4E7KA

Pfv integrase target capture complex (tcc-mn), freeze-trapped prior to strand transfer, at 3.0 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
366
structure length
366
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 96
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7kA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7kA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7kA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7kA03
3DI6A 3P83D 2F8TA 4HUGA 3NF8A 4CJVA 5I3UA 3PMIA 1KCFA 4FJHA 3LX7A 5J39A 3OS1A 3ZT1A 2XY5A 1U47A 5J2MA 2ZQBA 2VWJA 4EP5A 4KHYA 3JYTA 3PMTA 4CIGA 3AVJA 3F73A 3DYAA 4CE9A 4H4MA 4JRQA 4DSJA 3B6PA 2YHAA 1LWEA 3C6UA 3KLHA 3OYFA 3OYGA 3MEEA 4O5BA 1JLFA 3TWHA 4J2AA 3NAEA 4B9LA 4OLAA 1W0HA 3OQ5A 2GUIA 3L3VA 3QESA 2RJEA 3AV9A 4LY7A 3PO4A 4A4EA 3SQ0A 3SQ1A 4PLIA 5KGXA 3HO1A 2QXFA 3K2PA 2HHVA 1N27A 4EZ6A 3ZSZA 1EKEA 1SUQA 2HHWA 4DSKA 4CHYA 4B08A 2OYQA 4M42A 4DSLA 2P5GA 4QAGA 5EU7A 1KFSA 3AO2A 2LSNA 3DOKA 4KI4A 3OMCA 4E7KA 1S6QA 1CXQA 1WSIA 4IDKA 2IAJA 2QK9A 3KLFA 2YNFA 3ZSOA 4DFJA 1L3VA 4FU6A 1IKWA 4NCBA 2L3RA 3TR8A 1VRUA 5I42A 4DSEA 1RT7A 4Z4CA 3OYJA 4QW2A 3ZSWA 4A4GA 4DQQA 3SUNA 1BI4A 2G8KA 3MEDA 1L5UA 1FXXA 3L2WA 2DAQA 1FKOA 1RTHA 3HPHA 4BACA 2OPPA 1HNVA 3VQQA 3KLIA 1C0UA 1Q9XA 3RTVA 4N56A 3RR8A 2BIVA 1YT3A 2PZSA 2P0KA 4LSLA 4C5IA 1J9AA 4OPKA 2XY6A 4FLWA 4CK2A 3OYAA 1TGOA 3C94A 3QO9A 3V1OA 3ME9A 1KSPA 2KQ2A 4I2QA 2K3XA 1QSSA 1QQCA 4Z0UA 4AHCA 1EETA 2CKKA 4KRFA 1UA1A 4FJ7A 5D6XA 4QVZA 4QQDA 4CRIA 2B8AA 4NCGA 1NK4A 3HJFA 5D6WA 3QINA 4CFAA 2RJCA 3ZSXA 3M8QA 4RW4A 2JTFA 4FXDA 1SL1A 4HVJA 4C8OA 3D0PA 4CEAA 2R5MA 1N5YA 4HCZA 1SV5A 2EQUA 2RI5A 3ZSVA 1JLEA 5KE2A 4BE1A 4CEFA 5CY4A 3QNOA 3VQ8A 3TAGA 4CJKA 4DTNA 1C1BA 1C0MA 3AVAA 3OJUA 4JRPA 4QOZB 3HVTA 2DIQA 4FLUA 5J1EA 4DWIA 3ASKA 3S3OA 2FBXA 4BDZA 3LANA 4RG8A 4LD6A 4ZTFA 4HCBA 5KTQA 3QERA 5KRSA 1SKWA 1WJQA 3S9HA 2YRVA 4OKEA 3KKSA 3K58A 2IDOA 5T7BA 4DG1A 3F9KA 1RT6A 4UC4A 1A5VA 2GV9A 3AA4A 3SUPA 3L2RA 3SJJA 3THVA 1NOZA 4I7FA 3DLRA 4O55A 3SQ4A 1Q9YA 3HP9A 3KKRA 4X34A 3NBPA 3E01A 1IG9A 1UA0A 3SYZA 4DSFA 3PV8A 1KLNA 1K6YA 1TVRA 4ZTJA 2BANA 2X74A 1LWCA 3RMCA 3QIIA 1IO2A 3MXIA 5C6SA 2FBYA 4O0IA 4IG0A 2E4LA 2RF2A 3SPYA 2RHUA 1G15A 4IUTA 4B9MA 4FL6A 4CHOA 2XY8A 3SI6A 3LWMA 4OVAA 1RDDA 5KH6A 2M0OA 4II1A 5J2QA 2D0CA 3HSTB 1RT1A 1TAUA 4DS5A 1C1AA 3AO5A 1EX4A 4GVMA 4BD3A 4IURA 3VA3A 1XHZA 1B9FA 4Y1DA 4CJSA 4I9LA 1GOAA 2W42A 2KFNA 4J2EA 1XC9A 3OYIA 1UWBA 3BGRA 2QKBA 1T8EA 2OPQA 1RT4A 4YFUA 4OGEA 3VQPA 1SL0A 2L8DA 2YNIA 1VSLA 1KTQA 2HQXA 4CJEA 3CM6A 1JLCA 3SD4A 4E7JA 3CYMA 4H8KA 2WONA 1TAQA 3AVHA 4FJMA 1RCHA 2F96A 4BWMA 4LD0A 3BDPA 1G5VA 3FEOA 3V6DA 2X6SA 4M41A 4CFBA 1MHNA 2JLEA 1FK9A 4DSIA 3NF9A 4CGDA 4CGFA 2EX3A 2NUBA 2LDMA 2VG7A 3OMGA 3SCXA 3LP2A 4Z4GA 2PY5A 3L2UA 2RJFA 3NCIA 1TK5A 2A1RA 3RMBA 3MP1A 4E19A 1MU2A 1S9EA 4N4IA 1CZ9A 3BDLA 4DQIA 4JS4A 1Q8IA 3DRPA 4FVMA 3CFRA 4BE2A 2YNGA 1BQNA 4DS4A 2HHSA 1NKEA 1ASVA 1NKCA 1TKTA 5C25A 5CIUA 3AA2A 3QEVA 4BDYA 2PQWA 3OYKA 1S1TA 5KCOA 1JXEA 3MO8A 4HUFA 3O3FA 4C8KA 2L89A 2X78A 3ASMA 1JLGA 1U04A 2HNDA 3QEPA 3LLRA 2RI3A 4CJRA 1SKSA 4E0DA 1LW0A 4CK3A 3B6OA 1NJYA 4DLEA 4M3TA 4NYFA 5KGWA 3P5JA 3HM9A 1ZBLA 2IGIA 1O1WA 4J2BA 2KZMA 5KRTA 3LPTA 2D0BA 3UT1A 3A2FA 3E9GA 3MEUA 2DFFA 4CESA 2D9TA 1WSJA 4TSXA 3TAMA 3KK3A 4KV8A 3LPUA 4B8CA 2F8SA 2HHUA 3PY8A 1RBVA 4ELTA 1RTIA 4C5EA 1VSEA 3I8DA 4O4GA 4DTUA 3VN5A 4F2SA 2OPSA 4O0JA 3CFPA 1KVCA 4YNQA 4C8LA 5KCHA 1VSMA 4ID1A 3V81A 1NK9A 3L8BA 1LW2A 5DMRA 2QKKA 1JLAA 4W5OA 4ID5A 2QQRA 2RHYA 4G1QA 1D9DA 4OKJA 4IKFA 2FC0A 1JLBA 3LP0A 3NE6A 1S1VA 3M8RA 3T3FA 2R57A 3K59A 3ISNC 3L42A 1J5OA 5SWMA 1RBSA 1NK6A 2Y1JA 2FBVA 3IS9A 4N76A 2LCCA 1SKRA 4QQGA 1QS4A 3S6WA 1WSFA 4F4KA 3HVRA 4OJRA 3VQ4A 5HRNA 3Q1JA 4CGJA 3DLHA 3FC3A 3I0RA 4CJTA 3KLGA 3WNFA 1FKPA 1RBRA 1S1XA 3K5MA 3JSMA 4CEBA 4FJXA 2MWPA 2O4GA 3SV4A 3QEWA 1XNIA 3NGZA 4B9NA 2JZ2A 4N5SA 2KFZA 2XRIA 3OYLA 2FHDA 1RTDA 3LYIA 4FJNA 1RDAA 1TKXA 1RNHA 3KD5E 1YTAA 3AVLA 3SUQA 5M9OA 3AO1A 4KHSA 1KFDA 4AILC 4IG3A 3HP6A 3QJ6A 1BIZA 2XHBA 2P51A 4CJUA 4RW9A 4F3OA 1X9WA 4PL6A 3LP3A 3NHGA 1QE1A 3KTQA 2HQEA 1IH7A 2XO7A 1N6QA 2G8UA 3WNEA 4I2PA 3C4SA 1C1CA 1UOCA 1C0TA 1EP4A 4FZYA 1RT2A 5HROA 3P1GA 4F8RA 1VSIA 1T05A 4FM0A 4KPYA 4IUQA 1IKYA 3V1RA 4E1MA 1GOBA 4FJ5A 4I9QA 1T03A 2E6NA 3OYDA 2HHQA 4E89A 4CHQA 4DQRA 3HPGA 3KLEA 5FDLA 4ICLA 4AHSA 4FM1A 1REVA 4RW6A 2RKIA 4EZ9A 4FZXC 2G3RA 1BISA 1NK0A 2NLUA 4JS5A 1ZBUA 2QQSA 3ZCMA 4C8MA 3M9QA 1HRHA 3QEXA 1XWLA 2ZD1A 3E9FA 2O4XB 4LH5A 3MEGA 1WLJA 4DFPA 2LTOA 3OB9A 2VYTA 1H3ZA 3NDKA 2VWKA 1VSDA 2YKNA 3NH1A 1NJWA 3G0ZA 3PNWC 1KHCA 4KTQA 2R58A 1HYSA 3VQAA 3LZIA 5KI6A 4PA1A 1NK8A 4BDPA 2EQJA 3QIPA 3V4IA 1NKBA 4CEEA 2D5RA 4FLYA 3DLGA 4N47A 2KZZA 5FRNA 4HUEA 4F3TA 1A5XA 2X4XA 1RBTA 4FJLA 1JLQA 1WN7A 1ZBIA 4W5NA 4GW6A 3TABA 3F70A 3ITHA 3QEIA 1DTTA 3HYFA 4B3OA 2PYLA 1S1WA 2G8WA 3WNHA 3OA6A 1ZBHA 2M1HA 1UAXA 2RHIA 4DLGA 1KRPA 3OYHA 4N4GA 3ZT3A 3KD1E 1I3AA 3OYEA 3EY1A 3NTKA 2Z1GA 3V9SA 4C5GA 2DY4A 2M16A 