3S3OA

Crystal structure of the prototype foamy virus (pfv) n224h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/inhibitor/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3oA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3oA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3oA03
2HB5A 2HNDA 4KTWA 3TARA 4DFJA 1HJRA 4IUPA 3UWNA 3FFIA 3ZEHA 2FBTA 3LP1A 2XY5A 3VQ4A 1ASWA 3KD5E 3DM2A 3ZT2A 1RT2A 4OGEA 1BCOA 4KB0A 3NH2A 3ASMA 4CCHA 1RI0A 2IAJA 2NLUA 1W9HA 4CFAA 3S3NA 4CJKA 3QETA 4B9SA 5KRSA 3AVLA 1C6VA 3MEUA 2X4YA 5HRNA 4OLBA 3VQPA 2W42A 2PYLA 2B6AA 1L3VA 3QEPA 4RW6A 4CJPA 3AVCA 4ELTA 4C8MA 4CIFA 3ZSZA 4K8ZA 3BDLA 5J2PA 3NDKA 3NF9A 3AVMA 4LD6A 1Y97A 3QIOA 2QKBA 4B3OA 2OPQA 1Z26A 3G0ZA 3QBYA 4CGIA 1S6PA 2BIVA 3V1RA 1QSLA 4UC4A 3MEEA 3ZT3A 3IS9A 1RNHA 3V9XA 3TAPA 5K14A 4B9NA 1EX4A 1NJWA 3AA2A 4FK4A 2B8AA 3K59A 1D9DA 3Q1JA 4E89A 3WNGA 3BDPA 4F2SA 2HHXA 3L2RA 2KZZA 5KE3A 3HL8A 4N4IA 1D5AA 1TV6A 3OYBA 2HVIA 4M45A 3RWUA 1OYXA 2YNHA 4OKKA 1WJQA 4CGHA 4BE1A 1CLQA 1IH7A 2PYJA 3VQEA 2IDOA 4CK2A 3OYHA 1IKWA 1RT4A 4M3TA 4KTZA 3L2VA 4AHUA 2EFIA 4FLTA 3ZSVA 4ZHRA 3DOLA 5D6WA 3QEWA 3F70A 3KLIA 1HYVA 3QESA 4W5NA 1WSEA 3DLKA 4HCBA 1YTUA 4ICLA 2X6SA 1S1WA 4RW7A 1DLOA 1JLAA 5KE2A 3L3UA 1L5UA 3DRPA 2P5OA 3K5OA 1TL3A 1D8YA 1D9FA 3OYFA 1JLCA 1JLBA 1XC9A 1TVRA 3LANA 2RN2A 4GY5A 4KV8A 3ZT1A 4CEQA 1TAQA 4RW4A 4BDYA 3RR7A 1I3AA 4N41A 3P1GA 4HCZA 4DTXA 1RDCA 3O4QA 2JTFA 3CYMA 1GOAA 4O4GA 1FK9A 1Q9XA 4O0JA 4Y1DA 3OYIA 1U48A 3KIOA 3AA5X 3NTHA 1J54A 4FM1A 4CGFA 4G1QA 4CF1A 5DMRA 3TR8A 5IN1A 4N4GA 3NE6A 1WNSA 2BE2A 1RBVA 4HVJA 3OYAA 4OPKA 3K57A 3K5LA 1TK0A 4HCCA 5J2QA 1LV5A 4KHYA 2IS3A 4DSEA 1DTQA 3LX7A 1RDDA 3NAEA 3L3VA 3ZSXA 4FJJA 1X1PA 2FBVA 4QOZB 4AILC 4DLGA 4F3OA 3F73A 2MWOA 4W5QA 2QKKA 4YFUA 2ZQBA 4CK1A 5JS2A 2L3RA 2EQUA 3PMIA 2MWPA 1RTDA 3PNWC 3OYJA 1RTHA 1ZYQA 1HQUA 4O44A 3S3MA 3E9FA 3ZSRA 3HSTB 3OYDA 2F8SA 1NK4A 3RMBA 4BACA 3VQ9A 3MP1A 3NF6A 3KLFA 4DFMA 3OS2A 2QQRA 2WONA 3CM5A 3PY8A 1A5VA 3V1QA 2IG0A 1S1VA 2BUDA 3HP6A 1ITGA 1LW2A 3ZSQA 1NKCA 3M9QA 1ZBHA 4KI6A 4FXDA 4F2RA 4FLZA 3PX0A 4C5HA 1NK7A 4NYNA 3DLHA 3RRGA 4BE2A 4X34A 2P0KA 1U4BA 5C25A 3SV4A 1JXBA 5M9OA 2AJQA 1RT5A 1JXEA 2HHVA 5C42A 3EZ5A 3FLGA 1BI4B 2XY7A 3ZSWA 4DSLA 4FLWA 5FRNA 2O4GA 1KRPA 4A4EA 4DSJA 4Z4FA 1ASVA 1KFSA 1SL1A 5J26A 3KLHA 4FJLA 3SV3A 4QW2A 3MP6A 2X6NA 4FLYA 3MO8A 4N76A 3D45A 3VA0A 2X35A 1RTJA 3OJSA 4DTSA 4H8KA 1T8EA 1S5JA 3LYIA 2LRQA 4CGJA 3O8VA 4FZXC 3C6TA 3NH1A 3TAGA 1XHZA 2XY8A 2RHYA 2EHGA 2R58A 4M3YA 3NF7A 4CEAA 4O0IA 4H4MA 3ZT0A 1WSGA 4OKJA 1JLGA 4CEOA 5KRTA 4E7LA 3QNOA 1SKWA 3TAQA 5C6SA 4CJTA 3RRHA 1L3UA 3G10A 5HROA 1TK8A 1C1CA 4I2PA 3C94A 1BIZA 1HQEA 1SV5A 1VSJA 3CM6A 2Q3SA 3V9WA 3TAMA 4IFYA 1T7PA 3RMDA 4GMJB 1K6YA 1SL2A 3WNHA 1CXQA 1WSFA 4LSNA 5FROA 1EKEA 3V4IA 3KD1E 4E3SA 3KK3A 3E9GA 4F8RA 1Q9YA 4CJQA 3OYEA 4KRFA 4DQPA 2KQ2A 4QAGA 1NOZA 4C8OA 2HHTA 2BKDN 3KKRA 2XRIA 3NH0A 3L2WA 5C0MA 4C8KA 1TGOA 4DF8A 4Z02A 4K8XA 1TKXA 3NGYA 2P5GA 1T03A 4DTNA 4Z4EA 3V6DA 3I0RA 1UA1A 3HT3A 1WJRA 4DQIA 1ZBLA 2YNIA 2G8HA 2OZSA 2BGGA 1J5OA 4FJ7A 3MEWA 3LGLA 2RPIA 4OGCA 4DFPA 3ZCMA 3JYTA 1WGSA 3SJJA 3QLHA 2IOCA 3AVIA 3VQCA 4B9LA 3DLBA 3O3HA 4E0DA 1S1UA 2GF7A 1VSHA 4DLEA 3ULDA 3AO1A 1NOYA 4C5EA 2YV0X 3OQ5A 3QEVA 2ITGA 4FK0A 1JLFA 4H4OA 5FRMA 3L2UA 3MEDA 1H3ZA 4IURA 2P1JA 5CZ2A 5CIUA 1TK5A 2YHAA 2ETJA 3U3YA 3VQQA 4ID5A 1S6QA 4FJKA 1A5WA 3ZSYA 4E7IA 4C8NA 4CECA 1WLJA 3K58A 4LH4A 3FDRA 3AO4A 3HPGA 3H6ZA 3AVGA 4KHQA 3OYGA 2GUIA 3SQ2A 4HUEA 1OZ2A 4B8CA 4FJ8A 2X4WA 3WNFA 1ZBUA 1BISA 2EKOA 4NS5A 1IKVA 3DB4A 2G8IA 4CJSA 1JKHA 3KK1A 3AVKA 4PY5A 3DI6A 2DFFA 3OS0A 4NCBA 3HO1A 1L3SA 1N6QA 3LH0A 4CRIA 3HVTA 3EAEA 3ZT4A 4CF8A 2IGIA 4GVMA 1QTMA 1QS4A 4J2BA 3LP3A 4CF9A 4IUUA 4E7JA 3T19A 1BQNA 1VSKA 1IG9A 2M1HA 1VSFA 3KTQA 3OYCA 4W5TA 4PWDA 2RKIA 4A4HA 3L42A 5KCHA 4DQQA 4EDUA 3AA4A 4MQ3A 3H08A 3T1AA 2XDPA 4KHNA 3ZSOA 4CJUA 4AHSA 3VA3A 4JS5A 3TABA 1ZBIA 2HHSA 3QIIA 1B92A 1XWLA 4PQUA 2E6MA 2KTQA 4FM0A 3CQ8A 3SPZA 3M8QA 4RG2A 1EP4A 3M8SA 3KK2A 2Z1JA 2RO0A 4XIUA 4RW8A 2X4XA 4CERA 4CFDA 4FJNA 3MP8A 2HHWA 1EETA 4FL6A 1GOCA 5KTQA 2F8TA 2RJFA 4DQSA 1L3TA 3HK2A 4DF4A 1N27A 3LPUA 1C0UA 3RMAA 3OA6A 3S9HA 3TI0A 1VSDA 4LH5A 5HLFA 3KJVA 3LAMA 3VQ5A 3PO5A 4KHWA 2P51A 1NJXA 1MU2A 1X9WA 1WSJA 5EU7A 4N47A 5SZTA 2D5RA 3VQ7A 1RT6A 1LWFA 4BDPA 1XHXA 2ATQA 4CEEA 2QK9A 2R5AA 2D0AA 5D3GA 3AVHA 1B9DA 2DTUA 4FZZA 4NCAA 2GFUA 2OA8A 1HYSA 2FC0A 4QQDA 1QQCA 2RHXA 3DLEA 2R7YA 2VWKA 3LZIA 2HQXA 3O3FA 5DK5A 2JLEA 2OZMA 3NFAA 1NK6A 3NTIA 2YKMA 1TKZA 2LDMA 3OYKA 1YVUA 2HNYA 3K2PA 4E1MA 3LALA 4WE1A 4PL6A 3OMGA 1RT7A 1SUQA 4B08A 1WAFA 4FJ5A 2VG6A 1NK0A 3TWHA 4HTUA 3PFSA 4M42A 3AVNA 3DMJA 3RMCA 4B8AB 1CZBA 4Q0BA 2PQWA 2JZ2A 3QNNA 2R5MA 1VSIA 2GFAA 4AHCA 3KKSA 3THVA 3H8ZA 1UA0A 4DWIA 4KO0A 3LWMA 5I3UA 1LW0A 2KW4A 1JLQA 4L59A 1LWCA 1F21A 1KLMA 1KVCA 4O55A 4CEFA 3LWLA 1W0HA 1VSLA 5HRPA 3MXJA 4OLAA 4N4HA 3MEGA 4QCLA 2XHBA 4FM2A 4BE0A 4IDKA 3PX4A 1G5VA 3SQ0A 3MAQA 1TKDA 1IKYA 1HRHA 4PLIA 2F96A 