3S3OA

Crystal structure of the prototype foamy virus (pfv) n224h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/inhibitor/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3oA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3oA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3oA03
4ZTJA 4CCHA 4YFUA 3E01A 3AVKA 1RT5A 2RN2A 3SI6A 3SUOA 1N5YA 4FZYA 1NK0A 3LYIA 2RJDA 2PY5A 1JLEA 2NLUA 2IGIA 1HYVA 2M0OA 1VSLA 2L8DA 3QEWA 1VSJA 3SZ2A 4OGCA 3UT1A 4KPYA 1RT2A 2E5QA 4M3YA 2YV0X 3RTVA 2IS3A 3SUNA 5FDLA 1RDAA 1VSMA 2LVMA 4BE2A 4DSIA 4N47A 1VSKA 1CXQA 4I2PA 1RT3A 3ASMA 3MEDA 3AO5A 4KV8A 5CZ1A 4B08A 4CJLA 1FK9A 1RT4A 4DSKA 5T7BA 3LGLA 3PO4A 4TSXA 3ME9A 4IDKA 1BI4A 4DQQA 3NTHA 4O4GA 3RRHA 1L3VA 1DTTA 3VQ4A 2KFZA 3IAYA 1WSEA 1RI0A 2BE2A 3AA4A 4PA1A 1NJXA 4DQPA 4FJGA 5C24A 1TGOA 1B9DA 2GFAA 3HP6A 4HCBA 2WACA 4F2RA 4DFKA 2JGUA 1KCFA 2XO7A 1RT7A 1RBVA 4BWJA 5J2MA 4KB0A 5C25A 2RI5A 1S6QA 3KLIA 1Q9YA 4J2BA 1VSDA 5KGXA 2R57A 3QEXA 3MXJA 2P0KA 3NGZA 3DYAA 4A4HA 4N4HA 3UWNA 3TR8A 3K57A 4OPKA 3K58A 1XI1A 1YTUA 1W0HA 2HHXA 1ASWA 4PLLA 1NOZA 3AA2A 4O55A 2X6SA 3DM2A 4OGEA 3VQBA 4IG3A 1EXQA 2G8UA 5HBMA 4JRQA 4OVAA 1S1VA 3A2FA 2RKIA 3LAMA 4DLGA 3NFAA 4UC4A 2ZD1A 4IG0A 3KTQA 2PQWA 4FJXA 2XK0A 4E7LA 3QEIA 4CEQA 3V9UA 4CEFA 3M8QA 4LH4A 3VQ7A 3QKJA 3RMCA 1XWLA 3QINA 1MU2A 5D6XA 1JKHA 4C5EA 4FJ9A 4C8OA 2OPQA 2DFHA 3LDSA 4PY5A 2HHSA 2CKKA 1BCOA 1S5JA 2F5KA 3BGRA 3TABA 2VWJA 4E19A 1U04A 4C8MA 4E0DA 1ASUA 3HPOA 3FDRA 2FBXA 3L2WA 3WNEA 5KE2A 3HSTB 3VQ8A 4YNQA 3P8HA 1R0AA 1NOYA 3ZT2A 4FK2A 1I39A 3HK2A 1RDBA 4CGJA 3TAGA 4CEEA 2R5AA 1J9AA 3AVMA 3SQ2A 4PLIA 3B6PA 2HQEA 4QOZB 4GY5A 4M41A 3DLHA 1FXXA 4G1QA 3QIIA 2KQ2A 4UQGA 3KLGA 2M1HA 4HUFA 3MXIA 4F4KA 4HCCA 4J2AA 3HVRA 4L8RB 2HHWA 4Z4HA 1WSJA 3KLFA 1C1BA 3RR8A 4C8KA 3DLBA 2HVHA 4CFDA 4OLBA 1WGSA 4DS5A 4DTJA 3V9WA 4DU1A 2RHUA 4DG1A 1KRPA 3H08A 4KTWA 3DOKA 4DQIA 2R5MA 1IKWA 2FBTA 3NE6A 3HM9A 4FLVA 4M42A 1JLQA 4W5TA 4BE0A 4KREA 4LD6A 1RBTA 2FHDA 1K6YA 4E7JA 1RTHA 3I0SA 4CHPA 4DS4A 4CJQA 2O4IA 1RTJA 2EQMA 1S1WA 2YRVA 3LWMA 4NZGA 4CHNA 3T3FA 2EQKA 1RILA 4M3UA 1TL1A 4OKEA 4Z4GA 2E6NA 3ISNC 1BL3A 3OYGA 4E7IA 1KVCA 2OYQA 3LAKA 2DTUA 4CF2A 2R58A 1XHZA 3ZSZA 4HUEA 1IO2A 3U3GA 1SKSA 4DTSA 4ID5A 3HXMA 3KK2A 4RG2A 4AH9A 4ZTFA 3LZIA 1SKRA 4QQGA 4RG8A 1TK0A 1Q9XA 1GOAA 1REVA 1UAXA 1BGXT 3SNNA 4B9VA 5C42A 3AVLA 2EX3A 4BE1A 4N4GA 1VSEA 2QXFA 3C6TA 2YNGA 4CF1A 4CHOA 3OYFA 2BDPA 3MEWA 2B4JA 1WN7A 3ZSXA 3T1AA 3QESA 4DFJA 2BUDA 1NK8A 1J5OA 3MO8A 5J26A 1XHXA 4GVMA 3O4NA 3LP3A 2MWOA 1S1TA 1RDDA 3L8BA 4CRIA 1U47A 1LV5A 1QS4A 1NK6A 1W9HA 1SL1A 4IURA 1IKYA 1HRHA 5CZ2A 4DTUA 4FK0A 4B3OA 1KHCA 2BGGA 1H3ZA 2IOCA 2Z1JA 4NYFA 3LZJA 4K8ZA 4BD3A 2HW3A 1WJRA 4BDZA 3AVGA 3AVIA 1S1XA 1HJRA 3WNHA 3BDPA 2FC0A 4PQUA 4IUUA 4I9LA 2Q3SA 4CEOA 2KZMA 2RF2A 3BDLA 1RBUA 4Q5WA 3OYIA 4DSEA 3FC3A 3KK1A 4FJ7A 1NK7A 5KRSA 4KHUA 4C5GA 3ZSQA 1YVUA 2FBYA 2KTQA 2VYTA 2G8FA 2G8WA 3LLRA 2HMIA 4II1A 4M45A 4M3ZA 4FZZA 3SV4A 3AVNA 4NCAA 2B6AA 4HUGA 3S3NA 4IUTA 2O4XB 1IKXA 1BIUA 1QHTA 5DK5A 3HT3A 3OMCA 1WSGA 1ZBUA 2GV9A 5CYQA 1A5VA 4CEDA 3JYTA 1TKZA 1L5UA 4C8LA 4CECA 4I2QA 2O4GA 4FJMA 1VRTA 2YNHA 1WSIA 3OA6A 4C5HA 4JLHA 5K14A 5CIUA 3NH0A 1KSPA 3NTIA 1ZBFA 2Y1JA 2YHAA 1X1PA 3SPZA 3RR7A 3QBYA 3FEOA 4CFAA 1I3AA 3PNWC 4CGHA 3V9SA 4H4OA 4A4GA 4JRPA 3SUPA 5M9OA 1SSFA 4IUVA 3V9XA 3DOLA 3ZCMA 4IFVA 3SQ4A 2VWKA 4K8XA 2YNIA 3MEGA 4ELTA 3MEAA 2DIGA 1WJSA 4KHYA 1JXEA 3KLHA 3SJJA 4CFBA 2P51A 4I9QA 1HYSA 3KUFA 1LWCA 3RRGA 3L2UA 1EX4A 3VQDA 2QKKA 2DAQA 3LALA 4M3WA 2RHXA 1VSFA 4FLXA 4QVZA 3OYCA 4C5IA 2G8IA 2X4YA 2QKBA 1BQMA 4FJNA 1O1WA 1X9MA 3G0ZA 3SV3A 4DFMA 2K3YA 3OYKA 1HMVA 1HQEA 3LANA 1XNIA 4CJ5A 3O3GA 1NKBA 1B9FA 2LCCA 1KLMA 1JLFA 4OVLA 4CJEA 3AO3A 4CIEA 3RMDA 1U49A 4NCBA 4E89A 4OKKA 1HPZA 1QE1A 1FKPA 3DB4A 2FBVA 4DTRA 4BWMA 3M8RA 4B9TA 3SD4A 4NS5A 1JXBA 1NJWA 3LP0A 2QK9A 1OZ2A 3QLHA 1NKCA 3VQEA 1HQUA 3VQ9A 2XDPA 3DB3A 2P1JA 4CF9A 1JL2A 1OI1A 4DTMA 3RMAA 3TAQA 3RWUA 4N41A 2B5JA 2G3RA 4LSNA 2MWPA 1LAVA 4IKFA 4Y1DA 3ITHA 3NH1A 1TKDA 4O5BA 3L3UA 2VG6A 4DSJA 3LP2A 2HNDA 4QCLA 1D8YA 3OQ5A 4FYDA 4M3XA 5FRMA 1S6PA 4CJSA 3V1QA 3HL8A 4FLWA 1ZBIA 4A4EA 2LTOA 1WSFA 2ITGA 3L42A 3O8VA 4PL6A 4RW9A 2RPIA 1TKTA 1U48A 4B9MA 4KHQA 1X9WA 2JTFA 4W5OA 4FJ8A 4FL6A 3HP9A 1WLJA 2EHGA 5HRNA 1RBSA 1FKOA 3AO2A 4IBNA 3META 2D5RA 3CEYA 4FLYA 1Y97A 2G8HA 3QIPA 3ZSRA 4Z4FA 2E6MA 4B8AB 4CJVA 1QSSA 1C1CA 1OYXA 1C6VA 4AHSA 3PO5A 2OA8A 3ASKA 3PMTA 3MXMA 3C94A 1UA0A 1RCHA 4E7KA 2LSNA 1LW2A 3V1RA 4B8CA 3PMIA 3V1OA 1BCMA 1F21A 4CEAA 4FLTA 2O4XA 5SWMA 2BIVA 3TANA 3CM5A 4CIFA 1Q8IA 3P5JA 3CFPA 3E9FA 5HP1A 4N56A 1LWFA 5C6SA 3E9GA 5FROA 3PX6A 4CEBA 2Z1IA 3DLMA 1C0MA 4MFBA 1LWEA 3ALYA 3CFRA 4KKOA 2DIQA 3HYFA 1Z26A 1L3UA 1KFDA 3AA3A 2IG0A 4CHZA 4B9LA 2EQJA 4OLAA 1VK0A 2IAJA 3DRSA 4BDPA 3LGFA 2YHBA 5CY4A 3VQ5A 4AHVA 3OJSA 1RTDA 4KHNA 2D0BA 4H8KA 3NF6A 3TARA 4CJ3A 2GFUA 3M8PA 2G8VA 1B92A 4CFCA 1KLNA 4EZ6A 1C1AA 5SZTA 3NAEA 5J2NA 3V6DA 1EKEA 3M9QA 3PX4A 3VN5A 2A1SA 4AHCA 1BIZA 