4E7KA

Pfv integrase target capture complex (tcc-mn), freeze-trapped prior to strand transfer, at 3.0 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
366
structure length
366
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 96
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7kA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7kA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7kA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7kA03
2XO7A 4ZTFA 3MP8A 4LD0A 3QIIA 2HHWA 4W5RA 1BI4A 3ZSXA 1N5YA 2KZMA 1WSGA 4M3RA 1GOAA 1D9FA 3D45A 5FRMA 2GUIA 1N6QA 1RT3A 3SV4A 1EX4A 3OYAA 2B8AA 2O4XA 3FEOA 3KKSA 3MAQA 3SQ2A 3OYCA 3M9QA 2WONA 3NF8A 1K6YA 2O4XB 3T19A 3T1AA 3PX0A 3KD5E 2EFIA 1FKPA 3NTKA 3O3FA 1LAWA 1CXUA 3P8HA 4FU6A 4E7LA 3K57A 5HLFA 1UAXA 1X9WA 2VG5A 3QESA 2RI2A 4M41A 1JLQA 4A4FA 4CJLA 1O1WA 4AHRA 3K5MA 3CEYA 4QQGA 2BE2A 4NCGA 4J2BA 3O8VA 3K5OA 4GW6A 4LD6A 4F8RA 3AO2A 4CEQA 3MEAA 1EKEA 3AO4A 1VSIA 4CFCA 1FKOA 4NCBA 3HPGA 3NF9A 2E6LA 5KGXA 3O3GA 4FLXA 3F70A 4E7HA 4Z02A 3ZT4A 3NGIA 1ZBLA 4J2EA 1FXXA 3OYFA 3A2FA 3TAMA 1S1UA 1WJQA 4AH9A 3ZSZA 4CFDA 3EZ5A 4O44A 3AA2A 1L3VA 4FK0A 4KB1A 1RT7A 1WSJA 4KHSA 4OVAA 1DLOA 3O4NA 2B4JA 3ZT3A 4N4IA 3AVGA 3CYMA 4IG0A 1KFDA 3U3YA 4FW2A 2HMIA 1C0TA 1TAUA 2VG7A 2JTFA 1JLBA 3DB3A 3MP6A 4E7IA 1S6PA 1XI1A 1T03A 4DSLA 1U47A 4W5TA 1EETA 4CFBA 3HSTB 3L2QA 2F8TA 5DK5A 4IDKA 4M3ZA 3LPTA 3DLHA 4CEFA 4GMJB 3NAEA 3QNNA 4NS5A 1IKXA 4O4GA 4CEOA 3ZT0A 4DTOA 3RRHA 2YKMA 4E19A 3TAFA 4CHNA 4XIUA 2YV0X 2X4XA 1WAFA 5T7BA 4Z4IA 1RDCA 1YT3A 2G8IA 1TKXA 3DI6A 3V81A 3KJVA 4B9WA 2OPSA 2IGIA 4BD3A 3DYAA 3OA6A 3LLRA 4C5GA 5DMRA 4CGJA 3SUOA 1ZYQA 2L89A 4N76A 2AJQA 3S9HA 3EY1A 2YRVA 2JZ2A 3LWMA 3D0PA 4NYFA 1NOYA 1RTDA 2MWPA 3SNNA 3C4SA 3LAKA 1CZ9A 1S6QA 3VN5A 3Q1JA 4HUGA 3SI6A 2XRIA 4PWDA 3PNWC 4CJEA 4O55A 1DTTA 1Z25A 3SUPA 4ZHRA 3KLGA 3KK3A 1QE1A 3PFSA 1BGXT 3QBYA 1TL1A 4CF1A 4X34A 2B5JA 4OVLA 2HNYA 3S3NA 4FLWA 2G8UA 3M8SA 4FYDA 4CJTA 1HRHA 4RG8A 3V4IA 3THVA 1NOZA 3CG7A 4LH4A 3VQ6A 4AHCA 4UQGA 5KCOA 4DTRA 4FJIA 1J54A 3VA0A 4KRFA 2E4LA 1VRTA 2FBXA 4OKKA 3ZT2A 2P1JA 3P1GA 1UA1A 4PY5A 4M45A 1OI1A 3HM9A 3LGFA 3B6PA 4Q5VA 2RJDA 1KRPA 3MO8A 2FBVA 4F4KA 5KRSA 4DSFA 2G8WA 1QTMA 3ME9A 3OYGA 3DRRA 3HK2A 1RBSA 3LWLA 4DTSA 2D0CA 3OYBA 4KREA 3F73A 1VSHA 1RNHA 1BHLA 3HT3A 1SKRA 4M3UA 3CFPA 2HHVA 2DY4A 3P5JA 4CGIA 4N56A 3TAGA 1IG9A 4B3OA 2HQXA 1GOCA 2FBYA 4QW2A 2FHDA 4DFKA 2D0BA 3PMIA 3OQ5A 3QKJA 4DQRA 4DU3A 3FC3A 1JLCA 4LY7A 4RW8A 2OPPA 3RTVA 4KI6A 1IKVA 1RBRA 4JRQA 1S9EA 3AVJA 3E9FA 4CEDA 3V9ZA 1U49A 1DTQA 3MXJA 3M8QA 1C0UA 4L59A 2P51A 2DFHA 3LP1A 3QLHA 4E1NA 2RHYA 3VQBA 3OYLA 4CFAA 4GVMA 4YNQA 3KK1A 3OY9A 3OYEA 3SPYA 3MXMA 1NJXA 2QXFA 3EYZA 2ITGA 4CHYA 3WNGA 2F8SA 4OGCA 4FJ9A 2KZZA 5KGWA 2YHBA 1CXQA 4CERA 4CJPA 3QEPA 3CM6A 1NK0A 3CFRA 4B9UA 4FJKA 2BIVA 2DIQA 2B6AA 4FLUA 1QSYA 4Z4FA 1L5UA 4KHNA 3LH0A 1L3TA 3NGYA 3OJUA 1WJSA 3MEEA 4K8XA 3V9UA 5FRNA 1WAJA 2HW3A 1C6VA 1KVAA 3SPZA 3OB9A 3NCIA 2QKKA 2A1RA 3DLBA 3LAMA 4RW9A 4AHUA 4C5HA 1T7PA 1BISA 1JLAA 2F5KA 5J26A 3OYIA 2RPIA 5I3UA 3L2WA 4KV8A 4DTMA 2XY8A 4CJQA 5JS1A 1EP4A 1VSDA 1W0HA 4CJ5A 2OYQA 4E7KA 4AILC 4H4OA 3ITHA 4W5OA 1WSIA 3K2PA 4CK1A 3RRGA 1SL0A 2GBZA 3UWNA 1RTIA 2EQMA 1WN7A 2EQJA 1R0AA 1RT2A 3FLGA 1TL3A 1RT4A 3AVKA 5KI6A 1BQMA 3KUFA 1ASVA 5HRSA 2KFNA 2LDMA 4F3OA 4C8LA 4ELVA 3LGLA 1KVBA 3DMJA 3O4QA 1QSLA 3HP9A 3VQAA 4CJWA 2QKBA 4DLGA 4MQ3A 1S5JA 3OYJA 4CCHA 2LTOA 1C1AA 1JLFA 4IFYA 1XC9A 1XWLA 3DM2A 3NFAA 1J53A 4FJHA 4O0JA 4I7FA 3I8DA 5E41A 3HXMA 4KHWA 3MEWA 2M1HA 2RHUA 2E5QA 1A5VA 3PO5A 4E0DA 3AVFA 1NJWA 3BDLA 4BDZA 4DFJA 4B8CA 3NE6A 4DLEA 4CIEA 4IUQA 1ZBUA 4DFMA 4PA1A 4CF0A 1LW0A 4OKJA 4DWIA 4FM0A 1WJRA 3V9WA 3OS1A 3OS2A 3AVLA 1MHNA 2RJFA 3MP1A 1RDAA 3E01A 3OS0A 3TR8A 3VQCA 4Z4HA 3NH1A 2FC0A 1XHZA 4DU4A 1RBUA 1JXBA 2L8DA 2RN2A 1REVA 4PLLA 4CHOA 3LDSA 3RR7A 4OLAA 3VQ8A 2IAJA 2XHBA 2RHXA 3BDPA 3QIOA 1IKYA 2PY5A 2GF7A 4FJMA 1Q9XA 4DS5A 4BWJA 4IUTA 4JLHA 1VK0A 3LANA 3VQEA 2DFFA 3SQ1A 4Y1DA 1BL3A 3TAEA 3L2UA 3AO5A 4DQIA 4FJJA 1CLQA 2RO0A 4CK2A 3AVBA 4CJRA 1QQCA 4FK4A 2XDPA 4DSIA 4M3XA 1TAQA 1TKTA 3AVAA 5C25A 2X4YA 4FLTA 4DTUA 4M42A 4Z0UA 3ULDA 3QEWA 1LAVA 4G1QA 5D6WA 4KI4A 1RILA 4CHPA 1C1CA 1IH7A 3WNEA 2A1SA 3S3MA 3VQDA 4FJGA 3SV3A 5J2PA 5CZ1A 1WLJA 3NH2A 5FROA 2Z1JA 4EP5A 2BANA 2G8FA 3GOXA 4BE1A 3RMDA 2QK9A 1SKSA 2P5OA 4FL6A 4Z4GA 3WNFA 2XY6A 2VWKA 3C94A 3IRXA 3AA5X 3ZSYA 5CY4A 3NDKA 4UC4A 2YNHA 2LVMA 3PX4A 4FJLA 2EQUA 5D6YA 1KCFA 2G8HA 3AO3A 3OVNA 1X9MA 1RDBA 3OMGA 1B9DA 1VSMA 1X9SA 4KAZA 1IO2A 4QAGA 3ZSRA 1NK4A 3NTHA 2X6NA 2HHTA 3S6WA 3DLMA 5J2NA 1HQEA 4FJ7A 4CJKA 1NKBA 2NLUA 1W9HA 5CYMA 2EQKA 4DQPA 4CEZA 2JLEA 3S3OA 4B9VA 3AVHA 3DLEA 4QOZB 3H6ZA 4C8KA 1NK6A 3HVRA 3K59A 4E89A 4ELUA 4M3WA 2OPRA 2IG0A 2HB5A 3OYMA 1C0MA 3DOKA 3K5LA 1XNIA 5KCHA 4CJVA 4E3SA 5CYQA 5J39A 1C1BA 2EX3A 3H08A 4OGEA 5C24A 4EZ6A 4C8NA 4IKFA 3G0ZA 4F3TA 4N4HA 1FK9A 3IS9A 2BGGA 1SSFA 2K3XA 2D5RA 5JS2A 2K3YA 1TKDA 3DB4A 2G3RA 3P83D 1U48A 3CM5A 2LRQA 1YVUA 1EXQA 2RHIA 1J9AA 