4FLXA 3QEIA 3V81A 4C5GA 4KREA 4LD0A 3ALYA 1BHLA 3OY9A 3LGFA 2HQEA 4CHYA 2HHUA 3MXIA 1VSEA 4DU3A 1C0TA 1TAUA 3S6WA 1RBUA 2DY4A 5KGWA 1YT3A 3P8HA 2BDPA 4DSIA 4FJIA 3HVRA 3PX6A 2PY5A 2RI2A 1LAWA 3WNEA 3CFOA 2ZE2A 3SUPA 1GOBA 3V9ZA 4PUOA 2O4IA 2BANA 3F9KA 4FLVA 3B6OA 2O4XA 4A4GA 1Z25A 1WAJA 5KGXA 2EQJA 5E41A 5KI6A 3SUNA 3OMCA 1KHCA 4PA1A 3SQ1A 4FYDA 4CJ5A 4LY7A 4DTMA 1KVBA 3HP9A 3NHGA 1RT3A 2HNZA 3VN5A 3L2QA 2RI5A 3A2FA 2I5JA 3CFRA 4Q5WA 4FK2A 4CESA 2DAQA 2FBXA 2RHZA 4KB1A 1J9AA 4KKOA 4B9UA 1R0AA 3C6UA 4I9QA 4CIGA 4CHQA 5KH6A 2L89A 3MEVA 4W5OA 5J2NA 3U6FA 2D0BA 1B9FA 4ZTFA 4DQRA 4HHTA 4RG8A 4FW2A 4FLUA 4OKEA 3IG1A 4GW6A 1RBRA 3LP0A 1BIUA 1UAXA 4DSFA 3IAYA 3QIPA 3DLMA 3V9SA 3VQAA 3SUOA 4M3RA 1TL1A 4DG1A 4IG3A 3AO2A 2JGUA 2EQKA 4E7HA 4ELUA 4PLLA 3DLGA 4CJLA 4J2DA 4NYFA 2VYTA 3KLEA 4R5PA 2QXFA 4MFBA 1OZ3A 2PZSA 4NCGA 3P5JA 4KHUA 4DMNA 2HVHA 2B4JA 1JLEA 3MEAA 1WSHA 3UT1A 4FJMA 3QKJA 2K3XA 1C1AA 4FCYA 1REVA 1KSPA 2M16A 1NJYA 3P8DA 1BCMA 1HPZA 3V9UA 1BGXT 1VK0A 1XI1A 3DB3A 4BDZA 2E5QA 2VWJA 1NK8A 2G8UA 4C5IA 3OB9A 2IC3A 2G8KA 3HXMA 1NJZA 4YNQA 1RILA 3SZ2A 3CG7A 2WACA 4DTOA 3CEYA 3DYAA 4II1A 3O4NA 2Z1IA 4FW1A 1MHNA 1X9SA 4FJ9A 3OS1A 3OVNA 2G8WA 3U3GA 4A4FA 4B9WA 3QO9A 1U49A 3GOXA 1NKBA 5D6YA 4EP5A 4Y1CA 3ISNC 1OI1A 2OYQA 1X9MA 5CY4A 4CGDA 3META 3AVJA 3EYZA 2DIGA 2RJCA 3D0PA 5IAYA 4IUTA 1IKXA 2M0OA 3ITHA 5HRRA 3OJUA 4Z4HA 3OYLA 1I39A 1DTTA 5T7BA 4KPYA 5I42A 1UWBA 1UOCA 4E1NA 3MECA 4EZ9A 3B6PA 1SSFA 1G15A 4IKFA 2Y1IA 2Y1JA 2YNFA 2RHIA 3MXMA 2G8FA 1RBSA 5JS1A 3IRXA 3K5MA 3I0SA 2RJDA 2YNGA 1IO2A 2DFEA 3HPHA 2NUBA 4BWJA 4IBNA 1S1TA 1A5XA 2RHUA 1CZ9A 3LP2A 4N5SA 3FC3A 4CEBA 1ASUA 4DS5A 4C8LA 4CFBA 4DTUA 3AA3A 1U47A 3SQ4A 2K3YA 4CGGA 4Q5VA 2XY6A 1LAVA 1C0MA 1Q8IA 4DU4A 2G8VA 2E4LA 3NNQA 1J53A 2F5KA 4IG0A 4OJRA 2X74A 3BGRA 1BQMA 1FKOA 2FBYA 4CJFA 3TAEA 2Z1GA 3ASKA 4KAZA 5D6XA 1BL3A 4CHPA 2EX3A 4DTRA 3ME9A 2D9TA 4CEZA 3AV9A 2D0CA 1S9GA 5HRSA 1S1XA 4M3ZA 3NTKA 3JSMA 4I9LA 2GBZA 2FHDA 4AHTA 1RTIA 3UIQA 2QQSA 3EY1A 4M3UA 3DRSA 2X78A 1T05A 5HP1A 4E19A 4EZ6A 4B9XA 3QINA 2RJEA 4CHNA 4OVLA 4CJ3A 4M41A 4DS4A 1RDAA 4JRPA 2VG7A 2OPPA 2Z1HA 4Z4IA 2RF2A 3OYNA 1WSIA 1KCFA 4CJRA 5J1EA 3KUFA 5CYMA 1HNVA 3AO3A 3DRRA 3E01A 4L8RB 1QHTA 4CFCA 2OPSA 4KI4A 2L8DA 3TANA 4KFBA 2KFNA 3HM9A 4Z0UA 3NCIA 3V1OA 2KFZA 3OYMA 3DLRA 3M8RA 4KHSA 1VRUA 1QE1A 3LPTA 3HJFA 1O1WA 3T3FA 1S9EA 5J39A 5C24A 3S3OA 1JL2A 4O5BA 5J2MA 4JS4A 1SKRA 1FKPA 3NGIA 3SNNA 5SWMA 2XK0A 5CZ1A 4Z4CA 1NKEA 4E7KA 1C1BA 3M8PA 1U45A 2WOMA 4B9TA 3QJ6A 2LVMA 2G3RA 3VQ6A 3FEOA 4FJGA 4W5RA 4N56A 2O4XB 3K5NA 4B9VA 3PMTA 2XO7A 4CE9A 3SI6A 4ELVA 3NF8A 2OPRA 1YTAA 4DSKA 2A1SA 4J2AA 1SL0A 1RCHA 3PUFA 2DFHA 3LDSA 2LCCA 3NBPA 1NK5A 4IFVA 1NK9A 3SD4A 1QSSA 4FZYA 2B5JA 2LSNA 4QVZA 1HYZA 2HHQA 4DTPA 2YHBA 4CHOA 4HUFA 3SUQA 1RT1A 1U04A 4FJXA 1WJSA 4Z4GA 4EP4A 3LLRA 3PV8A 4J2EA 4CK3A 1KFDA 1TKTA 4CF0A 3O3GA 3LZJA 4QQ6A 2E6NA 2HMIA 1CXUA 1ZBFA 3P83D 4HUGA 3SCXA 4FJHA 3TAFA 1KTQA 1RDBA 5KCOA 4FU6A 2A1RA 2YKNA 3L8BA 5HBMA 2CKKA 1HNIA 4DFKA 3AVBA 1QSYA 4CJEA 2ZD1A 3HYFA 3SPYA 1HMVA 3DOKA 4ID1A 3AVAA 5FDLA 1BI4A 2EQMA 1KVAA 1SKSA 3RTVA 3I8DA 3QERA 2LTOA 3PO4A 4CIEA 4BWMA 2DIQA 3VQBA 4CJ4A 4BD3A 4IUQA 1VRTA 3RR8A 3AVFA 3HPOA 3C4SA 4OPJA 4CHZA 2KZMA 3VQ8A 3AO5A 4TSXA 4UQGA 3SYZA 4FVMA 4I2QA 4JRQA 3CFPA 1VSMA 4LSLA 4CJWA 1XNIA 4DU1A 3C95A 4IUVA 4RW9A 4F3TA 3KLGA 1JL1A 5CYQA 1RBTA 4M3XA 2R57A 4JLHA 4ZTJA 1N5YA 2VG5A 4I7FA 4M3WA 3VQDA 2E6LA 1LWEA 2RI3A 4B9MA 4F4KA 4QQGA 2YRVA 1WN7A 4CJVA 3QEXA 4AHRA 4CEDA 4DTJA 3LAKA 4CF2A 2GV9A 3NGZA 4KTQA 2HW3A 1KLNA 4AHVA 1EXQA 1FXXA 4NZGA 4OVAA 4AH9A
chains in the Genus database with same CATH superfamily
3H0FA 4KTWA 4DFJA 1HJRA 4M77D 2OAWA 5AQQA 3BG9A 3I8BA 1J5YA 2FBTA 4LDXA 3VQ4A 2JPBA 3MCZA 4RAFA 3KD5E 3E5XA 3DEUA 3DM2A 2NVQJ 1BCOA 2LP5A 2P84A 4KB0A 5J3LA 3NH2A 1VQKN 3ASMA 4CCHA 2DBKA 1Q86U 1WFWA 4ENJA 3EYIA 2HDDA 5AFUH 2MAMA 4EGYA 2IAJA 2NLUA 4CFAA 3S3NA 2LC4A 1NBWA 3SMPA 4B9SA 1U06A 1WHUA 5KRSA 1BIBA 1N5ZA 5GAMd 3AVLA 1FN7A 2QVOA 1AZGB 1YXQA 4FWQA 3G6EQ 4PFZA 1QVGA 4I7HA 1A31A 1BI3A 4A59A 1E4GT 3K4BA 4OP0A 1YS7A 4CJPA 3I54A 3T1HK 5ADXH 4BL0B 3KFVA 4ELTA 3SBGA 4K8ZA 2Y9YA 2KGTA 3WVDB 4BI8B 3PGGA 2YX7A 1Z9ZA 3AVMA 1ZUKA 4P96A 2DJIA 2QKBA 4B3OA 1F1BB 5IT3A 1QCNA 1C0WA 1LPLA 1XCVA 3G0ZA 1JT6A 1IBMK 1K8AR 1S6PA 1Y6IA 2KJBA 2DFIA 1FLIA 1R00A 4Y33A 3IUCA 2DAOA 1QSLA 2CYYA 1ON2A 3ZT3A 3MEEA 3QSUA 2X6OA 3TAPA 5K14A 1YJWQ 1EX4A 2JSPA 5EVZA 3HOTA 1K83J 2OANA 1ZH5A 1I5LA 2QWRA 2JN6A 2AQEA 1VQMA 5GANj 1PJRA 3FZLA 4X1VA 5TGTA 2HEOA 5AQNA 2ASPA 2X3WD 3QYGB 2LR8A 3JB9F 3KNTA 5GAN2 1KQJA 2QEXA 2V79A 2P9SB 2K9GA 3RWUA 2DJZA 2QGUA 4IOAF 1OYXA 1O7LA 1GXPA 2OC6A 4BREA 4YELA 1DU6A 2MA3A 4BRIA 1YIJQ 1Y71A 4CGHA 4KT5C 1PRLC 4JJCA 4H0XB 4F9OA 1IH7A 3VEZA 5ED4A 1VQ5I 4IZ9A 4YOYA 1JJ6C 5LGNA 3OYHA 2FF4A 1VTNC 4MZMA 4IEJA 4AHUA 3G4SA 2EFIA 3CMEN 4FLTA 1ILYA 3ZSVA 2KXCA 1IREB 2WY8Q 3HZ6A 3CO7C 3ERED 1RI9A 2GELA 4XQ3A 2V7ZA 1UAAA 4IHTA 4WQ4A 1FJGK 4W5NA 2MSYA 1IRXA 4U7DA 5GAHJ 