3S3OA

Crystal structure of the prototype foamy virus (pfv) n224h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/inhibitor/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3oA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3oA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3oA03
1NJXA 2VG7A 2DY4A 3NF6A 1U04A 2X6NA 3NF7A 1QSLA 1RDAA 1XNIA 3EZ5A 2P5GA 3DB4A 1TAQA 5FRMA 4DS5A 4FJHA 3HPGA 1TKDA 3RR8A 4J2AA 5CIUA 4KHWA 3LP1A 4FLWA 4C5HA 1W0HA 4CJ5A 3NHGA 2HQXA 4IUTA 2IOCA 4HVJA 4KREA 4M3WA 3LZIA 2R7YA 1J9AA 3L3VA 2VWKA 4CGFA 4BACA 3I0RA 3KKSA 4CEFA 3K59A 4DTXA 3S9HA 4FL6A 3ZSOA 4E89A 4M3XA 3NH0A 4RW4A 3MEAA 5CYQA 2PYJA 3OYBA 3RMDA 1U47A 2KTQA 1TVRA 3H6ZA 4QQ6A 3MO8A 3T19A 4B9WA 3O4NA 4CF0A 4CJPA 4UQGA 3SCXA 4II1A 1RT6A 3QNNA 4GY5A 4FZYA 4BD3A 2GF7A 4HUEA 4B9VA 4RG8A 4CGJA 2XY7A 3RWUA 4AHTA 4DQIA 5KCOA 2EFIA 2RI5A 1SUQA 2Z1HA 3HVTA 3KUFA 4A4GA 5HRRA 3QO9A 3SUNA 1T03A 4DSLA 3OS1A 5SWMA 4BE2A 3NH2A 3O3GA 1Z25A 2G8FA 1RBRA 2M1HA 3H08A 2D0AA 1UA0A 5FROA 1WLJA 4CEEA 1JLBA 2FBVA 5KTQA 1NK7A 3MEGA 1BCMA 5M9OA 3LGLA 1EX4A 4CJFA 5I42A 1SL1A 3AVAA 4FJKA 1RDBA 2HHQA 4DFJA 4KTZA 4CGDA 4RG2A 1I3AA 1RDCA 3L2QA 1S9GA 3VQBA 3QEXA 1N5YA 3FDRA 2VYTA 2G8KA 4CGIA 3NTIA 4F3TA 2HVIA 1VSIA 2ZE2A 3F73A 3TWHA 4KRFA 4K8XA 2LCCA 1HNIA 4Q5VA 4DTRA 3V4IA 1ASWA 2OZSA 2HNYA 1WSIA 2XHBA 4IUVA 2RF2A 3MAQA 3RTVA 2YKMA 4NYNA 3VQDA 4BWMA 2LRQA 5J1EA 2K3XA 3PMIA 1IKXA 2RJFA 3PMTA 3L2WA 3LH0A 4IUQA 5KE3A 2QXFA 4GVMA 3VQ4A 3AVGA 3OYKA 2FBXA 3MEWA 3HXMA 3SNNA 4AH9A 1NKBA 1JLFA 3FFIA 3QBYA 2JZ2A 4KKOA 2HHTA 1T8EA 1BL3A 3B6OA 3NDKA 4B08A 2M0OA 2BANA 3HL8A 1RT5A 3KK3A 1XC9A 2NUBA 1X9WA 1QSSA 1WJSA 4QQGA 3O4QA 4B8CA 3EYZA 3C94A 4FLXA 4HCCA 1WGSA 3HJFA 2HW3A 2GFUA 4TSXA 1BI4B 3ZSRA 4Y1CA 1A5WA 3VQPA 1S1WA 5HRPA 3HT3A 4NCAA 4EDUA 4CFAA 1N6QA 3OYDA 2EQKA 2R57A 1JXBA 4N56A 2AJQA 1GOCA 4FJLA 3S6WA 1Q9YA 1HYZA 2RHUA 1KVCA 5DMRA 3OS2A 1RTHA 3OYLA 2Z1GA 4KHYA 4KAZA 4HTUA 3RMBA 4M3RA 3LGFA 4WE1A 2P51A 4HCBA 3MP6A 3QEIA 4N5SA 4BE1A 2E6MA 3VQ7A 4N4GA 3VA0A 1LV5A 2HNDA 4DS4A 1LAVA 4LY7A 3O3FA 3OVNA 3MEDA 1I39A 1LW0A 4EP5A 4CJKA 4FM1A 2XY6A 4DFPA 4DSJA 1WAFA 5CY4A 1G15A 4N4IA 1J53A 1S1XA 3VQ9A 1C0MA 4PA1A 3DMJA 4JRQA 1RBUA 3KLHA 1S1UA 4H8KA 1KFDA 4RW6A 3TARA 4OGEA 3BGRA 1C1AA 4E19A 3OMGA 1K6YA 4ZHRA 3K58A 1EXQA 3RR7A 3HYFA 4YFUA 4OKEA 2D0CA 4FXDA 3ZSQA 4LSLA 2RHYA 5J2MA 1Q8IA 1IG9A 2MWOA 4A4EA 5C24A 3P8HA 4CECA 4CEZA 1REVA 2P1JA 1NK5A 2PZSA 3HO1A 4Z02A 1ZBIA 4CEDA 1YT3A 4AHUA 4ID5A 4KI4A 3OYMA 4FK0A 2ATQA 2ZD1A 3VQQA 4E7HA 1KHCA 1Z26A 3OS0A 3OYCA 2RKIA 4QAGA 3PX0A 4B9TA 4J2EA 2KW4A 3L2RA 4DFMA 3OYEA 4DFKA 4LH4A 2IC3A 1L5UA 3AA5X 3QETA 4UC4A 2GFAA 2LVMA 1D5AA 3VQ8A 5SZTA 3NAEA 3VA3A 3AVMA 4CJUA 1NK8A 1OZ3A 4FJXA 2B4JA 2OPPA 4CK1A 3SZ2A 4EZ6A 2EQJA 3DB3A 4QOZB 1BIZA 4BE0A 1O1WA 2B5JA 3QIIA 2EKOA 3AVKA 3AA3A 3LZJA 4E7JA 2F5KA 2FBYA 1EKEA 1CZBA 4W5QA 2OPSA 2GBZA 2HNZA 4FYDA 3O3HA 4I2PA 1SKSA 1HQEA 4Z4FA 4N4HA 4IG0A 4OVLA 3QJ6A 3OY9A 4Z4IA 4CFBA 3ALYA 2QKBA 3HP9A 3QIOA 4Z4CA 4FJ5A 3OB9A 5C0MA 5IAYA 3M8PA 3SYZA 3ASMA 4E1NA 3NF8A 1XWLA 3NBPA 2LSNA 4OKJA 4E7KA 1SV5A 5FDLA 5HROA 3T1AA 4FCYA 4JS5A 1QE1A 4GMJB 3SQ1A 3VQAA 1TKXA 4DTPA 3AO3A 2RI2A 3AV9A 5HBMA 3MXMA 1NJYA 3MP8A 4C5EA 4CJVA 3AVLA 4B9UA 4CF2A 4J2DA 5KRSA 3NGYA 3NTKA 3KLEA 3PX6A 1ITGA 1RT2A 4B9LA 3ITHA 5C6SA 2ZQBA 3S3NA 1D8YA 4DU3A 4CJRA 4FW2A 4HHTA 2HQEA 2G8UA 3M8QA 3UWNA 1DLOA 1WSHA 4PUOA 1XI1A 3F9KA 4FK4A 3KK2A 2G3RA 4NYFA 2RJCA 2E6NA 3QINA 4HUFA 3TAGA 2PY5A 1GOBA 5FRNA 4PL6A 4RW9A 4FM2A 3EAEA 4CFCA 3OYGA 3H8ZA 4N47A 3CFPA 3CEYA 3I8DA 2DFFA 4OPJA 1J5OA 4JS4A 2DTUA 3HK2A 4MQ3A 1C6VA 3K5MA 1U45A 3ZSWA 1YTAA 2CKKA 1BCOA 1BGXT 1TK5A 2RJDA 1VSJA 4F2RA 3QEVA 4BDYA 4FJMA 2B8AA 1N27A 2E4LA 3DRRA 4O4GA 4KO0A 5EU7A 4EP4A 4J2BA 4LD6A 4H4MA 1KLNA 4FJ9A 2XDPA 1RCHA 1WNSA 3ZSVA 3ASKA 4CERA 3NCIA 2RHXA 1VRTA 4DTOA 3RRHA 3TI0A 2XY5A 1SSFA 3IRXA 1SKWA 3C6TA 1HRHA 5CZ1A 2R58A 1QSYA 4FU6A 1HJRA 3AVBA 1CXQA 4NS5A 1T05A 4PWDA 1NOYA 4JLHA 3QNOA 1KRPA 3ULDA 3OJUA 3UIQA 3WNFA 3AO4A 1W9HA 4LSNA 1HMVA 3LWLA 4NCGA 2GV9A 4KV8A 3OYFA 1L3VA 2FBTA 1VSEA 4QCLA 1HYSA 1WAJA 4A4FA 3U6FA 1IO2A 4RW7A 4B9NA 3AVJA 1FXXA 4LD0A 4KB1A 4IFYA 4FW1A 4GW6A 1H3ZA 1LAWA 2WONA 3MXJA 3WNEA 2BDPA 4I9LA 4W5OA 1QS4A 1XHZA 2YKNA 3G10A 1QQCA 2ETJA 4O5BA 3NGZA 3LX7A 2I5JA 2O4GA 3MP1A 1VRUA 3M9QA 2JTFA 3QLHA 3AVHA 3ZSYA 4E7LA 3ZT0A 3KLFA 3K57A 2RPIA 2IGIA 4OKKA 4QQDA 5J2QA 2RO0A 2RJEA 3HSTB 1S5JA 4DLEA 5I3UA 2G8HA 4Q0BA 1F21A 4CJTA 4CRIA 2IG0A 3SD4A 4IKFA 2YNFA 4FJNA 1CLQA 4DTSA 3KKRA 4X34A 2W42A 5C42A 3TAMA 2F8TA 3DM2A 4I9QA 1C0TA 4LH5A 5K14A 1QHTA 1WSJA 4CEOA 1BHLA 4K8ZA 1C0UA 1VSMA 3PFSA 1VSFA 2OPQA 3SUPA 1RBSA 4DSFA 3L2VA 4QVZA 1RBVA 1X1PA 4NZGA 2O4XA 4CF8A 3V81A 1TGOA 4KPYA 5JS2A 2F8SA 4OVAA 4Q5WA 4ICLA 4DQSA 3U3YA 3PX4A 1NKCA 1D9FA 1TAUA 1MU2A 3TAQA 2IS3A 1WSEA 1JL2A 2KFNA 3NNQA 1HYVA 3V9ZA 3C4SA 4DSKA 2HHVA 1RT3A 4DG1A 3KJVA 3ZCMA 3KK1A 4G1QA 4QW2A 2E6LA 4HCZA 3HPOA 3SJJA 2X74A 1ZBHA 3LAMA 3ZT2A 1TKTA 3OYAA 2Z1JA 3LANA 4HUGA 