1OYXA 2RI3A 4IUVA 4CJ4A 2PZSA 2PYJA 2HHXA 4RG2A 5SWMA 4ID5A 3U3GA 5IN1A 3SZ2A 2YNFA 3DLRA 4B9XA 4CF9A 3ZSWA 4OLBA 2IDOA 2RKIA 5KTQA 3NH0A 4IG3A 3EAEA 4OJRA 2BKDN 4C5EA 2KW4A 3VA3A 3MECA 3V9XA 3AVMA 3U6FA 4F2RA 4W5NA 2X78A 4GY5A 3OYNA 2O4IA 3MEUA 1HPZA 4Y1CA 4KPYA 2PYLA 3C6TA 4B9TA 2XY5A 5KRTA 3KKRA 1SKWA 4MFBA 3LZJA 1NK9A 3NBPA 4KFBA 3NGZA 4FJXA 1NKEA 4CE9A 5HP1A 5HRNA 2X6SA 4J2AA 4HUEA 1HQUA 2HQEA 3V6DA 4LSNA 1ASWA 4DMNA 4KHYA 2LCCA 3L2VA 1JL1A 1I3AA 2RHZA 4HCZA 4QQ6A 2GFUA 2Z1GA 3I0SA 3QETA 1SL2A 4FLZA 1NJZA 1NJYA 2BUDA 3DOLA 2Z1HA 4LH5A 1XHXA 4I9LA 4HTUA 4BDYA 1HYSA 4KKOA 3V1RA 4DSEA 3I0RA 3HJFA 4RW4A 4FM1A 4CECA 3K5NA 3O3HA 3QEIA 3OYKA 2L3RA 3RWUA 4DFPA 1ZBIA 1BIUA 3KLHA 1WSEA 1KHCA 3TWHA 3HPOA 3RMBA 4KTQA 3P8DA 4DTJA 4CJ3A 2NUBA 1B92A 4C5IA 4EP4A 3OJSA 4FZYA 4FZZA 1JXEA 3VQQA 1G15A 4CEEA 1J5OA 4BACA 3L2RA 3L3VA 4NCAA 4CHZA 3B6OA 3DLGA 4PUOA 1S1VA 4JS4A 4L8RB 2RF2A 3LX7A 1RT5A 4CJSA 4N41A 1TKZA 1G5VA 2RI5A 2OPQA 2R5MA 2ZD1A 1BCMA 1HJRA 5J1EA 4EDUA 3C6UA 3NF6A 3SYZA 4IUPA 3RMAA 1HYZA 1BI4B 4HCBA 3PUFA 4CJUA 3V9SA 3TARA 4B9MA 4QCLA 4KHUA 1RBTA 3LZIA 4CGFA 1Y97A 4A4HA 4FJNA 3HYFA 2HHSA 5C0MA 3PX6A 3VQ7A 1UOCA 3QO9A 2O4GA 1HNIA 1TGOA 3ZSVA 3TABA 1KFSA 3ZSQA 2IC3A 1KTQA 4B08A 2RJEA 4FM2A 4ZTJA 5M9OA 5HRPA 4W5QA 3RMCA 3QINA 3ZSOA 4B9LA 1S1XA 2JGUA 3M8PA 4H8KA 4CEBA 3MXIA 1UA0A 1SUQA 3QIPA 2P5GA 4Z4CA 4HHTA 3AV9A 4CHQA 4FJ8A 2I5JA 1ZBHA 2DTUA 4IUUA 3LPUA 2XY7A 2HNDA 1LWCA 3NHGA 2WOMA 1OZ2A 3H8ZA 5IAYA 1BCOA 1ZBFA 2LSNA 1JKHA 1VSKA 1VSFA 4B9NA 1L3SA 4FLYA 4CESA 2VG6A 2X74A 4F2SA 1ASUA 5HBMA 3CFOA 4C8MA 4CEAA 4NYNA 2CKKA 1RCHA 1TVRA 3BGRA 2OZSA 2HVHA 3SJJA 3QEXA 3SQ0A 3META 1A5WA 3M8RA 4TSXA 4CGDA 4OKEA 3LYIA 1LV5A 3PY8A 4N5SA 1NKCA 5I42A 1S9GA 3L3UA 4Q5WA 1RI0A 4IBNA 4DG1A 5J2MA 4CGGA 3JSMA 4FZXC 2M0OA 1VSJA 2FBTA 2QQSA 2R5AA 3UT1A 4CIFA 4DS4A 1KVCA 3L42A 1RDDA 4A4EA 4A4GA 4ICLA 3HP6A 4DF4A 1L3UA 1D8YA 2BDPA 4E1MA 2OZMA 1X1PA 1BIZA 4YFUA 4CJFA 2PQWA 2X35A 3HVTA 4WE1A 1LW2A 1Z26A 2OA8A 4HVJA 3LP2A 4DSKA 4B8AB 2GV9A 3NF7A 1JL2A 4I2PA 5SZTA 2GFAA 1VSLA 1B9FA 4JS5A 5HROA 1NK7A 4FK2A 3KLEA 3F9KA 3OYDA 2QQRA 3SCXA 5KE3A 3PO4A 2KQ2A 4RW6A 5C6SA 1S1TA 4DU1A 4BDPA 1YTUA 2YNGA 2RJCA 1VRUA 3VQ4A 4CF8A 4OPJA 1RT6A 3LALA 3AA3A 2EHGA 5K14A 4R5PA 3T3FA 3QEVA 4C8OA 4AHSA 1LWEA 1S1WA 3AVNA 4FVMA 2R7YA 4KHQA 5CIUA 1JLEA 3C95A 1TV6A 3OMCA 4KTZA 2M16A 1HNVA 5C42A 1QSSA 2ATQA 2Q3SA 4AHVA 2KFZA 3DRSA 3V1QA 4FJ5A 4I9QA 1KSPA 2EKOA 3AA4A 2HVIA 4K8ZA 4LSLA 2E6MA 2VYTA 1QHTA 2G8KA 1IKWA 4DTPA 2ETJA 3MEDA 3ZCMA 2IOCA 5EU7A 1NK5A 3AVIA 3ZT1A 2ZQBA 3HO1A 1U04A 4RW7A 4KB0A 2DAQA 4ID1A 1WSHA 2R58A 3VQ9A 3SUQA 5D3GA 1T8EA 4B9SA 1GOBA 2E6NA 3HL8A 4FLVA 4IURA 3TANA 4DTNA 3K58A 1U4BA 3QNOA 4M3TA 3PMTA 4HUFA 3KD1E 1KLMA 1VSEA 3NNQA 1Q9YA 3QERA 4E7JA 5D6XA 4I2QA 4FCYA 1KLNA 2R57A 3KK2A 3L8BA 3IG1A 5FDLA 5J2QA 4FXDA 4NZGA 2DIGA 3LP0A 3MEGA 2YNIA 4AHTA 1Q8IA 3FFIA 3G10A 3VQPA 4KTWA 3KIOA 3WNHA 3KLIA 2KTQA 3E9GA 1WNSA 2ZE2A 3DLKA 1TK0A 1SV5A 3ASMA 4DSJA 4DQQA 4BWMA 2X4WA 2G8VA 4ELTA 1QS4A 1I39A 3VQ5A 1H3ZA 3KTQA 2MWOA 3RR8A 4N47A 2HNZA 3JYTA 3TAQA 4DQSA 4II1A 1RT1A 4FW1A 3TAPA 4O0IA 4KO0A 5KE2A 3OYHA 4CF2A 3ALYA 3KLFA 3ASKA 4Q0BA 3PV8A 2XK0A 1LWFA 1WGSA 5HRRA 2P0KA 1F21A 2Y1IA 2D0AA 3ZEHA 4M3YA 3LP3A 4DTXA 3SD4A 1D5AA 3NTIA 4PL6A 1OZ3A 1CZBA 3HPHA 2VWJA 3DRPA 1TK8A 3V1OA 4CGHA 3TI0A 1A5XA 4CK3A 4CRIA 1D9DA 4QQDA 4OPKA 3AVCA 3ISNC 3QJ6A 1ITGA 1N27A 3AO1A 1WSFA 4IFVA 4O5BA 2WACA 4BE2A 1U45A 4Z4EA 1TK5A 4JRPA 1YTAA 4HCCA 2Z1IA 3CQ8A 3SQ4A 1JLGA 1RTJA 1T05A 3IAYA 2Y1JA 3MEVA 4EZ9A 3UIQA 2F96A 1HMVA 4N4GA 5CZ2A 3FDRA 2HHUA 5KH6A 4DF8A 2YKNA 4BE0A 2HHQA 1UWBA 1SL1A 1RTHA 4PLIA 2DFEA 4H4MA 4J2DA 4CIGA 1MU2A 2W42A 2YHAA 2D9TA 4PQUA 2IS3A 1RBVA 3SUNA 1BQNA 1NK8A 1HYVA 4QVZA
chains in the Genus database with same CATH superfamily
3DU6A 4W5RA 4GDFA 2XGEA 2KQRA 2QSGX 1MV0B 4P1WA 3OYAA 4CCJA 2IS4A 2SEMA 4AFSC 2DDAA 2E35A 3FIFA 2IIRA 2P0PA 2COMA 5HODA 1AZEA 3ENOA 3QESA 3VYTB 3CC2Q 3M8FA 4DKWA 1R22A 3QP5A 4GW6A 2STWA 3ZEUA 3WE3A 1FKOA 1MJ9A 1HSJA 1O3QA 4E7HA 2A5XA 3NGIA 2FPFA 4CZFA 4A69C 2I7NA 3OIOA 3NEUA 1FC3A 1KQSP 1XPXA 1DLOA 3LL7A 3BG7A 5GAMf 3SZPA 2IXSA 1S6PA 4DSLA 1Z6TA 3BUZB 1S29A 4LLLA 2LH9A 2NOGA 2F8TA 4IDKA 1M8VA 4NS5A 1CKBA 2JMAA 1K73C 3HBLA 4GGGA 2P5KA 5IPAA 4B9WA 2IGIA 2UWMA 2L89A 1YQMA 2W04A 2GX9A 1K4TA 1KD1O 2O88A 1T6SA 1TOVA 4H5RA 3LAKA 1CZ9A 2IBDA 2HXIA 4DZPA 1Z25A 3H1CA 4PZJA 2GCXA 4FQGA 1ETWA 2B5JA 4OVLA 2NXNB 5D5VB 3D2FA 3CF5F 4RTVA 2XPWA 1W2BA 2HF4A 1U5SA 1ZHFA 3VA0A 1SD4A 2E2HJ 2DT5A 3WUHA 4F4KA 1JBMA 1OYIA 2HKQB 1GLCG 4II3A 3F73A 2ZC2A 3CCMA 2W85A 2HQXA 2H3EB 1GOCA 2XSDC 4RMNA 4E9HA 1X9JA 2R5YA 2G9WA 1FSHA 1DTQA 4I7HA 4L5JA 5ICCA 4YDUC 2COBA 1NGJA 1U06A 2YR2A 1HKQA 2QWMA 2NNYA 3FR0A 1VQNA 1U2VB 2KRHA 2CGLA 4EHTA 3MEEA 4K8XA 2QTVA 2F9WA 1WI7A 5AQUA 2YCHA 1T7PA 2O0YA 4UHTA 2VXFA 3G6EQ 1EP4A 1W0HA 1IB8A 4OMOA 3K2PA 3I56T 1U9NA 2GBZA 3CLQA 1R0AA 3AVKA 4F04B 5CJ9A 1BQMA 4BRLA 2CQQA 2JUGA 2G0EA 4YOXA 1VQMN 3FISA 1E7OA 3A1YA 3M0TA 1S5JA 1ILYA 