3LSTA 1E2XA 1YTUA 4L3QA 3LAPA 3CCUI 3ID6A 5ADXA 5GAHP 2O03A 3FXJA 2A3LA 4FSXA 3E66A 3HDDA 4I98B 1L5UA 1B6AA 2EPFA 1XC5A 2EV6A 4ETSA 3M54A 1JLCA 1XC9A 3AGRA 3EQLF 3M59A 3ZT1A 2NXNB 4A5NA 4CEQA 2O8BB 1TAQA 2YXYA 3CDIA 3P1GA 3GP8A 3KX2A 3ZCOA 3BEXA 1RDCA 2XKOC 4OB0B 4HBLA 3S1NJ 3MEXA 3ZN0A 2JTFA 4NO7A 1GOAA 4O4GA 1VQ7Q 5JVHL 2D8HA 1BBZA 1ZG1A 2JJ9A 4HVWA 4KGZB 4EM0B 3KIOA 1YHQT 2TRTA 4XH5A 4JKDA 2FNPA 1HOMA 5C15A 5BR9A 2LH9A 5E3OA 2CT3A 1RFQA 3CC2T 3H3UA 4K2EA 4LJZF 1WHKA 2FYKA 1KQSA 1WNSA 4JJNK 2GNCA 2EA2A 3DTKA 3SZPA 2MABA 3QBXA 3DAWA 2VIXA 1ZSZB 2JW4A 3CC4Q 2X85A 1X27A 4KHYA 2V1UA 2OTJQ 5DV5A 3ZN1A 1SVLA 3NAEA 3L3VA 1VQ8N 4F04B 1JGGA 4QS9A 2DW4A 4R56A 3EUHA 3F73A 4E6RA 3KHYA 2DU9A 2IVMA 2XKPA 2QKKA 3H0HA 4WYBA 4BEHB 4WWCA 4RTYA 2IGOA 3HTUA 1RTDA 3F0ZA 1RTHA 2OJ2A 3R0JA 1XNQK 3M7GA 5CQGA 4O44A 3S3MA 1R5HA 3ZSRA 4LIVA 2EILH 2EBPA 3CXCP 1DGKN 2F8SA 1JE8A 1ZSGA 3MP1A 3JCMV 2V1XA 3J7AO 4GXOA 3QOEA 2KHOA 2KBTA 3M4GA 3M5RA 3PY8A 3J81O 2ZXIA 5DM7F 5GMKj 4EEFG 5TJJA 1S1VA 1E3MA 2AO9A 4BUGA 3HRSA 5GAMe 3PQJA 1XB4A 3F6VA 1N3CA 2A6AA 1NKCA 1ZBHA 3CF5L 4B1RA 1IB8A 4FXDA 2GIZA 1ZSZA 3BR1A 4FLZA 2QQBA 4C5HA 1S29A 3KP7A 2K6DA 1GCQC 1TT0A 3RRGA 3BG6A 1EIFA 2P0KA 4AFQC 5C25A 2GIVA 5M9OA 3HRMA 1JXEA 5C42A 3FLGA 1BI4B 2JWLA 5GAMg 2O4GA 2HKXA 2D0NA 3IWFA 2H3EB 3J7AF 1KRPA 2F7TA 3RI4A 4FWPA 3KLHA 1MMDA 1TUDA 4N76A 3D45A 2HBKA 3VA0A 3M8JA 2XHKA 5E84A 3MX2A 1B3QA 2A37A 3L2CA 3JB9I 4DTSA 3THYA 2MLKA 4P9UA 1T8EA 1S5JA 2FVUA 2KI7A 4E2FB 5CCAA 1JJ2M 3O6WA 5LJ3h 3LSPA 1FMVA 4M78F 2EVRA 4WFNL 4A6DA 2RHYA 2EHGA 3VUBA 3PNVA 4YOWA 3NF7A 4FQGA 4HAMA 4CEAA 4HX8A 4JKCA 4O0IA 4WCIA 1WSGA 5BOXA 2YU9J 1SFEA 3QNOA 1NGJA 2DCEA 1S72I 1JEGA 3I55Q 5C6SA 4PHTX 4CJTA 3OL4A 5L3FA 4Q4ZF 3EZWA 4JBAA 5ICFA 1GLEG 1XC3A 1W5SA 4N4NB 1BJAA 5AQRA 4Q47A 4I2PA 1LE8A 4E47A 1P7IA 1VSJA 4NL3A 3V9WA 1OYIA 3UATA 4IFYA 3RMDA 4CUGA 2L2OA 5LJ5j 2M4GA 2DJNA 4AVPA 3J81E 4A57A 1CXQA 2P6TA 5FROA 3V4IA 3H5RA 1MUZA 3INZA 4RMOA 1BL0A 4E3SA 1JQQA 1ETQA 2O8DB 4KRFA 1K73O 3J80Z 1W36C 1PG5B 2KQ2A 2YPRA 5GADJ 4DR4K 4XLAA 1Q7YR 4WXDA 3NH0A 3ZEUA 2Z1DA 4MTDA 2WC9A 1TGOA 1S7AA 2P5VA 3ER0A 2XROA 4HLYA 3WTYC 2BHYA 5BREA 3V6DA 2OZ6A 5AYFA 5FO5A 2D1XA 2AHJB 1WJRA 4CCOA 1YF5L 4H5NA 4DQIA 2OX7A 1ZBLA 4TVRA 4HF0A 3CO6C 2QM3A 2NUPB 4YIIA 1H1VA 2ME6A 3FXUA 4IZZA 4OGCA 1VQNA 2ZJ2A 3LM2A 1EWQA 2CH5A 3EGUA 3RYRA 1I1SA 3B73A 5LBQA 2GEMA 3Q9VA 1R22A 1VNDA 3KYLA 3ZCMA 1M1KR 1UB4A 4JAXA 3KVGA 4CI6A 5DLQE 5C44J 4B9LA 1FT9A 1ZX6A 3DLBA 2GWJA 3M0PA 3HJEA 3K9TA 1KZHA 2H3GX 1VQLN 3CCQI 5IT9K 3G6EA 2K4YA 1NOYA 4OAZA 4MMLA 5FW9A 4CCNA 1YQKA 3BJOA 3N0UA 2HEQA 4Y28E 2KZGA 1NK3P 2PJRA 2M0MA 2DXUA 3EFSA 2RKHA 4H4OA 1MUYA 1H3ZA 5LLQA 2H8WA 1M4ZA 5BRFA 3CMYA 2FO0A 1TBXA 2L5QA 1TK5A 3BG5A 2YHAA 2OUMA 2ETJA 4E9HA 4XU0A 3I3LA 1S5LC 2R7ZJ 1NEBA 5AQOA 2JK3A 1S6QA 2XMFA 2W03A 4FJKA 1A5WA 4IOXA 3ZSYA 3QBWA 3CERA 3RSEB 1X69A 4RLQA 4NC8A 1OYYA 1STZA 3W6KB 4C8NA 4CECA 1ONVA 3FDRA 4ZYEA 4DKWA 3RZDJ 3K0LA 4FE7A 4OIRF 2W48A 1Z77A 3MN5A 4C1NI 1SEUA 3DKXA 4KHQA 4ENKA 2Y90A 2D0PA 4LUDA 3LDLA 1HNZK 4FJ8A 1ZREA 1ZBUA 4YORA 4BHCA 1OJLA 2G8IA 1U8RA 4EM1A 4R0KA 1ATRA 1X2QA 3E2UA 1ABQA 1GBQA 1T0FC 5HS7A 1L3SA 3FMSA 4OAYA 5GAOq 2BH1A 1H3HA 4CZZA 1K9MC 1U2WA 3HVTA 3EAEA 1PKSA 4BJ5C 1HU0A 1VQ4N 3LP3A 5GAOl 1MNEA 3COAC 2E41A 2BEOA 4GLKA 3T19A 4UVBA 1Z0XA 1BQNA 3BR3A 5FPDA 2M1HA 5AQVA 5JVGL 2RKIA 1K6OA 4H0VB 3HRGA 4AF1A 3M1EA 1ZG3A 3QXEB 2Y4YA 2VBZA 1GLAG 1UHMA 4M77B 4B3AA 2FXAA 1FYMA 5LGUA 1QQMA 3RSEA 1GLDG 3WTUC 4B1YB 5DM7L 4FE4A 4RTWA 4JS5A 3ZETB 4QPQA 1ZBIA 4JRKA 3QIIA 2HHSA 3OBYA 1B92A 1BOTO 1T39A 4PQUA 1TYQB 4NUBA 1VQ5Q 5EG2A 2ZAEA 3JB9J 4MDXA 1NNEA 3QWLA 3FFKB 2HQRA 3M8QA 1EP4A 5FLVA 2A3ZA 2J6KA 4C8QF 2HOSA 2F4IA 2RO0A 1YHQI 2M87A 1QZEA 4BC5A 4XIUA 4M7AF 3IKMA 4CERA 1UCRA 4F92B 3CD6T 4CFDA 3MP8A 2QWNA 2OU2A 2ELHA 5CE3A 1I07A 1MH4A 2KP6A 1GOCA 2F8TA 2JHNA 3DKYA 4JPBW 3WTTC 1L3TA 3HK2A 4DBHA 2HNHA 4BQQA 1YITI 2FMYA 2M51A 3ASOH 2KMUA 3VYSB 3WU2C 1SFXA 2IW5A 1ARKA 1GL5A 1E6HA 5M1FA 5AQHA 1VQKI 1VAZA 3HPWA 1BI2A 1P6RA 3S93A 5A2QZ 1BU1A 4BHPA 2LJ3A 1G2BA 3GLXA 3G71Q 2DQRA 4MHGA 2D5RA 2E71A 1OKJA 1HCRA 3VQ7A 2O7OA 2LYCA 3FZMA 5TKYA 4BDPA 1XHXA 2ZJRF 4AQYK 4CEEA 3LSHA 2R5AA 1V3FA 9ATCB 3PNYA 1TYQA 4M6YA 2STTA 1NGHA 5C2DA 3AVHA 1QVTA 4BQOA 1B9DA 3LSJA 4OPHA 2JHJA 4LG3A 1PCXA 2MK5A 2P9KB 2FC0A 4RA2A 2KRNA 2H09A 1HNWK 4C8QE 2CP2A 4ELYC 4FL9A 4M7AE 4RTUA 5HDNA 2HQXA 1FW6A 5DK5A 3NFAA 4JI8K 4OINF 1D0YA 3OYKA 4XLEA 2HNYA 3ZXSA 1KFZA 4M3BA 5KPZA 4M77G 1N8RU 2XPWA 2F4MB 4IQ4A 4E7SA 4M75F 4D0PA 3EG0A 3RTRA 5CKBA 1QVFS 3GE1A 1AWOA 4E1JA 4G9YA 4HTUA 3RMCA 1CZBA 2GQIA 2RQUA 1QCOA 2RD1A 1I5OB 1QVGM 2R5MA 1K61A 3S15J 2ZCFB 4DOWA 4AHCA 2VJJA 1YI2A 3GW2A 2DZCA 3EH1A 5EX5A 2DRKA 1NKUA 1RAAB 2C0OA 2OPTA 3VYGA 3CMEI 1I81A 1KVCA 5DTDA 2W85A 3TW6A 4ZYAA 3HL2A 4O55A 4CEFA 3DXJF 3OOPA 4KGXB 1E4FT 1W0HA 3CC7T 4KBMB 3ECHA 1VZ0A 3HG9A 4CICA 1TG0A 1IDZA 4IDKA 2O3FA 4GV6A 4J7IA 1G5VA 1A6QA 1BU6O 3DKMA 3L6QA 1PU6A 1W0TA 4YEJA 1IKYA 1ORPA 2XHCA 