1VRUA 1T03A 4J2EA 3QETA 2AJQA 3OYHA 4DU3A 3HO1A 4KRFA 1XC9A 4NCGA 4OKJA 4W5QA 3UIQA 3Q1JA 3TAFA 4CEZA 1KFSA 4DSFA 4RW4A 4KI4A 3AVJA 3P1GA 4XIUA 3P8DA 4Z4CA 3PV8A 4KAZA 5D6YA 5HROA 1SL0A 2RI3A 3MAQA 4FM2A 1JLBA 3TAPA 1NJYA 3DI6A 4IFYA 3VQ6A 3TI0A 3EZ5A 3NCIA 3AA5X 2EFIA 4QQDA 3IRXA 4F3OA 4QQ6A 2HHUA 4MQ3A 3SQ1A 1WSHA 3RMBA 1ASVA 2XHBA 3NBPA 2X35A 1TKXA 3OYDA 1IKVA 3MP6A 2W42A 3QEPA 2HHQA 1IH7A 3KD1E 3PFSA 1RT6A 1OZ3A 3C95A 4KHSA 2EKOA 5KI6A 1WJQA 3HPHA 4CJWA 4FW2A 5I42A 1S9GA 1JLGA 2Z1GA 3QNNA 2ZE2A 2M16A 3K59A 3KD5E 4GMJB 1NK9A 1L3TA 1HYZA 1RNHA 3OJUA 4CGDA 4DFPA 3MEVA 5IAYA 1YTAA 2D0CA 2KW4A 3HVTA 3JSMA 3TWHA 3SYZA 4DTNA 4CJPA 3OS1A 3K5OA 2YKMA 1NK5A 4FU6A 3S6WA 5C0MA 2PYJA 4FJLA 4ICLA 2DY4A 4CJRA 3KIOA 3VA0A 4B9XA 4JS4A 3L2VA 2VG7A 3O3HA 3CQ8A 3MEUA 4RW7A 3NDKA 2ATQA 1A5WA 3FFIA 3NGIA 3IG1A 4FM1A 3MECA 3OY9A 4LH5A 4Q5VA 1KVAA 4IUPA 3ZT3A 1T8EA 4CJFA 3F73A 2ZQBA 3G10A 3F9KA 3ZT1A 3AO4A 4Z0UA 4CGFA 1EP4A 5HRRA 4EP5A 1JLCA 1GOCA 4FM0A 4A4FA 3NTKA 1QQCA 2D0AA 4B9UA 5KH6A 2YKNA 4GW6A 4NYNA 1G5VA 2WOMA 3DRRA 3NF8A 3K5LA 1HNVA 3SPYA 3PY8A 4R5PA 4DWIA 2PYLA 4CGGA 1TAUA 4LSLA 1QSLA 4DQSA 4AHRA 3OYLA 2K3XA 2E6LA 4QW2A 1BQNA 3T19A 2PZSA 5IN1A 1DTQA 4Y1CA 1U45A 4FJ5A 3EAEA 2XY8A 2XRIA 5D6WA 3P83D 3AO1A 4FLUA 4LD0A 3U6FA 3ULDA 1CZBA 2X78A 4B9NA 3VQCA 3O3FA 1L3SA 5HRSA 1SV5A 3ZSVA 3WNGA 5JS1A 2RJCA 4O0IA 1BHLA 4E1MA 3MEEA 3S3OA 2VG5A 3KK3A 3L3VA 4CGIA 4B9SA 5HRPA 2KFNA 1JLAA 2B8AA 3ZT4A 4Z02A 4M3RA 4FJJA 3QO9A 4HTUA 2NUBA 3AVBA 4KTZA 1WNSA 3S9HA 1U4BA 4DSLA 2HHVA 3ZEHA 2RJEA 4FJIA 4O0JA 2XY5A 3TAEA 2HHTA 4DMNA 1HNIA 3H8ZA 1KTQA 1RT1A 1NJZA 4E7HA 3CFOA 3OYNA 3QNOA 4N4IA 4CF8A 3ZSYA 4OPJA 2E4LA 1DLOA 3K5MA 1NK4A 4DTXA 3OYBA 3QJ6A 1KVBA 3B6OA 2P5GA 1GOBA 4FCYA 3FLGA 1BI4B 4ZHRA 1JL1A 4FJKA 2RI2A 3ZSOA 4CIGA 3LPTA 1LW0A 3EYZA 4F8RA 2L89A 4AHUA 2YNFA 2Y1IA 5FRNA 1LAWA 4H4MA 3KJVA 1MHNA 4RW6A 3OYAA 1CXUA 2DFEA 5D3GA 3AVAA 4CK1A 3PX0A 4ID1A 3LH0A 4WE1A 1Z25A 1A5XA 5KTQA 4E3SA 2XY7A 2A1RA 4CJTA 3AVFA 3SQ0A 4Z4EA 2IC3A 4F2SA 3WNFA 2OPSA 3O4QA 4B9WA 3NHGA 2D9TA 4N5SA 4OJRA 2RHYA 1S9EA 2X74A 2JLEA 1TV6A 2LDMA 2X6NA 2XY6A 1ZBLA 4CJKA 1N6QA 2OZSA 4J2DA 4F3TA 1TL3A 5KCOA 3KKRA 3NF9A 3OMGA 3U3YA 2F8TA 1G15A 1D5AA 2X4XA 1C0UA 1TAQA 2RHZA 1TVRA 2QQSA 1EETA 1VSHA 3IS9A 3ZSWA 3VA3A 4BACA 1RBRA 3KLEA 2IDOA 4JS5A 4FZXC 4PUOA 4X34A 2L3RA 5CYMA 3TAMA 5I3UA 4IUQA 4CJ4A 1YT3A 3QEVA 4Z4IA 4ELVA 4KB1A 4KHWA 3OS0A 1WAFA 3L2RA 3CM6A 3OYJA 4HHTA 2OPRA 2R7YA 4DF4A 1ZBHA 2RHIA 1UA1A 3DMJA 4KI6A 2G8KA 1UWBA 2DFFA 4Q0BA 2BANA 2KZZA 4CHYA 3SCXA 3QIOA 3NH2A 4W5RA 2HNYA 4CJUA 4KFBA 4DQRA 1IG9A 4FK4A 2HVIA 4CF0A 3DLGA 2GF7A 1X9SA 5J2PA 1D9FA 4FXDA 3L2QA 4KTQA 3HJFA 1RDCA 2GUIA 1C0TA 3C6UA 3EY1A 5J2QA 4O44A 2RO0A 4M3TA 5KE3A 2GBZA 4BDYA 3AVHA 3VQAA 1RTIA 4DTPA 3OB9A 4N76A 4CERA 1BISA 3S3MA 3LPUA 4DU4A 4L59A 1J53A 3VQPA 2EQUA 1J54A 1QSYA 2Z1HA 2HQXA 3NF7A 3DLKA 3OYMA 3KKSA 4DLEA 3SUQA 1NKEA 5EU7A 1ITGA 4CHQA 5KCHA 1N27A 2RJFA 4DTOA 3I0RA 3PUFA 3CG7A 5KRTA 3THVA 4ELUA 1D9DA 4AHTA 2OZMA 1CLQA 3K2PA 5DMRA 4CE9A 5J1EA 1QTMA 3HPGA 1UOCA 3M8SA 3K5NA 2P5OA 3OVNA 3MP8A 3LX7A 3AVCA 4QAGA 3VQQA 3AV9A 4FVMA 2OPPA 3NGYA 4LY7A 1WAJA 1ZYQA 5E41A 4PWDA 4CESA 3V9ZA 2WONA 4DF8A 1TK8A 4FLZA 4EDUA 3GOXA 5KGWA 3LWLA 5J39A 3MP1A 3D45A 3CYMA 4E1NA 4HVJA 3QERA 5HLFA 1T7PA 2F8SA 3DLRA 1VSIA 4EZ9A 3LP1A 3V4IA 3V81A 2ETJA 3NNQA 1S1UA 1SL2A 3OS2A 2HB5A 2HNZA 3DLEA 4KO0A 4CK3A 3OYEA 1T05A 2I5JA 4W5NA 3H6ZA 4HCZA 4EP4A 3DRPA 4C8NA 1CZ9A 2X4WA 3I8DA 4CK2A 1SKWA 2F96A 1SUQA 4FW1A 4FJHA 3D0PA 3F70A 2QQRA 2BKDN 2JZ2A 4I7FA 3ZT0A 4AILC 2LRQA 4RW8A 1TK5A 3C4SA 5JS2A
chains in the Genus database with same CATH superfamily
2CT4A 4DA4A 4AYBA 2W4SA 5A0GA 4HVVA 1OH6A 3J7AO 2EYQA 3HJEA 3JR9A 5C2DA 1ZHIA 4AIHA 3SUNA 5AQSA 3CD6I 3DBRB 3GZ5A 3IKTA 3CCQQ 3EUKL 4NO7A 1HNZK 4CJLA 5MLCQ 4KV8A 4B08A 5K7HA 3QQAA 2JA2A 1J09A 3JB9F 2A6TA 4M9XA 4A62A 4M7DB 4BC3A 3HP6A 2LMJA 2DK3A 2RI5A 2G8IA 4CI0C 1FTTA 5KGXA 5JFRA 4NBQA 1MUNA 4KGVB 3VQBA 1OCTC 2GBQA 4A3MJ 5C4JJ 3JW4A 5H6RA 1VQOQ 1RAEB 3LDNA 2XASA 2M4GA 3FXJA 2DRMA 5KK1A 2LKPA 4F55A 2VWJA 4CXFA 4LB5A 3WNEA 4N0BA 3VQ8A 2ZXWH 1J9AA 3AVMA 3CQYA 2QUFA 2A28A 4J2AA 4HUFA 4FWOA 2Y4YA 1XQPA 3CLQA 1KRPA 3H08A 1R36A 1RTHA 2L9NA 4CJQA 2EZIA 3SDGA 3T3FA 2ECCA 4EATA 4NXNK 1BM9A 3K4NA 3PNYA 1M1KO 4HUEA 1Y96A 4ENNA 1EWQA 4E9FA 3CCLT 1BWFO 3HM8A 4CHOA 4WCIA 4K11A 2FZKB 2HR3A 3FXRA 1BKBA 2QA4T 2XDVA 1EF4A 3B02A 3J80K 2FC0A 3ABKH 2RDPA 3X20B 2RF2A 4DSEA 1M9SA 1VQ9A 2HNHA 2CSIA 3LLRA 4II1A 3SV4A 2IP2A 4HUGA 4WQ4C 2JM9A 1V4SA 1K73C 3JRAA 4GO1A 4I2QA 3TOBA 4CGHA 1XN7A 2ZF5O 2XB0X 1FYLA 3MX2A 5K7ZA 2ZGZA 3F6OA 4QVCA 3I53A 3CCUQ 1PNJA 1FIAA 5H20A 2K79A 2NNWA 3ER0A 2BH1A 1E4FT 3SJHA 4B21A 3RYRA 1O1WA 3FXKA 2DAOA 4LFUA 2IA0A 1JLFA 4D8DA 3MEXA 4M7AD 2RH2A 1HQUA 2LOOA 5M3FJ 4QS8A 1OI1A 2DEQA 2M8EA 5JR3A 4AM3A 3ZYYX 1E3OC 2C0TA 1NGIA 3I35A 3V8KA 2HNDA 2R7SA 3HL8A 2VGNA 1AKHB 2ITGA 1Z1DA 5KYXA 1U8BA 1S72Q 4XK8E 4LIUA 4WQ5A 4FWKA 2NOEA 1V3FA 1FYNA 3H0FA 3ZSRA 3FXOA 