4E7KA

Pfv integrase target capture complex (tcc-mn), freeze-trapped prior to strand transfer, at 3.0 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
366
structure length
366
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 96
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7kA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7kA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7kA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7kA03
4IUQA 1EETA 3IRXA 3NDKA 2F96A 2X4WA 4OKJA 1RT6A 3S9HA 5KRTA 4HCZA 3M8QA 3OYNA 2ITGA 3RR8A 5HRNA 3LANA 3T1AA 4CEZA 2RHIA 1NK7A 2G8HA 1D9FA 5C0MA 1XC9A 4ELTA 4KHUA 4Y1CA 1BGXT 1HMVA 3HPOA 5DMRA 2RPIA 1VSKA 1EKEA 3L2WA 2KW4A 4OVLA 4KHQA 1WN7A 4HCBA 1RT1A 4CFAA 3NF8A 4CGHA 4Y1DA 4DU3A 3K59A 3SYZA 3C6TA 4Z4GA 3OS0A 1VSFA 4I7FA 4CESA 4CHNA 3LZIA 3L2VA 3ULDA 3V81A 4CERA 5KH6A 3ME9A 3AVHA 5M9OA 5CZ2A 2E5QA 2IC3A 2D0CA 3OMGA 4DTUA 1QQCA 5HRSA 3HXMA 3SQ2A 3H08A 1I3AA 3L2UA 3LGLA 4H4MA 1CZBA 3AA4A 1EXQA 4BACA 4IFYA 4HHTA 1EX4A 1HRHA 1TKXA 2A1SA 2P0KA 2WACA 3C95A 3CM6A 4DFMA 1N5YA 4KRFA 1RNHA 3PV8A 2EKOA 5KI6A 4K8ZA 4FLXA 3SNNA 3DLRA 4FJ7A 2YKNA 3VQ4A 1QHTA 4ICLA 3OYCA 3NH1A 4J2EA 3QEPA 4N47A 3QEWA 4AHRA 3K5MA 4II1A 4GW6A 3E9GA 5KTQA 4ZHRA 3V9XA 4DTMA 1T05A 3AVBA 2YNGA 1DTQA 1HQEA 1QE1A 3OJSA 2XY7A 4NZGA 2EQUA 3OYKA 4BE2A 2HQEA 1BISA 2IDOA 4KO0A 3TABA 3DOLA 3SUNA 2QKKA 1RT5A 3OA6A 4FYDA 1XWLA 3MEGA 3OYBA 3NNQA 3QIIA 5D6XA 3OVNA 1VSDA 3SPZA 1F21A 3D0PA 1WAJA 3WNEA 5J2PA 4OVAA 4OGCA 1Z26A 3DRPA 4B08A 1REVA 1TV6A 2D0BA 4C8MA 4N4IA 3T3FA 3JSMA 4DTNA 1TK8A 1ASUA 1O1WA 3DLBA 1XNIA 4CJEA 1LWEA 2YHAA 3LPTA 3SZ2A 3K5LA 3PO4A 4DQPA 4KKOA 5J39A 1B9FA 3ZSXA 4FLUA 2OYQA 4JRPA 4RW6A 4DQSA 3SJJA 3KD5E 4RG2A 3U3GA 2D5RA 4CF9A 3AO1A 4DMNA 4O55A 1N27A 3P5JA 4N5SA 4KTQA 4Q5VA 1WNSA 2Z1IA 3K58A 3TAQA 2GF7A 2X6SA 4DLEA 3MO8A 2HNYA 3RWUA 4LY7A 4QVZA 1L3SA 3KLEA 1WSFA 1G15A 1X9SA 1VRUA 3QNOA 3PX0A 3TARA 4M3WA 4ELUA 1G5VA 3OYGA 4FK4A 3KLHA 4NCAA 2E6MA 2RJFA 3P8DA 2M1HA 2IAJA 1SL0A 3EZ5A 4CJKA 4NCBA 1HJRA 1C0UA 3AVKA 4E7JA 3OYLA 3MP6A 4QQ6A 4WE1A 3WNFA 3VQAA 4CHYA 1NJYA 3RTVA 2G8KA 2OZMA 5SZTA 4FK0A 2I5JA 3CYMA 5HRRA 5CYQA 4DFPA 4KB0A 2HW3A 3NAEA 1S6PA 3LGFA 3VQ8A 2FC0A 1DLOA 2NLUA 1HNIA 1LW0A 2G8WA 1QSLA 2DY4A 3AA3A 3UIQA 2X4XA 1OI1A 4J2DA 3LAKA 3DRRA 4CJRA 1S1UA 2BE2A 3NF6A 4JLHA 1JL2A 2P1JA 2DAQA 3V1QA 3ZEHA 2GBZA 2ZD1A 3QESA 4KI6A 3OS2A 2KTQA 5CY4A 4AHCA 2HMIA 1KRPA 3VQEA 4CIEA 5KRSA 3F73A 4KV8A 5FRMA 4E1MA 4FLYA 2KZMA 2FBXA 4TSXA 3OYFA 2RHUA 2CKKA 4PLLA 2VG5A 1KHCA 3ZSOA 4N56A 1HNVA 1RDDA 1A5WA 2HNDA 4CJWA 2EQMA 3M8SA 2XY8A 4O4GA 3QEVA 4DSKA 4E7IA 1GOAA 2VG6A 1LW2A 4DS5A 2LDMA 3GOXA 1C6VA 1KCFA 1N6QA 4N41A 4M45A 4HUFA 4LH4A 4DF4A 1ASWA 4Z4EA 1S9GA 2OPRA 2ZE2A 3DI6A 1RILA 4C8OA 4FJ5A 3ZSYA 3QIOA 4BDYA 5CZ1A 2HVIA 3PMTA 1VSHA 2Z1HA 4W5NA 4Z4CA 4M3RA 2B6AA 4CFDA 2HHQA 4OGEA 5J26A 3DLMA 2NUBA 1J9AA 2W42A 3CQ8A 3PX6A 3KD1E 4CJ3A 4R5PA 4B9TA 2DTUA 4FJXA 3MXMA 3PO5A 1IKVA 4F2SA 4HCCA 3NH2A 4CF2A 1K6YA 3NF9A 2HQXA 3SUPA 3MEDA 3HM9A 2IS3A 2KQ2A 3KLFA 4LSLA 2R58A 1B9DA 3HPGA 3AVIA 5CIUA 2B4JA 4FLVA 4PUOA 4CJFA 4CK3A 2X35A 3DLGA 3OB9A 3KTQA 4FJNA 4NS5A 1MU2A 4I9LA 5J1EA 2B5JA 2GV9A 3P8HA 1RBVA 4C8KA 4FJKA 1KLNA 1J5OA 2ATQA 3LWMA 1RBUA 4A4EA 4MFBA 5E41A 3OY9A 4OLBA 4DF8A 1TKTA 1J53A 4CF0A 4CCHA 2F8TA 2G8FA 2RI2A 1BL3A 4UQGA 3FC3A 4FM2A 4CHOA 3QERA 1U4BA 3V4IA 1RBSA 3MAQA 4FK2A 1RT4A 4DTXA 4LD6A 3OYIA 1R0AA 1Q9XA 1Y97A 5KCHA 5KCOA 3ALYA 1DTTA 5KGWA 2FBTA 4PWDA 5C42A 1U48A 5JS1A 3SQ0A 1EP4A 3S3NA 1RCHA 3QBYA 1RI0A 3KUFA 1W0HA 1NK0A 2MWPA 2VG7A 2EX3A 3KIOA 3KK2A 1IKYA 3PY8A 1VSEA 4FZXC 4I2PA 3HL8A 3HP9A 3P83D 4RW4A 3ZSZA 1NK4A 2EHGA 2QKBA 5FRNA 1JLEA 1X1PA 4DFKA 1WSIA 4IG3A 1XI1A 1TKDA 1L3VA 3ZT4A 3OJUA 3CFPA 4C8NA 3CFRA 3VQ7A 3IAYA 1JL1A 3WNHA 3VN5A 1CXUA 4NCGA 3ZSWA 3NE6A 2E4LA 1NKEA 2VWJA 3MEVA 1RT2A 2BDPA 1YVUA 1JLQA 4H8KA 1S6QA 2JLEA 3O3GA 5KGXA 3D45A 5EU7A 4FU6A 2Y1IA 4M3UA 3DYAA 4I2QA 3TANA 4B9VA 3V1RA 3K57A 4CEOA 2BKDN 1IH7A 4FJ8A 4HUEA 3QIPA 1RTHA 1RDAA 1NOYA 1SV5A 1NKBA 2GFUA 3DOKA 3H8ZA 3O8VA 1SUQA 3LP2A 2O4XB 3THVA 2BANA 3O4QA 1FKOA 2RI3A 4RG8A 3MEWA 3ZSQA 4CGDA 4E19A 4B3OA 2D0AA 1D9DA 4DSIA 1RBRA 3AVCA 3ZT3A 3O3FA 4O44A 1LWFA 4CEAA 4IUPA 3MXJA 1VSLA 2IGIA 3HT3A 3DLKA 3EAEA 4DQQA 4YNQA 2XO7A 5J2NA 4CFCA 3QEIA 3TAGA 3RR7A 4EZ6A 1VSJA 4DSLA 1WAFA 1Z25A 3TAMA 1SKWA 3S3MA 4CGJA 3RMCA 3DLHA 2O4IA 1HQUA 3LLRA 3NGYA 3HJFA 1U49A 4RW7A 3K2PA 4DTSA 3AVAA 3O4NA 4KHNA 4KHWA 2Z1GA 4AH9A 1X9WA 2QXFA 1JXEA 3AO2A 3HVRA 4QOZB 1LV5A 3CEYA 2F5KA 1HPZA 1S1VA 2R5AA 3AO4A 3BGRA 3K5OA 4KB1A 4J2AA 4RW8A 1FXXA 4CE9A 4CGFA 4KREA 3OQ5A 2LSNA 3E01A 1T7PA 1Q8IA 2HHSA 4E1NA 3F70A 1ZBUA 2LTOA 1BHLA 5SWMA 3LALA 3NHGA 4HUGA 4DTPA 3U3YA 3RMBA 3SI6A 4IUVA 4BE1A 1UOCA 2YHBA 2G3RA 2DFEA 2OPQA 2E6NA 4DWIA 3C94A 2KFNA 5J2QA 2K3XA 3DMJA 1TVRA 2RN2A 3QNNA 4A4FA 3NCIA 4C5HA 4Z02A 3HPHA 2MWOA 1YTUA 2LCCA 4CEEA 2XY5A 1JLFA 3C4SA 3H6ZA 1JLCA 4N4GA 1UA1A 1NK5A 3DB3A 4B9MA 1ZBHA 3SCXA 1TAUA 2DIGA 2A1RA 3LP1A 3I8DA 4DG1A 5I42A 3ZSRA 