5AT1B 4XR6A 2F96A 4CZIA 1YG2A 3TP3A 4C5GA 2H1LA 4M75E 4KREA 1ETWA 3C7NB 5KK1A 3EE9A 3ALYA 1NGBA 2O6GE 3I55A 2QA4Q 2P4WA 3AG3H 1IN4A 4LMYA 3QQAA 3LGFA 2HHUA 2VT2A 1GVDA 1E6GA 2DY4A 2KRSA 2DT5A 3DBLB 3T8TA 3P8HA 4HCKA 3TU4K 5FFXA 4FOEA 2D1VA 1K8AO 1Z7UA 3MKWB 3LWIA 3R4KA 1VQON 2FOKA 3SUPA 2E1MC 2EJFA 4BRNA 3OV8A 3VF4A 3WXKA 4CZCA 3FXRA 4CBUA 3A5ZB 3M3YJ 4NB5A 1NJIR 4RTZA 4JI0K 2OTLQ 2EQJA 4ZDOA 5E41A 3F5TA 5IYCJ 3LA7A 4D7NA 1BG3A 2RQWA 3VWBA 4FETA 4H5WA 4U67L 2K9QA 4LY7A 3HP9A 3NHGA 1R58A 1VQ8I 1MV3A 2ZBKA 2FSWA 3C3WA 1KC8R 4B1XB 3OSFA 2IPOB 1M90C 4LG0B 1Z1DA 3TO7A 2VUMJ 5GANf 2KQRA 1MNDA 2VQEK 2ZPEB 3CFRA 3M6GA 1IRFA 2FBXA 4NOYA 3P39A 5GTHC 2V9PA 2LC2A 2Y2ZA 5M3MJ 1CSKA 1XMKA 3UKUB 3DTIA 1LDJA 1Q86C 3U4LA 4KBOA 1M3BA 3O8GA 3MQ0A 2EW3A 2PX9A 1VFCA 1T6CA 4RGRA 4YDUA 4BVPA 2VC1A 1KQSM 5BR8K 3VV0A 3G1JA 5LJ3j 3QIPA 4DR7K 1LWYA 3V9SA 3CCST 5F64A 2STWA 2KNBB 4M3RA 1N77A 3EEQA 4EW4A 2IVNA 1G8XA 4Y0WA 2EQKA 4JK9A 3R8EA 2XUBA 2LG4A 4IOCF 4R5PA 2IIRA 2O8CA 4MFBA 2R7WA 4AFZC 1OZ3A 3A0IX 3CCEN 1X2MA 1WEFA 1PRMC 4NCGA 4PJOC 3L9FA 4IO9L 2A68F 4KHUA 2QAZA 4CC3A 2XF7A 2Q8KA 2E3IA 1EWRA 1AWJA 1JLEA 3H45C 3EFRA 3CJBA 1G3YA 3K4NA 5AQZA 3QWXX 1XN7A 4OIOF 4HYEA 1GXIE 3FK6A 4FJMA 2K2VA 1TW3A 1REVA 2AZSA 3K4KA 3WXJA 3EG1A 2VQHA 2CH4A 4CVNE 1BCMA 2EA4A 1LEAA 4PKIA 5ECAA 1WNLA 5BMZA 5L8RE 1ABOA 3RSNA 3A4CA 5E3LA 4IEEA 4G6QA 4C5IA 2RQPA 2G8KA 3UA7A 1UJ8A 1K8KB 1QZ5A 3DXMB 2UV1A 2VBWA 1ZBSA 3ID8A 3CEYA 2TDXA 2DMTA 1WQWA 3MWMA 1MHNA 1X9SA 3K1NA 2DL7A 4FJ9A 3F21A 2E7XA 4C0FA 2G8WA 2J5PA 3CWTA 4LB5A 1U49A 1PVSA 2CP5A 1KQ0A 2COMA 1DPRA 4YOXA 2EB7A 2BXZA 3ISNC 4HV5A 3M56A 1X9MA 3TCJA 2Y0SN 4V19K 1GLBG 3KBGA 2F5CA 1V76A 2DL8A 4UVCA 2DIGA 4CCKA 1YUWA 3D0PA 4JJBA 4IUTA 1IKXA 3UA6A 2IRFG 2DA3A 4CYCB 4Z4HA 3WE3A 3M53A 4E6KG 1DTTA 1J5EK 3FMQA 4R79A 4KPYA 5FU7B 2O9VA 2E65A 5FFZA 5I42A 1RLPC 1D1CA 1VQ5A 1ZG5A 4AT1B 2K4JA 3DU5A 2BVLA 1R8OB 2HBJA 5ICEA 9ANTA 2DVJA 4ESRA 1K8KA 5CKHA 3CBPA 2D45A 1U6ZA 3GZ6A 2Y1IA 1B07A 2EFOA 2RHIA 5JS1A 4FWOA 1U5TB 2FD5A 2PNIA 1YBYA 3DWLE 2D4WA 3ZOBA 1ZXOA 4L5GA 2QWWA 4ZGDB 3NAUA 5GIPA 3C0CA 3OWTA 2EZHA 2UWMA 3CCUA 3OIOA 3M5AA 3H46O 4X9CA 5K5OA 4H03B 2BTFA 2QUFA 3AG2H 3ECOA 4C8LA 4CFBA 3D7SB 2GM4A 1MJAA 3CUQC 2CG4A 3K2ZA 1Q8IA 4GBQA 2E4LA 1J53A 1QVFA 2PU9B 2F5KA 4IG0A 2MW8A 1YO5C 3JREA 2Q31A 1YHQQ 2R7DA 2FBYA 4B3TK 3TAEA 3ASKA 2FA5A 3EO3A 1VQLI 5IT9O 3S32A 1NG2A 3CC2Q 1BL3A 2YUQA 2CV0A 1RR8C 4CHPA 3J80E 1VQPN 3ME9A 3AV9A 1S9GA 2CUEA 1X1CA 3S8PA 4QIWN 4OB3B 2M1BA 3CPWS 3TTDA 3NTKA 4F7UF 2NVYJ 1J6ZA 3MMVA 1S6LA 1ZARA 5F04A 1RTIA 3GBTA 2E88A 4NNJA 3EY1A 4KHPK 1I4K1 5IYDJ 1RRJA 1ATNA 4JKHA 5HP1A 1YJ9N 1OX8A 3JCMQ 5DDGA 3JB9H 4JN4A 3QG1A 1KG6A 1JUMA 3VEVA 3PJRA 2SRCA 4ILHA 2ME0A 1IJWC 2PTKA 1QZ6A 2QKLB 1RDAA 2FPFA 4WXCA 1PD1A 2OPPA 3U8XA 4Z4IA 5LJ5f 2XF5A 3QP6A 1KCFA 2OA4A 5JLHA 4CJRA 1G6NA 3F6OA 1Q7YO 1QZZA 2XDVA 2JVHA 3JCUC 3E01A 4Z8AA 5GPAA 1KU9A 4CFCA 4FISA 5C4XJ 3TANA 4KFBA 1SAXA 2DDBA 4Z0UA 3V1OA 2KFZA 4L5JA 4BRGA 2VVKA 1VRUA 2XVCA 2RGVA 1O1WA 2MG4A 1B59A 5EZGA 2VKDA 5EG0A 5J39A 3PIOF 4G7ZF 3LL3A 2WAEA 3L1PA 1IZ6A 5CR2A 1N75A 4C2UA 1M1KO 1NMDA 3F10A 5CZ1A 1NKEA 3A8GB 4XLPF 3IH4A 2K3PA 1D4XA 3GZ5A 2ESWA 4KH5A 1IV0A 2G3RA 5CLSA 4C92D 5EYRA 2PAVA 1HW5A 2EK5A 2ETHA 2PG4A 4O5FA 4Y91A 1QZYA 1RKTA 1NMNA 4V2GA 5EGOA 4EMHA 3PMTA 3RJPA 3JCMc 2F5EA 4HRIA 5M1OA 2OAUA 4BRKA 3CMEQ 1RCHA 4Q48A 4H0YB 2DF6A 2E2JJ 2QQ9A 1IRZA 1T44A 2ATCB 2WV0A 3JAMZ 2UZKA 1I5ZA 4CZJA 2M2EA 4DOVA 2PVDB 2FEZA 1QSSA 2E7WA 4DUYK 2AA4A 2LSNA 2CGKA 1OEBA 1J0RA 3GL1A 4HQEA 4DTPA 4ZH4F 1RAFB 2WAQA 4CHOA 4HUFA 5BS6A 5BPNA 2BZ8A 3DQVC 3OL3A 1RT1A 1SFOJ 3A8MB 1S72A 4EP4A 3J80K 3PV8A 4EHUA 3BR6A 1TWHJ 1FIPA 1H89C 1TKTA 4CF0A 3EG9B 1FY7A 3U9ZA 3LZJA 3GBGA 1AT1B 4M7DC 1H9TA 2HMIA 2UXCK 3IDHA 4ISEA 1R6RA 1YVNA 3TU5A 1EA3A 2YUNA 3TAFA 3KXTA 3AL0B 1RDBA 1WIEA 1WYXA 3SEZA 2PVOB 4PJJA 4UV8A 5E26A 2QENA 1WJEA 4E9FA 2YKNA 1GUUA 4ESJA 3BTLA 2D5VA 4UY8O 4RB3C 2CGLA 3LMMA 3MMYB 4CSWA 2ZD1A 2F5VA 3BY7A 1Y0MA 4LK1F 1Y0NA 4ID1A 4JNEA 2EQMA 1N9RA 1SKSA 2LX7A 1UZCA 1B9MA 2DPPB 4DV6K 2LTOA 1ZGWA 3M1CA 1BWFO 4BR7A 1DUXC 5GAOm 3VQBA 3V8LA 1VRTA 1FYLA 4IUQA 3AVFA 3HPOA 3I56T 1B1BA 4CHZA 4DV3K 3VJPA 1ZGJA 3AO5A 4TSXA 1NYGA 3OGDA 2X1DA 5M1QA 5GAN5 4FVMA 5A2QE 4JRQA 5DS9A 3HTSB 2IA2A 3REOA 2YDLA 1VSMA 1JUSA 1YIJN 4QS7A 1PKTA 2KZVA 2KRFA 1X9JA 2ZFUA 2AKLA 1N34K 2XSDC 3KP6A 4IO8A 4IUVA 4HX7A 4RW9A 4F3TA 3KLGA 3EGDB 4HTLA 5CYQA 3FE1A 1R1VA 1I50J 2M4KA 1POGA 4JZ4A 1NLOC 5BRDA 3K4LA 5LEKA 2RI3A 2JG6A 1IN6A 2ZPGB 3CCQA 2KYBA 3MHXA 4F4KA 3ZX3A 1SRLA 5FKKA 3FJ5A 4ME7A 5D4RA 4QQGA 1D1AA 4FIBA 2E6ZA 3B8AX 3QEXA 2YT6A 1B34B 4AHRA 1WJDA 2HZDA 2FRYA 1IF1A 2RQQA 3NGZA 2XGCA 1T56A 4AHVA 1M2VB 3ZQIA 4M78B 3ZPLA 5IHKA 3E6MA 4GVEA 2VXZA 4BRDA 4HLXA 2R7SA 2HNDA 3TARA 4OFAA 3GF2A 3UWNA 2DETA 8ATCB 3ZEHA 4XAXB 1X2KA 3LP1A 2XY5A 1UB9A 1UJYA 5D8KB 1W7PD 2KY9A 4PJ0C 1JGSA 4M4ZA 1BJZA 1VQ7N 1A5JA 3ERMA 1RI0A 3MVPA 2FBKA 3IUOA 1VQOI 5F08A 1N3AA 2JRTA 4HSRA 4AVZA 3MEUA 3FDYA 3D5LA 2ASOA 2VJ5A 