2VPLA 2KDSA 2VONA 4E2FB 5FJ8J 1VFCA 3TANA 1GFDA 2DYBA 4BJ6C 4GVEA 3K2ZA 5FU7C 4KMUX 1VQ5Q 2Z1IA 1W4MA 1LWEA 4MZPA 3CC7N 2A5YB 1YHQQ 2QWQA 4KHNA 5AZJB 2OTJI 4C92E 3OL4A 2GTJA 4H8KA 2FZCB 3T0YA 2E65A 4EZ6A 5CVIA 4JPBW 1T33A 3K9KA 1WQWA 1TQMA 2OZ6A 5KCMA 3DU6A 4LIVA 4JK7A 2CZ7B 4WXHA 4X65K 3GTLJ 1MBKA 2W6LA 1QCNA 4C92F 2LC4A 1TKXA 1SSHA 5KVRA 5J1RA 3OYDA 3L4IA 3KD1E 2DMNA 1QHHD 2EKOA 3FWEA 3HM5A 1JLGA 1VQNQ 2OTLA 3K59A 1RNHA 3VYTB 3SYZA 3JSMA 1SHFA 3IAS2 3WTWC 3BTJA 3BR0A 3CJRB 3K1NA 2FPFA 5CHIA 4UHTA 3MECA 1T8EA 2K9SA 5LJ5f 2QSHX 1H88C 8ATCB 1RIOH 4DQSA 3ZX0A 4ESFA 3PGGA 2V9PA 3RJPA 2MPXC 4LD0A 2KL4A 2DQLA 3SZTA 1YITA 1TG0A 3PNTA 3NVMA 2RJCA 4J7FA 1X3UA 3L3VA 4M6VA 2GOMA 1EH6A 4N4OB 1RI7A 4B09A 3KX2A 1QQNA 3LDOA 2HHVA 1KQ8A 5AN4A 2QWOA 5A2QK 1IRGA 5F0CA 1R4MB 2HYGD 1K8AU 4XK4A 2Y1IA 3PT9A 3BY7A 3J7AP 4EPCA 4KYWA 2ELJA 1PU6A 1POGA 4ASNA 4HRIA 4I0BA 4XICA 1G4DA 1QO0D 3ML6A 2X74A 1RAAB 5CPRB 3M7GA 4OFEA 2RA2A 1D5AA 3UPUA 3G6EN 1KG6A 4JS5A 3EGDB 5M5WJ 5FKMA 2KKZA 1UWBA 3QPTA 4IO9L 2KGTA 2ZJRL 2CW0F 2RM4A 5LRSA 3HJFA 1EZZB 2I10A 1TWHJ 2CMPA 3RQIA 5AQJA 4M3TA 5JMVA 3NQOA 4N76A 3TU5A 1CF7A 1BISA 2YT6A 4OX9K 2FBHA 3VQPA 2MBFA 1Q82O 5CKDA 5KCHA 1X4PA 4BVOA 4MMLA 2CP2A 4DOWA 2E64A 2DTIA 3MP8A 3LX7A 4GGGA 2QTDA 4BR5A 3SWNB 1DUXC 3MP1A 3D45A 4E1NA 4B48A 5ECAA 1Q95G 3NNQA 2HBJA 2PUKB 4W5NA 1HSJA 1WI3A 1KZHA 1DT9A 3S8PA 1YQKA 4YIIA 1OX9A 2V75A 4RM3A 2EGAA 2PY5A 3TDZC 1VSLA 1RESA 2BHYA 3UT1A 4ZGDB 4M3YA 2IS3A 2CW7A 1Q82U 2FOKA 2DBMA 3ZPLA 3ASMA 3CMAQ 4XLHA 1W36D 4AT1B 2DMOA 4O4GA 1OH8A 1RI0A 4HCBA 3AL0C 2WACA 2XO7A 4BWJA 3D2EA 4BB7A 2AXLA 2R57A 1XI1A 3K58A 4KN4X 1P4XA 3ZOBA 4NOYA 4OMNA 3GBQA 1K4SA 4QTRA 3BZKA 2E1CA 4A3GJ 2K5IA 1MKMA 1YHQN 1IV8A 2HDCA 1S5JA 3RCOA 2NYXA 1NOYA 5FWCA 1KQSS 3O9QA 2E60A 3I9QA 5AIQA 3I8BA 1YIJN 1C1BA 5DTDA 4IOCF 4DS5A 2O8BB 5J1UA 4BNCA 1IKWA 3IV5A 2HBLA 4W5TA 1PUFB 1RBTA 1JJ2M 1Z9QA 2OFKA 2VGMA 2EQMA 4I6MA 2JWTA 1RILA 3X26B 1GDTA 1AWJA 3LFUA 1FOXA 1M2VA 3PSIA 4RG2A 4AH9A 4BL0B 4YFXF 5CQEA 2VB6A 3X25B 3UDCA 5KN9A 5L8RE 1ABQA 1OYIA 3CCMI 2FOWA 2OTJQ 3D2FB 2I8DA 1B6AA 1CF7B 4N9IA 4G7OF 4RA2A 3QP5A 4OB1B 1P9QC 2DO3A 3BJOA 2W04A 3DWLA 5AFUH 4PK4A 4DV3K 4DIQA 2AQEA 3D2EB 1VQ4Q 3F72A 4ZN1A 2EAYA 3A8YA 1ZRCA 3DWLE 4PJJA 3S3NA 4CJ7A 1SVOA 1UUEA 3MFKA 3BTCA 1FIPA 2YHAA 1VUBA 3CCLQ 3F2KA 3OBYA 4A4GA 1VQKT 4MEYF 2LCSA 1XSDA 4LB6B 2WBMA 3K69A 3KLHA 3OIPA 3RRGA 4FYVB 2KIFA 3OYCA 3M5AA 2LCCA 2DLLA 4XH1A 2DT6A 3VW4A 4V2FA 4QKUA 2EWSA 3V7RA 1MUDA 1IXRC 3QPHA 2L7ZA 3X28B 2VKEA 4J01A 1IUFA 4RGRA 3KTUA 3S14J 1MH4A 1DGWY 2B5JA 5LL6S 2DRKA 3MKWB 1WXUA 2IGKA 4XRSG 4FLWA 2P7CB 3L42A 3CMEI 3KP2A 3S2WA 2M0CA 3HP9A 1WZOA 1WLJA 3I56Q 3CEYA 4Z4FA 4C3IJ 3CWUA 1OYXA 4F7ZA 8AT1B 2LSNA 1VQ8N 4CEAA 2NOFA 3GUDA 3CM5A 1YTYA 1QKWA 1LWFA 1QPMA 3P9IA 3JCMX 1YCYA 4KKOA 2V26A 4C8QD 2EQJA 3FK6A 4OMPA 4J9BA 5SZTA 4AG2C 5LD2C 4AHCA 3B73A 1YJNT 4DR3K 4PKGA 5AQYA 1WWXA 2LDUA 4KAZA 2D1HA 4NQWA 2RNGA 1BL0A 3JCMV 2ZXIA 2UV1A 1Z05A 4JX4A 5D5UB 3HHHA 1N5ZA 4HW0A 5L3DA 3S93A 3ZCOA 3H9GA 3MP6A 1STZA 2O8CB 3I64A 1X1BA 3DKYA 1YHQI 2VXFA 1T0HA 2KRNA 3KD5E 3QSUA 1VQ4A 4CJPA 3CDLA 3OS1A 2Q0RA 1KQSM 3F6VA 4EVIA 4Z0UA 2E5LK 2LP5A 4PJOF 1YS7A 3GG4A 3OA9A 4H0VB 1FJLA 1VQOI 3EGXB 2PMZA 4UNOA 4BI3A 4FLUA 1VQLN 3QZ5B 2YUPA 3O3FA 3OR2C 5HL7L 3MKZA 3R1XA 1BHLA 2JPCA 1EBMA 3TP3A 1VI0A 1U5TC 1G99A 3TAEA 1WCMJ 3AARA 5IP7J 1R8OB 1DLOA 1K8KB 5GAN5 3RPQA 3H3OB 3THXA 1OR7C 5H2FC 2JXBA 4QPQA 3MCPA 1T95A 1RI9A 1HW5A 2WTEA 4HBLA 1KO9A 4IVNA 1VQKN 4H0EA 4C8QA 1FN7A 3FKIJ 3CBPA 4RTZA 1XGOA 2RQVA 2IC3A 2YHYA 2LK2A 2WA0A 5B8HA 1ZBLA 1N6QA 5F6FA 3DBHB 4F3TA 4O6JA 4A63B 2JMAA 2EYXA 2X48A 1UDLA 1HKCA 4BACA 1RBRA 2X0LA 2MLGA 1JJ2A 4WWCA 5GAN8 1C0GA 4KH0B 1IF1A 3C18A 3CC2T 4BRMA 5C10A 1IW7F 4DHYA 3RZOJ 2JM8A 2E2HJ 3GOIA 2MA3A 2L4AA 4XKBA 2HMPA 4O44A 5KE3A 3OB9A 4PJOC 3O6BB 5FD6A 2ESWA 2KIQA 2A36A 2X6WA 3BC8A 1K78A 3CG7A 4AHTA 1W36C 3HKZA 3O1WA 1ZX6A 2J7IA 3BDDA 4LLLA 4CESA 1Z6TA 4WFBL 5LEKA 3LWLA 2F2WA 1LDDA 1HKBA 1KQSA 1QP3A 1LKXA 4HWIA 1S1UA 5JI6A 1T0FC 3WEEA 3G1MA 1M3AA 4FW1A 2V1QA 4I7FA 3S17J 3JCMd 1LCKA 1JJ8C 1D5VA 2I7PA 4IJAA 2NS7A 1WPKA 2GTDA 3IH3A 3DXMA 3FDYA 5DD4A 3EG9B 4BRPA 4FQGA 3V4GA 4FWRA 2DPNA 1OFCX 5CZ1A 1RT4A 5KAFC 4DQPA 1B9DA 1MWMA 2EFWA 1KCFA 3CVTA 5C25A 3JREA 2ACJA 2GUPA 3K9JA 9ATCB 3V7CA 4O55A 2P0PA 1M8VA 2VBYA 1Y57A 3L00A 3NFAA 4EMGA 3HUGB 2DTOA 5BNGA 3JRDA 2COZA 3WXMB 4XH4A 5DM6L 3JCMh 1MU2A 4M7XA 2QTVA 3RSEA 1GRIA 2VUMJ 1MDMB 3A01B 2XSJC 5BRDA 1FSHA 3BJAA 3A5ZB 1PVSA 2F5FA 1G3SA 3DBLB 3GPLA 3FBNB 4UQGA 2CUBA 1FOWA 3F10A 4C8QE 5FPMA 3VSKA 3SZGA 5F0FA 3M5RA 2R5MA 1ARKA 2FBTA 3D7EO 3CCEA 4XM3A 3T1YK 3CF5F 5FKNA 3DPLC 4O8UA 1XCVA 1VQ9N 1TUCA 1PSFA 2EQKA 1ZR4A 4OKEA 2MLKA 5FKLA 5D4RA 3V8LA 4AI4A 1NG2A 1XHZA 1IZ1A 4I99C 2V8JA 1J5YA 1TK0A 1GOAA 1PCXA 4B9VA 1BGXT 4BUPA 2ZGWA 1WN7A 2WWYA 4DFJA 2MWOA 3HSFA 1TTHB 1TUUA 5BPNA 1IKYA 4BR4A 4UV9A 2K57A 3LZJA 2HW3A 3HTRA 4S05A 3JXUA 1R1TA 4I9LA 1DDNA 2KZMA 3FHNA 2KK4A 3OYIA 1S5LC 4FJ7A 1UHMA 2FBYA 4M3ZA 