3K5NA 3AA4A 4O55A 1RILA 4CIEA 2A1RA 1NJZA 4F3OA 3DLBA 3SPYA 4B9MA 3LAKA 4CHQA 4ELUA 4Z4GA 1S1VA 1HQUA 4OJRA 4CGHA 1OYXA 1VSLA 4Z4HA 2XY8A 3OJSA 4C8LA 4DQRA 3RMCA 2P0KA 3ME9A 2LDMA 3Q1JA 4FJ8A 2RI3A 4CHPA 4M3YA 3CFOA 2FHDA 3LP2A 4CGGA 3TABA 2YRVA 3IS9A 4PLLA 2BUDA 2WACA 2WOMA 5KI6A 1CXUA 4BDZA 4CF9A 5T7BA 5KRTA 3QESA 3S3OA 2DIQA 1RT1A 1ZBFA 3DLRA 3P8DA 3L42A 1GOAA 2D9TA 1UOCA 4AHCA 3RRGA 3VQEA 2YHAA 4OLAA 2OA8A 1D9DA 3VQCA 1JLCA 1VK0A 5HRSA 2K3YA 3LWMA 2YNHA 4JRPA 4FLTA 3SI6A 2VWJA 3OMCA 4Y1DA 3OA6A 3QIPA 3V9UA 3MXIA 2P5OA 5KGXA 1RTDA 1R0AA 2HB5A 4CEBA 4FJ7A 3FEOA 2OYQA 3BDLA 4MFBA 1HPZA 4DTMA 2HHUA 4E7IA 3G0ZA 3S3MA 2L8DA 3E9GA 3UT1A 2ITGA 2VG6A 3DI6A 4RW8A 4DTJA 3PO4A 1S9EA 3T3FA 4B3OA 4C8OA 3DRPA 1TV6A 4FK2A 2JLEA 4FM0A 4B9SA 4XIUA 4CIGA 2DIGA 2BIVA 3LYIA 1LWFA 4F4KA 1JLGA 4DU4A 1NOZA 3ZEHA 3NF9A 4DQPA 3CM5A 4CHYA 4W5NA 3A2FA 3META 1U49A 5DK5A 4BDPA 4FJIA 2BKDN 2X4YA 2B6AA 5D6YA 3AVFA 4DTUA 3V1OA 4CJWA 2R5AA 3CG7A 1RT7A 3DOKA 1KTQA 4CF1A 4N41A 3P1GA 4CJLA 3V1RA 2G8IA 3DLEA 2RHIA 1NKEA 1TK8A 4FZXC 5D6XA 1TK0A 3AO1A 4OGCA 4ZTFA 2JGUA 4M42A 2DFHA 4O0JA 3V9XA 2DFEA 1ZBLA 1ASUA 5JS1A 4AHVA 1X9SA 3OYJA 1DTTA 4DSIA 3SQ0A 2Q3SA 1RDDA 4Z0UA 3AVIA 1JLEA 2EQMA 5HP1A 4FJGA 3KLGA 2XK0A 4AHRA 1EP4A 3QEPA 2KZMA 3F70A 1S1TA 3NE6A 3LDSA 3TAFA 3OYIA 3K5OA 5C25A 4M41A 2X78A 1JLAA 4ELVA 5KE2A 4C8KA 1HNVA 4EZ9A 4NCBA 2OZMA 4R5PA 5HRNA 1WSFA 2KFZA 2D5RA 3JSMA 2M16A 1RBTA 3DLGA 1LWEA 3L2UA 2Y1JA 5HLFA 2KQ2A 2MWPA 3FC3A 1KFSA 4W5TA 1VSHA 3TAPA 1NK0A 2EX3A 4PLIA 3D0PA 5J39A 1JLQA 3TR8A 3DOLA 3QEWA 4KFBA 4YNQA 3DLHA 4M3ZA 3LALA 3IAYA 2XRIA 3TAEA 1SKRA 5CZ2A 3SQ2A 1Y97A 4KTQA 2IAJA 5D6WA 3M8SA 1KSPA 1TL1A 4CCHA 1S6QA 2X4WA 3ZT1A 4CFDA 1B9DA 4FVMA 3PV8A 2HHWA 3BDPA 4PY5A 4FLUA 4KI6A 1C1CA 1XHXA 4FLYA 4DSEA 4CJEA 1QTMA 3KTQA 4CIFA 3EY1A 2X35A 1FKPA 1A5VA 2G8WA 5KH6A 4DMNA 3TANA 4C5IA 2PYLA 3THVA 2DAQA 1IH7A 3CYMA 3VQ5A 1YTUA 1B92A 4E3SA 4CESA 3NFAA 3IG1A 1JXEA 4B8AB 1Q9XA 2G8VA 1VSKA 4IDKA 1RNHA 5E41A 3JYTA 1ZBUA 3D45A 2QK9A 3V1QA 1SL2A 3KLIA 3V6DA 2X4XA 4FLVA 1JL1A 1NK6A 4Z4EA 5KCHA 4C8NA 3NGIA 1UAXA 3C95A 4CJQA 5J2NA 2E5QA 3ZSXA 1FKOA 1KCFA 4CK3A 4L8RB 3ZT3A 4L59A 3O8VA 5CYMA 4F8RA 3SPZA 3DLKA 2LTOA 2IDOA 3MEVA 3NTHA 1NK9A 1WJRA 1UWBA 3AO2A 4BWJA 3SV3A 3V9WA 3MECA 1X9MA 4CJSA 1KLMA 3DLMA 1IKWA 2YNIA 4KTWA 3AVCA 1U4BA 4KHSA 2F96A 4CEAA 4ID1A 4CHNA 4IURA 3SUQA 1BISA 4O0IA 3WNGA 1B9FA 3RMAA 1SL0A 1T7PA 1TKZA 2X6SA 2QKKA 2L3RA 4CK2A 1IKYA 2R5MA 2RHZA 4DU1A 1A5XA 4IFVA 1UA1A 1OI1A 3HPHA 3I0SA 2BGGA 1ASVA 4FLZA 3E9FA 5J26A 3ZT4A 3E01A 3SUOA 2YV0X 3K5LA 1NK4A 1IKVA 3LPUA 3WNHA 2NLUA 1BQNA 2A1SA 4C8MA 4N76A 1EETA 4F2SA 2BE2A 3CQ8A 2YHBA 4DTNA 3OYNA 2QQSA 1CZ9A 3LLRA 1JKHA 1KVBA 3CM6A 3LPTA 3FLGA 4H4OA 4I2QA 4CE9A 1OZ2A 3NH1A 2XO7A 1L3SA 4AILC 1J54A 3LP3A 4IG3A 4KB0A 4CJ4A 3P83D 3HP6A 3U3GA 1NJWA 4DWIA 2PQWA 3L3UA 4M45A 4FZZA 4I7FA 3V9SA 3PNWC 1FK9A 4ELTA 1TL3A 4A4HA 1BI4A 4IBNA 4C5GA 1KVAA 5D3GA 1S6PA 4DQQA 3KD5E 4IUUA 4DLGA 3SQ4A 2HHSA 2KZZA 1WSGA 4M3UA 3OYHA 2OPRA 3C6UA 3P5JA 4E0DA 1RTIA 1L3TA 5J2PA 3KD1E 3SV4A 3OQ5A 4CEQA 4OLBA 2EQUA 2FC0A 2Y1IA 1RT4A 1RTJA 4B9XA 3LP0A 2EHGA 1L3UA 4DF4A 1VSDA 4IUPA 1C1BA 3PUFA 2RN2A 3DRSA 3DYAA 3VQ6A 4CJ3A 1ZYQA 2HHXA 2GUIA 3M8RA 3QERA 3AVNA 1LW2A 1LWCA 2L89A 4OPKA 3L8BA 1U48A 2O4XB 4E1MA 1RI0A 5IN1A 3GOXA 1BQMA 4ZTJA 1BIUA 2YNGA 3MEUA 3QKJA 3AA2A 3AO5A 3K2PA 4O44A 3MEEA 3HM9A 2HMIA 4M3TA 2HVHA 1WJQA 3VN5A 2Z1IA 2D0BA 3PY8A 3CFRA 4DF8A 3KIOA 4FJJA 4KHNA 4PQUA 1YVUA 3B6PA 3PO5A 4CHOA 4W5RA 4KHQA 2VG5A 4AHSA 1G5VA 3ZSZA 1DTQA 3HVRA 3ISNC 1WN7A 2QQRA 1MHNA 4KHUA 2O4IA 5KGWA 4CHZA
chains in the Genus database with same CATH superfamily
1QSLA 4GYGA 1H1VA 1NGBA 4FJHA 1ATRA 3E9PA 4FLWA 2Q1ZB 4LF7K 2PQ8A 1WX6A 1YHQT 3SZGA 5AQVA 4C0DC 3VS1A 3BUZB 4XU0A 1Q95G 4KBOA 1G2BA 3TTCA 4AYBA 3A5MC 1FOXA 3EG0A 4FE7A 3ZRGA 2C0TA 3V8LA 3MKDA 4AF1A 4CZEA 4C92F 3H9JA 3S17J 2XAJA 4BE2A 4LG0B 5KAIC 3OWTA 3QFUA 4HCKA 1YI2A 3MEGA 3C6AA 1ZGWA 3JRAA 4WF2A 3A8GB 2ZE2A 4MDBA 1OX8A 3VYUB 1X3WB 1D0ZA 4RGSA 3HXMA 3MEWA 2M87A 2Y0MA 4F3QA 4BRAA 2UWMA 1G6NA 2QLZA 2RHKA 3B6OA 3NDKA 2LF8A 2HBMA 1LVAA 3O4QA 2JVHA 5EY4A 4HDVA 1JBMA 4LUDA 2FF3B 1JXBA 3R1XA 1RTHA 4EJUA 3OYLA 3BZ6A 1LV5A 2HNDA 1KD1C 4XORA 1WAFA 2JMCA 2KKOA 2O9SA 3CCJI 3U8XA 1V5GA 5JMVA 3DBHB 2PJRA 3LSKA 3EG3A 2O61A 1VYTA 3G71I 2XHKA 4RB2C 3PO2J 3WGHA 4XTUA 1PM3A 1L5UA 2CQXA 3VA3A 4KUDK 2A37A 5B1AH 2DNUA 4XKBA 3MN6A 1DEJA 2NLXA 1MJAA 2EIJH 3I0TA 1V3FA 5BPDA 4ZYDA 5E1ZB 2E2OA 3DXMA 2JS2A 2EIMH 1MBKA 1UG2A 4OKJA 4JS5A 3SQ1A 2E7WA 3AVLA 2W03A 1NGNA 1NWKA 2K40A 4FK4A 1XI1A 4EGYA 3HEFA 2DD5A 1SRMA 3T7ZA 1P2FA 1YTAA 2BW3A 4DYRA 4GLMA 2IGKA 2ACJA 2O9VA 1X4PA 4UUTA 1N36K 2E2PA 2RQQA 2FRHA 1IN7A 3M54A 3CCVT 2BHZA 3RQ4A 5D5XB 1Z9QA 5TJJA 4JX5A 4B9NA 3AVJA 4IFYA 3U1DA 3JCMX 4MMLA 5F64A 4W5OA 3QQAA 2YKNA 2DXTA 1VTNC 3HSTB 4DLEA 3K9TA 4KN4X 4XN0A 2K7AA 1G99A 3W6VA 1K0SA 2D1KA 1IO6A 2GXBA 1C0UA 3K2ZA 2WSFE 1AKHA 2FMYA 4PK4A 1YW7A 2DILA 3QG1A 1YJNA 1N8RC 1MU2A 3VTHA 2X6OA 