IA 2RKIA 2D0BA 4HF1A 4YORA 2HZTA 2RN8A 2MYSA 2YUSA 2YRCA 3VTIA 4H5RA 4RGXA 3CCUI 1LV5A 2PJPA 4CZJA 1KFDA 2O7OA 1WPYA 4PHTX 2HOSA 4FVUA 3CWTA 3QNOA 2EGEA 2UXDK 4F93B 1VYTA 1X3WB 2X0LA 2R5YB 1KHIA 4TVRA 3MAJA 1WIEA 3SUOA 2ATCB 2VGMA 2E2PA 3PNTA 4WF2A 2F9TA 5HRNA 1QCNA 4FHTA 4UHTA 1MJAA 3AGRA 3QBXA 3EG0A 2QLZA 4R8HA 2LDMA 1JEGA 1MBKA 4LD9K 4C8QA 2VUMJ 3PE0A 4O6JA 4R56A 1NK8A 2Y0SA 5F0XA 1YBYA 3LW5E 5D6EA 4BI4A 2X51A 2KROA 2OD5A 5EGOB 1EV7A 3VEVA 1ORKA 3F10A 3N97A 1QZ5A 1MUYA 4YPRA 2A5WA 1VQNI 1EH8A 3M0QA 2ZO4A 1IGQA 1EF4A 1KVCA 2YV0X 2M51A 4KN7X 1M1KO 3W0LA 1VQOA 4MFDA 1KVAA 1U5TB 3CDHA 1KJWA 4LF5K 2PAVA 1K9AA 3RSEA 1UGVA 3CCUA 3DAWA 4YOYA 2Y4YA 1UAXA 3EZ5A 5D4SA 2IS3A 3J7YP 2D8JA 3CETA 4DTPA 2BZTA 2VJ4A 3CC7T 3WU2C 1NLVA 1DGKN 1NJZA 3SB2A 5ERIA 2IT0A 4H5NA 3HYFA 3R0AA 4HUGA 3BUZB 4XH5A 3M8QA 3ULDA 1T8EA 5KPRA 2E1CA 4UVCA 3QOEA 4MLEA 2CW8A 3J80O 2HBLA 8ATCB 5CLSA 5HLGA 1JHHA 5GMKm 1XTAA 2OAWA 3EH1A 3FXJA 1GFDA 5HDGA 1DTQA 2P8TA 4OPAA 1IN6A 2HKQB 1TNSA 1VQNA 3VQ8A 1KC8C 1Y39A 4C92E 1XCBA 3OOPA 1QVFA 1ZQ1A 1LDDA 4BACA 3UKUB 1SD4A 4RS8A 1IDYA 4A57A 4HX7A 2BVMA 5FKLA 1WVRA 1FOWA 1KU2A 4C8MA 2FX0A 3CJQB 2YNIA 5LBQA 5JFRA 2HDAA 3IH2A 4FPAA 1HYSA 2KRCA 1SSFA 2PNIA 3VQBA 3HOZJ 4C92B 3ER0A 1QSSA 5FPEA 1N39A 2UUZA 2CGHA 4QCLA 3TP3A 2W24A 5CR4A 3MMVA 2JSCA 3OSFA 3P83D 1JLAA 1NGCA 2RJCA 4EJUA 1G59A 2A37A 2L4AA 4MHGA 4J9IA 2CDTA 3ZEUA 1ZYQA 4HCCA 5LLQA 2L0KA 4BWMA 1YCYA 4HVVA 1MSEC 3ISPA 3KEYA 5FPNA 3HSCA 1YX3A 2JJ9A 3DKXA 2OA8A 3OA9A 4RTTA 4BRIA 3OYNA 1FIPA 1BU6O 1XHXA 5KYUB 1AKHB 1S22A 3N4QA 4Y0WA 1NH3A 1ITYA 1I07A 1KFZA 2P5KA 4I2OA 5KYXB 2O2OA 3VQPA 5CKBA 4AF1A 2RDPA 2VJJA 2CP6A 3S41A 3IUCA 1DP3A 2AXLA 4MZTA 3NVKA 3IRRA 4CHPA 3F8FA 2EILH 4E1MA 5CHIA 2EFNA 3VUBA 3FMSA 5BN8A 4FU6A 2P0PA 2I7PA 2K5FA 3X2QH 2EKHA 2M7AA 1OH7A 1FW6A 1APLC 5IAYA 1HKQA 3NMZC 1RAGB 4EMHA 2NOZA 1VQ9A 5AONA 1BWFO 4DF4A 1U6GA 3VV0A 5C0MA 1OPCA 1PU7A 4RKUE 1TV6A 4DR6K 3CQZJ 2ISYA 1SL0A 4AWXB 3NTHA 1Z6RA 3RKQA 4OMNA 4WQ5C 1U2VB 1I6XA 3S3MA 2RI5A 2UXNA 4CHZA 4JI0K 2BKDN 2QBYB 1JJ6C 2ESWA 2M1BA 2KIFA 4DJAA 1NGFA 2L9SA 1E6HA 1K9MU 3GNFB 2WONA 1TS9A 3OH6A 3RYRA 1IJWC 5KH6A 2EQKA 3M57A 4C8LA 2P9IB 4RTFD 1W2BS 1NK4A 5CK9A 1LEBA 2LBFA 3A03A 3C12A 4JLIA 3J8AA 2L9VA 2O8BA 3ERED 2HF4A 5AQRA 4QPQA 2H1LA 1VQ6I 2NZTA 4DS5A 2KJBA 2EQIA 3RMSA 3SYTA 4FYWB 1WX6A 3VQ5A 3NHGA 4XONA 1BA0A 3CM5A 1ASUA 4HTLA 2CH0A 2VI6A 1GLCG 4JAXA 4AIAA 1P4WA 4FVMA 1GT0C 3IRXA 4M6VA 1VOMA 3CC4N 1JCGA 2P5GA 4G6TB 3HOYJ 1YW9A 1YJWQ 4YIIA 4PGHA 1X75C 2JWLA 3DLGA 2YKNA 2X3XD 3QYHB 3B6OA 3IL2A 3A2KA 3C1DA 5E8GA 3C6HA 3JTGA 3LPTA 