3S3OA

Crystal structure of the prototype foamy virus (pfv) n224h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/inhibitor/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3oA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3oA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3oA03
4OGCA 3TARA 2BUDA 1W9HA 3AVGA 2DTUA 1GOBA 1Z26A 4Z0UA 3PV8A 3BDPA 3SPZA 4FJ9A 1QSYA 1QS4A 3PO4A 2F8TA 2HQXA 3LZIA 4PL6A 1VRUA 4BD3A 4IBNA 2OZMA 4M3YA 2E5QA 1B9DA 4CHOA 4C5HA 2D0AA 4FJJA 1OI1A 2GUIA 3DB4A 4QOZB 1RBTA 3V6DA 5JS2A 1A5XA 2F5KA 4UQGA 2RI3A 3M8PA 3RMBA 2P5GA 1R0AA 4HUFA 4KHNA 3T1AA 3VQ7A 1HRHA 4LSNA 1WAFA 3DLKA 3TABA 5K14A 3TWHA 1U49A 1T8EA 1WSHA 2E6NA 3OYFA 4FCYA 1BI4A 3LP1A 1JL2A 5FRMA 3AVIA 4M3XA 1QHTA 1RT5A 4YFUA 2JLEA 3ISNC 4C8NA 2LDMA 3WNFA 1WNSA 3SUQA 2YV0X 1QTMA 4DLGA 1NOZA 2RJDA 4FJXA 3HPHA 3DLHA 2EQKA 1WJRA 4OJRA 2B6AA 4FVMA 4CJWA 3AA2A 1ZBHA 3OYEA 4BDZA 4DWIA 2FBYA 1UAXA 1L5UA 4Z4GA 3OYLA 1IO2A 5SWMA 3LWLA 1D5AA 3FDRA 5CYQA 5CYMA 2B5JA 1LW0A 4E7JA 1A5WA 2XO7A 1S1WA 4E19A 1OZ3A 5J1EA 3NTHA 1JXEA 4Q5WA 2X4YA 4B9VA 4CEAA 1D8YA 1WSIA 2D5RA 2JZ2A 3U6FA 4FXDA 1SSFA 1RTHA 4CEQA 3UIQA 3AO3A 2XY6A 1CXUA 1DTQA 3PX6A 3MXJA 2F8SA 1VSDA 4DQRA 2AJQA 4QW2A 3OYAA 4AHTA 3DRRA 1TKTA 1S1TA 2BIVA 5HROA 5D6YA 4DTPA 4IFVA 2KQ2A 2DFEA 3VQPA 3LPTA 2XY5A 3H8ZA 2KTQA 3AVAA 4ELUA 4DFKA 4HVJA 3V4IA 1XHXA 3NTKA 4M3TA 3T19A 2Y1IA 2VWJA 3SCXA 1XHZA 1B92A 2PQWA 4IFYA 3EZ5A 4KREA 1TK0A 3IRXA 2B4JA 3P1GA 4E3SA 1NKCA 3ZSVA 3MXIA 4IUPA 4BE0A 3K2PA 3MO8A 2QQSA 2L3RA 1S6PA 2M1HA 1FKOA 3QEPA 1T03A 5D6WA 4XIUA 2R5AA 4J2EA 4QVZA 3NF9A 2EQUA 3AVJA 4AH9A 3AA4A 1EP4A 1HYVA 3D0PA 1GOAA 2GV9A 2IG0A 1TK5A 3OMGA 2X4XA 5HBMA 2B8AA 3BGRA 1FXXA 1Q9YA 4DSEA 1F21A 1QE1A 4ID1A 3SQ1A 3HO1A 3RTVA 3M9QA 4LD0A 1C1AA 4QAGA 3KJVA 3RR8A 3CFRA 5C6SA 2FC0A 1NK5A 3KLIA 3RRGA 1BI4B 3L2VA 1JXBA 1D9DA 2IOCA 1HYZA 4FK4A 2Q3SA 3PNWC 2YHBA 4F3TA 2QKBA 4CFCA 4HHTA 3SJJA 3KK1A 3SI6A 1TKXA 2RJEA 2MWPA 3THVA 2RI5A 2FBVA 3ZCMA 2EFIA 4AHUA 5KRSA 2HHTA 3AV9A 4NCGA 5KTQA 2RJCA 4QQDA 4E0DA 2HHUA 4QCLA 4CF1A 4ZHRA 2HVHA 2HHQA 4O0IA 1NOYA 2HNYA 3LANA 5I42A 1SUQA 3FC3A 1BCOA 2E4LA 3NFAA 3P83D 1S6QA 4AHCA 1FKPA 1BIUA 3QEIA 4IUQA 2G3RA 2A1SA 2G8UA 4OKEA 4NCBA 4N5SA 4C5GA 3KLGA 1TAQA 1U47A 3LH0A 2YNGA 3TI0A 4CJQA 4IURA 3L2UA 3EAEA 2P51A 4FK0A 4E1MA 3QETA 4UC4A 4RW8A 4OVAA 4RW9A 4WE1A 5HRPA 4DSLA 4CRIA 4CGDA 3QESA 3MEUA 3DM2A 1VSIA 2Z1GA 3LLRA 5D3GA 2O4XB 1QQCA 3LP0A 3EYZA 4KI6A 5T7BA 3K57A 1OZ2A 4E7LA 1C0UA 5C42A 4PQUA 3NE6A 3NGZA 4W5TA 3OYJA 4FJ5A 3LX7A 3AVBA 3WNGA 3SQ2A 4DTUA 4M3UA 4CJLA 1A5VA 3TAGA 3M8SA 3LAMA 1CZ9A 3C94A 3HK2A 4Z4EA 4FM0A 1RILA 2DIQA 5KCHA 1BHLA 3ZT1A 3G10A 4BE1A 4B8AB 3HYFA 4CK1A 3U3YA 4CEFA 3NF7A 3SV4A 4DS5A 5CZ2A 1RBVA 4Z4IA 2LVMA 1TV6A 1DTTA 3C4SA 3DI6A 5E41A 4DU1A 4BDYA 2G8VA 3MAQA 5I3UA 4CK3A 4FJIA 3P8HA 1Y97A 3KD1E 3C95A 1B9FA 1IKXA 1C1CA 2FBXA 3L8BA 3T3FA 4OKKA 1NK4A 1WSEA 1X9WA 1BCMA 3L3VA 4IG3A 4K8XA 4FW1A 1HMVA 4C8LA 4FLVA 1J54A 1KVCA 3V9XA 3LZJA 3LDSA 4KHQA 4B8CA 1BQMA 2K3XA 3M8QA 3CQ8A 1NK9A 1BIZA 3PFSA 4B9MA 2DAQA 1RTJA 1L3TA 4B9NA 2RHXA 1LAVA 3E9FA 3OMCA 4CJPA 4O4GA 3CM6A 4FYDA 4CGFA 3QNOA 4FJHA 4CESA 4QQGA 2NUBA 3DYAA 3QEVA 3NAEA 1J53A 4BWJA 4HTUA 4AHRA 1I39A 2EX3A 1TK8A 4CF0A 4KTWA 4RG2A 3WNEA 2IC3A 5C25A 4CCHA 4CJFA 5HRRA 4CJRA 3OB9A 3VQAA 1RDBA 5FRNA 4PA1A 1TAUA 2LTOA 1JLGA 4KTQA 4EP4A 4CFAA 5CZ1A 1WSJA 3PMIA 3NH2A 3FLGA 4E1NA 4CFBA 2BKDN 1U4BA 4FLTA 1ASVA 3TAQA 2HNZA 2F96A 3CM5A 4CJKA 3KD5E 2K3YA 3NHGA 4C5IA 3JSMA 4DSKA 4KO0A 1U48A 3LP3A 4Y1DA 3SUPA 1UA0A 1TGOA 1SL0A 4ID5A 3NH1A 1WGSA 4OPJA 1VSMA 4CJ4A 2ZE2A 2Z1IA 4CFDA 3OY9A 2P0KA 1SL1A 3LALA 4N4HA 3QIIA 2YKNA 4Z4CA 3PY8A 4H8KA 1U04A 3P8DA 3CEYA 1S1UA 2OPPA 4HUGA 3OYCA 3ASKA 4IDKA 4FLUA 4PY5A 2BANA 4DTXA 4B08A 3KKSA 4J2BA 3KLEA 1ASWA 1VSHA 3K5LA 2RN2A 3QEWA 3RMAA 4RG8A 3OJUA 3HPOA 3DLMA 3HJFA 2ITGA 4C8MA 3ZSRA 4BE2A 1YT3A 1HYSA 3O8VA 1RI0A 3NBPA 4FJGA 4CK2A 3SPYA 4LH5A 4O55A 2VG6A 3OYIA 3SYZA 2WOMA 4DTSA 3NNQA 1ZYQA 4DQIA 1VSFA 3QJ6A 2XDPA 1G15A 3S3MA 2HHSA 3V81A 3DOLA 5IN1A 1BGXT 1T05A 1CXQA 3HP6A 2P5OA 5J2NA 3VQ5A 4CEZA 4DF4A 3KK2A 3LAKA 4FM1A 3EY1A 3VQDA 2VG7A 4OLAA 3LP2A 3MECA 3O4NA 2HB5A 1JLEA 1C1BA 3V9SA 4DFJA 1X1PA 3MEAA 1X9SA 3CFOA 2X6SA 1WSGA 1K6YA 4DQQA 4J2AA 3E01A 3OYBA 1LAWA 3H08A 2OPQA 1RNHA 3QNNA 2XY7A 4ELTA 4IUVA 5KE2A 2XK0A 4ICLA 4I7FA 4DG1A 4CJTA 1NJXA 3OQ5A 3NGYA 4TSXA 4FJ7A 1KFDA 5DK5A 2OPSA 4KB1A 3PX0A 1C0TA 4OVLA 5D6XA 3VQBA 4CIEA 2YNIA 4F4KA 3O3GA 5C24A 4DS4A 4B9XA 1HPZA 3S6WA 1SKSA 4M41A 3CYMA 3VQEA 3HXMA 4CF8A 5J39A 2GFAA 2XHBA 3IAYA 3MEGA 1KRPA 2FBTA 4KHSA 2ETJA 1S9EA 5CY4A 3D45A 4EDUA 3SNNA 1BQNA 2Z1JA 1BISA 1VSEA 4DF8A 2BE2A 2YNHA 3HL8A 1JL1A 3ME9A 5J2MA 3CFPA 3KLHA 4L8RB 2G8IA 2R58A 2YRVA 4DMNA 1Z25A 4OPKA 4M3WA 4C8OA 1L3VA 2ZQBA 3AVNA 1NKEA 4A4EA 3OYGA 3F9KA 4N4GA 4E89A 2KFZA 1N5YA 2RJFA 1J9AA 1SKRA 3MP6A 4IUUA 1KHCA 2RHZA 4AILC 4CIFA 3H6ZA 4B9WA 3C6TA 4KHWA 5KCOA 3S3NA 4JS5A 3K59A 1RCHA 1YTUA 4RW6A 4W5QA 3IG1A 4O0JA 3L2RA 3AO2A 3NH0A 