1HQUA 3FDRA 4M3RA 1QSLA 4CHNA 3K57A 4E3SA 3V9WA 4EP4A 3OY9A 2B5JA 3ZT2A 3U3YA 5HRPA 2RO0A 1WGSA 4DQPA 4DQSA 4NS5A 3MXMA 3O4NA 3L2QA 4OLBA 1TV6A 4QQ6A 3V9UA 2HHXA 1RDCA 4Z4FA 3LP1A 3ZT4A 3UIQA 3CG7A 3K5LA 1TK8A 3S3NA 1J53A 4IUPA 3DLMA 4PWDA 2MWOA 3CM5A 4GMJB 1VSFA 2Q3SA 3KIOA 2KTQA 4PY5A 1ASWA 4KHQA 4CECA 3FFIA 3DB4A 4OPJA 4QCLA 1TKZA 4DFMA 1RBUA 5HBMA 3QIOA 1JL1A 3LALA 3SNNA 1KVAA 1JKHA 1OZ2A 3DMJA 3AO3A 1KVBA 4PUOA 3DLBA 2D0AA 2E6LA 3V1QA 5SZTA 3U6FA 3O3HA 1RI0A 4ELVA 4M3YA 1HQEA 3EZ5A 4IFVA 2GFUA 4FJ8A 3TI0A 4IUUA 1XHXA 2BE2A 4FJIA 3T19A 4PQUA 3MECA 4WE1A 4Q5VA 3VA0A 3PX6A 4FJGA 3META 2VG5A 2GBZA 4CF9A 2DFEA 2BDPA 2XK0A 5DK5A 3L3UA 4IBNA 1T7PA 4BWJA 3OJSA 3G10A 4FK2A 2DTUA 5J26A 2P5OA 3DM2A 3MP6A 4W5QA 1I39A 3TAQA 2O4XA 1HJRA 4CJWA 2G8HA 4CEOA 4RW7A 4RG2A 3T1AA 3U3GA 5C42A 3LAMA 1TK0A 5FRMA 1RTJA 3VQBA 2YKMA 4AH9A 3LAKA 3NFAA 4Z4IA 1IKVA 4CK1A 4CGGA 1S5JA 2ETJA 2OZSA 1CLQA 1WAJA 3S3MA 1S1UA 3PX4A 2G8VA 4CIEA 1Y97A 2HHTA 4CF0A 3ALYA 1L3TA 1HYZA 3PO5A 1NJXA 4FW2A 3AVMA 4KFBA 3TARA 3SQ2A 2YHBA 3DLEA 4CJPA 3AO4A 4RW8A 2HNYA 2E5QA 5J2PA 4DTMA 4KAZA 3OS2A 2FBTA 2XDPA 1U4BA 3KK1A 4E7LA 4FCYA 5FROA 1NK7A 2YV0X 4Z4EA 3MEAA 3ZSQA 2OZMA 3LZJA 1OYXA 2R5AA 4B9UA 4F2RA 2F5KA 3TAFA 3ZEHA 1RDBA 2Z1HA 4OVLA 5JS1A 2IC3A 4CF1A 1WJRA 2IS3A 1DLOA 1D9FA 4M45A 1EXQA 3HXMA 3CQ8A 1QTMA 4B9WA 1BGXT 4JLHA 3RRHA 4OGCA 4DTXA 3KUFA 1TL3A 4KB1A 4UQGA 4N41A 4A4FA 1L3UA 2EFIA 4FLTA 2BKDN 4BE0A 3RMAA 3H6ZA 3K5NA 5IN1A 2DIGA 4M3UA 4CHZA 1X9MA 4K8XA 2HW3A 2E6MA 4FLZA 2Z1IA 2RHZA 3KJVA 3MXJA 1WAFA 3AVBA 1LAVA 4IFYA 3NTHA 2YNHA 5HRSA 3O3GA 1VRTA 3TAPA 5C0MA 5D6YA 3NH2A 1BCOA 3DB3A 4CGHA 3AVNA 4KTZA 1L3SA 3IAYA 4E1NA 1VSHA 4Y1CA 5IAYA 4FLVA 1LV5A 3PUFA 2LVMA 3NF7A 2HB5A 4LH4A 1ZYQA 3VQ7A 3EAEA 3LGFA 2G8IA 2WOMA 1U45A 4FLXA 4CCHA 3AA3A 4CFDA 4N4HA 1YVUA 2BGGA 4KTWA 4ZHRA 3DOLA 3HK2A 4ELUA 2HMIA 4CJ5A 2ITGA 4NCAA 4NYNA 3MEWA 4DF8A 4L8RB 1VK0A 2VG6A 3MEVA 1IKXA 4DMNA 1A5WA 1BHLA 3VQEA 4FJJA 1NOYA 4DFKA 4CF2A 2B4JA 3NF6A 3CFOA 4NZGA 4HCCA 3QKJA 3M8SA 2X6NA 1WJSA 3VQ6A 4KHNA 1OZ3A 2X4WA 1S9GA 3DRSA 3V9ZA 1QHTA 2XY7A 1XI1A 2EQKA 1SSFA 4DTJA 3FLGA 3I0SA 3O4QA 4KI6A 1WNSA 3K5OA 3OVNA 3OYCA 2KW4A 2X35A 3WNGA 3CEYA 1S6PA 2B6AA 4AHUA 2PYJA 3ZT0A 4C8NA 4B9VA 2O4IA 3AVIA 3AVKA 1SL2A 3OS0A 1RT5A 4FZZA 1WSEA 4W5TA 3GOXA 2P1JA 4DTRA 3NGIA 4FK0A 3HT3A 3P8HA 1B9DA 3SZ2A 1OI1A 4IUVA 3QETA 4M3WA 2HNZA 1TL1A 1W9HA 4B9SA 4CJQA 4FM2A 5HP1A 1YTUA 5JS2A 2RN2A 2Y1IA 3PX0A 3MP8A 3AVCA 3DLKA 1BL3A 4B9TA 3RR7A 4OKKA 1WSHA 4Z02A 4CERA 2A1SA 2ZE2A 2EQMA 1ASUA 2GFAA 1HMVA 3NH0A 1KLMA 4K8ZA 3O8VA 3H08A 2AJQA 4B9XA 1D8YA 4DTOA 3ULDA 1C6VA 2IG0A 3D45A 1VSKA 2RPIA 4O44A 3NGYA 4CEZA 1TKDA 4H4OA 3V9XA 4DU4A 1VSJA 5D3GA 4M3ZA 4DU1A 4AHVA 4KHUA 1RILA 4AHTA 4XIUA 3NTIA 2R7YA 4R5PA 3LH0A 1LAWA 1R0AA 4DU3A 4KREA 3L2VA 3P8DA 4PLLA 3QBYA 4CEDA 2OA8A 3PFSA 4FW1A 2X4YA 2HVIA 2RJDA 4C5HA 5CZ2A 3VQ9A 1D5AA 4KO0A 4Q5WA 1F21A 2RHXA 4CHPA 3OYMA 4KKOA 4CEQA 3H8ZA 1X9SA 3IG1A 3VQDA 5CZ1A 2OPRA 3VQ5A 3RMDA 1DTQA 3EYZA 3SV3A 3M8PA 1U49A 1ITGA 4DF4A 3QLHA 1HPZA 4MFBA 4KB0A 4CJFA 1NJZA 3QNNA 4M3XA 3SUOA 4A4HA 1BQMA 1JL2A 4LSNA 5KE3A 3OYBA 5CYQA 3VQCA 3OYNA 1B92A 2Z1JA 4CGIA 5C24A 4E7IA 3DRRA 1RT3A 4CJLA 2K3YA 1BI4B 4W5RA 5HRRA 1CZBA 4J2DA 1LWFA 3RRGA 2WACA 3IRXA 4EDUA 4FYDA 4Q0BA 3AVGA 2RI2A 2GF7A 2JGUA 3ZSYA 3C95A 4HTUA 5HLFA 4CFCA 4DTSA 1CXUA 3SPZA 1QSYA 3LGLA 4MQ3A 3LWLA 4FJ9A 1HNIA 3LDSA 4CF8A 2HVHA 2G8FA 1X1PA 3UWNA 2I5JA 4HHTA 3HPOA 1Z26A 5E41A 2DFHA 3RWUA 3AA5X 1BIUA 4DTPA 1ZBFA 1Z25A 3TANA 4B8AB 3C6TA 2EHGA 4L59A 3HL8A 5J2NA 4E7HA 1U48A 3ZSRA 3MAQA 1JXBA 4CJ3A 3TAEA 4FK4A 4Z4HA 5K14A 5CYMA 4KHWA 2LRQA 2ATQA 2BUDA 1GOCA 4AHRA 4CJ4A 4CIFA 4FJKA 3NNQA 3KK2A 4GY5A 2IOCA 2EKOA 1NK5A 3AVFA 1HYVA 1WSGA 1J54A 1BCMA
chains in the Genus database with same CATH superfamily
5LEKA 5KYWA 2HSPA 3P83D 1G59A 1GVDA 3IAS2 1M1KC 2KISA 3SZPA 2PI0A 3PMIA 2DTOA 4FJHA 4DV5K 2F9TA 3Q7CA 1JUSA 3CC4I 1ZRFA 2O8FB 2QI2A 1U47A 2BHYA 1FBUA 4H0YB 1HJOA 3ER0A 5GMKm 1TW3A 2DNUA 1E4FT 2Q0RA 4XLHA 2UZKA 4HNUA 4HAMA 3J8AA 5J3BA 3THWA 4F9OA 4FWPA 4BC2A 1R1TA 3AVJA 2LD5A 2RQQA 3TL4X 1BOBA 3QYEA 1Y57A 3B6PA 1SANA 5EC7A 1LWEA 4O5BA 3MEEA 1EF4A 2UXBK 3VMFB 2KLOA 1KD1O 1FC3A 2MOXA 3EG9A 3TWHA 4FSVA 1MMGA 2EV0A 1I4K1 3H9QA 2GUIA 2R7SA 3QESA 3FX3A 5A2QE 4KHPK 1Z1DA 2XIGA 5AFUH 2RC4A 4A3DJ 3PO4A 1JU5C 1E3PA 1NBEB 4A3MJ 3SQ0A 3SQ1A 2J06A 3GIBA 4J6YA 3KP2A 2DPPB 2A36A 4I0AA 1W2BS 3ZSZA 3T69A 3F8CA 2HHWA 3WTXC 2VBZA 1ETWA 4CHYA 4B08A 2VBXA 3CUQB 2OQRA 3UA6A 2O7OA 2ZXJA 2DL3A 3HHHA 4JI2K 5EU7A 2XGEA 3IWFA 2EJFA 2EZKA 2MI6A 3CWTA 4LMYA 5D4SA 1E3MA 4JK7A 2QEXN 4E7KA 1YS6A 5IPAA 4FWSA 5CKTA 1S6QA 5AQXA 3C1DA 3GNFB 2VXEA 4MDXA 1Q7YR 2IAJA 2HBKA 3IRQA 4FWQA 3MDQA 4PIIA 1XGMA 2XU8A 2JWKA 2E5LK 3F3XA 5EGOA 2P0QA 1BDGA 2YNFA 2K27A 1BU1A 4LDYA 1GLNA 4C92A 2WSCE 1K4SA 4GO1A 2HAXA 4K43A 4DZJA 1KG7A 2OZ6A 3K1PA 4B3SK 2L3RA 3OW2M 3KP5A 1VRUA 1BN5A 2GTJA 4YFKF 2A0FB 1KU2A 2O88A 2YHTA 4QW2A 1HBXG 2HBMA 3SUNA 3DWLA 2Y9ZA 1YJNN 2ASPA 3E9PA 1HUXA 2YWWA 