2LVMA 5HRPA 3BDPA 4F2RA 1JLAA 1GOBA 2DIQA 3T19A 2M0OA 3AA5X 3G0ZA 4CJ5A 2XK0A 1BCMA 3S6WA 1SSFA 4DLGA 4QQDA 4AILC 1QSYA 2HHWA 4QQGA 2VYTA 4ID5A 3META 4E7HA 2L3RA 2XDPA 4E7KA 4CIGA 4B9UA 2K3YA 2OA8A 4DSEA 1TKZA 4L59A 4F4KA 3Q1JA 1L3UA 3L3VA 1ZBLA 2ZQBA 4CJ4A 2BUDA 2RO0A 3VA0A 2R5MA 3SUQA 4E7LA 4AHUA 1ITGA 3I0SA 4IKFA 3LYIA 1WSGA 1UAXA 4FW1A 3SUOA 4B9SA 2X78A 1SKRA 3AVFA 1Q9YA 1U04A 4Z0UA 4Z4IA 2RKIA 3KKRA 3PFSA 2Y1JA 4DS4A 1I39A 4FZYA 1BI4A 2M16A 2WOMA 2OPPA 4RW9A 3TR8A 4B8AB 1C0TA 1CLQA 1T03A 4BD3A 4KPYA 3IS9A 3AVMA 4YFUA 1RBTA 4FJLA 3E9FA 3NTHA 2PQWA 3PNWC 1A5XA 4UC4A 1RTJA 4GVMA 3OYDA 4DTRA 1H3ZA 3SV4A 3SQ1A 4O5BA 3VQBA 3MP1A 2IOCA 1WGSA 3MXIA 4LD0A 3WNGA 4AHSA 4ZTFA 4BE0A 4FLTA 1VRTA 4CJTA 3JYTA 1UA0A 1LAWA 1QS4A 1BIZA 3NFAA 4O0JA 3KK3A 2E6LA 4FM0A 3V9WA 1NK9A 3DLEA 3VQPA 3IG1A 3G10A 4EP5A 1NJWA 1WJSA 3AVGA 4KFBA 4M3ZA 3HK2A 2O4XA 1VSIA 4G1QA 3ZT2A 4FL6A 4Q5WA 1TL1A 4F8RA 3ASKA 3OS1A 5J2MA 3MP8A 3LPUA 5HBMA 1LWCA 3VQCA 1JLBA 3DM2A 1C1AA 2YV0X 4KTWA 2XRIA 2RJCA 4KTZA 3SQ4A 1NKCA 4BDPA 4FM1A 2JGUA 2BGGA 3NTKA 4F3TA 2HHTA 5JS2A 4W5RA 1JLGA 1JXBA 2FHDA 4IBNA 4W5TA 1QTMA 4E89A 4CJSA 4OPJA 4QW2A 4EP4A 2HHVA 4W5OA 3SPYA 3U6FA 2HNZA 3UWNA 1TAQA 1RT3A 3MECA 3ZT0A 3TAEA 4CIFA 4FVMA 4M3XA 2Q3SA 5CYMA 3KLGA 4CGGA 4OPKA 2X74A 5HLFA 2FBVA 4C8LA 4FJGA 3HVTA 2Z1JA 1BQNA 3LZJA 1OYXA 4CECA 2BIVA 4CFBA 2OZSA 3SD4A 3LAMA 3PX4A 5D3GA 4DTOA 4BWMA 4DTJA 5HROA 3M8PA 2L89A 4JS4A 2IG0A 3HSTB 4CGIA 1TK0A 3M9QA 3LP3A 2RJDA 4CEQA 1L5UA 3CM5A 3KJVA 2L8DA 4DSFA 4PQUA 4IUTA 4KHSA 4J2BA 3RRGA 3AVLA 4B9LA 1BQMA 3CFOA 1WSHA 4FLWA 1D8YA 4A4GA 4ID1A 3NBPA 4JRQA 4CEBA 4M3TA 4QCLA 1D5AA 3AO3A 2R7YA 1RDCA 3A2FA 1NK8A 3SV3A 4E0DA 3FLGA 5IAYA 3V9SA 1SKSA 3FDRA 2KZZA 3HYFA 2OPSA 4DQRA 4CJPA 4BDZA 1U45A 2YNFA 4PY5A 4BWJA 4IURA 1S1TA 4CHPA 4IUUA 4QAGA 3ZT1A 3O3HA 3TAFA 1X9MA 3NF7A 2EQKA 4GMJB 1KVAA 4HTUA 4F3OA 1WJRA 4JS5A 2R57A 1ZBFA 4CF1A 2X4YA 1WSEA 1B92A 3ASMA 3VQ5A 4ELVA 3M8RA 4IFVA 3VQQA 1KLMA 2G8UA 2G8VA 1KFDA 4FCYA 2HHUA 1VSMA 2F8SA 1KFSA 4PLIA 4AHTA 2O4GA 4FJ9A 1IKWA 2XHBA 3L2QA 1XHXA 4NYFA 1IG9A 1ZBIA 1W9HA 5D6WA 4B8CA 3L8BA 3AA2A 4FLZA 2RHZA 2X6NA 3LWLA 2EQJA 5KE2A 1GOCA 4CJUA 2PZSA 3S3OA 5KE3A 1KTQA 3MEEA 3FFIA 4CHQA 2RJEA 3V9UA 3NH0A 1QSSA 2HVHA 5T7BA 4EDUA 5D6YA 4B9XA 2XY6A 4M42A 3QEXA 4Q0BA 5C24A 4OLAA 2G8IA 3HO1A 1S9EA 3AV9A 3KLIA 4CK1A 5HP1A 1J54A 4OKKA 2QQRA 1KVBA 4CK2A 1SL1A 1YTAA 1ZYQA 2GUIA 1NK6A 4KHYA 4CEDA 4DFJA 2EFIA 4GY5A 3AO5A 2WONA 3V6DA 4FZZA 4MQ3A 3B6PA 5DK5A 3LX7A 2YNIA 2PYLA 3L42A 1RT7A 3ITHA 3KKSA 4FXDA 1VK0A 2AJQA 4HVJA 4C5GA 3BDLA 4FJHA 1NOZA 3CG7A 1OZ3A 3DRSA 4M3YA 1C1CA 3HP6A 4CEFA 3OYAA 2D9TA 2QQSA 3PMIA 3DB4A 4E3SA 4PL6A 5K14A 3KK1A 3LDSA 3L3UA 1KSPA 1S1XA 1LAVA 2JTFA 4LH5A 4DU1A 1FKPA 4EZ9A 1YT3A 2DFHA 3L2RA 2ETJA 4FJMA 3QO9A 3V9ZA 1IO2A 3QETA 3OYHA 4CRIA 3FEOA 1S5JA 4Z4HA 2RF2A 3K5NA 2YRVA 4A4HA 3NGIA 4XIUA 4CF8A 3TWHA 1NJZA 1RTDA 4FW2A 3VQ6A 5IN1A 3AVJA 4AHVA 4B9NA 4X34A 1WJQA 3LP0A 3QINA 3OMCA 4OJRA 1FK9A 2RHXA 1WSJA 2B8AA 4LSNA 4CJLA 4O0IA 4I9QA 2HHXA 2FBYA 2P5OA 3TI0A 2RHYA 1CZ9A 4C5IA 1C0MA 1HYVA 1RTIA 2P5GA 5FROA 3VA3A 1C1BA 3V1OA 2QK9A 2LRQA 4M41A 3EY1A 3VQDA 2VWKA 1T8EA 3I0RA 3P1GA 1JKHA 4IG0A 3PUFA 4C5EA 3VQ9A 1IKXA 4KI4A 4Z4FA 2YNHA 2JZ2A 5FDLA 4FJIA 4NYNA 1BI4B 3QLHA 3AVNA 4W5QA 1L3TA 4FJJA 4L8RB 1WLJA 1OZ2A 4DQIA 1SL2A 1NJXA 1UWBA 4CJVA 3F9KA 2HB5A 1TK5A 3C6UA 1BIUA 3EYZA 1ASVA 3MEAA 4KAZA 3OYJA 2GFAA 3MEUA 4ZTJA 3QJ6A 5C6SA 1TL3A 3ZCMA 4OKEA 3OYEA 3RMDA 5I3UA 3OYMA 2YKMA 3ZSVA 1MHNA 1KVCA 4CJQA 2DFFA 4K8XA 2PYJA 3QKJA 1CXQA 3TAPA 1RDBA 4DU4A 1HYSA 3RRHA 1U47A 2KFZA 4B9WA 3B6OA 1HYZA 2P51A 4H4OA 4PA1A 3RMAA 2PY5A 3NTIA 1S1WA 3NGZA 1BCOA 5C25A 1TGOA 4N76A 1XHZA 4DSJA 3ISNC 2RI5A 3UT1A 4CHZA 4IDKA 3LH0A 4N4HA 1A5VA
chains in the Genus database with same CATH superfamily
1KQ0A 1YQLA 2Y30A 4F7ZA 5L8RE 3I55N 3RR8A 5HRNA 1NJIO 4JKGA 2R5YA 3L2WA 4M78F 2VGNA 4CICA 2FSKA 2ELKA 3DP7A 1O75A 3JTHA 4IOCL 1W1FA 1Q86R 1S9HA 3JR9A 3Q3SA 3JCMJ 2QWNA 3VS7A 1VYUA 1KA8A 2VONA 3Q0WA 4N47A 2P7VB 2YJEA 2R7VA 4LFAK 2V8IA 2DLLA 3A5MC 4LC9B 2J6FA 1BKBA 4M75E 3HSCA 2ZJPL 1K73C 3OGDA 3PO4A 2EA4A 2DVJA 1E6HA 4JK7A 2X3WD 4FWMA 3VUBA 3VMFB 1N27A 4M75D 3HOYJ 1A5JA 2VIXA 5HLTA 4FT8A 4QLCU 2G0EA 3ENHA 1T08B 3HM8A 2QA4I 5GAMe 2IVOA 3C3WA 4WE1A 1XNRK 5GJVB 1B3QA 3VQAA 2EA2A 4JI0K 4LK1F 5E1ZB 2UXBK 3RDIA 3VF2A 1QSLA 5HY6A 3VU3C 3LAKA 4FWSA 2A28A 4M7AE 4DIQA 1CKAA 1FC3A 2HMIA 1ARKA 1TUYA 1QZZA 3OYFA 1HNVA 2ZFUA 2JA7J 4E7IA 1GFCA 1CQTA 1VQ6I 1VQ7I 4BDYA 2XSDC 3SWNA 5J8CA 4M3RA 2P9NA 4YRVA 3DLMA 3TQNA 3RERA 3CQ8A 3J80O 5A0DA 3PX6A 2JUCA 3CCVT 2KQ2A 3K70C 2UZKA 3DWLA 3P8HA 2CUDA 4B23A 1Y57A 3K4KA 1QP2A 3ABKH 4NB4A 4A4EA 3A2KA 5FKLA 2YUPA 4GRIA 3IH2A 2G8FA 3K4LA 4FK2A 1KO9A 3MAQA 1NLVA 1J59A 1RT4A 4JI7K 1R0AA 1P9QC 2P6TA 2OTJQ 5AQXA 3S3NA 3KUFA 5HS9A 3S8PA 1U5TC 1R5GA 5D8KB 1QHHD 4A0XA 5KGXA 3W2AA 1YWOA 4I2QA 4B9VA 3GBGA 2MBFA 1XMQK 4FYYB 1EV7A 3SMPA 1S7OA 1SUQA 3I71A 4RG8A 4E19A 1E2XA 1PUFA 4PDKA 1P7JA 2HVSA 3ZT3A 5IT9E 4A3MJ 4BRHA 