4AMCA 1WHKA 2ELKA 3DEUA 4O55A 4CIEA 4F3OA 5DM7F 3P9CA 2YXYA 3FK7A 1Y6IA 4DR2K 2EZKA 1CXUA 4XLAA 1SAXA 1RUNA 2EJGA 5E26A 1MUNA 4XH1A 1RRSA 4FLTA 4BR4A 1YNZA 4RB3C 5KGXA 1FP2A 3GTJJ 5DM6F 5LHHA 2HB5A 3VF4A 2KT1A 4F91B 3UA6A 4A3MJ 1D1CA 2KR3A 1MSEC 1CZAN 2HL3A 1MBFA 2LT4A 2R4GA 3KK7A 3KLNA 2E10A 4BC3A 2L4AA 1PDNC 5ILSA 5KYYA 3E66A 1GLBG 2WWYA 1YITA 5FPMA 1M3BA 2X4YA 5D6YA 2CT4A 1IXSB 3EGXB 3FIFA 2VN2A 4CD3A 4NNJA 4FZXC 4OGCA 3HKZA 5CCAA 4QLCU 1HLVA 4Z0UA 1JLEA 1C6VX 1AZGB 3JV3A 3LDLA 4AHRA 2O01E 2ICWG 3D2EA 5LEJA 5KAFC 1J9IA 3K70D 5LJ3e 5HRNA 1XTAA 1WJ5A 3SWNC 2LCSA 5ICCA 1OVYA 5B3SH 5K1YA 2Z2SB 3UKRA 3EG9A 2WC2A 1T95A 2LQNA 2XRIA 1TP4A 4A59A 1W70A 4XR6A 1T6SA 3LSRA 2HEQA 3PV8A 1YJ9Q 5BMZA 2NOLA 1WGXA 1WUAA 4CJEA 3KTQA 1UELB 1A5VA 1YJ9N 2YRDA 1HYSA 4PFPA 2RQWA 2VXZA 1VSKA 3CCLQ 4A6EA 1X1DA 1RR8C 3VF6A 3S1QJ 4ZGJB 3S6IA 5DM7R 1NGGA 4CK3A 4OPHA 1VQ9Q 1T0FA 3MWTA 5M5WJ 4D7MA 1E0EA 3CC4N 2E3HA 1S72N 4XKCA 2XICA 3DLMA 2CQKA 2CZ6B 1P7JA 5AJ3K 4NOYA 1T7PA 2VJIA 4AFZC 3HGGA 3WNHA 2LD5A 1BQNA 4A0YA 4JKGB 4CI6A 4RCBA 4CCMA 4KGVB 1WI7A 2ISZA 1HSQA 4DWIA 1YHQQ 4M45A 2LH9A 4DOZA 4UB6C 4YPRA 1OCTC 2VYPA 1WYXA 1LFBA 1DIZA 3ABTA 1WSGA 2Q8KA 4UVCA 4DA4A 3Q0VA 4LF8K 3OQ5A 4N9HA 4XTXA 4AWXB 2RN2A 1KD1R 4OPKA 1NEBA 4CH7A 5TKWA 2TDXA 4HEA2 1WVRA 1NGDA 1B34A 1BOAA 4KHQA 2YLCA 4B4CA 3W6KB 4RAGA 1MHNA 3WVDB 4E89A 1RDAA 3RR8A 5DD4A 4CJ5A 4HVJA 3LZIA 3L3VA 3K59A 3ATVA 4A12A 3A8HB 1NU0A 1Z7LA 3DTIA 4B9QA 5A0DA 4QSHA 5KCOA 4B47A 4I98B 4JKHA 1PVEA 4KFCA 3WTUC 2DODA 3G25A 4DZPA 2HDWA 1KSWA 4FPAA 4L5GA 4C8QF 3ZLJA 3EHQA 4AFUC 3LSTA 2K3XA 4CIGA 3LH0A 1AEYA 2FBXA 2P9NB 2RE2A 4XKVA 1GCQC 2GNCA 3IFRA 3KK3A 2NUBA 1KIKA 2E1ZA 3HJFA 1IN4A 1FYKA 2HDCA 2AJQA 1MUDA 4HKEA 2QEXQ 3A1PA 4ITVA 4FJLA 1Q9YA 3HFNA 4YHHK 2LVSA 2YLBA 4IZ9A 1MWKA 2QWRA 3RBBB 2IVNA 3ZQCA 3O3FA 4GBQA 2IP2A 4EP5A 3H9GA 3KLHA 4D8KA 5K7FA 2P6SA 3GCMA 1K8AR 2GOMA 1EXQA 4OKEA 3SJMA 2PMZA 4CEZA 3HO1A 4Z02A 4AG2C 1J59A 3LL3A 3VQQA 1OYYA 1T0JA 4RKUE 3QPTA 1OCPA 2RKIA 5TKYA 4J2EA 2KW4A 1S6LA 3VQ8A 2UU9K 4WQ4C 2GWJA 1BIZA 1JEGA 4XK8E 1U2VA 4E7JA 3VS5A 4AVZA 5IHNA 1HUXA 4L5JA 3J81K 3A8MB 2O8BA 2E5KA 2MI6A 1VQ8A 3GE1A 4F04B 4IHVA 3CCLT 5CKFA 2E2NA 2LSNA 1W1FA 3T1AA 4HSBA 3MKLA 2LP0A 2YUPA 4XBFA 1WH7A 3AV9A 4C23A 3LCNA 5C15A 1VQKT 2CUDA 1HW5A 1NJIU 4CO8A 3WHCA 2HBKA 5C10A 3HB9A 3WTVC 1NLOC 3DKMA 2JPCA 2FRYA 3H3UA 2HQRA 1Y1VJ 3HYIA 3CCRI 1WJDA 1IN6A 1I4K1 1UB4A 1TLHB 1N27A 2DVJA 2XDPA 2NUZA 2HHVA 1VRTA 2DDBA 5FLXO 2C0OA 1HRHA 2EB7A 2MGQA 1VQ4N 1HJRA 4XK4A 4AU7A 1BBYA 3RDVA 3BCBA 4C92E 5AZJB 4EEFG 3UIQA 3HHTB 3OL4A 3MZHA 3CUQA 1O3RA 4MMKA 1KG3A 2QQ9A 1FXXA 5K5OA 3TEEA 3MXJA 2DW4A 3I35A 4A3JJ 4I9LA 2Z1DA 1KXPA 2ETJA 3M9QA 5EG2A 4D7NA 2PTKA 1W36D 2RJEA 1S5JA 4IHXA 1WFWA 5KYXB 1FZPB 4FYWB 4BEHA 1VQLA 1NE8A 1ENHA 4CZCA 4G6TB 1TGOA 5DPKA 5JS2A 4YIFA 1D9FA 3TAQA 4IXAA 2IS3A 2NOZA 3CC2T 1E6HA 4LITA 2MIOA 3KJVA 3I55T 4LLNA 3BJAA 4LB6B 2X74A 3ZT2A 5LEKA 4IOCL 3TO6A 2YU9J 1YF5L 3SPYA 4U67L 4EJWA 1WI3A 1E3OC 2PVOB 1F5TA 3IS9A 2V7YA 1XMOK 2O0YA 1ZA1B 3QESA 2CP2A 2NRRA 1R36A 1RT1A 3LQQA 1P4XA 1Y0NA 1RIOH 1MIJA 1MDMA 4M7AF 3MXIA 3V9UA 2JHJA 1RAEB 3B8AX 1UHWA 4DTMA 3THXB 3G0ZA 1W5CC 3I56T 1CKAA 1M90R 3S3MA 3OW2A 4MEXF 3FXJA 3N97A 4B3OA 5FW9A 2PFBA 4JKDA 2QGUA 1ACIA 3T69A 3PNYA 2BE9B 2R7SA 4DTUA 4N41A 1KTQA 1V4SA 3AG4H 1ILYA 2VONA 3CCEA 5AQYA 5JHFA 5GAGJ 5AIPA 2K9QA 1KEAA 1HDPA 1AZEA 4H0YB 2FSWA 2OV7A 2KPMA 3C2BA 2LX7A 2K5LA 4G12A 2VKNA 2KFZA 2FX0A 2JVVA 2W6KA 3DLHA 1JHFA 2JRTA 1VQ6T 1E7OA 3ZETB 3H0HA 2M7AA 1B4AA 3I5SA 4FVMA 2JA8J 1VQ4T 3BDPA 1G3TA 1YO5C 1WRJA 1X2MA 2DF6A 3EY1A 4MDXA 3CPWA 3TGNA 1HJDA 3CYMA 4C8QB 5IT9O 2DDAA 3O9RA 2X6WA 3LSPA 2OTLI 2QWLA 2XAFA 3KLIA 2RC4A 2XKOC 2CSQA 4X65K 3M9AA 1I1JA 2DZ9A 3I59A 3ZSXA 2SRCA 4L59A 5EZHA 1MJ9A 1W7PB 1ZARA 1B3QA 2KIMA 4CBUA 3CXCM 4DUZK 2ABKA 1KU9A 2L02A 4RM2A 3L2CA 4R0KA 1Y64A 4JI2K 2QKKA 4AIDA 3QODA 4ENKA 1IKVA 4M72A 3FFKB 3ERMA 4N4OB 3WU0A 4I2QA 3TSQA 3D5LA 3CJBA 2M0YA 2MBFA 2PQWA 4FZZA 1NGJA 4M7AC 1KVAA 3F22A 1RAGB 2E4HA 4IUUA 1IB8A 3CUOA 2P4WA 2YR2A 5AQJA 2I8DA 1H92A 2IVWA 2NRAC 3OSFA 1O13A 4KICA 2NS8A 2O4XB 3ZX0A 4LJZF 4PJOC 4IRHA 3A02A 3G6EI 3OSSC 3NPFA 5IHKA 3MN2A 4BUGA 4WQ5C 2NOJB 2ZC2A 3H41A 3PIPF 4XU3A 1OH5A 1DTQA 4GY5A 5KQ8A 5AQQA 5AYFA 2DOFA 3WGIA 1ITYA 4CSWA 3AG2H 3KKSA 4J7IA 5JLFA 2E8AA 3HZ6A 3MD2A 3UNGC 2QWWA 2BHYA 3ZMZA 2F6CA 4DOVA 4M6XA 5HS8A 4R1HA 2F5DA 1Z25A 1RBRA 3TQ7P 4UNFA 1WLJA 1A0NB 5LHGA 5KTQA 1WBBA 3K4MA 3E7LA 5M9OA 1EX4A 3MWMA 2FMLA 3ZMVA 5JR3A 3REAB 1Q7YC 3CCRN 4EATA 3JCMe 4YIIA 3MWPA 5FB2A 3V4IA 4YOVA 1M27C 5A2QO 4IUVA 4N4NB 1VQ4I 5FWBA 2RJFA 5LJ3h 2DL8A 1KZHA 2RA2A 3FFIA 1OH6A 5E84A 2FEIA 2EPFA 2IGNA 1N5ZA 2IA2A 1FYNA 3GFMA 4HCCA 3ZQ7A 4H0EA 4UB8C 2IRFG 2WTEA 1I1SA 3O6BB 1A6IA 4IWVA 1GOCA 4WCIA 1SZ2A 3REOA 5DMRA 2MOXA 1X9JA 3QJYA 4J83A 1EFNA 4RMNA 3LW5E 5CO7A 1K8AU 4LY7A 3IRQA 2CP3A 2RF0A 1WJEA 4L9NA 1U8RA 4XLFA 1P7IA 3VWBA 3M1CA 4BH9A 4GXOA 4L18B 4DHYA 2D0CA 4FXDA 1OH7A 1FMKA 1TWFJ 2KQRA 4QIWN 2GTOA 4FK0A 3ZP5A 