4M7XA 1HKGA 4HCZA 4LDUA 3VEZA 3MXMA 4FSXA 5DM7L 1SFKA 4IIMA 1K4US 3DPLC 4OIPF 5GAOn 4CEEA 3KP2A 3PJRA 2DLLA 3NF9A 1GDTA 2E2NA 4N0AA 3VODA 4M75C 4CJQA 3A8OB 2LF8A 3JCUC 1T6SA 2NS8A 2OJED 1WI7A 4RTXA 3CC2I 1VQ6A 1WGXA 4CZLA 1YITI 3DEEA 1GCPA 4DR4K 3ZSZA 3CJNA 4EZ6A 1U5SA 3WXLA 1WJQA 4J19A 4B6MA 4FLWA 2DN0A 4KRTA 4W5OA 3C95A 2NRWA 1YI2T 2CREA 4MGRA 2ZJ2A 4PJNA 1R0BG 3CJCA 3FMRA 2DERA 3JCMe 1XOVA 1W0HA 1N3CA 1YTUA 2M4KA 3BT9A 1EIFA 1VSHA 1D3BB 2XRIA 1S9GA 3A0HC 3V4GA 4FLUA 5GAEJ 2RO0A 2ED1A 2Y48A 3E01A 3VEOA 1YJ9T 4PA1A 3S2HJ 2ZB9A 1I1JA 1IG8A 4Q0BA 2M1HA 5LFAA 4BHBA 1BI4B 2JS0A 2OV7A 4JOMA 2RM4A 2AKLA 4J01A 1LPLA 2IEKA 2YU9J 3RJPA 1U48A 4L8RB 1R8OB 1Q7YO 3CC2A 4FOIA 2YLCA 3GOIA 1SVOA 1NGAA 1RETA 1T7PA 1Y1WJ 4JI8K 5DMRA 3DWLE 1VQPA 3O6BB 3SQ2A 4BKXA 1Q9YA 1A31A 3THXB 2ZM6K 1T0FA 3UA6A 2K5IA 3RBBB 2AQEA 1U2WA 1UJ0A 4A2BA 3CCJT 3FFKB 2DT6A 5M1FA 4F4KA 2XY5A 3PFSA 4U0VA 2HOAA 2RN7A 1X3NA 2D1VA 4CEOA 1QZZA 3KP5A 2E88A 4H4OA 4K25A 5DCMB 1RT5A 3RZDJ 1JXEA 3A01A 1FEXA 3SI6A 1D9DA 4K43A 3H9JA 3MN2A 2OTJI 4EAHD 1DLOA 2HEOA 3G25A 2CFXA 2OU2A 4DTOA 2KRNA 4H0VB 1MBGA 2HYJA 1YNZA 4B24A 5DUIA 4U7DA 3W3DA 5DV5A 2YX6A 1G2HA 3G6EI 1SF9A 2LTOA 2P6SA 4A0XA 3H6ZA 2EQUA 2AKKA 3JCMX 3E0JB 2K57A 4FLTA 3S6WA 5AQUA 1QNTA 1U49A 3QSUA 1T44A 2CUZA 1B07A 3DXMA 1PD1A 3QFUA 4F2RA 3TO6A 4B9VA 2CJJA 1VQOQ 3O8VA 4OLAA 4YIFA 2V7FA 5GAMg 4QS8A 2DZ9A 2XPWA 4XLEA 2ABKA 3CCUQ 4PCQA 1BI3A 4OMLA 4M7DG 1YTAA 3GP8A 1X6BA 2EV5A 4DB3A 3VQ6A 1N8RO 3ESWB 4M9ZA 4J5YA 2EYZA 2OTJA 4U0WA 5FLMJ 3JCMQ 3D7EO 1ZSZA 4PJOC 4ISFA 5AQVA 2LVSA 2K02A 3REBB 3GTJJ 1MV0B 2VUBA 3EQLF 3KLGA 3H0FA 2H8HA 5BPDA 3H08A 4I76A 1JGSA 1XGSA 2JNGA 4RGUA 3H0IA 4ENKA 4HW0A 1OCOH 1E3PA 4XOTA 1VQNQ 1BA5A 4FWLA 1BHLA 3ZSVA 2DTOA 2F7TA 1YS6A 2EA2A 3F0ZA 3KLEA 3K59A 1CF7B 1ZBFA 4JKGA 2G8IA 1SMTA 2ICWG 1S1XA 1N25A 4BJ6C 2XY7A 3HC7A 1GBQA 2WADA 2RVCA 1GLAG 1IXDA 1POGA 2XC7A 3Q5FA 4AH9A 1ACIA 5GAN4 1HNVA 2OAUA 5E3LA 2WSFE 3QG1A 5KTQA 1VQ5I 1ABQA 1I3AA 2F4VK 3CVTA 4LF6K 4WF9L 4RB1A 2COZA 2HHVA 5GAGJ 1OU9A 1J75A 2ELHA 2HSEB 3OJUA 1KK7A 3HJFA 2VODA 3V9UA 3H8ZA 3E7LA 5GANd 1RNHA 5M3FJ 1ZXOA 4HX8A 3HXMA 2BEOA 5IT9O 3EG3A 5JHUA 3L2QA 4I6MB 5L3CA 5D8LB 4C5GA 4FJXA 3CXCP 3F8NA 3A5OC 4JHDA 2FSNA 2QDLA 3CCMT 5J47A 2JT1A 4LH4A 4K8XA 4I2QA 3V6DA 3G3ZA 4IDHA 4FJGA 2CUEA 2YS9A 3CF5F 3GDQA 1H8KA 5GAOm 1ZBIA 5A2QK 3LH0A 4O0JA 2K9NA 5E3OA 2GTDA 3KJVA 1IZ6A 4WQ4C 1O3SA 3K9JA 2ELKA 4A5BA 3X28B 4XBFA 4MIMA 3KLOA 5J3LA 3GE1A 3EFOA 1GOBA 1VQ5A 2RGVA 3H3ZA 4UB8C 4OMYA 4G8XA 2MOXA 2RQRA 2WFBA 3GTPJ 2LF7A 4ZHRA 4AFUC 1ZHFA 3QZ9B 1ABOA 3N5BB 2V1XA 3D0SA 4IL6C 