4PWDA 3UT1A 1TKDA 4CJSA 3HVRA 4I2QA 4B9SA 4O5BA 3E9GA 3OYKA 3OYNA 3LGFA 4FZXC 1HJRA 1VSKA 3KLFA 2IGIA 1C6VA 4MQ3A 4RW4A 3AVFA 4Z4FA 1J5OA 4CJ5A 4LH4A 1L3UA 4FLXA 4CF2A 4AHSA 5HLFA 4EP5A 3S3OA 1BL3A 4BDPA 1QSLA 2ATQA 3VQ9A 3FEOA 4FLZA 1H3ZA 1HNIA 1KVBA 2R57A 4B9LA 4OKJA 3SUOA 4PLLA 3OS0A 2KW4A 2HW3A 4JRPA 4YNQA 3MXMA 3TR8A 4R5PA 3VN5A 3QERA 1RT7A 3RRHA 4NYNA 4FJMA 2O4IA 3AVMA 4NS5A 2X4WA 4BWMA 3VQ4A 1RT2A 1YVUA 4JLHA 2OYQA 5KGXA 2QK9A 4Q0BA 4H4MA 4O44A 1RTIA 2KFNA 2RKIA 4F2SA 4II1A 3AO4A 1TKZA 3AA5X 3DRSA 4FU6A 3DOKA 3HT3A 1X9MA 1WSFA 1Q9XA 3PO5A 1UOCA 1RDDA 4F2RA 2VYTA 3ASMA 3NCIA 4LD6A 1CLQA 3HPGA 1JLCA 3HVTA 4DU4A 2QKKA 4QQ6A 3DMJA 1RT1A 2HHWA 2YNFA 3P5JA 1QSSA 1N27A 1SV5A 1ZBFA 3OS1A 4DSJA 4LY7A 2LCCA 3V1OA 3LWMA 5FROA 4ELVA 2A1RA 1TL3A 1EETA 1DLOA 3G0ZA 3MP8A 3RWUA 4FJNA 1NK7A 4M42A 1JLAA 4A4GA 4NZGA 3MEDA 3DLEA 3ZSXA 4HCBA 4B3OA 2G8FA 4CEEA 3M8RA 1NK0A 3B6OA 3ZSQA 3HM9A 1NJZA 2RI2A 2GBZA 4FL6A 4B9UA 3TAPA 1JLBA 1ZBUA 2LSNA 1OYXA 4M3RA 3SZ2A 3NGIA 3MEEA 3OVNA 3PMTA 3K5OA 3UWNA 3LPUA 3V1RA 4W5NA 2RHUA 3AVCA 3NDKA 4KPYA 4FW2A 3HSTB 5DMRA 1UWBA 4FZYA 5KE3A 4GW6A 3SQ4A 1MU2A 4E7HA 1O1WA 4IUTA 3O3HA 3TAFA 3L2QA 2L89A 3ZSYA 1RT4A 3I0SA 4DSFA 4I2PA 1NK6A 2XRIA 1MHNA 1N6QA 4DTNA 2OA8A 1ZBIA 4N47A 3DLRA 1JLQA 3K58A 3OJSA 1IG9A 5JS1A 4CJ3A 3AVHA 4M3ZA 2R5MA 2O4GA 2PY5A 5FDLA 2EQJA 2OPRA 3IS9A 4DTRA 1LV5A 1HNVA 2G8WA 1KSPA 3BDLA 1RBSA 4FZZA 3DB3A 2NLUA 1XI1A 3QKJA 4CEOA 4N41A 1LWCA 2D0BA 1W0HA 1C0MA 1KCFA 4DTOA 1LWEA 1UA1A 1EX4A 2MWOA 4AHVA 3AVKA 2BDPA 1WN7A 2QQRA 1RT3A 1VRTA 3I0RA 4E7IA 1I3AA 4Q5VA 3ZT2A 3V9UA 4A4FA 4W5OA 3RMDA 5CIUA 4GY5A 3L42A 1RT6A 2GFUA 4HUEA 3QEXA 3QBYA 4CERA 4N56A 2D9TA 4JS4A 1ZBLA 3MEVA 3V1QA 2YHAA 4CGJA 1YTAA 3ZSWA 4DU3A 1IKVA 3KK3A 4ZTJA 1TVRA 3DLGA 4CGIA 3SQ0A 4EZ6A 1HQUA 4OLBA 3K5MA 3ZSOA 2DY4A 5KI6A 3ITHA 4G1QA 3ZEHA 4CHPA 1G5VA 4KKOA 4JRQA 3KIOA 4GMJB 2O4XA 2WONA 3ZT4A 4CEBA 5J2PA 2IDOA 2X35A 5SZTA 4FM2A 2VG5A 5IAYA 2E6MA 3ALYA 3TAMA 1JLFA 4Y1CA 3MP1A 1RDCA 1S5JA 4I9QA 5C0MA 4H4OA 3TANA 4DTMA 4KRFA 3NF8A 3VQCA 2L8DA 4IG0A 3SV3A 4C8KA 2IAJA 3PUFA 4CHNA 5KH6A 4MFBA 4DQSA 2DFFA 4GVMA 2D0CA 4DFPA 4CIGA 2YKMA 4CECA 4J2DA 1RBUA 1NK8A 3V9ZA 2WACA 2Z1HA 1KFSA 3O3FA 3AO1A 2KZMA 4CHZA 1LW2A 3L3UA 1NJWA 4LSLA 3META 1RTDA 2LRQA 2HQEA 4B9TA 5J26A 2RHYA 3JYTA 4PUOA 1JKHA 3CG7A 4M45A 3HP9A 4PLIA 2R7YA 2CKKA 5M9OA 2W42A 4Z02A 3LYIA 4KFBA 3F70A 4CJEA 1TL1A 4N4IA 1KLNA 3OYDA 3VQQA 1U45A 3OYHA 1IKWA 1NKBA 4KTZA 1RDAA 3QO9A 4NYFA 2JTFA 3I8DA 2G8HA 2G8KA 1ASUA 3AVLA 4A4HA 1IH7A 2GF7A 2X6NA 3QINA 2RO0A 1REVA 1NJYA 4FJ8A 4HCZA 4BACA 3PX4A 1WJQA 1VSLA 2XY8A 2JGUA 3TAEA 4ZTFA 3NTIA 1IKYA 2IS3A 4CGHA 4KB0A 3ZSZA 2E6LA 4IKFA 4KV8A 2HHVA 4I9LA 2PYLA 2X78A 2FHDA 2DFHA 3O4QA 3KUFA 3L2WA 4C5EA 3K5NA 3KKRA 3VQ8A 2BGGA 1WJSA 3RR7A 3ZT3A 4EZ9A 4E7KA 1CZBA 4CEDA 3GOXA 4DLEA 4CF9A 1S9GA 2EHGA 2P1JA 3KTQA 3NF6A 2Y1JA 2DIGA 1KTQA 3WNHA 1SKWA 4CE9A 2VWKA 3QLHA 4CJVA 3Q1JA 4F8RA 3VA3A 3B6PA 4Z4HA 4FLYA 1XC9A 3AO5A 1RBRA 3OS2A 5KRTA 3QIPA 1L3SA 1KVAA 4FJKA 4NCAA 1S1VA 3SD4A 3DRPA 2X74A 4KHUA 2QXFA 4N76A 3SUNA 5KGWA 3OYMA 4RW7A 2ZD1A 1FK9A 2KZZA 1XWLA 4X34A 4FJLA 1XNIA 2EQMA 1EXQA 2HVIA 5HRNA 4CJUA 1D9FA 2RPIA 2EKOA 4DQPA 4FLWA 1SL2A 1HQEA 1WAJA 3OA6A 4DSIA 4HCCA 4FK2A 3DLBA 4DFMA 1LWFA 5HP1A 1EKEA 1T7PA 5EU7A 3AA3A 4L59A 2I5JA 3QIOA 2HNDA 4CGGA 3FFIA 3VA0A 4DTJA 1GOCA 3RMCA 4F3OA 4K8ZA 2M0OA 1Q8IA 1VSJA 1KLMA 3ULDA 1ITGA 3V9WA 3A2FA 4KHYA 3U3GA 1WLJA 4CHQA 3VQ6A 5HRSA 2HHXA 3C6UA 3ZT0A 2HMIA 4W5RA 2OZSA 2M16A 3MEWA 4KAZA 5J2QA 3S9HA 2PZSA 3F73A 2PYJA 4KI4A 4CHYA 3LGLA 2RHIA 1S1XA 2RF2A 1VK0A 4OGEA
chains in the Genus database with same CATH superfamily
3TARA 1LVAA 2RQUA 2VE8A 2DTUA 1GOBA 5KK1A 4OOIA 5TKYA 4IZ9A 4NL3A 3BDPA 4LDXA 2GOMA 4KGZB 4BL0B 1S22A 2HS5A 5HS8A 2PMZN 7AT1B 2MC4A 3K4BA 4LLNA 2X1DA 1UG1A 3O9TA 4ETSA 1WGXA 1VRUA 4AF1A 1BK2A 1VQPN 3H0IA 2M30A 2E5QA 1OFCX 1CGPA 4PFZA 1VQMN 1M1KO 2CW7A 4FT4A 3LSTA 3URGA 5AQJA 1FTTA 4CZZA 1QP2A 3SDZA 3D0SA 2GUIA 1SAUA 3BR0A 3HOUJ 3DB4A 4E7ZA 2EPFA 1ACMB 2HFHA 1RBTA 1A5XA 2EAYA 3M8PA 2ZJQF 3SDGA 2A69F 5FFXA 2FPEA 2DPDA 1VQ6Q 3KYDB 3AG1H 3X20B 4UV8A 1X3NA 3FZVA 1M4ZA 3T8RA 2QSHX 4BY6C 3MKZA 3DLKA 2DRKA 3TABA 1B3QA 5BRFA 2AS5F 1T8EA 4CZJA 2Z3YA 2FSKA 1Q95G 4FCYA 1OR7C 1BI4A 1VF9A 3V7CA 4M3XA 3R6OA 9ATCB 4YFUA 5JVGF 2JLEA 1TSFA 2YV0X 3NMUA 4DLGA 1NOZA 4MZPA 3JCMQ 2EQKA 3CCQT 1X69A 3SB2A 4OJRA 5FU6C 3LQQA 3S2DJ 3CCRQ 3AA2A 4BDZA 1SEUA 3MN6A 1S6LA 1NE8A 3LSJA 4JYKA 1L5UA 3GTMJ 4II3A 4Z4GA 4IXCA 2BE7D 1AHJB 2DI3A 4EQQA 3P31A 6PAXA 5SWMA 3WUHA 3CJ9A 2DD4A 1E6HA 2HYFA 5CYMA 2B5JA 3ZPLA 2CJJA 2V6CA 5AZIA 3K2ZA 4Y92A 4JI7K 4E2FB 1A5WA 1S1WA 2DOEA 3CCJI 4I6MA 1V3FA 1ZLMA 1HW1A 2ABLA 2QW9A 3D2EB 2JZ2A 5IT9O 4A3MJ 2VGMA 2LX7A 3IUOA 1UHCA 3CJRB 1SSFA 2Y31A 2KDZA 3AO3A 4A12A 3GTGJ 1H641 3F5TA 1BBZA 5L8RE 3VF6A 3MXJA 2QAZA 1XMXA 2YX7A 3DLAA 2O9LA 3M57A 2GLOA 1YHQQ 1SD4A 2HDAA 2LP5A 3JRDA 3X24B 3EFOB 2QGGA 3G1LA 4FM4B 1S1TA 3I55N 2MIOA 2BIVA 4JPBW 2XAJA 2UYTA 4DTPA 2DPNA 