4J9EA 1A5JA 3N5NX 1KQ0A 3H45C 4DFMA 1Q81U 1MSFC 1VQ5I 2P84A 3AA3A 2LREA 2DJNA 3ASNH 4CBWA 4FYDA 3GBGA 2DYIA 3A8LB 4N4HA 2VXEA 4ORZA 4NQWA 1JU5C 2A6AA 3CCMA 1AT1B 3M8PA 4BRDA 1YIJQ 2Y9ZA 3HSRA 3JB9H 5FDLA 3ABLH 1XSDA 2MK5A 3VQAA 2FQ3A 3BR2A 4DTPA 3WHBA 1F36A 1O57A 4ZYEA 1LPQA 1HSTA 1DUXC 1N3AA 3QBWA 2HVSA 4RUGA 4B9LA 2XRNA 3WU1B 4I76A 1Y8QB 1YJWA 4PUOA 1Y0MA 2X48A 5GAN2 2VC1A 4RW9A 2KL4A 3CP2A 4EHTA 1JB0E 4EA5A 1NJIO 3NHNA 2DO3A 5B8HA 1UHFA 2DEQA 4BDYA 2W1OA 3TU5A 3JCMd 4RCCA 4JLIA 4FSXA 1DU6A 3P39A 4BQLA 1CXQA 2XD0A 1N75A 3H5NA 1HLUA 1E4GT 1FX7A 3OGDA 2RMOA 2AA4A 4KV8A 4QTRA 2ED0A 4GW6A 5AQRA 1UJYA 2WONA 3CCSA 1QZ6A 2D0QB 1B59A 5CKTA 1U9NA 3FHZA 3FZKA 3VS2A 2D4WA 2KISA 1TSFA 4IOCF 3TAMA 3DFGA 4EM1A 5I22A 4BG9A 3GBTA 4FO0A 2FSNA 2OPQA 4OVAA 4Q5WA 1PRMC 2HYGD 5I2MA 4IHYA 4DR1K 1QRYA 3TKYA 3DEEA 3ZMUA 4BL0B 5J1YA 5AQLA 3IQLA 5F1XA 1K9MR 4PZJA 3K5NA 4B43A 5CKEA 4CHQA 2P9LB 3OJSA 3REBB 4DQRA 4FJ8A 4Y33A 3LP2A 3CCLI 3NRVA 2YRVA 3F6VA 1VUBA 2BUDA 1U1SA 4OX9K 2J4RA 3KYCB 1PJRA 1I5LA 1KQ2A 2HVHA 2VXDA 3PY8A 1IBKK 5GAOl 2TRTA 3OIQA 2NYSA 3RRGA 3A0BC 2YNHA 4BY6C 4Y1DA 4EQQA 2CH5A 2EQRA 4HLXA 2ITGA 2ELHA 4Q5SF 3UKUA 2HKXA 2V7FA 5LD2C 3VEOA 1Q82U 3JXUA 5CHIA 3KYDB 2NVYJ 3K69A 4BDPA 1ZHIA 1PP8F 3PSFA 2RK2A 2ZXJA 3V1RA 4FISA 3KETA 1TK8A 5H6QA 3JCMV 5JS1A 4KGZB 3LA2A 1DTTA 2XSDC 3SQ0A 2Q3SA 2XV4S 2FD5A 1K1ZA 2PVGB 1KC8C 4DGWB 1X19A 4AD9A 3QEPA 1EP4A 3LDSA 2JTEA 2P5LC 1FPQA 4NCBA 5F1JA 3SLCA 3G6EA 1ZG1A 2MF2A 1RUOA 1VQMT 3DLGA 3S15J 1CF7B 4JK8A 1NK0A 3JB9J 1HNWK 1AD5A 1HPMA 5D6WA 4MLEA 1GDTA 4LDXA 3M0QA 1PU8A 1BA0A 5LBQA 2R5ZB 2LJ0A 4C92A 5E17F 5DEQA 2BE5F 3M59A 4CYDA 2CYYA 1Q81R 1SAZA 2J5OA 1VQMI 3JYTA 1RDUA 1ZGJA 1WLPB 4EAHD 4B8XA 1O7FA 3M0PA 5GAOn 2E5QA 2LQKA 4YY3K 2KKZA 3N4MA 3NTHA 3ZETA 2E5ZA 5KHDA 1VQ9T 2O3FA 4A3IJ 1N77A 3VOVA 3DEWA 5FFZA 4DV0K 1PC0A 3ZYYX 4WFNL 1N32K 2WV1A 4BRQA 3QWLA 3EGUA 4IDHA 2BGGA 3M57A 5C4XJ 4E9FA 3VFZA 2X9HA 4XEIA 3WTYC 1KQSS 2BE2A 5AZIA 2E19A 2LBFB 3OYNA 1T44A 3EUHC 3T8TA 3LLRA 3CCQQ 1U2VB 1VQKI 5ED4A 2F5EA 1Z7UA 2HQAA 5AZIB 2WAQA 1J5EK 3MZYA 4UUVA 4ELTA 2P9IB 3M07A 1S7AA 2VIXA 3AAFA 5KYUA 1NEGA 2YHTA 3QICA 4DQQA 3KD5E 2HHSA 1A36A 4E0DA 4J5YA 5A2QZ 2ZXIA 1EO1A 4OLBA 3FE1A 1VSDA 4HWIA 2R5YA 3A0IX 4CJ3A 3U23A 3KLOA 5CJ9A 1JJ6C 3AVNA 2BV6A 1S5LC 1YRNA 1B1BA 3KP3A 5GTHC 4M78G 4K2EA 1MD0A 1QZEA 4E4HA 2PFUA 1WJQA 2HMIA 3VN5A 3SHWA 1WHMA 3PL8A 2IGMA 2CZ0B 2C6YA 1D0XA 3IH7A 1ZLJA 1WHGA 2CDTA 2FA5A 1W0HA 4JK1X 3M5AA 2VWKA 4CGFA 4BACA 4DTXA 3CO6C 5ECAA 1TYQA 3VJPA 1U47A 1TVRA 3MO8A 2DO7A 4MZMA 3O4NA 5M1NA 3QNNA 5GJWB 2VJJA 5L3DA 4RG8A 5IT9K 4HTLA 4CHUA 4DSLA 3QZ9B 5DLOA 4IOAL 3QO9A 4F17A 5KPRA 4D9JA 2YJFA 4AIKA 2QASA 3BR3A 1R4MB 3L1AA 3LGLA 4CJFA 4S05A 2OX7A 4DFJA 4JI8K 1VQ9N 1W36C 4DTRA 3I33A 2KP6A 2LMDA 3RTVA 1Z3XA 3VQDA 2M0CA 5E20A 4CYCB 2GIZA 1N8RU 5EYRA 1X1BA 3INZA 2QAZA 2YU3A 2VKHA 1SQKA 3L6QA 4RB0A 5AQNA 1OPLA 4JPBW 5H2FC 3A98A 3LSGA 3OIPA 5E3OA 1WEGA 3I5RA 4J01A 1S1WA 5HRPA 4NCAA 2CO5A 4AYBN 4WQ5A 3S6WA 4ISEA 1KVCA 2ZFWA 1U3OA 4ENNA 4DEXA 4BRLA 5LGNA 4I0AA 4HTUA 4XLNF 4HT9A 3OIOA 1W2BS 5HOOA 4CJKA 5GMKe 2HNHA 4DFPA 4B1UB 2VBYA 3FXLA 1KJWA 2D2WA 4RW6A 2DPUA 3GLXA 3OBYA 2DYRH 3D5SC 2ZGYA 1U5TB 3CMAA 2R7OA 1DJ7B 4B44A 3OYEA 4IEIA 4C0ZA 4R56A 3ZX2A 1BI3A 1SFKA 2FBYA 1GCPA 3KXTA 4I6MA 3HM5A 1TWAJ 1K9MC 4II3A 4BGDA 2ECBA 3HRGA 4FJ5A 5HNFA 4YTLA 2DKGA 5IAYA 4UY8O 1MNMC 2EK5A 5CVRA 3CCJA 1SV5A 3WGGA 1TKXA 1XGMA 4RTVA 4P96A 4MQVA 1LEAA 1KG7A 2CQ7A 4CJRA 1VQMQ 2HQEA 4BRGA 4WWCA 2RJCA 1EF4A 3WU2C 3ZMSA 3EAEA 1T56A 5DYMA 3MVPA 3VRZA 1KQ8A 1G4DA 5GPCA 1VSJA 3BEXA 4H5WA 4O4GA 1KLNA 4CERA 1UFMA 3M8JA 5TGTA 2DT5A 1VFCA 2DOAA 3V7RA 2P0PA 1SRLA 2UYTA 3LWLA 4Y0WA 2CUBA 4HSTA 3BJOA 1U6ZA 2QEXA 4CCOA 2A42A 1QS4A 5J3LA 2UUAK 3QLHA 1RAIB 1JTYA 3OHRA 4OKKA 5I3UA 3FB9A 3NMUA 1LMZA 4ZGEB 1LFPA 1YJWI 4JHDA 1SFUA 4BI4A 1QHTA 2HMAA 1VOMA 1SVMA 4E6KG 4QVZA 1YXQA 2A69F 4F7UF 2F9WA 1JUPA 5F6FA 1JCFA 2E1YA 1M1KC 1HYVA 2QGFB 2F4OB 4J6XA 3X24B 2Z1JA 4HUGA 3AA4A 2OJED 1STZA 4PSXA 2JOYA 2F5VA 4XSXF 1OU8A 2DN0A 4M3YA 1X3ZB 2IJLA 4D5FA 4AHCA 1RRJA 1I27A 2QQBA 1LE8A 1LNXA 2QGGA 1Q7YU 1UTIA 3FEOA 1R00A 3O5BA 3QBXA 1BG3A 3UT1A 5KK1A 4JKAA 3DAWA 3N5BB 2NVTJ 5FKLA 3CWUA 3A01B 1M3AA 1ZHFA 2XRLA 3PM1A 2EYWA 4U7BA 4X1EA 1JHHA 1VQPQ 1K79A 4B1ZA 5FPEA 4FWKA 2R7VA 2R5AA 4PJ0C 4D6WA 3CCQN 4M42A 1UGRB 3FXQA 2W00A 5ADXA 1RDDA 2VGNA 3CCEN 1VIEA 1Z6RA 2X4JA 3F23A 5M3MJ 4XLCA 5HLFA 4Y4RA 5GAN8 1E3MA 5GAN7 5I21A 1MGTA 4UVBA 2CH4W 2VB6A 5LJ5e 1JLQA 1IREB 1LWVA 2XDBA 2ZJPL 4KYWA 3H9NA 2LKPA 1SD7A 4HF0A 5LL6Z 1OCZH 2L3SA 4PY5A 2EFQA 4KI6A 3CDLA 1RLPC 4Q4ZF 2E35A 2OQGA 4UV9A 5ILUA 4CESA 2IA0A 4KT5C 1ETWA 4FLVA 4Z4EA 5KCHA 3NGIA 2V4JC 4J9FA 4EIKA 5L3FA 2MH2A 4CCKA 2K9MA 3M53A 5CYMA 2LTOA 1ON1A 3H3NO 4HBLA 4E47A 2E5NA 2CW0F 1S72I 3CC4I 4BRCA 4CEAA 4ID1A 4CHNA 3KX2A 2DX1A 2L3RA 5L8RE 2V6EA 3CP8A 3DXMB 3A4CA 1UCRA 3VB2A 2D8JA 4D8DA 2A68F 2J6FA 1JCGA 2A1SA 5JLXA 1EETA 4F2SA 1UDLA 4DTNA 5IP6A 4H4OA 2PAVA 4IG3A 3EGXA 3U3GA 2COMA 1JT6A 