1KHCA 5HY6A 1WXTA 1UHCA 1PD0A 4CIGA 5FFXA 2G6FX 5AZJB 1RTDA 4HVWA 1VQ9Q 3ZMSA 4HF2A 2DMNA 2CGKA 5BMZA 3WG9A 2NRVA 4PJLA 2VIXA 1P4AA 1Z3YA 4CJTA 2F9WA 2FEZA 3QP5A 3CCQN 4RB3C 4M7AC 1TYQB 4RW9A 2VYTA 3AFHA 1R5GA 1FLIA 3ZQIA 1DJ7B 3NWTA 4PLIA 3M4GA 2KRMA 2E35A 2DAQA 3ZLJA 5KNLA 4PJMA 3ZMZA 4MQVA 3KCCA 1D0ZA 3TSQA 2QEXA 5KCHA 1IN7A 2FPFA 1FP2A 5E3MA 1XPXA 2OZSA 2QGGA 2R7UA 2MH2A 2YG8A 3MP1A 4B9NA 2IW5A 4G12A 2VBXA 1KSWA 1WDXA 3HHHA 2LQKA 2AK5A 4RB2C 4D7MA 2CG4A 4X9DA 3K5LA 4A3BJ 2R93J 3FEOA 2FUG2 5M3MJ 1ZC6A 4CF8A 3AA4A 4FWNA 2XSJC 5I3UA 2W7NA 1Y0NA 3O8MA 2HMPA 1TWFJ 1WJBA 4AUXA 3MZYA 4C5HA 2KIUA 4B1VA 1UELB 3QKJA 1TWHJ 4ZH4F 4A3DJ 2X78A 3CESA 2DXTA 1TQIA 1RAIB 4QS9A 3LGFA 4D0PA 3BG7A 4PZJA 3OR2C 3P1GA 3MKDA 1TL8A 3L42A 2KFZA 1SFUA 2P5LC 2O9LA 2R7TA 5GAHP 3BF3A 1AZEA 3M53A 1LW2A 1HSQA 2WUSA 4LDXA 1HMVA 3E6DA 2PMHA 4ZYAA 4KPYA 4S04A 2D4WA 1AHDP 4LIVA 3HUGA 4KIBA 1GCQC 2EZIA 2NOHA 4OMFB 2NNNA 8AT1B 4XU2A 2PBDA 3ITHA 1DU0A 1ZUKA 3GL1A 2M87A 3KYCB 2LC4A 2P51A 3ZT3A 3MWMA 1HPMA 3F22A 2CSOA 2K9MA 5KHDA 2XDBA 3DQVC 1D8KA 1VQ6Q 4CA0A 3R3LA 3KLNA 3LSKA 2NUPB 5GMKe 4D9JA 1LNWA 1JQQA 1KD1R 1KG1A 1H3HA 2IGIA 2DXIA 1IB8A 1Z05A 3F8CA 1YJWT 2NNWA 4LDYA 3BY6A 5JLXA 2VWBA 2KRSA 3IWFA 4F7UF 4XLNF 4AQYK 1K4TA 3QJ6A 1S9HA 3TI0A 3VRZA 1E0EA 2SEMA 3DRPA 3BCAA 4EMKA 3U1KA 1IBLK 3OTOK 2V1DA 4ZN1A 2VG6A 3HRUA 2KKOA 2X4HA 2Q0UA 1UFFA 3SPYA 3LDOA 1SFEA 2IVPA 1KQJA 1WBDA 1IKXA 3IV5A 2O8XA 3BPVA 3V42A 4A93J 4QS7A 2PVOB 4EW4A 2XDPA 1FOYA 2GUPA 2ITGA 3WT0A 5ELZA 5L3DA 3SWNC 5LRRA 2J05A 1P59A 1F5TA 3MO8A 4BRCA 4A2AA 2HQRA 3OYLA 3QJYA 3CC2Q 1BI1A 1K8AC 1R9TJ 2E1OA 3QDFA 1D8JA 3DPTA 4OP0A 3DU6A 2DL3A 1SD5A 4MDBA 1IXSB 1UAAA 1VQPQ 1FYKA 2EH3A 2XKOA 2HNYA 3J7AP 1P9QC 2MGQA 4PFOA 3CUQB 4OJRA 3ULEA 2EFOA 2LFBA 4B1XB 2OUMA 1YXQA 1GLDG 3U4LA 2JPCA 2RQWA 3H1CA 1TXQA 2A41A 5BREA 4KB1A 1HJDA 1YG2A 2ZKZA 1ZUUA 1KC8O 3META 4NOYA 4GLKA 1YLFA 2M0CA 5DUKA 2FBTA 3N4MA 2YUQA 1TZLA 2ZXHA 4CDGA 2FU4A 2HNZA 3SMSA 1OMIA 3WVEB 5ICFA 1WJFA 1OJLA 2DF6A 1ERDA 2LY2A 1YTYA 2GV9A 3SBGA 2YHTA 3V4IA 2AXTC 4HV6A 3OL3A 2CH6A 1HF0A 3TGNA 4UNOA 2RD1A 4BQNA 3CI5A 4JK9A 3R6NA 2DA6A 3I4PA 2KI7A 4YNQA 3PL8A 1JKPC 3TOAA 4B9UA 4FM1A 2DEQA 3BZCA 3F70A 2LZ6B 3CPWM 2PJRA 4H0TB 4R5PA 2X1DA 1QCFA 3SJJA 2LR8A 1M9SA 3OW2A 4EM2A 4CGZA 3RR6A 3MPUB 3CLQA 1GOAA 2BIVA 5A0LA 2EJGA 3OIQA 1VZ0A 3L4QA 1LDKB 2AZVA 3P8BB 4FZXC 1SL2A 4C9YA 3DXJF 4CSWA 1UFMA 1N6QA 5HS7A 3M6GA 4PWDA 3CC4I 3PVQA 1IW7F 3L9FA 1TGOA 4A61A 2OTJQ 1PRLC 1MGTA 4JX6A 3S1MJ 1BO5O 1W4MA 3E3VA 3OYJA 1WJSA 4OGEA 2MCNA 2BY3A 3EH2A 3CMMA 2ID3A 1WQ2A 2EK5A 5CVRA 1YX5A 4DSLA 