5GAN4 1LDDA 5CLSA 1HJDA 3HEFA 4CVNE 1VQOQ 3LPTA 1XCBA 2XY5A 3VOEA 3JCMW 4CCMA 3FR0A 1W1FA 2ZJPF 2HDCA 3KZZA 3EG3A 2X48A 1QZ5A 4WCEL 1OYIA 3V4IA 4XM3A 3T19A 2Y1IA 2VWJA 3SCXA 1KU2A 2BH1A 4BG8A 1EH6A 1USSA 4KREA 5GMKh 1IBKK 3IRXA 2DX1A 1KYWA 1XQPA 1TWAJ 4IUPA 2TCTA 5A2QK 4BE0A 3K2PA 2P9PB 2JA2A 2JT4A 3PT9A 5CVRA 2AK5A 1T03A 2R7ZJ 3AKZA 4YOVA 2Y9ZA 3NF9A 2EQUA 3AA4A 2IVWA 1B59A 2JPBA 1EP4A 3FJ5A 3H3ZA 3VS3A 3E7LA 4P55A 5M1FA 3UDCA 3D0PA 5EDNA 1GOAA 4J9GA 2GV9A 2LBFB 2GWKA 2K9NA 1JXMA 2X4XA 4WF9L 1FXXA 2XRLA 3S2HJ 2OQGA 4CC4B 3QBXA 1F21A 1QE1A 1ZREA 1GCPA 3QPLA 3B6AA 5CHZA 3HO1A 3RTVA 1V55H 3J8AA 4JJCA 4BRQA 1ZA2B 5AQWA 4X6AJ 2KKZA 3RR8A 1SF9A 2CU7A 2GXBA 2EYXA 5GJWB 1ZUUA 1NEBA 3KLIA 4GY2B 4IZZA 3L2VA 3F6OA 4FK4A 4MNUA 3WQTA 1J09A 1VQ4I 2Q3SA 4OMYA 1WA7A 3O9QA 4UUSB 3D2FA 3G6ET 5CVIA 3I4MJ 4LGWA 2LT1A 3KK1A 3HRSA 3SI6A 5CKDA 1U3OA 1HBXG 2K9SA 3LDNA 5M1QA 3VF2A 3CJ1A 1HNWK 2HHTA 4EA5A 2D1XA 2KQRA 1RETA 3E5XA 2K2MA 2PFBA 1I94K 4QCLA 4ILJA 1K7AA 2W6KA 2VQLA 4RAZA 2QWLA 3PO2J 3QQAA 1U6GA 4RTUA 3VETA 1MZBA 3S1MJ 1I1SA 5I42A 1XG7A 4D1QA 3FC3A 3FZKA 4JYAK 3V8KA 2GWJA 3P83D 2EVRA 2GQQA 1FKPA 1TP4A 3PVQA 4ZYGA 4Z8AA 1MBFA 2KE9A 1YXQA 1KSWA 5AQLA 4JI4K 4A57A 4LF4K 2ZPIB 3M0SA 4JJNK 4NCBA 3KLGA 1N36K 3FXUA 5FWBA 2WSCE 5FLXO 1TWHJ 1YJWA 2EQRA 4U7BA 1K76A 3ZCOA 3LH0A 2YNGA 1N9RA 4M3GA 4ZNXA 3CC7N 5A0LA 5GMKm 1M3BA 1E0EA 3CC7A 3ABKH 4E1MA 5KCMA 4UC4A 4P9FA 5DPKA 4OVAA 4OFHA 2BXZA 4Q48A 2QWQA 5DLOA 2E6ZA 2HOEA 3G73A 3QESA 5KN8A 2DO7A 3LLRA 5D3GA 5HY6A 1X75C 3CCET 3KWGA 1OZ2A 3GYHX 1C0UA 2LC2A 4YTLA 5CVJA 4M7DA 4PQUA 1QZ6A 3NGZA 3OYJA 1GBRA 4AYBA 1MW7A 5HK0A 3ULRB 3I54A 4B4CA 4A3LJ 4DTUA 4IJNA 4Y3OA 2JWKA 3O5ZA 1A5VA 3A5NC 3CCVN 1X6OA 3A2KA 2Y90A 2IA2A 3CCVA 3LAMA 2QZ8A 1MUYA 4XQFA 3H0DA 1MGQA 4ZDOA 1MH3A 4KHPK 2WB1N 2KISA 1B7TA 4JI0K 3FZFA 1BHLA 1K79A 1GLJO 1M90R 1FJGK 2UXNA 1OISA 2D2WA 3HYFA 1P92A 3OSFA 3CC4A 1ZX6A 1M90U 3T0YA 1M1FA 3QICA 4HOBA 3T1HK 2KRFA 1V54H 3SV4A 5CZ2A 1LMZA 5E84A 4FX0A 1KQSM 4H0XB 1K0SA 1RNLA 3DI6A 2KDSA 5E41A 5GANd 1UFMA 3MAQA 3QU6A 2QKLB 1S72T 2RKHA 3GXOA 1Y97A 3KD1E 3CPWA 4U67L 5AR0A 1IKXA 2XRNA 3WEEA 5AQRA 1CF7B 2FBXA 2DL7A 2JMWA 2HU9A 2RHKA 3L8BA 3T3FA 4OKKA 1NK4A 1BCMA 3TBIA 4FWPA 4K8XA 4FW1A 4C3JJ 3HFOA 2XAFA 4HCKA 3CPEA 1ORKA 4LDVA 4FWLA 4YDUA 2YS9A 2L9RA 1BIZA 3UKRB 5K5OA 3FHZA 1K9MR 2NRVA 4H03B 1WHMA 2RHXA 1LAVA 3CF5L 3D5SC 5IYDJ 4F55A 2KLOA 2E65A 2VUMJ 2DA1A 5GJVB 1YW9A 5IP7J 4CGFA 3SAHA 1R4MB 2I7NA 3WGIA 3LWHA 3QAHA 4IO8A 4CESA 4BR7A 2HZTA 3WU0A 1VYVA 4XRMA 3Q7CA 3BROA 3L2ZA 1FZPB 2P0QA 3VEVA 3EL2A 3I3LA 2UUZA 3HTVA 1TK8A 4WX9A 4CF0A 3RMQA 3JRFA 3NHNA 4X9CA 3H3VK 3TSPA 2QQBA 4CJFA 1F1BB 5JLWA 3I56I 5CQXA 1I3QJ 2A28A 3VQAA 3CCQQ 1RDBA 3C12A 2FYKA 5FRNA 2MMPA 3MKLA 3J80O 2DOAA 1M1KU 5CZ1A 2ZMEB 4UVCA 1TL8A 3MHXA 1RI7A 3ESWB 3JSOA 3DWLA 3Q7BA 5FB2A 5GAMh 4BJ6C 2VJ4A 1KG1A 1A31A 4L5EA 1LVKA 2BKDN 3FZLA 3LMMA 3FB9A 3TAQA 1Y8RB 1U78A 1MJ9A 4D0PA 4CCOA 3M1CA 4IWVA 4KO0A 3KP2A 2L9NA 1U48A 1FSHA 1GUUA 2R5YA 3H9GA 2R7OA 4Y1DA 1HNZK 1TGOA 1B8IB 3BDDA 3NH1A 1OQKA 1WGSA 3VYRB 4OPJA 3HYIA 4RTYA 1A0NB 1Q1VA 3VS2A 2ZE2A 1W4MA 4CFDA 1K9MC 1IV8A 2P0KA 1ETXA 1SL1A 4ORZA 3LALA 3CCJN 3WTTC 3PY8A 4H8KA 3CEYA 1S1UA 2O8FA 4RCHA 2QWNA 1E4FT 4BG9A 5GANg 1BYMA 1IDZA 1P2FA 3GFMA 4DTXA 2EA2A 4B08A 2NVXJ 3EO3A 1F36A 1ASWA 2HR3A 4M78D 2PLYA 2RN2A 4P96A 5GAEJ 3V4GA 4L5GA 3F3XA 1UAAA 1ZRFA 3RMAA 1U9OA 4FYYB 5LJ5h 4XN3A 2DILA 4HLYA 3ENOA 5DCMB 2R7DA 8ATCB 1A36A 3LOCA 1HYSA 3O8VA 3TSZA 2PX9A 2CSQA 3IUCA 3GMEA 1OH5A 4IEEA 4ZN3A 1PKSA 5DLQE 4X1VA 2EIFA 4M78B 4LH5A 2L3DA 4EVIA 4O55A 2VG6A 2P8TA 1RAHB 3OYIA 2HGCA 4M7AF 3NNQA 4Q4ZF 2VQHA 2D45A 2XDPA 1BIAA 4HEA2 5FKOA 1BA5A 2WTUA 1BGXT 5CJ9A 2EINH 2P7CB 1OH8A 2KY9A 1K78A 2F2EA 3BF3A 2EKHA 5J2NA 2CH4W 4CYCB 2HKQB 3WXJA 4F92B 1R59O 3SEQA 3LAKA 3LSRA 2EV6A 4FM1A 4B1WB 3VQDA 1XSDA 3RSEB 4RA2A 2V79A 4CBUA 5GADP 3C7JA 3MECA 1QCOA 4BC3A 2C6YA 3HXLA 2W41A 4P9UA 3K4JA 4LXCA 3G4SI 4E70A 5LGUA 4LFBK 1KXPA 3CI5A 2IVMA 1J6ZA 2DZCA 3HBLA 1IZ1A 3OW2M 2FBHA 3E01A 2XD0A 5E3MA 3R6NA 2XY7A 1J7KA 4YEJA 4ELTA 4IUVA 3MQ0A 2MCNA 5KE2A 3KCCA 1G2HA 1AWJA 4J6YA 2OF7A 4X65K 1RADB 4ICLA 4I7FA 2ACJA 4DG1A 5JR3A 2DEQA 3TEEA 1HDDC 3QOPA 2YSQA 3QUIA 2Z2SB 2JS2A 2BEOA 4JKBA 4KDPA 1C0TA 3DEUA 2V1NA 4OVLA 2BTTA 2HPIA 1WJAA 2W03A 4CIEA 1LE8A 4L9VA 5C24A 3I5RA 4A3EJ 4C8QD 5EG0B 1FNNA 3H36A 1YFHA 3G6EQ 2NVQJ 5DM6L 5BN9A 4WCGA 5IXBA 3WODF 5FU7B 5AQIA 3QU3A 2VJJA 1N3AA 4C8QG 2J4RA 3HXMA 4LUEA 5J39A 5D8KB 3H92A 1SFKA 2GTDA 4PUSA 3MEGA 3A8LB 1LB2A 5DUIA 3FWEA 4KHSA 3ASNH 1YCYA 2ETJA 3LSIA 3D45A 3SNNA 1Z91A 1W70A 2ESHA 4C8QB 4DF8A 2COMA 2BE2A 2XPUA 3VOVA 3HL8A 2W6LA 1RABB 2LJ3A 2COYA 5DV5A 1X6GA 3GP8A 4MO7A 1ETQA 1PUFB 3IRQA 4LDYA 4CCLA 3H45C 2OAUA 1EO1A 1L3VA 2DXUA 2YU3A 2R7RA 1NKEA 3G7ZA 2OBPA 4HNTA 4E89A 3TPQA 1U8RA 4M7AC 3OMYA 2RJFA 4NO7A 3ZL7C 4IUUA 5B3SH 4B9WA 3C6TA 2IGNA 4KHWA 3M8EA 1SG5A 2K4BA 4RW6A 4M78E 3IC7A 3JB9F 3TREA 4BS9A 1T44A 4PWDA 4C92G 3A8OB 3MFKA 3VEZA 1K1ZA 1S5LC 2P0PA 4EPCA 