1OR7A 2RNAA 3WTZA 2ZFWA 2E1HA 5KYNA 2KFDA 3F3XA 1JUMA 1SC7A 3EL2A 2JHJA 3JB9G 3Q3SA 3CJ9A 4JK1X 5LL6Z 2RJFA 4IRGA 5CK9A 4J00A 4CHOA 1VQKN 4KGZB 3J7ZI 3ZXSA 4IUTA 4BWJA 2OJ2A 5M1FA 3O9RA 4XKCA 1CLQA 1F1BB 1TYQA 3CWUA 2RO0A 4FISA 3LDNA 3EG9B 3IHOA 1WEIA 1WJFA 4N0AA 4ESRA 2CUZA 2CH4W 2P4WA 1GBRA 4IXAA 3TO9A 2MI6A 4JAXA 4M7YA 2XY6A 3IRXA 3C94A 2O01E 1RDBA 3OMGA 1VSMA 4QAGA 4C8QC 2EFQA 3GX4X 2DT7B 3M5AA 3K59A 4A3DJ 2NS0A 2W7NA 2DL4A 4R55A 3DOKA 1T6DA 3DU5A 4JEPA 3H08A 1AVZC 2QWPA 5HCKA 5JS2A 5GANd 1W4SA 4I6ZA 4M75C 4WCEL 2CH5A 3ULEB 5FLVA 1I4K1 1LNWA 1TU0B 4S0HB 5LJ5d 2AZVA 1MWMA 1D1AA 3PL8A 3HSRA 3AVMA 5KNLA 3RERA 2YPRA 4FJXA 4JKAA 5HRNA 1IW7F 4H0TB 3L2VA 4QQ6A 4F7UA 4CZMA 1MWKA 1P90A 3OW2P 2OU2A 2M8GX 1WSEA 3RMBA 4KTQA 1TW2A 1S7OA 4ISFA 4KH5A 1KG2A 4GCVA 3DTKA 4FSVA 1IUYA 1YJWA 3T7ZA 2BH1A 1RT5A 4YORA 4KT6A 4A59A 2RI5A 2DODA 1QHGA 4XTYA 3L1AA 2NOJB 1HYZA 4JJBA 4VUBA 1WXUA 3I33A 2FRWA 3CXCP 5JI6A 1TP4A 3SJMA 2IC3A 1SPKA 2JGUA 1NLVA 2NVTJ 4M77E 4H8KA 1IBKK 3S16J 4HHTA 3CDIA 2NUTA 3K4KA 5FLXE 1KU2A 5F1XA 1RABB 1M27C 5B5EC 2Q1ZB 4J9BA 1X3ZB 1L3SA 2M4KA 1YJ9N 1MDMB 2X74A 4CEAA 1BL0A 3TREA 4HBLA 3C3WA 2RQWA 3META 1A5WA 3HKZN 1HOMA 1NGIA 3VS4A 4GV9A 1UDLA 1I6XA 1S1NA 2ICWG 2NNNA 4DS4A 1N39A 3S2DJ 4A4GA 2BDPA 2ATCB 3IRQA 1YJNI 1XMKA 4CJFA 4YFUA 2FZCB 4WE1A 1LW2A 2MH2A 2ZPIB 2Q97A 1AA7A 2DCEA 1G6NA 1IXDA 1S72N 4D5FA 3V6DA 3T3FA 3U9GA 1S1WA 2NRVA 2KRMA 3U4LA 3OMCA 4KTZA 2Q3SA 3RTRA 3AA4A 4RM2A 3VKIA 3JAMO 3SAGA 3SUQA 2FF6A 2LT1A 4H0OA 1M1KO 2AS5F 4E9GA 2YRDA 1TTYA 2IGKA 1KLMA 1IV0A 1YHQA 5B1BH 2YUNA 4BAYA 1YIJQ 3C7NB 5BQTA 2EW3A 1P59A 1WOQA 2QAZA 2LK2A 3E9GA 2DJNA 3F5TA 5AYFA 3KFVA 1SV5A 1QS4A 2RKHA 2ID6A 3CMAI 1EZZB 2ELKA 5FLXK 3R6OA 1OPCA 5GAGP 1D3BA 3A8YA 3BR5A 3S1QJ 3EFSA 1ODDA 3CCST 1XCVA 3ABKH 2WY7Q 1BYMA 1QBJA 2F2XA 2F96A 5CZ2A 3G73A 1YNZA 2HHQA 4K42A 2YUOA 3O6WA 4O5VA 2VVKA 4B1YB 1T08B 1Z05A 5LJ5h 2HXOA 4M75G 2B8AA 2DOAA 4FWSA 2FNAA 4AUXA 3KD5E 3TW7A 1H9GA 1FKPA 3TSUA 5B8HA 1LAWA 4C92F 1IGQA 2M5WA 1WH7A 5DV5A 3VFZA 1HKSA 3EUHA 3BQZA 2GZWA 1TUDA 3OW2S 3ML6A 2VV5A 4IVNA 3OYFA 4AH9A 3O2PE 5AQNA 4AIKA 4KB1A 5D6FA 4DHYA 1NK3P 2M0YA 3CYMA 1KFDA 3RKQA 2L3QA 2DYBA 3JRZA 1ZQ1A 4M78D 2OTLT 5HS8A 2K9MA 3IWFA 2MLKA 4GMJB 2JN6A 3LWHA 2CGKA 2QA4A 4EM0B 3D5SC 3KJVA 5AQHA 3QWYA 4LDYA 1GVJA 3ONQA 5IT9K 2OX7A 3EY1A 2UZKA 4FWNA 4A5NA 4M73A 1M1GA 3C4SA 3Q1JA 4IOAL 4MO5A 4A2AA 1KONA 3KLGA 1CGPA 3I5RA 3THKA 5LJ5e 1M90U 4FT8A 1YITI 2HNYA 1YJNQ 2KE9A 2HU9A 5J8FA 3EGUA 3M56A 1UA1A 1VQKI 3OL3A 1ZSGA 1PU8A 1LFBA 5J1RA 4LIUA 4A57A 2D0CA 4CZGA 4C8QA 4RS8A 2L3PA 3BF3A 2EZIA 4M3UA 2QQAA 4N56A 2DA2A 3DFGA 3QUIA 3OQ5A 2QA4N 4KNYA 5K1YA 1AOYA 3VPRA 4EQQA 3A8MB 3LFKA 4M3GA 3ZETA 1MBKA 1O3TA 3DEWA 4JX6A 1YXQA 3JREA 4FT4A 2EGCA 1TTHB 1I3QJ 4LDUA 1JCGA 4E6RA 2TRTA 3FKJA 1W7AA 4DV6K 5JVHL 1RTIA 4CZJA 3D2EA 2D1HA 4B1ZA 5LJ3h 5FKKA 2CS7A 5KYWA 4B43A 4IEJA 4O0JA 2Z99A 5EY4A 2W10A 4EJYA 4IUQA 2Q0UA 1Y1VJ 1W1FA 1NM1A 4M75E 5AQSA 1YITA 3OS2A 3AVLA 4RGXA 1RDAA 3NH1A 1RBUA 2BV6A 4B3RK 2XHBA 5AIPA 9ANTA 4KH6A 3BC8A 1PHTA 2RGVA 5GAOn 3RIRA 3IMXA 1T39A 4A3CJ 4JLIA 2A5YB 1O3SA 1WIEA 5CZ1A 4DUZK 3HRMA 2IJLA 1SKSA 1FTTA 5FKOA 1KD1U 1KCFA 3G2BA 4KAZA 1VQ4I 3U23A 3NTHA 2X6NA 1VQ6A 2HHTA 3DLMA 2C0IA 4KN7X 1O75A 1W0TA 4LE9A 1ZAOA 2F9TA 1WJ5A 2YG8A 2V1RA 1MSFC 1MKMA 3E6DA 4IKFA 2KZVA 4RB2C 1QZEA 1WZOA 3COAC 5AQVA 1ZBSA 4HA8A 4AI5A 1Z1DA 2ZPFB 1ETKA 1DUXC 4ID5A 1T0FA 1J0RA 2OAZA 4OLBA 4M3DA 2BHZA 1VQ8I 2O03A 3DLLA 1X3MA 3MKYB 2RM4A 2W24A 2XMFA 2GQQA 2VJIA 5AQRA 1B9MA 4IHYA 4NB4A 1HQCA 1MUDA 4KHYA 3W6VA 3PO3J 2YJEA 3FF5A 4BDYA 1QMCA 2WTUA 3V1RA 2NOBA 3T0YA 3I9QA 1HYSA 1LFPA 2NNWA 1RI7A 4PNOA 5DM6F 4JZ3A 3TTCA 4V19S 1RESA 4WXHA 4DTJA 3K2AA 1GCPA 1OCTC 2H6CA 3EFOA 4XTXA 3H35A 2VBWA 5B3SH 1TKZA 2ZD1A 1UECA 1BCMA 3H3UA 3EQLF 4EJUA 3ASNH 3FXJA 3CMET 2JPSA 1Y97A 3HYFA 1Q86U 2A42A 4DV4K 3QINA 3S6IA 1VQ9Q 2EPDA 4M9XA 2JTVA 3SFIA 5EZHA 3QPSA 1RUOA 3JSOA 4FWQA 3H8ZA 4B24A 5HBMA 3DTIA 3AT1B 4L9NA 4DA4A 3O5BA 2GGRA 3CP2A 4OKEA 4MDAA 5DTDA 4CGGA 5BR9A 2QQSA 1RDDA 1RDWX 1WJCA 4DF4A 3BY5A 2KYBA 1V5FA 2EK5A 4M7DG 3HVTA 1RRJA 3JV3A 4DYQA 4FK2A 2HDDA 3OYDA 1W2BM 5DY9A 3QQAA 4AHSA 1KZHA 2R7YA 1WNLA 1JLEA 1VRLA 1ZA1B 5F0FA 3V1QA 3CCUQ 3QJYA 3CCQT 2HVIA 1KAYA 3WTXC 4ZJZA 2OTJQ 1PKTA 5IT9Z 2M45A 3HO1A 4JUVA 1ZARA 2LKSA 5AQIA 1G2BA 4JI7K 3NNQA 1R0BG 1M30A 2HPIA 1YJ9I 1UG1A 4JKDA 3MEGA 5LBQA 2QVOA 1Q8IA 4OMPA 2BZXA 5IT3A 1ON2A 5EYRA 2Z9OA 1K6OA 2ECBA 2X4WA 3PT9A 2BOLA 1VQ8N 1RT1A 2MD0A 4Q0BA 3CMEA 3CPEA 1KAZA 3INZA 1YO5C 3DCFA 2BVLA 1ATNA 2D8HA 5A2QE 4LF6K 5J4VA 4CK3A 2A0FB 2HNHA 1SD6A 3WTYC 2G7UA 2WAFA 4C2MJ 2FYKA 4A4KA 4JI4K 3O4WA 4CVNE 4BHBA 2Y1JA 1WKMA 2FPDA 5M5XJ 3I55I 3C7JA 1HMVA 1JI8A 5FD5A 4YDUA 3T9NA 1SL1A 1YJNA 2YHAA 3QOEA 3SUNA 4YIIA 1HSTA 4OX9K 1N5YA 2KZMA 5M1NA 4KITB 4K41A 4M77C 1EX4A 2J5PA 3M0PA 4W97A 4DEXA 2O4XB 4G94A 3QXEB 3REOA 5AQQA 4DV7K 4A4FA 1O1WA 3R0JA 4C1NK 2BE2A 5E17F 5EVZA 3MX5A 2JTEA 4FWOA 5GMKl 1RNLA 3TDZC 5GMKm 1TUCA 1D09B 1M3HA 1RRSA 2KMUA 3CCLT 3TAMA 4CFDA 4NOYA 