1BIUA 3H3ZA 4DTNA 4ENJA 2GOXB 4M71A 3AAPA 5CIUA 2Z2SB 3QBYA 4M78B 4H4OA 1M90R 1B59A 5CLSA 4YOQA 3GIBA 3JS6A 2JTVA 4YOVA 3EG3A 2YNIA 5GTHC 5AQXA 1RUWA 2EA2A 4EW0A 3K10A 1IAWA 3VKIA 3I55Q 5CKBA 1SVMA 4ISEA 1JKOC 3ZX3A 2A37A 1QCOA 4CJ5A 3IMXA 2YJFA 5B3SH 4WFAL 1QE1A 1X4OA 1JGGA 3M8RA 1OZ2A 4JJCA 5E3LA 5BPMA 1EWRA 4IKFA 2K3FA 4NC6A 3NH1A 3I4PA 1M90U 2R7ZJ 2E35A 2KHMA 1S6PA 1ZBIA 2JTFA 1KAXA 2EINH 4LXCA 4M78G 2L54A 1MNDA 1YS6A 3H46O 1W2BS 1C1CA 5I2MA 4KUIA 4EM2A 3G3ZA 4Z8AA 2O9VA 4A3DJ 1M90C 1UA0A 2IAIA 2NVUB 4HXJA 3CFPA 5HP1A 4XLCA 4B1RA 4U0WA 3EN9A 3J7AY 1LJOA 1OCRH 1KC8R 3EKSA 3HYFA 4XU1A 4E9GA 3VYUB 2YHBA 3TARA 2D0PA 5ED4A 1U1SA 1KLNA 3OMYA 1XC9A 3AG4H 2SEMA 2O9LA 2DYIA 3FSPA 4XIUA 5D6YA 3MAQA 5GPCA 2PMZN 1HKTA 4A3LJ 1P4WA 4M3FA 3OH9A 1KQSP 3EZ5A 3M9AA 4QQ6A 4YOXA 2QA4Q 4J8FA 3VS7A 1DJ7B 1YJWQ 3VERA 3KZBA 4M9SA 2A6AA 2ZE2A 2R7WA 5ELZA 3OJUA 1RRSA 2KW4A 3K5OA 4RDUA 1OQKA 4RWTA 2Q36A 4BGDA 2VV5A 4BROA 1KVAA 4IUPA 3ZT1A 2P7VB 1X3ZB 2HKNA 1G5VA 3K4BA 3TBIA 5CVVA 1N8RO 1E4GT 5IN1A 3CO6C 1JJ2P 5AFUA 4D5FA 4L9NA 2GGRA 3E6BA 2NNYA 4XRFA 1LNWA 2C0OA 2RQPA 3CUQC 4FJJA 1R71A 1P7MA 3VDXA 5E1WA 3CFOA 2KPMA 5HS9A 2STWA 2H8HA 1TOVA 1K9AA 1VA7A 3AG2H 1LW0A 3QYBA 5FO5A 2EV6A 1LAWA 3WXKA 4H4MA 3F3XA 4QT7A 3ZMSA 4OFAA 1WXBA 3PX0A 1IV0A 1A5XA 4E3SA 1NJIO 2RQRA 5K7FA 2E8AA 3AVFA 2K4YA 4WF9L 4FE4A 2QQ8A 2HQNA 2OPSA 4HDVA 5D5VB 4HZFA 1M1FA 4EJTA 4OPHA 3Q9SA 1TVRA 4OIQF 1VIFA 2YUQA 3FX3A 1I1SA 2QENA 5I3UA 5GMKm 4ELVA 2R7YA 1JTXA 4CJUA 1NG7A 4CF0A 2HD0A 3ONQA 3L2QA 4FIBA 2XKOC 2ME6A 5CE3A 4L0ZB 1RUNA 4LJZF 4QS7A 4RKUE 1Y07A 1J53A 4HVWA 4PL8A 3DLKA 2KI7A 2JQ7A 3U1KA 4NB5A 3P39A 4DBRA 2JVVA 4XLFA 5CHZA 4QAGA 4XOPA 1NGJA 3NGYA 2KFDA 1ZYQA 4HA8A 1IDZA 1NGFA 1VQNT 3GDQA 2OJED 5IP9J 3FMRA 3LM9A 3M4GA 2LJ0A 3M4YA 2XDBA 2WAQN 4CD3A 5BR8K 2HB5A 2G0EA 1T05A 3CBOA 4HCZA 2RKHA 4LITA 2O7OA 3F70A 4F93B 1VQ6T 2WFBA 1J5EK 3O3KA 2IGIA 3P4IA 1ZXOA 2K2MA 4BS9A 5FDLA 1VSMA 1FP2A 4AMCA 4PSWA 2LZ6B 3CCMQ 3RRHA 1XGNA 1O57A 1KG4A 1Q18A 2JGUA 2X4JA 4B3RK 3TTCA 4WK8F 4G7HF 1RUOA 5AYFA 4HAMA 5J4YA 4CEBA 4ZDLA 1BC7C 3KLOA 2RKIA 4AVPA 3CCQI 5AQIA 4CEQA 2IA1A 3NARA 2DXTA 2H1LA 4C8OA 1A5JA 1VYTA 2EJRA 2X3WD 2V6EA 4C8MA 4E0DA 4JJNK 4G8XA 1N34K 5KE2A 4A3FJ 4YNQA 4KN7X 1YYVA 4M41A 1VQPA 4N9HA 4DR4K 1EJ9A 3G6ET 3MN7A 3KLFA 2ZSIB 2LQ8A 3TSZA 4EJUA 5BRHA 2K9QA 3R6SA 1VQ8I 4FLVA 2W03A 4M42A 1VQ5A 1MBJA 4AI5A 5HKCA 4Q47A 4G7ZF 4CHPA 1LEBA 3MK6A 3VUZA 1MV3A 4J9IA 4GV6A 4CZKA 3TOAA 2XMFA 2BEOA 1BL3A 4E7IA 3WG7H 4MHGA 1YG2A 2R5ZA 4RMOA 1X3MA 1BA0A 2E7WA 2GTOA 2LY2A 4DTSA 2VBWA 4UUVA 3CPEA 1Z3YA 2D2WA 2AP1A 3E7LA 2EX3A 4BE1A 4LNPA 1ESVA 1VSEA 3DPTA 3OYFA 2FEIA 2LVSA 2AZVA 3F9MA 4B1XB 4AWXB 4BUGA 2VT2A 1XQOA 3KYLA 2KE9A 3W2AA 2QWLA 4EGYA 1K9MC 1NK6A 1MMSA 1KIKA 5DLQE 3CJNA 1U6GA 4BDZA 7AT1B 3IAM2 3WNHA 2V7YA 4NDLA 4EA4A 3BDLA 2V79A 1NJIR 3M8EA 4CC3A 5AQHA 1OULA 4UB6C 2O4XB 4C0DC 5B1BH 2GV9A 5CYQA 2K40A 2A0FB 4FYXB 1MGTA 3H1CA 4C5HA 4RGUA 2R5YB 4A6DA 2VWKA 3U21A 3K70C 3HOTA 3A8LB 3HSRA 3PO3J 4M4ZA 3CCMN 3RUXA 1VAZA 3SV3A 1HQEA 3K4MA 4BRDA 2I7NA 2DPPB 3ZEUB 3A5NC 2ZPIB 3CIPA 4H5RA 4ZYAA 1JJ2S 4RLQA 1TH7A 3ERMA 4IO9F 4DTMA 1YI2T 3QBXA 1Z6RA 3G4SI 3EG9A 4HF0A 1ZUYA 3LL3A 4O5BA 1BOAA 2YG8A 5IPAA 1D8YA 1KAZA 4RW9A 5TKYA 4FE7A 5I11A 1VQNA 2XROA 3C2HA 3LH5A 2CQKA 4RMNA 3GX4X 1SZ2A 3NWTA 1Q7YR 4LF7K 4JLGA 1QCFA 1KK7A 4FLTA 3SYTA 4XN0A 1KG2A 2P9LA 5D5XB 2A5XA 3GTMJ 1MDUB 3LQQA 3RSEB 3BR2A 2HNIA 3HG9A 4IHSA 4C0FA 2KRMA 1C1AA 3LSRA 4F3QA 4A59A 3TAFA 4CEZA 4DOZA 3VYSB 4DSFA 4XORA 4JI2K 3CESA 3IWZA 3MWTA 5AQRA 3QDKA 2E19A 1VQ5N 2JPSA 5AQGA 2W48A 1ABOA 2R7VA 1Q7YU 1GXIE 3E6CC 3RMBA 1O7LA 1YLFA 1VNDA 3PFSA 1HX1A 1RT6A 4E7ZA 1K73R 2YUOA 1TC3C 2O8FB 1A35A 1N75A 5LHGA 1XSVA 3CQXA 3S6IA 5IAYA 2PYJA 2J5OA 3KVGA 3O3HA 2WBNA 3UKRA 1HKQA 3A1YA 4FT4A 4FM4B 3ZT3A 4CJFA 2EGCA 3G10A 1RAGB 1EP4A 1JLCA 5J4VA 4CBXA 4CZHA 4G9YA 1FYKA 3SZPA 4NYNA 3SPYA 3V42A 3K5LA 4IHVA 1VQKA 4LLNA 2XF6A 2VJJA 2FYKA 1D0ZA 2DA5A 2GQIA 1GCQA 3CD6T 4FX0A 1U2VA 4JD2B 1M3QA 5FPNA 1P7JA 3GTQJ 4UUTA 4O0IA 3ZT4A 4M3RA 1D5YA 1XUPO 2WV0A 4DSLA 3CCRT 5BR9A 4MLOA 5GAHJ 2J06A 3JCMg 2PX9A 2ABKA 3OH6A 4D7MA 3QWLA 1G2HA 1QQOA 3FIWA 1SFUA 3EYYA 1S7OA 1X2MA 3NEUA 1VYUA 4HF2A 3VEVA 4CJTA 1WOQA 2VODA 3CXCA 4FOEA 3NHGA 3CPWP 4JOMA 2XY6A 3I71A 2OTLQ 3AFHA 1EETA 4M3WA 2L3RA 2IVWA 3OS0A 2OPRA 1AKHA 1UA1A 2BTFA 2ESHA 2L4MA 1FP1D 1GBRA 2DA3A 3CD6N 1IBMK 2EQIA 3S3MA 4DU4A 1Y0NA 1QVUA 1XMAA 4KITB 1GLFO 3HSCA 5FU7B 1B4AA 1XNRK 1WRJA 4KIGA 4EM1A 4XIDA 2R7RA 1N27A 3WGHA 4ANJA 4LDYA 5LJWA 2HKOA 4O5VA 1UOCA 3AV9A 4FVMA 4PWDA 3EUAA 3IH4A 1U5TA 2F8SA 1KQ1A 3HKSA 2ZCFB 3OS2A 2HNZA 3DRPA 1RGIA 4NC7A 2KR3A 4FJHA 3H3UA 1YVNA 1TQIA 4ZC3A 5JVTA 4W97A 1U2WA 1JE8A 3H9NA 5HY6A 1VQ5T 4OGCA 4MDBA 3L1PA 1O3QA 4DOVA 2UUZA 2LFBA 3FBIB 1YHQT 3ZQFA 5T7BA 3SEZA 1BI4A 2DKGA 2FO0A 4G94A 4MMKA 4PA1A 1C0FA 5BPDA 4L6V5 1WH5A 4UV8A 4CI6A 1RT7A 4KB0A 5J2MA 1VQPI 1LMZA 2JMWA 2HGCA 2COYA 3SHWA 3KTQA 1B07A 3GF5A 1PG5B 4WXCA 2L01A 3NFCA 4C30A 5D6XA 1JKHA 2OPQA 