4B9SA 4BY9C 1YS7A 3E9GA 3LM2A 4FZXC 2ZJRL 1ON1A 3HOXJ 3CIPA 4EGYA 2ZO4A 3AVFA 4Z4FA 1J5OA 4CJ5A 4LH4A 5BPNA 3M0TA 3F9MA 3CCEQ 2DXTA 1FEXA 4FLXA 1QCFA 2PBDA 4P1WA 1H89C 1X58A 2KDOA 1X1CA 4LFCK 2L0AA 1QSLA 1HKQA 2HSTA 3RQ4A 4XU0A 1HNIA 1KVBA 4B9LA 4OKJA 3SUOA 4PLLA 4A59A 4B43A 3CCLI 2RA2A 2ZCWA 3W2WA 3F8NA 4GXOA 2O4IA 3AVMA 4NS5A 3M53A 4RBOA 2O03A 1SANA 3VQ4A 2NAZA 3CESA 1BWFO 2KXCA 3HPWA 1YJWT 3ZGKA 4H4MA 2RKIA 4F2SA 1BOAA 2QLZA 1B72A 4NQWA 4JKCA 1WQ2A 1LKXA 4V19K 1Y71A 2YDLA 2CH6A 3TO7A 1AOJA 1T95A 2VONA 2E1YA 3E5UA 4PJOF 1W97L 2ELKA 5BPDA 1S72Q 1FBQA 3QRFF 4D5FA 2M87A 2NUTA 2LLKA 1W6XA 2ENMA 2H94A 2HSPA 2EBPA 3DV8A 2MK5A 3HVTA 2QKKA 3WTYC 4PKIA 4ZDLA 3P5JA 3EQLF 2EIJH 1ITYA 4YOTA 5E79C 3BJ6A 2ZBKA 4DKWA 1MPGA 1NEGA 2EIKH 3S2WA 3VFZA 4HSTA 4GLKA 4LY7A 1K9MO 3ISPA 5FROA 1G3SA 4MLEA 4PSWA 4C2UA 2ETHA 2H6CA 2WA0A 4F7UE 5F2RA 3FGUA 1N34K 2A1RA 3GF5A 1TL3A 1GFDA 1EETA 4L0YB 4DA4A 1DGWY 5KN9A 4FJNA 4A93J 4NB5A 1T3VA 3SMSA 1NK7A 4M42A 3CW7A 4NZGA 2H3GX 2YCHA 3DLLF 2NUPA 4QS7A 3CC4T 4IHYA 1ZUKA 3F8CA 3IH3A 4DR5K 1R6RA 4HV6A 2ZXWH 1IG7A 1NJZA 1NTCA 3LWFA 1WCMJ 1WX6A 4A5BA 4EAHD 1VNDA 3HIFA 3CMAA 3W6JB 1PNJA 2LSNA 2YI1A 3MVPA 5TISC 3CUQB 1HOMA 3NGIA 2X4HA 4IOAF 2R5ZA 4M3BA 2P9PA 2VL8A 1ARKA 2IIRA 2DE0X 3NDKA 4OX9K 2KIUA 3M4GA 4KPYA 2OV7A 5DMRA 1D3BA 1BIBA 1PHTA 4IHSA 4K41A 3I56N 4GW6A 1R4NB 1MU2A 4CZHA 2IAIA 5J4YA 1O1WA 3TAFA 1QVTA 3DPTA 3EGDA 4OB3B 2Y69H 2LBFA 2Q36A 3ZSYA 1HCRA 4OP0A 2FG0A 3GL1A 2BVLA 3DEEA 2KRNA 2ZGYA 2M02A 4I2PA 4XOPA 4YIIA 1VQ6I 1HPMA 3FE1A 2K5IA 4K42A 1OPLA 3DLRA 3SYTA 2GTJA 3AVHA 3VYGA 2DYRH 4PJOC 3RYPA 5EF6A 3BTLA 2PY5A 4XTUA 1QBJA 2XROA 2HF4A 2EQJA 3EFSA 1HF0A 3QPTA 1HNVA 2G8WA 1RBSA 1HDPA 3OYYA 3A4CA 1ATRA 3VTIA 1LUJB 2LNBA 3CMEA 3CCRI 1YRNB 1LWCA 1QU3A 2JRTA 3MN2A 4HF1A 4JLGA 1KCFA 1MDMB 2EPDA 3DKYA 1UA1A 3DP7A 2C0IA 1WN7A 1KAZA 4XKCA 3A1PA 1M3HA 3SZTA 3VB2A 2LRDA 5HLIA 1WH5A 1G99A 3S41A 4Q5VA 3AL0B 3ZT2A 2WUSA 4I98B 2QF7A 4A4FA 4W5OA 1JJ8C 2D1KA 5CIUA 3DKXA 2EW3A 1NGEA 3CDLA 4RLFA 3VODA 4CDGA 4HUEA 2VKDA 3QEXA 4BUGA 4M7AA 4N56A 2LF7A 1ZBLA 2FRYA 4CGJA 2E1NA 4KT6A 1ONVA 1U1SA 3ZSWA 3CXCM 4BXXJ 2JWLA 1JCFA 2NRWA 3QG1A 3FXJA 4CGIA 5A2QO 3BR1A 1PWTA 2DK3A 4DR4K 3C7NB 3VSKA 3RNJA 3SQ0A 2GIVA 3N5BB 1YHQI 1MNMC 3C18A 3JCMV 3IKMA 4OLBA 2PI0A 3K5MA 2R7QA 4NDLA 5L23A 2Q8KA 4B48A 2DBBA 2ZJ2A 1U5SA 1G5VA 1YQMA 4PHTX 3FLCO 3R4KA 4K0KK 3EYYA 1VQOI 2NRZA 3PJRA 3WTVC 1BB9A 5FJ8J 1TLHB 3UE5A 5HVQC 1XGMA 4FM2A 1QZYA 2W48A 5IAYA 2QA4T 3R3LA 4XH4A 4L0ZB 2OTLT 4Y33A 4H4OA 3TANA 1TUDA 2MI6A 3GZ6A 1WSUA 2DU9A 1U06A 4LK0F 4KRTA 2ZB9A 3NF8A 2YLCA 3VQCA 4IVNA 3CJBA 5TRDA 3SV3A 3IH4A 4C8KA 4W97A 5AQPA 3B02A 3EHRA 4CHNA 4OO1J 5KH6A 1WH7A 3ZLJA 4DQSA 2E71A 3PIOF 2KBTA 4DFPA 1XMQK 4N4NB 5J8FA 4LF6K 5GAN3 5LFAA 3A01B 4CECA 2R93J 2XKOC 2O01E 1YVNA 3LM9A 2D1VA 2Z1HA 1KFSA 3CCYA 5FPNA 3JV3A 1Z1DA 1A6QA 1PCXA 1RTDA 4XRSA 3GFIA 3DTEA 5J26A 2JUGA 4YY3K 2EYYA 4M45A 3VGKA 3KWIA 4XLPF 2R7YA 4XLAA 1BKBA 5I2MA 3K10A 1GXPA 4AIAA 2UUAK 1AOYA 1ZK8A 2IGKA 3ZXSA 4OMLA 2DLPA 3LYIA 3CZ6A 4C8QC 1L0OC 5I2SA 2O61A 3VV0A 2WADA 1RDWX 1CF7A 1YF5L 4CC7A 2AP1A 3SFZA 3KYCB 1YJ9A 3OYDA 1U9NA 3DU6A 1U45A 2XDVA 1IKWA 2F4OB 1RDAA 3TTDA 2A6EF 4MO4A 1R0BG 3X25B 3I8DA 4RB2C 4A61A 1ASUA 3I9QA 2JRMA 4A4HA 2PG4A 5GTIC 2GF7A 5AQVA 4IL6C 4A3JJ 3M8FA 2HQ5A 2X6NA 2BZ8A 4WCIA 4ISEA 2VB6A 2RO0A 5F0XA 2EFWA 2E4HA 4FJ8A 1R22A 4BACA 3IH2A 1WYXA 3O6WA 2M0YA 2EFPA 3W6KB 1QKXA 1KHIA 1NGFA 2JVVA 5LEJA 1WJQA 3HUGB 3WXKA 2E70A 4DGWB 2JGUA 3RPUD 4MDWA 3P38A 4L9TA 1ZLKA 2Q31A 2KP6A 4DV5K 2O8KA 5IP6A 2E6LA 2WBMA 3FM5A 4KV8A 1VQNT 3OS5A 3G3ZA 2FHDA 4C92C 2Y0SA 1H88C 2GQVA 1GVJA 3QFPA 3EUAA 3K5NA 2FSNA 2CUZA 5HK3A 5EY4A 2BGGA 1O7LA 1WJSA 3RR7A 4Y28E 1HX1A 1ZSZB 3KZIC 4V19S 4X66K 4E7KA 4FE4A 4CEDA 3GOXA 4FETA 1MMAA 4XQ3A 2OFIA 3KTQA 3NF6A 2HSEB 2AXLA 3WNHA 2CRGA 1N77A 3GF2A 3NPFA 4RTTA 1OCZH 3N0UA 3CCLN 3B6PA 5BQTA 3RBBB 4H5TA 4Z4HA 1AZGB 2WBNA 4XOTA 4NHJA 3J81E 4PKCC 1YJWQ 3QXEB 3JCMX 4R8HA 5GAEP 1HSJA 1WPKA 4CZLA 1XDUA 1WHJA 1B8IA 4E6RA 1HW5A 3B73A 3JXUA 4FJKA 4PJOA 4NCAA 3SD4A 1UGVA 1RAFB 2NNYA 2IXSA 3IHOA 2GNCA 4KHUA 2E60A 3DFGA 4N76A 2OTJN 2Y2ZA 2L0KA 3QYBA 2OTJA 4RW7A 2JWTA 1M27C 5EEHA 2XGEA 4V2SA 1QRYA 2EBIA 1XQHA 3P4IA 1BI3A 2HVIA 3WHCA 1KIKA 4A6EA 4CJUA 3G0QA 1WJBA 2RQTA 3ZMUA 2EKOA 2E64A 1SL2A 4GBQA 2HL3A 2HKOA 2F5TX 2K9QA 4FK2A 1Q86U 3M0PA 3OV8A 3AGKA 1M8MA 1KG7A 1WZ2A 1UHSA 1EKEA 2E2HJ 3THYA 5EZGA 1I8FA 4HV5A 4L59A 2EJFA 2FRHA 3BPVA 1MV3A 1IAWA 3EHQA 1RFQA 4IJAA 2MF2A 3KYLA 4GKJK 4XH5A 2GIZA 3ATVA 4BGDA 3DLLA 3CC4Q 2HXOA 3RDVA 1VSJA 4MGRA 5JLXA 2DA2A 1FMVA 3M7GA 4ISGA 3ERMA 1KLMA 3ULDA 1GHCA 4KHYA 1WLJA 3VQ6A 3ZT0A 4W5RA 2OZSA 2GM4A 1LJOA 1PRMC 4M75E 3S9HA 1KA8A 1TU0B 2LTPA 4C3HJ 3M4OJ 2JVGA 1LCUA 5M3MJ 1XC5A 3U2RA 1S1XA 4OGEA 1EH7A 2V75A 3CUQC 2M0CA 4YFKF 1FC3A 3AFHA 1BA0A 3AVGA 1P7IA 1ZARA 3AAPA 1FYLA 1MJAA 3GUDA 2AZSA 4EIKA 3JCMe 3V8JA 1QSYA 3PO4A 4RMOA 2E5ZA 1I4K1 3EG2A 2IPOB 1YN8A 3LZIA 2M3AA 4A3CJ 3ECOA 3CDIA 4PL6A 2KL4A 4BD3A 4IBNA 2LC4A 