2AKKA 5A0LA 1X01A 2OA4A 4BR9A 2W7NA 2CH0A 1IZ6A 1YQLA 2ZM6K 1Z1DA 2CW7A 4HAMA 1NPPA 2P9SB 2L3DA 1V29B 5M1KA 3QPLA 3PQJA 2VUBA 1MWMA 3OA9A 1QQIA 1ZYQA 2D0PA 2ZZDA 3CCMI 3G6EN 5H6RA 2R7TA 1SEUA 3JRGA 3M55A 3W6JB 4M75A 4ZTJA 4DF8A 1WSUA 4PQUA 2RQUA 2HPMA 1VQKN 2VG5A 4AHSA 3O8MA 3NQOA 2K9GA 3TP3A 1R58A 3QXEB 1JJ2S 4Z8AA 3ZSOA 4OFHA 4KA4A 3E97A 4II1A 4HUEA 2YHWA 2L7FP 2RNGA 5HRRA 5LLQA 3CXCA 3TREA 4CEEA 3DWLE 4ZDLA 4A3EJ 2E64A 3MDQA 1I3AA 3LDNA 2M9HA 3FDRA 4M3BA 5IWAK 3F73A 2DD4A 4K8XA 1WPYA 3CQTA 2UUBK 3THKA 2L9RA 3MAQA 4NYNA 2LRQA 4AM3A 2GBQA 4B3AA 1M1KU 3CCRT 2ZJQF 2ZCFB 5ERIA 3M0RA 3R0JA 4B8CA 4C8QG 3V42A 3GLLA 3OYDA 3CC2N 4PKCC 4MDAA 4A57A 3VUZA 3OR1C 2P9PA 2F4VK 3O2PE 3DXJF 4ELYC 2VQLA 1QHHD 4FYXB 2JTVA 2XB0X 2KT0A 1Z9ZA 1ZBLA 1RPWA 1K6YA 2HR3A 5BS6A 2P5KA 4YG2F 2LYCA 4PJOE 4LMYA 1IRFA 4CZGA 1BA1A 3E6BA 1EV7A 3KWGA 3IUCA 5L23A 4EGZA 1Z3YA 3ZN0A 1D8JA 3L2RA 3CDIA 4MFEA 2GLOA 1RESA 3SZ2A 4BE0A 4JKEA 2EKOA 5JI6A 2F5KA 3GFIA 4F55A 2JWLA 4IEJA 4A2AA 1VI0A 1C0FA 4X0GA 2KZVA 2BY3A 3NBPA 4E7KA 4BYYA 2G0EA 1QE1A 2ZJRF 1U6GA 2OC6A 2NNWA 3FDYA 1TH7A 3FHGA 2C06A 4ISGA 4FW2A 5C4JJ 5GAEP 4IFEA 3F9KA 5FLVA 3KK2A 3E6MA 1QLYA 2IS2A 4FM2A 3RSEB 4CFCA 3H8ZA 2LY1A 2LC2A 1TWCJ 4FTHA 3I8DA 5IOYA 1LB2A 1R1VA 3ZSWA 3ELKA 5GAGP 1FSHA 3I9QA 5K7HA 4GDFA 3SK3A 4C92G 2V1DA 1QVGP 4M3GA 1BYMA 1SSFA 5TISC 4ZZLA 4PJOA 2L0AA 4JRIA 2CUZA 1UJ0A 4BRFA 2V52B 5J1UA 1W9HA 2UXDK 4QCLA 3U6FA 3VS4A 4RW7A 1LJ9A 4LF5K 2VGMA 3CC4Q 1S72Q 3G10A 4O5BA 3HM9A 5BNGA 3AVHA 4RTXA 4NL3A 4LOCA 2RB6A 3MHXA 1CLQA 2BYVE 1SF9A 4DTSA 1V55H 4KGXB 4YOQA 2XAGA 1TWHJ 4KISA 4DV5K 4IIMA 1ESVA 1JO8A 2RH2A 4ICLA 3PX4A 4BQOA 3GBQA 3NNQA 3E19A 1G2HA 2JQ7A 3Q7CA 5LJWA 5M3FJ 2KMUA 4M4ZA 3P31A 3HSEA 4A5BA 5GAOr 2UUZA 2RI3A 1LQ1A 2AXLA 5T7BA 1YVNA 3ZCOA 2A40A 3DLRA 1EIFA 4ZYAA 2XUBA 2MH9A 3DPLC 1KQSP 3I54A 2DMQA 1KC8O 1RTDA 2HZDA 3EGDA 1FOKA 3M3ZA 2VG6A 3E9GA 3DPUA 1S9EA 3T3FA 4DYQA 2MPXC 3CCYA 3OS5A 3J81O 4M75G 3NF9A 4H03B 2E2QA 2AP1A 1QVFM 3PQKA 3BPXA 2V8IA 1TK0A 2DEUA 4ZTFA 5LHIA 4CC4B 3EUKL 3ZMTA 1ASUA 1ZSGA 4AHVA 1VQMN 1Z91A 1R4NB 4BQAA 3IHOA 4CUGA 4NC6A 3CCLA 5F27A 4CA0A 1W7AA 1YCYA 1CSKA 2HD0A 3G71A 4QKUA 1VQ9A 3JS6A 1OLTA 1VSHA 1DGWY 5J39A 3FRNA 1LKXA 3THYA 3IDHA 2VUMJ 4KIFA 3CXCP 4PHTX 1B9DA 1YQKA 2HHWA 3CCRQ 2YUQA 2A3LA 3GTQJ 1XHXA 3PVLA 4C92C 4CJ7A 3G3ZA 2COBA 2WB1A 1YQAA 3PJRA 3QOEA 1FKPA 4WK8F 3CF5L 2K79A 2QK0A 4H4KC 4E3SA 3V1QA 1SL2A 1YIJN 1GRIA 2A5WA 3QRFF 5CVVA 3CCSI 1FKOA 1IZ1A 3EE9A 4WYBA 3MEVA 1WJRA 3MECA 3J7YJ 4CJSA 2P81A 1LEBA 2DL5A 1OQYA 1SHFA 2L2PA 4DJAA 1MMAA 1A5XA 1JE8A 4HG2A 1TG0A 1DPRA 3MKWB 2CW8A 3GTKJ 2A3SA 4XU1A 4M78B 1OYIA 3R6NA 2YHBA 3CM6A 4RS8A 1KD1U 3A2KA 2QDYB 1EH7A 3P83D 4CICA 1NJWA 1S3JA 5E3NA 1R7JA 1GLLO 4X9CA 1FK9A 4XOTA 5AQTA 4IRGA 4WFAL 4PKHA 2W40A 5E3MA 1UE9A 1HYOA 5CQGA 2GQQA 4S04A 2KDZA 2EQUA 4BG8A 1RT4A 1RTJA 4DF4A 3RMQA 1XS9A 5GAMe 2VBXA 3H1QA 2L54A 1NH3A 2QQAA 2R92J 1M8MA 2FLOA 1NNEA 4LN2A 1JKOC 5KN8A 1JQQA 5EG0B 3ISNC 1WN7A 1VQ9I 3UATA 1NJXA 1YQMA 3C7NB 4BI8B 1T3SA 1YW8A 2A61A 1YJNQ 1XG7A 5FLXE 4IUTA 3CCEQ 2VKVA 2P0QA 3CCMT 3W0LA 2ZMEC 1IXRC 2HDAA 3R4KA 3UKRB 5DCMA 3GPLA 3BY5A 4JI5K 1N8RR 1Q86R 1ARKA 1B6AA 3RKWA 3GNFB 1XMAA 1D3YA 3CQZJ 3EYIA 3L9FA 2NNNA 5DDGA 4HA8A 3JCMQ 4BXFA 4B09A 3SMPA 2E70A 3JCMc 1WJFA 4F3TA 1VSIA 5IOZA 1TQIA 5GANg 1YJWQ 5CKBA 4BWMA 3F8MA 2HQ5A 4NBQA 5IXBA 1QZYA 1K76A 1VF9A 4HVWA 4B08A 2BOLA 3HBLA 1VQ5A 3I0XA 1OOTA 3KWIA 3ZSRA 4I99C 3TW6A 2R57A 3N0UA 3GDQA 4M7DB 3LGFA 2OTJA 1I6HJ 3LSJA 4N5SA 2XIGA 4IQJA 1T3LA 4FQGA 5GAOp 4FM1A 2F5CA 3TARA 2YDLA 2EFWA 5AQGA 3SBTA 1EBMA 1Y96B 3CCUI 2RHYA 2GELA 2LC4A 4M7AE 3P8HA 1NK5A 3O8HA 3QDRB 1P4WA 3OYMA 1KHCA 4DFKA 4LH4A 1ORNA 1PYVA 2GFAA 4HQMA 3X20B 1BOBA 3I4MJ 1IDYA 5EC7A 3VENA 3VEZA 5EZGA 1D5VA 1ACMB 3CD6T 2HNZA 1LJOA 3O3HA 3G4SA 1EWRA 4DUYK 1ZA2B 3D6RA 3ASMA 2RDPA 1ZBXA 4H0VB 2DMTA 3K7AJ 4YRVA 2RI2A 3OL3A 4C1NI 2KRFA 4GV9A 2H27A 6PAXA 5KRSA 2PEXA 5M1QA 2FNAA 4E6RA 1NG9A 3S3NA 4BC5A 2HAXA 2HF3A 2CS3A 2STWA 4MZTA 2HVRA 3OYGA 5BPLA 3J7AP 3H9QA 5CQEA 3ECOA 1XB4A 1W0TA 1H8KA 2X1DA 5DV5A 4FJMA 4X1VA 4LD6A 4H4MA 3NCIA 1GLNA 1WNSA 3SJHA 2MLKA 3KCCA 4KIBA 2DTOA 3GFLA 2WA0A 5B5EC 4PWDA 5BPIA 2X6YA 3EH1A 5LJ5g 2RPNA 3IMXA 3OYFA 1AA7A 1HU0A 3K2AA 3J80Z 2KDSA 1O7LA 2V9KA 1R71A 1T6DA 1RR7A 2DRMA 4BRHA 3U3YA 3T1HK 1RC9A 1YJWN 3E1SA 3DTKA 2N8GA 4M3EA 1FBQA 2L3QA 2IG0A 4IZZA 3KZIC 4PFZA 2QVOA 4HW0A 2D8HA 3J7AF 3GUDA 1RBSA 3V81A 4OP0A 2K9NA 3BCAA 4BR0A 1EJ9A 1J7KA 3DF8A 4V2GA 5GAN5 5F04A 4QW2A 2E6LA 4HCZA 4DR7K 2DJIA 1SD6A 3HRMA 2LG4A 3RVCA 3OYAA 5GIOA 4LXCA 4ETSA 1RILA 4O8UA 1FIPA 2W0ZA 3CWTA 1OJLA 2XASA 3DQVC 3CCQI 3ZBDA 2RKHA 3N4QA 2WACA 3TSWA 2FE3A 4XTZA 3MEXA 4JAXA 4JHDB 3UE5A 1K61A 3CCLN 2RN8A 3CCEI 1JLCA 2QBYB 3ABKH 5DS9A 2VWJA 2KAFA 3I8BA 1TTYA 1MDUB 2OYQA 3NFCA 5A0GA 3R9PA 3BR6A 2DA7A 1GXQA 3C6HA 3JCMW 4XIUA 3IRRA 2V9VA 2BIVA 3LYIA 5GANj 4LC9B 2ZGZA 3HUGA 3PFIA 1UJ8A 2W57A 1NGHA 4M7AG 1U49A 2KLAA 3V1OA 4CJWA 2O8KA 3A8YA 4A3BJ 2QWNA 2X0LA 2ME0A 1K8AO 3OBWA 3UR3C 