2ZMEA 2G6FX 2KRCA 4I09A 1RL2A 3L2WA 4FK2A 1YJ9Q 1HNWK 2XSDC 2B63J 4CZJA 2A5WA 3AKZA 2LX9A 5ICCA 4M77G 2M7AA 2WC9A 4C8KA 4S0HB 3ASNH 4I0AA 1IG8A 2NUPA 2HSEB 1U84A 2P4TA 5EG2A 2VKVA 3L2ZA 1TL1A 2W84A 4AYBN 3ISNC 2RREA 4FPBA 4CYCA 3U3GA 5F1XA 2KQWA 3HXMA 2F4MB 1AOJA 5EG0B 3CD6Q 1YAGA 4MDWA 2CH6A 2D0OA 4KH1B 1KYZA 1NMNA 3LDPA 1V29B 1NE8A 1QS4A 1ZG5A 4QS9A 1V5EA 1SL1A 4XU3A 4IURA 4B3OA 2EIKH 4NYFA 3IFRA 1S1XA 1G3WA 2Q3SA 2WY7Q 2XIDA 3MMVA 4KHUA 2WAFA 3ZSQA 2KTQA 2G8FA 1M1EB 1FPQA 1EIFA 1NBEB 3AT1B 2W85A 4IUTA 3RPUA 1U5SA 3OMCA 5F1RA 5AQTA 2O4GA 3CCLN 2DA2A 3VSLA 4EM0B 1M90O 3FEOA 3V9SA 3IHOA 2DW4A 3SUPA 1RPWA 2VKDA 1X2KA 2OJ2A 2FUG2 3MEAA 1JXEA 1NG6A 1X9JA 1Z67A 1KJWA 3OSVA 1VQ4N 2RHXA 1NNEA 2VL8A 4Z89A 1ETQA 4DBFA 1X9MA 4U0YA 1QA6A 3GLXA 2NOJB 2ABLA 1TT5B 2ME0A 4NCBA 5HDKA 2Y4XA 3EE8A 4YY3K 3W0LA 3G2BA 1PM3A 4YORA 2DD4A 4LDUA 3TVTA 2QASA 4N41A 3TAQA 4NXMK 4ZYGA 3EUHA 2L0AA 2VG6A 3REOA 2QGGA 4CJSA 1KQ0A 2ZKZA 3I54A 1YJNI 2VE9A 1Q86U 1C0WA 3ZX2A 3Q9VA 4BRQA 4H03B 1XTAA 2GIZA 1C6VA 4AHSA 1N32K 2E5NA 1FMVA 1KYWA 1RKTA 4EP5A 1LW2A 3V1OA 2EA4A 2QW9A 1Q1HA 4OWRB 5AR0A 2CUJA 3AL0B 1N8RR 3PJRA 2E12A 3H3VK 2WSCE 1IRFA 1OEBA 2DIQA 1L3UA 4B9LA 3R8EA 2I5UA 4D7NA 2GFUA 2DF6A 2QKMB 5J2NA 1KC8U 1VRUA 4GLMA 4XTUA 4X66K 1B1BA 2WAEA 2BYVE 1VQ7T 5HROA 5L3GA 1SL0A 5CQYA 2CWEA 4JZ3A 1ORPA 5KQDA 3ZQIA 4RAYA 4BBSJ 3ZEUA 5GAOm 3M54A 1IKVA 5GPAA 2Z1GA 4CGDA 3HVTA 2D0CA 2YKMA 2F4VK 5M1PA 3IUOA 3SFZA 2E2PA 3VA0A 3LAJA 2ZFUA 4GFBA 2F5TX 4CGFA 1G2BA 3PFIA 1IHVA 2ASOA 2P5KA 1Y6IA 1ZK8A 5EGOB 1BQNA 2ZJPL 1NM7A 4CCNA 1T08B 3E97A 2IGNA 2DCEA 3U6FA 4S04A 2M51A 4MO4A 5HRSA 1D1AA 4PIIA 3MCAB 3WNGA 3D1NI 4U0VA 1SKUB 2QGUA 4MLEA 2G7UA 3VMFB 2NVTJ 2B7EA 5GIOA 2Q1NA 2KKOA 3FZKA 4DMNA 4M7DG 4E7HA 1YJ9N 2DL8A 4PNOA 2P9UB 2EIFA 1BI4B 1JL1A 4X1VA 2O8EB 1UEBA 3CCMT 3KJVA 4YHHK 2PUOB 3I55T 3BG6A 4BY6C 1MMNA 5M1OA 4Z4EA 2P5VA 1X43A 3COAC 1M8MA 3G6EQ 4JHDA 5C0YA 2LDMA 3U4LA 4YPHA 3BR5A 4BH9A 2FPDA 3OMGA 4JI5K 4A61A 1QBJA 4M3EA 5JLXA 3DTKA 1YT3A 1DP3A 3BCBA 4HHTA 3WTTC 2DFFA 4JJDA 2HVRA 2UU9K 4FXDA 2LT4A 1C0TA 3K4CA 5J2QA 4XQFA 1SFEA 2FL7A 2KEAA 3LPUA 1QZYA 2BZTA 3CXCS 4LF9K 1ITGA 3THKA 2VC0A 2E4HA 3P38A 1NU0A 3K2PA 1SC7A 1BW6A 2DK8A 4II2A 2P5OA 1YJ9I 1P2FA 3CPWA 3DXJF 5A0LA 2QEXA 1FC3A 2XVCA 4ESJA 3TSWA 3AG1H 3TEEA 2HF3A 3ID6A 3I56T 2F4OB 2Y48A 5J3LA 3J7ZO 2JVHA 2CFXA 4LFAK 4XL9A 5CYVA 3K2AA 5GMKi 3O08A 1Y64A 4CK3A 2W82A 1SMTA 2O0YA 3RESA 3H0GJ 2IVNA 4RGXA 3RR6A 1FSEA 1O4XA 2LLKA 1PHTA 4KT0E 2JHJA 4YFUA 4EMKA 1HYVA 2ASMA 2L2OA 2L8DA 2BHZA 4HT8A 1SEUA 4B3MK 4CBWA 5LJ3h 1SD4A 3CCRQ 3CC2A 4JUVA 4DSKA 2F1LA 1OJLA 1YJNA 4M77A 2KFZA 3SFIA 5CVUA 3TTDA 2MOXA 1T44A 3HHGA 2BY3A 2OTLN 2EJGA 3NGZA 4HSRA 3DYAA 4HLYA 2C0IA 3ZMVA 2JJ9A 1I8FA 2VASA 4UC4A 3A0IX 1X2QA 3I59A 1FBQA 3EFSA 3RMCA 3K70D 2IVOA 2M3AA 5EYRA 4XKVA 1Q7YC 3BGRA 3U9ZA 4PFZA 2RGVA 2AZSA 3HSTB 2J5PA 3DLLA 2DO7A 3K0LA 2EZHA 5GIPA 3M3YJ 3SQ2A 3DLHA 5GANe 1R00A 1QPIA 2HVHA 4FWNA 4DTJA 3HGYA 4LOCA 4DZJA 3V9WA 2QGFB 1BBZA 2CGHA 3OS5A 4PHTX 4JKGA 1NJIC 4JYKA 3HEFA 1X6GA 3WTUC 2FB7A 2O4IA 1I5LA 4H4KC 1S1WA 3OTOK 1F43A 4LUDA 1HSTA 3OYGA 4F7UG 1D3YA 4YDUA 1K9MO 1DGKN 2DXIA 2GNCA 4ZYHA 1TTYA 2QQBA 1VQ6I 3FZFA 2A41A 4RM2A 4RTYA 1IXDA 1XHXA 3CCUA 3BJ6A 3L8BA 4CRIA 1LV5A 2JN0A 2SRCA 5I22A 4FSVA 3M1EA 4P5NA 4BI8B 1JUMA 4GDFA 2DTHA 2M7BA 2D6FA 1RBUA 1FBSA 3J7YJ 1VOMA 2B6AA 3M6GA 2J4RA 1Y56A 5B5EC 1F1BB 1Q81R 3KXTA 4BRHA 4JLHA 5K14A 3U2RA 1JKRC 1WQ2A 4FT2A 1IGNA 2NAZA 2E71A 3DOLA 4IFVA 1EFNA 1UHCA 2KMUA 5E1ZB 4PJOE 4HNTA 1IN5A 2KRFA 3WHCA 2GX9A 3A8MB 3LALA 2QBYA 4QPOA 3H41A 3KEQA 5HNHA 3HRTA 4V19K 3CMAN 1NKBA 4DJAA 3BPXA 1U49A 1AOYA 3AO3A 3MMYB 4E89A 2KYMA 1RDWX 4HTLA 3W2WA 4Y0WA 4BWMA 3K4KA 3S2HJ 2GA2A 3OOPA 3N5BB 4AFZC 3SJMA 2BV6A 3CP8A 4PL7A 5FRMA 2K6DA 3SB2A 2XGCA 2IA2A 3BW1A 2VCPA 3I59B 4FL6A 3ECOA 5BMZA 3JCMf 3BFMA 1VQ9I 4OF1A 2G8HA 2DX1A 3JCMe 2DDBA 2X3XD 4M3UA 5E3MA 2O4XA 4KUDK 1TNTA 3LSTA 3NVKA 5ADXA 1H1VA 3JRBA 3G4SA 2CV2A 4OLAA 1HD3A 1VQ4T 4AHVA 5D6EA 2HXIA 1IXCA 1QQIA 2QWRA 3W6VA 1OV3A 1OYWA 2G9WA 1OCPA 2IS6A 1W2BA 4WQ4A 4W5QA 1R1UA 3HSBA 2GWKA 2GXBA 3HHTB 2ECZA 2JTMA 4FX4A 4FT8A 4IFYA 1FZPB 5GMKh 3S2DJ 2R7FA 5FGMA 2NS0A 4H0OA 1ASVA 2L9SA 4DQ2A 1WJQA 2KSSA 2N8GA 3TPQA 1RAFB 2M9UA 2L3QA 2DQRA 3MEVA 1WEFA 2YU9J 3A0HC 4PUSA 2OF7A 3KIOA 1DU0A 2A05A 4OIRF 3CQ8A 2HYFA 1XC5A 4P5OA 1R0BG 2YX6A 1LOTB 1LNXA 2ZQBA 3PUBA 4X64K 1UB4A 2WOMA 3DF8A 1F9NA 4Z2YA 3NGPA 3T19A 3TREA 1DTQA 2NLXA 3CMAI 1GLCG 1R5ID 3VS5A 2X78A 4H5WA 1SV5A 5BQTA 4HDUA 2P9KA 3NRVA 3QO9A 3E2UA 1WHLA 1CSKA 3KZZA 4XRSA 3GLLA 3HOVJ 4CIGA 2CP3A 3DU5A 3AY9A 4F91B 2HDWA 3OW2M 2F48A 1ZLMA 3LH0A 4B1UB 1Y0UA 5LHHA 4IHYA 3LDLA 4C92A 1ZRFA 2DD5A 3CLOA 5C2FA 5IY5H 1K61A 1TL3A 3U3YA 2X4XA 3QDRB 4JZ4A 3J7ZI 2QQ9A 5CR4A 2AT1B 4CJ4A 1ONVA 1VQ8Q 5JVHL 3L2RA 1D1CA 2X9HA 4PJNA 1YIJT 4DQRA 3VRYA 2QEXI 2A6EF 2DTZA 2HBWA 4KUMA 2R93J 2DYRH 3EETA 1V4TA 3BWGA 4BDYA 3VQAA 1LWYA 3TP0A 3OYMA 4LDVA 5CAIA 4CHQA 4CBUA 2B86A 3Q7CA 3EL2A 4U67L 4CE9A 5BREA 3A5MC 1H3HA 