5JLFA 1DKGD 1FBSA 1MMGA 3FBNB 1FLIA 3GTPJ 3MN7A 2VQEK 2VKNA 2FZGB 1PKTA 4C5HA 2ID6A 4GGGA 4LB5A 3S1QJ 3REOA 1WRJA 1VQ6N 1LDJA 1O3QA 4QOZB 1AWWA 1JKRC 3V6DA 4ENKA 5GMKj 1TS9A 4CH7A 3ZQIA 3B6CA 2F5KA 2GQIA 1OU8A 4XH1A 1ODDA 3GBGA 3HGYA 3RMBA 1RR8C 2IS4A 5ICFA 3O8HA 2L01A 2XKOA 4ZYEA 4A2UA 3QWLA 2AIRB 1JJ2S 2V8IA 3CBPA 4LSNA 5BRHA 3R2XC 3CMAT 2HZDA 2L5QA 1WAFA 1BW6A 4FWMA 5LHHA 1U49A 4LN2A 4DOZA 2E6NA 2H8WA 4YPHA 2P84A 2R0QC 4H0YB 4XEIA 3THKA 3LP1A 1JL2A 2K9GA 1K4SA 2A68F 4OB0B 1RT5A 3CCRN 3LCNA 4LF9K 5J47A 4C8NA 1TW2A 2GZWA 2M2EA 3WNFA 2FEZA 3PFIA 1WNSA 3SUQA 2XC7A 2KIQA 4B9QA 2RJDA 3HPHA 3MCPA 3OHRA 2P9KB 2KXDA 2B6AA 2J6KA 4AC0A 2HQAA 2E1MB 2XF6A 3RIRA 4CJWA 1XN7A 1YE9A 3AAQA 1Q1HA 3K2AA 2RQRA 5F1RA 1TOVA 2FBYA 4DWIA 1KU9A 5FKLA 4JI1K 5AN4A 3ULQB 3OYLA 4AD9A 4OMPA 3I0WA 3A5OC 1P4AA 3K1MA 4UY8I 4CI0C 5CYQA 3QODA 3LSKA 1EWRA 2DTIA 1ZBSA 2XO7A 2K7LA 1D0YA 2F5FA 2P5VA 3GG4A 5J1EA 2FSWA 4Q5WA 5IPAA 4AI5A 2M8GX 2DYIA 2HEOA 4B9VA 4CEAA 1LNWA 5LJ3g 1OKJA 3FXQA 5C12A 4G12A 2R7FA 1LEBA 4JLIA 4EA4A 2PVDB 2CUFA 3VRYA 5GMKe 2A6TA 1HSQA 1U5TB 4FWOA 1YHQN 3VS0A 1RTHA 3UIQA 1RL2A 2A5WA 1DTQA 2BY3A 3CMET 5LRSA 1IN5A 2D4WA 1FW6A 2F8SA 1VSDA 1K73R 4C92A 3DKMA 2QM1A 4OIPF 1C6VX 4QW2A 3OYAA 2F5EA 1TKTA 1VQON 2QENA 2QA4Q 1WEGA 3VESA 1KU3A 2O31A 5HROA 2OTLQ 4IQJA 1N6AA 4B3MK 5B1AH 3WTZA 2QQAA 4IFVA 3BOQA 4M77F 2KQ2A 3TEDA 3O8GA 5GMKi 2DFEA 3CC2A 2YUSA 5IH2A 2P4WA 2O8CA 3L7WA 3R1XA 3QB0A 3GTOJ 1XHXA 3NTKA 3KP7A 4BQAA 4MTEA 3KZYA 1FP2A 2JPSA 4UB8C 1LNXA 2JM8A 3VRZA 4HVUA 4LG0B 2AA4A 4CCJA 5E8GA 2AKKA 3P1GA 4E3SA 3GFLA 2PMUA 2VT3A 3MXIA 2NOHA 1VOMA 3TQ7P 1POGA 3OTOK 3MO8A 4E4HA 2QQSA 1S6PA 1PDNC 2M1HA 2A40A 4XONA 3QEPA 1BJZA 5HLGA 5D6WA 4XIUA 3NARA 2R5AA 1IRGA 1DPRA 4KJZA 4BGAA 3A0HC 1I6XA 2DT6A 3S15J 4OWRB 1WIEA 1O13A 5DDGA 3G25A 1QCNA 3QYEA 3DU5A 3CCST 4H4KC 1FIPA 4L9NA 3OMGA 3T8TA 3TTFA 2B8AA 1PD1A 3F10A 2DA6A 4DSEA 3CJCA 3LDLA 4FT2A 4ID1A 4B3RK 4MIMA 1WOQA 1GV5A 2IA1A 5IYBJ 2AHJB 1JTXA 4QAGA 3QYGB 2E35A 3F8BA 3CFRA 2FF4A 1X1BA 3BUZB 3HSFA 3BCBA 3RRGA 1BI4B 1YS6A 1G3YA 4OB2B 3PNWC 3TVTA 2GBQA 1LWWA 4F3TA 4CFCA 5L3GA 1VQNQ 4J8FA 3SEZA 3SJJA 3P39A 3I59B 4IOCL 4GKKK 2Q2RA 1ATNA 4CZKA 3KEOA 3THVA 2GA1A 1KAXA 4RAFA 2K86A 1PRLC 4NCGA 3TSUA 3ZX0A 2O9SA 3F8FA 1QVFA 5A0GA 4QQDA 4GDFA 2I10A 2MH9A 1QVGA 2QTDA 1ZTRA 4M77C 4NB4A 3A02A 2HVHA 4O0IA 1NOYA 2QASA 1Q7YR 1X1AA 3L09A 3MEXA 1SUQA 1YJ9T 4FVUA 5CVUA 3S6IA 5DCFA 2QQ8A 4I6MB 3ULEA 5J3LA 4LLGF 2A36A 3SXYA 4AHCA 1BIUA 3OOPA 4AM3A 2G3RA 4LFUA 1XS9A 5D5WB 3BR2A 1KD1R 1Y8QB 4QS9A 4IRIA 1D1CA 4EJOA 1G6NA 2V52B 2JT1A 3L9FA 3QOEA 2DL4A 1TAQA 2VGNA 1ZAOA 2VPLA 4CJQA 1E6GA 2CMPA 2F5DA 2SRCA 3CCEI 4HNVA 4I09A 2DTHA 3EAEA 9ANTA 4MEYF 2P51A 5LHGA 1VRLA 2VXDA 1EBMA 3HZ6A 3IV5A 3PGGA 1SFUA 2NS8A 4BC5A 5HRPA 4DSLA 2J7IA 1K61A 1BL0A 3DM2A 2Z1GA 3GWZA 2RDPA 1N75A 3LP0A 4KI6A 2JA6J 4E7LA 2K57A 1RLQC 3JRAA 1GLDG 2ASMA 4C0ZA 4W5TA 5GAMj 3FXLA 3H9JA 2G0EA 3LX7A 2OAZA 4Z88A 1YITT 3WNGA 2B0LA 3SQ2A 4M3UA 4YOUA 4CJLA 2DYBA 1IUFA 3CPWM 3M8SA 2BHYA 1CZ9A 3C94A 3J7ZO 2CP6A 4Z4EA 3EG0A 3CETA 2GXAA 1GXQA 1Q7YC 1RILA 3VENA 4DOWA 2YWWA 5BN8A 3N4PA 2JHNA 3ZT1A 3G10A 1J59A 3PE0A 3SHFA 1S72I 1Y56A 1BR2A 2ZJPL 1X43A 1KD1C 4N0AC 5GIOA 4ANJA 1A35A 4BKXA 3OWTA 1ZGWA 1TW3A 3R6SA 1T6DA 3E19A 2LH9A 2CT4A 3TSWA 4DU1A 2HL5C 2G8VA 1JCEA 1K8AR 1EJ9A 3PL8A 3GDQA 2YRCA 1R1VA 4JRKA 4PGHA 3AG4H 3O3KA 5C10A 4KGVB 5LJ5j 2K5LA 5CO7A 1VQKA 3L3VA 3CQXA 4M78F 2A6AA 1HMVA 4C8LA 2HBWA 5GAOn 1J54A 3V9XA 2W00A 3LZJA 1KG2A 3LDSA 4KULA 3CVTA 1NK3P 2X1EA 1JJ6C 1BQMA 1NGNA 1SFOJ 5DM7L 1HSTA 1JBMA 1GCQA 1VQ9A 3O8MA 1NK9A 2K3FA 4GYGA 2FLOA 2DAQA 4B9MA 5H6RA 5GAMe 4LD9K 1L3TA 1NH3A 2DKGA 4CJPA 3OMCA 4O4GA 2P7VB 5DEQA 5TKWA 3G71I 3CM6A 4FYDA 4WFNL 4ZYHA 2COBA 1N25A 2YHTA 3FRNA 2NOGA 1YWOA 4FJHA 3E6MA 3I0TA 3CMAQ 3GW2A 2NUBA 5F64A 3U9DA 3QMLA 2FEIA 1VQLA 4IF4A 1KQSS 1R9TJ 2P9SA 3QEVA 5BRDA 3JR9A 2JM9A 1QVUA 1GXIE 4X0GA 4HTUA 3CCQN 2Z16A 2EX3A 4XAXB 2P81A 4E47A 3CCQA 4L5IA 1ZSGA 5AYFA 4U0YA 1BR1A 4PGGA 4I99C 1W5CC 3IDHA 1APLC 2O8BB 1XGNA 4PA1A 1TAUA 1UHMA 2LTOA 1RIOH 1JLGA 4KTQA 3HTRA 4EP4A 4H0EA 3PMIA 3CWTA 4U88A 3H3OB 1AEYA 3NH2A 3FLGA 1UHFA 5AJ3K 4AM6A 4CFBA 5K5QA 1HA8A 5ED4A 4ZGDB 3FMRA 4M7DD 2KFDA 4J00A 2JJ7A 4FLTA 3CQYA 2Y4XA 2OCEA 1ZBXA 5LJ5e 2SEMA 2KI7A 4QVDA 1X3WB 3CM5A 3T1BA 1P9QC 3KD5E 4GLMA 2CH4A 4C5IA 4DSKA 1STZA 3G2BA 3K6GA 4M7DG 5GANj 4BY6B 2KROA 3SUPA 2H27A 3ZX3A 3HM8A 3TSQA 1WQWA 3CPFA 3OSVA 3X26B 4XLHA 3CJ7A 4BR9A 2VOOA 2VOPA 2CP5A 3OY9A 1Q82C 5GP9A 2I5WA 4M7DB 3K70C 3QIIA 2O8XA 2X85A 2YKNA 1N5ZA 2V51B 5F1JA 5FPMA 2OPPA 4HUGA 4LJZF 1FPQA 3OYCA 2M7AA 2OA4A 3H35A 2YUNA 3KLNA 1M8VA 3CMEQ 4M63C 1DGRM 5FU6B 1MNEA 1N8RC 4BREA 1T2KA 1U5TC 4F7UF 2BANA 3PFYA 4OIRF 4S05A 3CCUA 1VSHA 3ZRGA 4R1HA 3IFRA 3K5LA 2D0QB 5J8CA 3GTLJ 2L9SA 3CWAA 1DDNA 4M77A 4PKGA 2CGKA 4Y15A 3ZETB 4X62K 3M56A 3ROUA 4AFQC 1Q81U 3HJFA 2EGAA 4BE2A 1YT3A 2BTFA 5D5VB 2E5KA 5IHKA 2KT0A 3QDKA 2JMAA 4RUGA 2CQKA 1R00A 3WVEB 2CW0F 2VPRA 2VVKA 2UXXA 2FSJA 4E9EA 