2NVTJ 2DAQA 1V5EA 1YX3A 3JSCA 3BT9A 2AKKA 5GAMd 4BACA 4Y3OA 1QZYA 2ZBKA 4J9EA 2X85A 2NUTB 4D5CA 2OPPA 3VQQA 1TLHB 2V7YA 1QNTA 3DAWA 3HRUA 4F91B 2DA7A 4N56A 2J4RA 3RR8A 2WAFA 2DJQA 4LE9A 2EYZA 1ETVA 3CCUT 2HOSA 4C2MJ 2P0KA 5HNFA 4Q5SF 4LSLA 3M8EA 2RN7A 4FLWA 3DQVC 3FR0A 5CO7A 3LSTA 2R92J 1TGOA 4KUDK 1Z7LA 2GA1A 4MZMA 3OTOK 1KHIA 4M75F 2LT4A 2K3XA 1QQCA 3FIWA 3M1CA 4BY6B 4AHCA 1EETA 4B22A 1GFCA 2EBPA 1SAXA 3SMPA 2CKKA 3HBLA 3VW4A 4QVZA 2JNGA 3W3CA 1MSEC 4NCGA 5K7HA 2NUZA 1X3WB 1NK4A 3HJFA 5D6WA 1JXSA 3ZSXA 3E3VA 4FXDA 1ZAOA 2BY1A 3D7SB 1S72T 3FF5A 1FJGK 3WTWC 4CEAA 1RETA 4YPRA 1VQ4A 1Q7YO 4HCZA 2C0IA 3CCEN 2KSSA 4DUYK 4C8QG 3I53A 4OPHA 5KE2A 4BE1A 3CD6N 3CCUQ 3R1XA 3LMMA 1XTAA 4JLGA 2CUEA 3TAGA 1GBQA 1X27A 3W2VA 2FEIA 2LQNA 1C1BA 3VF4A 3OJUA 3FFKB 4QOZB 1HJDA 4X6AJ 4MDWA 2DIQA 1KYWA 2CUDA 1APLC 1WA7A 1BW5A 2XROA 4DWIA 2QG9B 2WB1N 2R7XA 5ELZA 2ZSIB 4HTLA 2FBXA 4RTUA 1R7JA 4RB0A 3LSKA 1FTZA 4V19S 1AOYA 4M9ZA 5F04A 3CPWA 1LWYA 2RREA 5A0GA 4LD6A 1OH6A 4IHTA 4HCBA 2CS3A 3BY6A 5KRSA 2GWRA 4XAXB 2E1OA 2YRVA 4KULA 5D5XB 4YG2F 4A62A 3F9KA 1S72Q 2KNBB 1K8KA 1D5YA 1YRNB 2GUPA 4UC4A 3I8BA 3HTRA 1T6SA 2I8DA 1A5VA 3FZKA 1SRMA 2GV9A 1KQSS 3SJJA 2JS2A 1OYYA 3HTSB 2ZMEC 2K3FA 2CGHA 2ED1A 2IEKA 3ZMSA 4CCOA 3SYZA 3LQRA 1UJ8A 1VI0A 4XLEA 4DR6K 4GNIA 4ZYAA 3QXEB 1VQ7N 1LPQA 3GTGJ 3RMCA 3QIIA 4R79A 1IO2A 1P7IA 1N78A 3OSFA 4DOWA 5M1FA 4XRFA 3MKWB 2E4LA 2DTRA 2RHUA 5IT9Z 4P9FA 1G15A 4I2OA 1XCVA 2WY7Q 4EATA 2M8GX 1GLDG 3CF5L 4CHOA 3KEOA 1K78A 1KA8A 1XSVA 4HEA2 2R7DA 2RQWA 4A61A 2RQPA 1TAUA 4DNCA 2W57A 4JJNK 1C1AA 2M02A 2LBFA 5AQTA 1IRFA 3AO5A 1EX4A 4J9IA 3MKDA 4M7AD 4ZDLA 2DQRA 2LZ6B 3R60A 4Y1DA 3FK6A 3GOIA 2W42A 5BN9A 3LOCA 2D0QB 4EM2A 3JW4A 2W40A 1WB9A 3K6GA 4K11A 2R7RA 1V29B 3K4NA 3OYIA 3BGRA 4AQYK 2XAHA 5EZHA 4CZCA 2OPQA 3CCSI 4HVVA 4ZYEA 3TO6A 3VQPA 3WEEB 1GLCG 2FNAA 4CGZA 1VSLA 4B3MK 3M5AA 1RRSA 1DQUA 4GV6A 3FSPA 1HDPA 3AHUA 3SD4A 4E7JA 1RACB 3CC2T 3G4SA 2HBPA 1RCHA 1NTCA 2FMLA 4BWMA 4RCHA 4LD0A 3BZKA 1S29A 2YPRA 1G5VA 2PBDA 5HODA 2ZJRL 2KHOA 2X6SA 3VYUB 1OU9A 4JJDA 3C7NA 1NEBA 1QQOA 1I27A 3CQXA 2NUBA 3OMGA 2QENA 2RKHA 3LP2A 2M8EA 3DLLF 1JCFA 1GCQC 2E35A 2RJFA 4XH4A 1TK5A 1IBMK 3PIPF 2E1ZA 5JHUA 5DD4A 1IC8A 1MU2A 1OR7A 3BDLA 3ZQGA 3RESA 2XUBA 4D7MA 1ONVA 3CFRA 5BRDA 4M7DD 1VQ6I 4FYVB 3CVTA 3L1AA 4M77F 1ASVA 4PJOG 5D8LB 1I5LA 3AGKA 3CC2Q 1TKTA 2E88A 5CIUA 1J09A 4M78G 4BDYA 5AQHA 3PIOF 4BRCA 3QYBA 5AN4A 2UXDK 4JI8K 4HNVA 3AFHA 1NU0A 5KCOA 1MMAA 3TSZA 5LJ5h 2COBA 3TP0A 2FBKA 1KU3A 2XDVA 1BW6A 5E1WA 2LNVA 4GBQA 1I50J 4ZZDA 1WZOA 1JLGA 1T3VA 2CZ6B 5C44J 4KA4A 3SHFA 3LLRA 1U04A 2HNDA 4CJRA 1QLYA 5LEJA 1TT0A 4Z89A 4CK3A 3B6OA 2L3PA 1NJYA 4DLEA 4M3TA 3QU6A 3JAMZ 2IGIA 3R6MA 4AVZA 4CVNE 1MWKA 5K1YA 1M27C 5KK1A 5KRTA 3BJAA 3D0SA 3IKMA 3UT1A 3JB9J 1WUAA 2KJCA 2O8DB 2H1KA 4M9XA 3MEUA 2CO5A 4CESA 2D9TA 1TNSA 2GOXB 1ZTRA 4JNEA 3CXCS 1HF0A 2D0OA 3PY8A 3J7ZI 3CF2A 4JKDA 3KZZA 3WTYC 5CQXA 2GXBA 1U8RA 4C5EA 3P4IA 4EEFG 4WXCA 2QBYA 5CR4A 3BQZA 4N4OB 1OKRA 2KMUA 3LAPA 2IVNA 3H5NA 2L7ZA 3GLLA 4AIAA 4KIFA 4O0JA 3CFPA 3CCVT 1F36A 1BBZA 3BP8A 1UAAA 1KVCA 1WH7A 1ZLKA 4LNPA 3J7YJ 1Z21A 5LJ5d 1E3HA 2QKKA 3MN2A 1FBSA 1NG7A 4RTWA 1PSFA 3IRRA 1Z77A 2L01A 1HQCA 5GTHC 2QQRA 4DB3A 1M3QA 2FC0A 4H5RA 1QBJA 1JLBA 3LP0A 2Y90A 2AS5F 5AQNA 1S1VA 5FLXK 3MJXA 4P9UA 4CXFA 4J83A 2MCNA 1J5OA 4OMFB 3BC8A 2VPRA 2DMOA 3NVMA 3IS9A 1JHHA 2V1DA 1F1BB 1WDXA 3VOEA 4IWVA 2V51B 4KH4A 5JR3A 5JICA 1QS4A 3S6WA 4F4KA 1TZLA 1ZK8A 2QSHX 4OFEA 1MDMA 2QA4N 3KYCB 3Q1JA 3LDNA 1VQLT 3N4MA 1FNNA 5FLXE 3KLGA 3WNFA 4CEBA 2YHWA 4XLCA 2MWPA 1U2WA 3QEWA 3SXYA 1CZAN 3NGZA 2JZ2A 4ZDPA 3CCVQ 3OYLA 3HRSA 2FHDA 1RTDA 5F6FA 3CJRB 1RDAA 1TKXA 3JCMP 4KIGA 3AVLA 1B3QA 1WJAA 5M9OA 3AO1A 1ETKA 2TRTA 2VV5A 3H5RA 3DXKB 3FHNA 2P51A 3QQAA 4CZJA 3SBTA 2LR8A 1NGBA 4RW9A 3MKYB 1X9WA 3BTIA 4A6DA 4BC4A 2F4IA 1QU3A 3IMXA 3KTQA 5EOYA 1TTHB 3WTZA 1N6QA 3B6AA 4EFHA 2LT1A 2G8UA 1MGTA 2F48A 1GVJA 2P8TA 3M8JA 2QUFA 3WNEA 1TQPA 3CCLI 1DT9A 2KT1A 2CGJA 1S5LC 2Z1DA 4NC6A 2A3LA 1AU7A 1VQLQ 5HROA 4FZYA 3CCMN 3P1GA 3JRBA 1C6VX 1T05A 1IBLK 4C8QE 4B23A 1S22A 2JUFA 3TSWA 4JX4A 4FM0A 1HNXK 3NAUA 4M3GA 3T8TA 3UB5A 4M7AA 3MAJA 1YIJQ 3T9NA 2CUJA 2JRMA 3E19A 2CSOA 4B3RK 1RAAB 3I56N 4FJ5A 3S1RJ 1KAXA 4I9QA 3OYDA 3SLCA 4DQRA 3CPFA 1T38A 3KLEA 3BLYA 1FLIA 4ICLA 4GYIA 3A8OB 3NQOA 4FM1A 2MFZA 3GTOJ 1Q81C 1K73C 3EHQA 3A98A 4EZ9A 4N0AA 1OX9A 2NLUA 4FYYB 5CKHA 3CUQC 4KITB 1S3XA 1TQIA 2DA1A 2QQSA 4G6QA 5BPLA 4I98B 1SMYF 3N0UA 1Y96B 4BRQA 2OAZA 3K10A 3E9FA 1BI2A 3F8NA 3TEDA 2VUMJ 3VJPA 1IHWA 2QKLB 2VYTA 1G3TA 2KAFA 3NDKA 1KFZA 3CI5A 3A1YA 3JB9D 4WQ4A 1HSJA 1KG6A 2R58A 1QVFS 4DK9A 3M0PA 4PA1A 4C3IJ 2EQJA 4HA8A 2QEXT 3V4IA 1NKBA 3UKUA 4CEEA 1LOTB 3O5ZA 2KZZA 4HUEA 4LITA 4CCKA 2Z99A 4FJLA 2IAIA 3A4CA 4GW6A 4OX9K 4HSRA 5AQZA 1Y1WJ 2P9KA 3IV5A 4B3OA 1UGVA 1UHFA 3KP3A 1W7PB 4M7DA 2ECBA 5HDGA 1IG8A 5LGUA 3RYRA 3HZ6A 3M0QA 5K7FA 2BVLA 2K40A 2V6EA 1R00A 3IFRA 4CICA 4DLGA 4XKBA 3ZT3A 1VQPI 1AWJA 5E84A 2Z1GA 2GQIA 3V9SA 1T6DA 4C5GA 1ZLMA 3ZETA 2DY4A 2M16A 