3F8CA 1SVLA 1R22A 4LY7A 4DF8A 3GOXA 3E5QA 1O9SA 5J39A 4L5IA 2E2JJ 3GWZA 2Q1ZB 5F1JA 4Y52J 3V81A 4BY9C 1S1NA 2DJIA 5J6XA 5D7UA 2CT3A 4M78E 2JZ2A 2LQNA 5LGTA 1WGXA 4CCHA 3JSOA 4FZYA 1FWZA 3SUOA 1Y7XA 3KFWX 1NGHA 1VSJA 3DKXA 5IYCJ 2K86A 1VSKA 2X4HA 3R0AA 1UCRA 2G7HA 3HBTA 4A5NA 1S22A 1UGVA 1GV5A 1TWFJ 4C1NK 1BI0A 5EEGA 2BVMA 2CFOA 1BR2A 2PU9B 2MH9A 3CMEQ 3DP7A 2P0KA 3OYYA 5KHDA 2IJLA 3Q3SA 2G8UA 1SG5A 2HTSA 1ZYRF 4IG0A 2PVGB 2KLAA 1NBWA 5I21A 5DY9A 3VS0A 1S3XA 3PIPL 3VEOA 4KH6A 4WYBA 3O1BA 2NOBA 2MD5A 5CQXA 3VF4A 2ZC2A 3HPOA 4M9ZA 2DBBA 3VOVA 3ABMH 3QIIA 4F4KA 2CU7A 3HVRA 2HHWA 4UUSA 4BRCA 4ELYC 4MZTA 1YIJI 4DG1A 4M78F 2E34A 5LL6Z 3HZ6A 1K7AA 1YFHA 4DS4A 3VS1A 1M3CA 4BU2A 3URGA 4EA5A 3OHRA 2W6KA 3D0SA 4CF2A 4DV5K 2JRTA 3KP4A 4XKCA 2F4IA 4HNUA 1I27A 4YEJA 1J0RA 1VQ5I 4A69C 1WSUA 3EG0A 1XJWB 1K83J 1JTYA 1MJBA 3ZR8X 4CICA 1NK8A 2W25A 3VEWA 3BE3A 3J81Z 2ID3A 2V1RA 3O8GA 1S1TA 2Z99A 1Z7UA 5GADP 2OTLT 3SXYA 2CGLA 4MQ9F 4BD3A 3AVIA 2BOLA 3C2GA 4BJ5C 2EFNA 2E1NA 1FYMA 5KRSA 3EFRA 3CPFA 2H09A 4CHUA 3EEQA 1E2XA 4I98B 3VFZA 4ZZDA 5FFXA 2XHIA 2K85A 3S1QJ 2A68F 1O13A 4DZPA 3OGDA 1LPQA 4P55A 4JX6A 2EV0A 2F5VA 3RSNA 3PNWC 3E3VA 5GANf 1SSFA 3IP4B 1QZ6A 3LCNA 2PLYA 1OCCH 1BYMA 1MD0A 4BQZA 4RB0A 3GFIA 1PU8A 1Q82R 1VSFA 4QVZA 5CKTA 3I56A 5AZJA 2QKBA 4DFMA 3CCQN 4GNIA 2DJNA 1TL8A 3WXLA 3FM3A 3C7NB 2GELA 4DQ8A 1V5FA 4KH4A 1VIEA 3ELKA 4WCGA 1S6LA 1FNNA 2GAUA 3LM2A 3CCMA 2QA4I 5AQWA 2Z16A 3DPUA 1K8AC 1WH7A 4FASD 3VV0A 3LP2A 3FMQA 4F7UF 5DCMB 1WQ7A 2BE7D 1X1CA 1IGUA 4B24A 2RPIA 1U48A 1WLPB 3RTRA 4M77B 4BQNA 2LF7A 3H5AA 1RBSA 4IBNA 3CCVQ 1Y97A 3QIPA 4R8HA 1QHGA 4J9CA 3FXLA 4B1YB 3R60A 3G71Q 4BHCA 1BK2A 1BCMA 4JEPA 1YITN 3E9GA 3MKLA 3CQTA 4K41A 1Z26A 3AA3A 2IG0A 5AQMA 2BBYA 1VK0A 4JI8K 4C0GA 3M8PA 5ADXH 3M9QA 1MSFC 3CC2I 1ULYA 2FSKA 2NWMA 1WUAA 1KFSA 2ZJRF 3RVCA 4Z4CA 1TLHB 4HSBA 4MTDA 5J1YA 2QA4N 1GFCA 3VQ6A 1XNQK 3A5LC 3NCIA 3JB9G 2EPFA 2XAJA 1TSFA 2MI6A 2W42A 1MBHA 2DDAA 2KMTA 3C95A 4QSHA 4CJWA 3FXMA 4BQAA 1S9GA 1WJ5A 2F5CA 4EW4A 1RKWA 1X75C 4OB3B 2FRHA 3TWHA 3CDHA 3DEWA 3BG5A 1P8ZA 2H56A 2P81A 3GCMA 2XV4S 1PD0A 1WPYA 1JO8A 3MZYA 3R3LA 2RN7A 2L7FP 1RETA 2K9GA 4R5PA 3FM5A 1QSLA 1OCOH 2QYZA 3KYDB 2VJIA 2FBIA 1ACIA 4CZLA 3P83D 3FRNA 4BREA 4BQLA 1CZBA 1L3SA 3ZSVA 3CPWM 2M45A 4DV6K 5JS1A 1HOMA 2Q0OA 2VG5A 1JLAA 3HB9A 3CC7I 2B8AA 4Z02A 4EMKC 2OFIA 2Y0SA 1OH5A 4OOIA 4O0JA 4KGZB 3L9FA 4PGGA 3T5XA 1R1VA 2PEXA 2HWVA 1NGAA 1JKPC 4RTTA 1UHWA 1LE8A 4AU7A 2CYZB 4MDXA 3VENA 4CC4B 4KT6A 2ECBA 3L2CA 5KYWB 4U87A 1RACB 1S72T 4Y33A 2PMHA 4F2SA 3WNFA 4DCHA 1S9EA 4A2AA 2KT0A 1NLOC 2ADUA 2QWWA 4OMLA 1DPUA 1VSHA 4YG2F 4KBOA 3ZL7C 2CS7A 4IUQA 4MO7A 4KB1A 1ETOA 2O88A 4UXNA 3ID8A 2KDOA 2V9VA 5TJJA 1VQ8A 3T7ZA 1LJ9A 4CHYA 2LQWA 4KFBA 2GF7A 3ZRGA 2PJRB 5GANg 3KFVA 4JLIA 2ZMEB 1Q86C 5E8IA 1ZELA 3GBGA 2NUZA 1VQ6N 2Q2EA 3PUFA 4GKJK 4V2GA 4ELUA 4BQQA 3VU3C 3HPGA 3AVCA 4IXCA 3K1MA 5CJ9A 5E41A 2YX4A 1PUEE 1IDYA 3VTIA 1ZHFA 3W3CA 5HOOA 4PKHA 2ETJA 1FOYA 5GAHP 4LG0B 2FPEA 4JKGB 3CCST 4MQVA 1J6ZA 1ZKGA 1OR7A 2E88A 5JLHA 4J19A 2KAFA 1SFOJ 3LYIA 2LBFB 4UNFA 2NZTA 2AA4A 2DA6A 2EFPA 3QEWA 3SZ2A 2E1MC 1VQ7Q 3GZNB 1HA8A 5EF6A 4A53A 3I0TA 4B47A 4A12A 1RT3A 5E18F 1O75A 1Y8QB 3PO4A 3OIOA 3DXKA 3FZVA 3QODA 1UGPB 3I55I 1YRNB 3HOYJ 3AA4A 3PL8A 3I9V2 1TUGB 1NZ9A 3BT9A 2YX7A 1RBVA 4I6ZA 2E10A 3KLIA 1Q9YA 3QEXA 1RADB 5LJ3d 4A4HA 4N4HA 2K5LA 4OVAA 2NRAC 3M0UA 3F8NA 2A3SA 1BDGA 2IRFG 1OVQA 2BZYA 3R61A 2HHSA 5KAIC 4PY5A 4BI4A 4NLBA 4KT5C 3TABA 2WV1A 4EVVA 3C3WA 3CWTA 2J6FA 5DPKA 2Y30A 5J3BA 3CMMA 3HK2A 4B3AA 4RCBA 4QOZB 4GY5A 1XOVA 4G1QA 4LUEA 4MFEA 4FPAA 2D5VA 2RK2A 1WSJA 3M8FA 1X2NA 3DLBA 2P9KB 5GAGP 1W0UA 3CDIA 3O2PE 4EEFG 1I3QJ 1JCFA 2F6CA 3LA7A 3KEYA 3IL2A 1RTJA 5IH2A 3VPRA 1ZG3A 3DEUA 3I4NJ 2OYQA 2H94A 2R58A 1GLDG 3DV8A 2Y9YA 1U9NA 4ID5A 4JNEA 5IWAK 2ZB9A 3WGIA 2HOSA 1KU9A 1SPKA 3JB9D 2Y90A 3C7NA 2BUDA 1J5OA 4ISGA 4B3TK 1F36A 4C8QF 1NPRA 1WBDA 2H8WA 2KZGA 4ZDOA 2P9SA 1BOTO 1H3ZA 5HS7A 1M3HA 3BZCA 3CCJA 4IWVA 3AVGA 2DM1A 2I2LA 1VRLA 4KGXB 2O8DB 1XG1A 4UOBA 4AC0A 4FZZA 3HT3A 5AQVA 4M3GA 3KP6A 4M7AF 5IOZA 2HZYA 2LSOA 3I0SA 2EV5A 5KN8A 5HVQC 5M9OA 2FX0A 3J81O 5AT1B 2ETHA 4KHYA 3HL2A 3DXMB 2HZDA 4I7HA 4DV2K 4LF5K 3A1PA 5L3EA 2X4YA 3M07A 2JS0A 3E9PA 3J80O 1TXQA 1K0SA 4IO8A 4G6TB 1NK2P 3ERED 3QMLA 3INZA 4C8QG 3E1SA 1USTA 2DFUA 5JICA 1NJWA 3QLHA 1ORNA 1JL2A 2HQAA 2PI0A 5E79C 4M75B 4M3XA 3LDQA 4LFBK 3I0WA 2V8KA 4YRVA 1WSFA 3VTHA 4YTLA 1MUZA 5LHIA 1GLBG 3CJQB 2QF7A 2XGEA 4FJ8A 5LBQA 3AO2A 3META 2OX7A 3ZP5A 4JKCA 1HJOA 1BI1A 2X51A 4L3QA 1DIZA 1NJZA 2PBIA 5SWMA 4FYYB 1Q8IA 2DILA 2VI6A 3KP7A 4OP0A 2EPDA 2IAJA 2D0BA 1RLQC 4L5EA 1W7PA 1B92A 3ABUA 1WVRA 2R7UA 1VQON 5J47A 2RE2A 3OYHA 1ATRA 4CGZA 1HKGA 3CMAA 4H0YB 1TW2A 3HOUJ 2QCOA 3HFNA 3P31A 1HQCA 2O01E 2Z3YA 3MWMA 1T0FA 1MJAA 3THWB 4N0AA 3DI6A 3EO3A 2DLPA 1T3LA 3AA5X 3U23A 5IHKA 1IH7A 4B23A 3CJ9A 4FW2A 2DMTA 3K9TA 1SRMA 3QG1A 1KG1A 2JG6A 1R23A 1KG5A 2D0NA 2HOAA 5ILUA 2NS8A 1T6CA 4BG8A 2BGCA 1QVGA 1G3YA 2OAZA 2QEXT 3D2FA 