1ZN2A 3AVIA 4M78F 2QUFA 3WQTA 4XRSG 1S1TA 3NE6A 3TAFA 3QZ5B 1ZUYA 1ORKA 2Z3YA 4YOYA 5D4RA 1KFSA 5AQHA 3DOLA 2E60A 3LALA 1E4FT 4CCHA 1KSPA 1SG5A 2P4RA 5IH2A 1QHGA 3O9UA 5BR8K 4HRIA 2QQ8A 5D8LB 2HFHA 4C5IA 3AFHA 3OOUA 5AIQA 4C8QA 1Q9XA 3D45A 5GIPA 3F6OA 1L0OC 4LFUA 2DMOA 2AKLA 4LDUA 2H6BA 2V7ZA 1P8ZA 1S1NA 3OV8A 4JJCA 3O8VA 3G4SI 2GAUA 3ASOH 1FIAA 3ZX3A 3RYPA 2V1RA 2LNVA 1QU3A 3ZOBA 1U4BA 5FJ8J 4G7ZF 2PJRB 1T6CA 1Q86O 2OCCH 1H89C 2GA2A 1IKYA 1HW2A 1S3XA 1OI1A 3SHFA 1PHTA 2RK1A 3ZT4A 2MABA 2L2OA 4RMOA 3KP5A 2NLUA 4HLYA 3G1OA 1CZ9A 4FJKA 1BW6A 1MH3A 1YJNT 3BW1A 2KIQA 1X3UA 2VQGA 1YLFA 3PNWC 4IBNA 1EH6A 1MW7A 1ZREA 4EJOA 4JI1K 3D7EO 3R61A 3KNTA 3PIOA 1JTXA 3C6UA 4OB2B 3NVMA 5AQOA 4M77F 5FFXA 1Q18A 2FQ4A 4LLLA 1POGA 1X27A 3DRSA 3DYAA 3WTZA 2FPDA 1RI0A 5IN1A 1P59A 4FASD 3AA2A 4O44A 3IV5A 2EZLA 2FOWA 1H641 4CHOA 4W5RA 3G6ET 4WCGA 1YIJI 2LRDA 1VQLQ 2B7EA 1Y71A 2VG7A 2DY4A 4J7FA 3EZ5A 5CYVA 2UXCK 2E41A 3X28B 1R22A 1VQLN 3AGKA 2XF6A 2P9UB 3EZWA 1QQMA 3QMLA 1J9AA 2EW3A 3MEAA 2G7UA 3H6ZA 4PJOG 5AQSA 2ZKZA 4UQGA 1W0UA 1H0MA 1TUGB 2GM4A 2KQWA 3PIPA 3JRBA 2IS1A 2RI5A 1TNTA 4NL2A 3NH2A 3AAPA 2G8FA 3H08A 3CWSA 3JSOA 5LY3A 1SFXA 3AVAA 2MSYA 3L00A 4I6ZA 1EQYA 2HVIA 5GAN4 4M78A 1WHLA 4DIQA 2EA4A 2HNYA 3I9V2 2H3GX 2LY9A 4Y17A 4FL9A 1IKXA 3CUQB 1AOYA 3L2WA 1Y7XA 3SNNA 1UGVA 3U9DA 4AH9A 3GYHX 1NKBA 2QWPA 2HHTA 4CC7A 2DLPA 4XQ3A 4H0PA 2A05A 5LJ3g 4C3HJ 1BW5A 5EXWA 3EYZA 1YJNN 4AG1C 2P9IA 2HSTA 3VSLA 3TP0A 4N56A 4P9FA 2RHUA 1BWFO 3MJXA 3E9OA 2ZNYA 4LF4K 1YFNA 4A2BA 5C3EJ 1YWOA 3QEIA 2LNHB 1VQ6A 3CQYA 1GCQA 3ISPA 1LW0A 1VIFA 1G15A 2OPTA 1C0MA 4PA1A 1KFDA 4DNCA 2Z9OA 3SFMA 4ZHRA 2JPSA 2HOTA 2JUGA 1RAHB 1IG9A 4L9TA 3GF2A 1RGIA 5C44J 5M5YJ 2LT1A 3OS0A 1BI0A 3JB9F 3V7SA 4EVVA 2FZGB 3WE3A 4S0HB 4D0PA 1IDZA 2JXBA 4X64K 5FU6C 3AVMA 3WEEB 1OZ3A 1WB9A 2WFBA 1QCOA 4YFNF 4M6YA 1NJIC 1ZAOA 3MN7A 4MQ9F 4XSZF 1ZK8A 3RPQA 3OW2M 2I7NA 1HKQA 4C5EA 4OMYA 1HKTA 3UKGA 2FRWA 3BG7A 2ZQBA 2EV6A 3BQYA 4CYCA 1K9AA 3T0YA 3FXOA 3DKWA 1M8VA 3PNVA 1VQNI 4R55A 1NBEB 2LJ1A 3CFPA 4BJTA 3CEYA 1IHVA 2IIRA 3ZPLA 3J7YP 1FBSA 2L9SA 2RJDA 4QS7A 3CLOA 2ID3A 2E4LA 3Q3SA 4FJ9A 4EP4A 2KZMA 3K4CA 2NRZA 3GNGA 4IQ4A 3EFOA 1SFOJ 3CETA 1M1FA 2VLAA 4G94A 2WB1N 2HI3A 2DA3A 4C2UA 1VQ7T 3WNEA 1YYVA 1OR7C 2P7CB 3NGZA 3LX7A 2O4GA 4FZYA 2CGJA 3G0QA 1VQKQ 4HX8A 4V19K 4I0BA 4IKFA 2EFNA 1E6GA 3DKYA 5C42A 3JTHA 3CPEA 1YE9A 4CF8A 3U4LA 1UUEA 4DQSA 1OULA 2FXAA 4LD9K 3CF5F 2D5VA 4H0OA 4G9YA 3BTCA 3PO3J 3WXJA 4C8LA 3GL1A 4DZJA 3CJNA 4CGGA 3VETA 4ESRA 2V26A 3IKVA 5KI6A 3OMYA 1BKBA 5HLHA 2DIQA 5KN9A 2OZSA 3L42A 4MO7A 3PTAA 3CC7A 1ZUUA 1D9DA 4QS9A 4GRIA 4DR3K 3FZLA 1N8RO 1IN8A 2M8EA 1RETA 4IO9L 2EZIA 3EKUA 3G6EQ 2P9LA 3TTDA 4DTJA 1F43A 3R2XC 1MA9B 4L9VA 4BQQA 4GV3A 2FUG2 4KNYA 3ZEHA 4HX4A 2A28A 3AVFA 4HF2A 2G8IA 3CMYA 5CLSA 4M75F 3OYJA 4UXNA 3P7NA 4OIOF 2HQHA 1HJOA 3S2HJ 1N9RA 1AVZC 3KEQA 1RACB 4M41A 2WY8Q 1HNVA 3NVKA 1YX5A 2AXTC 1LWEA 1R77A 2KQ2A 1HD3A 1OX9A 2H6CA 4M7DC 4PLIA 4FT8A 5CR2A 2A5YB 2RD1A 4FOEA 4B1VA 1QW1A 3TAEA 1SKRA 4BJ5C 5CZ2A 1ETQA 5DM7L 5ICEA 1PUEE 4JX6A 4CIFA 1IUYA 2JSCA 1YHQI 3I71A 1PG5B 1LPLA 4BNCA 1NLPC 1PUFA 1JXEA 1ON2A 2G8VA 4IDKA 5F1RA 2GA1A 3BZKA 9ANTA 4U0WA 4OMOA 4AT1B 3P8BB 3FM3A 3EETA 4JKCA 2ZPBB 5BN8A 1IKWA 4BI3A 2JJ7A 2VKEA 4JJNK 4XLEA 1BISA 4O0IA 4DQ8A 2X6SA 3RERA 1QKWA 4B1XB 4IEEA 3CW7A 2JW4A 3M1EA 4BB7A 2DL4A 1UZCA 3K5LA 2M4GA 2F69A 1YW9A 1PSFA 1KVBA 3EUHA 1TWGJ 1J54A 4MO5A 3BWGA 1ULYA 2BEOA 3EO3A 5LRRA 2W82A 1KC8R 4G9ZA 3QSUA 1S6PA 1D0YA 5JFRA 1QVFS 3GXOA 2DAOA 1SS6A 3OYHA 3B6AA 3P5JA 3TU4K 5J2PA 3FXKA 1OV3A 4OO1J 5LMUK 3KPHA 2P6TA 2CT3A 3FF5A 2GUIA 1KK7A 1N6AA 1LWCA 4BKXA 2O88A 1EH8A 4MDWA 4RTZA 3MEUA 3A03A 2GBYA 5EGOB 3QYEA 1SEMA 2Z33A 3VV0A 5E1XA 1G5VA 1OYWA 4CHZA 2LKSA 1FYMA 2PBDA 5FRMA 3LSIA 1DPUA 1QNTA 1GHCA 3I0RA 2HKNA 4FL6A 1I07A 2BTTA 2COWA 3CCVA 3CCRA 4B9WA 2CFXA 3CCET 1QZ5A 2ATCB 4BD3A 4B9VA 1Q82C 1OVQA 3RKYA 2Z16A 3O3GA 3VEYA 2LQ8A 1BN5A 2DYBA 3ENHA 1XQOA 1BCMA 2DL7A 3BDUA 3I55A 4OPAA 1RDBA 3BP8A 2MMPA 3O6WA 2M51A 2G8KA 1PVSA 3NTIA 4JK9A 5KQDA 3FZVA 5KYWA 2XHBA 2QM3A 5J1EA 1ZYRF 4Y3OA 3O8GA 3SZPA 4P1WA 4GGGA 1WJAA 1YJWT 2CJJA 1U06A 5JICA 2HTSA 5J40A 2M0OA 2CUEA 1O9SA 2FXUA 2HZTA 2ZGWA 5GP9A 1HDDC 2L4MA 3AL0B 3GZNB 1W4MA 2ZJQL 2Q31A 2AT1B 1TQMA 4DS4A 1MJBA 3DU6A 2XY6A 3RSNA 4RAFA 1JI8A 1J53A 1TC3C 3DMJA 3PNTA 2F2EA 4NXMK 3ZSQA 3CHWA 2PZSA 2K5IA 1MBHA 2KRNA 2V79A 3P4IA 4B9TA 2R7QA 7AT1B 1IV6A 4JK7A 4F16A 5SZTA 3QIIA 4KULA 1CZBA 4M7AA 2EV0A 2GBZA 1Z21A 2B63J 2K2MA 3QJ6A 5K5QA 1C0GA 2NS7A 1VQOT 4JBAA 4FWRA 4N0AC 4DR6K 3ULRB 5BOXA 2H94A 5HROA 4FCYA 3W2VA 4XRSA 1ZR2A 5HL7L 2ESNA 3BTLA 4DV2K 1IRXA 4FE4A 5CHZA 3OW2P 1W7PA 1WSHA 2JRMA 4PIIA 3QINA 3ERED 2PY5A 4KH6A 4BR5A 1Q7YO 2WY7Q 1AWOA 1QVPA 3TL4X 1BCOA 3JTGA 1REPC 1PWTA 3FJPA 1KG6A 3HSBA 5EU7A 1QVGM 1D8KA 4HT8A 2I10A 4OMMA 1PKTA 1YI2I 2DZCA 1Y1WJ 1IGQA 4JLHA 3ULDA 2DTRA 3ZL7C 3OW2S 1HMVA 2OBPA 4NDLA 4NCGA 5J8CA 2WTUA 2BZXA 1ZRFA 1YIJT 2DMPA 4HXJA 5I2SA 4LD0A 2BBYA 3Q0UA 2FF4A 4DQ2A 