2JG6A

Crystal structure of a 3-methyladenine dna glycosylase i from staphylococcus aureus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
186
structure length
186
Chain Sequence
MNECAFGTKDPVYLNYHDHVWGQPLYDSKALFKLLALESQHAGLSWLTILKKKEAYEEAFYDFEPEKVAQMTAQDIDRLMTFPNIVHHRKKLEAIVNQAQGYLKIEQAYGSFSKFLWSYVNGKPKDLQYEHASDRITVDDTATQLSKDLKQYGFKFLGPVTVFSFLEAAGLYDAHLKDCPSKPKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DNA-3-METHYLADENINE GLYCOSIDASE
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 74
structure length 186
sequence length 186
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03352 Adenine_glyco Methyladenine glycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 2jg6A00
3OH6A 1LWYA 2JHNA 2NOFA 3I0WA 1MUYA 4E9HA 1MUDA 2NOZA 3KNTA 4B22A 1ORPA 1P59A 3IH7A 2NOHA 3CWAA 1WEFA 1YQLA 4DK9A 4EW0A 1RRQA 3D4VA 1KQJA 1M3QA 4YPRA 1FN7A 1N39A 1KG2A 4AI4A 1M3HA 4B21A 1KEAA 3CWTA 1LMZA 4E9GA 1HU0A 1RRSA 2NOIA 1KG6A 3IHOA 1KO9A 1YQRA 1NKUA 1KG3A 3CWUA 4AIAA 2NOEA 4EVVA 1PU6A 4B23A 3OH9A 1VRLA 1XQOA 4UOBA 5CHZA 3G0QA 1KG5A 3KTUA 1LWVA 1PU7A 2ABKA 1ORNA 1P7MA 1PVSA 1N3AA 2OFKA 4B24A 1XG7A 3N0UA 1MPGA 4YPHA 2H56A 1KG7A 2YG8A 1N3CA 3FSPA 3N5NX 5DPKA 2JG6A 4OFAA 3CVSA 1MUNA 3CVTA 3FHFA 2NOLA 4E9EA 4EA5A 1NGNA 2I5WA 4YOQA 1KG4A 5AN4A 2OFIA 3F10A 1YQMA 1YQKA 4EJZA 1XQPA 5KN8A 4PIIA 5KN9A 3S6IA 1DIZA 4AI5A 1EBMA 1WEIA 3OGDA 4OFEA 1LWWA 4UNFA 2XHIA 2NOBA 2YG9A 4EJYA 3F0ZA 3CW7A 4HSBA 4EA4A 4E9FA 3I0XA 4OFHA 2JHJA 3FHGA 1PU8A 1WEGA 4EW4A 3CWSA
chains in the Genus database with same CATH superfamily
3OH6A 3L2VA 3S3OA 1LWYA 3OYCA 2JHNA 3OS0A 2NOFA 3I0WA 1MUYA 4E9HA 1MUDA 2NOZA 2V75A 3KNTA 4B22A 1ORPA 1P59A 3IH7A 2NOHA 3CWAA 1WEFA 1YQLA 4DK9A 4EW0A 1RRQA 3D4VA 4BDYA 1KQJA 4BE1A 1M3QA 4E7LA 4YPRA 1FN7A 3LCNA 1N39A 3R2XC 1KG2A 4AI4A 1M3HA 4B21A 1KEAA 3CWTA 1LMZA 4E9GA 1HU0A 1RRSA 2NOIA 3VW4A 2JPSA 1KG6A 3IHOA 1KO9A 1YQRA 1NKUA 2W03A 1KG3A 3NNQA 3CWUA 4AIAA 2NOEA 4EVVA 1PU6A 4B23A 3OH9A 1VRLA 3L2WA 1XQOA 4UOBA 5CHZA 3G0QA 4E7KA 1KG5A 3OYLA 3KTUA 1LWVA 1PU7A 2ABKA 4E7HA 1P7MA 1PVSA 1ORNA 2W04A 3OYGA 3OYJA 1N3AA 4ZTFA 3S3MA 3OYKA 5FRNA 3OYNA 2OFKA 4B24A 1XG7A 3N0UA 1MPGA 3OYBA 3OYDA 4YPHA 3OYHA 2H56A 4IKFA 1KG7A 2YG8A 1N3CA 3FSPA 3L2RA 3N5NX 5DPKA 2JG6A 4OFAA 3CVSA 1MUNA 3CVTA 3FHFA 4E7IA 3S3NA 2NOLA 4E9EA 4EA5A 1NGNA 2I5WA 3OYIA 4YOQA 1KG4A 5AN4A 5FRMA 2OFIA 3F10A 1YQMA 1YQKA 3OYMA 4BDZA 4EJZA 1XQPA 3OYAA 5KN8A 3L2UA 4PIIA 5KN9A 3S6IA 5FROA 3OYEA 1DIZA 4AI5A 3OS2A 1EBMA 1WEIA 3OGDA 4BACA 3CWSA 4OFEA 1LWWA 3OS1A 4UNFA 4NZGA 1U84A 4E7JA 2XHIA 2NOBA 2YG9A 4EJYA 3F0ZA 3CW7A 4HSBA 4BE2A 4EA4A 3L2QA 4E9FA 4ZTJA 3I0XA 4OFHA 2JHJA 3FHGA 1PU8A 4BE0A 3OY9A 1WEGA 4EW4A 3OYFA