2CV0A 4O44A 1VQ8I 5F0CA 3DLKA 3EAEA 3TAGA 4C2TA 2BVMA 2X6WA 1GXPA 1G3WA 2BW3A 1EH8A 5IOZA 2LX9A 2CQQA 1V5GA 3S16J 2ZPGB 2J7IA 4XRSA 4M78D 3EYIA 3MN9A 5IYBJ 4E1NA 3LALA 1TTYA 2NOJB 5ILVA 4RGSA 3I53A 1YIJN 2KRSA 3LSTA 2JTMA 2ZSIB 4U88A 4GYIA 4IQ4A 4B24A 1Y71A 3FRNA 2K3YA 3GUDA 1Z9ZA 5IPAA 2VJ5A 3ZL7C 5D6EA 3AVFA 3BP8A 4Z0UA 4H0VB 3REBB 1CLQA 2LD5A 3MKYB 3AHUA 2ED1A 2ASPA 2ZGZA 2AO9A 2KIUA 1D5VA 1JRIA 2OBPA 2IOCA 2P4RA 1B1BA 2KRHA 4O5VA 4CC3A 3BFMA 2QM3A 2GTDA 3GL1A 4BGDA 4Q5WA 4F8RA 5B66C 3EGUA 3JB9J 1BW5A 4MNUA 1NKCA 4BDPA 1OLTA 2V52B 1TP4A 2XASA 1ACIA 2W25A 2QWOA 3BQYA 4W5TA 1I50J 4EP4A 3C2GA 2Q0RA 1BQNA 3LZJA 4WFBL 3CMEQ 3EUHA 4JS4A 3ZMTA 3GTOJ 2H3JA 3VPZA 2V9PA 1WLPB 4YY3K 4KHSA 1G4DA 2EIFA 1CF7A 3CD6A 2CP6A 4C30A 1SKSA 4BY1J 1NHAA 3MJXA 2F48A 1WQ2A 2VXZA 5BPNA 3CCJT 1U1SA 3FMRA 1YX5A 4HX7A 1WSEA 3RR6A 1XMXA 4H5TA 4RLQA 4FWQA 1NJIR 2F8SA 3CCRN 4IJNA 3VKIA 1KSWA 2HDWA 2JVGA 2KRMA 2O8DB 3CBMA 1UB9A 4MFDA 3HKZA 4B9XA 3LSIA 1WJEA 1DKGD 3FXQA 1S9EA 1FMVA 3VS0A 3A5LC 3B6CA 5KYYB 5DK5A 1UMQA 5LJ5h 3RPUD 2OZUA 4DUZK 4C5GA 3W2WA 3H41A 1S29A 4GO1A 5FW9A 3CCQT 3OSFA 4M7AA 2E3IA 3L2RA 3N0UA 1N5ZA 2RH2A 3MX2A 4CRIA 1VRLA 3NGIA 4RDUA 1R8OB 5IN1A 5IXFA 1V5EA 2HS5A 4A3LJ 4X1EA 3VYRB 4CJLA 4DOWA 2XGDA 5DEQA 5H20A 1X2KA 2DTRA 3EY1A 2ZKZA 2H6BA 2YNHA 4FJJA 3E3VA 2QENA 1ZKGA 4FT2A 4ENMA 1FLIA 3ROUA 2IRFG 4JI8K 2ZB9A 3FXLA 3V8JA 2DTOA 5DYMA 3SJHA 1K83J 1WIEA 3CXCA 2KRNA 4PA1A 2F4MB 2Q36A 1W97L 1RFQA 2ZGYA 2F96A 2P0WA 5CVIA 3M8QA 1ORKA 3CC7N 4MEXF 5AT1B 1E4GT 4LGWA 4CEZA 2Q31A 4MGRA 4RM3A 1VSKA 1EKEA 1VQ4T 4RMOA 3LQQA 1PYVA 1RUOA 1WGXA 2ROLA 2NOZA 5M9OA 3G2BA 3OMGA 2HKQB 2Z5UA 3BZ6A 3CDIA 3QYBA 4UVCA 2IS2A 1HRHA 4KRFA 1VQNA 4LIUA 4ICLA 5KAFC 2Y4YA 4E9HA 1TL8A 4LD9K 4N4OB 1BA1A 3AVBA 1T05A 5H2FC 5M1QA 1ILYA 4BU2A 2ZJQL 4K0KK 3NNQA 1LDJA 3VPRA 3HXLA 5IT3A 2IGOA 5DM6L 1Z26A 1REVA 3CVSA 3QYGB 4DTNA 5DLOA 3NARA 4FK0A 1ZG1A 2BW3B 3TPQA 1P4AA 4O55A 1LWVA 3P5JA 3C1DA 1WNSA 1Z9CA 2I2LA 1NGGA 2OD5A 1R77A 1U8BA 2DQLA 3KLEA 3UF4A 2OTLA 3OYGA 5AFUA 1ZRDA 2FVUA 1HLVA 3WHCA 3P7NA 2LLKA 3A01A 3SHFA 4L9NA 2GWJA 2EYXA 1BR4A 3CI5A 2EFWA 4HQMA 2NAZA 4J2DA 2DO7A 2CH0A 4B43A 2YS9A 3AG2H 5A2QK 5AFUH 1W2BM 3DLLA 1VQ8A 3SAGA 2RB6A 3M8SA 4O4GA 3LMMA 3VENA 3H0HA 1M1KC 4Z4EA 5E18F 4FJ5A 2DMQA 2O8KA 3GTPJ 2QTXA 3PMTA 4RB1A 1K0XA 1VSHA 4EM1A 3RVCA 4Z4CA 2DW4A 1J9AA 2NUZA 2OAUA 1JJ6C 1RETA 2X6YA 4CF2A 3NF9A 4XU3A 2VBYA 3AVIA 1NYFA 1M27C 4BRDA 5FU6C 3HPWA 4JKDA 1K8AO 4L18B 3H35A 1QWFA 4QPQA 3BR5A 1AEYA 3B8AX 5E41A 2XAFA 1ABOA 4LD6A 3CJRB 1WZOA 2XHCA 3QBYA 1KJWA 1TYQA 4KUDK 1M1KU 4WCIA 3P83D 3ZSZA 4EAHD 4M63C 4B22A 1LOTB 1POGA 5BMZA 1QVGA 4XLCA 4XMYA 4A3EJ 2H8RA 1E6GA 1YVUA 4HV5A 1O7FA 1ZBSA 3UKUA 2MLGA 5BN8A 1M3CA 1ZSZA 2KY9A 1KC8C 1IREB 3ZSQA 1IV6A 3NWSA 3BUZB 2GELA 3O8GA 1N75A 3TAMA 2CU7A 3P38A 4DHYA 4FPAA 4WTOB 2UXCK 3ZMUA 1JXEA 3CCEQ 4CE9A 2UUZA 1P92A 1T7PA 3GF2A 4HUGA 4B3TK 1TC3C 2LJ0A 3SXYA 3L6QA 2KE9A 2MAMA 1ATSA 4C8QB 4YDUC 3EG3A 4M3FA 3H9GA 1TQMA 4ESFA 4PJOG 3AAPA 3J7AP 4M9ZA 2EIMH 4N4GA 1ZBHA 5AZJA 1WVRA 1WZ2A 2JWLA 1TW3A 5BNGA 1UGSB 3CMYA 1MV0B 4E7HA 3EUAA 2QQBA 5L3DA 4FOEA 4E6KG 4E7LA 2N8GA 1WB9A 1PP7U 1SKRA 2TRTA 1U04A 2CQKA 1HNXK 3PFSA 4M9XA 2PBIA 4A3CJ 4LDYA 4KPYA 5I22A 2Q1NA 4C8QA 2RREA 4HDVA 3QXEB 4IIMA 1IC8A 4UC4A 3M07A 3H6EA 1ETQA 2WY7Q 1WGSA 4AM3A 4AHSA 4BE0A 4XNFA 5CQYA 1T0HA 4BR9A 3OIQA 2RNGA 3RCOA 3AVGA 4XQ3A 4FL6A 3JCMb 1WKMA 4RAZA 1ZGJA 2QWPA 2NYXA 2OA4A 4B1YB 4BEHB 2F69A 5LL6S 1TWGJ 4E89A 3T8RA 1N6AA 5FFXA 1BC7C 1RLPC 2KXCA 1TAQA 4E9EA 1U3EM 4ISEA 4XU1A 2FBVA 1ERDA 3CUQC 1S8NA 2CS3A 3GWZA 3DJCA 1Z7LA 5ADXH 3IH7A 3RDVA 1SMYF 4LF4K 2WAEA 2E2QA 3CCLQ 4IUTA 1Q81C 2QSHX 1D8YA 4QVCA 3G1OA 1KC8O 1P2FA 3H46O 5DM6F 1WJCA 1MMNA 3FLGA 2KZZA 4YDUA 3U1KA 2E8AA 3PSIA 4M77E 4C0FA 4BWJA 4AC0A 3IMXA 4BC3A 2F7TA 2IGKA 4PJOB 3KZIC 2EQKA 1UJYA 4EPCA 3EO3A 2KDOA 3ASMA 1R71A 2HHUA 1W2BP 1VSMA 4PLIA 2D2WA 3DXMB 2A36A 3G73A 3LA2A 3IAS2 5D6WA 3L8BA 4LLLA 4M72A 4C0GA 1GOCA 1KTQA 3MEEA 2XDVA 5C24A 2DQRA 3VUZA 3SB2A 5LJ3h 2KMTA 1KD1U 1YLFA 2OJED 2F5FA 1TS9A 1ZYQA 2E1MB 4S04A 4YOYA 1YHQQ 3B6PA 3HUGB 2YNIA 3CLQA 2AJQA 1WXBA 3O8HA 1BO5O 1QZEA 1RRQA 2PEXA 3OYAA 4LE9A 2Y48A 2PZ1A 4KJZA 1W7PD 2EH3A 3EFOB 4ELYC 1VQNI 1IO2A 1S5JA 4JRIA 1ZHIA 3TO6A 4CF8A 1NJZA 3C65A 1MDMB 2NNYA 4HVVA 3T1YK 4BQQA 2RHYA 1NJIU 2UU9K 1N32K 4H5VA 2O9VA 5GINA 1FJGK 2LRQA 3I59A 1S72I 3I56T 5FDLA 5AYFA 3HYIA 4PUSA 2GX9A 3DKWA 5J6XA 1VQPQ 2H27A 4IF4A 4KAZA 2HTSA 3OYJA 5CJ9A 2YUQA 3THWB 2ZXHA 3LQRA 1MJ9A 1UHMA 3M58A 4DU4A 4GV3A 2K9GA 5C0YA 4H4OA 5J3LA 3E97A 3DBHB 4OMLA 2BY2A 1X69A 1XHZA 1VQ6T 3LH0A 5DD8A 2D0QB 3NDKA 1KQ2A 2ITGA 3J8AA 3LANA 5ICFA 4EJZA 4PSWA 3HKSA 3CPWM 1WUAA 1BJZA 3NF8A 1HKTA 4CI0C 4BGBA 1H92A 3FXRA 2XPVA 2COMA 4DTUA 5ICCA 2KGTA 1M90U 2E20A 4LDXA 3CM6A 2A5YB 1CSKA 3OYCA 3ZX3A 2L9NA 4DBHA 3QEPA 4D9JA 3K5MA 5CQEA 4R8HA 1Y0UA 2E2PA 4XTZA 1K9MO 2O31A 1GCPA 3OJSA 2AXTC 4CD1A 1BI2A 1ZSGA 1ZUYA 3U4LA 3GTQJ 2ICWG 3PIPA 3F5TA 1X19A 2VQHA 3K69A 4C3HJ 4JKHA 5C3EJ 1ZC6A 3FHNA 4JNEA 3FK6A 