1P6RA 3ONQA 5HVQC 2DU9A 4CCNA 2O8DA 5J4VA 4BQZA 1NTCA 4CRIA 2CFOA 2GXGA 4LH5A 2OZ6A 5M1FA 2JTMA 4KT6A 2JZYA 1KG4A 3VRYA 3THYB 2G6FX 1NKCA 4F52A 3O9SA 2PUKB 3V9ZA 3E9LA 5GJVB 2V1XA 3DXKB 3CWAA 3RKQA 1N78A 1HKSA 1SVLA 1YWPA 2DK3A 5IY5H 1Q82O 4LDWA 3H36A 3DLAA 3OSGA 4CHPA 5KPTA 4OB0B 2KNBB 2E1NA 2DMNA 3VQCA 4CBXA 3SI6A 3OA6A 2P5OA 2JN6A 1M1KO 1QGPA 2UXXA 3M8FA 5DM6L 6AT1B 3G7ZA 1NG2A 9ATCB 3PO4A 3VS6A 3HC7A 3DKXA 4A5NA 1QWEA 3QFPA 4IO8A 2JMWA 2LCLA 2GGRA 1OH8A 2VQEK 1FY7A 1CGPA 4CHYA 1WQ2A 3J81Z 1K4SA 2J05A 4XU2A 3E3VA 3CG7A 2OAWA 4CF1A 2KHMA 5DD8A 3BC8A 4YIRX 2JGUA 1X3MA 1HF0A 2QENA 4DSIA 4WXHA 4JZ4A 5HP1A 3HTRA 3KZZA 3F70A 2Y4XA 3OYIA 3DU5A 4ELVA 2BZYA 5E8IA 2ZJRL 3BZCA 2GQIA 2Y1JA 2R5YB 2KIUA 4FETA 2RQTA 4CZJA 4M75D 4KFBA 2IS6A 1RFQA 3H0IA 3H46O 4YFXF 3CUQC 2VPLA 4RBOA 2V1NA 4A3KJ 2O8BB 2DBKA 3GO5A 5GAMh 4F93B 2VOPA 3T1YK 2X6XA 2LOOA 1XPXA 3DLLF 1ZBUA 2G9WA 2DFUA 3BTJA 1JL1A 3EUAA 1T33A 1VNDA 3JAMZ 3DLKA 1NK9A 5LGUA 1TZLA 2EH3A 4BWJA 4K0KK 3VPZA 2RNAA 1OKJA 4DU1A 2MFZA 4ATOA 2DMUA 1IXCA 1NMNA 4FWOA 4CZKA 1ZQ1A 3URGA 2FSJA 1TWBA 4P9UA 1QP3A 4ZJZA 3ZQHA 3CQ8A 3MKZA 5FPNA 3ID6A 3CCVI 1WCMJ 3LP3A 3K9KA 4KB0A 2RNJA 4H5RA 2D0OA 4M75C 1FMWA 1V5EA 4YOXA 3AY9A 2GZWA 4H5VA 2AS5F 5DLQE 2OPRA 2JUCA 3R6SA 4PJMA 3LP0A 2HBLA 4BR2A 3SDBA 5CK9A 2X9DA 4IHTA 2XI9A 4KT0E 2YNGA 1K9MU 2MC3A 4BEHB 1W7PD 1S22A 4GYIA 2NOIA 3CFRA 3VEPA 4JQFA 4FJJA 1FTTA 4P55A 1BO5O 2VI6A 3K1PA 3P9IA 2R5ZA 4J6YA 2JWTA 4JN4A 1F9NA 3DB4A 1WDXA 1TKDA 3VTIA 3CCQT 5KVRA 2DXCA 2DRKA 2ENMA 2KEAA 3SWNA 2PUOB 4BC2A 3P38A 1IG8A 1RT6A 3W3CA 1YJNI 4BBSJ 4BRMA 3V7CA 2P9NA 1M1KR 3D5RC 5IT9Z 3G71Q 2XSJC 4XH5A 2K27A 1WEFA 4GNIA 2KJBA 3QHSA 2M1BA 3VQBA 2EGEA 4KRFA 3TWHA 2X4HA 4EMHA 1BK2A 3OTOK 3PE0A 3FWEA 1SC7A 1NK4A 2QF7A 1B72A 4ESFA 3QDKA 1Q1VA 2Q0OA 2JA7J 1TS9A 2EYQA 4LUEA 2K4JA 3C94A 1KQ9A 3CC2Q 2ZFUA 4EIAA 3EDPA 4CFAA 4BU2A 1M2VA 1X69A 2QM1A 2EPDA 4WE1A 2E2IJ 2VE9A 2KJCA 3VYSB 2KRMA 3BR0A 5J47A 4N4IA 3JCMf 1S1XA 1ETXA 1C1AA 3OMGA 1J5YA 4EJTA 2LX9A 2Q97A 2MWOA 4A4EA 1PCXA 3F8FA 2ZD1A 1U2WA 5AQIA 3HKSA 1Y39A 3S41A 1ABOA 4FWLA 3QETA 1DU0A 4UC4A 2MYSA 2Y69H 1Y8RB 4WXDA 3R0AA 5EGOA 3S16J 2FBHA 1FWZA 2LK2A 5BN9A 4HNTA 4Z4FA 3ZR8X 4OVLA 3EFRA 4Z4IA 3E5XA 2YX7A 3QU6A 1MGQA 3FBNB 4CZHA 4FX4A 1XSVA 5HBMA 3MXMA 4CJVA 2ECZA 4C3IJ 3VS3A 2QDLA 2FL7A 2VWBA 2QTVA 1D8YA 4DU3A 1XC3A 3T8RA 4NYFA 4L0YB 1PD0A 4OMLA 2MC4A 4CC2A 3VYTB 2PN6A 4JKBA 1BU6O 4AFQC 2R7XA 5M5XJ 2CUJA 2E2JJ 1ZG3A 3PSIA 3K4BA 3FMQA 1IAWA 3QEVA 2B8AA 4M3DA 1ZSZB 1T3VA 2XY5A 2H8WA 2F2XA 5FD6A 1U3EM 4FU6A 2ZNZA 3HM8A 4RLFA 5I11A 3WNFA 3AO4A 2OTJI 1WH5A 3D0SA 5FLXK 5HODA 2FF6A 3PT9A 1W2BM 2QXLA 4IHSA 4JX4A 2YHXA 3ZQFA 4BHPA 1QQCA 5HKCA 3C18A 4VUBA 1VRUA 4E7LA 3K57A 3A5LC 2HYJA 4PJNA 2UXBK 3JRHA 1RI7A 1WJCA 1H88C 1VQ5Q 4XRFA 3HRTA 4X34A 1WHHA 1WEIA 1VSFA 3DWLA 3VDXA 1X1PA 4IVNA 2QYZA 2YPRA 1VQNQ 4DSKA 4DB3A 3MN5A 1LVKA 2W41A 4BUPA 3LAKA 2ZPEB 3MFKA 1VSLA 2XY8A 2XPUA 2EJFA 3A1YA 3ZQIA 3Q1JA 3TQNA 2WOMA 2DJQA 2P8TA 1UOCA 2KI7A 2DLLA 2FZCB 1T38A 1J2XA 3MCZA 3LH5A 2GTDA 4DCHA 1NBWA 1TT5B 3G4SQ 1SAUA 5DCMB 3GF5A 1JLGA 1NOZA 2DFIA 2DPPB 1VQ8I 2YS9A 3A2FA 1ETVA 2HTJA 2BKDN 2J06A 1RT7A 3K10A 4F9OA 2QEXI 3THWB 2CSOA 1U9OA 2FU4A 4NQWB 3BQZA 1X6BA 2EQMA 4A3FJ 2EV5A 3G2BA 1R9TJ 3KP6A 1K4TA 4E9HA 4C8KA 2OZMA 1WSFA 2DETA 3JSMA 3LFKA 5LRSA 2DPDA 2I0NA 2EX3A 3CF2A 2QSGX 2YSQA 1V54H 4BY1J 3EG9B 2VJ4A 1QWFA 3QEWA 2F7TA 3O9QA 1B9MA 5IYDJ 1C1CA 4RCHA 1X6OA 2JA6J 2YUOA 2CV2A 2W4SA 3THVA 3NFAA 3J7ZI 2QK9A 2XGXA 4M7DA 3AL0C 4CJQA 4M6VA 4Y91A 3BF1A 4K42A 3V9WA 3L4QA 4O8KA 2VWFA 2Y9YA 1KAYA 1GBRA 1E2XA 5C12A 1QA6A 4JZ3A 3I0SA 3VS0A 4C0DB 5AFUA 2XVCA 2ASOA 3EG2A 2FOKA 3FJ5A 4C8MA 4ISFA 2O2OA 4X9DA 1NMDA 5IPAA 5CPRB 1YQRA 4ZH4F 4A5AA 3F5TA 1M5Q1 4I7FA 1TQPA 1IJWC 4PJLA 2XKPA 1M2VB 4RDUA 4MTDA 3CMEA 3UDCA 2X3XD 3SDZA 3VQ6A 4DBRA 4LB5A 3D7SB 5AFUH 3CTAA 3NAUA 5AQWA 4BY6B 3CBOA 3LA3A 1BIUA 4C2TA 3K2PA 1QVUA 1NG6A 2Z1IA 4A62A 2NS0A 2XGDA 2NWMA 4M77G 3ZSZA 2QQRA 4QOZB 2O4IA 3I53A 4LK1F 2KRHA 3D4VA 1HCRA 4BGAA 1IF1A 5DUIA 2M8GX 4RAZA 4MHGA 3X25B 3WVEB 2XC7A 3CMMA 4A63B 4CGJA 4JEPA 2EGAA 3GFJA 5FKOA 5GAMd 4LFAK 3BG3A 1EZZB 1DGRM 1V5FA 3QYHB 1Y57A 4KTZA 4CGDA 2OTJQ 4U0VA 3QEXA 3QDFA 2M30A 2E88A 4ILHA 1GLCG 1X2NA 4IHWA 4PL7A 3PMTA 5KE3A 3ZSVA 3LAJA 5J1RA 4X6AJ 1E3HA 2K6DA 4KKOA 3I56A 3SZTA 2MD0A 3DPTA 5FGMA 4FWSA 4J9HA 2M9UA 3G73A 2TCTA 4LFCK 3HOVJ 1K73R 4BVOA 2E1HA 3TPQA 1ZLKA 3E5UA 2O8FA 3MEDA 4N9IA 4KJZA 3UF4A 1S1UA 3KZBA 2QW9A 4PFOA 4MLOA 3FGUA 3J8AA 4DBHA 3GTOJ 1ODDA 3JAMO 1VQKA 5J2MA 3MMYB 3JW4A 3E0JB 1ZTRA 4JI6K 2MLGA 4IXCA 3OYCA 2EQIA 1D5AA 3G4ST 3NAEA 4HNUA 2QTDA 4UUSA 3LOCA 4DW6A 1SKSA 1YRNB 3JCMb 1ERDA 3HSCA 1YITI 3HP9A 1MUYA 2OTLA 2QA4A 1N33K 2VT2A 3AO3A 2K3FA 3BOQA 4C1NK 4B9UA 3NTKA 1P90A 1BOTO 4EMGA 3CC7Q 3UWNA 2G3RA 2YRCA 2FNPA 3WTXC 4PL6A 4GO1A 4OIRF 2DT7B 2QG9B 5EJCA 1JJ2P 2O9LA 1J5OA 2DTUA 1U45A 1HQCA 3GW2A 4F2RA 1VQNT 3FLCO 1RCHA 2RHXA 1J0RA 3FXRA 3DCFA 4IX7A 3E2UA 3KVGA 3LDOA 2LR8A 1T05A 1NOYA 3KP7A 2BGCA 1HR0K 