3JRHA 4DTSA 2VCPA 1ZYQA 1S3XA 2YLBA 3WEEB 3GNFB 2HHSA 3DOLA 1KC8R 4QWQA 5FLXE 3KP6A 5BPIA 3TDZC 5GANe 3QP6A 4DF4A 3KK2A 3FHNA 1KC8U 4F91B 3BT9A 4XLEA 1NJIR 5BS6A 2A3ZA 2M7BA 4DEXA 2VWFA 2FQ3A 5K7FA 2ZPEB 3LP2A 3MZHA 2FNAA 3O4NA 2LQ8A 2ME0A 3WTWC 4B24A 2HB5A 1T38A 1C1BA 1REPC 3V9SA 3CCSQ 1OKRA 2HDWA 2KRMA 2DPPB 3SJHA 1X1PA 3MEAA 1QVPA 2X6SA 4NL2A 3TTCA 2TRTA 4YOWA 3DCFA 1F43A 4DQQA 4J2AA 4CA0A 3U23A 4LE9A 2Q1NA 4KISA 4AIHA 1LAWA 4KYWA 3H08A 1CSKA 4ASNA 3BEXA 3CC2T 2WFBA 4KT5C 1ZQ3P 3QPSA 2KVQG 5LJWA 4OMMA 1NJXA 2VC8A 1U6ZA 2P0WA 4TSXA 4M74A 1W5TA 3G6EN 1YQKA 3C65A 2DOFA 1KFDA 2JTVA 1XOVA 3G6EA 1NGBA 4FO0A 4A5AA 3CF5F 3RQIA 1D5VA 2OC6A 2YNIA 4M3DA 3O3GA 2DBMA 1IRXA 1AVZC 5E3NA 2IVPA 4CZFA 4HA8A 1MMSA 2A05A 2UXDK 2OPTA 4B9XA 4N0AA 3F6VA 3ZQFA 3M55A 4M41A 1ZG3A 4EMHA 1NMNA 1SQKA 1AD5A 2F9WA 3TCJA 2XHBA 1R36A 4ZC3A 4PJMA 1S9EA 2LMJA 3RMSA 4EDUA 1XG1A 1NJIC 1Q7YO 2DMUA 4KBMB 5GAHP 1EF4A 1YJ9Q 4L8RB 2R58A 4DMNA 1ORNA 1RUNA 2Z99A 1ATSA 3OW2S 3BF1A 1P90A 1IO6A 3U4LA 1EH8A 2WV1A 2CUDA 1VQ4T 2ZQBA 1D5YA 1KD1O 3AVNA 5F6FA 4JI2K 1WHUA 1I81A 2KFZA 1N5YA 4DV0K 3SWNB 5GPAA 4CJ7A 3OSGA 1AKHB 1NPPA 1WKMA 3GEZA 1GLEG 2RB6A 3UATA 4CIFA 2RQPA 3H6ZA 5DYMA 2DERA 2EZHA 1YTUA 2DJZA 1SVMA 2HNIA 2EZLA 3L2RA 3NH0A 4BEHB 5J6XA 3TKYA 3LFKA 4CJSA 3HVRA 3CCEN 5HL7L 1VQ5A 2AXTC 2FOWA 4Y0WA 2MC3A 3HTUA 2NWMA 4F17A 3G1MA 3U1DA 3C2BA 3OL4A 2F4MB 2RK2A 4JI8K 1XPXA 2HXIA 2NOBA 2H3JA 4RB1A 1HUXA 4DQ2A 1LCKA 4BY1J 3VGMA 3IWZA 3VDXA 2KJBA 3GE1A 2FXUA 2EQIA 4D7NA 2F4VK 5HLFA 4EP5A 2A7YA 4BDPA 2KMTA 2ATQA 3WG9A 3Q9SA 2HEQA 3RTRA 4QLCU 2R57A 2HW3A 1YJWI 2EYZA 3O9UA 2WAEA 4YNQA 2G7HA 3MXMA 1ZELA 3J80E 2P9KA 3LSGA 4R5PA 3CC7I 3E97A 1K78B 4J9EA 4EJTA 1TC3C 2W4SA 4CO8A 3AHUA 5AQFA 4FJMA 2O2OA 3KX2A 4IO9F 1YVUA 4JLHA 4YORA 3BE3A 1W0TA 3MMYB 4J19A 1EZZB 3KFWX 4WYBA 3VYHB 2P9LB 1DEJA 4O44A 1S72N 2NOLA 1NGJA 4II1A 1TQIA 1W5SA 3K9JA 4JJBA 1BW5A 1O4XA 4BR5A 4WWCA 3BQYA 1X9MA 1WSFA 2R7TA 1K8AO 4JX6A 4DOVA 1NLOC 1UOCA 1HKGA 4QTRA 3VS5A 4BROA 1J75A 1RDDA 2ROLA 4XTVA 4ZH4F 4J01A 3NCIA 5C44J 3DKWA 1W4SA 5ICEA 1ETYA 3CERA 1JI8A 1U5TA 3FISA 1TUYA 1YI2A 4KN4X 2HHHK 3DWLE 3CCVI 3HM5A 4B1RA 4U0VA 2OANA 4AWXB 1UJ0A 3DMJA 1PSEA 3LAPA 1N32K 1MBGA 5HDGA 2EGEA 4Y52J 4BRCA 1QQJA 4XICA 1B34A 2WSEE 1SV5A 4LF5K 3BQZA 2JTEA 1W36C 4F9OA 1LE8B 3RCOA 2CV1A 4PJLA 4YOYA 1ZBFA 3CC4I 5J1YA 3CVSA 2JHJA 5GADJ 3QFUA 2P5KA 2LCCA 4JX4A 3LWMA 3QZ9B 4BGBA 4ELVA 5L3DA 1Q82O 2QG9B 3FIFA 1IG8A 2XIDA 1DLOA 1XD7A 3G0ZA 2QUFA 1O3TA 3MP8A 3GZNB 3IAM2 4C0FA 4NOYA 1MBEA 3U9GA 4A4GA 1N8RO 3RVCA 3CJQB 3QJYA 1ZKGA 2XMFA 4J9IA 1GT0C 3DLEA 4HQMA 4HQEA 2W04A 4HCBA 4PK4A 4BUPA 1IUYA 4CEEA 1NK0A 5DM6F 2RNJA 3ZSQA 3HM9A 2GBZA 4LG0A 4IPAA 4FL6A 2J5OA 4NC6A 4BC2A 1SMYF 2KPMA 2L2PA 4AFSC 3OVNA 2KYMA 3VWBA 2P4TA 3K5OA 3UWNA 4HPQA 8AT1B 3T1YK 2RHUA 4Z2YA 3AVCA 3CBMA 3SLCA 5KVRA 3BZKA 2LF8A 2XAHA 1YW7A 5KE3A 5IWAK 2A5YB 4D8DA 1VQKT 3SQ4A 5C15A 4HF2A 4FWQA 3E3VA 2LKXA 2J05A 1YCSB 4LF7K 4L9JA 2E41A 3L2QA 3C0CA 2JK3A 4RAGA 2L89A 1NYGA 3MPUB 3PQJA 1XQSC 3ZQGA 2K5CA 2JG6A 1VQ9T 4DSFA 3BR5A 3JRZA 3HRGA 1LPLA 4RCCA 1X3UA 2OA8A 2BY1A 3DXMB 3UB5A 5GAGJ 2HWVA 3Q5FA 1Y6IA 3J80Z 4N47A 1JLQA 3HB9A 3OJSA 1MDUB 3O4WA 1IG9A 5JS1A 1K4US 2F4IA 4PDKA 4AM7A 4CJ3A 4M3ZA 2R5MA 2D8HA 4ELYC 1C0GA 1WJCA 2ASPA 4C30A 4A0ZA 1R7JA 5GIPA 4XU1A 1VQLT 1RDUA 2EIMH 4J9CA 3NGPA 1DUXC 4M7DC 4WXHA 4LB6B 4NLCA 1LV5A 1KSPA 1A5JA 1WJDA 1TXQA 4FZZA 3G1OA 4CZMA 1UMQA 1K8KA 4N41A 2K27A 2D0BA 3I59A 1W0HA 3EN9A 1OPKA 2KNBB 3W2AA 2QYZA 5HCKA 4AHVA 2BDPA 4OPHA 1I1GA 2XF5A 3QDFA 2PVGB 4ITVA 4DV3K 2IIMA 1B72B 2CQNA 2GBYA 4NQWB 1I3AA 1X2NA 1UHWA 3HOSA 4M75F 4HNUA 1P4XA 2P6SA 4ZZLA 4BVOA 4NNJA 2YG9A 3R60A 2M8EA 4UNFA 3L42A 3B8AX 1RT6A 5ICCA 1WBDA 1HNXK 2OJED 3WXMB 4H5RA 1HD3A 4JS4A 2IGMA 2NUTB 2EILH 3EG1A 2CGJA 3PTAA 4ATOA 1E3PA 1IZ6A 2NRTA 4JK9A 3DLGA 1NJIO 1WJEA 2D8JA 4IRHA 2E88A 4ENNA 1DGKN 1O3SA 4F16A 1SFXA 4EZ6A 2L2OA 5ECAA 1HQUA 3NFCA 3LFUA 5HLTA 3F8MA 2M34A 4IHWA 2YHWA 5FD5A 1WXUA 4OAYA 4M72A 2F2WA 4JRQA 4YDUC 4J8OA 3JCMf 3CCUT 2FBIA 1B9MA 4CEBA 2DL8A 3MD2A 2A08A 2ZXJA 4BRIA 1NWKA 2NUPB 5LD2C 2Y4YA 3TAMA 1TUGB 1N39A 3CC2Q 1TBXA 3TOAA 2JSPA 1RDCA 3R6MA 3D4VA 3J7AF 2DDBA 2IS2A 3LH5A 1BOTO 1Y96B 4IG0A 2QDLA 2LKSA 4DBRA 2NNWA 2PJRB 2IAJA 4ZJZA 4E1JA 2R5ZB 1YIJA 4FX4A 4MFBA 1MSEC 2DFFA 2JJ9A 4A0YA 3CXCS 3G4ST 1OJLA 4KIGA 5A0DA 1D3BB 4DJAA 2F7TA 3V9ZA 1PVEA 1U2WA 2KAFA 2EFQA 1OX9A 3O3FA 3AO1A 4CHZA 1NJWA 2K4JA 3I33A 4U87A 4O8UA 2LRQA 3EGDB 2EZIA 2OQRA 4OMFB 3GVAA 2UUBK 2E20A 1V5GA 3CG7A 2M9UA 2RAEA 3HP9A 3DPLC 1RC9A 3BP8A 5M9OA 1UCRA 2W42A 4Z02A 2LY2A 1YJNA 3ENBA 2PEXA 3O9SA 3RKWA 1TL1A 1VQ4Q 2FD5A 3FF5A 2FPDA 1Z9CA 1YAGA 5GAMd 3OYHA 4Y13A 2CGHA 1E3HA 2LREA 2H09A 1X1DA 1T56A 3O9RA 1LFUP 3WTUC 4MHGA 2YUPA 1ZA1B 1IF1A 1IN4A 2QCOA 1KG4A 3SWNC 1W2BS 3CLQA 2V1DA 2OCCH 1T6SA 1FSEA 2X3WD 5HDNA 4A6DA 2JVHA 1BC7C 1GFCA 1P7JA 4M7AD 3S14J 3NTIA 4R55A 1IKYA 2IS3A 1OH6A 2L4MA 4WXCA 1N9SA 3IRRA 4DW6A 2ED0A 4KB0A 1QPMA 1YW8A 3W6VA 4M7AG 2ZF5O 3VUBA 2HHVA 4I9LA 