4GRIA 3S93A 2QF7A 3NMUA 1HQUA 4C3JJ 3M7GA 1JTYA 2QEXQ 3V9WA 1Y39A 2E7XA 1PP8F 2CYYA 2QGGA 4RGXA 3ZT2A 4DQPA 1R36A 4DQSA 4BY6C 3OYYA 2LJ1A 1M90U 1YCYA 4JKFA 4BR7A 2J05A 4DR4K 5F0CA 3FXJA 1MA9B 2NOJB 3RI4A 1SFEA 3FXQA 4QQ6A 3V9UA 3WUHA 2HHXA 2O3FA 1P90A 3ZT4A 2MA3A 3CG7A 1VQKN 1N8RR 4K2EA 2AK5A 5M1KA 4PWDA 3CPWM 4JRIA 1O3QA 1VSFA 2Q3SA 2EYXA 1WPYA 5LJ5g 2RHKA 3A5NC 3DB4A 2HTJA 4FYWB 4F93B 1TKZA 3VF6A 1M4ZA 2VJIA 4QKUA 1RBUA 3CCET 2OX7A 2A5XA 3FXOA 5LD2C 1JL1A 2GIVA 1KVAA 4F7UA 2OA4A 2DVEA 1XCBA 5I2MA 2D0AA 3V1QA 2O8BB 2C0TA 4B1XB 2VWBA 2VI6A 1B7TA 2YHYA 3U6FA 1WQ2A 3ULEA 2LP0A 4IO9F 2NXNB 2IIMA 3H1VX 4V2GA 1Y0MA 4M3YA 4B3AA 5ICFA 3JS6A 4PJOE 2PAVA 3M0RA 3EZ5A 1GV2A 1TWFJ 3FMQA 3JRDA 1N77A 2GFUA 4M78E 4FJ8A 2CT4A 2SEMA 1YJWQ 3TI0A 2JPSA 3ZQQA 2X3WD 4M3DA 3FKJA 4A3LJ 3H0IA 1RDWX 3EG0A 1Q82U 3CO7C 3R9PA 1YHQN 3VA0A 4BHCA 1ZGAA 1NPRA 2DD5A 1RR7A 2EV5A 5AQMA 3FZLA 3FIFA 2OD5A 1K8AR 4CF9A 2XK0A 3K4CA 5CLSA 3L3UA 1EZZB 5BPIA 3SEMA 5M1PA 3CVSA 4BWJA 1JEGA 3G10A 3GYHX 2P5OA 3SB2A 3DBHB 2OJED 2ZFWA 4EMHA 1B6AA 4CEOA 3JTGA 5CE3A 3CCUA 1IRZA 3HSCA 1PWTA 3EFOB 3LAMA 4H03B 3ZN0A 1NKUA 1OQKA 4XKWA 4M75G 1A31A 2K7AA 3D2EA 3VQBA 1VQ7T 4AH9A 2KRHA 4L5JA 2X9DA 3DPUA 5LJ3h 1D3YA 3SWNA 2IGOA 3G6EQ 1UG1A 2E2JJ 4WCEL 3M4YA 2UXXA 1GFDA 3HI0A 4CK1A 4CGGA 1YITI 3KFVA 4DJAA 1RI7A 2GXAA 2F5DA 2FYKA 1CLQA 1XMQK 4ENJA 1XGSA 3L1PA 4HQMA 1SFUA 5TRDA 1BO5O 1G4DA 4ILHA 1E4GT 4WCIA 2HHTA 4CF0A 3S2HJ 2EH3A 3JRGA 3WG7H 3KEYA 3O1BA 3BR2A 4JZ4A 1S72A 3PO5A 1PSEA 4JYKA 4J9HA 4EPCA 3FRNA 2MBFA 4E7SA 3BTLA 2X6YA 2LG4A 3Q9SA 3H1QA 2NRRA 4LF4K 3O2PE 3BDDA 3GFJA 1TP4A 2YHBA 4ZGJB 3HUGB 4J9CA 3VS7A 2AZSA 2CH4W 1E6GA 5GMKe 4RW8A 2A7YA 3ID6A 3IDHA 2FEZA 1VQ7Q 3OSSC 5D8KB 1B72B 4DTMA 4KAZA 2Q1NA 3ZQ7A 3UATA 3OS2A 1XPXA 2XD0A 1KQ8A 4U7DA 5KYYB 5LJ3d 1XQOA 5FD6A 4LXCA 2XPUA 2K9SA 2Y9YA 5FLMJ 4M7XA 1KC8O 2MABA 3K9JA 5LHGA 1ZG1A 5HK3A 5E3MA 2KKOA 1BC7C 1KZHA 2ISZA 2ROTA 3GZNB 2F5KA 3F23A 3TEEA 1BU6O 3HYIA 3N5NX 2EIMH 5CVJA 2A69F 3I58A 3P31A 1DLOA 2IGNA 2MLGA 2EJ9A 5IHIA 1H641 4HOBA 1FYMA 1M5Q1 1K0XA 3FXMA 4JLHA 5HS7A 2JTVA 2E2PA 2YSRA 4OGCA 3GX4X 1YO5C 3KUFA 3MN5A 1CGPA 3EE8A 4A4FA 1L3UA 1VQ9I 4P96A 3ZLJA 2VQCA 4A3GJ 3GVAA 3CHWA 5GMKi 3H6ZA 1ZSZA 5B8HA 1WOQA 2QWWA 2OANA 2NRWA 3KWIA 1DKGD 2VL8A 4BYYA 1X9MA 3H5AA 1GLBG 3EETA 2L02A 3MXJA 5LJWA 2WSFE 4JK8A 3AVBA 2WAEA 2EV6A 4CC7A 4F04B 1QPMA 2XRLA 1HC8A 4IIOA 4JAXA 1T8IA 1IV0A 4FISA 3O3GA 1VRTA 1USTA 2CH5A 3D5LA 5D6YA 3HOUJ 1LCUA 1BCOA 2QK0A 4FASD 4DR3K 4KTZA 1FOKA 3SFMA 2NVQJ 2CV1A 2CQNA 2COMA 4RDUA 4CC4B 1IZ1A 2QDYB 1UHWA 1LVAA 4MQVA 2MAMA 4XLNF 2FA5A 3ERMA 4FLVA 1VQ8A 2DOFA 4KT5C 3MMVA 2JJ7A 3FXKA 3VUZA 3UKRA 1TTYA 2XGXA 5B1AH 4QS8A 2FB7A 3JR9A 4XRSA 1ORKA 4XTWA 2G8IA 4WXHA 5AZJA 1U45A 3E2UA 3CC2A 2P9PA 3F5TA 5LGTA 2YUQA 3MN7A 1JT6A 5AQYA 3DEWA 3LM2A 4ZDOA 1OYWA 1AKHA 1I8FA 4HZFA 1G83A 5FKNA 3JSPA 8AT1B 3WQTA 5KYXA 1XJWB 2HMIA 2MD5A 3LAJA 1WJEA 1QPIA 1HNZK 3HOVJ 2NYSA 1VK0A 2HKNA 5GAN2 1TWCJ 1KQJA 3VS6A 1IKXA 4S04A 4EJUA 5DUIA 3ATVA 3VEZA 5H6QA 3OR2C 1O3TA 4DFKA 3CFOA 4HCCA 3QKJA 4Z8AA 4M77G 1WJSA 4ZN3A 3VQ6A 3VS2A 5KN8A 4KHNA 2FLOA 1S9GA 2HEQA 2HDCA 3M4GA 1R9TJ 2BE9B 2KK4A 1QHTA 4S0HB 2KRSA 2QA4T 1ON2A 4EJYA 1KG1A 1XI1A 4BRDA 3EE9A 1NMNA 5FLXZ 3HHGA 3CJ7A 1YUWA 4DZPA 1BI0A 1U9NA 2JVHA 5GAMf 2F5CA 2MC4A 4RCCA 2KIMA 3FB9A 4I09A 4B1YB 4IZZA 4WXDA 4JHDA 4WF9L 2GBQA 4MDAA 4BG8A 3CEYA 1FWZA 4X0GA 4U0VA 2JJ9A 1WI3A 3ZT0A 5JVGL 2ME6A 4FWRA 2NAZA 2CUBA 4EQQA 2P9SB 1T2KA 2ZSHB 3AVKA 2FRYA 1B07A 1WSEA 3GOXA 4M6YA 2Z9OA 4DTRA 4HWIA 4NLBA 4CCLA 2COWA 3HT3A 2P4WA 3IKTA 5J1UA 3CDLA 4LFUA 4M3WA 4ESRA 2FU4A 1W9HA 4CJQA 3EEQA 3F9MA 5D6FA 1ZR4A 1A36A 1LE8B 4BC3A 1OCPA 3O9RA 3FLCO 2QA4Q 3K0LA 2HYJA 4HF0A 2O0YA 3AVCA 4A3IJ 1BL3A 2KQWA 3B8AX 2OAWA 5CK9A 2HQAA 3EG2A 4OKKA 1WSHA 3HDDA 1P7JA 2RQTA 4ILGB 3I55Q 3C0CA 3T7ZA 4K8ZA 4CC3A 3I56T 5JVHL 5L3GA 5F08A 4B9XA 1XX5A 1D8YA 4B9QA 2KYMA 4DTOA 4XTZA 1C6VA 3CCUI 4WF2A 1AZGB 1G8XA 2KLAA 3SFIA 2EA4A 1JJ8C 4RTFD 4A3JJ 5LJ3g 1TKDA 2A41A 1IHVA 3KE2A 1HKQA 4DU4A 5D3GA 5L3DA 3UDCA 5C2DA 3ZEUB 3FK7A 4R5PA 2RMOA 4JRKA 3L2VA 4BUPA 3N5BB 1VQ4N 3P8DA 4PLLA 2QWPA 3QBYA 4DBQA 2JSPA 5E8IA 1H89C 3PFSA 5AQLA 2PMUA 1VQLA 4ETSA 1S7OA 4KICA 2RJDA 1HK9A 1TH7A 4D6WA 2A6AA 3J7YP 3J7AF 3ZQHA 5JMVA 1Z3XA 2FRHA 2DT5A 3I56Q 4KKOA 1QZ6A 3TQ7P 4CEQA 4XU2A 1YIJA 4M75E 3VQDA 4WX9A 4Y15A 3KP6A 2ABKA 3AG4H 3VQ5A 1T0FC 1WCMJ 3RMDA 1DTQA 2D8HA 5HLTA 2XF7A 2G7UA 4ABZA 3FZMA 2O8EA 4HCKA 2HQNA 4DOVA 3M8PA 3ZOBA 3PVQA 1JGGA 1ITGA 5FJ8J 1HPZA 2J6KA 5IXBA 3REBB 4CJFA 1NJZA 2P5VA 4JJCA 2P9UA 4M3XA 3SUOA 1Q86U 4A4HA 1JL2A 2ZJQL 3THKA 4OB1B 1VA7A 3OIOA 1XMOK 5KE3A 2QQ9A 1ZARA 2P9IB 1P4AA 3JB9I 2PJPA 4JD2A 2MPXC 4CGIA 2XPWA 1G3SA 4RLQA 1KAYA 3X26B 2L9RA 1BR2A 2ZMEA 2FJ1A 3O3KA 4E9HA 3M59A 1M8VA 4DQ2A 3N4QA 1VQNT 2K4BA 3ZR8X 1DEJA 2UV1A 3J7AO 1X2NA 2F2WA 3FBNB 3D2FA 5M5XJ 3VKIA 5GINA 2DX1A 2M9HA 1RR8C 2KDOA 3T1YK 5HS9A 4BY9C 3G71Q 1CXUA 4A4KA 2W85A 1EV7A 3LWLA 5HDNA 2KBTA 3HKSA 2M5WA 4MEYF 4LK1F 3HSRA 3MX2A 2K9MA 4C30A 4OMNA 5BMZA 