2RDPA 4YOVA 4BR2A 4N4IA 4M7AA 2DI3A 4FW2A 2Q1NA 1IXRC 1HDDC 1Q7YC 1U47A 3GTGJ 1OJLA 1A35A 5DK5A 2LR8A 5D5UB 3NAEA 5ILUA 1XGOA 2YV0X 1WAFA 3GTKJ 3ZQLA 2PAVA 3VERA 2OTJA 4DR7K 2NUPB 2OPSA 4PGHA 1YJWQ 3LLRA 4CGJA 1I1JA 1BA5A 4UUSA 2R7WA 3CMEN 3M57A 2Q31A 5KQ8A 2XRIA 5M1OA 2X3XD 2DD5A 4CBXA 3QBYA 3BEXA 1OCOH 4BR7A 4AIJA 5LL6S 1VQ5N 3CCMQ 1M1KC 2XRNA 3ROUA 1B3QA 3VS0A 2E4LA 1VRTA 3ZT2A 4BG8A 2P1JA 3P1GA 4G7OF 3HUGA 4B3AA 5AJ3K 2BVMA 3OYGA 2ASMA 1BHLA 5KPZA 3HT3A 3CFPA 1Y0UA 1AEYA 2KKZA 1TYQB 4QW2A 4OB3B 3BTIA 1JLCA 4QVCA 4RW8A 1VQ7Q 3MMVA 2X85A 4LF5K 3Q0WA 4CXFA 2L54A 2QK0A 1VQNQ 1WUAA 2ZWHA 3OYEA 2RQVA 3GZ6A 5CE3A 2O8BB 3VB2A 4M3EA 3CP8A 2OUMA 3G71Q 4BRGA 5DM6L 3DLBA 2QKKA 2A1RA 4D8DA 2J06A 1VUBA 3TSZA 2YJFA 1YHQQ 1YJWN 1QKXA 4GNIA 4E7KA 2EYXA 2M9HA 4AI4A 1NU0A 3EE8A 4AD9A 3HZ6A 4JKEA 3FLGA 3NGPA 3HOUJ 4EVVA 1JXOA 4XQFA 3KZBA 4D8KA 2CGJA 3ZN0A 1MBGA 2LTOA 2JT1A 2CP5A 2HZDA 2P9UB 3BR1A 4FM0A 4F2RA 1FYLA 1DGRM 1XHZA 1S72T 2IAJA 5DLOA 4HT8A 3J80K 1Q81U 4R8HA 4DS5A 1IN7A 3CTAA 3OBWA 1TNSA 4DSIA 1M90R 1TKTA 5IY5H 1JTYA 3ULDA 2Y69H 4XOPA 5J2PA 4EMSA 1YG2A 2ZSHB 1FZPB 2G8FA 5BS6A 4BYYA 2IW5A 3KCCA 3TW6A 3IKTA 4UC4A 4FJLA 2KGTA 4K2EA 2KDZA 1W5CC 3RKYA 2EYWA 1X9SA 4ZN1A 4M63C 1BR2A 1E3PA 2PJRA 5CYMA 1BOBA 2ZPEB 4OFEA 3VSLA 2A37A 2O6GE 1KD1R 2CV2A 2UU9K 1VQLA 1EBMA 4HSRA 5KCHA 1YITT 5FU6B 4MIMA 1U8BA 2K3XA 3ER0A 4XAXB 3RYRA 1JGGA 2YNFA 4I6MA 2MFZA 2X1CA 3NH0A 4M7XA 4C5EA 5ICEA 3HTSB 4W5NA 1WB9A 3KFWX 4JI5K 3AY9A 4CC7A 4CE9A 4BC5A 2KIMA 1OCPA 4DV0K 1LJ9A 1VQ6N 4LJZF 1Y56A 2VC8A 3D1NI 1NJYA 3CQXA 1XHXA 2QKMB 1HD3A 4CECA 1TWCJ 1K4SA 3OYKA 2L3RA 2E20A 1R5ID 1WI3A 2JSPA 5ELZA 3RWUA 3JB9F 3KLHA 3X2QH 4KISA 1LB2A 1USSA 4PUSA 4BRFA 3TWHA 2F5VA 3E19A 3BR6A 2ZNZA 1LMZA 3CJNA 3L3VA 5BN8A 4DUYK 3RKWA 2C0TA 1VQMI 3OH9A 2DMOA 4NLBA 2EKHA 2DMNA 1G5VA 2UUCK 1DKGD 4QWQA 2EZHA 6AT1B 3JR9A 1HW5A 4BRCA 4EDUA 3NF6A 1WQWA 5HDKA 2VIXA 2AIRB 2DE0X 3F0ZA 4AU7A 2FL7A 4FJNA 4AM6A 1T33A 3SDBA 1K7AA 4AF1A 3H5RA 1KTQA 1YCYA 2RH2A 2K86A 2HBJA 1X1BA 1M5Q1 4X9CA 3UR3C 1N36K 3QIPA 2DFIA 2I5JA 1NMDA 2F5TX 2VE8A 1MIJA 1XGNA 2VXZA 1Q86R 2BXYA 2HSEB 4A5MA 2DL8A 4B9NA 5FU7C 3BGRA 4DOZA 3QFPA 3OOPA 3LYIA 5EDNA 2I2LA 3TAPA 4HVVA 1IBLK 2QTDA 4LDWA 1IN6A 4LB6B 4HQMA 4ELYC 1Z26A 2E1ZA 2DA1A 3CUQB 1AT1B 1G8XA 1NJIU 3JCMf 4LFUA 2LFBA 1GLAG 3A98A 2ZB9A 1FOXA 2CJJA 2KQ2A 3Q9VA 1JEGA 2VBYA 4M7AE 1GV2A 1NGCA 1S3XA 4FWLA 1YHQN 4HF1A 5LGUA 2E6MA 2Y4XA 1QHTA 4DW6A 2G8KA 4QSHA 3ZCMA 3FJ5A 3AKZA 2IVWA 2OAUA 3AVIA 1OVQA 5HK3A 3TVTA 2H3GX 2L01A 5C10A 2E6NA 4CHUA 2BZTA 5JHFA 2XB5A 3ABTA 4NC8A 3O8HA 4KBMB 4B09A 1B59A 3LP0A 2IGNA 3MKDA 2F5DA 3LSMA 4EATA 1KG5A 4YFNF 3VJPA 4XL9A 1X01A 4LXCA 4DOVA 2JNGA 4N47A 2HNZA 3B02A 4O0IA 3WODF 5TRDA 5TISC 3FMSA 1LWFA 3JCMg 1VNDA 3UDCA 1YW8A 4H4KC 3SJHA 4A2BA 3CMEI 4IOCF 1I8FA 3E9LA 3V1OA 3QICA 3S1NJ 4O5BA 2DK8A 1YTAA 1YI2T 1GVDA 5F0HA 2PEXA 4A0ZA 3U21A 4H4MA 2DAOA 4E7ZA 2HOEA 2MBFA 4CJ7A 3D45A 1QVGP 1N6QA 3SV4A 1XC3A 3RI4A 2MK5A 3RVCA 3M9QA 1NJIR 3T1AA 1K6YA 4KH0B 1IJWC 4I99C 2MCNA 1FJGK 2WADA 1XCBA 4M41A 4ELZC 1KC8U 4ENKA 3GP8A 1X3UA 2ZXIA 1M1KU 1A0NB 5MLCQ 4ZDLA 4J2EA 5AZIA 1Y8QB 2C0OA 2OZ6A 4U0YA 4OF1A 2CQXA 3WXMB 4OVAA 1TAUA 3JB9H 2JTFA 2A68F 2P6TA 4RB0A 5A0GA 3P31A 2EJGA 3L2QA 4B9QA 5CKDA 1SVMA 3TSWA 3S8PA 2V1UA 3H9JA 4S04A 1VQ4T 3DI6A 2HSTA 2EAYA 3LNQA 1BIBA 4WWCA 2EV0A 1BR4A 2PQ8A 5KAIC 1OOTA 1S6QA 5L3EA 4GO1A 3SUPA 4HVUA 1HXDA 4JI0K 3JSCA 4FLWA 3R4KA 4FYXB 2JHNA 4RG8A 3BR0A 1YHQI 1DP7P 4A0XA 1DPUA 1J54A 2A6TA 3BJ6A 5CHIA 3ZQCA 1PC0A 1QTMA 3E0JB 4NL3A 3N4QA 2DFUA 2HEOA 4C1NI 4U0VA 1Z6RA 2FUG2 3DXJF 5BOXA 1XNQK 2IA0A 4RB3C 4DFKA 5JMVA 3FC3A 2V6EA 2OPPA 3EE9A 1C0UA 5GADP 2DFHA 2DJIA 4J9EA 1ENHA 1FOKA 5E3OA 5CVJA 1UFFA 3WNGA 3VS1A 2DYRH 5DD8A 3OV8A 2R7QA 1VYTA 3C2GA 3DKXA 2A3SA 5BMZA 3HSFA 3NCIA 4AHUA 4M77G 2F5KA 3UATA 3L2WA 4NLCA 2XY8A 4FWMA 2HQAA 3ITHA 2D6FA 2ZMEC 2DTHA 5GAN4 1YJ9A 1D8JA 1S6LA 2H56A 3RKXA 2QWNA 4JKHA 3C6HA 5HRSA 2VQEK 3RJPA 1GL5A 4M7AD 4JJNK 1V29B 5LMUK 2JUCA 1XC9A 4FJHA 4F93B 1VQOQ 1U2VA 1YITN 4BBSJ 4IIOA 2DRKA 3CCJA 5L8RE 2VQHA 1U9OA 3S17J 5M3FJ 2NUZA 1ABQA 4BREA 2HDCA 4K25A 3LANA 2H3JA 3G1JA 2R7FA 4DQIA 1K61A 1TH7A 5F04A 2JW4A 4CJRA 2W0ZA 1GRIA 5C25A 3NMUA 5GAMj 4L9TA 3CPWM 2XICA 1QQNA 4ZDOA 4GRIA 3CPWS 1WHJA 4IO9L 1MNDA 1NGNA 1N77A 1Y71A 2D0NA 1GXPA 2FRYA 3VWBA 2OTLN 3DLEA 2KYMA 2L5QA 1DIZA 4XR6A 5DUIA 4UUSB 2HB5A 5JHUA 4XLHA 3MCPA 5C24A 2YUSA 1E6HA 2D5RA 2GOXB 5ECAA 4M78A 2W40A 3CM5A 1JJ2S 3FHZA 3DLRA 3CIPA 4IG3A 4OJRA 5LRSA 4DQ8A 3EGDB 2RK2A 2O8FA 1NGGA 3PVLA 1NK9A 2IGMA 5D5WB 1NKEA 4D9JA 5K7ZA 3I0SA 4YY3K 1U6GA 2ZSIB 2Z1HA 1UHFA 4GV3A 4IQJA 3W6JB 1J75A 2XIGA 2OFIA 4RW4A 4DFPA 4B1XB 1SEUA 3OSSC 4BUPA 1Z21A 4CI0C 5GMKe 3HI0A 4CEEA 4NCAA 4JS4A 1PKSA 4H5NA 1YJWT 4CA0A 3H46O 1UGRB 4JKBA 3AARA 3FB9A 4U88A 2PI0A 2E41A 4J19A 3HEFA 2D1KA 1QVGM 3LZIA 2XKOA 2O4GA 3IAS2 1ATRA 4C0DC 2VJJA 5GAN7 2YS9A 2Y0MA 2LBFB 1X1DA 3M8PA 3P39A 5EGOA 4Y15A 2RE2A 1QU3A 2FZKB 1HR0K 3HTUA 2WOMA 5IAYA 1ZBFA 4OPAA 5BPIA 3ZMUA 1REPC 1RCHA 4DYCA 