4CW7B 4F17A 2W42A 3VS5A 3CC4N 2UUBK 3KEQA 3NEUA 3I35A 3KWIA 4C8MA 4CIFA 2OTJN 1ZAOA 3NDKA 3NF9A 2R7TA 3CMAN 3QIOA 4XN3A 4WQ4C 3CCJN 1G59A 2HVSA 1DGRM 4BY9C 4EV0A 5CAIA 3CPWA 3D4VA 1M2VA 3V1RA 3REBB 1KU7A 1X6BA 4EATA 4RTTA 1K1ZA 2X9DA 4L5EA 3IS9A 1OV3A 5I9EB 3REAB 1NJWA 2HQAA 3UR3C 3QMLA 3K59A 1T3VA 4FWRA 4DHYA 2K85A 4QWQA 2HHXA 3L2RA 1VQ9T 2I0NA 5H1SQ 2KZZA 4M3FA 2QGGA 5DY9A 1D5AA 1DT9A 3EGXA 4AI5A 4FWMA 4M45A 2HZTA 4DQ8A 2YNHA 4DIQA 2EZIA 3CD6Q 1AHJB 4B9QA 1WJQA 3QPSA 5A2QK 5LMUK 2NS7A 4QS8A 5BPMA 1OVYA 4XICA 3A98A 3VPZA 4M7XA 3SFMA 4P1WA 4B3SK 4M78G 5E1XA 3RQ4A 1RT4A 4D5CA 5EEHA 5LL6Z 1TNTA 2A28A 1YITA 1T3LA 4KH0B 2NOBA 1WOQA 2HD0A 1P92A 3EUHC 1X3NA 1D0XA 5D6WA 2EWSA 2FSNA 2P0WA 1V4RA 4N9HA 3TSUA 2KR3A 3CCEI 3CCMT 2NRTA 5K7FA 1G83A 1N8RC 1VQKA 4HCBA 2VWFA 1BDGA 1DLOA 5JHUA 3L3UA 2P5OA 2KDOA 1NJIO 1D8YA 2W4SA 1ZELA 1JLBA 1IGNA 3LANA 2RN2A 2ABLA 2LP0A 4GY5A 2KVQG 2J05A 1YCSB 2QQAA 3RR7A 4N41A 1FX7A 1KG7A 2X1EA 4Q5SF 4U0WA 2LKPA 4DTXA 1QVPA 3TBIA 3GOIA 2CV1A 4HF2A 2DODA 1KC8O 4O0JA 4UY8I 1WWXA 3OYIA 1SHGA 1OU9A 1JHFA 5C4JJ 3HTVA 2PJPA 1S3XA 4A62A 4WQ5A 1ZSZC 2CDTA 4CF1A 2ZWHA 5DMRA 2LKSA 3TR8A 4JI3K 4N4GA 3CCRT 4PNOA 1EBMA 1V54H 2CP6A 2E5KA 3W3CA 1RBVA 1ETKA 3SWNA 3OYAA 3O9TA 2VLAA 1JKQC 3K57A 2KROA 1MWMA 2RB6A 3ULRB 2YRDA 1RDDA 4U7BA 4FJJA 3HSRA 1USSA 3PVLA 3VS2A 2FU4A 4DLGA 3K4CA 3RUXA 4W5QA 3DP7A 4YFUA 1V5GA 4IL6C 4X9DA 1R1TA 1X1AA 5J47A 4CK1A 4DR2K 5HLIA 2LJ0A 2EQUA 3HB9A 4IHVA 1R0BG 3I5SA 3PNWC 3OYJA 4LFUA 5C3EJ 4HA8A 1ZYQA 1HQUA 2Z5UA 1ZUYA 2J6OA 1QGPA 1ULYA 1WZOA 1XMAA 1IBKK 1NK4A 1SFUA 5LJ3f 2W24A 4BACA 3RMBA 3NF6A 1K79A 4WXHA 3KE2A 4JEPA 3OS2A 1BA0A 2UXDK 2QQRA 3CC7Q 1WA7A 4IX7A 2GXGA 3FXOA 3CM5A 4D5FA 1A5VA 3CMEA 1ON1A 1JBMA 2KE9A 2V8IA 2V1DA 2X6YA 1R0CB 3LW5E 4X1EA 3HP6A 3THXB 4DBFA 4RDUA 2K5LA 4DZJA 1Q81R 2DA5A 1D5YA 3HOVJ 2ZJQF 5FLXO 4F2RA 2FB7A 2DA6A 4CDGA 1NK7A 3QJYA 1ZHFA 4LDWA 1Z21A 1UHFA 3FZVA 2FQ4A 1C0GA 4CZMA 3RKQA 2VC8A 4B24A 4KRTA 1JXBA 1PNJA 4J5YA 5FLMJ 2L3SA 4YFXF 2QK0A 3X25B 2EGCA 3QAHA 3IHUA 3ZSWA 1KD1R 5A0DA 1MGTA 2A5XA 5DEQA 2LDUA 5ICGA 1TTHB 5J26A 5GAGP 1W36D 1FJLA 1B7TA 2E2QA 2JA2A 5BPDA 3CCLT 5JVTA 3MO8A 1VQPI 2AZVA 2Y30A 4B47A 1TSFA 4RTVA 2LY1A 4KULA 3OJSA 1FOKA 2FEIA 3LYIA 2LRQA 1YJNT 3K1PA 3O8VA 4FZXC 3NH1A 4HOBA 1WJ5A 3NFCA 2YWWA 1WXTA 4C8QA 3M0SA 3CCVT 2FZCB 4M7AA 1M1GA 1EH8A 3BJ6A 1LMZA 4GV9A 1YJ9I 2R58A 1VQ8A 4U0YA 3LH5A 3TGNA 2HCKA 1IGUA 2WAFA 3ZT0A 3FMRA 4OKJA 1JLGA 1BI0A 3O6BB 1Z7LA 3DPUA 3VTIA 1QVFM 1MMGA 1IHVA 3HM8A 5CVJA 1L3UA 3EE8A 2A40A 4G6DA 3L00A 2IP2A 4C92B 1C1CA 3G1OA 1N36K 2DLLA 4CCJA 1BIZA 1XG7A 4HG2A 5AZJA 3ZGKA 5F6FA 3U9DA 4PGGA 3TAMA 1MBJA 1T7PA 4LF8K 2KDSA 4N9IA 5B66C 4MMKA 5CHZA 2JWTA 2XAFA 2QWMA 4A5BA 3M55A 1JUPA 3E9GA 4LD5A 2GOMA 2MIOA 5KNLA 2EYQA 1U8BA 5FLXE 3ZR8X 1IUYA 4BC2A 2HSPA 1LJOA 2R7OA 3X20B 1YS6A 2HDCA 2XRIA 1XS9A 4C8KA 4U87A 3HKZN 1JTXA 4CC4B 1Q82R 4BG9A 2KKOA 1AKHA 4EJYA 1V5EA 5GANe 1T03A 4O6JA 3I9V2 4G9ZA 5AQKA 4EMGA 3OTOK 5H6QA 3HT3A 5CVIA 5HVQC 2PEXA 2DO7A 4RMNA 2QEXN 1G99A 1TU0B 2YNIA 1WI3A 3RMSA 4DR1K 1I1JA 2OZSA 2BGGA 3MEWA 3LGLA 5IHNA 4J83A 1M27C 2E1ZA 4BYYA 4M75A 2E12A 2UXNA 3W2WA 4M77F 1HKGA 4DFPA 1WGSA 3HUGB 5E8GA 5J3BA 3QLHA 1IN8A 1XQSC 3WEEA 1AWXA 5GANg 1RRSA 3HC7A 2ASMA 3K9JA 4RGXA 1NGDA 1X3MA 1S1UA 5AZIA 3P9CA 4VUBA 3ULDA 1ENHA 2BW3B 4HPQA 3JSOA 4EA4A 3PL8A 4YOUA 3GXOA 2NYXA 3SYTA 2GXAA 1XTDA 4RB1A 5FRMA 2PMZN 4ZN3A 3L2UA 3MEDA 3N5NX 3BF3A 2IA1A 4IURA 5LJ5d 2P1JA 2HR3A 1U0JA 3G71N 1CF7B 4Z6YA 1MDMB 1X19A 3HGYA 1VQ9A 4C92G 1NE8A 2P6SA 2CGHA 4ZC3A 2LK2A 4E7IA 1VQOQ 2M0CA 3AO4A 2MLGA 5IPAA 3CLQA 2FX0A 4QSHA 3PIPF 3BW1A 1U2VB 2DPUA 2YHTA 3AVGA 5DD8A 4M77E 4CC7A 3HUGA 3IP4B 2GUIA 2BY3A 2W0ZA 3HOWJ 4HUEA 2XRNA 5GJWB 3WNFA 1JU5C 2OFIA 3I64A 4BJ6C 1BISA 4M9SA 2QXLA 3DB4A 2L01A 2BW3A 1P4WA 2LZ6B 2E1YA 3RCOA 3OS0A 2CRGA 5H6RA 1ZA2B 3MZYA 2CP7A 1VYVA 2M0YA 2LF7A 3W6JB 3SAHA 5FPNA 2O01E 4KNYA 4UUVA 4H0OA 3CJ9A 4BRAA 2F2WA 3N5BB 2ROLA 2GWRA 1WPKA 3G1MA 4AWXB 5I2MA 5F0XA 1CF7A 3UNGC 2TCTA 3DXKB 2ESNA 4AM3A 1VSKA 1VSFA 3KTQA 3OYCA 2RF0A 4PWDA 5HDGA 4HEA2 1YIJI 5KCHA 3RR6A 3VYHB 3I0TA 2QI2A 3VOEA 1QWEA 3H5NA 1M3QA 3EG2A 4MQ3A 3CWAA 3H08A 1W7PB 3CWUA 4PIIA 1XQPA 4YOQA 4CJUA 3VA3A 1N39A 2HPIA 1RAEB 4FOIA 4IXCA 3H3NO 5GMKe 3EHQA 3IWZA 4M63C 5JR3A 2X0LA 3PFIA 1VQLA 2Q97A 2NOGA 4LLLA 3UF4A 4KFCA 3CQ8A 4M72A 4RG2A 3M8SA 2ELJA 3JCMb 3HHTB 2X4JA 1JT0A 3M58A 1YWOA 1LQ1A 1R9TJ 1HLVA 2JXBA 4RW8A 2X4XA 1LB2A 3Q0UA 1X4PA 1WEGA 3R0AA 3TPQA 2YJEA 2A3SA 2RK2A 5KTQA 3VW4A 3V42A 2IS2A 4DQSA 4DF4A 3KYCB 3VEPA 1VQMT 3VUZA 1N27A 1W7AA 1C6VX 4J6WA 2QA4N 3RMAA 2YLBA 3S9HA 3WTZA 3LFKA 3J81Z 4HV6A 4LH5A 5HLFA 4JD2A 5L3CA 2LX9A 4RCHA 3VQ5A 3LQRA 1QQNA 1Q18A 2DXBA 4KHWA 1X6GA 1VQ7I 3GBQA 3G7ZA 1MU2A 1X9WA 1WSJA 1PWTA 2OQRA 3F0CA 3VFZA 4N47A 1VQ6A 4ITVA 1K73U 5CKTA 2MCNA 1GBRA 3PUBA 5SZTA 2EFQA 4R1HA 2R7QA 2Q1ZB 1LWFA 2LFBA 2GBYA 3BT9A 5CQXA 2GA1A 1PU8A 5HK3A 2D0AA 2OTLN 2NNYA 4BGAA 3G4ST 3OH9A 4YOTA 2FUG2 1K7AA 3CC4I 4NCAA 4NC7A 3W2AA 3VS6A 