4P5NA 2X78A 3EE9A 5AQUA 3KUFA 4OMNA 3ZMZA 4C5EA 2YJEA 3RKYA 3I64A 4HZFA 2JMCA 2RREA 1A6IA 4B1VA 3VQ8A 5H6QA 4M7AB 5E3OA 4B1ZA 2G7UA 2B9SA 1CZBA 1Z6TA 2ISZA 5LJ5d 2O8BA 2EHGA 4PFOA 3O5BA 2DIGA 1Z6RA 4A0XA 2OZ6A 1YJWN 1XDSA 3LW5E 1X01A 2VC0A 4I0AA 1WFWA 4QS8A 4H0OA 4XIDA 4FHTA 2ZAEA 4LG3A 3HSRA 1UJYA 3AO5A 3RKQA 2EB7A 3OS2A 3SAFA 4DNCA 1T0FC 5D6FA 4GVEA 4KMFA 2W1OA 4JI5K 2CW8A 2RQWA 1V76A 4NC8A 1SRLA 4BQNA 1VQ5T 2QBYB 2O6GE 1MUDA 2QXFA 2HMPA 1D4XA 2JPCA 2ZPBB 5E26A 1VUBA 2VBWA 4O6JA 4AYBN 5CKHA 4O3MA 3M8JA 5EEAA 1KQ8A 1MD0A 2A6HF 4B47A 2V7YA 1GLFO 2EQMA 4JP0A 2L3PA 1OLTA 4ON0A 1IXCA 2VKEA 2RPIA 5IOZA 4FLWA 2R7WA 5CPRB 1HQEA 2O0YA 1K9AA 1WAJA 1WZOA 1R5HA 2Y75A 1IW7F 4XRSG 2GA2A 1GLNA 3CC4N 3AA3A 5GAMg 4C2TA 3BG3A 3ZETA 2CZ6B 5KPTA 2JZYA 5AFUH 2Q97A 2I8DA 5EG2A 4CGGA 3VA0A 5FLVA 3CD6A 1ETVA 2C0OA 1D0XA 4JEPA 5AFUA 4V2GA 3RMCA 3P9CA 3DQVC 1HR0K 2UZKA 2EYQA 2EV5A 3VU3C 4F3OA 4FTHA 2QEXA 1Y1VJ 4IHVA 5AQNA 3IKVA 1G2BA 3O1WA 4DR6K 1RZ4A 3V9WA 3I8BA 2HMIA 1T08B 4Y17A 5J40A 2NRRA 3VGLA 5AIPA 3PVLA 3JSPA 2PYJA 3LGLA 5A2QE 2RHIA 5ADXH 2R92J 2IRFG 2GOXB 2RF2A 1VK0A 4FOIA 2XGXA 3QYFA 5K7ZA 1TUCA 1JE8A 3S17J 3JB9G 4BJ5C 4XL9A 1YI2T 5ADXA 2BUDA 1W9HA 3ZQQA 1MNDA 1GL5A 4PJNA 1VQKQ 3H5RA 3LL3A 2AKLA 1Z26A 5IP9J 3PV8A 1KG3A 4FJ9A 1IV6A 3X2QH 4OU0A 2GCXA 2HQXA 4MZTA 1LQ1A 1HKTA 1B1BA 2Q1ZB 5LJ5g 1VQ9Q 3M1EA 4J7IA 2OZMA 2OJ2A 1WEFA 1FY7A 5E1ZB 1R49A 1NK2P 1KG6A 4FJJA 2EWNA 1OI1A 1ZUYA 2C0TA 4BY7J 3CMAI 5L3CA 1TG0A 2DTOA 1W7PA 1M90C 3GTQJ 3JRBA 5JS2A 2VXFA 3M3YJ 4UQGA 4FOEA 1BN5A 1VQLQ 1R0AA 4HUFA 1PC0A 5D4SA 4KHNA 1P6RA 5FKMA 2B7EA 2KHOA 1M1KR 1HRHA 4JHDA 2DMNA 2QDYB 2WTEA 3UPUA 1RRSA 5K14A 2E19A 1JEGA 1WSHA 2XPVA 4UXNA 2RH2A 3IWFA 5JVTA 5FGMA 3OYFA 4PJOD 5FRMA 1QHTA 2J06A 1YQAA 2DK5A 4L18B 2QWRA 3F0ZA 4KGXB 2LDMA 3KPHA 2HYGD 1RACB 4PJOG 2V7FA 1Y0MA 3DLHA 2NRAC 2KQWA 1M1GA 2CQQA 3CTAA 3L0QA 4J6XA 1BU1A 1ZBHA 5BR8K 5LLQA 2EWSA 1UAXA 5LJ3j 4A4KA 4CZGA 3A8YA 4PJOB 4FE7A 1S7EA 3PUBA 3HKSA 3P8BB 1NU0A 2E5NA 4EM0B 2J6FA 3A1YA 4F52A 1D5AA 4F7ZA 1LOTB 1J2XA 3FDRA 3J80K 4WQ5C 4DV7K 1T98A 5FO5A 5AQHA 3JRCA 4JKHA 2E5LK 1NGCA 1LW0A 1NG7A 3SWNA 2I7PA 4E7JA 3PSIA 1AKHA 4M4ZA 3CMEI 2A41A 1JXEA 2A5XA 1D8YA 1CQTA 5D5XB 1SEMA 2HVSA 2AT1B 2D5RA 4KH6A 1KZHA 2XF7A 3KP4A 4BEHA 3ECHA 3I4PA 2BBYA 3U6FA 3CLOA 4FXDA 1QVFP 2K2VA 1IHWA 4CEQA 1QVGP 2NYSA 3THYB 1CXUA 2QA4N 3CCUQ 3NEUA 3M54A 5DUKA 2QA4A 2M4GA 2FMYA 3L4IA 5JHUA 1OYWA 2OTLN 1AWXA 1OCRH 4E9FA 3GTKJ 2OTLA 4DQRA 3M4YA 3F2KA 1D1BA 5E1WA 2HKXA 2FUG2 1KFZA 1X2MA 4DYCA 3MWMA 5D6YA 4C9YA 1JGSA 5E18F 4B8XA 5LMNK 4JX5A 1WHHA 1ENHA 4DBFA 1ZQ1A 3JCMc 1KYZA 3M58A 2ZXHA 3H8ZA 3AVAA 3ELKA 4DFKA 3HOVJ 5F08A 1Y39A 3HI0A 1VIFA 2A37A 4HVJA 4QT7A 4IX7A 3OSSC 3ZOBA 3DPUA 3G4SQ 3TU4K 2M1BA 1W1WE 5IOYA 4FPAA 5LJ3e 1B92A 4KBOA 4BVPA 1T0FA 3SAGA 1KQ1A 2P9NB 5CQEA 1H1VA 1Z7LA 3A0BC 1M1EB 2P9LA 5DS9A 3LDPA 1NKCA 3ZX2A 1T3SA 5FKNA 2KYBA 2DA9A 2L3RA 1L3LA 3J7AO 1IB8A 1FKOA 2QWWA 4X64K 3ZR8X 3NQOA 4BI4A 4QVZA 4TV7A 1WHGA 4AH9A 4XORA 2FOKA 2XDBA 3TL4X 2VYPA 1UTIA 2Q0RA 2HMAA 4D7MA 5HBMA 4EW0A 2XDDA 1FT9A 3BGRA 5CAIA 3PM1A 3T5XA 1MGTA 1TTHB 1LFBA 3M9QA 5GTHC 2UU9K 1SAZA 1S1NA 2DJQA 1QVFM 1C1AA 4JKEA 1W2BA 5HNFA 1QVGM 3KJVA 2CV2A 4PJOE 2YUQA 2ROTA 1UECA 3RR6A 1ZLJA 1YIJT 2FC0A 4FT8A 2FQ4A 1PM3A 1YG2A 5GAN2 1VQNN 3UNGC 4LIVA 2F1LA 1JXBA 2IOCA 1VQNA 1X6BA 3IKTA 2PFUA 2O8EB 3D7SB 4V2FA 1LPQA 2ISYA 2YHBA 1ZRDA 2QKBA 2IS6A 3J7YJ 4HHTA 4KUDK 1MUNA 1TKXA 3I5SA 4O5VA 3F22A 1T0HA 1YJ9I 5ILVA 4RM2A 1XNQK 2AQEA 2MWPA 5GAGP 2RI5A 3ZCMA 1GBQA 2IP2A 4AHUA 5KRSA 1SD7A 1E3OC 1YJNT 5KTQA 2RJCA 3OGDA 4E0DA 2HHUA 4B09A 3BZCA 3QPHA 3PLAA 4CF1A 2E10A 3L00A 2X4JA 2JN6A 2N8GA 3FK6A 3FXRA 4NBQA 2CH0A 1GLCG 2HHQA 2HNYA 3LANA 1NLPC 1FMKA 2OI3A 2DTZA 4C92D 4JKDA 3GO5A 3HSBA 2K3BA 4KH1B 3I35A 2ESWA 1UDLA 1S6QA 3ZEUA 3VEYA 1IRZA 2NOFA 3UA6A 3QEIA 4IUQA 2A1SA 2VIXA 1FYMA 3A03A 2K9LA 2F48A 2O7OA 2W57A 3RUXA 2E2JJ 4AIDA 4C5GA 1R5ID 5BMZA 4UV9A 3HHHA 1OU9A 2CGLA 1U47A 2EZKA 2VJ5A 1KAYA 1VQ5Q 3DXMA 5M5YJ 5DTDA 1OCOH 4C92B 3H5AA 5GANf 4B23A 1WUAA 2JS0A 3SBTA 3DF8A 4XRFA 3EGXA 4RW8A 3JW4A 4RW9A 4JV5K 4WE1A 4CRIA 4XLCA 3MEUA 4K11A 1VSIA 3DXKB 1C0FA 2O4XB 1QQCA 3EYZA 1VQ7A 1V29B 1ULYA 3H3UA 2QWPA 2H6BA 4EMKC 2O8CB 2HKNA 1E4GT 1VQ8A 4MFDA 5C42A 3Q0VA 1M90O 5F1XA 3F21A 5HNHA 1XB4A 3AVBA 3NMZC 3K0SA 3TAGA 3U9ZA 2XSJC 2J6OA 5H20A 2CS7A 1X3ZB 5BPMA 4FM0A 1M2VB 1PU8A 2OTJI 4WQ5A 2FO0A 3VYUB 3K7AJ 5IY5H 1QO0D 2VBYA 1K6OA 4KA4A 4BRGA 4HX7A 4DHYA 2YSRA 1HYOA 4CEFA 3N97A 4BRPA 3VUZA 3NF7A 1IXSB 4B1UB 2WC9A 1DTTA 3VF4A 5KYWB 5TGTA 3F0CA 3C4SA 5ILSA 1VTNC 1YI2Q 5CKEA 4C8QE 4CK3A 1GRIA 5KPZA 3P8HA 4JK1X 3HGGA 2XHCA 3CJTB 3NWTA 4EJVA 4BRLA 1B9FA 1C1CA 2IPQX 4OB1B 3K4MA 1P7MA 2P5LC 2UXBK 4ZYAA 1X9WA 2MLKA 1R0CB 4M71A 3KHYA 4YHHK 4A53A 1WXBA 4G7ZF 1RKTA 4HX8A 2GEMA 3FJPA 5CKFA 1KVCA 4MMKA 1IJWC 2NOZA 4KHQA 2B86A 4B8CA 2L9VA 2K3XA 2O9VA 1GLBG 3M8QA 3CPWS 2CWEA 2JXBA 3SJMA 4LLLA 2R7VA 1XX5A 3PFSA 2PMZA 1RTJA 3CD6T 3CMAN 1E7OA 1NZ9A 3H9NA 1VQPA 2QEXT 1Y96A 