5SZTA 4FWRA 3X26B 1Q7YU 4GDFA 3G6EQ 2HQAA 5ADXA 4NBQA 1JRIA 1MV3A 1H8AC 1CXUA 4YFNF 3WNHA 1H92A 1VFCA 1FC3A 2JUFA 2E5LK 1O3TA 5D6YA 5KQDA 4BE2A 1VQOT 3GFLA 2YNFA 1DDNA 1QZ6A 1EETA 1OX9A 1UHSA 1W6XA 2VQCA 3PFIA 3MXIA 4C8QG 3CCUT 3M8RA 1TLHB 4FOEA 2C0TA 3VKIA 3HRTA 4DR1K 3X24B 5BQTA 3UKRA 2JPSA 1ZN2A 1M27C 1EH7A 1K73R 3VW4A 1UUEA 3L00A 1MUZA 2JMCA 4H0EA 2ZWHA 2IXSA 3HSRA 4PKGA 2DFFA 1M3BA 4DQSA 4IFYA 3CCLN 2X6YA 4KULA 3S1NJ 2F96A 1XX5A 4FJ9A 2Y1JA 4DSKA 2E36A 3SDBA 3A5NC 3JSCA 1M90C 3RIRA 4DYRA 1YI2N 1ETWA 3NAEA 1VRLA 2QF7A 1QVFS 4C8NA 2PMZN 4PJ0C 1DU6A 3BR5A 1GLJO 3LYIA 2E3IA 1VQNT 3R6SA 4JYKA 2ZJRF 1ETOA 3EHQA 3V9ZA 3LSGA 4CJLA 3QIPA 2A6TA 4J6XA 2ZGWA 3ID6A 2KE9A 1JKQC 5KK1A 4Y33A 5LJ3d 1LAVA 3ZT0A 1ZLJA 2YPRA 3S1QJ 4FL9A 1RRJA 5HL7L 1Z91A 1NMDA 1USSA 4BGBA 3NHNA 3CD6I 1PKSA 2ZPGB 4GYGA 1VQ5Q 4J9DA 1DKGD 4XN3A 4X64K 1RILA 5DLOA 5GAMj 1IUFA 2JRMA 2V75A 1FYMA 3JRBA 1T6CA 2RHUA 1ZX6A 2DMUA 3VS1A 1XC5A 3ATUA 1FSEA 1QSYA 4BY7J 3H41A 1ZGJA 3ENBA 2DU9A 1Q86R 3CJ9A 1WI3A 4DOVA 5H1SQ 2JZYA 4A4FA 1RAAB 1KYWA 1PP7U 1K8KB 3VYHB 2QWMA 1NGBA 1HUXA 3GBTA 4BB7A 1OKRA 3SZGA 1ZREA 3CFRA 1KQ0A 1VSDA 2G7HA 5E1XA 2K3PA 4DQIA 1TKXA 3VDXA 1S6QA 1WOQA 1T3VA 5F04A 4PIIA 3RNJA 1IKWA 1WAJA 2RHXA 2DQLA 3IH4A 2MPXC 3W6VA 1RZ4A 2K9GA 2XHKA 5D5XB 3VQAA 2QEXQ 5EGOA 3QPHA 2V51B 3H3NO 2NLUA 4L59A 3CD6A 1RL2A 3DLMA 3M4YA 3J7YJ 3R61A 5AT1B 2DILA 2VLAA 3O3FA 5J40A 1KXPA 1F4KA 4YHHK 4KHWA 1ATNA 4CC2A 5AQSA 4OFAA 3SD4A 3KK2A 1U5TA 5TRDA 5BPIA 1V1CA 2M02A 4AHCA 1MHNA 1KRPA 2EHGA 1TW2A 5CVIA 5C4JJ 1B1BA 4BXFA 3C6UA 2X48A 3CJTB 3QAHA 2O8EB 3P5JA 2HNIA 3CQTA 2CWEA 3GZ6A 4QLCU 2Z33A 1XGMA 2FD5A 4KIGA 2ME6A 1ZG3A 4EM1A 2Q2RA 3C6AA 3TAMA 3K2AA 3M0TA 3ZFJA 3K5NA 5GAN5 2C6YA 5IN1A 1SRLA 1J0RA 4IFEA 2X6OA 3QOPA 3QRFF 4DU3A 3BOQA 4UY8O 3WE3A 2F4OB 4QQ6A 2M30A 1OOTA 4MMLA 4OB0B 2M8EA 3B8AX 2L3PA 2WAQA 4BRNA 4ME7A 4RTZA 1IV6A 3P8DA 2HHQA 4I0AA 4EJOA 1VRTA 3PO3J 2H94A 4HQEA 1FMWA 3UKUA 1S6LA 5AQKA 4M75F 3I8BA 2ESNA 4B43A 1B9MA 1BJZA 2RKHA 3TBIA 3O5ZA 1M2OA 2ITMA 3FM3A 4HNTA 1U47A 4PKCC 1USTA 3AVKA 1Y8RB 3JAMZ 3CERA 2GXAA 4C92A 3DB4A 3ZSWA 3PIPL 5EXWA 4HLXA 3VS7A 1K0SA 3ROUA 2HD0A 1NGJA 3I53A 3R4KA 3AO3A 1VSJA 4ZGDB 1MJ9A 4KT0E 3JS6A 3LWLA 1PU6A 2E1ZA 3UWNA 3M0RA 1T03A 4AIJA 4BVOA 4A5AA 1JE8A 2X6WA 4ZNXA 4WFBL 2P0WA 1YVUA 3K1PA 2GF7A 3WTTC 4P96A 3NBPA 3TARA 3ZX2A 5KVRA 3VF6A 3RMAA 2BDPA 1EKEA 3LDSA 1BU1A 3DU5A 2DFEA 2YSRA 5HOOA 1QBJA 2CV2A 4PY5A 1SSHA 2DRMA 2WC2A 2PYJA 4C8QB 2VKDA 1AKHA 1BGXT 5LHGA 1VQ6T 4EIAA 4O8KA 5BR8K 2DK8A 1Z9CA 2QKLB 3N5NX 2QWWA 3CJRB 1VQ8N 4B8CA 2W41A 2NRHA 4CJSA 3GXOA 4JK8A 