1YLFA 4JUVA 1MUNA 2OTJI 2RHXA 2E19A 1P90A 2Y9ZA 1ZTRA 2F48A 4CZGA 3CMAI 2LMJA 1NYFA 4X62K 2GX9A 2VWKA 1D8KA 3CCJI 1VQ4A 2ZMEA 1P7MA 3NTIA 1WDXA 2YKMA 2LDMA 3A0BC 3EG3A 4M7DF 4PL6A 2G7HA 2JM8A 3OMGA 1RT7A 3ZMVA 3H0GJ 2JA8J 1SUQA 2NVXJ 1B8IA 3JAMK 5TKWA 1N78A 3DWLA 3CP2A 4FJ5A 3HKSA 3FF5A 2VG6A 5LJ5e 2XG8D 1IO6A 1NK0A 1MSEC 4AI4A 2Z3YA 1T95A 2CJJA 1Z9QA 3PFSA 2CS3A 3VSKA 4B8AB 4LITA 4DZPA 3JCMW 1NGCA 2LJ1A 1ORNA 2JZ2A 3JSCA 2COZA 3F9MA 3V7RA 2CH0A 1WEIA 1PUFA 3GG4A 3H8ZA 3J7YJ 4EPCA 1UA0A 2J7IA 3UB5A 3O9QA 4FSSA 4KO0A 3J7YP 5B3SH 3Q0VA 3E9LA 3MX5A 2KW4A 1FSEA 3LA2A 3MCPA 1GLFO 1XMOK 2Q2EA 5CYVA 1BBYA 2O9SA 4G6TB 5LJ5g 2ISYA 3CPWM 3L2ZA 1MMSA 2EKHA 1B4AA 2HOAA 2BE5F 1FMKA 3C7JA 2KSSA 1B72B 2LY2A 4CCLA 1VSLA 4JLGA 1MZBA 4QCLA 2FF6A 2XHBA 4FM2A 4Y3OA 4BE0A 4AM7A 4J9IA 1TUGB 2ZPHB 4F7UB 2DYSH 2HBPA 1JO8A 1JHHA 3MAQA 1HRHA 3VB2A 3ZRGA 4KH4A 1NLVA 3VGLA 2QDYB 5KYWA 1KAZA 4PKHA 3U1DA 1BHLA 3OY9A 2L0KA 3Q0WA 2DMPA 2HQEA 2Y75A 3G2BA 4YDUC 5K5QA 3EUKL 4AYBN 5IP7J 2VE9A 4DU3A 3MD2A 1C0TA 1TAUA 1NGIA 2UUZA 2HMPA 2CFOA 1GVJA 2RI2A 2QYZA 2JZYA 3WNEA 3L7WA 4FWSA 3HZJA 2ZE2A 2OCEA 3CHWA 3DEWA 1GOBA 2ECCA 4CBWA 1RL2A 4C23A 2KEAA 5HK0A 2BANA 2YX4A 3F9KA 3I56Q 2OCCH 2HMAA 2O4XA 4A4GA 2NS0A 3CJCA 1WPYA 3JCMh 5J4VA 3G3ZA 4I2OA 3EETA 5KI6A 4PJOD 2BXYA 2PUKB 2EIMH 4PA1A 3C2GA 5L3BA 3SQ1A 3TQ7P 2DILA 1RT3A 3PIPL 4F7UA 4XRMA 2HNZA 3L2QA 3ZQLA 2RI5A 4EMSA 4M71A 2I5JA 1HD3A 4GCVA 1Z91A 1OULA 4E70A 2P9NB 4OB1B 2BY1A 2RHZA 1SS6A 2H6BA 5DUIA 3BTJA 1PHTA 1R0AA 4EMKA 4EVVA 4BRQA 2CSOA 3VS1A 5KH6A 3PO3J 3NARA 3F23A 2R93J 1LUJB 4D9JA 5J2NA 2FRHA 1B9FA 5CPRB 4ZGEB 2RDPA 4RG8A 4HHTA 1D09B 1WFXA 3BCBA 3TDUC 3WTWC 3N05A 3G25A 4FLUA 3IG1A 3PM1A 3VF2A 3TOAA 5KHDA 1R36A 4GW6A 3LP0A 3FLCO 2XGDA 3AKZA 3DLMA 2HXIA 5IXFA 1W0UA 2HSTA 4XRSG 1TL1A 5IWAK 2BYVE 4DG1A 4PL7A 3K4JA 3SZTA 4A3JJ 4E7HA 4ELUA 4QPOA 4XH1A 4W97A 3OBWA 4C3JJ 1NTCA 5CO7A 4U0VA 3SFIA 4HXJA 5FB2A 2QXFA 3Q5FA 4RGSA 2M8EA 4MDWA 3PIOA 5GINA 1HUXA 2PZSA 3P5JA 3SLCA 5K7ZA 5C12A 5KYUA 1LKXA 5F1JA 1BW5A 1YHQN 3RESA 4EVIA 2HVHA 3CC2N 4R55A 1K78A 1VQOA 3UT1A 2GTOA 1QMCA 2E5NA 3A5LC 1Y56A 3OYYA 4C0GA 1KSPA 2X1CA 2ENMA 3WXLA 1OH5A 1QQIA 2XDDA 5D6FA 1GLCG 1XI1A 1KU3A 4J9BA 2K7LA 3BTIA 4BDZA 4IWVA 2G8UA 2W00A 3WUHA 3HXMA 3ZQFA 1PC0A 3R2XC 3GMEA 1JCFA 3SZ2A 2WACA 1RESA 3P9IA 2G6FX 4JYKA 4FW1A 4LGWA 2E34A 1VQNT 2Q0UA 3CZ6A 3U3GA 2NRRA 1ZKGA 3ZFJA 1FOXA 1GDTA 1YN8A 3ZYYX 3ELKA 4PZJA 1NKBA 5E1WA 5D6YA 2YJFA 2DTRA 1FYKA 4F93B 5LJ3d 3WT0A 4EP5A 4Y1CA 3X24B 1OI1A 4M74A 1WLPB 3I59B 2OYQA 3GDQA 5M1KA 2VASA 2HZYA 3QICA 3EYZA 3W0LA 5FU7C 3G6ET 5JLXA 5IAYA 2DBMA 4PK4A 1Q81O 2RQTA 4ASNA 1YYVA 3FHGA 1P4XA 1Y07A 4PSWA 4Y7NJ 2FPDA 1J2XA 2GQQA 1SANA 2EJGA 1F4KA 4RLFA 1YX5A 1OCRH 3I71A 3JR9A 1WXBA 1Y1VJ 4BUPA 1UOCA 3B6PA 4EZ9A 1FBSA 3CCMQ 4AFUC 3TOBA 4OMMA 1E3HA 2DK5A 1SMTA 1KD1O 4DYQA 1BR2A 4D8KA 3IRXA 4J9CA 2F2VA 2V1QA 4KDPA 3I0SA 4KUMA 1EZZB 5GAN7 1XGSA 3CCEA 4XOTA 2YNGA 3IKVA 2CH6A 2DFEA 3HPHA 4J6XA 3S14J 2QEXI 1I8FA 3L0QA 2X9HA 4HWIA 2NUBA 4BWJA 4E4HA 4IBNA 2DA7A 1S1TA 1EFNA 1K8AU 2RHUA 5KAIC 3FIFA 2IPQX 2GTDA 4DV7K 4BR4A 2JTVA 4A3LJ 1UFMA 4O3MA 2EFPA 4BY1J 1Q95G 1ASUA 4CEBA 3LL7A 3WQTA 3AA3A 5HL7L 4CGGA 2O2OA 2VKVA 2ZPFB 2XY6A 1C0MA 4L5IA 2G8VA 3FIWA 3TQNA 2D0QB 5E18F 2DE0X 3THWB 1BKBA 5TRDA 1GLLO 4OMQA 3DLLF 1X3ZB 3IRRA 1BQMA 1T6SA 3H92A 4L9TA 4OPAA 4B1UB 4B8XA 3E3VA 4ON0A 2VYPA 3DEEA 1T3SA 3BP8A 3IRQA 3CCRQ 2P9PB 3JRIA 3O9RA 3QDKA 4CEZA 5I21A 2VC0A 4FX4A 2F2XA 1D1BA 4LXCA 4YFKF 5FD6A 3QYEA 2IS1A 4XL9A 2N8GA 3M07A 1KAXA 2P7CB 1Y96B 1LNXA 2E3HA 4IJAA 2P9SA 4I9LA 3G71I 2GBZA 4AHTA 3GTQJ 1Z67A 3NWTA 3UIQA 2QQSA 2AP1A 3EFOB 1MBHA 2X78A 1T38A 1Y1WJ 1HDPA 4NLCA 1T98A 2Y0SA 4OX9K 4BXUA 3CQYA 2D2WA 4CHNA 4BC4A 1Z9CA 4YFNF 4QVDA 4CJ3A 1H8AC 4XN0A 2A42A 2VT3A 2VG7A 5E1ZB 2DD4A 4OMLA 2OV7A 1UG0A 2FBIA 2DDAA 2E8AA 3THWA 1NLPC 1VI0A 3CTAA 2KRMA 2ZJPL 1Q82O 4J8OA 2HDWA 4K0KK 3DU6A 4B1WB 4A3EJ 3CMAQ 1KG5A 2L8DA 2KFNA 3CCJQ 2HBMA 3HM9A 4DK9A 2H8RA 2RH2A 3LWHA 4XLCA 4QVCA 4WFAL 1QP3A 4YY3K 3M8RA 1QHGA 1QE1A 3LPTA 3MPUB 3BZ6A 3T3FA 1SZ2A 5C24A 1K0SA 2O8BA 4HF1A 4JI6K 2HYFA 2JA7J 5J2MA 1TL8A 1SKRA 3SNNA 1J9IA 5SWMA 2XK0A 4E7KA 4M7DD 2JMWA 3LQQA 2Z99A 3PNTA 3CWSA 1U45A 5CVVA 4BS9A 1DDNA 1XTAA 1W97L 3CBMA 1P8ZA 1TQIA 2HWVA 4W5RA 3CCLQ 1T0JA 2GXBA 5LGTA 2G7UA 1OPKA 3VODA 4B9VA 5LJ3e 2XO7A 1ZLMA 4CZEA 2OBPA 1VQPA 1YJNQ 2WADA 1RDWX 4DSKA 3I33A 4NBQA 2EYZA 1KG3A 5HCKA 1GFCA 5M1NA 3RPUA 3PE0A 2RE2A 3VPRA 4ZZDA 4NLBA 1X58A 4BEHA 4JQFA 1OFCX 3CCVQ 2KJCA 3NBPA 1X3WB 3AAQA 4IFVA 2P5LC 1IV8A 4ELZC 1J3TA 2NOLA 2QA4I 3N4PA 4QVZA 4IEIA 4XRFA 1YJ9A 1HYZA 2HHQA 2YHBA 1FOWA 3BPVA 4RM2A 3WU0A 3SUQA 5LJ3g 2ID3A 2XAGA 1O57A 2J5OA 1CGPA 4JI5K 4FJXA 3FXKA 3AAFA 3LLRA 4EGZA 2A36A 4RTFD 1HYOA 4KIGA 4XTXA 3OIPA 2Z33A 2CQKA 1YI2T 1KFDA 3C2BA 2R5YB 4FWKA 3O3GA 2E6NA 2FRWA 4V2FA 1NH3A 1CXUA 2IEKA 2JSCA 4BROA 2OTLI 4LF9K 4HUGA 5DLOA 4PGHA 1TZLA 1U1SA 3F8NA 5K7HA 2DEUA 1KTQA 4H5VA 5KCOA 3EHRA 4FU6A 5DCFA 4B3MK 2A1RA 4A3MJ 4IIOA 4B23A 2ZKZA 