1R5GA 4ZGEB 3SJJA 4CZIA 3W3DA 1ZLJA 1LV5A 3WU1B 1V4RA 1VQMT 2QDYB 2JWLA 2VKDA 2ED0A 4PFPA 1KD1C 3QAHA 3KTUA 4HVJA 2CQKA 1AZGB 4BJ5C 1OYYA 1B9FA 1LDJA 5CVIA 5I9EB 3CESA 3JAMZ 3SCXA 2LX9A 2MC4A 4CF8A 3AA3A 4AFQC 1R0CB 4J9CA 3CLOA 2QYZA 2KDOA 5AQPA 4KHQA 4J7IA 4AHVA 4IZ9A 2O3FA 2CYZB 4CC4B 3MEDA 1NMNA 1U04A 1WPKA 2DAQA 1A5JA 1NPPA 1GOBA 3G71A 3ERMA 4HDUA 4IL6C 5J2QA 4H03B 2E5LK 2PMUA 3H0DA 3ZBDA 1U1TA 1XMOK 1WA7A 3F8BA 1H3ZA 3NVMA 4E2FB 4II1A 1FBQA 3VS6A 1JE8A 3A0IX 5GAMh 2P0KA 3MZHA 2VWJA 2NUTB 4RGRA 2R7TA 1BG3A 3BY6A 3CCSA 1ITYA 4M42A 4X62K 4M7AC 3ZX3A 1GXIE 3CCUA 3C12A 1TK5A 4JRPA 2HD0A 4Y0WA 5EG0B 4N41A 1KC8C 1G3WA 2OC6A 4DF8A 3QPTA 2YKNA 5E8IA 4JYAK 5CYVA 3LSJA 4PJOG 5GAHJ 4I0BA 3QIIA 2XIDA 1I5LA 1PSEA 2I5WA 3PX0A 1YUWA 3ISPA 3VMFB 2A40A 2EJFA 1UAXA 2RI2A 2VPRA 3CCEQ 2GWRA 1OYWA 3LM2A 3L4IA 1RUNA 1GCQA 2FO0A 2AHJB 1PJRA 5CR2A 1KC8R 2ZJRL 3G71N 4CCNA 1YI2I 1K9AA 2M8EA 4JLGA 4EMGA 4PFOA 3RCOA 4PSWA 1U6ZA 2YLCA 4XIUA 4Z4IA 2G8IA 3GTMJ 2ZPGB 3OA6A 2XB0X 2DMTA 1OV3A 1XB4A 2ESHA 2FSKA 4M7DE 3I4NJ 3D0PA 4NYFA 4M77D 4AG1C 4BR5A 3SI6A 2DQLA 2HTJA 1RAEB 1DTTA 4RMOA 1J5EK 4D1QA 3CCRQ 3H3VK 1JQQA 3VOEA 1YCSB 3FBNB 3MHXA 3KP3A 3ZGKA 5EZGA 3ENHA 3VUBA 2Z33A 3O9TA 3THXA 2NOHA 4Z2YA 5ICFA 2QEXQ 1BJZA 5FW9A 4CEDA 1U49A 3KK1A 2JS2A 1VQ7N 1ZRDA 3GLXA 3MQ0A 1NGFA 3O9UA 3VYUB 2F8SA 4HSBA 4OIOF 3HC7A 4ZYEA 2ZCFB 4QVDA 1S72Q 3ZMSA 3F6VA 1C6VA 3J7AP 3VGKA 2H6BA 3LAMA 5F6FA 3TO6A 1QW1A 3F21A 4TV7A 3EUHC 5HLTA 1N75A 2EQMA 4MLEA 1WJEA 4O8KA 2CYYA 4H0XB 3GL1A 3HJEA 3DMJA 4CCHA 2V79A 5C2FA 1ZK8A 5EF6A 3PO5A 3JCMV 1ZGAA 1D5VA 4F7ZA 4CZEA 4DU4A 3R61A 3RR7A 1FX7A 5IP7J 3VQ8A 3AGRA 3CD6A 1SF9A 2R7OA 4J9IA 4MLHA 2YDLA 1UGVA 1BI0A 2IS2A 2KRNA 1MH4A 2V7ZA 5FROA 1PM3A 1ZR4A 1S8NA 2Y9YA 3FHFA 1RLQC 2E7WA 1B9DA 4A6EA 2HEQA 1XC5A 3X25B 1NKBA 4QOZB 1IHWA 1M3QA 3J81Z 3O08A 4YRVA 4AM3A 1ZC6A 1VQ4Q 2M1BA 4ANJA 1X2QA 2VONA 4QIWN 4OIPF 3JCMQ 3I4MJ 1I50J 1YJ9T 2XAQA 2QUFA 2QA4Q 2LRQA 1EXQA 4PJOD 4KMUX 1O4XA 4GBQA 2IDOA 1LVAA 2P9SA 4IRIA 1X3NA 1BU1A 2EV6A 3MEUA 1MH3A 1HPZA 3CETA 3UE5A 4JOMA 3HGGA 1FYKA 2UYTA 1UG0A 2O7OA 2ZGWA 2CFXA 1G4DA 2O61A 4LSNA 3MFKA 2YHYA 1K78A 3CO6C 3EPZA 3K4JA 3W2AA 1BIUA 3BOQA 2D1XA 3SMPA 1QCNA 2NRTA 4ISEA 2PNIA 3UKGA 4XH1A 2XDBA 3HOYJ 4F9OA 5J1EA 3WXLA 3NWSA 1FOYA 1P6RA 3QO9A 1GLNA 1KFSA 5KYUB 4RAGA 2WFBA 5HRPA 1T95A 1SRMA 2P4RA 3JRBA 3J7AY 2O8DA 1RETA 3O8MA 3KNTA 4CHQA 1B7TA 3EG3A 4YFXF 2MSYA 1QQIA 3UNGC 4FLYA 3KPHA 4XLEA 4QPOA 1HU0A 5AFUA 5FLMJ 2NYSA 4N5SA 2GBYA 1NKCA 1XSXA 1WFWA 2M0OA 2O31A 1VSJA 4CIFA 3CCSQ 2X9HA 2F4VK 2JA8J 3C6AA 1L3UA 2E65A 5GMKh 4M77B 2PVOB 3FHNA 3CUOA 4A62A 4M4ZA 2PFBA 4IZZA 4HX8A 2YNGA 2H94A 3DV8A 1FLIA 1K8AR 3FXKA 1YIJT 4I9QA 4N0BA 1XOVA 2KMTA 1VQ4N 5M5WJ 5TKYA 1XN7A 2ZQBA 2HOTA 2MW8A 4B9SA 3G0QA 1I0CA 3DXKA 2HKOA 2NVQJ 3QERA 2HWVA 1KLNA 2BUPA 1VQ6I 2B7EA 2ECZA 3OGDA 3CCJQ 2WC2A 4CO8A 5HS7A 2ZE2A 2BYVE 2P9KB 4BQAA 1BI3A 2W6LA 2FEZA 3JRHA 1UUEA 1TWAJ 3JYTA 2JA2A 4B1VA 2VE9A 4WXCA 1TWGJ 2ZJ2A 2FG0A 3T8RA 1B4AA 5GIPA 1Y39A 1OZ3A 3JCMe 3EH1A 4F16A 1A5XA 1R1TA 5CPRB 4LF8K 1Q7YU 4HSTA 1H3HA 1ITGA 2HQRA 3IAYA 3MEVA 1OVYA 1XGMA 1RTHA 2XRLA 1MU2A 2XHKA 1R9TJ 4A6DA 4AWXB 2XO7A 2OTLA 4M3RA 4OPHA 2RD1A 5FRMA 4X66K 2KRFA 2ZXJA 1YW7A 3OYCA 4CZKA 5F2RA 1T6CA 3HOSA 3NTKA 4CC3A 3WXIA 3O5ZA 4E7LA 4QS8A 3TTFA 3P4IA 2CH6A 3GTPJ 3CC4N 2K5FA 4CFCA 3NF9A 2L2OA 3SEZA 2NS7A 2LYCA 2B63J 2EQIA 5IP6A 4A3FJ 2HYFA 2ADUA 4QT7A 1LOJA 3E3VA 4DBQA 5AONA 2HHHK 3A8LB 2NZTA 4XLCA 1OULA 1IKXA 2Y90A 4C0FA 3GF2A 2YKMA 1VQOT 3BCAA 4Y13A 3A02A 3KBGA 2EZKA 4BD3A 2CFOA 2E88A 1SVLA 2WSEE 1E3HA 3CCVI 4QKUA 1ESVA 4CICA 4CC2A 1UELB 1KYWA 4M7AB 4ZGJB 3H0GJ 4L3QA 3M0QA 2K7AA 2RJDA 4J9HA 5LJ5f 1CQTA 2LY1A 5GP9A 2ME0A 3CXCS 3HYIA 3PVQA 2VASA 2X6OA 3FZMA 1GXQA 1UGSB 4DK9A 1G2HA 1Y8RB 3V9ZA 1IGNA 1PD1A 2ECCA 3M8QA 3QLHA 5GMKi 1X27A 3DQVC 3EYZA 3OW2M 4Z89A 3HSCA 4CERA 1CXQA 2FXUA 4CJPA 3CFRA 4LUDA 2V52B 2CW0F 2RNJA 3BROA 4V2GA 3AFHA 2E60A 3FSPA 1AWJA 2YXYA 4LDVA 1B72A 2DD4A 3VW4A 3WXKA 4RW9A 4HW0A 5DPKA 2FBHA 2RPIA 5GAOp 2D0OA 2XPUA 5LEKA 1VQPT 2RPNA 4XRFA 4BY1J 3WEEA 2V8KA 2K5CA 2D1VA 5EX5A 1IJJA 3X28B 1C1AA 4V2SA 5IYCJ 2O8BA 4DLEA 2LY9A 4BGDA 1VQON 4Z4HA 2XU8A 3E01A 2ZO4A 3W2VA 3GE1A 3OL4A 4XICA 3L00A 3HDDA 2FZGB 1KHIA 1QQCA 1J3TA 4M9ZA 3A2KA 4PIIA 2QTXA 1JCEA 5F27A 1LAVA 1X4OA 3WNEA 5DM7L 1H89C 3SV3A 1T0JA 2O8KA 1WHUA 2W57A 4UNFA 1RC9A 4IOXA 2P5OA 4XIDA 1FBSA 3ZSYA 1HF0A 2RK1A 4M3FA 1W2BP 2MD5A 1DU0A 3VTHA 4PSXA 2DEQA 1KQ1A 2EQKA 2LY2A 3R6MA 4C8KA 2OD5A 2KT0A 1RAIB 3U2RA 4E3SA 5CYQA 4OGEA 4C8NA 1YJ9Q 3CCVN 5FO5A 2EWSA 2L7MP 2K3YA 5GANf 1OYXA 1SHGA 4HNUA 2JOYA 2JSCA 3UA7A 3ZSWA 5D4SA 3SZTA 3VYRB 4X64K 3TQNA 1VQOA 4H0VB 2IPQX 4XSXF 4YOUA 3GTQJ 2RB6A 2HQEA 5AZIB 4LUEA 4HTUA 3RDVA 3G4SQ 3CF5L 3TKYA 2UXBK 4HAMA 3MD2A 1B8IB 4H5TA 1B1BA 1SD7A 3W3CA 2EB7A 4CJ3A 4EP4A 5GAMg 3M54A 1JXEA 3BR3A 4PUOA 3CZ6A 1DGKN 1OKRA 2A61A 1WWXA 3FZHA 1ZELA 4G7ZF 2OFKA 1UTIA 4PKCC 3I58A 3PUFA 3TARA 2GM4A 2DA4A 2LZ6B 2QW9A 4KHUA 5C0YA 1HNIA 1T56A 3ZSQA 4MLOA 4F7UB 2BY0A 5LY3A 4AC0A 