chains in the Genus database with same CATH topology
3OH6A 1LWYA 2JHNA 2NOFA 3I0WA 1MUYA 4E9HA 1MUDA 2NOZA 3KNTA 4B22A 1ORPA 1P59A 3IH7A 2NOHA 3CWAA 1WEFA 1YQLA 4DK9A 4EW0A 1RRQA 3D4VA 1KQJA 1M3QA 4YPRA 1FN7A 1N39A 1KG2A 4AI4A 1M3HA 4B21A 1KEAA 3CWTA 1LMZA 4E9GA 1HU0A 1RRSA 2NOIA 1KG6A 3IHOA 1KO9A 1YQRA 1NKUA 1KG3A 3CWUA 4AIAA 2NOEA 4EVVA 1PU6A 4B23A 3OH9A 1VRLA 1XQOA 4UOBA 5CHZA 3G0QA 1KG5A 3KTUA 1LWVA 1PU7A 2ABKA 1ORNA 1P7MA 1PVSA 1N3AA 2OFKA 4B24A 1XG7A 3N0UA 1MPGA 4YPHA 2H56A 1KG7A 2YG8A 1N3CA 3FSPA 3N5NX 5DPKA 2JG6A 4OFAA 3CVSA 1MUNA 3CVTA 3FHFA 2NOLA 4E9EA 4EA5A 1NGNA 2I5WA 4YOQA 1KG4A 5AN4A 2OFIA 3F10A 1YQMA 1YQKA 4EJZA 1XQPA 5KN8A 4PIIA 5KN9A 3S6IA 1DIZA 4AI5A 1EBMA 1WEIA 3OGDA 4OFEA 1LWWA 4UNFA 2XHIA 2NOBA 2YG9A 4EJYA 3F0ZA 3CW7A 4HSBA 4EA4A 4E9FA 3I0XA 4OFHA 2JHJA 3FHGA 1PU8A 1WEGA 4EW4A 3CWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OH6 A;  1LWY A;  2JHN A;  2NOF A;  3I0W A;  1MUY A;  4E9H A;  1MUD A;  2NOZ A;  3KNT A;  4B22 A;  1ORP A;  1P59 A;  3IH7 A;  2NOH A;  3CWA A;  1WEF A;  1YQL A;  4DK9 A;  4EW0 A;  1RRQ A;  3D4V A;  1KQJ A;  1M3Q A;  4YPR A;  1FN7 A;  1N39 A;  1KG2 A;  4AI4 A;  1M3H A;  4B21 A;  1KEA A;  3CWT A;  1LMZ A;  4E9G A;  1HU0 A;  1RRS A;  2NOI A;  1KG6 A;  3IHO A;  1KO9 A;  1YQR A;  1NKU A;  1KG3 A;  3CWU A;  4AIA A;  2NOE A;  4EVV A;  1PU6 A;  4B23 A;  3OH9 A;  1VRL A;  1XQO A;  4UOB A;  5CHZ A;  3G0Q A;  1KG5 A;  3KTU A;  1LWV A;  1PU7 A;  2ABK A;  1ORN A;  1P7M A;  1PVS A;  1N3A A;  2OFK A;  4B24 A;  1XG7 A;  3N0U A;  1MPG A;  4YPH A;  2H56 A;  1KG7 A;  2YG8 A;  1N3C A;  3FSP A;  3N5N X;  5DPK A;  2JG6 A;  4OFA A;  3CVS A;  1MUN A;  3CVT A;  3FHF A;  2NOL A;  4E9E A;  4EA5 A;  1NGN A;  2I5W A;  4YOQ A;  1KG4 A;  5AN4 A;  2OFI A;  3F10 A;  1YQM A;  1YQK A;  4EJZ A;  1XQP A;  5KN8 A;  4PII A;  5KN9 A;  3S6I A;  1DIZ A;  4AI5 A;  1EBM A;  1WEI A;  3OGD A;  4OFE A;  1LWW A;  4UNF A;  2XHI A;  2NOB A;  2YG9 A;  4EJY A;  3F0Z A;  3CW7 A;  4HSB A;  4EA4 A;  4E9F A;  3I0X A;  4OFH A;  2JHJ A;  3FHG A;  1PU8 A;  1WEG A;  4EW4 A;  3CWS A; 
#chains in the Genus database with same CATH topology