2CUZA 2X4HA 5GJVB 2WC2A 3AVBA 3VEOA 2I5UA 3I4PA 3H1QA 1BI4A 4UVAA 4A5MA 4CJ7A 1KVAA 4CXFA 2EGEA 4E9EA 5GMKi 2A41A 3QERA 3ZMZA 5IOZA 1OCOH 1ORKA 3NRVA 3DPLC 3JTHA 3O8HA 4JHDB 2DIQA 1REPC 3WXIA 4BD3A 4ATOA 2EBIA 3I55T 3BPXA 3C4SA 2D8JA 1OISA 5BN9A 2DOFA 4AC0A 2DA4A 4UQGA 4LF7K 2AXLA 5AQLA 3R61A 1ACMB 1AHDP 3CFPA 4IRIA 5B1AH 3CD6N 2R5YA 1GCPA 2QG9B 4M78E 5GADP 5AQIA 2P9LB 4I6MB 1UHSA 3D2FB 1CKAA 1I6XA 3C12A 2YUOA 2O5RA 1HKQA 4BR5A 3GF5A 3DKWA 5F27A 2VG5A 2X3XD 4IOAL 4I7FA 1G2HA 1NGEA 3VQDA 2E6LA 1GT0C 4B9MA 5K1YA 5EDNA 3H9QA 1IW7F 4MFEA 1NZ9A 4MDAA 2YRVA 4N0AA 4FT4A 4M78C 3K9KA 4A0XA 4TV7A 1IC8A 3RNJA 1QVFP 5D6EA 3V8JA 3MDQA 2OI3A 3CPEA 3LAKA 2WTEA 2IJLA 2GV9A 4BAYA 3FXQA 4CD1A 5HS9A 4PJOB 1KLNA 1EXQA 3EYYA 3WGIA 1Q7YU 4NZGA 1Y0UA 2HB5A 5GAOn 1N33K 2O8DA 1QHAA 3DLLL 4IHXA 3RDVA 1FZPB 2OFKA 1AZEA 5KYXB 3ZT2A 1I3QJ 1T33A 2A0FB 3C65A 2X6XA 3S2WA 4OGEA 4GKKK 5CQEA 2GGRA 1WCMJ 3R1XA 2DI3A 4UB6C 4D8DA 2HAXA 1W9HA 2H6CA 2CW0F 4LF6K 1JJ8C 1UGSB 3GTJJ 4BR9A 4D7MA 1C6VA 4IJNA 4OMPA 4OLBA 3VQPA 1QO0D 1M1KU 2PYLA 1L3VA 2NUPA 3QEPA 2A5YB 2KYMA 1YJWA 3AVCA 3ZSZA 1XX5A 2L54A 2P9UB 2RAEA 1RR7A 3BDLA 5J2PA 1KU2A 4KN4X 4AIDA 4LD6A 1Y97A 4OFHA 1TWCJ 5IT9Z 4CGIA 4FM4B 3F8MA 1ZK8A 4RAZA 3FJPA 4DBQA 3MKDA 2F5TX 2MH9A 4KT0E 3MKZA 3O5ZA 1RNHA 3V9XA 3CP8A 4DEXA 1YIJA 4C1NK 4YRVA 4C2TA 2XAQA 3CJ7A 1XSVA 3AA2A 1AA7A 2B8AA 4M7YA 1Z6RA 4CC2A 3J8AA 5D5VB 5B5EC 4A3BJ 3WNGA 1HDDC 2DN0A 2ZGWA 4A3DJ 4BRPA 3SEQA 3CC7N 3K2AA 1FC3A 3KEYA 2Y4XA 3J81K 1TV6A 3KYDB 3HTRA 3OYBA 2RA2A 2EINH 4WQ5C 2DERA 1K9MR 4OKKA 5EY4A 3A01B 4BBRJ 3D5RC 4BE1A 2ZSHB 1PDNC 3R60A 3SWNC 2L7MP 4A69C 4GYIA 4FWNA 1NK2P 1VQMQ 5IH2A 3ATVA 2IDOA 4CK2A 5LL6S 3BROA 1M1FA 1V1CA 2PI0A 2P9UA 1VOMA 4LDUA 4PJOG 4IHWA 4M3TA 4B09A 4YHHK 3L2VA 4H0PA 4KMFA 2QEXQ 3U23A 4ZHRA 4A3GJ 4JX5A 5EXWA 3ENHA 3MFKA 3Q7BA 3F70A 5FJ8J 2NRWA 2DMNA 5FGMA 1SSHA 3IFRA 3CJAA 1HYVA 4JRIA 2LMDA 5KQDA 3C1DA 2ESHA 1SVMA 1VQ7A 2CO5A 3CC2I 2XF6A 4M3EA 4ICLA 2R5ZB 1S1WA 5LHIA 5KE2A 3DRPA 2OD5A 2MOXA 3CDHA 3G4SQ 1VQ5T 1D9FA 3FZKA 3OYFA 2XAUA 1TVRA 2QSHX 2HSEB 1GLNA 3HEFA 1CKBA 4RW4A 3A8LB 2VXDA 5GAEJ 3CC4A 2E2NA 2GA2A 1SQKA 2VN2A 3UE5A 4M77A 1TOVA 1FK9A 3F8FA 4C3HJ 2OTJA 3KWGA 3ABUA 3MN9A 4K41A 1U9NA 3H1CA 3CETA 3G0QA 1HNXK 2VONA 1G3SA 3NTHA 4RB0A 1J54A 1BOAA 3CCJA 3AG4H 4G1QA 4JI4K 3CCUT 5IN1A 2DYIA 2PBIA 5GMKm 1Z05A 3ZETA 2BE7D 2BE2A 2HTSA 1K4SA 2YHXA 3LM9A 3KP2A 1IXRC 1RNLA 1TK0A 3K5LA 5EF6A 2BTTA 2FLOA 5J2QA 1LV5A 1M8MA 4MO4A 4DSEA 2EQRA 1OOTA 1DTQA 4S05A 3I0XA 3ZQHA 3ZSXA 1X1PA 1PUEE 4LLGF 1WXUA 3ZLJA 2ZQBA 4J9DA 3NVMA 3CCSN 2M34A 5LRSA 4FPAA 3ULEB 4BGDA 3LSKA 2MI6A 5JS2A 2BHZA 2JS2A 2MWPA 1VRLA 2DMQA 4PKGA 3A1YA 3E9FA 2XPVA 1S7OA 2X51A 3HSTB 5B1BH 3OYDA 1WB9A 3A1PA 4C92F 4BRLA 3BWGA 3H0DA 3VQ9A 1FP1D 1P4AA 3K4MA 2L7KA 2UXXA 3PIPA 1U3EM 4ILGB 4C8QC 2IAIA 1TUYA 2KIQA 2WONA 4UB8C 2HQ5A 5ERIA 4M7AC 3FBNB 3V1QA 2IG0A 3OH6A 1O7FA 2OZUA 2BUDA 2C0IA 1V4TA 1LW2A 3WQUA 4KI6A 4MZPA 1H92A 5LJVA 2I5WA 3PLAA 4B6MA 4JZ3A 4GDFA 3LSGA 3PX0A 2EIJH 4NYNA 3DLHA 5GTIC 2P9KA 1O3RA 1S8NA 4M6VA 4MFDA 4BE2A 3JCMX 4XONA 3H6EA 3O2PE 3SAFA 3MZHA 4DGWB 5FWCA 1YI2I 1YTYA 2CP3A 1RT5A 3S1RJ 4BGBA 3ULEA 4XMYA 3E6CC 4C0DC 2VPRA 4MDBA 5FRNA 1WI7A 1ZGAA 4M6XA 3L4QA 2B86A 3SJMA 2CQ7A 4DSJA 4Z4FA 1VA7A 1SL1A 2JJ7A 2E4HA 4GKJK 1NG9A 3GX4X 1HX1A 4AUXA 4FJLA 3MAJA 3SV3A 3MP6A 2AKKA 3WU1B 4IDHA 4C92E 2MH2A 1Y57A 2X35A 5I2SA 1MUDA 1RETA 1SC7A 3I0WA 2Z16A 4BI3A 1RTJA 1X6OA 4B3XA 4H8KA 3ATUA 3E97A 2WTUA 4CGJA 3E5QA 1BIAA 3C6TA 3TAGA 2LBFB 1T6DA 4BXFA 3OR2C 1KQ2A 2JUCA 4XTUA 1OH6A 3ULQB 2XGXA 1RAIB 1WHLA 3M0RA 4M3YA 3OW2S 3VYUB 3J7AP 4BY7J 5C10A 3ZQ7A 2WBMA 3VGKA 2JTMA 1GHCA 5A0GA 4M75C 3HOZJ 4CEOA 5KRTA 5KYNA 4AMCA 2ED1A 2RNJA 4M7DB 1SKWA 4UNFA 3FK7A 3AAPA 4BC3A 3BC8A 3LDQA 2COBA 3RRHA 2L4MA 2W10A 2CZ7B 3OMYA 5AONA 5ICCA 2KK4A 3KK7A 4ZJZA 4ZYDA 5IY5H 5J8FA 2EYWA 1GV5A 3QWYA 3IH3A 3CPWP 1O13A 3VS3A 2Q3SA 1UEBA 2ZGYA 3O9UA 4HVVA 4FASD 5IP9J 4GMJB 1K6YA 4GV3A 1WSFA 4LSNA 2ISZA 5F2RA 2A6TA 2A05A 3KD1E 2LNVA 1KONA 2VUBA 3C7NA 3KK3A 4FHTA 4F8RA 1Q9YA 4JX6A 4CJQA 4L9JA 1XMQK 1Y7XA 3E9PA 1D3BB 1S72T 1M90R 1MV0B 4QAGA 2F4VK 1DP7P 2RREA 4Z89A 2LBFA 5L3GA 4C8OA 1UJ0A 3KKRA 3CF5F 1UELB 3LDOA 2WUSA 2V1NA 5C0MA 1NJIU 4HX4A 5JHFA 3TW7A 1TKXA 4XKVA 3NGYA 2P5GA 4B21A 4NB4A 1H88C 4FT2A 2J6FA 1OR7A 3E1SA 3OHRA 1RLQC 2IS6A 4OFEA 4LDVA 3ZBDA 2ZNZA 4XK4A 4G8XA 2QTVA 1Q86R 1W2BP 5AR0A 4NHJA 5D5UB 1BA5A 1XJWB 1KC8U 1NHAA 3QFPA 5LY3A 5LRRA 2HPMA 1O9SA 4NQWB 3JYTA 3SJJA 3P7NA 2B63J 1UE9A 4KMUX 1TWGJ 3CJTB 3A8HB 3SB2A 3ISPA 4LG0A 1QPIA 2WB1N 2IOCA 5KN8A 4GFBA 3JCMJ 4E0DA 3QODA 1MD0A 2P4RA 3JV3A 1R4NB 3JCMP 1VSHA 3PSFA 1OQKA 3GZNB 5EJCA 3VEYA 3OSVA 1D3BA 4JV5K 1I27A 4K25A 1VQNQ 2H1KA 3OQ5A 5DCMB 1BC8C 1WHMA 3HRUA 2AT1B 3DLAA 3UKUA 4FK0A 1JLFA 5GPCA 3O08A 3FKJA 2RN8A 3O4WA 2H27A 4M7DG 3A5OC 5FPMA 2JPCA 4ISFA 3GFMA 5CZ2A 5J1YA 2HFHA 3HSEA 3TEEA 3U3YA 3DBHB 4KJZA 1BYMA 1WUAA 4BRFA 1LCUA 1EV7A 2P81A 3RBBB 1K8AC 1WLJA 3CCQT 2K4BA 2NVUB 4X64K 2NAZA 5JICA 2V6CA 