3AV9A 2CP2A 1ZBHA 5JLFA 3MWMA 4NC6A 3PIOL 2HNDA 3NHGA 4DJAA 2YHWA 1T0FC 3M55A 2EZLA 4D7NA 1MSEC 5GJWB 1TVRA 2OZSA 1WEGA 2ABLA 3SQ0A 1JUSA 4CGDA 2VOPA 4FWRA 5I42A 3JCMJ 4BC3A 3PTAA 2FBTA 2R5AA 4BRHA 3ZFJA 3BJAA 3CQZJ 2X35A 3DPTA 3NF7A 1TT5B 2IVMA 2L02A 2R7RA 3CF2A 4OPJA 1RT6A 1OH7A 1STZA 5IOYA 3OWTA 3FZLA 3GNFB 2A05A 2XVCA 2P84A 4MQ9F 4KICA 3ZT1A 4RW7A 1U5TA 4AQYK 3D2FB 4DTNA 4XOTA 2M2EA 1KA8A 4RCBA 1Q9YA 3SWNC 5B66C 1P4AA 3CJAA 1QVUA 1ZLKA 2QCOA 2DNUA 2DVEA 1I39A 3I4PA 3M8EA 3E5XA 1JHFA 5KE2A 3KLFA 3ULQB 2WBMA 3VEOA 3PV8A 1NJIO 2Y1IA 2Z1DA 3TCJA 4DTXA 4EAHD 1M3BA 4OAZA 2DPPB 3QBXA 3M53A 3P9KA 5TJJA 1LDDA 1Z3XA 3M0RA 3FDYA 5AQMA 3ZEUB 3K0SA 1I6HJ 3DPUA 2VBXA 1UE9A 3CBMA 4LD0A 1DGWY 1K73R 2VQGA 2HHWA 3FGUA 5LD2C 3CJCA 3MPUB 4H0YB 2K3FA 2HBLA 1M1FA 5ADXH 2R93J 3KVGA 3SHFA 5IXFA 2V9PA 5HKCA 1JLQA 1XTDA 1RI9A 3LDOA 3PO2J 1XQHA 4NCBA 3ATVA 2PG4A 3JAME 3UA6A 3LSRA 1L3VA 4B3TK 3MZ8A 4JDSA 3AVGA 4IEEA 1WQ7A 1C0TA 1ZR2A 3Q0VA 2CG4A 4I2OA 4RGSA 1YIJI 1FOWA 2A3ZA 1IZ6A 3GNGA 1Q95G 3DYAA 3S15J 5DMRA 4R0KA 1LE8B 2RNGA 3IV5A 5LHIA 2DXTA 1R7JA 4JRKA 1NM7A 1JGSA 4M9SA 2J6KA 1XQSC 2E19A 5HNFA 1KQ8A 3KXTA 2PJRB 5DD4A 3JW4A 1KIKA 4CJTA 1VZ0A 3VS7A 2RV8A 1YQRA 3CC4I 3CCRI 3LAPA 3BW1A 2FBVA 3T1BA 3H5AA 5I2MA 1J7KA 3FKIJ 5DLQE 1T3LA 1UHSA 1OH6A 4BQLA 3ABUA 1Q7YR 4IIMA 1BJAA 1BM9A 1S3JA 2OQGA 3R9PA 3FXRA 1A31A 2QKLB 3BWGA 4KH1B 4GVEA 4LY7A 2V6CA 3RTVA 3BG5A 1R71A 2QBYB 1AD5A 3MXJA 4E1NA 5LJVA 4K43A 1U8RA 2K4BA 2FEIA 2D4WA 4GVMA 4MQVA 3JTGA 4BNCA 3G7ZA 1E0EA 4OO1J 3QEPA 2V26A 1YTYA 3J80O 2MPXC 1TWFJ 1YFNA 4JRIA 2YX7A 3OJUA 1ZN2A 3WQUA 4I09A 3K1NA 1Q81O 1N9RA 4W1UA 3HSBA 3WU0A 1U78A 3V8KA 5AQLA 3OYIA 4KV8A 1KK7A 3I3LA 1BI1A 4EIKA 2YX4A 3F22A 1D3BB 3TO7A 4F3OA 1BW5A 2V9VA 3O4QA 1QSLA 3VQAA 5KYUA 3OYJA 1H1VA 2ROTA 4FWKA 4AT1B 4H5WA 1E2XA 4ATOA 2M1HA 2LF7A 5CHZA 2E5QA 4YIFA 1P9QC 4DFMA 4A53A 1YI2N 3CC2A 5JVGF 2RN2A 5IWAK 2NRXA 4E4HA 2AHQA 2QA4T 3ATUA 2PVDB 2GF7A 1VK0A 3SQ1A 3HFOA 3GFIA 3EETA 4XKWA 2X4YA 3TOAA 3QEWA 1XQPA 1VQNT 3KZYA 3VQDA 3LA2A 3NH2A 2JVHA 2QK9A 1NK2P 2CUJA 2K4YA 3JCMb 2VWKA 3A01B 3KEYA 2A41A 3HHTB 1X19A 4BGAA 3THWA 3I55A 1UHWA 1IO2A 1K1ZA 2X6XA 4FX4A 1R1VA 3W0LA 4HF2A 1W9HA 2CDTA 2H8RA 1T0HA 4PDKA 2VL8A 1NTCA 3UKUB 2IG0A 4EZ6A 2G3RA 3LDQA 3CCQQ 1V5EA 3JS6A 2M34A 5SWMA 2J4RA 4B9XA 4ISGA 2BKDN 2A36A 3CCSN 3QYGB 4DB3A 4NL2A 2CZ7B 2JWKA 5KYXA 3JTHA 4PHTX 2GAUA 2LCCA 3PFYA 3LSPA 2Z1GA 3QETA 4FLZA 1IRGA 2JRTA 4B44A 4LLGF 4KKOA 3O3HA 4P5OA 1NBWA 4XQ3A 1QVFP 1UGQB 1ZGJA 2VXEA 3L2RA 3L2CA 2OA4A 1GLBG 1KG4A 1OLTA 1LKXA 4BBRJ 4F91B 2DOFA 4CJSA 1K9MO 2Q2EB 1WRJA 2LNHB 1HYOA 4U7DA 2EYZA 1EH8A 1KXPA 1JKPC 3GPLA 3PX6A 1RGIA 3VESA 2DOEA 1LOTB 2RJEA 3ZSOA 2XV4S 3ABMH 3V8LA 2ZKZA 1TXQA 2DL3A 1GBQA 3NWTA 2XKOC 2KEAA 1FIPA 1Y07A 3IH3A 1DU6A 1LWCA 2Y4YA 3CCEN 3I56N 1VSKA 3WG9A 2LMDA 5BPLA 4E70A 3VF6A 2CWEA 3GOIA 2HVRA 1H8AC 4JN4A 2BGGA 3HBTA 3J81E 5J2MA 3F10A 3L42A 3DF8A 2HQNA 3E6CC 2DO3A 3UKUA 2OZMA 1X1PA 5FGMA 4OB2B 4MNUA 1ZUKA 4I2PA 2GFAA 1OMIA 1K73O 5FU6C 2O8CB 3IH2A 3IUCA 1NK7A 2GWJA 4EM1A 3GTOJ 4BDPA 1VQ7A 3QYEA 4A54A 1VRUA 2R4GA 5K14A 2QEXA 3AVNA 2BZYA 3CC2I 5C42A 4LDXA 2YU3A 4XTZA 4C92G 4JI1K 3BLYA 3EG9A 1R00A 3HUGB 3VOVA 2IOCA 1WJBA 5HLGA 3LSTA 3GCMA 4ID1A 1WSHA 1Z67A 1M2OA 1GV5A 1NPRA 2OAWA 1JJ8C 4QTRA 4OMQA 3QNOA 2CP0A 3R8EA 3KD1E 3VPZA 3KK2A 3HG9A 4XU2A 1DDNA 3H0IA 5JLHA 3DKYA 1ACMB 4ELTA 2CH0A 3VSKA 3CWSA 1KSWA 3H36A 4XRSG 1M1KR 3EO3A 3CJ1A 2MLGA 4KULA 3DEUA 2DXBA 4M3YA 1VF9A 3BTCA 3DRPA 3QWLA 3QOPA 1R4MB 2QGFB 2X3WD 3BF1A 3HOVJ 4KRTA 2Y9ZA 1N27A 1R8OB 2WACA 3GZ5A 4M6XA 4EMKA 3SQ4A 1FJLA 5KK1A 4N0AC 4KA4A 4OAYA 4FETA 1UWBA 3FK7A 2PTKA 3J8AA 2IS3A 2HSPA 1BQNA 2VC1A 2KKOA 2QWOA 1OQKA 1VQLQ 3PNTA 1Z0XA 2L2PA 2Q2EA 4JK9A 2DMQA 3S93A 4EMHA 4EGZA 3N0UA 2DMUA 2K4JA 3AG1H 2A28A 3L7WA 1OCZH 4QQGA 3K5OA 5B1AH 4CEQA 2ZJQL 4BY9C 1CF7B 2NS8A 3FIWA 4NXMK 1QZYA 1KAXA 3H5NA 1YF5L 2ME6A 2KLAA 3VS5A 1QP2A 5DYMA 2I10A 3L6QA 5GAMd 3CCMN 4NB5A 4PJOB 2QSFX 1HC8A 1YAGA 3E2UA 3E5UA 4OIRF 2HBWA 5EEAA 3LPTA 2JG6A 2DN0A 4J8OA 3SK3A 2X4XA 4NHJA 2LKPA 2QI2A 5J3BA 5D6EA 4IWVA 1IREB 4Z94A 3CD6N 4JZ4A 4PKIA 3ZLJA 2GTJA 1RTDA 4LG0B 4HZFA 4LC9B 2QG9B 4WF2A 4O55A 2IRFG 2RVCA 4JX4A 1EF4A 4J9DA 1I1GA 3M8SA 2OCCH 1VIFA 3CG7A 4PKGA 2UV1A 2N8GA 3CWTA 2Y75A 3HHGA 2E10A 1RAFB 2Q8KA 3CQYA 1VQ9A 1UHCA 1MUNA 4PKHA 2BZ8A 1O7FA 1D3YA 2R7UA 3P5JA 1VQ6T 3F8NA 1FMVA 3PIPF 1KQ9A 2HGCA 3S32A 1N9SA 2F2VA 3SB2A 3LP1A 4FWPA 2P51A 4CFAA 2KAFA 4O8UA 3SPYA 2QXFA 3M8JA 5LJWA 4CHYA 2DERA 4M7DA 1QVFM 1D1BA 5LMNK 4FJKA 1WLPB 2DIQA 4XLFA 3GBQA 3E9PA 3LH0A 1TG0A 4FE4A 5IYDJ 4LITA 1YRNB 3G1LA 1NGHA 5J26A 3L1PA 4FL9A 1YWOA 2GLOA 3VS2A 3F6OA 1P4XA 2KHMA 4XLPF 1K76A 2KK4A 4A0YA 2VOOA 2KFNA 3QP6A 1MBHA 5GMKj 3H9QA 2L9RA 1XWLA 1WHLA 4KHWA 1K8AU 2WY8Q 4B8CA 4PA1A 2DBKA 4CF0A 3OTOK 4OINF 4XORA 1WHMA 3S1MJ 1MHNA 3MP1A 3VQCA 5H6QA 3ZETB 2CGHA 3I64A 3P9IA 2H8WA 3BDPA 4KUMA 4Y1DA 3A8HB 1LEBA 3AG4H 3KP6A 5FWCA 4FK4A 2AQFA 1GLEG 4DNCA 3QYFA 1PVEA 3TP0A 3WTTC 1WXTA 1RILA 1IH7A 1W97L 4P5NA 3THXB 1IRXA 