3MN6A 1KD1U 4DTPA 1Z25A 1RIOH 3C6TA 1YG2A 3ASOH 2RV8A 3IHUA 2M34A 1I1JA 4EVVA 3HL8A 3BF3A 3TU4K 2CSIA 4RB1A 3T5XA 2AQEA 4CJ3A 3TAEA 3CZ6A 5CYVA 3UA7A 2ESNA 2OQGA 3BR0A 4AHRA 2XKOC 1MUZA 4CJ4A 1VQNQ 4RTYA 4FJKA 3NNQA 2ZZDA 4EMKB 2IOCA 2HZTA 5ICGA 5BRHA 3U9GA 5I21A 3CQZJ 3Q9VA 4F52A 5M5WJ 5MLCQ 1X1AA 4HYEA 4CBXA 5F0HA 1TWBA 4HUGA 2EBIA 3LSRA 2HF4A 1NGEA 4MO4A 3F21A 1BIBA 5I3UA 3G4SN 2ESWA 2HHHK 3LX7A 5F64A 1N8RC 3WG9A 2M4KA 2XY5A 4ISEA 2VWJA 2QM3A 2HVRA 1BI3A 3JYTA 4KGXB 3SJMA 3AL0B 1YHQT 1KXPA 3CC2I 2J6FA 5GPCA 2E12A 2GTDA 3T1HK 2OAUA 3C2BA 1G3WA 3RKWA 4CE9A 4JRQA 1R22A 2MMPA 4J00A 2LJ0A 2YHAA 2HI3A 3DPLC 1TT5B 1GCQA 4TVRA 3URGA 2CP6A 3ZMZA 2CV2A 2OV7A 3CCJQ 5FWCA 3TTFA 3M1FA 5I9EB 3NAEA 4B9LA 4AUXA 4OLAA 1J0RA 1EQYA 4CHUA 4HKEA 3AV9A 4LY7A 3FISA 3ABMH 1SQKA 3IH7A 2HMPA 3HSEA 3H3NO 4A4EA 2BUPA 3Q3SA 4PLIA 3O08A 2YJEA 3CPEA 2QXFA 2LP5A 2RGVA 3S32A 4EZ6A 1DUXC 4A2BA 3LA7A 5FKKA 1QMCA 1SUQA 2NUPB 3PNYA 2NS7A 1YJWA 3TO7A 4DSKA 3QJYA 2D1HA 2OYQA 4M42A 2YLCA 2FF6A 1IXDA 1ETQA 1YHQQ 2P5GA 4BQZA 4P1WA 2AO9A 3H0GJ 2HNHA 2DJNA 1K8AC 5EG0A 2E65A 5DV5A 1ZELA 2DK5A 2LY9A 2VONA 1N6AA 2A5YB 3KLFA 1HKTA 1RAIB 4CCMA 1D5VA 4FU6A 2HF3A 2ZJPL 1S6LA 4M77E 5AQWA 2M7AA 3E5XA 1WHJA 3S41A 5DTDA 2BZXA 1Q7YU 3A1PA 2E1YA 3OYJA 2EA2A 2ZFUA 3CP2A 2LKXA 1ZYRF 4RS8A 3CJNA 4A4GA 4DQQA 1BI4A 5KVRA 1L5UA 1HOMA 1FBQA 2CW8A 3G6EA 4A3KJ 1JXMA 1NMDA 2Q8KA 3N4PA 2KT8A 2ELHA 4KT6A 2JVGA 1HNVA 3DLAA 2DZ9A 2GNCA 1I0CA 5F1RA 1Q9XA 3RTVA 4L0ZB 2DL4A 1SFKA 5E17F 4BXUA 1D3BA 5LY3A 3CCVI 2DFIA 1V4SA 4FWKA 2P7CB 4Y28E 4OPKA 2XY6A 2EFWA 2DL7A 4O5FA 3FBIB 1X69A 3OYAA 2EYWA 1I3QJ 3V42A 5E3NA 1YJ9I 3TTDA 1AD5A 5KAIC 2V79A 3QO9A 2DKGA 4JI5K 3W6JB 4I2QA 3F8MA 1ZSGA 3X2QH 1R8OB 1R5GA 2LSOA 5GAOp 5KAFC 4XL9A 3MK6A 4FJ7A 4QQDA 3Q0WA 3D5RC 2L5QA 2NRHA 4CFAA 1I94K 2B7EA 4RW4A 4BR9A 2JTFA 3DXJF 1MW7A 1VQMA 5DEQA 4HVJA 2HQ5A 4C8OA 4LLGF 4LOCA 1XC3A 2ZXIA 1N5YA 1VQLI 1RI9A 2DZCA 1SV5A 2EQUA 1DJ7B 2H8RA 3LFKA 5CY4A 1Z91A 1JE8A 1HCRA 1DIZA 3REAB 4I0BA 2O8FA 4DTNA 3AVAA 2HSTA 4FLUA 1HD3A 4WYBA 2KY9A 3BY5A 3S3OA 1NGGA 3LANA 4RG8A 4HDUA 2KVQG 4FSXA 2R5ZB 4C0FA 3JREA 3QYFA 2AT1B 2LX7A 3KKSA 2EZIA 5HLHA 2RVCA 1WJ5A 2DOEA 1W0UA 4WCGA 2DDBA 2P81A 5GANe 2X1DA 3LDPA 4AIHA 3SYTA 4PL7A 3SUPA 3L2RA 3THVA 4Y91A 3DTIA 3SQ4A 1Q9YA 3KKRA 2E1MB 1I5ZA 3GFLA 3FE1A 5IYDJ 2GZWA 4I6MB 3CJBA 2XVCA 1HA8A 4M3EA 3BG9A 4JP0A 1UA0A 2YT6A 2G9WA 3PO3J 1BYMA 4DSFA 2QXLA 2I5UA 4ZTJA 3CUQA 2NRVA 1P4XA 4A3CJ 4ESJA 5GANf 4DV7K 2AHQA 3FZHA 1GXIE 5EXWA 3MXIA 1POGA 5E1XA 5ADXA 5E8GA 2BE5F 2FBYA 3WXMB 2YRDA 3PO2J 1T08B 4HPQA 5DS9A 3GTLJ 3X20B 4E47A 1G6NA 4NB5A 1JCEA 5AQFA 4OWRB 3VETA 5J2QA 1RT1A 4DS5A 1TC3C 4DV4K 4CO8A 1B8IB 4HX8A 3CW7A 3DTKA 2LQWA 4J2EA 3K4KA 1IDYA 3RKQA 1LNWA 2QEXI 1UWBA 3KNTA 1Y0UA 5CQYA 1AZEA 1NM1A 1RT4A 3ECHA 2CQXA 4CC2A 4OGEA 2HVQA 3KTUA 2PX9A 1XGOA 2K4YA 4EJWA 4M3BA 1Q82R 4KJZA 1M2VB 2NUTA 1BC8C 3CM6A 1YS7A 3DKMA 1JLCA 3THXB 3LSJA 2V7FA 4BRLA 5BREA 2WONA 4FJMA 1JB0E 4H0XB 3E1SA 4UVCA 1ERDA 2VBWA 1YJNI 4BC5A 2RDPA 3B73A 3L0QA 4M41A 4CFBA 1MHNA 5K5QA 2K9NA 4WQ5C 1WHLA 4G6TB 2L3SA 1YWOA 2K5LA 3FM5A 3PL8A 3EGUA 2VG7A 4CGFA 2LDMA 1T3SA 4LIUA 4N4NB 3A5LC 2AIRB 4A5BA 3L2UA 4YOQA 4AFZC 3H3ZA 2H1LA 1FOWA 4O6JA 5LHHA 2V75A 3RMBA 3MP1A 3KBGA 4BEHB 2F5FA 2W82A 2X3XD 1CZ9A 4GYGA 2H27A 4DQIA 3EQLF 4FVMA 4C9YA 3HB9A 3WE2A 4CZKA 4B1ZA 2GCXA 3WQUA 1D0YA 4C1NK 4PCQA 4XNFA 5C25A 4G6DA 1REPC 4BRMA 2VQFK 3RERA 5J1RA 4KN7X 1KSWA 3OYKA 4C1NI 1PRLC 1W5CC 2DDAA 1GV5A 2DPDA 1S3JA 4MFEA 1JXEA 3MO8A 4HUFA 3BTCA 4IOXA 3I5SA 3O3FA 3M54A 2QA4A 4C8KA 2L89A 4E0DA 1LW0A 2OUMA 3C2HA 5JFRA 5LMUK 1OEBA 5DCMB 4J8OA 3P5JA 4MHGA 3HM9A 1ZBLA 1NH3A 3I55A 3CCEI 1YQMA 4CYCB 5FLXO 2K3BA 3QP6A 2HXOA 1VQ5Q 1Q82O 3CD6I 2NRTA 1X43A 1WSJA 4TSXA 2FUG2 1MBEA 1C0WA 2V8JA 4AM3A 2E8AA 4B8CA 1YRNA 2YX6A 2F8SA 4C0ZA 4DR1K 2HHUA 1RBVA 3UKGA 1UTIA 2KT0A 3VODA 1VAZA 4FOEA 3E9OA 4YHHK 4DTUA 4BI3A 3C6AA 3COAC 4M63C 2VJJA 4HDVA 4C8QB 5KCHA 1NK9A 3V81A 3W6KB 1U6GA 1PD1A 3L8BA 3TSPA 1QVUA 1I1GA 2JWLA 3NARA 2K2MA 1JLAA 4W5OA 3ZQLA 2K9QA 4OKJA 4IKFA 1X1DA 4JDSA 2CP2A 4TV7A 4E7ZA 3NE6A 1GXQA 3M8RA 2ZPFB 3T3FA 4I01A 4A5AA 2K2VA 2QTXA 3ISNC 2XAFA 3I56A 1YX5A 3L42A 5SWMA 1RBSA 5DD8A 3W6VA 2EPDA 3MCAB 1RPWA 4FWLA 4ITVA 1HW1A 5HCKA 4N76A 3KEQA 2LCCA 1ZA1B 2WTEA 4QQGA 4YORA 1XGNA 4NXMK 2JN0A 1WSFA 2Y31A 1IV8A 5EEAA 4BREA 4BHPA 2IS2A 3VQ4A 1P6RA 1VQ7I 3FC3A 3BDUA 4CJTA 2W6KA 1FKPA 3K5MA 3ZMTA 1S1XA 1W5SA 2LQ8A 1HXDA 4EMKC 1BWFO 2KZVA 1XNIA 3DLLL 3WEEA 4N5SA 1S72N 3VYSB 3CCSN 1V5FA 1R23A 2FQ3A 3PUBA 2AKLA 4FJNA 1XQHA 2GX9A 1RNHA 4BRGA 3PIPL 1TG0A 1KFDA 4IRIA 2L4AA 3QJ6A 2NRXA 4A5NA 3E6DA 4RTXA 5DY9A 1JJ2A 3JCMe 3CMAN 2MK5A 4CJUA 1QVGA 3Q0UA 3SZGA 4OB2B 3LP3A 3AY9A 1QE1A 2L9SA 4A63B 1IH7A 5AFUA 3AL0C 4II3A 5AZIB 5FU6B 3PIOL 3AAFA 2CU7A 4XTUA 2PU9B 4J9BA 1FEXA 3G71A 2Y2ZA 1OISA 3I59B 4GV9A 1HKGA 4I2PA 3HSFA 2R7ZJ 1C1CA 1C0TA 1TUYA 2O5RA 1KG2A 1R4NB 3JCMf 2A37A 4KUMA 1PNJA 3D7EO 4GCVA 3HG9A 3WU0A 4KYWA 4RM3A 1IKYA 3ZQIA 3LH5A 3GTJJ 4BB7A 1W7PD 4XEIA 4K25A 1T03A 1TSFA 