2DYBA 4O3MA 4WXDA 5GAMh 2G8KA 1WBBA 3RSEB 4XSXF 1I6HJ 5LD2C 4C5EA 1NTCA 4BU2A 4XLAA 3ZQFA 2DPUA 4RTWA 4CGIA 3MZHA 5AQXA 3WEEB 2ZFUA 5CQEA 3H45C 3DLBA 4EA5A 1X58A 3K69A 1NWKA 2FZGB 4HUFA 4C8KA 2VWFA 1U9OA 5ECAA 4RMNA 4M7DC 1Y1VJ 4XRSG 3KYLA 5I2MA 3J81K 2HVHA 4M77E 1IG9A 4H4MA 1ZBXA 4L18B 2G0EA 1DUXC 1J53A 4CIEA 4II3A 3P39A 4CE9A 1BOTO 3RRGA 1K76A 3L2WA 3SHWA 2GXGA 2ZCWA 2CUBA 3J81E 3M8PA 4B47A 2Y9YA 2QBYA 3CC2T 1YITT 3CCQI 1RLPC 2VT2A 3TPQA 3I56I 3HRMA 2CZ7B 2F2XA 4ISGA 5ED4A 5KE3A 3U1DA 3H5AA 3QEXA 4P55A 2LKXA 5FRNA 3TDUC 4M77B 1UB9A 3HZ6A 1KQ1A 2RA2A 5AQHA 4JKCA 4G7ZF 5FPMA 4BC2A 2W42A 4FM0A 1MKMA 3IKMA 4DR5K 4M71A 4ZDLA 4CCHA 1PSFA 2P5VA 2DT5A 4GMJB 3VB2A 4IOCL 2QYOA 2CH4W 2E5NA 5DPKA 2OZMA 4BI3A 1IN8A 3QDKA 1MH3A 2K27A 3M5RA 2FEIA 3TMOA 4DV4K 4BY6B 3NAUA 2RJDA 4JN4A 4N4OB 1E6GA 1QGPA 1NGEA 2E60A 1OULA 3VYTB 4BQQA 3GVAA 2FO0A 4KV8A 2ETHA 3EGDB 1MDUB 4BH9A 5AFUA 3CDLA 3NDKA 4C92D 3IH3A 3NH0A 3CCQA 1ETYA 3QP6A 4BEHB 3ZL7C 1DPUA 4GVEA 3I56A 4N4GA 3REAB 5HP1A 4PJOF 3TDZC 4B9XA 3CMYA 5I22A 3R6MA 1SAZA 1KG3A 2PTKA 4BQOA 4BDZA 1FPQA 4RLQA 3ZMUA 3QYBA 2RC4A 2CV0A 2K2MA 4OPHA 4QIWN 3VRYA 1TKDA 1MIJA 2HVIA 5DD4A 3MN7A 3PUBA 1X3ZB 2K7AA 4EW0A 4RAZA 3OSSC 3CEYA 4YEJA 4KH1B 5HK0A 2V4JC 4EPCA 5DM7R 2V9PA 3LWMA 1T39A 1K1ZA 3AAFA 4BHCA 2O0YA 1IG7A 1VI0A 3BR0A 5JLHA 2NYXA 2WV1A 5HRRA 1RGIA 3DXKB 2LKPA 2JRTA 2E7WA 3PIPF 3OS0A 2GBQA 4JI1K 4L9TA 2VOOA 2WY7Q 2OTJT 4LB5A 1Z9QA 3H3VK 5D8KB 1WLPB 1VQMA 1KC8U 1RTJA 5ADXH 2E2QA 3BJOA 1DP7P 1YJWN 1ITGA 1HQUA 1D3BA 2DL5A 2HOEA 2FPDA 1OCZH 2OA4A 1F43A 3G6ET 3FHZA 4IUUA 4KFCA 4G6QA 3VQCA 2NRXA 2ZGZA 3SJMA 4CZMA 2BTTA 4IOAF 3MN6A 1BI4A 4KMUX 2JMAA 1IXRC 3O80A 2EIJH 1KA8A 3H1QA 3PO4A 3U23A 3NRVA 4NQWB 4LLLA 1BR1A 1LWFA 1NK5A 2QWNA 3NVMA 2BHYA 2X6SA 4NS5A 2A1RA 4N4HA 1K73U 3JRFA 4EMGA 2E4HA 2UXBK 1JL1A 2D9TA 1ZRFA 4NHJA 1LKXA 1A6IA 2E6LA 3EUHC 1HQEA 2HBPA 1U45A 2O8BB 4OIQF 1UA0A 2GLOA 2DDAA 3WGIA 3TR8A 4M78C 5IWAK 4MTEA 4DK9A 4DHYA 4D5FA 1J7KA 1VSEA 4IJNA 3GTKJ 2Y69H 3CCRA 3DP7A 4WCEL 1YE9A 2NVYJ 2QK0A 1B4AA 1L0OC 3RMDA 3WU1B 3DWLA 3DKMA 2CP3A 3THYB 1PUFB 2FBHA 5DCMA 4LGWA 3HYIA 4RCBA 1LWYA 1EP4A 2F5FA 1JL2A 1UCRA 2M0OA 1F36A 4LG3A 2L54A 2YNHA 5K1YA 3JR9A 2Z1GA 1VIFA 1FBUA 2PQWA 4P5NA 4HTUA 1LW0A 3CPWP 1WFWA 4J9EA 1BDGA 1BIAA 3HTUA 3H0HA 4M7AF 4DV2K 4LF7K 4O0IA 2HDCA 1P8ZA 3G0ZA 5FLXK 2YNGA 3VF2A 2JUGA 4A4HA 1VQ5T 1SHFA 4PQUA 3CD6Q 4JI3K 3SJHA 1OH5A 4P5OA 2YT6A 5HDKA 4XU3A 3I64A 1EJ9A 5KN9A 1Q86U 2O4XB 2Y0MA 3OYGA 1IBKK 2VXDA 2GUIA 3JCMb 2HEQA 4A3LJ 3GG4A 3VSKA 4A12A 2IJLA 1NJXA 3TW7A 4J9GA 1NPPA 3ZPLA 4FM2A 1FTTA 2OI3A 3J80Z 