1WLJA 2BY2A 2LQNA 1S9HA 2DETA 2EA2A 5HDGA 4P9FA 2EQUA 4MTEA 3F9MA 2DYIA 3ZSRA 2HS5A 2JTMA 3CD6I 2YU9J 3O8GA 1K83J 3WG7H 4J6YA 4JD2A 1NZ9A 4IHXA 3OYMA 1XNIA 1CKAA 4F3TA 3CXCM 3EKUA 3GFMA 3MJXA 5BPMA 1NE8A 1W7PB 2OQRA 2PYJA 3CERA 5IN1A 4G7HF 4XRMA 2QEXI 5IP9J 1ETQA 2RKIA 2CV0A 3ESWB 4M78E 2KI7A 4Z88A 2RQRA 3CCJN 4B21A 3KP4A 3FXUA 2XGXA 4Y91A 1R1UA 5HP1A 4B23A 4DBFA 2OTLQ 2GQIA 4LH5A 2CU7A 5E3LA 3I0RA 3WVEB 3QEIA 3G4SN 4KT5C 1G3YA 4D7MA 4C5IA 1Q81C 2FJ1A 4BACA 5J4YA 3G6EI 2OTJN 3JRIA 1N8RR 3I35A 2WA0A 3CMAT 5L3CA 2L9NA 2CQNA 1HJRA 3TTDA 2L7ZA 4B9MA 2Q2RA 2NRZA 3JRDA 4EA5A 2IGOA 4DR3K 1TGOA 3ZSVA 1YHQT 1OH5A 1M90O 2NVXJ 1S72A 5FPEA 4FPBA 1B34B 2MC3A 3T1HK 3GFLA 1NHAA 5LGNA 3LPUA 1PUFB 4F7UE 2O8EA 1ON1A 1BCOA 1JKHA 1VSFA 5JLWA 4EA4A 3VTIA 4L0YB 1VQ9I 4BHPA 1YBYA 4Z6YA 3PY8A 1RI0A 1N8RC 3EG1A 4UY8I 3BDDA 4U0WA 4B4CA 3H6EA 3J7ZO 2ESWA 1E4GT 4N4OB 4IJAA 4X9DA 1VA7A 2V8JA 4M7AF 1QGPA 3SZGA 3REAB 1IZ1A 3CBPA 3PQKA 5HROA 5AN4A 3D7EO 2LP0A 1IGUA 5C6SA 1S1TA 2UXCK 3RSNA 1PWTA 3OSFA 2L9VA 1QSSA 1UCRA 4C8QG 4QS9A 3IUOA 3DXMA 2JA6J 2D0QB 1OPLA 4YEJA 1PYVA 1GUUA 3Q0UA 5EU7A 3UPUA 4CH7A 4IURA 2UUZA 1VSEA 3S1RJ 5DCFA 3BE3A 4L9VA 4FXDA 3CUQA 2LJ1A 3AL0C 1ZREA 1BBZA 2BE5F 1EH7A 3VQPA 4KTWA 4LG3A 3DLKA 3ASMA 1EWRA 2IEKA 5DCMB 2MWOA 1UEBA 2IS6A 2DPNA 2CP7A 1BA0A 1GDTA 2RQPA 1F4KA 1YLFA 2QF7A 3LSGA 4PL6A 3HPHA 4AYBN 5IYBJ 2GOMA 1TK8A 3H9NA 5AIQA 1JKOC 1VFCA 5E1ZB 4ZYGA 2KVQG 4BKXA 1Q82O 4UB8C 2XDVA 1Y6IA 4BE2A 4XEIA 1QPMA 1JLGA 4KYWA 3MN2A 5AQYA 4ZNXA 3K4NA 3T5XA 2H09A 4PFZA 4HLXA 5IHIA 2NVYJ 3SQ2A 3T19A 3OR1C 2NOLA 1X9WA 3DLAA 2CT4A 1N34K 4NCGA 4KHPK 3IL2A 2CS3A 3A0HC 4RBOA 3CO7C 3QO3A 2LSOA 2X4JA 2FNPA 1FY7A 4IF4A 1ZA2B 2VUMJ 3I54A 1VQ9N 1N32K 3DLHA 2MAMA 4X0GA 5A2QO 1K8KB 3LH5A 2VKVA 1ZH5A 4DR4K 3RMQA 1KU7A 2D45A 5FWBA 4G12A 2JZ2A 2JMCA 4Y52J 3EDPA 2E2OA 3O80A 1VQNI 2VGNA 2A3LA 1BGXT 1H92A 5HK0A 1DT9A 3R6SA 2M0MA 4ENJA 3V4IA 4PJOA 5GANg 3THWB 3AG2H 4WFAL 3FE1A 3HM9A 5I21A 3MO8A 3CCVQ 3DXMB 3DRRA 4FTHA 4H5VA 5BRDA 3IKVA 1LWYA 1TWBA 3J7YJ 5JFRA 2EFPA 3CCMI 2KJBA 3IWZA 2YRCA 4JRQA 1S9EA 2O8CA 4IOAF 2CSOA 3OY9A 4JQFA 3I0TA 1S5LC 1NH3A 1Q1HA 2ID3A 3WGHA 5KQDA 4B9UA 2BIVA 4WFBL 2VQLA 3R3LA 1L5UA 2E12A 3NGYA 3D7SB 5ADXA 4IRHA 1WAJA 3Q5FA 2FF3B 1XSVA 2WV0A 1R59O 1JLAA 2XSJC 3QRFF 4KGXB 4DTMA 1VQLT 4PGGA 2OYQA 4WX9A 3D2EB 4ZC3A 4OMMA 2EQJA 1B34A 1TL3A 4KDPA 2ELHA 2LDMA 2BY3A 1O9SA 4MO4A 4XKBA 2QKBA 2DK5A 4RKUE 1G3TA 2YX6A 3BZKA 3PLAA 2DEUA 2GTOA 1NJWA 4CIEA 4A61A 2XAHA 1SHFA 1R36A 2GXGA 2RMOA 2FC0A 2DA6A 1OPKA 2D0PA 3LQQA 2ZAEA 3F0CA 2A07F 4BRQA 1YS6A 5CKEA 1YS7A 3TAEA 4FJJA 1KQSM 2FF4A 4BI8B 2OTJI 1F43A 5FB2A 4DTUA 4Z0UA 4LOCA 4G1QA 2HZYA 1BU6O 2EJ9A 5HS9A 4KIBA 2CUDA 4Z4GA 3UKRA 4EGYA 4HOBA 5CY4A 1PDNC 5CQYA 2JM9A 4O6JA 1I1SA 4CI6A 5AQZA 5CKHA 4CJKA 1WXBA 1ORNA 3CCRN 4LN2A 1VYUA 3H6ZA 1FNNA 4XKVA 3V7SA 3K5LA 4LG0A 4CJVA 1HNWK 4ME7A 2XAGA 2M0CA 4HQEA 3DB4A 4ZYHA 5FFXA 5J1UA 2RI3A 1G59A 2VQCA 4YOTA 4BXXJ 1OCRH 4ESFA 2KW4A 2K5LA 5KHDA 2F5EA 2PYLA 3KKRA 1Y7XA 3JB9I 1OR7C 4CYCB 3B8AX 1O13A 3TGNA 4F7UG 1YN8A 3K69A 1BC7C 3K70D 5I2SA 3OW2A 1WEFA 3DOLA 4FIBA 4ZN3A 1IBMK 4ILJA 2XC7A 3KEQA 2E4HA 3O3KA 3IDHA 1KQ0A 3JRCA 4XM3A 1RAHB 5D8LB 2FQ3A 1PRLC 1W6XA 3VEYA 3GYHX 1M3AA 2NYXA 1F9NA 1IV8A 4JI6K 4FASD 4IUPA 3PFIA 4QCLA 1SAXA 2QEXT 5GAOq 3GIBA 1QRYA 5GANh 4MZMA 4CBUA 4FM2A 2Y30A 4W5QA 2GNCA 1SMYF 3L2ZA 3CI5A 2DXCA 2J7IA 3FZVA 2VC0A 2Q36A 4LFBK 1XX5A 4YG2F 1FWZA 2ZNYA 4DV3K 3MN5A 2KXCA 3QB0A 2DXIA 2VWBA 1LPQA 3M8RA 3ZMZA 1VAZA 1S72I 4IBNA 5E20A 1YJWI 4A4EA 4M75D 2E3HA 4E1MA 2GV9A 2JUFA 2KIUA 3ZX2A 1FT9A 1D1CA 4JS5A 3CCLI 3K0LA 4E6KG 4EFHA 3EFRA 5KE3A 4OMLA 5E26A 1LWWA 3N4PA 2ATQA 1WJAA 3O1WA 4C92A 1NNEA 3CC4T 4KB0A 4EMKC 5D3GA 4FLVA 4M78C 2DTRA 3MDQA 2R57A 2DDBA 3G4SA 3JCMc 4AHTA 1KU3A 1KFZA 2YNIA 4M77A 3H3ZA 2KTQA 2P9UA 3J81O 4BC2A 3FXLA 3HRGA 2F6CA 3ZQIA 1T44A 3V42A 1QZZA 2JRMA 5A2QK 2EWNA 2BW3B 4FOEA 3SLCA 2FPEA 1PUFA 4MDXA 1H88C 3TI0A 4CRIA 1T98A 2EA4A 4EM2A 3ZP5A 2O8DB 1PUEE 2COWA 5AT1B 2B0LA 3JCMX 4HCCA 1LPLA 3A5LC 4EZ9A 1XD7A 4BJTA 3SFZA 3E6MA 3R2XC 3FDRA 4BE0A 4J2DA 3MCZA 5GADJ 5KGWA 2DF6A 2K2VA 3DPLC 4ZYDA 2KIFA 2PZ1A 1FYMA 3QMLA 2HVQA 5LEJA 3AG3H 2EIKH 1RT3A 1ETOA 2XDDA 3FEOA 2CGPA 4BHCA 2CUEA 5CO7A 4FU6A 2BXZA 4FE7A 2W6KA 3EFOB 2EIJH 3GWZA 1OISA 4XLNF 2H27A 2BE9B 3EHQA 4MZTA 4NBQA 1VQ8T 4DV5K 1HKTA 3O3GA 2QQ8A 3ZT4A 1ZBLA 2LRDA 3CCLQ 3BDUA 3AA2A 4CYCA 5FKMA 3OSVA 3OYYA 2VQFK 2HMIA 5CVVA 1TBXA 2L0AA 3H0HA 3CC2T 1EETA 2O8FB 1QQMA 3RQ4A 5AQTA 4M3ZA 4QLCU 3ULEA 2QLZA 3H3NO 1YT3A 4BRKA 2JJ9A 1TKXA 1BA1A 4ETSA 2Z5UA 1VQMQ 2XD0A 2HTSA 2YRVA 4C9YA 1UJ8A 2V4JC 4JD2B 4IHVA 2EQRA 1UZCA 3HM5A 3CCET 3VQ6A 5KCOA 1JXMA 2HBPA 4M45A 1OI1A 1KRPA 4Q5VA 5GAHP 2NOEA 3KETA 2E2JJ 4OMZA 3OYBA 1WX6A 3TBIA 1OX8A 4HRIA 3QKJA 1RBRA 1ZBJA 3FM3A 4ZDPA 2HYGD 4HNVA 4G9ZA 2JK3A 3CPWA 2HOAA 1U5TC 2L0KA 3QWXX 3QDFA 4FLUA 2UXXA 4F7UF 3EZWA 4JHDA 5E3NA 1OCCH 2QA4I 4F55A 3MWTA 4ZZLA 2LTPA 1WJSA 2XPVA 5JVTA 3SPZA 3TL4X 1XNRK 3G1OA 1VQ7I 4K0KK 2RN7A 4BR0A 1KG6A 4PJOE 2BBYA 