3L2VA 5DDGA 3NGIA 5HRRA 3WXIA 3CCVI 3NTKA 2GLOA 5KH6A 3C12A 1HNVA 1NJIU 2VQFK 1J59A 2E6LA 2NVXJ 3VEZA 2Q97A 5FD5A 2XRIA 4OMYA 4E4HA 4J9HA 4B9NA 2HQHA 5GJVB 1BW5A 2R7TA 3S3OA 4DGWB 1W7AA 2O03A 1YJWI 2M5WA 1U4BA 1WNSA 1YUWA 3ZEHA 2VXDA 2DOEA 5J8FA 1Q86R 1YJNN 3EQLF 2HCKA 3OYBA 1YHQA 3B6OA 2V7ZA 1YBYA 4FJKA 1ETKA 4IX7A 3B8AX 4HX8A 4LC9B 4ZGEB 2Y31A 1CXUA 3AVAA 4ITVA 4FETA 2P8TA 2A7YA 2CGJA 1N8RU 5DLOA 5E3OA 2L3PA 3THWA 2RB6A 2KY9A 4CW7B 3CCEN 1G15A 1LCUA 2COBA 1OX8A 2ENMA 4JI4K 4Z4IA 3RMQA 3CM6A 1K76A 3D5SC 4DKWA 3DMJA 3NH2A 2E7XA 3DLGA 1D9FA 3QYFA 3VESA 3QO3A 2AO9A 2RO0A 3UB5A 1FX7A 2VBXA 1MPGA 5JLWA 2WUSA 2CUEA 4MTEA 3HOSA 1Q81C 1NKEA 4MNUA 5E26A 4YFKF 3HFOA 2OCEA 4BRNA 1KA8A 4HG2A 2OZMA 5DMRA 4DBQA 3S32A 4M7DD 1QZEA 2OPPA 1X3NA 2K9NA 1ZSGA 4EJVA 1LVKA 3CC4T 3DLRA 1P7IA 2MGQA 2OTJA 5AQQA 4IOXA 3OSSC 1K1ZA 4A57A 1LUJB 2DU9A 3ZETB 2YRDA 2ZSHB 2RQTA 1OU8A 1T8IA 3GVAA 1V76A 4BG9A 4ESBA 3A8HB 1HW1A 4IZ9A 4O8KA 3R0JA 3TEDA 1JLEA 2NLUA 4FTHA 2D8JA 2EYWA 4CCMA 1WFXA 2K5FA 2LG4A 2MAMA 5FU6C 3THVA 3AO5A 3Q0WA 3CCSI 2O8CA 2YLBA 1VF9A 2FF3B 2LKSA 2EKHA 1WEGA 2GFAA 3QWXX 2QSGX 1OKRA 3MD2A 2CQXA 3L1AA 1YF5L 5KPRA 3TR8A 2UUCK 2EK5A 1YI2A 1ASWA 2JVGA 3EHRA 4OGEA 2LX7A 4IG3A 5FLXO 3F0ZA 2ZD1A 4LF4K 2GCXA 2KZVA 3VQ7A 3QZ9B 4LK0F 1QMCA 1I6XA 3CF5L 1K9MU 4C5EA 2CUFA 3LDSA 4M7AG 3IUCA 1AVZC 4W1UA 4M75C 2W41A 2R0QC 5GAMe 2FBXA 2LQKA 2ELHA 1AHJB 1YI2I 1NH3A 4HCCA 2M1HA 1PYVA 3N97A 4XTWA 2E20A 1P4AA 5KYWA 3MCZA 2V4JC 4KIFA 3L0QA 4BVPA 1HW2A 4BR2A 1K73O 4F52A 2QAZA 3G25A 3I5RA 2QYOA 2A07F 4E7JA 3WU0A 2ED1A 1N3AA 4NZGA 2CV0A 3H1VX 3IRRA 1T0JA 1T38A 2YRCA 3KK2A 1VQMT 4JI3K 3HSEA 3FB9A 3EH1A 3PM1A 4B43A 4A54A 4YIFA 1LPLA 1SANA 3LP3A 1AWCA 3N4PA 1U47A 4C0DB 4FK0A 4HV5A 2HVSA 1EQYA 2JW4A 1PDNC 1HJRA 4IL6C 1I07A 4BC5A 1T6SA 1MWKA 2P0QA 3M55A 1YVUA 5LJ5g 2O31A 3ZFJA 2KRSA 1WSGA 4JRKA 1C6VX 4YIRX 3OA6A 1YJWA 3D6RA 3R9PA 2MABA 2VJ5A 2QDYB 3TU4K 4DR7K 5HNFA 2FBKA 2CYYA 2P5LC 4K8XA 3MEGA 4BJTA 1XG7A 4A3EJ 3WTYC 1U9OA 3WXJA 1ZSZB 4C5IA 5FLVA 5EEHA 1LDJA 2VT3A 2Y69H 3CD6A 4DUYK 4OVLA 4WFNL 3CW7A 2XPVA 3MDQA 2HDAA 2K7AA 2HSPA 4FWSA 2DZCA 2P4RA 4C2TA 3CCJQ 1SRLA 4M77C 3RWUA 2KXCA 4OMFB 2BW3B 3CXCM 3H45C 3LQRA 2K7LA 3U9GA 4GV9A 4QCLA 3FJ5A 5KYXB 1LB2A 2WY8Q 5KYUB 3V1QA 3LWFA 3SBGA 4LGWA 4BR9A 1H9TA 1RDUA 3H35A 1IXSB 1DU6A 1TWCJ 4CZIA 4Z88A 1LEAA 2A3LA 2HMIA 2E36A 4KRTA 3GTJJ 3P5JA 2VKNA 3JTHA 1OOTA 1MDMA 4JK9A 3JCMb 4ESRA 4ZYEA 5K5OA 3EHQA 1RTDA 3CCSN 4U7BA 2AIRB 2PFBA 5GANh 4Q48A 2O8EA 1EV7A 2EFQA 3EFOB 4ATOA 1K6OA 1XTDA 3QU6A 3P1GA 1Q81O 1UFMA 4C3JJ 3OBWA 5IP6A 1V5GA 3G1JA 1UG1A 1GCQC 1EO1A 2EFIA 1CZAN 1ON2A 4QLCU 3NBPA 2H1KA 1VQKQ 2NRTA 1NGBA 4KHSA 2ID6A 2K3BA 5GINA 3WVEB 1VQ7N 2HOEA 1NK9A 4KFCA 4DFPA 1XPXA 2DOAA 4CJRA 4II3A 2VG7A 1WHUA 2BY2A 2L0KA 4AIKA 4RW7A 3FFIA 3IG1A 3JAMO 5DYMA 3TCJA 4Q5VA 2DYSH 2VXZA 4ME7A 3D4VA 2K02A 2F5EA 3QPSA 4D1QA 4Y13A 1CKAA 2VLAA 3IH2A 4BC4A 2OTJN 5B1AH 2FE3A 1FMWA 2E3IA 1JHFA 1W5TA 3E66A 2DJZA 3VQCA 3GNGA 1RFQA 3J80Z 2E2NA 1YJWN 2ZJQL 2DOFA 2C06A 1ZAOA 4HTUA 4M3BA 4EHUA 1VQ6Q 1REPC 4A3CJ 5L3BA 4J5YA 1KTQA 1RT1A 3KYCB 1M1KR 3MAJA 1X01A 4CF8A 2DVEA 4PKCC 3EUHC 4FCYA 1G8XA 4BXXJ 4RW6A 3UF4A 2HFHA 1Z25A 6AT1B 4X1EA 2M1BA 4GYIA 4ZDPA 3LW5E 4B9WA 2PTKA 3M57A 2RHYA 2JLEA 1Y96B 1TAQA 3C0CA 3HDDA 3I55N 3M0PA 2IDOA 3PQJA 4CCOA 4DF4A 1ZBHA 4UVAA 3QU3A 3SCXA 2HNYA 1E6HA 3BDUA 2FQ3A 3CMEA 2JSPA 3LNQA 1MZBA 4EHTA 4CERA 2ZJQF 1BA5A 1UJ0A 1OLTA 2EQUA 1IZ6A 1W1WE 4B1WB 2E70A 3DTEA 3WE3A 3F8MA 2LC2A 3TGNA 4NL2A 3O6WA 1GBQA 4ZN3A 2IGMA 1VQPQ 4MO5A 1VSIA 5IHIA 3L09A 1NK3P 1JI8A 2ZO4A 4HYEA 2L9VA 4OAZA 1KG3A 1LE8B 3I8DA 3BUZB 4ZJZA 1B72A 1FJGK 3I3LA 4FSSA 3FZMA 3K5MA 2XF5A 3G6EI 1NK0A 5DUKA 4A5MA 1SD5A 2EB7A 4RAGA 4AQYK 1MGQA 2YV0X 3RTVA 1KU7A 1RDAA 1MNMC 3HRMA 2Z33A 3QUIA 4YOTA 4Y3OA 4AD9A 1CGPA 1HU0A 4EMHA 4RBOA 2FZGB 4AFQC 1UELB 1P90A 3R6OA 3MXJA 5DEQA 4CH7A 1W0HA 2HHXA 4FJ5A 1UJ8A 2UZKA 4JRQA 3UKRB 4FJXA 4EMSA 4GLKA 3V9UA 2LJ3A 5LEJA 4LH4A 4B3XA 3ECHA 2LYCA 1VQOA 1U04A 3K4JA 4PKIA 2HMAA 2DA1A 2EJ9A 3P8HA 1RR8C 1DP7P 3CCRI 3CMEN 2KP6A 5M1KA 3FXQA 5GAGJ 3SLCA 4RGSA 5ICFA 4KTWA 4DQIA 3NE6A 4F9OA 2YS9A 3LA2A 4KISA 1JLQA 4B4CA 1GHCA 4LD6A 3H9QA 1Q82C 2IBDA 4XTYA 2OTLI 4XONA 3D7SB 2FRWA 1DQUA 2D1VA 5JHFA 3LZIA 4RG8A 4M7AC 4IQ4A 4JKAA 3R6MA 4ILHA 2YNGA 2VQHA 3VYHB 2FLOA 3ZSXA 4GYGA 1I1JA 4IFEA 1SEMA 5HLTA 4GVMA 3O9RA 2QSFX 4EV0A 3BR1A 1FLIA 4K8ZA 3PTAA 3VJPA 2NUTB 4RB1A 1R9TJ 4RTFD 3FC3A 1Y8RB 3I0XA 3CJ7A 4XOTA 3JSPA 2YHWA 4OMOA 3HTVA 1FT9A 1NLVA 1ZBUA 4H5NA 1VQMQ 4ZH4F 1JU5C 2OI3A 1HSQA 2BXZA 1VRTA 1I6HJ 1ZBFA 1I3AA 3JRIA 1QZZA 3ZCMA 2F2EA 2HZTA 4ELTA 5HLGA 1RZ4A 2WSFE 4A4KA 2PQ8A 3BTLA 2R7QA 4EJWA 4IHTA 5LJ3j 1ZUKA 4M72A 3CCEQ 1W4SA 1VQLI 2B9SA 2K3YA 1HMVA 3J81E 2H3EB 1XNIA 3LANA 4JK8A 2ZXJA 1BBYA 2RD1A 2DERA 1K0XA 3N4QA 1RLPC 1HPZA 1M5Q1 2HBMA 2X6OA 3BY5A 3FZHA 2MD0A 4J7IA 1NKCA 3NMZC 4F7UB 3DCFA 4RAFA 2GZWA 1VQMI 4LSNA 3CI5A 5BN9A 4CO8A 2X6XA 6PAXA 5FLMJ 2QLZA 3OQ5A 4FYDA 1M27C 3AGRA 2VC1A 3TO6A 1VQPT 3HRSA 1TKTA 