 3OH6 A;  3L2V A;  3S3O A;  1LWY A;  3OYC A;  2JHN A;  3OS0 A;  2NOF A;  3I0W A;  1MUY A;  4E9H A;  1MUD A;  2NOZ A;  2V75 A;  3KNT A;  4B22 A;  1ORP A;  1P59 A;  3IH7 A;  2NOH A;  3CWA A;  1WEF A;  1YQL A;  4DK9 A;  4EW0 A;  1RRQ A;  3D4V A;  4BDY A;  1KQJ A;  4BE1 A;  1M3Q A;  4E7L A;  4YPR A;  1FN7 A;  3LCN A;  1N39 A;  3R2X C;  1KG2 A;  4AI4 A;  1M3H A;  4B21 A;  1KEA A;  3CWT A;  1LMZ A;  4E9G A;  1HU0 A;  1RRS A;  2NOI A;  3VW4 A;  2JPS A;  1KG6 A;  3IHO A;  1KO9 A;  1YQR A;  1NKU A;  2W03 A;  1KG3 A;  3NNQ A;  3CWU A;  4AIA A;  2NOE A;  4EVV A;  1PU6 A;  4B23 A;  3OH9 A;  1VRL A;  3L2W A;  1XQO A;  4UOB A;  5CHZ A;  3G0Q A;  4E7K A;  1KG5 A;  3OYL A;  3KTU A;  1LWV A;  1PU7 A;  2ABK A;  4E7H A;  1P7M A;  1PVS A;  1ORN A;  2W04 A;  3OYG A;  3OYJ A;  1N3A A;  4ZTF A;  3S3M A;  3OYK A;  5FRN A;  3OYN A;  2OFK A;  4B24 A;  1XG7 A;  3N0U A;  1MPG A;  3OYB A;  3OYD A;  4YPH A;  3OYH A;  2H56 A;  4IKF A;  1KG7 A;  2YG8 A;  1N3C A;  3FSP A;  3L2R A;  3N5N X;  5DPK A;  2JG6 A;  4OFA A;  3CVS A;  1MUN A;  3CVT A;  3FHF A;  4E7I A;  3S3N A;  2NOL A;  4E9E A;  4EA5 A;  1NGN A;  2I5W A;  3OYI A;  4YOQ A;  1KG4 A;  5AN4 A;  5FRM A;  2OFI A;  3F10 A;  1YQM A;  1YQK A;  3OYM A;  4BDZ A;  4EJZ A;  1XQP A;  3OYA A;  5KN8 A;  3L2U A;  4PII A;  5KN9 A;  3S6I A;  5FRO A;  3OYE A;  1DIZ A;  4AI5 A;  3OS2 A;  1EBM A;  1WEI A;  3OGD A;  4BAC A;  3CWS A;  4OFE A;  1LWW A;  3OS1 A;  4UNF A;  4NZG A;  1U84 A;  4E7J A;  2XHI A;  2NOB A;  2YG9 A;  4EJY A;  3F0Z A;  3CW7 A;  4HSB A;  4BE2 A;  4EA4 A;  3L2Q A;  4E9F A;  4ZTJ A;  3I0X A;  4OFH A;  2JHJ A;  3FHG A;  1PU8 A;  4BE0 A;  3OY9 A;  1WEG A;  4EW4 A;  3OYF A; 
#chains in the Genus database with same CATH homology
 3OH6 A;  1LWY A;  2JHN A;  2NOF A;  3I0W A;  1MUY A;  4E9H A;  1MUD A;  2NOZ A;  3KNT A;  4B22 A;  1ORP A;  1P59 A;  3IH7 A;  2NOH A;  3CWA A;  1WEF A;  1YQL A;  4DK9 A;  4EW0 A;  1RRQ A;  3D4V A;  1KQJ A;  1M3Q A;  4YPR A;  1FN7 A;  1N39 A;  1KG2 A;  4AI4 A;  1M3H A;  4B21 A;  1KEA A;  3CWT A;  1LMZ A;  4E9G A;  1HU0 A;  1RRS A;  2NOI A;  1KG6 A;  3IHO A;  1KO9 A;  1YQR A;  1NKU A;  1KG3 A;  3CWU A;  4AIA A;  2NOE A;  4EVV A;  1PU6 A;  4B23 A;  3OH9 A;  1VRL A;  1XQO A;  4UOB A;  5CHZ A;  3G0Q A;  1KG5 A;  3KTU A;  1LWV A;  1PU7 A;  2ABK A;  1ORN A;  1P7M A;  1PVS A;  1N3A A;  2OFK A;  4B24 A;  1XG7 A;  3N0U A;  1MPG A;  4YPH A;  2H56 A;  1KG7 A;  2YG8 A;  1N3C A;  3FSP A;  3N5N X;  5DPK A;  2JG6 A;  4OFA A;  3CVS A;  1MUN A;  3CVT A;  3FHF A;  2NOL A;  4E9E A;  4EA5 A;  1NGN A;  2I5W A;  4YOQ A;  1KG4 A;  5AN4 A;  2OFI A;  3F10 A;  1YQM A;  1YQK A;  4EJZ A;  1XQP A;  5KN8 A;  4PII A;  5KN9 A;  3S6I A;  1DIZ A;  4AI5 A;  1EBM A;  1WEI A;  3OGD A;  4OFE A;  1LWW A;  4UNF A;  2XHI A;  2NOB A;  2YG9 A;  4EJY A;  3F0Z A;  3CW7 A;  4HSB A;  4EA4 A;  4E9F A;  3I0X A;  4OFH A;  2JHJ A;  3FHG A;  1PU8 A;  1WEG A;  4EW4 A;  3CWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...