4E89A 1T95A 5L3EA 2MC3A 2A42A 3MWTA 5BPNA 4FT8A 1ZG5A 4AHSA 5IP9J 3PM1A 1IUFA 4B24A 4OFHA 3ULRB 4FZXC 1VQNA 1MMDA 4ZGDB 5LMNK 1IN7A 1OCCH 1TL8A 2G3RA 2BBYA 4ZZLA 2F9WA 2R7TA 5CKEA 3I5UA 1V3FA 2ZXWH 2XIDA 3E0JB 3LL7A 2XG8D 4C8MA 1XWLA 2ZD1A 1X2MA 2V9VA 2HPMA 2O4XB 2ZNYA 4LH5A 2QWMA 4IFEA 5FPDA 3MEGA 3H3OB 4DV6K 3QEPA 2CP3A 4UVBA 3HOWJ 1VOMA 1N25A 2LTOA 5GIOA 1QCOA 1KG3A 2JXBA 4A57A 1NJWA 2EB7A 4BY7J 4UB8C 2O8DA 3PNWC 3A5ZB 4KTQA 4DA4A 1MZBA 4BDPA 4IRGA 4DV1K 2K3PA 3PIOA 2RM4A 4EGYA 1EH7A 3OIQA 3CQTA 2D5RA 3DLGA 4F3TA 1NJIR 2X4XA 5AQVA 1RDUA 4KH6A 1JLQA 1WN7A 4W5NA 4ENNA 4E4HA 3ENBA 1DTTA 3CCJA 3OIPA 3CCQN 1ARKA 2QKMB 3U21A 5M1NA 4IIMA 4CZMA 1PKSA 1VQ8N 3CMEN 4PJOB 1Y8QB 2R4GA 1MBKA 2YU3A 5F27A 1WNLA 2M51A 1TWAJ 4M78B 3WGIA 3LL3A 4BG9A 2DTZA 1LCKA 3NGPA 3GFIA 4LG3A 2RHIA 3CP8A 4A54A 2EQIA 3OYHA 2OTJQ 2B0LA 2MH2A 3KYDB 1P9QC 3PQKA 3WXJA 2VKHA 4Y17A 1FPQA 4AFUC 2F2XA 1Y1VJ 4GXOA 1WHUA 3IC7A 3FDRA 2R7UA 1WZ2A 3LSHA 1YHQA 1WPKA 1JKRC 5HOOA 4A3FJ 3OY9A 4Y4RA 3U3YA 3AG1H 4EIAA 3ABUA 2X6XA 1WGSA 1XMAA 2E4HA 4NS5A 3MXMA 4W97A 1SD7A 2M1BA 3O4NA 3L2QA 2BOLA 3C6HA 1A35A 2FZGB 5GADJ 3FZVA 2V1NA 1U84A 2L7FP 3VV0A 1BG3A 2DJZA 3C3WA 1W2BA 1DGRM 1LDJA 2MWOA 3JCMV 2HOTA 1M3BA 4E2FB 1AEYA 3KIOA 1N34K 2KTQA 3CC7N 4PY5A 3PNVA 3DXKA 1OVYA 3OW2P 4QCLA 4BU2A 2QA4I 4IEIA 2RNJA 4DFMA 3RBBB 3LALA 1NJIO 2D0NA 4BBSJ 4BVOA 1KVBA 3DLBA 3JCMg 1QP2A 4E9FA 2E6LA 1DPRA 2JPCA 3DXMB 3LNQA 5M5YJ 1EFNA 5LGNA 1PDNC 3RMSA 4YOXA 3O3HA 2G7HA 3P38A 3CC4T 1BUPA 4B8XA 4BQQA 1HQEA 2CWEA 5IXFA 4CZFA 4M7AF 1M2OA 3G3ZA 1QP3A 2JPBA 3OS5A 1UHSA 1XHXA 2BE2A 2LREA 3EH2A 3TPQA 4PQUA 1Z9CA 4KGVB 2JMWA 2IBDA 2DXTA 3CERA 1XMKA 2E1MC 1HKCA 2HOEA 4Q5VA 2PTKA 1SG5A 2HOAA 5F1XA 2GBZA 2DFEA 2EVRA 2NS0A 2O8KA 4BQNA 4DYQA 3CCMI 4M3FA 5CQGA 4DOZA 1XSDA 3J7AP 1KGSA 3HGGA 4UUVA 2GGRA 3DM2A 3MP6A 2DPUA 4BRPA 4HV5A 5J3LA 1Y96A 2YUSA 4KRTA 4XQ3A 1HJRA 4A0ZA 4CJWA 2G8HA 4U67L 4RG2A 5KYUB 2JMCA 3DEUA 4J5YA 3R3LA 3T1AA 1CQTA 3I56I 1KC8U 1V4RA 2IVMA 3W2AA 4HF2A 1I1SA 2VKDA 3CC4Q 3TU5A 3LSMA 1ENHA 1E3OC 3LDQA 2YKMA 2JHNA 2ZPGB 1BA1A 1ZRCA 3HPWA 2Y75A 4ENMA 3MWMA 1J2XA 5J4VA 4V2SA 3GPLA 1LFBA 2K57A 3R4KA 5GJVB 2NZTA 2JTMA 2ZGYA 3HTUA 2VCPA 1IF1A 1P92A 1MJAA 3HZJA 3JB9H 3GCMA 1NWKA 4H0PA 4PJLA 3ZCOA 1YLFA 1FP1D 1U8BA 5CKFA 3QBXA 4YIIA 3OL4A 1KQ1A 1F43A 4LD9K 1V1CA 4DQ8A 4DR7K 1M90C 1HYZA 4EA4A 1YIJN 3T1BA 4FW2A 4KFBA 3TARA 4XKVA 2Z16A 5GAN8 1T0FA 1UUEA 4PGHA 3K2AA 4CJPA 1YN8A 1YI2N 2FSKA 1KYZA 3R2XC 2BGCA 2JA8J 5E18F 5J47A 4AYBA 4UY8I 2FVUA 2DERA 4BAYA 2E5QA 2RF0A 1IN5A 5CHIA 4JX5A 3LCNA 1HW5A 1MV3A 2FBTA 2XDPA 4YOUA 1XN7A 1D0ZA 3KK1A 3AKZA 4E7LA 1W4SA 3PT9A 2M0MA 1Q18A 3AARA 2DTIA 3A0BC 4X62K 3I35A 2DL5A 4BNCA 2IRFG 4H5NA 2OZMA 2OPTA 1KK7A 1A5JA 4F55A 3I0TA 1VZ0A 4IRHA 1UGQB 4B9UA 1H8KA 3K4MA 3TAFA 1X1BA 2DF6A 4XN0A 3T8RA 5AQJA 1Y0NA 1RDBA 1KQSA 4C2TA 3ZMUA 4IX7A 4B09A 1GXPA 4IO9L 1BIAA 4CF1A 1WJRA 2R5YB 1D9FA 3GTPJ 1ZR2A 4M45A 5AONA 1EXQA 3WU1B 2RE2A 3KFWX 4B9WA 4D9JA 1IJJA 3MCZA 4PKHA 3MD2A 2RQRA 2EK5A 1BA0A 3SMSA 4HT8A 3MHXA 2OTLI 4KB1A 3G1OA 4N41A 2WWYA 2EFIA 3ERED 4FLTA 4H0EA 4BE0A 4UUSB 5GMKj 5TKYA 1Q82C 2ZPHB 2HTSA 3PFYA 4CD3A 3FXUA 1MBFA 1VQKI 2DA3A 1NHAA 2O8BA 1ZQ3P 3O8GA 4M3UA 4CHZA 1SD6A 1MV0B 4K8XA 1KEAA 2NS8A 3J81O 4J7FA 2E6MA 3FDYA 2HL5C 1KQ9A 1WAFA 2J7IA 2NOEA 2P0PA 4ESBA 1RESA 3FWEA 1UG2A 2XKOA 4IFYA 3CIPA 4DIQA 3TAPA 4MZTA 4OOIA 3NH2A 4MIMA 4CGHA 3KYLA 3AVNA 3N97A 1RABB 2PEXA 1J5EK 4H0VB 3ZQCA 1PP7U 3L09A 4IXCA 1CF7B 2YUNA 4A53A 1LV5A 4C8QC 2LVMA 1XD7A 1QVPA 1D8JA 1ZYQA 3EAEA 3GG4A 1I6XA 2HVSA 2K9LA 2AXLA 4M9SA 3O8MA 3AA3A 3L4QA 4MTDA 4N4HA 4LN2A 4CFDA 2BGGA 1XSXA 3EFOA 1FOYA 3H0DA 2HKXA 2XHKA 3OSVA 4EW0A 2D1KA 4JYAK 1PU7A 1QWFA 2YLBA 4XU0A 2QWNA 4CJ5A 4KT0E 2ITGA 3WVDB 2MLKA 1DDNA 3VWBA 4DF8A 5KYNA 1D1AA 1UJYA 1EWQA 1JGSA 4XTXA 3D5SC 4GDFA 4B1UB 1X3NA 4LF8K 1A5WA 1JJ2M 2X6OA 1YITN 1NOYA 4CF2A 4EIKA 1QVGM 3RZOJ 3NF6A 4PUSA 4XRMA 2IVOA 1VQ5A 2PUKB 4OU0A 4FT2A 1OZ3A 3R6OA 1YJWN 2VLAA 4B44A 5GAN4 3VSKA 2XSJC 4A5MA 4CD1A 2XY7A 4OIOF 3WTSC 2YCHA 2A61A 4W1UA 4U0WA 4HLXA 1RLQC 3U23A 3MPUB 4BKXA 4XH1A 5AT1B 4IHWA 2FG0A 3HUGA 1WNSA 1BJAA 4CBUA 4BHBA 3CCST 3K5OA 2HBLA 1NM7A 1MH3A 2KW4A 3CDIA 3INZA 4BR5A 3ZMDA 2X35A 1B72A 2F1LA 5FU6C 4Y33A 5FFZA 3P9KA 1S6PA 5ICCA 2B6AA 2PYJA 4B3TK 5KYYA 2A3ZA 3CMAT 1MJBA 3AVIA 3BFMA 4MZPA 1Z9ZA 2KKZA 4M75B 2XDBA 3JB9F 2NOGA 2RPNA 3NGIA 3CXCA 2W6LA 1OI1A 2VJ4A 4JJBA 7AT1B 5DM7R 3SZ2A 4BI8B 2DMQA 1XMXA 1TL1A 3G6EN 4B9SA 4FM2A 4K0KK 1T56A 5GAMj 2BY0A 1ODDA 3PX0A 4D8KA 5HS8A 4H5WA 3D1NI 3BPXA 2YSQA 3DLKA 1E17A 4B9TA 1AWXA 4FM4B 4CERA 2ZE2A 2I0NA 4NO7A 2EQMA 2X1CA 1PKTA 2JUGA 4UNFA 3CCSQ 4X64K 4OMYA 2ZGWA 1VQ6T 2KRFA 5DM7F 2XKPA 2QW9A 1K1ZA 3I0XA 1M1FA 3MZYA 3CMAQ 4N0BA 4OIQF 3FJPA 2RPIA 1VFCA 2BY3A 3E5UA 4L5EA 2LY2A 1LUJB 1X4OA 2QWRA 3OGDA 5FKMA 2TCTA 4IHVA 4DU1A 4AHVA 1RILA 4AHTA 4XIUA 3NTIA 4FHTA 3RPQA 5AYFA 1WVRA 1HPMA 1LAWA 3LDLA 1JTXA 1R0AA 3OOUA 1VQMN 1OYIA 2CP7A 3R0JA 2IPOB 4RTTA 1GLFO 1ETOA 4HF1A 2P4TA 2K5IA 5CAIA 4C5HA 2D8JA 2ZNZA 2NOZA 