2JN0A 2GV9A 1DKGD 5D5VB 4AM7A 2EA2A 2Z99A 4CGZA 3M58A 1NGCA 4JLGA 3WUHA 1IO2A 3SXYA 1NK2P 1I8FA 4HDUA 4JP0A 1PD1A 2HKOA 2LP5A 5BRFA 1BJZA 2G8HA 1TW2A 4CJTA 2YNFA 2ITMA 1FSEA 4A4KA 2W42A 1SMTA 1MKMA 3WODF 3J7AO 3S2WA 2WAEA 4PKIA 2F8SA 2F4MB 2AIRB 1WSEA 2M0MA 1JL2A 3MAJA 2B0LA 1BJAA 3SJJA 4YPHA 1NJZA 2V75A 5CQXA 2P5VA 3TO7A 2P9KB 1WIEA 4J9GA 4Z4HA 4JDSA 4PJOB 2RN7A 1SD5A 3QB0A 4O6JA 2C0IA 3S3OA 2K02A 1RAFB 1RRQA 4FYVB 2PLYA 2DA2A 2IIMA 1W97L 1E3PA 1UGPB 3BPVA 1VK0A 3RKXA 3O1BA 2HVQA 4JRPA 1D1BA 1ETOA 4C9YA 1H9GA 1GXPA 4AIJA 1KU2A 4CEBA 4DKWA 5BREA 1K6OA 3VF2A 3DXKA 1TUCA 3BDLA 4MFBA 1UGSB 5L3GA 1Q81C 2GWKA 4FVUA 5GAHJ 1FBUA 4OAZA 4FK2A 2BVMA 3CJTB 4BRPA 2R7RA 2CUFA 2P9UA 2IVMA 1WHJA 2Z5UA 1VQ7A 5ICGA 2MCNA 3C3WA 3B6CA 3DP7A 1NM1A 4M77A 2RHIA 3TSUA 1NKEA 1J3TA 1IGNA 1JCEA 1FEXA 2HPIA 1AWXA 1K8AC 3BFMA 1YTYA 1V76A 4B1RA 2X78A 1JLAA 4EJVA 4B1WB 2QSHX 2CH4A 2XAUA 3M8SA 2X4WA 1S7EA 3A5ZB 2RV8A 2DXUA 3H0FA 1TXQA 1HXDA 3NEUA 2X35A 5KH6A 2VQHA 2YJEA 2KRSA 3U9GA 3EL2A 2EGCA 5FLXZ 2P9PB 3CCVQ 3ABMH 4LD5A 1NK6A 4C8NA 4LF9K 1IN5A 2BY1A 2DK8A 4M7AD 1T0FC 4F8RA 2D6FA 3MCPA 3BG9A 2XHCA 3WNGA 1B9FA 2RHZA 4M7YA 4OOIA 1ASVA 1IBLK 1EA3A 2G7HA 4BRIA 3LDQA 3CC7T 1XGNA 3BLYA 4XKWA 4OIPF 3WG7H 4N76A 4Y7NJ 2FSKA 2HXOA 3LPTA 2QQSA 3I5UA 3U2RA 2AQEA 1OZ2A 2YT6A 3A5OC 2KMTA 4IRIA 2HBWA 3HP6A 1YS7A 5CAIA 2D45A 1R1UA 2R3SA 2GUPA 1UFFA 1JJ2M 3THWA 4ELZC 3W2WA 1ZBSA 5LJ5j 1L3TA 3HOXJ 3VYRB 2COYA 4RGXA 3K4KA 4LIVA 1K73C 3BE3A 2FC0A 1L3UA 1VQPN 3PUFA 1WJBA 3CVSA 2OA8A 2A0FB 3L8BA 1NPRA 3L1PA 1I0CA 1WZOA 4MGRA 3AO5A 2K5CA 3MN9A 2OANA 2L7ZA 1VQLT 2EBPA 3CIPA 1ATSA 4Y92A 3PO5A 4PSWA 5IYBJ 3JSCA 1Z9CA 5LJ5d 1MBJA 4L8RB 4LIUA 4M3FA 1TAQA 3TDUC 3LP1A 3HUGB 2HQXA 1V4RA 4KREA 2O5RA 3U9ZA 4CEFA 4UNOA 3FX3A 3OYBA 2DE0X 4CJPA 3Q9VA 1T39A 4XICA 2XDDA 4KHPK 3QYFA 5DTDA 2Z1HA 1RABB 3OS1A 2OJ2A 2QA4I 1Q86C 3PLAA 2D0AA 2CYZB 1JLBA 1PUFB 5CE3A 5HLIA 4A69C 1RDCA 1M90C 1N5YA 4G6DA 4JYAK 3IH3A 4JKGA 4Y13A 4B3SK 4Q5VA 4JI3K 4NLBA 1MV3A 2M45A 1Q82R 5IP9J 3EN9A 1QHAA 1ZKGA 2VCPA 2HBJA 5HCKA 2QWMA 1BL3A 4U88A 2BANA 4CDGA 1RT5A 1QSSA 4BROA 2O8CB 1QQNA 1BIAA 3HOTA 2JNGA 1JXSA 1G3SA 3ZEUB 1HYZA 4MTEA 4C0GA 4DBQA 1U78A 5LL6S 2E6MA 2P0WA 4N4GA 3PVQA 1LAVA 1KYZA 1I39A 1XD7A 1K0XA 3KEOA 2QI2A 5MLCQ 3BGRA 1W2BP 4F7UA 1KQ1A 2WADA 3TSPA 2YWWA 1I6XA 3HRSA 2UUCK 3PFYA 1U8BA 4AHUA 1P9QC 8AT1B 5E8GA 3P9KA 5GADP 4PCQA 5FU6B 5GINA 1RUWA 1F4KA 3SBGA 3VESA 4B22A 1PU6A 2EIFA 3DB3A 5KNLA 1V4TA 3VYHB 1YJ9A 3WXIA 2KRCA 3HOZJ 1HQEA 4ZN3A 1ATNA 2PJPA 2QKBA 2XPVA 4Z4CA 3TW7A 1KHIA 2P4TA 2L9VA 5LFAA 1FTZA 3LDPA 3M4GA 5LJ3f 3CPFA 2EINH 2ZB9A 4OWRB 3F10A 3SDGA 3KLEA 1BDGA 2HCKA 1VQ4A 3HOSA 3K70C 1X1CA 4U7DA 3CCUA 4BR7A 2JK3A 3K9JA 4JV5K 2HS5A 4KH1B 4HV6A 2DOEA 1X2QA 2E5LK 3IWFA 3W2AA 4JS4A 1BGXT 1TK5A 4J2BA 3RRHA 3IRXA 2KY9A 1K78B 5DCFA 2AO9A 3AVBA 2OTJN 1X2KA 4M7DG 4D1QA 3QO3A 5FLMJ 3JRZA 3JRIA 1L3VA 2V8JA 3EFOB 1XNQK 2DA6A 1UHCA 4I6MB 1UB9A 3HT3A 4IL6C 4KAZA 4HCBA 1K8KB 2RPIA 1F21A 4BREA 5HLTA 1TOVA 3KKRA 1B9NA 2ZCWA 4M77B 3CQXA 1KG1A 1C0TA 2V8KA 1QVGA 1PU7A 1TL8A 4RLQA 4NZGA 2O4XA 4RTTA 3UB5A 2H3JA 1QQJA 1U5TA 2ZBKA 3BROA 2KFNA 1NG7A 3O08A 1XCVA 1ZSZC 3LANA 4EMSA 5M1PA 4ELUA 2P0KA 3M8EA 2W24A 1IGUA 4LF6K 1QCFA 1OCRH 2K57A 3FZFA 4RB1A 4CF9A 4QVCA 2YX4A 4RTUA 2MD5A 1Q1HA 1MV0B 5LGTA 4B3MK 5HS7A 3LWIA 3IC7A 3O80A 2JUFA 5H20A 4HPQA 1PKSA 3DI6A 1U0JA 1DT9A 2BY2A 4FM0A 2DIGA 5IP7J 4F4KA 3C0BA 1TYQB 2GEMA 3HHGA 3SAFA 3VEVA 2QZ8A 4FJIA 4UOBA 5D6XA 1QVFA 1FT9A 1DQUA 1R23A 4AUXA 3LSMA 1Y0UA 3CMEI 2HSPA 2ID6A 2X1CA 5GMKj 4PJOF 3K5OA 4M77E 3CXCS 4R5PA 4K41A 1K73O 1XTDA 3OSVA 4M78C 4I2OA 3VEXA 1UHMA 1HNZK 2GCXA 1Y97A 4YDUA 3CCMN 1FN7A 1RNLA 5JLWA 4I02A 1PNJA 1KYWA 4ZGDB 5AQZA 2WAQN 3C7JA 1W5SA 5HDKA 2NOFA 4ANJA 1BA5A 1IH7A 4ILJA 1B92A 4O3MA 3L7WA 1M4ZA 1KU7A 2PX9A 2LBFA 2HMPA 2K5FA 2RQVA 4EJZA 2KZZA 4M3UA 4FWNA 4L0ZB 1J6ZA 1NJIR 4ZYHA 1HSJA 1HC8A 4CXFA 4IURA 3TSZA 1UA1A 3E9FA 3LPUA 3F72A 3VUBA 4YNQA 4L3QA 3I55N 2VQFK 2EAYA 5D4SA 2IVOA 2HNIA 1FC3A 1KGSA 3V9SA 1IW7F 4A4HA 2CZ1B 1BC8C 1X6GA 3SQ4A 3F8CA 2Z0WA 3KD1E 1S72A 3CC4A 2HXIA 4RGRA 3SFZA 2HSEB 3AAQA 3I4PA 2Y2ZA 1JJ8C 3HTUA 1U48A 2OAZA 3UPUA 3C1DA 2D1XA 3GOXA 1WOQA 1HKCA 1VQ5N 3MEEA 4KIGA 4NUBA 1RZ4A 5KGWA 5FKMA 2NRVA 1XC5A 4P5NA 2P9KA 4CCLA 2NUPB 3HPGA 4G6QA 5AN4A 2H3EB 1BI2A 2ZPIB 4YEJA 2R7YA 4NB4A 1JXMA 3FXUA 3JCUC 2KTQA 4PJOD 2PI0A 3ZFJA 4EPCA 4V19S 1VA7A 3HTVA 2YSRA 2XY7A 4AHTA 4DQIA 1SUQA 3KUFA 2CRGA 2A6EF 5SWMA 3LFUA 4PUSA 5FROA 2FBVA 1NK7A 2CH6A 1S9GA 3OH6A 2VYTA 3CC4T 1S72T 1HNIA 1ASWA 1WSIA 2RF2A 2FB7A 4R8HA 4AIHA 5EVZA 1GVJA 2ADUA 4IUQA 1RKTA 3AVGA 4P5OA 1JLFA 1QVTA 3QBYA 1F1BB 3IUOA 5ICFA 3MKYB 3HL8A 3K0SA 3JB9G 2OD5A 4KITB 4QQGA 1OCCH 2V51B 2GFUA 4BS9A 2K3BA 4TSXA 1BI4B 2OU2A 2IEKA 2H1KA 2EQKA 3WXLA 1QKXA 2Z1GA 3KFWX 2Q0RA 4M3RA 5CVIA 3IH4A 3MP6A 1K7AA 1M30A 3S8PA 4OMFB 4MZPA 1B8IB 2MA3A 3CJ7A 4EW4A 2OI3A 1ZELA 4FT4A 3CPWP 2BH1A 5GMKi 4JJDA 3VERA 5B1BH 4E19A 4B6MA 5J4YA 5HK3A 3HYFA 4YFUA 3JCMJ 4NC8A 4GVEA 3KE2A 2QCO