4C8QE 5M1OA 3TSUA 4AIHA 3FX3A 4N9IA 4HSBA 1KXPA 1KQSA 3ZQCA 3QNOA 1SRLA 1V4RA 3BR2A 3AGKA 1NK2P 1C0UA 2CUJA 2Q2EB 3VRZA 1KONA 9ANTA 4RB2C 1B59A 2DDBA 5E8IA 1JQQA 1OI1A 3OW2M 2W03A 5HK0A 4HDUA 4FE7A 2YR2A 4M78C 5M1NA 3QSUA 1O7LA 2KTQA 2P9UB 3SAHA 1C0GA 5CY4A 4HZFA 1QRYA 1RDDA 2QBYA 3M0PA 1DT9A 1SEUA 1C6VA 2HBKA 4XH5A 2LJ1A 3H1VX 2ZE2A 2EFOA 3QDRB 4M6VA 3R1XA 4EVIA 2HOSA 1ZBXA 1SFEA 4OMZA 3I55Q 3CC7T 4P96A 1U9NA 1ZLMA 4EEFG 2H09A 2V79A 4HVUA 2XDBA 1GLAG 4A12A 2HDCA 1B4AA 3CWSA 3EYYA 4FPBA 2ZNZA 3I56A 2LFBA 4CF0A 3IQLA 2F8TA 3ZQGA 2D0PA 2EYZA 1VQOA 4LF8K 5HLIA 2E1CA 1F43A 3ER0A 5FWCA 1I0CA 2CW0F 3CCMA 2FBTA 1YFHA 3CCQN 5GAN2 1GBRA 3ZQIA 3HL8A 2BY0A 1MBGA 4IG3A 3EPZA 1KQSS 3JSPA 3MCPA 4NLBA 3VQ7A 3WNHA 2ABKA 4GBQA 3ABLH 5DLQE 3IRRA 4PCQA 5CKDA 3CCLT 1WI9A 3EH1A 3OH9A 2XDDA 4DBFA 2YI1A 5C2DA 3CCVI 1YQMA 2QUFA 2OTJA 3CMEI 3MEXA 3RR7A 5J2NA 2GQVA 2DI3A 4WX9A 1P4XA 2V1DA 8ATCB 5BRDA 1BM9A 4ITVA 2IVNA 1IJJA 1JCEA 3O4NA 5F08A 1PRMC 4KHWA 1NU0A 2Z1GA 1TW2A 1KAXA 4GGGA 4CGFA 1TWFJ 4BJ5C 4DV6K 2LSNA 5FFZA 2MA3A 2J6KA 1JJ2M 2A3LA 1SD6A 4N0AC 2M7AA 2RN2A 4JKFA 2OTLI 2HF4A 1I81A 1FMKA 2A3ZA 3WEEA 4AI4A 3A8HB 3EE8A 2QSGX 1K4US 2LVMA 4LITA 5KPRA 1T8IA 1Y39A 4DLGA 4BY6C 3PL8A 4W97A 5KQ8A 4BHPA 5D5WB 3P4IA 4CVNE 4I9QA 4IKFA 5C10A 1E17A 3FIWA 2DTZA 3IH3A 3WVDB 3VOVA 4G7HF 1SFKA 1ZN2A 4UUTA 1HD3A 2L7KA 1OCPA 3PNWC 4MLHA 3CCVA 5K5QA 2K4JA 2JWKA 4RTVA 4HWIA 3MN7A 2YXYA 3J7YP 1BIZA 3HHGA 1RC9A 5AQFA 3VQPA 4J9IA 4EP5A 5DUKA 4ON0A 2CMPA 3S41A 4HXJA 2DA1A 3JREA 4KITB 3TTFA 3BTIA 1UB4A 4CUGA 4M75C 4QW2A 3WU1B 3RZDJ 3ATVA 4BVOA 1V5FA 3VEZA 2NVXJ 3PQJA 5FPNA 2Z1JA 2UV1A 3QWXX 1VQ8Q 1QVFP 5EG2A 5B1AH 5GAGP 4BRNA 2L7FP 4DSFA 1I07A 1VIEA 4ILHA 4ZGEB 4FYWB 3AO3A 1FTTA 2DL4A 3CF5F 4EJUA 2LBFB 3F6OA 4BDZA 4WYBA 2HZTA 1DPUA 1S1TA 2VC0A 2HKXA 2LNBA 4F7UG 5GANh 1KQ9A 4BEHA 5GAN4 3VQQA 3HM5A 4OB1B 3MKWB 2K9QA 3Q0UA 1IKWA 2XHBA 4NHJA 5KYWB 5GAOl 3HKZN 4FLZA 1UGRB 3DEEA 1WXUA 5LHGA 2XIDA 1KC8U 3A4CA 3MWPA 2R7TA 4XH4A 2X3XD 4LJZF 1J54A 4OKKA 5CO7A 2VT3A 3BWGA 3FHGA 1OCZH 1K78B 4CZLA 5BOXA 3CP8A 1AWJA 2YU9J 2G8IA 5KN8A 3L42A 1OOTA 1NGNA 3F0CA 1ZG3A 1VQ6Q 5K14A 1W36C 5JLXA 4B1UB 2J6OA 4YIRX 2GZWA 4B3SK 3O9SA 4RGXA 3HRSA 4Y4RA 4BXFA 2LR8A 2RHXA 2HHXA 3BEXA 1WFXA 1OCOH 2O3FA 4C5IA 2CREA 1G2HA 3KYDB 2VWKA 4XONA 2YUSA 1X6GA 2H3GX 2ZJQF 4W5QA 4LDUA 4M7DC 1R5ID 1OZ2A 3T9NA 2P7CB 5L3BA 2EK5A 5ELZA 1V76A 2EWNA 4RTFD 4AYBN 2EZIA 4BRGA 3ZSVA 1MHNA 3TAPA 4PL8A 4FE4A 2XROA 5C25A 4IDKA 4N4HA 1ORPA 2WTUA 3S9HA 1NK7A 5C0MA 2IS1A 3PNYA 2CSIA 1IGUA 4HKEA 2K86A 4CGHA 4Z4GA 4WQ5C 4UOBA 2PBDA 3H9NA 1ZLJA 2HOTA 4DBRA 4FSSA 1D8KA 5KI6A 5E3OA 3PV8A 3KYLA 4FJ7A 3PGGA 3ML6A 2DYSH 1CF7B 4NDLA 2D1KA 4ZHRA 1VQPN 1DTQA 4BE2A 2EQUA 4CW7B 1RI9A 2XMFA 2W00A 3OYBA 3QIIA 3SPZA 1YFNA 4OVAA 4I7HA 3FSPA 2OV7A 1U2VA 5GMKm 1RI7A 4J7FA 1O1WA 2HXOA 1KAYA 3ZSXA 4LDVA 4Q5VA 1VQOI 4DLEA 4CZZA 3KZBA 3IAM2 4XTXA 3SQNA 1VQ6N 4NCBA 1OISA 3CCVQ 1NK3P 2E64A 3K1MA 3GTKJ 3L1PA 1VNDA 3G7ZA 3LGFA 2CYYA 4Z88A 2JPCA 3VS3A 2FBIA 1X27A 3R9PA 3M59A 4CCJA 1GDTA 1EIFA 1HKQA 1FSHA 4K42A 2RQUA 4JLHA 1IN4A 2VE8A 4YOQA 2F4IA 1ETYA 3DFGA 2LP5A 4KI6A 4JD2B 4AHCA 2JN0A 1K8AR 3FXMA 5FRMA 1BDGA 4WCGA 2ZC2A 4N56A 4NC8A 4DA4A 1A5WA 1YJWT 3S2HJ 1AD5A 4ZYDA 1LW2A 2LDMA 3VW4A 4Y13A 1GLEG 4BC5A 2OPRA 2QA4N 4YPRA 3ZSYA 3DXKB 3H0GJ 2DTUA 1WJBA 4LG0A 3HM9A 4AG1C 4KYWA 4EHUA 4OF1A 1WPYA 1C0FA 3FIFA 5M1FA 4OLBA 1YJWQ 1R0CB 2LT4A 2NRRA 1U6ZA 1RBSA 2XRNA 3JCMV 3TSZA 1ZQ3P 5C42A 4QT7A 3SQ0A 1HX1A 1Y0NA 3QZ5B 5DDGA 2VG7A 3M3YJ 3PY8A 3LDPA 4RW4A 1S3JA 2EHGA 4YOUA 3CD6I 2EB7A 3LOCA 1J9IA 5CAIA 1CXUA 3EDPA 3FHZA 3KPHA 4FWOA 4A2UA 4CEOA 4M78E 1YJ9A 1T0FC 3ERED 4C92E 2P9PB 1SV5A 2A5WA 4Y3OA 1Y8QB 2CV2A 2KT1A 1YP5A 1U0JA 4JLIA 4OB2B 4PUOA 2P5KA 2XO7A 3ISPA 3BR1A 1U78A 3ZMSA 2HQAA 1YHQN 1GXQA 4DTSA 4JZ3A 4KHNA 2VQCA 2QXFA 1NMNA 4CZEA 1NEBA 3H9QA 2F5KA 3C0BA 2L01A 1HUXA 3A0HC 1HW1A 2DJIA 1Q8IA 2TCTA 2YT6A 2QWRA 3L4IA 2C0IA 2BH1A 1IRFA 1YNZA 2NUTA 3NCIA 4OMQA 5IT9O 4RKUE 4M77F 1UA1A 3EE9A 3RJPA 4BL0B 1YJ9Q 3BZCA 4DG1A 2P9KB 5CLSA 3BDPA 2DIQA 5GAOm 3S6WA 4ATOA 3SBGA 2HHWA 4AILC 3META 2L3RA 1WI7A 3MMYB 1ZA1B 1TKZA 4DSEA 1JKQC 2E36A 2K5LA 3LYIA 4IEIA 2JA6J 3BY5A 2HR3A 2M9HA 1D1AA 2YUOA 2NOBA 4RW9A 4ASNA 3HBTA 1RTJA 3QOEA 2P6SA 3CCJA 4DTRA 1WH7A 3E66A 3MXIA 4B3RK 1FIPA 4CZCA 1H89C 2HYFA 2L4AA 3KP2A 4A3IJ 1WPKA 3MP8A 1B34B 1UDLA 2RN8A 2Q97A 4F3TA 4MO7A 3RQ4A 2P9IB 1N8RU 3I56I 2FSWA 3PO3J 1LFPA 3JAMO 1HC8A 2HBJA 1U1TA 4M3XA 4C1NK 1YITN 1H9GA 5DS9A 4XICA 4PKIA 1M1GA 3VTIA 4BC4A 2M0MA 3PNTA 4BWMA 2WSFE 3M8JA 2CH4A 2DYRH 4PQUA 5FKMA 4OIOF 4EMKA 2YLCA 4M3TA 1XSVA 1VQLN 2QASA 1VYTA 3SV3A 2PTKA 1GLBG 1MNDA 1WA7A 2V1UA 3MMVA 1S5LC 3RNJA 2H56A 3NF7A 2KDZA 4BNCA 1M2VA 4JS5A 2R57A 4NOYA 3QYHB 4ELVA 3ZX2A 3LSJA 2P9IA 2FQ3A 3CETA 1KFSA 3FZMA 4L5EA 1XHXA 2DCEA 1XTAA 2UWMA 4ZDLA 4RS8A 4B8CA 4OIQF 2BBYA 2WUSA 4L5JA 4EDUA 3D1NI 3QEXA 2EV6A 3EETA 5K5OA 4MQ3A 4B4CA 2M45A 2UXDK 3K6GA 4DR5K 4B09A 4M7AB 1QPMA 1RKWA 1QVGM 1MMAA 5AQKA 2ETJA 3K5NA 3A1YA 4A4HA 1RTDA 2HZDA 