4NQWA 3SDBA 2NOJB 1FOYA 3KLOA 2Y48A 5CK9A 3VOVA 2ZJRL 3SQ2A 5FD5A 5H2FC 4B8CA 3DBRB 3ENBA 2X4WA 1B9NA 5E20A 4NS5A 1R59O 1JKHA 2KLAA 2QLZA 3AVKA 3QPHA 5EEAA 1JXSA 1TUUA 2ZB9A 4O5VA 4PCQA 4NCBA 2HHHK 2A6HF 1N6QA 3HKZA 2P7VB 3LH0A 3F2KA 5DCMA 1YW8A 3ZT4A 2LQ8A 1IXSB 3GNGA 4PSXA 4CZFA 2QWOA 1QS4A 4CF9A 2ZPBB 2WA0A 4E7JA 2L0AA 3QDRB 1MMNA 2PN6A 2HS5A 3P4IA 1N32K 3I5UA 4W5TA 3CD6I 2W84A 1IZ1A 4A4HA 3L42A 4DQQA 3JRAA 1G3TA 1FEXA 3AA4A 2ZXHA 1Y39A 2K3FA 3DXMA 1P9QC 3MJXA 4FVUA 4CD3A 3VMFB 3CIPA 4LE9A 1XNRK 2XDPA 4EM2A 1JB0E 3ZSOA 3NMZC 4BBSJ 4DB3A 1EF4A 4AHSA 1LEBA 3VRYA 2L9SA 2NNWA 5AFUA 3T5XA 1OYWA 1MBFA 2XAJA 1SVOA 2E6MA 3D2EB 2KTQA 3BR0A 2ZMEC 4FM0A 2O88A 4Z88A 1IXDA 5J40A 1YW9A 3KK2A 3QDFA 2SEMA 3BDDA 2Z1JA 3FB9A 3TSZA 2XASA 4EJTA 3M8FA 1SMYF 4FJNA 1WJCA 2PMZA 1OMIA 4DR3K 1XQHA 3G71A 1HBXG 2NYSA 4CYCA 3U2RA 3TSPA 4XKWA 5L23A 4DEYA 2K9LA 3HFOA 3LPUA 4FPBA 2GLOA 3VERA 3HHHA 4YG2F 1QA6A 3OA6A 3TI0A 8AT1B 3MWPA 4AFSC 2ID6A 2M7BA 2NRZA 1ZR4A 3LAMA 1NGAA 2MC3A 1W5CC 1K4US 2NOIA 2VJ4A 2HI3A 3H3VK 1NJXA 5FLXZ 1WH5A 3TO9A 2EZLA 4XQFA 2DMUA 3K7AJ 4O8UA 4KICA 2HOTA 3RIRA 4A53A 2VPLA 3SK3A 5J8CA 2GBQA 4GYGA 1WHJA 3AHUA 4HT8A 1U5TA 1RI7A 1RT6A 3I56N 1F9NA 2QK9A 3TMOA 1WVRA 4UHTA 4BNCA 2F9WA 2W7NA 5D3GA 3D2EA 3A5MC 1YITT 1AD5A 2DTUA 1U6GA 4FZZA 1NPRA 2OA8A 2MD0A 1HYSA 3JSPA 1QQCA 3ZQGA 4A3IJ 3A02A 2CGPA 4B44A 2R7YA 2DX1A 2JRMA 2V7YA 3LZIA 3O3FA 2OZMA 3JRDA 1VQKT 2JLEA 1NK6A 2RNGA 3R6SA 4OB2B 5LEJA 1YVUA 3K2PA 1BK2A 3I53A 5E3MA 4E1MA 3LALA 1W2BS 1RPWA 1JKOC 2MFZA 1WI9A 4KITB 5GP9A 3D5SC 5JVGF 1R5ID 2HKOA 4D1QA 1UGVA 5L3EA 3OW2A 4AG2C 2ZFWA 3K1MA 3JRHA 1WAFA 1EQYA 1QRYA 3CC7I 3THYB 4QT7A 3SZGA 4BQZA 4LFBK 4X0GA 3AG1H 5CR4A 3IMXA 4NXMK 3TWHA 4F7UE 3NWSA 5FWBA 2LNHB 1S7EA 4M42A 4Y92A 3DMJA 1JCGA 3F3XA 3J7ZO 3SMSA 3QNNA 1WJBA 2VOOA 4KYWA 3RVCA 2GFAA 1UUEA 1SF9A 2LRDA 2YLCA 3OSSC 3KKSA 2LQKA 4L18B 3F72A 2A07F 2IVWA 3JCMf 3C6HA 4EQQA 5LMNK 4CBXA 1L3LA 4BXXJ 1AOYA 5I3UA 1JLQA 1FBUA 5JLWA 1Z3YA 3TSQA 2XICA 4L59A 4ZYHA 2CW7A 1F21A 2IXSA 4H5RA 2KIUA 5D7UA 1VYUA 4ZZLA 5IT9E 2QA4A 2L2PA 3CQTA 4LN2A 3GLLA 3MXJA 4OLAA 2JS0A 4N4HA 3MEGA 3EKUA 2LOOA 2VKHA 4DV0K 1LE8B 1YI2Q 2DBBA 3SQ0A 2E2HJ 1PYVA 1MBKA 1K76A 2Q2RA 1TC3C 4L0ZB 3S2HJ 4D6WA 4EMKC 4MO5A 4DR6K 4PLIA 4IOCL 2FSJA 5GAMh 4XLHA 2DTOA 3MWTA 3V81A 4CHUA 1R77A 5HNFA 3GIBA 1RC9A 4DV2K 1K4TA 3CF2A 4CZLA 1RUNA 2B9SA 2BOLA 3RKWA 1M30A 4LK0F 1HW2A 4CHYA 3MXIA 2OTLA 1JCEA 1VSEA 1LVAA 3CMET 3CW7A 3S6WA 1W4MA 3OS5A 1RBUA 3ZEUB 1HR0K 3LAJA 4FJIA 2PMHA 3HFNA 3CFOA 5AQJA 2YG9A 3V9ZA 1DPUA 4PUOA 4BKXA 2HBWA 4XTWA 1O3QA 3DLLA 4GNIA 2DM1A 3QOPA 2NUTB 5KGXA 1YQLA 1VQ9N 2OJED 2JPSA 4AIKA 2LVSA 1ZHIA 3JRFA 3NMUA 4B43A 4FYDA 3HSFA 2XU8A 1J75A 4HT9A 1K9MO 1QQJA 5IP6A 3Q9SA 1MMAA 3ZQQA 2L9NA 2E35A 3CCSI 4FK2A 1Q7YC 2I7NA 2DAQA 1JKRC 1JI8A 2FNAA 4DV5K 3HYIA 1J9AA 3CJNA 3A5NC 3WTSC 3GTMJ 4RTXA 1RGIA 2HF3A 4I9QA 2VB6A 2JA6J 2V4JC 3EN9A 3UPUA 2PJRB 1SD7A 5L3DA 3RYPA 3QB0A 2KMTA 4G94A 3U6FA 1IN5A 2D0BA 1BO5O 4ZTFA 2KT1A 3CCMN 2VJIA 4OKEA 1PP7U 4J8FA 3I9QA 3P38A 4II3A 1VQ8T 1APLC 5D8LB 3VF6A 2CQXA 1BIUA 5FKNA 3EG9A 1UAXA 1D8JA 3A8OB 2LT4A 2KIFA 3IH7A 3VQAA 1M1KC 2NUTA 3M4YA 4GRIA 4M3DA 3E19A 1NU0A 1NBEB 1RUWA 2K79A 2EYYA 2JOYA 2QWQA 2JGUA 2K5IA 3AY9A 2CMPA 2AS5F 3DLGA 3O9SA 2F4OB 1WBDA 4RS8A 1YWPA 2VQLA 3QZ9B 3ZMTA 4EFHA 2CFXA 2AHQA 5FU6C 2KT0A 3KETA 3BG3A 1FP2A 2JT4A 3GFIA 3FM5A 2RN7A 4AYBA 1FSHA 4BVOA 1KQ9A 5EZHA 2B4JA 4DYCA 3CCRN 3VS0A 3DCFA 1NGFA 2DD5A 5MLCQ 3MEAA 3Q3SA 1ZBXA 2YSQA 1TUCA 3QKJA 2K3XA 1C1AA 3X2QH 4XTVA 3OSGA 2M16A 2FSKA 2W1OA 4ISGA 3P8DA 1HPZA 3V9UA 1BGXT 2MBFA 2ELKA 2O0YA 4A2UA 1VK0A 4MNUA 2G0EA 2CUJA 5F1XA 1NG7A 3GFLA 1KEAA 3F22A 2HL5C 2VWJA 1NK8A 4DJAA 2IC3A 4MQ9F 1M3CA 2NWMA 2CSQA 1RILA 1KG1A 3CG7A 3VEXA 4DTOA 3EGDA 4BU2A 3CXCS 5DM6F 4II1A 3KP4A 5FKOA 2FZGB 3OS1A 2Q36A 2VKNA 1ESVA 2RHKA 3QO9A 3M0QA 1VQ6N 3L09A 3GOXA 3WHBA 2ZXJA 3A0HC 2DXCA 1Q1VA 4JKBA 2LCLA 2IBDA 2BVMA 3QRFF 3SAGA 1P59A 2WSFE 1B34A 4CO8A 1IDYA 4CGDA 3BLYA 4F52A 2RJCA 3J7ZI 2X6WA 2M02A 1ZRDA 4O8KA 4JDSA 4M78A 3ITHA 5HRRA 3OJUA 1OPLA 2ZGZA 1TWAJ 2DPDA 5FKLA 3OYLA 1I39A 1MNMC 5M1PA 1S9HA 2V9VA 2V8KA 4PJMA 2DXTA 2V52B 5CHIA 5HOOA 3I4NJ 1XOVA 2XHIA 3HI0A 1UWBA 1GXQA 5CJ9A 3IH2A 1QHHD 3FHZA 2HOEA 1AVZC 1SSFA 3K70C 4YPRA 1KG2A 3PIOL 4JI2K 5KPRA 5BRHA 2RM4A 1NGNA 2FBHA 3CCLN 3FHNA 1M1EB 1ZRCA 2ITMA 2L4AA 1YHQA 1ERDA 2W6LA 3TVTA 2NOEA 3JB9D 4IO9F 3CC2A 1CZ9A 3LP2A 3T8RA 4BHBA 3FC3A 1W2BA 3OR1C 3LDNA 1YJNN 2JWKA 2V75A 4DS5A 1M3AA 5BNGA 1MDUB 1KQ1A 4DTUA 1U47A 2E36A 3SQ4A 2K3YA 1TLHB 4J9EA 1U3OA 2HVQA 1JRIA 3CCVN 3NNQA 5J1RA 5JLFA 4P9FA 4I76A 4MLEA 4OJRA 2X74A 5AIQA 2DL5A 4IIMA 1FKOA 2EAYA 1UGPB 1NM1A 4G12A 4S04A 5D6XA 3CCUQ 3X26B 3KZYA 4NL2A 1A0NB 3ML6A 3G1LA 4LOCA 2EX3A 4DTRA 3TTFA 2Q0OA 1C0FA 2E1CA 2D0CA 5DYMA 2Y69H 4YPHA 5M5YJ 4C30A 1N8RR 4Z94A 4EJUA 1A36A 3GVAA 1QWFA 2EFWA 2F6CA 3CMMA 4M9XA 4G7OF 1SD4A 2YUPA 5DPKA 1T05A 4E19A 3Q7CA 4EZ6A 4B9XA 3QINA 2RJEA 5GANd 3T1BA 1MPGA 1VQLT 3URGA 3VENA 3LSMA 1U1TA 4M41A