3CJ7A 2V1QA 3JAME 5GAN2 1WQ7A 4MDWA 3HKZA 3NE6A 2NRZA 4K41A 2H8RA 3ENHA 1GLBG 1M5Q1 4Z4IA 5C25A 2WC9A 4CC3A 1YHQI 2NOGA 1YJNT 4RUGA 2HFHA 2QTDA 4BDYA 1I94K 3QBYA 5HKCA 1U3EM 2PQ8A 2GIVA 4UV9A 3SUNA 1K7AA 1W5CC 1VQ4I 1JUPA 3T5XA 3PSIA 1RBSA 2OFIA 2ETJA 4E9HA 2GOXB 4B9QA 5EDNA 3AT1B 4ELZC 2Y0SN 5GAEP 3FXOA 1IGNA 1MMAA 1E7OA 3BWGA 1MDMB 5HLTA 5I2SA 1CF7A 2YDLA 1IRXA 2BANA 2Q2EB 2CW7A 1WXBA 3A8HB 4G1QA 3K1MA 1GV5A 1TUUA 2KRFA 4L3QA 1VQON 2YI1A 2RK2A 3G71A 2ZD1A 1P2FA 1S72N 4Y3OA 5KRSA 2DK5A 3K4MA 5HODA 1O3QA 2VQFK 3MKYB 1FYLA 3ZT1A 3EYZA 3I8DA 2DFIA 3LAKA 3CCUN 4B9LA 2G8HA 4JD2B 5E84A 4B21A 1H89C 2QW9A 1AWXA 4DTRA 1B92A 4CCKA 5ICGA 3TP0A 4PUSA 1JKRC 2KT8A 3CCLI 3SYZA 1I39A 2XGEA 3ASNH 3EO3A 3MCAB 2RQQA 4O5VA 1YHQA 3LA7A 4XQ3A 4KH4A 2CV1A 3ZR8X 3CWSA 3K9TA 3A01B 4I6MA 3LA3A 5EZGA 1VQ4A 2QQ9A 1BCMA 3HPHA 1SKWA 4KFBA 3CF2A 1VSFA 1FBSA 3K6GA 4HHTA 1HJRA 3Q9VA 2B8AA 4EJZA 1W97L 3BZKA 2DD4A 1RT3A 2DKGA 2X4WA 3NGYA 1VQNN 3HOUJ 2ZCFB 1Q82O 4CHQA 2OCCH 2D6FA 1VQKI 4IUVA 1QZYA 3VS6A 5DY9A 1VQ7I 2QTVA 1A5XA 4GV6A 4Q4ZF 1WKMA 1CZAN 1QHAA 2E2JJ 4E4HA 2M5WA 3T69A 2XAGA 1ENHA 4DR7K 4B3RK 5HLHA 1AZGB 3O1BA 1ORPA 2KNBB 5D4RA 2FBXA 4U7BA 2NRRA 4HDVA 1F21A 4AI5A 3E2UA 5AZJA 4DYQA 2E34A 3JCMh 2KXCA 4WX9A 3PIOL 1ON1A 1HK9A 1WUAA 3L2CA 4B8XA 3M58A 4KTWA 1YT3A 1MZBA 1ONVA 2LK2A 1ZSZB 4U67L 3P4IA 3MXJA 2E8AA 3OBYA 1IRGA 2LC2A 1TTHB 1U9NA 5CKTA 4E9FA 5IXFA 1GXQA 2GA2A 1TYQA 4J2EA 1AWWA 2XMFA 2PFBA 3UF4A 4JK7A 2RAEA 4FJNA 1KAYA 1H9GA 1VQKA 2Z1JA 4EVIA 4HLYA 1JCEA 2Z0WA 5JVTA 5C0YA 3B6AA 1VQ7A 4FLYA 2ED0A 2K9LA 4FZZA 1QHGA 4EM0B 1ZHIA 5CHZA 2DYSH 1WWXA 2V7ZA 5CZ1A 1YFNA 5J1YA 4NLCA 4NNJA 3E5XA 4I98B 1I5ZA 1MGQA 4UUSB 2MD0A 2C0OA 4DEYA 4F8RA 5EEGA 2EB7A 2IVNA 3AA3A 1M90O 1QQMA 4C8QC 2D0PA 1HNZK 3V7CA 5I9EB 1GVDA 2QXFA 1B9NA 2KL4A 3NGPA 3AL0B 1ZA2B 4XRMA 3ZSRA 3COAC 3EHRA 4FETA 2MMPA 2JA5J 3C7JA 4XLFA 2QKBA 4Q5WA 1VQ9N 4XEIA 1KVBA 1YQKA 2NOFA 2L02A 3R9PA 1YRNB 4CI6A 3BG5A 1SC7A 3CCQQ 2LD5A 4JHDB 2EAYA 5K7HA 4OKJA 3I56Q 3TU4K 4E6KG 4PJJA 1S7AA 5GAGP 2VV5A 2YX4A 2TCTA 2F5VA 3DF8A 3KZIC 3ID8A 5LJ3e 1SRMA 2BYVE 4AIDA 1KLNA 2DA2A 1NU0A 3CO7C 2OFKA 1PHTA 1D1CA 2GAUA 3OW2S 2F4IA 3SCXA 1NM7A 3ZQHA 3CCYA 3UPUA 3SV3A 4CI0C 4F3OA 1I8FA 1RKTA 3GWZA 1Q95G 4FLZA 2R58A 3EFOB 2BUPA 2NUPA 2CFOA 3DB3A 2OPSA 2OPRA 1YFHA 5AQGA 2D45A 2IBDA 1D0YA 1EZZB 1ZBSA 3HRSA 3H3UA 1HA8A 3OB9A 2JXBA 4ORZA 2DD5A 2D1XA 2ZMEB 1SL1A 2Q1NA 4JP0A 4IZ9A 5JR3A 2CQNA 1Q9XA 1R5ID 3ZQGA 4B1UB 2BY1A 3F8MA 1XNQK 3K4KA 4ZZDA 3HGYA 2TRTA 1JCFA 2KZMA 4M3DA 1QQNA 2LVMA 1VQMQ 2KZZA 4IRIA 1J3TA 2LY1A 2W85A 4FJ8A 1PDNC 4CC7A 1MNEA 