3BY7A 3R6NA 5JS1A 4CJ5A 4W5OA 4ASNA 3UWNA 3K9KA 1RT2A 5KI6A 4C8LA 1KVBA 3SMSA 3A03A 5JICA 1YYVA 2RF0A 5D7UA 3I8DA 4YIRX 3MEWA 3OS1A 3HOXJ 1RADB 3OS0A 4OLAA 4M72A 1IN8A 3VV0A 4XK4A 1QLYA 2RHXA 1IKYA 2PY5A 4FJMA 3VQEA 3L2UA 5C3EJ 2D2WA 3FBIB 3AVAA 2MGQA 2FQ4A 3JXUA 1C1CA 2Z2SB 4C8QB 2OI3A 1F36A 4RGUA 4HX7A 1ETYA 3RMDA 1JJ2M 3PX4A 4OB0B 2E5NA 1V3FA 2ZXHA 5H6RA 3OVNA 1AHDP 1SFEA 2ASPA 2XAFA 2JWTA 2JLEA 4I6MB 4G6TB 1X6BA 4R1HA 3HVRA 4UVAA 4N4HA 3V4GA 2ZBKA 5H20A 1VQPA 4GYIA 2VODA 2NUPA 3FXOA 2Z16A 3EAEA 2CH4A 3MECA 2IIMA 5DM7F 1XG7A 4KPYA 2XY5A 2OZUA 1ACIA 1XG1A 2P7VB 1HLVA 1P92A 4J2AA 2X6SA 3F8MA 1FPQA 1QKWA 3I55N 5IT9E 4LFAK 2CUFA 1ASWA 3RSEA 2LDUA 4KFCA 2AQEA 3CCLN 1BDGA 4C2UA 3CPWP 4DSEA 4B47A 2WUSA 2E70A 1HKCA 1B92A 3OJSA 4EJZA 3IAM2 2XF5A 2F7TA 3Q9SA 5FKLA 2BHYA 4A5BA 1X2NA 2RF2A 5GTHC 3FK6A 4UB6C 2OPQA 2R5MA 1IC8A 4A3KJ 3RMAA 4J8FA 1BI4B 1MZBA 4A3GJ 4B08A 1YQAA 3VEPA 3ZQ7A 2RC4A 2JA5J 4RTYA 5LGTA 3PNYA 4AIDA 2DTUA 1F5TA 1UMQA 3M4OJ 1EO1A 2L7KA 3NRVA 4C0ZA 2DA3A 1RR7A 3WHBA 1TWHJ 3RMSA 5GAN8 4CSWA 3VENA 3C0CA 1MMNA 2E2PA 4DG1A 3LSKA 4BEHA 3CCUT 3HP6A 3O9SA 4WCIA 1BIZA 1LUJB 4DSKA 1LVKA 5SZTA 5K5OA 1MBEA 2G7HA 3CWAA 4Q47A 3FLCO 5LJ3e 3WT0A 3TU4K 1UJYA 1UAAA 3U9ZA 2LC4A 3C65A 4S05A 3LALA 1VQ8Q 1BIAA 4PL8A 5E8GA 1ZKGA 1Y0MA 1LQ1A 1BR1A 4K8ZA 4WK8F 3M5RA 4A3EJ 3CC4Q 5F0XA 2EGEA 2R58A 1W7PD 4FYWB 3QDRB 1QWFA 1Q18A 3K58A 1U4BA 1R77A 1G99A 3OIQA 4H0PA 2CSQA 1LEAA 3CCQA 3IG1A 2F2EA 4JKGA 1NWKA 4MHGA 1WNSA 4A3BJ 3K7AJ 4DQSA 5LLQA 3ZYYX 3V8JA 4BRNA 4N9HA 1V76A 2HI3A 2DA5A 3FX3A 1X6GA 1VYVA 3K2ZA 1M3CA 1GLLO 3K6GA 2A5WA 1TLHB 5EGOB 3SBGA 4Z4EA 3PJRA 1NG7A 2HHUA 4OIQF 2Y31A 1WCMJ 1Y57A 5GPCA 2K02A 1W70A 2A6EF 3RBBB 2ZM6K 3G1MA 1NEGA 3KHYA 2O4XA 3MAQA 3P38A 1IRZA 4B1RA 3B6AA 3JB9D 2C6YA 4FOIA 2FBKA 1AWWA 3MEXA 2P5LC 1ZXOA 1N6AA 4B22A 3K5MA 3N5NX 2LCLA 3MEAA 2ZPBB 3GLLA 3F70A 3P8BB 1NGBA 3A2FA 5GAOl 3EZ5A 5BPDA 4M75B 2R92J 1V54H 3DLLL 1RT7A 4J7FA 2VKEA 4C8QE 4F52A 3T69A 4KUDK 5LRRA 1K8AC 3O9QA 4C92D 4BQOA 3QSUA 2YHXA 3CCLA 2P9SB 5AQKA 4DTOA 3TAFA 5J40A 3GBTA 1EJ9A 3KP5A 3E1YA 1HKBA 1LFUP 1K0XA 1U1SA 4CDGA 5J3LA 3CQTA 1TUYA 3SWNB 3ABLH 3FHGA 1NOYA 4PWDA 3VN5A 1VQ8A 2L4MA 2P9PA 4N9IA 2LQWA 3S3NA 1SAZA 2FBXA 4WQ5C 1YOVB 1X1AA 3MWPA 4ZGDB 2G8WA 4UOBA 3J7YP 3MCAB 3HK2A 2C06A 4DTSA 2LNVA 1SKRA 1W36C 4CBWA 4YTLA 4CGIA 1IG9A 4XRSA 2FHDA 1VQ4A 4DQRA 1MD0A 3BT9A 2ZCWA 3WTVC 3FJPA 4UV8A 2HPMA 3HKZA 5D8KB 1TT0A 2P9LB 1K9MC 3DAWA 3KEOA 3GW2A 5CVUA 1KGSA 3AAFA 2ZXWH 2PN6A 1NJIC 5KN9A 1SKUB 1JTXA 3VRYA 1NGDA 1WH5A 1X6OA 2EH3A 1ZLMA 1BISA 1JUPA 4AYBA 5I3UA 3S41A 2IVPA 4MEYF 3RQIA 1QQOA 4AILC 1SFOJ 3RRGA 1GFDA 3LWFA 2NOIA 2AXTC 4A93J 2F69A 4ELVA 4A3IJ 1HW2A 5E1WA 4MGRA 1WHKA 1SEMA 1ZBUA 1EA3A 1MJBA 1IDYA 4OKJA 1CZAN 4RB1A 5LJ5g 3ZX0A 1KQSA 1JXBA 1FIAA 1KQ2A 2E6ZA 2QBYA 1U84A 4XNFA 4JLHA 4D0PA 4I0AA 4RLQA 1BL3A 1YJNT 4TVRA 4KN4X 4GLMA 4FLTA 5D6WA 1JB0E 4C92B 1HCRA 4FJGA 5ILVA 1HNXK 3GOXA 4FL6A 2QSHX 3QU3A 3QZ9B 2FU4A 3NDKA 3GEZA 2YNHA 2LVMA 3N4MA 4M6YA 2K3BA 3U1DA 3KYLA 3S6WA 2PBIA 4DQPA 3NPFA 1O57A 2FBIA 3CCMT 3URGA 2YSQA 2WBNA 3L0QA 2K79A 2EX3A 3FXMA 1FK9A 1XUPO 5DDGA 3ZQGA 1U48A 2RHIA 2ZGZA 1J9AA 4CJ4A 2HHXA 3SZ2A 3BG6A 1UG2A 3I53A 2QWQA 3K1PA 3LFUA 1PSFA 4M77F 1WYXA 2IVNA 4Y1CA 2XUBA 4Q48A 2GUPA 4DOWA 4KFBA 3WTWC 3P7NA 2DO7A 3EH2A 1CF7A 4A3LJ 4NC7A 2OJED 2KNBB 2W41A 2LT4A 3VQQA 1B6AA 1QCOA 3B6OA 3PIPA 5TKWA 1NYGA 3QFUA 4B6MA 3FZKA 3AL0B 4X65K 3A1PA 4FHTA 4EEFG 3M3YJ 4JNEA 1S7EA 5LJ3f 1B8IA 1K73U 3PM1A 2HHSA 3CC7N 3CC7A 4UNOA 2O5RA 4L6V5 4XBFA 1Y0NA 3K4MA 1RLPC 3X20B 4FM4B 1OZ2A 2KSSA 5CQEA 1GLFO 2BW3A 1SANA 5C4JJ 2K9QA 5H1SQ 3T8TA 3CFOA 3F72A 1X3WB 3MKZA 2E2NA 2VJ5A 4TSXA 3M4GA 2E64A 3SFMA 3JSMA 1YQKA 1KVCA 3F23A 4EJOA 2PUOB 1C0WA 3BG9A 4BVOA 4JKGB 5LJ3j 1FW6A 1JL2A 2X6YA 1QO0D 1BB9A 1BKBA 3PO4A 4DU1A 4OMFB 1A36A 4OWRB 4BVPA 1N3AA 3C95A 2M16A 3VETA 4FJ5A 1W36D 4A3JJ 1SD5A 4IQ4A 2DMPA 2W1OA 2MG4A 4BQQA 4DTPA 1W1WE 1NK5A 2PJPA 2HQ5A 1MPGA 1HUXA 5BPNA 2V9KA 3SAFA 3TANA 1WBBA 3N97A 3HOZJ 3KX2A 4FCYA 1PD0A 5FDLA 3J81K 2DIGA 1WGXA 1I07A 2QENA 5ED4A 4EW0A 2LVSA 1N8RO 2AKKA 1TS9A 1R23A 4HTLA 1N3CA 5AR0A 3OYHA 3I0XA 1GLJO 2E71A 5HRRA 2Y0SA 2D0AA 5CQGA 1D4XA 1CZBA 2HDAA 2MOXA 3HXLA 5C15A 1Z9QA 1GT0C 3JB9J 3ENBA 5M5YJ 5GANj 3OS5A 2E8AA 2EYYA 3EEQA 3ZN1A 1XGSA 3CC7Q 1ETXA 2DZCA 2HR3A 2LNBA 1MGQA 4PLIA 4NQWB 1YE9A 4J9FA 4XTVA 1YFHA 1RBVA 3CMAA 2E2IJ 1WN7A 3Q7CA 4G6QA 4JHDB 3MP8A 1NGAA 3M3ZA 4J5YA 3IH7A 2K85A 3R0AA 2GUIA 1IUFA 3TQ7P 4IHTA 5EC7A 2IS1A 2I8DA 3NF8A 1QZ5A 2OCEA 2NOZA 2JXBA 4JK8A 3K57A 4LGWA 5L23A 1RAGB 2K57A 3O8VA 2ED1A 1C6VX 3AO2A 2OV7A 1NEBA 5CR4A 4Z02A 3LOCA 2K9NA 2FVUA 2GBQA 1IHVA 1ZRFA 1WJDA 1MA9B 2QZ8A 3KP7A 3TEDA 2COZA 3U3YA 2RA2A 1OH8A 2KY9A 3TPQA 1R4NB 1AKHB 2F4MB 4W5TA 4CEFA 3S2WA 1W7PA 4E19A 3V7CA 3J80Z 4Y92A 5T7BA 2DBMA 1RDCA 2LOOA 4F92B 3DKMA 1ZYQA 1Z77A 3GFJA 2V7YA 3F2KA 4EHUA 3HTVA 2FSWA 4HUGA 2CP6A 2W4SA 4L5IA 4Y4RA 3PNWC 4CJEA 4A5AA 1JT6A 4XU3A 4X34A 1HX1A 1NOZA 4UQGA 4M6VA 2KRSA 1J5YA 3A01A 3LGFA 4M75A 2LC2A 1IAWA