2NRXA 1AWCA 2AKLA 1WJQA 3OMCA 3OBYA 4LSNA 2EZHA 1B9NA 5FLVA 5FROA 2NVUB 4ISFA 3AAQA 4CDGA 1PRLC 2A0FB 1IKXA 1SD4A 2JZ2A 3M0QA 2E12A 2HMAA 4CZHA 2FB7A 1XCBA 1BIUA 3RSNA 3BT9A 5E1WA 3MEUA 1BBZA 4PZJA 4D1QA 1SVOA 1KAZA 4WXCA 5FD5A 4F93B 4B9WA 3M1CA 4LLNA 4BVPA 3EFOA 1I94K 2KZGA 2HAXA 1EETA 3IRXA 2KP6A 2MD5A 4ANJA 3L2CA 5DMRA 3K2AA 3K59A 3SYZA 3QPSA 3I3LA 1JU5C 2UXXA 3QP6A 2NRAC 1VQKN 2C0TA 1VQLT 3BE3A 1N3AA 4XORA 1VQ6A 4MLEA 4AIDA 2A1SA 4JEPA 2P0PA 1REPC 2W40A 4AHRA 4YTLA 1GFDA 3I56Q 2YNGA 2HQEA 5JLFA 2GIVA 1TTHB 3OA6A 5AZJB 3CCEI 4XLPF 3T3FA 4J9FA 4F7UE 5F1RA 3BG3A 4KKOA 3QFUA 1JJ2P 5B8HA 1V55H 4KTQA 4MO4A 2Z1IA 3K58A 2GF7A 2FZKB 3WTUC 1L3SA 2PUOB 3HSBA 3TU4K 1FOWA 3TSQA 1YCSB 4F92B 4UUVA 3T1HK 4W1UA 4CI6A 4XLFA 1S6PA 1BIAA 4RBOA 2O8BA 2R7DA 2IVWA 3KXTA 4GKJK 3DRRA 2K9NA 3F8FA 2F2XA 2UYTA 4G9YA 4EW0A 2LT1A 1E4FT 3CD6N 2ZD1A 1IZ6A 1YJ9I 3S32A 2OAZA 4J8FA 2EV0A 3D5SC 1TSFA 2XVCA 1XQOA 3R4KA 2F2WA 1UJ8A 4BRMA 2NUBA 3LFKA 2ID6A 1T2KA 3OW2S 4ZDPA 3MKLA 1RUWA 3GBTA 3MEDA 2NXNB 3CCEA 1BJAA 2B5JA 4L5IA 4LG3A 1WQ7A 1FX7A 2Q0OA 4EJYA 3ASOH 4FM2A 1OX9A 1OYIA 2CW8A 4HNVA 1SANA 1Y97A 3N4PA 4MZPA 3SJMA 1KC8R 3DKXA 1RZ4A 3EH2A 4BQOA 1W0HA 2CGKA 1QZ6A 4AI5A 4I09A 4PJMA 2BTFA 1J0RA 4PIIA 4KMFA 2LX7A 1UG0A 2B7EA 3OJUA 3IAYA 4M75B 2GAUA 3D45A 5EU7A 2Y1IA 4J6XA 4EGZA 3H8ZA 1H3HA 4XKCA 3Q7CA 3MEWA 2EFQA 4RCHA 4R1HA 2ZMEB 3W6KB 3HJEA 3THXB 3MXJA 2E1HA 4DQQA 3FMQA 2QKMB 2KI7A 1NKUA 4Q48A 1XSXA 3H0DA 1U49A 3LDLA 1X9WA 2P9NB 3O1WA 4J2AA 2FF3B 1ZX6A 5L3CA 2DXTA 3OQ5A 2JS2A 3ID8A 3HB9A 4RCCA 2LF7A 3U3YA 1RPWA 1UHFA 2QI2A 1JUMA 2K3XA 3E2UA 1TVRA 2O88A 3HPHA 4K11A 3CCQI 4OMOA 4XLAA 1TAUA 1OU9A 3N4MA 2ZJRL 1P8ZA 2R7QA 5H1SQ 4U67L 5EZGA 3MCZA 4Y28E 1J7KA 4ID5A 2E5LK 2JZYA 3DWLE 3VSKA 2A6HF 2VGMA 2KISA 1YHQA 1O13A 2RO0A 2ROTA 2YHTA 5GAN8 2QSFX 3UA6A 3EHRA 1I39A 2M16A 4XTWA 2OPPA 1LQ1A 3W6JB 4M7XA 4MFEA 3CCMQ 4ZJZA 3BC8A 2V6EA 2R93J 2L3PA 3EEQA 1VQOQ 4O5BA 3GO5A 1WBDA 4LD0A 3J7YJ 2LG4A 3CJNA 1ZXOA 4JJCA 2OTLT 2MF2A 4CO8A 1QKWA 2BOLA 2VKEA 1Z67A 1TL1A 1Z21A 1LFBA 2YV0X 3GFIA 3I0TA 5CQGA 2FSJA 3OYYA 5IH2A 3SBTA 4KGZB 4D7MA 3WT0A 2VBWA 3ULEA 2FX0A 1Z9QA 2KDSA 3H5AA 5CK9A 2L7MP 2HVRA 3HVTA 1OYXA 3RPUA 4HF1A 1Q82U 2MG4A 3W0LA 1YJWN 3AVLA 4KH1B 4B9LA 2E10A 1BQMA 2JRTA 3MQ0A 2A37A 4JI5K 4C8QD 4H0EA 3NMZC 2PU9B 4YOTA 3G6ET 2XAQA 1ZELA 3HYFA 3REAB 6AT1B 1VUBA 4X66K 3AG3H 3TAFA 1ZGWA 1WJRA 2RN7A 2GXGA 3M8RA 1JXMA 2G8UA 1KFDA 4FJ9A 2RNJA 2ZSHB 3S2DJ 4BJTA 3L2QA 2AZSA 2FBHA 2EJFA 5IOYA 1QSSA 1W4MA 3GFJA 1P7MA 3VYGA 2RE2A 2ACJA 3CCLN 5I11A 2QQRA 2Q2EA 1Z3YA 1VQLA 2WONA 2O01E 4KGXB 5M3MJ 3C12A 3CCQA 2MI6A 4E3SA 2FMYA 4Q5SF 5C4XJ 3TWHA 1U5SA 2HU9A 1DP3A 2DA3A 3H1QA 2B8AA 5FLXK 4O0IA 1N25A 5AQIA 3WTZA 1IDZA 1C1BA 3KVGA 3VQDA 1IN5A 1U2VB 5AQPA 4KI4A 2QDYB 3O6WA 2VWBA 5L3FA 3K7AJ 2B9SA 3JSOA 1DJ7B 3ZCMA 4CZIA 4YOWA 2W10A 1EQYA 1LFUP 1DEJA 1RDBA 1U47A 1JT6A 3RMAA 3D4VA 3LWHA 3MN6A 1O3SA 4YOVA 2VUBA 1W70A 2HMPA 3MWTA 5D4RA 2EINH 2LKXA 2RPIA 2KROA 1EJ9A 2G6FX 3C6TA 1QO0D 5B5EC 3L2VA 2AKKA 4FWRA 2LRDA 3ME9A 3VYSB 4IOCF 2R7FA 3KE2A 5EF6A 2L0AA 4UB6C 4DZPA 1A31A 1RNHA 4FYVB 4WXDA 2DT7B 4J00A 3CMEA 2F5TX 4GW6A 5JMVA 1IGNA 2LQKA 1PUFB 2XY7A 4M3DA 4Z8AA 3J81E 2BYVE 1UECA 1XWLA 1QP3A 2LQWA 2BTTA 1XC5A 2ZJPF 3DRPA 4F55A 1Q86C 1XNIA 1W36D 2LTPA 2CP5A 2RM4A 3MFKA 4JRPA 3A8GB 4CF9A 4PJOC 3AO1A 1T95A 4DB3A 3VV0A 1VQKA 3ZCOA 1U5TB 4IRHA 2XU8A 3QWLA 2H8WA 1HJRA 4E7JA 4ESRA 2XPWA 3JS6A 3AG1H 2D0OA 1F1ZA 3HOWJ 1M3AA 5LJVA 4B9QA 2DY4A 3CWTA 5CKEA 3VGKA 1NG9A 1JL2A 1NPPA 5BRFA 3JRGA 3F73A 2E41A 2CKKA 2NUTB 4FQGA 1K79A 2OTLQ 4CH7A 4YOXA 4BKXA 1UEBA 2X4HA 3LAPA 1KCFA 1N6QA 1XGOA 3BOQA 3JSCA 1X2QA 5CZ1A 1GVDA 2FMLA 2ZFWA 1QMCA 5CR4A 1M9SA 3PIOF 2STWA 1S22A 3J7AO 1OYYA 2WAQN 2DAOA 4FJKA 5HLHA 4RTXA 1KLNA 2O8BB 4I01A 1FMWA 4PJOA 2FOKA 3P31A 4CA0A 5KGWA 2VVKA 2KT0A 2VYPA 1K73R 1VQ7N 3HP9A 1XUPO 1RLQC 5K7ZA 4LFBK 4HBLA 3CFPA 1FW6A 1FNNA 3FFKB 1PSFA 1NKEA 2DF6A 1QW1A 5M5WJ 3NQOA 1T44A 4JKAA 3D2EA 4FU6A 4M3UA 1VQKQ 3MD2A 2KHMA 2DTIA 4UXNA 5BQTA 1Y1WJ 2B63J 1ATNA 4C3IJ 1VI0A 2QLZA 3QICA 1WJDA 3M0UA 2OU2A 2DJNA 3G1LA 2JOYA 1Q86O 3HT3A 1OH8A 3CPWS 5J40A 4ZGDB 4CGJA 1YX3A 2X1EA 3HJFA 2K7LA 2EFPA 3AVAA 2DOFA 4AH9A 4ZGJB 3IUCA 2GBQA 2HQNA 3K5OA 2P9LB 2ZXJA 1R59O 4WFNL 2F1LA 4M75G 1T38A 1QZYA 4D8KA 4A5AA 4JJDA 2F4VK 4DBQA 4DV5K 1X3WB 1ZK8A 5LJWA 4TVRA 3VJPA 2MWOA 2DA2A 2XY5A 2DIGA 1ITYA 4IHYA 2NLXA 2OUMA 3KEQA 4CJ5A 1MGQA 1R1VA 3VYUB 4QQGA 2L4MA 5HL7L 4C2MJ 2XDPA 4B9UA 3PUBA 3JV3A 3KK7A 2FYKA 2UUBK 4FX0A 1TNTA 3RKWA 1FYLA 4HPQA 1Z91A 3JB9G 1YI2N 4I6MA 5CR2A 2XKOC 4DR3K 3NTHA 3CMAA 1HSQA 1T3SA 2R7UA 3CXCS 1VQPA 4H5WA 2LKPA 3CCMI 4CJTA 2HPMA 2ATCB 3ZQFA 1NM1A 2QWQA 3JCMe 3HK2A 2R7SA 1AKHA 2P9SA 2ZPIB 3LPUA 5HBMA 1LWCA 3DM2A 4KTWA 1LWYA 2HHTA 4J5YA 1JLGA 1W7PB 3KLNA 4IBNA 2HBPA 4CJSA 1ETOA 3UWNA 2WAFA 5CVVA 1M30A 3CCQQ 3I0XA 3REOA 4CFBA 1TUUA 3E6CC 2HYGD 5J1YA 3BR3A 4CEQA 1VQLQ 2P84A 2V7ZA 1Q7YC 3KYCB 3LM2A 2JM9A 4CEBA 5KYUB 4GKKK 1RAHB 3FBNB 3X24B 4DQRA 3KP4A 2DBMA 2VC8A 2BUPA 5FPDA 4OO1J 3PIPF 3VQ5A 