1YNZA 2AZVA 3PIPL 3LL7A 1WJ5A 2PJRA 1VQMA 2W7NA 2VXZA 3BCAA 3QNOA 3BTIA 1QLYA 3GLLA 3CCMT 2F6CA 4QQGA 4XK4A 1S29A 5CCAA 2COWA 4C92E 2FXAA 2DMOA 1IGUA 3HRUA 3NAEA 4BWJA 3M3ZA 2CFOA 4AHRA 4LC9B 2OFKA 4FYVB 4IOCF 3ID8A 3ULEB 4A54A 4RG2A 5CHIA 3K9TA 1RAGB 2IC3A 5C25A 2BHZA 2LP0A 4CCHA 5HRRA 3DJCA 4ESBA 5IXFA 4EHUA 2LY1A 5DD4A 2PQ8A 1NGGA 2LYCA 2QSFX 3TO6A 3V8LA 4CFAA 3JCMh 1SFEA 4A3BJ 2V8JA 2J5PA 2CYZB 1JGGA 1FWZA 1SS6A 2QQ9A 2R4GA 4JBAA 2Y9YA 4JQFA 1EQYA 3F72A 1U4BA 1V4TA 4QIWN 2F96A 2LQKA 4PFPA 3VSLA 2K3YA 1DP3A 4AFUC 3JSMA 4E9GA 2CP2A 3K4CA 3LP3A 1TWBA 3MN5A 2DEUA 1H3HA 1KONA 2QTXA 3HKZN 1SL0A 4ID5A 3JAME 1ABQA 4EIAA 4B22A 2DODA 3HKZA 1VSMA 1USTA 2W0ZA 2DA3A 1F9NA 2RD1A 5E1XA 2Z1IA 4J83A 3CMEN 3WGGA 1KG5A 4N4HA 2HBKA 2DVEA 1G4DA 4JN4A 2EJRA 2E1ZA 3ASKA 4OMOA 4IDKA 2GWRA 5BR9A 4HSBA 1KEAA 4CC3A 1K4TA 5JMVA 3AG2H 3H46O 2DQLA 1QNTA 4XN0A 3KKSA 4J2BA 1SVLA 3KLEA 1O3RA 2LK2A 1BR4A 4G6TB 1Y57A 3V42A 2G9WA 5BPLA 1BU6O 5LEKA 2D0PA 3FXMA 1JKQC 1RUWA 2XUBA 2ITGA 1QPIA 1SHGA 3LSHA 3JTGA 2Y0MA 3NBPA 2P4RA 3P7NA 4D8KA 3HRTA 4FJGA 4U0WA 2HZYA 3I55A 3VJPA 4CK2A 5TJJA 3SPYA 3FIWA 3VEPA 4EMGA 4BRMA 3SYZA 4DV2K 2E3IA 2VQFK 1TT5B 2VKHA 1G15A 3S3MA 3V81A 3MZ8A 4M6XA 1CXQA 4H0TB 4JKGB 1T05A 4DK9A 2JTMA 2P5OA 4CEZA 3RDIA 1WVRA 3IMXA 3CP2A 4FSXA 4JK7A 4ISFA 3HC7A 3CCSN 4CBXA 2QBYA 2H1KA 3CCSA 3EY1A 1M5Q1 3L2CA 4E6KG 2NNNA 4PZJA 5KPRA 2MPXC 2GELA 4B6MA 3C2HA 3K69A 2VASA 5LGTA 1ZG5A 3CC2I 4RDUA 1JLEA 1YWPA 4RGXA 2DBKA 3CQZJ 2D0NA 3OL3A 2UV1A 5F0FA 4EMKA 3BY6A 3WU2C 2YUOA 2FJ1A 4IOXA 1UGRB 2QM3A 2CP3A 4IHXA 2OPQA 4OAZA 1RNHA 3QNNA 2WAFA 4MDBA 2QGUA 1EFNA 3M5RA 5DM7F 2RQVA 2PJPA 2KIMA 2A61A 3OQ5A 2X3XD 3NGYA 1YIJQ 4FJ7A 3JS6A 2FVUA 4YOQA 3QZ5B 2P9SB 1QQOA 4HXJA 2JSCA 1XMAA 4A3KJ 3H0HA 5D6XA 3VQBA 3EKUA 4F4KA 4M3EA 3WGHA 2X6OA 1V4SA 4DS4A 4BH9A 4CHUA 1BDGA 3IAS2 4KMUX 2M5WA 3S6WA 2BZXA 2CH5A 3JAMZ 3CYMA 3MMVA 5C0YA 4CF8A 4RTFD 3FHFA 1CKBA 1ACIA 2DMPA 1JKOC 3IAYA 3SZGA 2DF6A 1YJNQ 1YJ9N 5D5UB 2E1CA 5CY4A 4XTXA 1BQNA 2Z1JA 5DM7R 2IS1A 1VSEA 3A0IX 2FX0A 2YNHA 2HAXA 5KQ8A 2I5UA 2YRVA 2HBJA 4CXFA 3JB9H 4OPKA 3G1JA 1H92A 1NHAA 4HYEA 4JKAA 4C8OA 4MEXF 2FBKA 2LJ0A 2DZ9A 3H1QA 2RC4A 3EPZA 1ZXOA 3OYGA 4NUBA 4N4GA 4M77D 4D9JA 4HG2A 3BFMA 1R58A 2ECZA 1J9AA 3K1PA 1KQSP 1BI0A 2FZKB 1KHCA 2A07F 4AILC 3O2PE 1JXOA 5EGOB 4JS5A 3K59A 1RCHA 5C2DA 1JUSA 5MLCQ 4M77G 3NVKA 2L3QA 1FMWA 1NG6A 4O0JA 3AO2A 3OIOA 4DIQA 2X6WA 2IGOA 4CGZA 1U0JA 4B3SK 2Y0SN 4IRGA 4B1YB 2R7XA 2WY7Q 1KO9A 3OYNA 2Q2EB 3LGFA 3O1BA 3HSCA 4QPQA 4M77B 1HJRA 4L5JA 1VSKA 2ZKZA 2IGIA 4MQ3A 4RW4A 3W2VA 2DYSH 2GXGA 3CBOA 1VAZA 1YITN 3C1DA 2CZ0B 1J5YA 5FW9A 1YITA 2JUFA 5ERIA 3LNQA 4AHSA 3VEOA 4JI3K 3DTIA 5CQGA 2HCKA 3S3OA 3ABMH 2A0FB 1BL3A 1VYUA 3FEOA 3HFNA 4CD1A 3FX3A 3HL2A 2Y48A 4R79A 4ZN1A 4JRPA 1OR7A 4LDWA 1Z0XA 3JCMP 1V1CA 3A8MB 3E1SA 2JW4A 2DCEA 4LNPA 3TR8A 3VN5A 3QERA 1RT7A 5F27A 5E3LA 2K5FA 3J7ZI 1YX5A 2VBZA 1EIFA 1J9IA 5GAOr 1BI2A 1V5EA 4II2A 2X4WA 4LITA 1RT2A 3H9QA 1LWVA 1HC8A 4Z89A 1P59A 4Q0BA 1RTIA 1YQLA 2KFNA 1G59A 4XKBA 1PVSA 4S04A 4UUVA 4G6DA 4WF2A 2NOIA 1TKZA 3QYHB 1V5FA 2WB1A 3DRSA 3LA7A 4RB0A 3DOKA 4L6V5 1CZAN 1HKCA 5C3EJ 3ZQCA 3PO5A 4RCBA 3QWXX 2BY2A 1Q86R 2QKMB 1UE9A 1H8AC 1IXRC 2ITMA 3ASMA 5B1BH 4YOXA 4DBHA 1MBJA 4LD6A 1OMIA 2ME6A 1VQ7T 4BRHA 4B3XA 2HQRA 4IEIA 1CLQA 3HPGA 1JLCA 4DU4A 3BG5A 5I9EB 1VQ8T 2HHWA 1QSSA 5KAFC 1AHDP 2DVJA 2DW4A 3X28B 3WT0A 4BHCA 2VV5A 2HD0A 2XASA 4MDAA 1P8ZA 4M9SA 1MMDA 2HDDA 1T0JA 3W0LA 2RK1A 4J5YA 1O75A 3O6BB 1ZRCA 2CSOA 1U2VB 1WI3A 3CD6Q 2RQQA 5LJ3d 3Q0WA 4KUMA 2QEXQ 3PO3J 4WFAL 1JLAA 1XSXA 1F5TA 3OR2C 3S1RJ 3CCMQ 3ZSXA 5M1KA 5LL6S 1Y64A 1O57A 3M8RA 3B6OA 2HBMA 3K0LA 2RI2A 3H41A 2P9NA 4BR4A 1XTAA 3TAPA 3M0RA 1VQKI 4E9HA 1K9MU 1JLBA 1UJ8A 1ZBUA 1OYXA 4NXNK 1RAEB 5KQDA 3PMTA 4M77E 3NVMA 5E20A 4M9XA 3WQUA 3ZQ7A 5GAN7 4W5NA 4WK8F 2RV8A 1VQ9I 4FW2A 3HSTB 1Q86C 4FZYA 2JNGA 1TYQA 3EH2A 4RTVA 3O80A 4F93B 1AWOA 3G71T 4DR3K 3V7SA 2K3PA 1D1AA 4IUTA 1SHFA 3J7YP 2E2PA 1NPRA 2YHXA 2ELHA 1HLUA 2BZYA 3RJPA 3QO3A 2XPWA 2LY9A 3EH1A 1VQLI 1B07A 4BB7A 5GAHJ 1E17A 3J81Z 3JCMb 4DTNA 3FMSA 1VQPT 3K58A 3CCQI 3JREA 1YOVB 2L7FP 1ZR2A 1VQMT 4NC7A 3INZA 2HF3A 4BXUA 3JCUC 2O4GA 2MW8A 3HBTA 2HOAA 2DL5A 1D0ZA 4ZGJB 3FMQA 3IL2A 2ED1A 2O8EA 2D6FA 4DTRA 2DXBA 1IV0A 4YELA 1PU6A 3OW2P 3DB3A 1UELB 3BDUA 2R3SA 3QKJA 1SC7A 2BW3A 4I6ZA 2VQGA 3I9V2 2CT3A 4BBSJ 3K70D 3CCJA 2XHKA 1X4OA 4N9HA 3UF4A 4DTOA 5CKBA 2JA7J 3LDQA 1JU5C 2MWOA 3AVKA 4OIQF 1T39A 2QQRA 1RT3A 3EKSA 4BAYA 1VRTA 4E7IA 2WAQN 2H8HA 4PSXA 2WAQA 4BXFA 3K9KA 2LX9A 4QSHA 4BRKA 2NYXA 3V9UA 1W7AA 3RYRA 1H0MA 4R56A 3RMDA 4BQLA 4JNEA 4GY5A 5C2FA 1I5OB 3K4LA 3OBWA 2X51A 2QGFB 3EUHC 4M78G 4CERA 2D9TA 5CE3A 3MEVA 5M5XJ 3V1QA 2YHAA 3C6AA 3LAJA 2L7ZA 4LUDA 2XI9A 2PNIA 3ERED 5LY3A 5ICGA 4DU3A 3KK3A 5FLMJ 4I0BA 4AQYK 2LR8A 3CCUI 4AVPA 4IO9L 3UKUB 2JN0A 4XSZF 2FMLA 4FPBA 1B34B 1U3EM 4Y4RA 1IGNA 3QBWA 3ZSOA 4FSVA 3CWSA 4G9ZA 2DY4A 4GCVA 3ITHA 3TW7A 2GX9A 2HI3A 4H5NA 1ETKA 4GMJB 2EGCA 3CC2N 3DXKA 4O8KA 1O9SA 1GCQC 2O4XA