3VEYA 1QHHD 1SVMA 2ZPBB 3GEZA 2DA6A 3KP7A 3CUOA 4YDUC 1FP2A 4Q5WA 1F21A 3ZN1A 4PJOC 3EN9A 4ELYC 3OYMA 3VS3A 2IVWA 1VQ6Q 2JK3A 3IG1A 4M78C 2P5LC 4I99C 2E20A 2P6TA 1V54H 4NC7A 4X1VA 4BGBA 1ATSA 3CMMA 3HEFA 3CCQT 2E1CA 3SV3A 5AIQA 1VQ8T 3CMET 1RL2A 1H1VA 3HKZA 1AWWA 4DF4A 4ILJA 3QLHA 1R4MB 5GIPA 2LKSA 4MFDA 4KB0A 4M74A 4FTHA 4BY1J 3K69A 1IGQA 1W2BM 2ABLA 2LKPA 1U0JA 3H35A 4LSNA 4X1EA 3OYBA 1SEUA 3VQCA 2WC2A 2ZGZA 4ISGA 4PHTX 5GJWB 2Z1JA 2HQHA 4E7IA 2RA2A 2E7WA 3KLOA 3UNGC 1VQON 2NVXJ 5HRRA 2STWA 1CZBA 3KK7A 4A0YA 3M5RA 2AP1A 1LWFA 3RRGA 2PVOB 1RAHB 3IRXA 4Q0BA 4BGDA 1ZQ1A 4OMLA 4BXXJ 1CKAA 3C95A 4HTUA 5HLFA 3LW5E 5GAHJ 5C15A 2YX7A 9ANTA 3SBGA 1IW7F 3CLQA 4BUGA 2H56A 3CCQQ 2VKEA 2CRGA 1Z05A 4DW6A 1VQ8Q 3CMEQ 5J8FA 2HVHA 3RQIA 1WWXA 5FU7B 1NYGA 1X1PA 3UWNA 3HPOA 5E41A 4ELZC 2FPEA 2PFUA 1ZX6A 3QUIA 1ZLJA 2WAQA 3SDZA 3CC7T 1ZBFA 3TANA 3EH1A 1LDDA 2NYXA 2JS0A 1PC0A 2VODA 2P9SA 2OTJA 4QT7A 1FX7A 1QVFA 2ECZA 3IAM2 2DYIA 3MAQA 4FK4A 3EFSA 3VESA 4KHWA 2LRQA 1QGPA 2BUDA 2YRCA 1GOCA 4XOTA 2O03A 3QOPA 2JW4A 5TJJA 3FMSA 3RIRA 2PZ1A 2K85A 3VEWA 1LE8A 2V52B 1HYVA 4OMMA 3CCLT 1QHGA 3DI6A 1GUUA 3SDGA 2AHJB 3AT1B 3IWZA 5GTIC 4M77B 2K86A 3O9TA 3NF8A 1SSHA 3BTJA 4CJVA 4EJTA 1CSKA 3DBRB 1RC9A 4C92E 5J39A 3GF2A 1STZA 2CFXA 1VYVA 2BZTA 2QYOA 2ZQBA 1BR4A 3QO3A 3TQNA 4EP5A 1QA6A 4KHYA 3H9NA 3NRVA 4OO1J 4DYCA 4AG2C 3PMTA 3CC7Q 3WE3A 3CWUA 4WQ5A 4C23A 3ZFJA 3F6OA 4RAGA 1PU6A 1ZUKA 4BH9A 3F73A 3I64A 3DYAA 2HYFA 3ID8A 2EKHA 2DYBA 4M72A 2JTEA 5EY4A 1YQKA 2FF3B 4YOYA 3OYFA 3CPWP 1JLFA 4NB4A 3VS4A 3ZEUA 3ZQFA 4EMGA 5AQGA 1K4TA 5L3BA 1Z9QA 3OHRA 4J2AA 1X6OA 1MUYA 1HLVA 1W0HA 3L3VA 1E2XA 3VOVA 3VYRB 2BW3B 3CCLQ 1B1BA 4JV5K 3NHNA 1WEFA 4EV0A 4PL8A 3GL1A 1SHFA 4BRKA 5KGXA 3EYYA 4AMCA 3HO1A 3HJEA 3D6RA 1Q86C 1WX6A 4LB5A 2OZUA 1FN7A 3H36A 3Q7BA 5GAOq 1J6ZA 1EKEA 1B59A 1U5TB 1UHMA 2WY8Q 4JKBA 2MGQA 2DTHA 3VB2A 4AM6A 5AIPA 4QAGA 1VTNC 4PK4A 5CQEA 4FETA 4Z2YA 3AO2A 1YP5A 2LSNA 2BXYA 5D6EA 2E2HJ 2QQAA 1NEGA 4NDLA 2E36A 4KI4A 4U7BA 1VQ4I 3U9DA 1SC7A 3I55N 1IRGA 3CJQB 2Y69H 4NUBA 4IDKA 1YIJT 1KQSM 4X9DA 1X2QA 2QTVA 3N05A 4KMUX 3ZSOA 1ZHFA 4DFJA 1L3VA 3RUXA 4OAYA 1UG0A 4BRFA 2FZKB 3S14J 2XAJA 1YI2T 2HDWA 2P9IA 3TR8A 3ELKA 1JKPC 4B6MA 4DSEA 4M7AG 1RT7A 2Y4YA 4G8XA 1IXSB 4CYDA 4KISA 3ZSWA 3CC4A 2H94A 2HZYA 1KD1C 1J5YA 3LA3A 3VTIA 2WV1A 2GQQA 1RTHA 2H3GX 3ZMVA 3VEPA 4ME7A 2F2EA 1Z67A 4GLKA 3KLIA 4Z88A 1C0UA 1B4AA 2MYSA 3OH9A 2IGKA 2N8GA 2BIVA 5ILVA 1YT3A 2PZSA 2Q2RA 2I5WA 2RNGA 3VF2A 1F4KA 1J9AA 4CK2A 4Z6YA 1BK2A 3G7ZA 1NGDA 1TUDA 2O9SA 3I0WA 2RN8A 3M0TA 2MG4A 3C94A 2D5VA 3V1OA 3ME9A 4G9ZA 2P7VB 3A01B 1YI2Q 4DHYA 1WYXA 2EFOA 1G2BA 1OCOH 1VQPQ 4Z0UA 3DU6A 3EGXB 1J9IA 2V1XA 2XB0X 1G3YA 1BL0A 4FPAA 3SEZA 4KRFA 1UA1A 5D6XA 4B48A 5L8RE 3E6MA 5E20A 3HOXJ 2RJCA 3M8QA 5B1BH 4EMKA 1S7EA 2FSNA 2C0OA 2FXUA 1QZ5A 3D0PA 2IP2A 3CJ1A 4EVIA 2R5MA 4L3QA 2LMDA 4K42A 2QWQA 3DP7A 4PSXA 2XC7A 4AIKA 3FM3A 4CEFA 2F6CA 1R0CB 3SJHA 2CGPA 3QNOA 3VQ8A 4L5IA 3P39A 4CJKA 4JKGB 1I07A 2CDTA 4QTRA 4DBFA 3WTTC 1U2VB 3I4MJ 1C0MA 3TO9A 4JRPA 3K2ZA 2GELA 4HLYA 2NOFA 1A04A 1O7LA 2DBMA 4DV3K 5ADXH 3IH4A 4QVCA 4Y13A 2MF2A 3ASKA 3G71N 3GBQA 1FTTA 1R77A 4BDZA 2HXIA 2P0WA 2E41A 2VXZA 4BQOA 3QBWA 2LC4A 5KTQA 1SKWA 1N3CA 3S9HA 4GFBA 3LSGA 2MD0A 4OKEA 3CJ9A 3G4SI 1SFOJ 4Q4ZF 3K58A 4MLHA 2BV6A 5T7BA 4HX4A 1QQMA 3DKYA 2L0KA 1NK3P 1X19A 4BR4A 2BYVE 2A68F 3FGUA 1KQ0A 1NOZA 4YOTA 3DLRA 2HFHA 3T0YA 1P7MA 1IUYA 3GFMA 2WV0A 4PSWA 3E01A 1IG9A 2EW3A 1VQNN 4DEXA 3S1NJ 4FYXB 4RLFA 3VTHA 4EJVA 3JRIA 2NUPA 3OW2S 1Q7YC 2FZCB 1K6YA 3CWAA 1YITT 2YG9A 4OIPF 1PYVA 2BANA 1M9SA 3DJCA 2X74A 2DVJA 1N5ZA 3QP5A 2DO7A 1LWCA 4LF7K 1VNDA 2CUFA 5C6SA 4O0IA 4IG0A 3ZYYX 1ZGWA 4DKWA 4BJ5C 1YJWT 4IUTA 1BA5A 4XU3A 4PJNA 2XGCA 3F2KA 3TTCA 4LFBK 2M0OA 4II1A 3WGHA 2DYSH 2NOHA 4IURA 4M75C 1B9FA 1GLJO 4CJSA 3GDQA 1LMZA 2EIFA 4I9LA 4EJZA 5GANj 2P5KA 4LF6K 1MMNA 2EFNA 1OH5A 2JA2A 3K4JA 1XC9A 2QKBA 1KU7A 2FOKA 1FY7A 2HQRA 3VERA 3TMOA 4YFUA 3CCJN 4A6EA 5A0LA 2YX4A 4RKUE 1YITQ 1KTQA 5H2FC 1WXBA 5GMKh 5BOXA 5JLHA 2DBBA 5GAOm 4CJEA 4H5TA 1W1FA 1VIEA 1WFWA 5GPAA 3CYMA 2D1XA 3G6ET 4H8KA 1TAQA 3AVHA 2JN6A 2DO3A 4KN4X 2WBMA 5CVVA 1N36K 3F10A 3J80K 4U0YA 5DM6F 3BR6A 3M9AA 3W3DA 2GA2A 1UEBA 4FIBA 2OCCH 1FK9A 3M6GA 2QWLA 2BE7D 1OCTC 2K5FA 4RAFA 1KC8R 2BXZA 4CGDA 3X25B 2EX3A 3SCXA 2Y0SN 4Z4GA 2PY5A 2P84A 3CJTB 3VS1A 1HR0K 4IHYA 2F7TA 3UE5A 1H0MA 2FRWA 4J9DA 4B1WB 3J80E 1L0OC 1ZGJA 3CDHA 2VYPA 2A1RA 4E19A 1UGRB 4N4IA 4FX4A 1H92A 2QZ8A 2HD0A 3KCCA 1Q8IA 2YNGA 2PN6A 3OSGA 3FKIJ 4AU7A 4C8QD 4LFCK 5HKCA 1NKEA 2IS6A 4ZYDA 4F17A 2XMFA 4MNUA 3I9V2 5C3EJ 3W2WA 1NKCA 3AA2A 3WVEB 5DDGA 2PQWA 1VQMT 2ZF5O 5M1OA 1S1TA 1BOTO 3KXTA 3LA2A 5IHKA 1DGWY 3BR3A 4PDKA 4JI6K 2X48A 3ABLH 2NVUB 2VKVA 1IN6A 2PNIA 1O1WA 3M07A 3QZ9B 1RRJA 3CCSA 2FNPA 4J2BA 2LCLA 2R5ZA 4QPQA 1VQ9Q 5BN8A 1TS9A 2X6WA 5C0YA 5IOYA 4E6RA 3A2FA 2DFFA 2QAZA 3JB9G 4OAZA 2NRAC 3KK3A 4KV8A 4P5OA 3LPUA 5HVQC 2VT3A 1MUNA 4MTEA 3CMAA 5EVZA 4PGGA 1X3MA 5H1SQ 2PJRB 3O1WA 4G9YA 3GTMJ 1VSEA 3QWLA 2CYZB 1B34B 5E26A 