4F7UF 2EV5A 3MAJA 4MTDA 4JI2K 5H6RA 2CUBA 2EPFA 2OCCH 1Y64A 1IG9A 3HTUA 2DL3A 3CF5L 3DTKA 4GNIA 2JNGA 2IPQX 3ID6A 3CCJQ 2ECZA 2LC4A 5GAOn 3JRDA 4PFPA 2RJEA 1S72Q 1VZ0A 2O8FB 3TSWA 3BY6A 1D5YA 3HO1A 4PNOA 4E1JA 4HAMA 3VETA 1NWKA 4D6WA 1OH5A 4BQNA 4MTEA 1XQPA 2ECBA 4FO0A 5AQSA 1QGPA 1YW7A 4OPAA 1VQNQ 1AZEA 3WTSC 1C1CA 4X62K 3HP6A 2QQSA 1OH6A 4DW6A 4AFUC 2W6LA 2QBYB 5LJ5d 1M90C 2V9KA 1BR2A 2ASOA 2ABLA 1MUDA 3COAC 5HKCA 2DPNA 1IV8A 3VFZA 4LUDA 1EO1A 1T8EA 3Q0VA 1ABQA 4GY2B 4C5EA 1QVPA 4Z4FA 4HVWA 5FB2A 2WB1A 1TUDA 1FBSA 3F9KA 3CMAI 4CCOA 5GPCA 1AVZC 4RAFA 3RMDA 3HUGA 3QUIA 2PYJA 1NLOC 3QKJA 1CXQA 2KFZA 3TOAA 4G94A 2WBNA 1X3ZB 4CYCB 3WXLA 3J7AY 1GV2A 4ZDOA 2K5IA 1Q82C 5C4JJ 3GCMA 1KU2A 3UKGA 4BH9A 3FF5A 4YHHK 1W0TA 1NBEB 4ZYEA 3P9IA 3BDDA 4CESA 3CCLI 2XF5A 1ZARA 5GAOr 2P5LC 2CRGA 4F7UA 5CZ2A 3QYEA 2D0CA 3LWFA 1XOVA 5GAHP 4XTYA 1Z3XA 2P0KA 2WACA 5CE3A 2JK3A 1ZYRF 1ACMB 4II1A 4RGUA 2GUPA 4A6DA 4ZZDA 4DTMA 4NZGA 5M5XJ 1WYXA 4UUSB 4KO0A 2QM1A 3L09A 4DV2K 3H3ZA 1FZPB 3U9DA 2RDPA 3MEGA 2Z99A 1JBMA 2B0LA 1HLUA 2COZA 3RKYA 3RPQA 2JPBA 4CCMA 1DGWY 4OB3B 3SJJA 2X85A 2Z1DA 3M4GA 5KQDA 1NMDA 2V9VA 1WSFA 3TEDA 2XAJA 3EZ5A 4BI8B 4XK4A 3KWGA 2WY8Q 2I5JA 2KXDA 4KT6A 4JKEA 1MBHA 4I2OA 3CJBA 3OW2A 1XQHA 1DLOA 4C1NI 1BOAA 4CYDA 4IX7A 3S15J 3SWNC 3WXIA 3ENOA 3QBXA 1PKTA 5ICEA 3ZEHA 2ASMA 2GBZA 1B34A 4I6MB 2EPDA 4KV8A 2FBXA 2CP2A 1TUCA 2RHUA 2LH9A 2HKNA 1TWBA 4G6TB 4CBWA 3PVLA 4LH4A 3DI6A 1RILA 3ZLJA 3QIOA 4F04B 3MK6A 3FZLA 3EGDB 3BR0A 4B9TA 2MK5A 1OKRA 3ATUA 1X43A 1IKVA 2RF0A 3TP3A 3O2PE 3NFCA 5CIUA 3BTJA 3IWFA 1G59A 2YRDA 1YUWA 4CJFA 3N05A 4RUGA 2HSTA 3RYRA 2K2VA 4A6EA 2BHYA 1Q9XA 3ALYA 4XEIA 2W85A 1Q1VA 3GDQA 1FBQA 2R5ZA 3RESA 3PNVA 1I1SA 1WFWA 1KYZA 1SAUA 1VSEA 2NUPA 3L1AA 3OBWA 1LPQA 4V19S 2ZJRF 4C8NA 1WRJA 3WG7H 3VN5A 4BQAA 1YIJQ 1RT2A 1JLQA 3O3GA 3ZEUA 2CQXA 2LOOA 2DX1A 3HOTA 4I6ZA 1IH7A 2DU9A 1K78A 4Y91A 2GFUA 3BF3A 1RR8C 2BANA 3VODA 3LSRA 5GMKh 4DSIA 4BY7J 1LNXA 1K73O 3HTVA 2IGIA 4YNQA 2FZCB 3IHUA 1TXQA 3DLHA 3QHSA 3CJCA 3P9CA 2CV1A 1TYQB 1SZ2A 2NS7A 1LCKA 1TT0A 3J81K 2NRVA 1HPZA 1YIJT 2IP2A 2QXLA 4AT1B 2CSOA 2YX7A 4DTPA 1G2BA 2GA2A 4IUVA 4DWIA 5B1BH 4GYGA 1EBMA 3QNNA 3SMSA 2CZ1B 3HGGA 1JLFA 4W5NA 2QZ8A 4J6YA 3DB3A 2A1RA 3LP1A 3DU5A 1IUYA 3I9QA 2HI3A 2A07F 3CCRI 2QEXQ 1E7OA 1K9MR 5AZIA 1ZBLA 1YVNA 3C2BA 1XGMA 1HPMA 3F22A 2RKIA 3CC2I 4DS4A 2WOMA 3OR1C 1UG2A 3GNFB 1H8AC 4ZYAA 4YFUA 4B6MA 4G8XA 1A5XA 4QS8A 5AQYA 4P9FA 3T7ZA 2DMOA 1YW8A 1QS4A 2OAWA 3V9WA 2QYZA 2O4XA 1NGEA 3F9MA 3OS1A 2DLPA 2JJ7A 1M3QA 1HYOA 1OU8A 2DL8A 2RQRA 2FHDA 3ERMA 3UE5A 1HSTA 1OPCA 4FSVA 1BN5A 4J7IA 1HA8A 4BRQA 3QP5A 2KBTA 3FM3A 1ESVA 3WTVC 3I8BA 3LAMA 2W82A 1MNEA 3CIPA 4DTOA 1EFNA 3DU6A 3CMAN 3MWMA 3KLOA 4NL3A 3T8TA 1K7AA 3RRGA 4WXHA 2EJRA 2F2EA 3VF6A 2ID3A 3D2EB 2YHYA 4BHCA 5CVRA 1MGTA 2OPSA 4BREA 4PY5A 3JAMZ 1YQKA 2IIRA 1UCRA 4KFCA 2YPRA 4Y52J 3LH5A 1R36A 5JVTA 1NE8A 4IFVA 2KHOA 3CCSQ 2CUEA 2A41A 4JI1K 1U3OA 1VQ5N 4AFSC 1SD5A 2DJQA 5IHKA 5LHIA 3S3OA 3I0WA 1OV3A 3NH0A 5FLMJ 1R22A 2NRTA 4Q0BA 4IPAA 3CD6Q 1QU3A 5GAMd 4HRIA 3KLIA 5HP1A 5TRDA 3DF8A 1KGSA 1KIKA 3F0ZA 4XAXB 3ASNH 4D0PA 4KMUX 3QMLA 3OMYA 1ZG5A 2OC6A 4DOVA 3CG7A 2ZO4A 4M77C 1N9RA 1IRGA 1C6VX 4QIWN 4LH5A 1YJWI 5FU6B 4EZ9A 4LN2A 4FJMA 1W4SA 4YG2F 2MD0A 4IDHA 2XKOA 4DV7K 4B9NA 1HNWK 1PVSA 2QK9A 5AIQA 1MMDA 5JI6A 1Z7UA 4R0KA 3IKMA 2HCKA 4X9DA 2GA1A 2A3SA 1EH7A 3MVPA 2HL3A 4HG2A 1WHJA 5DY9A 2K85A 2IEKA 1KQSM 3MEAA 5C6SA 3OYEA 4A3DJ 3WU0A 2FXUA 3WXMB 2ME0A 3QO3A 2F5VA 1H0MA 3BJ6A 1P90A 3K2ZA 1Z77A 2Z0WA 2JXBA 5GANf 4XQFA 1X4PA 1RT6A 1K9AA 3X2QH 1X58A 4KHUA 1XPXA 3HPOA 4B1VA 1IXSB 1IBKK 5LHHA 1R58A 5M3FJ 4M75A 5HRSA 2KZVA 1I3AA 2XAUA 3IV5A 3J7ZO 4HT8A 3C95A 1T0FA 2GQQA 4HYEA 5GAN6 4K8ZA 1TQIA 2XKPA 3QU3A 1Y0MA 2DVEA 2ZCFB 4C23A 3CJ1A 3CCJN 1WI3A 2WV0A 3U23A 5M5YJ 2RK1A 3VEVA 3TABA 2XGEA 2X1CA 3LL7A 4A0ZA 1VSDA 5FU7B 2IVPA 3WNEA 1AZGB 3WE3A 4C92F 1R49A 3I55A 3CJTB 4R79A 2D0BA 2E1ZA 3M55A 4LMYA 1GLLO 4RW6A 3CCUN 1FOYA 2D6FA 1VQ8T 1MWKA 4MEYF 2XAGA 3K4NA 4CGZA 2BZXA 5EOYA 3BROA 1RNLA 5HRRA 2QA4T 4PKCC 2HW3A 3NAEA 1J75A 2YSRA 4QKUA 3HRUA 1SSHA 2P4TA 3AA3A 3UIQA 4BGAA 4HEA2 1HK9A 4CJRA 2YRCA 1MSEC 1S1UA 3PLAA 1YBYA 2P1JA 2DAQA 3CW7A 1YJWA 3CCST 3WXKA 4OFHA 5CHZA 1JTXA 1S1NA 4CXFA 4JJNK 2D1VA 1APLC 4CFDA 2BVLA 3R0JA 4EJOA 3HSFA 3DPLC 4KT0E 3A8OB 4F52A 2CFOA 5A0GA 2R58A 2B4JA 3TQ7P 1XX5A 3O08A 4BBSJ 2E1MC 2GOXB 2OANA 4C0DC 3D7SB 1RBUA 4DF8A 1TKTA 1J53A 3OYIA 2V1XA 4WWCA 4DV4K 2FOWA 2PVDB 3I9V2 1WEFA 2EBIA 1M8VA 2MWPA 3SDGA 3PTAA 1XS9A 1N8RO 5JVGF 4BRLA 5K5RA 2M7BA 1YHQT 1JL1A 3NE6A 5GAHJ 1FEXA 1IHVA 4MMKA 4OMYA 1S6QA 4IWVA 1UGPB 4RTUA 3SFIA 3F6VA 4EM0B 4LIVA 1RDAA 2HXIA 3DOKA 1F4KA 5FGMA 2GQIA 2G7UA 4M3EA 1RBRA 4HQEA 2ZZDA 4IUPA 1BOTO 5LGUA 4EZ6A 1I6HJ 2V75A 5EVZA 3RMCA 4CHUA 3JRZA 3CUQB 1N39A 4B1ZA 1LV5A 2LREA 1R0BG 4JN4A 2Y0MA 5E84A 4A61A 1SL0A 1G3SA 1MD0A 2O8EB 4U0VA 2KIQA 4Z02A 1YTUA 2NZTA 5GP9A 1NK5A 1D0YA 3ELKA 4HNTA 1JEGA 3HZJA 3RTRA 4IJAA 4BQZA 3JCMc 2XK0A 4LF7K 4HW0A 1ORNA 3VEYA 1HOMA 5IHIA 2OA8A 