5DUIA 3CCVN 4N0AC 1M1KU 1TYQB 2XC7A 2D8HA 5M1NA 3WTXC 4CJVA 2IXSA 2CH0A 3IKVA 3GFMA 3MXMA 4LK1F 2RQQA 2E5ZA 2FNPA 2V7FA 1WHJA 1F21A 1H92A 2E1HA 5GAN2 2DN0A 3PX6A 5EC7A 2IVPA 1C0MA 3ZQHA 1NGGA 1VYVA 3A5OC 2DBKA 2OU2A 3VQ5A 3ASOH 5FU6B 3V6DA 4PJOD 3QETA 1YX5A 1B9MA 4CC7A 1Q86O 3K7AJ 2K4BA 3H1QA 2O8FA 3H5RA 2KISA 4DV1K 1UJYA 4KBMB 4BC2A 4YOWA 2FMYA 2HPMA 2ISYA 2R7XA 4J9FA 3IRXA 4LE9A 1KU2A 5E17F 4A3BJ 3I58A 1X3WB 4ABZA 4M73A 4VUBA 1U1TA 3TSUA 4KIBA 4DEYA 4YFNF 2UYTA 3S16J 1YE9A 1SF9A 1YFNA 1V1CA 1MW7A 1HJDA 4FU6A 5E20A 1JT6A 5IYDJ 1D3BA 2B0LA 4XSXF 3C6AA 3OY9A 3F9KA 2XAQA 2VE8A 2FXUA 4A0ZA 2GA1A 2PMUA 3DRRA 3BQZA 5BN8A 3PY8A 2QTXA 4XTVA 1HDDC 2QI2A 2PZSA 3CCQT 1LFUP 4PFPA 5GAN3 3ULDA 2CH4A 2A3ZA 3GE1A 3MEEA 5HRPA 4M75G 1OCZH 2IEKA 5F04A 4IOAL 4BQOA 3S9HA 2LKXA 2V1UA 2KRHA 1QVGP 2DT5A 2Y0MA 2E4LA 4DTXA 1GOBA 4QIWN 4RTUA 2MC4A 5FRNA 3CC7A 3RIRA 3MKDA 4GXOA 1JCGA 3WTVC 1ZG1A 2ZAEA 2HDDA 2ZXHA 5DM7L 1TV6A 1H641 3AHUA 1ZLKA 3KKRA 4HQEA 5HCKA 1C0UA 2YSQA 1I4K1 3S41A 5LJ5h 3TAMA 3KHYA 2PN6A 5DCMA 4TVRA 1ZQ1A 3SAFA 3HOZJ 4Q0BA 5AZIA 3LSKA 3VUBA 4PJLA 4EFHA 4E7SA 1WA7A 1QU3A 3E9LA 2JK3A 1JEGA 2OV7A 1QVFM 1YW7A 1S72A 1MMGA 2HYJA 2Z1HA 1K73U 3T69A 4M77E 4DTOA 2CH5A 3ULQB 3DQVC 2WAQA 5KRTA 3H9JA 3N4MA 3EFOA 5GJWB 3MVPA 3DLLF 2A69F 3SEMA 2QZ8A 4FLZA 4EDUA 2MH2A 3G71A 3C2BA 3HKZN 2LRDA 4IIMA 5HDGA 1XGSA 1W7PD 4HLXA 1TK5A 2LY1A 3CCJN 3ZT0A 4RW8A 4GRIA 1FY7A 5LY3A 2ZMEC 2W00A 3AVKA 3UE5A 3PLAA 2XAHA 3VRZA 1ZA1B 4F92B 3LSHA 4P9FA 4M6XA 4A2UA 5C3EJ 2E5QA 1UE9A 4F04B 4P96A 3BG7A 4CYCB 1KQJA 5KPTA 1DTTA 1IG7A 1K8AO 4FJGA 4DR6K 4JN4A 5C24A 1MH3A 1S7EA 1QKXA 3OWTA 3AAFA 4OPKA 3DM2A 3O4WA 2HHTA 3N05A 5TKWA 1S1VA 1AZEA 4A6EA 2EIMH 2PQWA 2XK0A 4E7LA 2L2PA 1LFPA 4BKXA 4FJ9A 2UUBK 2DFHA 2QWPA 2F5KA 1Y71A 1ETVA 5FLXE 1XDUA 1ASUA 2OC6A 1ERDA 5HLIA 1N8RC 1RDBA 3CC4A 4LDXA 1IHWA 1FXXA 2Z9OA 3LSPA 4FWMA 3CUQB 2OD5A 1NEBA 4OLBA 1GLNA 4DU1A 2RHUA 1O3SA 2ED0A 4KREA 1IRXA 2EIJH 4YELA 4NC8A 1KG7A 1OU9A 3GO5A 4CHNA 4PGHA 5JLFA 3CC4I 1W0TA 2TDXA 1BB9A 1Z9ZA 3A8GB 1IO2A 1SKSA 5K5QA 2FF6A 3REBB 2EH3A 2PVOB 2JA7J 2BW3A 4PJOA 2CG4A 4N4GA 3P9CA 4D9JA 3C6TA 1R5GA 4Y4RA 4JHDB 3MEWA 3PSFA 1NGNA 2HS5A 3T1AA 5J26A 2KJBA 3U1DA 4FWLA 1N3CA 1T39A 4C2UA 1ZBJA 1H8KA 5CZ2A 1TW3A 1VQNN 3JCMQ 2BGGA 3HTUA 1SS6A 1FTZA 2CJJA 3HRUA 4CEOA 2DJQA 5M1FA 2L02A 3QAHA 3KK1A 1AHDP 4CZMA 2FSJA 5IOYA 2G8WA 1KD1R 3L4QA 1ODDA 1JHHA 2X9DA 1YITT 2ZNZA 3KBGA 4CECA 1WSIA 1S29A 3NH0A 2CQ7A 3SPZA 3GEZA 3V9XA 1QVFP 3CCYA 1WJSA 3OSGA 4CFBA 4L5JA 1EX4A 2WB1A 3DLLL 3MHXA 5AJ3K 3THXB 1L3LA 3VS6A 3QP6A 2E2IJ 1D4XA 3O3GA 5FKKA 4JKBA 1YQMA 2O5RA 1X69A 1PC0A 2RQUA 3DB4A 1J7KA 2BZXA 4B9TA 3I4MJ 3F5TA 1BIBA 2XDPA 2P1JA 2JN6A 3QPLA 1BO5O 3O9TA 1VQ7I 5GAMj 1H89C 2JHNA 2UXCK 3VGLA 3BZ6A 4Y1DA 3JSCA 1ZN2A 1I0CA 4XSZF 2QWMA 1YRNA 2AKLA 5IT3A 1WDXA 3IKMA 4PL6A 4GBQA 2DETA 3EZWA 4W5OA 3REAB 1AWXA 3M0QA 4WXDA 3OOUA 4YOUA 1KD1U 2D5RA 4B8AB 1QSSA 2RPNA 4BGBA 2RV8A 4M74A 4E7KA 2ICWG 1O7FA 4Q4ZF 4OAYA 2YU3A 2GWJA 3JB9I 3LWIA 1U06A 3CTAA 1N77A 4ON0A 1EKEA 4KH5A 3VN5A 3HO1A 3ZQ7A 3HOWJ 4OKJA 3FJPA 3EE9A 4RW4A 1XMQK 3G4ST 1NJYA 4DEXA 3BQYA 2QG9B 2YCHA 4MQ3A 4IEIA 2AK5A 3KETA 3DFGA 5LGUA 4B44A 2VQGA 5KI6A 2H6BA 4J83A 4XU2A 1PUFA 3BLYA 2DPDA 1QQJA 5C12A 1GT0C 5KYUA 4ICLA 5EX5A 4B9XA 2EZLA 2XU8A 5D8LB 4B8XA 4JKHA 4C1NI 2DXUA 5DV5A 3HGGA 4BEHB 1QWFA 4LD5A 1GOCA 2HU9A 2YKNA 4GW6A 3F21A 4L0YB 4J6WA 2QM3A 4DWIA 2PYLA 1SD7A 4CGGA 4LSLA 1GLEG 4A3IJ 3JAME 1KFZA 5FW9A 3CMAT 3PFYA 1WEIA 1AU7A 2DEUA 4R1HA 4C0ZA 3ZMZA 3PIPF 3MKYB 3FHGA 1DGRM 1HC8A 4J6YA 2M9HA 2K5CA 2KFNA 2HKQB 1UAAA 2NUBA 2QEXQ 4KTZA 2RJEA 3H8ZA 3CJBA 4M75F 3S1NJ 5H6QA 3OYNA 4JKDA 4NB4A 4K25A 5GAEJ 4BRFA 4YPRA 5K1YA 2NOLA 1ZH5A 3BPVA 3D5RC 3HIFA 2Y9ZA 4FHTA 3EYZA 4XLPF 3BF1A 1SD6A 3OL3A 4DK9A 4P1WA 4WE1A 1ZBXA 2O6GE 2Q31A 2DNUA 4F17A 1AZGB 4LLGF 3DXKB 3SK3A 2D9TA 2OZSA 2X6NA 3SDZA 1JUPA 2F8TA 3TQ7P 2NYSA 4HKEA 5CYMA 3O8HA 2XB5A 1F1ZA 4KI6A 3FR0A 3CCUT 5L23A 1K4US 4KTQA 3C6UA 1K78B 2V51B 4R79A 1QSYA 5LMNK 4M7DF 4ENMA 2O61A 5EU7A 2ISZA 3SWNA 3M8JA 3WT0A 5M5XJ 2JRMA 1WHGA 3TSPA 1VQLT 2PAVA 1QTMA 3NWSA 3L7WA 2WONA 2BVLA 2ZPFB 2NRHA 5J40A 1W6XA 1JXMA 4OB2B 4CC2A 2WC2A 2QQAA 3CCLA 4C8NA 1SKWA 4TV7A 2DXBA 1XMXA 1RT5A 1TUYA 3GBTA 1B8IA 1N5YA 1R59O 5GMKj 1FOKA 2YHTA 1ZRDA 1VQ9T 4DSIA 3QRFF 2KLOA 4E6KG 4TSXA 1L3VA 1NJXA 4CZFA 1TGOA 3LMMA 5FFZA 3ESWB 4B9SA 4MGRA 2AQFA 3QXEB 1PD1A 4H5VA 1BI3A 4CEFA 3M8QA 4Y28E 3QINA 2ZPHB 1V55H 2F69A 4M75E 4E19A 4EGZA 5KYYA 3RKYA 5EOYA 3ZT2A 2M34A 2DMPA 2EGEA 1IBKK 2OQGA 1V4RA 4E9HA 1ZGWA 2ROTA 3EH2A 1P59A 5AQLA 3MN2A 3DOKA 2XKOA 4NQWB 1RRQA 1TUDA 5JVGF 4RUGA 4I02A 5F64A 2YLCA 4IHWA 2ZBKA 3LWMA 4KHPK 3CWAA 1M30A 4HEA2 3TO9A 3LAKA 2AHJB 2DA4A 3ZSZA 4HV6A 3K6GA 3WTSC 4ZTFA 2DL5A 3F8BA 5AQZA 1Q9XA 3SNNA 1LQ1A 4BY6B 2JWLA 2B4JA 5GAOp 4F7UA 4MDAA 3M1CA 1Z7LA 1GXPA 1RAHB 1W5SA 3EGUA 3CP2A 4CCLA 3ZQCA 2EVRA 3QB0A 2R7OA 3JRZA 2RNAA 1XSXA 1VZ0A 4DTUA 3G4SN 3UA7A 2DK5A 1NGEA 1YX3A 2HQ5A 4Y91A 5EZHA 4H0PA 1B7TA 1X1DA 1J3TA 2V6C