3TCJA 4U87A 5EF6A 4I6MA 2E5KA 2OFIA 1VQMQ 4IOCF 5A2QK 5F0XA 1T39A 4DGWB 2IS1A 5TISC 1SF9A 2OPSA 2J6OA 4UHTA 1W6XA 2ELKA 4ATOA 5IYCJ 2L7MP 1VQOT 3RSEB 1QVFM 2PVGB 4CSWA 4G1QA 4EGZA 1IREB 4D8DA 1K9MR 5FU7C 2QLZA 2E3IA 3EGDB 2VQLA 5E1ZB 4M7AE 1TYQB 3K59A 5HY6A 3CBMA 1VYTA 4IXAA 1VQ6A 2DA9A 2FBVA 2V7ZA 4JN4A 1SKRA 3P7NA 2P9NB 5GAMh 2KL4A 1B8IA 1NPPA 2RAEA 5BR8K 2VC8A 3K9TA 4OMOA 2ZCFB 3IUCA 3GZ6A 3HVRA 1HKBA 3CCRN 2VOPA 1WSUA 3MZHA 4OB0B 4CGJA 2UUZA 4A2UA 3DLHA 4H4KC 5KHDA 1PD0A 4LFAK 4LLLA 1RBRA 3OMYA 4HRIA 3JSMA 4E1JA 1SZ2A 2O4GA 3VPRA 2NLXA 1Q81O 1K73O 2KR3A 1TU0B 1SPKA 2KFZA 4UB6C 4E6KG 3LYIA 2KP6A 4B3XA 3M8FA 1M2VA 1O57A 4KHSA 4M77C 1VQOQ 5JVTA 3WTUC 3HP6A 4AFSC 5GAGJ 3THXA 1O3RA 9ATCB 4ZH4F 3C65A 2IGMA 1JUPA 1R5HA 1RKTA 2A05A 4XRSG 5IOZA 4BR0A 2Q2EB 2LH9A 4AYBN 4QS9A 2Y48A 3MVPA 1WJFA 2XO7A 2TDXA 3RNJA 3H9JA 4IEEA 2CZ1B 2XI9A 5LJ3j 1MNEA 2Q0UA 1G99A 4XLFA 3CCQA 2PG4A 5J8CA 3C4SA 1M8MA 4PJMA 4EM0B 3CMEA 2HYGD 1WH5A 4PKIA 2DYRH 1RT2A 4CZIA 3TW7A 4F8RA 1VSIA 2CG4A 4MLOA 4M7DE 3G1LA 5F2RA 4JI3K 4KPYA 4BEHA 3LSPA 4IUQA 5IT3A 2GM4A 3CQYA 4E1MA 3DTEA 3J81K 2E5ZA 4PJOD 1K9MO 2Q1ZB 3HGYA 2GWJA 1JQQA 3ZP5A 4CZLA 4M78D 2E6NA 1ZRDA 2HHQA 1W7AA 4DUZK 3ENOA 2WFBA 4J6WA 2RKIA 1U5TC 1WEGA 1X2KA 4R55A 1NK0A 1BISA 5KN9A 1M3CA 1WXUA 3J81E 1OULA 1DP7P 5L23A 2LQKA 3FHFA 4JS5A 2JWTA 4DBRA 4OIRF 3GBTA 2DLLA 3QEXA 1U1TA 3M9QA 1HRHA 1Y7XA 2V1QA 4JLIA 5GAMe 5DCMA 2YUPA 4QIWN 1DU6A 3DEEA 1BBYA 4IF4A 1WLJA 3O6WA 5BPMA 4OINF 1IGUA 4CYCA 2VWKA 1SS6A 5F1JA 4JEPA 3NH1A 2M7BA 3G0ZA 2KHMA 5KI6A 1NK8A 1O3SA 2VASA 1V4TA 3CC7A 3L2ZA 3V4GA 2JHJA 3I55T 2XGDA 4N47A 4FLYA 3FHGA 2LRDA 5FPNA 1YQAA 1RBTA 3EO3A 2H8WA 1FW6A 1MNMC 1SFXA 1OPKA 1V76A 2DXBA 4CZGA 3ITHA 5AQQA 5GAHP 4F7UE 4JUVA 3HYFA 3JV3A 4XONA 2G8WA 2VN2A 4C8QA 3CCLA 3OA6A 2OU2A 1NJIU 1ZBHA 5GAOn 4IQ4A 3VGLA 4V2FA 4CCJA 3DKXA 2M30A 1WRJA 3IHOA 5BPDA 4IHSA 3QWYA 4IZ9A 1HDDC 3R6SA 4N4GA 3KD1E 3G0QA 2KMTA 2DXIA 4JBAA 2W24A 3NWTA 3WT0A 3BZ6A 5FKLA 2LF7A 3VRYA 1HW2A 1SAUA 1QSLA 4E3SA 4J19A 3ONQA 4EP4A 3AGRA 2JUCA 5HRPA 5BS6A 4MO5A 4E9GA 1A6QA 2E5NA 4KDPA 1TV6A 1FOXA 3HRTA 4JX6A 2DEUA 1VQ5N 4ZC3A 5F0FA 4Z4FA 1S9HA 3LP1A 4XIDA 1IV6A 4IJAA 3UIQA 2A6TA 1PUFB 1TK8A 2KDZA 1WHMA 4FE7A 4NHJA 1MPGA 4IUPA 1ORNA 2CUZA 4O8KA 3DLMA 1AHDP 5IH2A 3E6CC 4YTLA 5DLOA 3CM5A 4YPHA 4GMJB 3THYB 2RK1A 2LK2A 4IDHA 4KHQA 4RCBA 2EIJH 2LDUA 4NXNK 2ISYA 1N9RA 2GAUA 2DW4A 3HXLA 4EMSA 1ZA2B 2E2OA 5AZIA 3SNNA 3QZ5B 4DYRA 1JKHA 3U1KA 4YFNF 1OZ2A 3DMJA 3AO3A 2ZM6K 4PUOA 1S72I 2DRMA 3I59A 2YI1A 4Q47A 5SZTA 2D2WA 3HOYJ 5IWAK 1M1EB 3FJ5A 4JZ3A 3R61A 4UUTA 3HC7A 1NG2A 3A8MB 3QDRB 2DI3A 2F4MB 3G71T 4IFVA 3CMAI 5D5WB 2DJIA 3V8KA 1H8AC 2DMNA 4IUUA 2MW8A 4LG0B 1YI2A 3T19A 2IXSA 1VQPA 4LDUA 4BRAA 1SVLA 3NWSA 2FX0A 4WE1A 2XDDA 1LDKB 1K6OA 4IBNA 1WIEA 2Q0OA 2JA5J 2E2QA 4FK2A 2R93J 2BVMA 3MWPA 3BCAA 1I39A 3TAQA 2NWMA 2O4XA 4UY8O 4RGSA 4CCNA 3U3GA 1GBRA 1TK0A 1N39A 1Q95G 2KROA 5GAMg 3K9KA 1UELB 2HBWA 3LAKA 3NFAA 2K9GA 1IKVA 5E79C 3S17J 1YXQA 3WHBA 3FXRA 4QLCU 4RB2C 2OZSA 1UFMA 3S15J 3S3MA 1S1UA 1ZG3A 1RUOA 1Y71A 2JT4A 1BKBA 2G8VA 4CIEA 2VB6A 1Y97A 4YDUA 1K9AA 3ALYA 4BXFA 1L3TA 2F5TX 3TOAA 4AIDA 4PJOA 2R7VA 1AWCA 3GO5A 1GLEG 1NJXA 1K79A 4M78A 2O61A 4KUIA 4UVAA 1XOVA 3KVGA 3REOA 3SQ2A 2HCKA 3CCJT 4IJNA 4X65K 3BROA 3H46O 2JM9A 1PHTA 1QKWA 2L3DA 1D8KA 3HKZN 5EEGA 3M58A 3V7CA 2HNYA 4HVWA 5J2PA 3ZGKA 3G25A 3CPWS 1RZ4A 4R1HA 3OWTA 3CCQI 4FCYA 1NK7A 2HDAA 2YV0X 2MH9A 2M9UA 4QWQA 2VQEK 1VQ8I 3CMEI 4NL2A 3H6EA 4YFXF 1X01A 5AQIA 4Z4EA 3MEAA 1IXCA 3LZJA 2R5AA 4F2RA 1K7AA 5HLGA 2H6BA 1YJ9T 1W4MA 4O3MA 4YELA 1WHKA 3OOPA 2Z1HA 2Q36A 3ISPA 2IC3A 3TVTA 2IIRA 2O8CB 3E66A 4C0DB 2DILA 3HXMA 3CQ8A 2NNYA 5AR0A 2L2OA 2HWVA 5K5OA 5AQSA 2EILH 4JI0K 4MMLA 2XHCA 2DMUA 3J80Z 4DTXA 2DOAA 2HGCA 2IT0A 1TL3A 4D0PA 3RVCA 3I3LA 2LCSA 4UQGA 3CTAA 5JLFA 4ZYHA 2KDSA 2BKDN 1YITA 3KLNA 1YQRA 2WAQN 4XTYA 2AQFA 1SMTA 3PLAA 5IN1A 1OPCA 2OC6A 2DIGA 1PRMC 1X75C 2E3HA 2DA5A 2QVOA 2WTUA 2OTJN 4DV2K 1R71A 1M3HA 1HX1A 3DXMA 5C4XJ 5LJ5e 2FD5A 2HW3A 1QCNA 4M7YA 3LSIA 2Z0WA 4FLZA 2Z1IA 1JKOC 3KJVA 1MD0A 4AI5A 4NQWB 3VENA 3QG1A 3SAHA 3CC7I 3M0SA 4M4ZA 1QWEA 2A08A 1YJ9Q 3NTHA 3O9QA 2A6HF 5M3FJ 1U5SA 1N75A 1KC8C 4B1VA 5C0MA 1ULYA 2NOLA 2W10A 1UGPB 1Z7UA 2VE8A 4L5GA 3J7AY 2GIZA 3DB3A 5LJ5f 1XQSC 2C06A 2LX9A 5DYMA 3IAYA 3RZDJ 3PJRA 4E1NA 4Y1CA 1RNLA 4IOAF 2A3SA 2EZHA 5FO5A 1N33K 4LH4A 3VQ7A 4GLMA 3LGFA 1PJRA 2E71A 3X24B 1K0SA 1XG7A 3OBYA 2XAQA 3PSFA 1SD5A 2VQGA 2LF8A 4YY3K 5KYUA 1IB8A 1R6RA 4M75D 1YVUA 5CJ9A 4KBMB 4KTWA 3CJAA 1AT1B 2E19A 5GANh 2ATCB 1NNEA 2UYTA 4ELUA 2WUSA 4AIJA 4FWOA 1ZUYA 4NCAA 1FYLA 1YW7A 4B43A 4NYNA 3MEWA 4L8RB 5J1YA 2UU9K 2VG6A 3MEVA 3KZBA 1WKMA 3WXIA 4Y92A 5HK0A 5A2QZ 5FGMA 5GP9A 4RMNA 5IYBJ 3WXLA 2WADA 2XICA 2B4JA 4II2A 3HL2A 1VQ9A 1KO9A 2HPIA 1M1GA 3M8SA 1YIOA 1PM3A 2M87A 1Z6RA 4PFPA 3E1YA 2X4WA 3ABKH 1TW2A 4IEJA 3H0HA 4RAYA 1TUCA 1Y8RB 3CCRT 1GLAG 4H0TB 1XNQK 4NNJA 4F92B 2EQKA 1SSFA 5IY5H 3FLGA 4FWNA 3ATUA 1OH8A 1HNWK 4XOPA 3I0SA 3O4QA 4AC0A 4ZN1A 1Y07A 1U6ZA 3OVNA