3EGXB 3BW1A 3EN9A 3CC2T 1L3UA 3CUQA 1KD1C 4KH4A 3H36A 1GCQA 1XMAA 3JB9F 2L54A 4A3GJ 3GXOA 3GG4A 1T03A 3CERA 2E71A 1EH6A 2ELJA 4LFUA 2M8GX 3TMOA 2YHWA 4J9EA 3SV4A 2P9PA 3SQ1A 1IGQA 1KHIA 2ISZA 4OFEA 1YITT 3TDZC 3EFRA 5GTIC 2Q2RA 1EF4A 2EQIA 3QRFF 4M4ZA 2GEMA 1WJSA 1MUYA 1XMOK 3IP4B 5BPIA 5CVUA 2JT1A 2A61A 1WEIA 3A0IX 2RJCA 4K2EA 4XRFA 2FF6A 4FISA 4ZN1A 3WTXC 3TW6A 5DV5A 3VS1A 3F8CA 3NWTA 2KPMA 5IP6A 2O6GE 3JXUA 1PG5B 2EQRA 3PFYA 3CCUI 5EC7A 5EG0B 2PMZN 3MKZA 3IRQA 3HSTB 3CM5A 3EG9B 1AA7A 2EGCA 2C0OA 5AQOA 4JRQA 1HDPA 1E3OC 2MH9A 3WTTC 2LY9A 4BY6B 3DTEA 4TV7A 4HLXA 3BF1A 5IT9K 4CJPA 2DZ9A 2FJ1A 3X26B 3IKVA 5LMNK 4GV6A 2Q8KA 2R0QC 1UGVA 4XKVA 4G6DA 1KLMA 1GVJA 4PKGA 4FCYA 5F0HA 3LFUA 1F9NA 3CPWP 2RNAA 2X6NA 4FM4B 5KE2A 2FRHA 4CHQA 1OMIA 1TWHJ 3TGNA 2O0YA 5HDGA 2MYSA 3G1JA 4WQ5A 1X3UA 3EUHC 2O9SA 3VTHA 3SFMA 3V6DA 4KUIA 3UR3C 1Q82R 4M7AF 3CF2A 1MPGA 4CEFA 4M78A 2DT5A 5LJ3d 3Q7BA 5GMKi 3DV8A 8AT1B 4LD5A 2P5GA 3I55I 3SEZA 4JQFA 3T1BA 4RA2A 1DUXC 4L8RB 5FPMA 2P9KA 3H0IA 1NJXA 1UG1A 4DEYA 1I3QJ 1SS6A 5DM7L 2NS0A 1DDNA 3HHTB 2ZCWA 1SVLA 2I7NA 4CJQA 2DFFA 5GAMj 2XV4S 3B6OA 1ON1A 5DCMB 4IHTA 3NGZA 2L7ZA 3ISNC 3UT1A 2DERA 1A5VA 2HBLA 1HCRA 5AQRA 2RHIA 1YI2T 1UE9A 4ELTA 4KIBA 1BGXT 3HSRA 1QQJA 5KN9A 4P9UA 4CFAA 4FYXB 4DU3A 4DR4K 3PQKA 3NRVA 5LRSA 2EWSA 5BN9A 1RADB 3I58A 1HF0A 1U06A 2ZF5O 1XTDA 3V42A 4FLXA 2YKNA 4BHBA 1YQRA 2DXBA 4PSXA 4K41A 2IW5A 1BISA 3SUNA 3S17J 1K0SA 2DFIA 4DNCA 5J2PA 2DA6A 1HXDA 1MH4A 3LM9A 1PP8F 1TV6A 1ZREA 2OTJT 4AIKA 1V3FA 3DLBA 1YJNQ 2YHAA 3LPTA 3A8LB 4DV3K 3SEMA 2CT3A 2H8HA 3MO8A 2JTEA 3IDHA 1ZH5A 4YIFA 3BCBA 1BA0A 1M3BA 3TARA 1MMSA 3FKJA 2PFBA 1YWPA 2WTEA 5GAGJ 1I5LA 3SFZA 5HCKA 3RIRA 2Z16A 3LCNA 2UUCK 5CYQA 2J4RA 2R7RA 3RQIA 5LJ5g 4JK8A 4A0YA 3HFNA 5JICA 1S72T 4N4NB 4BC2A 2PNIA 3DLLF 4M78B 2UUAK 3VDXA 1QLYA 3V1QA 4BRAA 3C18A 1PWTA 2LMJA 4LDWA 4PLLA 1T6DA 2SEMA 3AARA 3KP7A 2O8CB 3QODA 1VQPI 4AMCA 1X1BA 2MLKA 1X6BA 1S9GA 3R3LA 3CCRT 4J01A 3CVTA 4KA4A 4UNFA 3H0FA 1OVQA 2QDLA 3TTDA 1M2OA 2CP3A 4E9GA 4RMNA 2E2NA 3CMET 2E65A 2DA5A 1FP2A 3VGMA 2RI2A 4UQGA 3MKDA 1JHFA 2BY3A 1Q86U 2CDTA 1VQ8N 3RKQA 5IP9J 1EP4A 1S7EA 3DKYA 3C7NB 1YHQI 1P7IA 3BJAA 4FT4A 1NK4A 4EQQA 7AT1B 5JLWA 4KHPK 3BTCA 5KCMA 2C6YA 1JGSA 5ILUA 1K9MC 1RACB 3DYAA 3K57A 5HNHA 4H03B 3ABMH 3QIPA 1G6NA 3CJ7A 1VYVA 3LP2A 4FWKA 3M9AA 5J4YA 3TTCA 2D0AA 3O3FA 1IXCA 1VQ9Q 3G0QA 3S3MA 2O4IA 3UKRB 4JX6A 2NRWA 3TKYA 3QWYA 1U8RA 1S3XA 1YRNB 3GVAA 1DGKN 5EGOB 4RW8A 3K70D 3THYB 2NS8A 1MA9B 2R3SA 3F70A 3NHGA 4PJOF 3THYA 1UOCA 2IBDA 5J2QA 1V4SA 4C3JJ 3VS2A 1R7JA 3OV8A 2DETA 1LEAA 3LDNA 4NBQA 4MZTA 3CWUA 4QQDA 3H3OB 1X9JA 4J9GA 2VI6A 2V26A 1VOMA 4L59A 2Y31A 2QGUA 1VTNC 4NO7A 4CJ4A 1ODDA 4BUPA 2BUDA 2BE9B 4J19A 1I4K1 1UAXA 4HX8A 2W41A 4E4HA 1MNMC 4OFAA 5FKOA 2ZM6K 4C2UA 1N77A 4RCBA 3AVMA 1TWCJ 2PQWA 2NNWA 4JKBA 4XTUA 4WCEL 1G83A 2XF7A 2AIRB 1XDSA 4L0ZB 2ZPFB 1ULYA 4FLTA 1DQUA 1PVEA 1NGAA 4K25A 3LAJA 2DBKA 1L3LA 1O3QA 1VQ4A 3TP0A 1C1AA 4DR2K 2XRIA 1NH3A 1LVAA 5CVJA 4ME7A 3WVEB 1D0ZA 3M54A 5FLXZ 4IFEA 5AIPA 3KZZA 5CYMA 5GAEP 5CHIA 4CECA 2JA8J 4Z89A 4XKBA 1PNJA 4DTJA 3DQVC 5LGNA 2IG0A 4CGIA 2QQ8A 2PMUA 2VASA 2HD0A 2PN6A 1KU3A 2D45A 3KFWX 3HIFA 3ABTA 3OIOA 1NK8A 3FGUA 5J8FA 4UV9A 3ZQHA 3A2FA 5KYYA 4Q4ZF 3QG1A 2QA4A 4M7DF 2HZYA 4CHPA 4IUUA 3ZT1A 1MH3A 4G9ZA 3LWIA 1KVAA 2DD5A 1D3YA 4HV6A 4CF1A 1IRXA 3KEYA 2VQFK 2I7PA 1YS7A 3O9QA 2M0CA 3HRTA 3VF4A 3PE0A 4I02A 2CW7A 1Z6TA 5GIOA 4M73A 1YRNA 2CYZB 3EGXA 3E5QA 3LSGA 5J3BA 1WHLA 1GRIA 5BRHA 3CWAA 3M5AA 1NK6A 3CCLA 1VQMI 1RT7A 1VK0A 1O4XA 1PKSA 1OZ3A 4M7DB 2M2EA 3QYFA 4IOAF 1UUEA 3H5NA 1FKPA 3M8FA 2LQ8A 3V9ZA 3R6MA 2A6TA 1XSDA 3FEOA 5EG0A 4FASD 3DPUA 3CJ9A 3KP3A 4X34A 9ATCB 4KN4X 5GJWB 2P5OA 4JHDA 3VA3A 5BS6A 4EA4A 2KYBA 1P4WA 3PUFA 4AU7A 3G71I 4NYNA 1LNWA 2RQVA 2KQRA 4MLOA 3OH6A 3CBOA 1FJLA 2L9VA 1HKCA 2GFAA 4ZTJA 1KG3A 3GYHX 1TOVA 1V29B 1YITI 4FWLA 1TGOA 4N76A 5GTHC 2JJ9A 4CHZA 3PIOL 2K79A 3W2VA 2JVVA 1CGPA 1IN6A 3T1AA 1FN7A 1IHWA 3VEWA 1K8KB 2G8HA 1J5YA 2KK4A 1YJ9N 4C8QG 1USTA 1Q81R 1IW7F 2CSQA 4HCBA 5LBQA 4P5OA 3G4SQ 1Q7YO 2HKOA 4CERA 3ZGKA 2RGVA 2CGJA 4A2BA 3HXMA 1W0UA 3GW2A 2RD1A 4EMSA 2M87A 2D1HA 5ILSA 4BI3A 5FO5A 1K76A 1J2XA 3C6HA 3QU6A 2FNPA 3FZFA 1I8FA 1QE1A 4IO9F 3WU2C 1T6SA 1ZTRA 3CPEA 1RT5A 2ZPHB 1ZQ1A 5AQQA 3G6EI 5D6FA 4N4IA 5GAMg 5J39A 1B9FA 2OYQA 4B8XA 2M9UA 3SYTA 1MJAA 2X6SA 2CGHA 3TO9A 2R7OA 1QVGS 3WGGA 4I76A 4UHTA 3KFVA 2O8XA 2FZGB 1YITA 4WF2A 4NCAA 3FZHA 2EW3A 2E1YA 4CJKA 3J7AF 1ETKA 3NAUA 5AJ3K 2AZVA 1SFXA 1D0XA 4II3A 4AFZC 2GCXA 1K4TA 5GMKl 2HEQA 3S14J 3CC2A 4O5FA 4IO8A 3OS2A 2DEQA 3JCUC 1KRPA 2R5YB 1B7TA 1UTIA 3NEUA 4XU2A 3K10A 4YIIA 4EVVA 2VJJA 2QAZA 2VG6A 1SAZA 1QCOA 1ZUUA 3OSGA 3U9GA 3R6NA 2JMCA 3JRCA 5TKWA 1E0EA 3ZRGA 4QSHA 3PO5A 4XN3A 5KAIC 1K6YA 3A5ZB 5F0FA 2M5WA 2A7YA 2H3EB 2ATQA 4EIKA 1Q82O 1JJ2S 4MFBA 4M77B 4C9YA 2DE0X 4NUBA 1VQ9T 4U7BA 1U4BA 5KYXB 4Z6YA 1YJ9T 5KCOA 1BI1A 4RAYA 1RCHA 1RAIB 1VQ9N 1RI0A 3VOEA 4I2PA 1G3TA 1JJ8C 4BR4A 2M0YA 1TKDA 1XI1A 3N5NX 4YELA 2CQNA 5H6QA 2L3SA 5DPKA 