2FL7A 3G2BA 1QP3A 3QWYA 5I21A 2ZSIB 3M1FA 1Z26A 3KKRA 4IZZA 4RTUA 3ULQB 4TSXA 3ZSYA 2J5PA 4BY6C 4ESBA 2ROTA 4A4KA 1V5GA 3MKZA 4CHNA 1Z21A 4CZCA 1B3QA 3P31A 4HWIA 4PUOA 1IREB 2WACA 1MBFA 3JCMP 2FQ3A 3PQKA 2MAMA 2HNHA 4XU0A 3NF8A 2GZWA 4AHVA 1FJLA 3U21A 4DWIA 1UA1A 3UDCA 2OBPA 2V9VA 3OOUA 3R2XC 4OF1A 3OVNA 5GAOl 1YOVB 4R79A 1VQ6N 4VUBA 2HPMA 2ZXWH 4E7JA 1VQ8I 1NGDA 3CUQA 3CC4T 4DSEA 3AGKA 4DQ2A 1R0CB 2KVQG 1VAZA 1VQLA 3QYFA 1R58A 5GMKj 2XVCA 1AD5A 6AT1B 1HYZA 3C0CA 2COMA 3CCRQ 3OYAA 2LJ3A 3T8TA 4AG1C 1Q81R 5A2QO 2EZHA 3M1EA 3P9CA 4R0KA 2FNAA 1L3LA 2EQMA 1BL3A 4LDVA 3DLLL 2ZE2A 5IPAA 1TU0B 1IKVA 3ZMDA 4WXCA 3J80E 2JHNA 3FSPA 3MVPA 4LE9A 4CCMA 3E9LA 2CUJA 4DV0K 3CMEI 3Q7CA 5E8IA 1JB0E 1G5VA 4M3ZA 4D6WA 3QWLA 1K9MO 4J8OA 3CC2N 3K7AJ 2GGRA 3ECOA 4JZ4A 4BR4A 2JA8J 3BEXA 3AO4A 2CKKA 3TVTA 3JXUA 2QQBA 5AQFA 2LT1A 1VQPN 1QWFA 4PL6A 2MWOA 1OV3A 4B9SA 2RF2A 3GBGA 5J4VA 4CF2A 5LEKA 3MDQA 1T38A 4JJDA 2UXXA 4NLBA 4L0ZB 4E47A 4H03B 3TO7A 3DTEA 1OX8A 3IUOA 1OKJA 2KKZA 3PIPA 4RW7A 4EMKB 5T7BA 4AHRA 1NG6A 2V26A 1A35A 4M7YA 4CZKA 1HYOA 4BR2A 5LGTA 2BH1A 3EL2A 9ANTA 2OQGA 1LPQA 3M55A 4YFXF 5GINA 3QPSA 5IHKA 2HKNA 2DM1A 2GBZA 3CMEA 2E1MB 4UVAA 3IG1A 2ISZA 4YPHA 1Z77A 1FZPB 3CD6T 5FU6C 1C1AA 1HLUA 4BVPA 2YR2A 3HSFA 1P7JA 2NWMA 4I6ZA 4UVBA 2DA7A 2FG0A 5DLQE 1C6VA 1NLPC 2STWA 3DJCA 4BL0B 3HOWJ 2W4SA 3VEPA 4I9LA 1AU7A 1G83A 4XOPA 4U87A 3VS0A 2W25A 1BC7C 3WNEA 1QQCA 3OGDA 4NCBA 1OQKA 3AG4H 2N8GA 2QTXA 1WSHA 2QG9B 4CO8A 4N0AC 3G71Q 1X19A 2JVVA 5IXBA 5FDLA 4AM7A 2Y4XA 4CF1A 1NNEA 1W1FA 4BRGA 5FU7C 3QNNA 1FNNA 4BBRJ 3LDQA 5IT9Z 1C0TA 2CT4A 2VVKA 1XB4A 3EPZA 3X20B 4Y52J 3JW4A 2W48A 2HTSA 4KISA 4A63B 4RW4A 4DFJA 1V54H 2OTJN 1YHQQ 4E7KA 3PFYA 4IVNA 3RPUD 2NVQJ 4U0YA 1VQ4Q 2K3BA 3IAM2 5JVGL 2VE8A 3V1OA 4CFDA 4B3AA 3PGGA 2IVOA 4JRIA 4EP5A 5LHHA 1U4BA 4C3JJ 5KYWB 4M63C 3MK6A 2XAQA 2F4MB 3AAPA 3ZT4A 4F9OA 3LZJA 1AWJA 4KUIA 2FMYA 1GBRA 2PJRB 4P9FA 1H9TA 3GZ5A 2O31A 5D5UB 4DV5K 5GMKh 1XDSA 3LWIA 2Q1ZB 1ASVA 4CZHA 1X9JA 2BW3B 3JREA 3GTQJ 4CHYA 3VTHA 2K4JA 4L5IA 2AZSA 1K4SA 5GADP 3FJ5A 1S3JA 3QINA 2O4IA 1O7FA 4HSTA 4ZGJB 4NUBA 4FLXA 4BG8A 2DQRA 2R5MA 1K8AU 4HBLA 1VRUA 1DTTA 1YQAA 3K4BA 3KTUA 1K8KA 5KAIC 2XF5A 4M7DF 2A28A 4A3CJ 4MFEA 4IXCA 2RJEA 2QCOA 3DLLF 2CRGA 4S0HB 4BXXJ 4BREA 2JW4A 3JCMW 3L09A 3GFIA 1T2KA 4IEJA 4HT8A 3LP2A 2BZYA 2O8FB 1XMKA 4ANJA 4ZTJA 4IWVA 2FYKA 4DR2K 1VQKQ 1VQ7Q 3TAFA 2I5JA 1WRJA 3U9ZA 3PY8A 4CGHA 4X1EA 1O75A 4BS9A 5JVHL 1N9SA 2V79A 4OLBA 5GTHC 3UKRB 3A4CA 1VQ5N 4XIDA 3H0GJ 4D8KA 4C1NK 5D6FA 1KD1C 3HIFA 2Q8KA 3JRZA 3KLIA 4Z02A 1MH4A 2DJZA 3FZHA 5B1BH 4FJIA 2HZYA 