1YI2I 3CFRA 5EZHA 4IRGA 3F10A 4M9SA 3ULRB 2VWJA 3I4NJ 4Y0WA 3V7SA 1O9SA 3M0SA 1IG7A 2BKDN 1AOYA 1YIOA 2D8JA 1YJNN 2HFHA 4DGWB 1UHCA 1BG3A 4B3OA 3AVCA 2PVOB 3EKUA 2GWKA 3M0RA 2QQAA 2LZ6B 2YCHA 4A62A 2MSYA 1U2WA 2DMUA 1BR1A 2DN0A 3LDOA 1MJBA 5IYCJ 3AO2A 2HDDA 3HVRA 1X4OA 2YG8A 3LL3A 1IXDA 4KREA 2K3PA 2YDLA 2W0ZA 5JFRA 2YHBA 2G3RA 2KFNA 4PFZA 3C6AA 4C5HA 1MBKA 3U8XA 5KVRA 3LA7A 1ETXA 1Z1DA 2CP0A 3ZSRA 2E6ZA 2DODA 2QTVA 4FVUA 4F2RA 4UV8A 3WEEB 2FEZA 2JS0A 1FSEA 4M7DA 2UXNA 4S0HB 1EWQA 4CIGA 2MGQA 1VHXA 3Q1JA 2ZQBA 5TGTA 2CFXA 2G7HA 4FW1A 4LF6K 1YI2A 1Q9YA 3Q5FA 2QWLA 4A3KJ 1RDUA 2H1KA 4HX4A 3SWNB 4BR7A 2HQ5A 3OYDA 4DV1K 4IRIA 3ZN1A 4E70A 3CC4Q 2YWWA 4O0JA 3NFAA 4FM0A 3KK3A 5I2SA 1KEAA 2PI0A 3ZR8X 2FRYA 3I5SA 2ZPBB 4XRSG 4XOPA 3CCUA 2CH5A 3CQYA 2W7NA 3MECA 4CGGA 3E19A 1MZBA 3SK3A 1QA6A 1RAEB 2HNIA 2BV6A 1H1VA 2L02A 2BEOA 4IO9L 3SD4A 3LW5E 2EIKH 2DYBA 2ZWHA 3K4CA 5F1JA 4OWRB 1L5UA 4JI4K 4FLWA 2VQLA 1D5AA 1YJNT 2X9HA 4NQWA 3FXKA 2WWYA 5KPTA 2NVYJ 3K0SA 3EG0A 3A5OC 2VOPA 1VQ4N 2V6CA 1A0NB 2DXIA 1X2NA 4JK9A 1LMZA 1ETVA 2LC2A 3GIBA 2E34A 4J83A 3OIPA 2G8VA 1WEGA 4OIRF 2RQWA 4Q47A 1TT5B 4NYFA 3M56A 1AT1B 3GTLJ 3AA2A 2ETHA 2I5UA 2EAYA 1B8IB 4KBOA 5JVHL 4DR1K 2XY6A 4M42A 4OLAA 2E19A 2NOGA 3QB0A 5CKTA 3I5UA 3FXJA 4EV0A 4CEDA 4DFJA 3AO5A 4AIJA 3PVQA 2QKLB 2OTJI 1O57A 1M2VB 3LDQA 1MWMA 3VB2A 3PMIA 1T3LA 2XIGA 3VSLA 3LDSA 4KIFA 2JTFA 1YT3A 1VFCA 1DPRA 4Y15A 4JAXA 2VBXA 3K1NA 4QPOA 4BR0A 2YRVA 4D7NA 4FW2A 3BG9A 3H3UA 2A6EF 4R56A 3OL3A 1MBJA 4BJ6C 3K0LA 1JJ2A 4NNJA 2QEXT 4DQ2A 2WB1N 2DNUA 2VT2A 1VQ7Q 3I55T 3CC7Q 1GXIE 2J06A 3AVNA 2JUGA 3KTUA 1WLJA 4B3AA 1SL2A 3JCMQ 3M4OJ 1ASVA 4IOXA 3AKZA 4E47A 3M6GA 2XGXA 1QQNA 1S6LA 3UKUB 4LF9K 5JHFA 2NUPB 2HVQA 5DD4A 2PJRA 1D9FA 4Y1CA 1HMVA 1GL5A 1IBLK 3OTOK 2KW4A 3G6EQ 2DT6A 1WN7A 2IJLA 5GMKe 2QA4Q 3G1MA 3E9OA 3LZIA 3ULDA 4IEEA 2XICA 1RDWX 2YJFA 5FLXE 2KKOA 1RABB 2HBWA 1QQCA 1WOQA 3LGLA 1N8RC 2CUFA 2X6OA 1EXQA 4BACA 3L00A 2EKOA 5IXBA 3VQ4A 2QWWA 1HW2A 2E5ZA 5DM7R 3QEWA 4ESBA 1KU9A 4UY8I 5KTQA 2QTDA 1HQEA 3CHWA 2KQWA 1HR0K 3HTSB 1R6RA 2HOEA 3MHXA 3OVNA 2V1QA 2QW9A 4KH6A 4MZMA 3DCFA 5GANe 2HQRA 4UY8O 3O8MA 4CJEA 2JPSA 4P55A 3UATA 3FZKA 2LMDA 2GLOA 1R4NB 5L3EA 2K9LA 2DXUA 4CZGA 3ZQQA 1BL0A 1KG5A 3N5BB 4J9CA 4MO5A 2DMPA 1CKBA 4L3QA 4PL7A 4GDFA 4QQ6A 1NJYA 3SZGA 5LJ3g 3WODF 2PAVA 3E6DA 3G71Q 1HNIA 1QVFM 5E17F 4M7DE 4XH1A 2PMZA 4PJOD 2GWRA 1QBJA 1UHWA 2CP7A 4E1MA 2DDAA 3UB5A 3VYHB 4BUGA 3HRMA 4PGGA 1KHCA 2VG5A 1KD1O 2XY8A 4DSKA 1A6QA 2M30A 4E2FB 4N41A 4HUFA 2O7OA 3INZA 2GXBA 4A3JJ 2MIOA 2OQGA 2BY1A 2HHQA 5E20A 4C92G 4CCNA 4Y7NJ 3NH2A 2VJIA 3W3DA 2E7XA 1HKGA 3O1BA 2X35A 3DLGA 1MU2A 3J7ZI 2GV9A 2XG8D 4FHTA 5DTDA 1JKOC 2VCPA 3CC4A 2IVMA 1ZRFA 1LPLA 4F9OA 4MHGA 3OR2C 3FJ5A 4CHOA 2QVOA 2GOMA 3V4GA 1ZRCA 2FE3A 2RHKA 5JS1A 1PU7A 1XGNA 1A36A 5EDNA 4J9BA 4FZXC 4EJWA 5AQWA 4M6YA 1VQPT 1N33K 4I0BA 3ZETB 1OCRH 1MSFC 1FY7A 4PK4A 3ZT4A 2OFKA 5I9EB 1WJFA 2RMOA 4RTZA 2K9MA 2NOIA 1Y8RB 2JLEA 2PVGB 1ZSZB 4QVDA 4FJ8A 4FL9A 3DEWA 2KLOA 1NOYA 3T69A 5FU7C 5E3NA 1TNSA 5DCMA 4KDPA 4CZKA 4EW4A 4X6AJ 4CEAA 1VSLA 1QHAA 1SKWA 1RAAB 3BY7A 3HTRA 1HQUA 2F5EA 3SZTA 2GTJA 2AP1A 1SHGA 4C92C 3A98A 2WC2A 3CEYA 3BGRA 1QNTA 2X6XA 4BBRJ 2ZJ2A 3JAME 2Z33A 2CJJA 3RMBA 1SC7A 3W6VA 4XM3A 5LLQA 1U84A 1SVMA 2E6NA 4EFHA 3DMJA 4CBXA 2DMNA 2LNHB 4V2SA 4JK1X 2R92J 4A3BJ 3I8DA 3OOUA 2COWA 3G4ST 1JLAA 3AA5X 1B9MA 4GV9A 2JWTA 2O9LA 4G7OF 2H1LA 1PM3A 3BQZA 1U6GA 1ITGA 3SUOA 5GAMh 3R8EA 5D4SA 1KU7A 3BJOA 3TL4X 3CP2A 4O6JA 5B3SH 3AG4H 1BU1A 4IZ9A 3ZQ7A 1HJDA 1RBTA 4NL2A 1BIBA 1Q95G 4L9JA 1H3ZA 4KT5C 3CQXA 3VEPA 5JR3A 3O6BB 5E3MA 4L6V5 2R5ZB 2D8HA 2JA2A 2E6LA 2X0LA 2MFZA 5GANj 2OI3A 1ENHA 4G1QA 3ZT2A 3EZWA 4G12A 1RAGB 5J2MA 4JI3K 3VQCA 1NLPC 4JBAA 2JSCA 3ECHA 3HOUJ 3W3CA 1WDXA 5JS2A 3I4MJ 3OOPA 1RKTA 3G71T 1RUNA 5FLXO 3HFOA 2RVCA 5HLGA 4BR2A 2TDXA 2W48A 4Y92A 4GVEA 2A08A 4C92B 2BIVA 2X9DA 1G3YA 2HSEB 2L89A 3I56N 3PIPL 2KYMA 2YX6A 2E3HA 2Y2ZA 1MMGA 1Y96B 3CPFA 1RDCA 4DZJA 2A40A 2E2JJ 4XR6A 5IAYA 3LSKA 3J80K 5FWBA 2EJGA 3LSPA 2ISYA 5HNFA 4GMJB 3BCAA 3Q9SA 4A3FJ 3D5RC 1YE9A 2WAQA 3WGIA 2L3DA 2O4GA 3UDCA 1EA3A 2WC9A 1ZLKA 1MKMA 1W9HA 1ETWA 2XHIA 2RHZA 3LWLA 2PZSA 3I59B 5KE3A 2MCNA 4DYQA 2HVHA 2K40A 4H0YB 5T7BA 1VQMA 2W84A 2F4OB 3MCAB 3KETA 4L9TA 1BUPA 1NGHA 1KFZA 2WFBA 3LSHA 2JHJA 2JVHA 2YUNA 1BOBA 4GY5A 1YN8A 2JQ7A 3ITHA 3CLOA 4FXDA 4U87A 5J47A 3WGHA 2IT0A 2XPUA 1NOZA 5AQGA 4AIAA 2M4GA 3FDYA 4GFBA 1A6IA 1LAVA 1WHGA 4QS9A 4DU1A 3SHWA 2W57A 4FOIA 5LEJA 1DIZA 3PSFA 3ENBA 2DPPB 1HYVA 4JV5K 3V1OA 1X75C 3H1CA 3URGA 4A59A 2MH2A 1BB9A 3D7EO 1IUFA 4AM6A 2OX7A 2YKMA 3CJQB 4PJ0C 4UVBA 5KNLA 3I4PA 3VEXA 4DK9A 3C2HA 5K1YA 2LDUA 2ZNYA 4ZN3A 4IUQA 3E9PA 1XG1A 4NQWB 4X9CA 4OKJA 2X4WA 4HA8A 4GXOA 3THXA 2ZMEC 4HCZA 5KRTA 3OYNA 4OB0B 1E3PA 3IUOA 4M74A 1QCFA 5GAN3 4UNOA 2OFIA 1M1KR 4M7AD 4I7FA 4IL6C 4JX5A 1OQKA 3V81A 3A0BC 3QBWA 5AQZA 4A5BA 1UHSA 3CXCM 3H08A 3AA4A 4IFYA 1PU8A 3DLRA 2D1XA 3ECOA 1G99A 4J2EA 5AQMA 2JW4A 1DP7P 2AA4A 2D0NA 4KISA 3ULEB 2XD0A 2JTVA 3CMEN 3OYKA