4FWKA 3CUOA 4RBOA 4KUMA 2J6FA 1NE8A 3CCSA 3HDDA 4MDAA 2IVWA 4CJEA 2M8GX 2BY2A 3LSPA 3M8EA 4RAFA 3KZYA 3K4NA 3FXRA 5CZ2A 3KP4A 2IPQX 4PNOA 3QO9A 3FISA 1I27A 1JKOC 4RLFA 4QTRA 3NEUA 4M3RA 2QWQA 2QEXN 1Y57A 1OCCH 4OKKA 3CXCM 4DG1A 1UG1A 1ZSZC 3HG9A 2XAHA 3AVCA 4BRAA 2CU7A 2K40A 1D0XA 2VKHA 2AIRB 1WHJA 5C3EJ 1RDCA 1A04A 3CC7I 1S72I 2Y9ZA 2RNGA 4EGZA 4A4GA 5DK5A 4XSZF 1NK9A 1WHKA 3M59A 3CCQT 2EJRA 4FTHA 3BP8A 2XG8D 1ZBUA 4LUEA 3CFPA 4OU0A 1I0CA 3I56T 1R1UA 3B73A 2IAIA 4AHTA 4DFMA 1FKOA 2IS1A 2CSQA 1EFNA 1VNDA 3MX5A 3GTMJ 1UB4A 4KIFA 3S3OA 1NG9A 2MABA 2QENA 2P7VB 1SZ2A 1WSUA 2KT1A 2LY9A 3A8YA 4F7UG 3I0WA 1EQYA 2NUBA 1IO2A 5JVGF 2I2LA 2X1CA 1VYUA 2L7KA 2DTRA 1E3MA 5HS9A 4AHSA 2KXDA 3BDLA 4B1WB 2VBYA 3FE1A 5E1WA 2KEAA 4BQLA 2MLKA 4ZN3A 4LH5A 4RTYA 2D1HA 1G3TA 4X9CA 2NUZA 1SVLA 1M2VB 4RCCA 3NCIA 2B9SA 1XSXA 3HPWA 1QVGM 1M90U 2KFNA 3HOTA 3UNGC 3CC7A 4P9UA 3UR3C 1S72A 3I5RA 4KHYA 4CJFA 4H8KA 3MAQA 1C0FA 4GVMA 5KQ8A 4GW6A 2OPTA 4YDUA 3E5UA 3L7WA 3LQQA 3KHYA 3DFGA 4JYAK 3AV9A 3QETA 1ZRCA 4M78F 1VQLQ 2M0YA 3AG3H 3WEEA 1T98A 3JSPA 1BOBA 2HHSA 2BE5F 1QVPA 5E41A 4BHPA 4ILGB 2YU3A 3VGKA 4N4NB 4AFQC 2MA3A 2KLAA 2XPVA 2XI9A 2RQPA 2A7YA 4MLHA 4MDXA 4UC4A 3DBHB 2WV0A 3D6RA 1PUEE 5F1JA 3LSMA 4MQ3A 3OYCA 1XQOA 3RRHA 2X6NA 2QXLA 1Z7UA 1KG4A 1ZH5A 3G0QA 3O9UA 1QWEA 1FY7A 4J8FA 3A8LB 2V1RA 1I5LA 3W2VA 1JLCA 2O01E 4M41A 1YO5C 4M77A 4KB0A 3OV8A 1RDDA 4A3JJ 3TSUA 2JJ7A 4XICA 1FOKA 2H3GX 3S8PA 2O03A 1VQ8Q 3KYDB 2Y2ZA 1Z1DA 1TWCJ 2ZXJA 2R3SA 2KR3A 5FWCA 2DJIA 4QPOA 1MA9B 2VPLA 4K0KK 1OCRH 2KDZA 4XKCA 1ZARA 3THWB 2HQEA 1L3VA 5D7UA 4ZYEA 2KHOA 1K73C 1NGNA 1K78B 2HDWA 1O4XA 1C0UA 5IOZA 3KK1A 2Z1HA 3U2RA 2P9PB 3QEVA 3CMAN 3WXKA 3EGDA 2WBNA 1LFUP 2HMIA 1BQMA 1C6VX 4FASD 3H35A 1VQ9I 5M1PA 1ETQA 1UGSB 4BEHA 4CYCB 3LCNA 2O88A 3CFOA 3IDHA 1HSTA 4B9TA 1YP5A 3MEUA 2E20A 4YOVA 3JCMf 5IT9E 4A4EA 1FXXA 3ZN0A 1VHXA 3WXJA 1XGOA 3CMEQ 2L2PA 4DV7K 1TAQA 1PC0A 3LWFA 3W3CA 4FWSA 2K9QA 3BY5A 1WNSA 3IMXA 5TISC 3EFSA 3Q7BA 2IAJA 2G3RA 4MQ9F 1VSLA 1ETKA 3M5AA 3SXYA 2COWA 2Q31A 3GO5A 4IOXA 2HXOA 4A5NA 2YHBA 1N27A 4C8QD 3PMIA 5KRTA 3FGUA 1JI8A 1HCRA 5LJ5j 3VF4A 4V19S 1TKZA 4HA8A 2A6AA 3NF7A 3DXKA 4RG8A 3BTCA 3A98A 3KEQA 2FBKA 5J4YA 1OH8A 1BBYA 2VC8A 1LVAA 1ATRA 1C0MA 4E1NA 2M16A 4FM4B 5FKOA 4Z88A 4YFUA 4DQRA 3MEAA 1NK3P 2AO9A 1ULYA 3OS1A 5GANj 2HAXA 3VENA 4EHUA 3IS9A 1Q86C 3PIOA 3SFIA 3PX0A 1U1SA 3GW2A 5C42A 1OH6A 3LOCA 3LP1A 2GFUA 3OMYA 4I99C 2R7OA 3VWBA 2LDUA 2ZNYA 4CZZA 4NQWA 3ALYA 3EE8A 4HF0A 3QUIA 2MI6A 3IQLA 4EATA 4ICLA 1WB9A 3C7NA 1FOXA 3FIFA 3OHRA 1WSGA 1JJ2M 3DPUA 1I4K1 1KQSM 3E9OA 2FBYA 1YN8A