3S3OA

Crystal structure of the prototype foamy virus (pfv) n224h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/inhibitor/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3oA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3oA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3oA03
3KUFA 4CGDA 1BI4B 1RT3A 3NTHA 1W9HA 2JZ2A 4FJNA 4OLBA 4QQ6A 4CJLA 4E7LA 2YKNA 1D9DA 2OPPA 3KLHA 1SKWA 5IAYA 4QW2A 2RHZA 5KCOA 4KB1A 4KFBA 1D9FA 4HUFA 3LAMA 2HHTA 4BDYA 3SQ4A 4CJQA 4KKOA 3ZSYA 5C25A 4N5SA 2HHVA 3S9HA 1OYXA 4FVMA 4RW4A 4E7HA 1BIUA 3WNEA 2YHBA 2P1JA 2B4JA 1BHLA 3NH2A 3IG1A 2FBVA 3L2UA 4DFPA 4A4EA 2E6LA 2QQRA 3QBYA 4RG8A 4Y1DA 3PX4A 1N5YA 4KHUA 3I8DA 2VWKA 4B9SA 1KVBA 4LY7A 1HMVA 2Z1JA 1LW0A 4DTOA 3KTQA 3QESA 4CEBA 1XNIA 2G3RA 3K5NA 3LDSA 1Q9YA 1VSFA 2JTFA 4FJJA 3DRSA 5J1EA 1HNIA 1FKPA 1VRUA 3K59A 1TK0A 1GOBA 1FXXA 4C5EA 1C1BA 1L3SA 3DM2A 1RDDA 2A1SA 3ASMA 3O3GA 3OQ5A 4CJ4A 3LH0A 1O1WA 5DK5A 1NK4A 2BGGA 1RT2A 4EP5A 4OPJA 1VSLA 2IAJA 5DMRA 3T1AA 4O0IA 3AVJA 4OPKA 1S5JA 4CJKA 2X6NA 3WNFA 3JSMA 1T03A 2G8VA 3OYNA 3HT3A 2OZMA 1CXQA 4O0JA 4OKKA 1NK7A 4M3ZA 1RT6A 4YFUA 3PX0A 2DY4A 3HP9A 3OS1A 3ALYA 3KLFA 1S1TA 2R57A 2KFZA 3SYZA 2GF7A 3OVNA 4M3YA 4F8RA 3AO4A 2NLUA 2ZE2A 2HMIA 1NJYA 2Y1IA 1UAXA 4E7JA 4OKJA 1IO2A 1QSYA 1HYSA 3NAEA 2HVHA 2LCCA 4CFDA 1EKEA 1JKHA 4I9QA 2IDOA 3PMTA 5FRNA 1OZ3A 1TGOA 3I0RA 3VQ8A 1KRPA 4OJRA 4CFCA 4E0DA 4C8KA 4OLAA 2LTOA 3AA3A 3H6ZA 2YNFA 3P83D 3B6PA 5CIUA 4ZTFA 1UOCA 4BE0A 2FBXA 5EU7A 3ZT2A 2E4LA 5HROA 3P5JA 1I3AA 4CJEA 3TAQA 3AO5A 2EQMA 2P0KA 4CGFA 5HRPA 3K57A 3NGYA 4FJGA 4ZHRA 2F8SA 3TANA 3B6OA 4CF1A 2DFEA 3VQEA 1J54A 1WSJA 1D5AA 4FJIA 1RT5A 4MFBA 3TI0A 4DTPA 4KTQA 4FM1A 2F5KA 3AVIA 4CJFA 1RT7A 1WN7A 1NJXA 3DB3A 3L2QA 4IUQA 4IBNA 1NK9A 1K6YA 4CEOA 1WSGA 3L8BA 1ZBLA 5IN1A 1TKZA 3K5LA 3LP3A 2EX3A 2G8WA 1NKBA 4LH4A 3KK2A 1ZBHA 2R5AA 3SUOA 3SQ2A 1H3ZA 1LWFA 5K14A 5J26A 3O8VA 2Z1IA 2GFUA 5KTQA 4UQGA 3MXMA 4NYNA 1L3UA 1WSHA 2I5JA 2QXFA 2X4YA 4GY5A 4C8MA 1XWLA 3ULDA 3AVBA 3ZT0A 4C8LA 3TR8A 4JS4A 1VSDA 3DLHA 4FJ9A 4FXDA 5HRRA 1RI0A 3LAKA 3V1OA 1HQUA 4CEDA 2X4XA 4EZ9A 2EKOA 1WSFA 4DMNA 3LX7A 1C1AA 2VG5A 2FC0A 2OYQA 4EZ6A 1B9FA 3RMBA 3V4IA 4HCCA 4FJKA 1DTQA 2RI5A 1UWBA 1WJQA 5J2MA 2G8KA 3IAYA 2P51A 3CYMA 1Q9XA 3LWLA 4KHWA 1REVA 2IS3A 5JS1A 1RT4A 1S1VA 4Z0UA 4E1NA 1S1WA 1YTAA 3CFRA 4A4HA 4DFJA 4N76A 3MP6A 4DSKA 4DTRA 4CERA 1KLMA 4ELVA 3ASKA 4IUTA 4E7IA 1IH7A 4CCHA 4DQSA 2CKKA 2EQKA 1RDAA 1DLOA 4CJ5A 4C5IA 5KGXA 2BE2A 1EXQA 2QKBA 1TAUA 4DSEA 1BIZA 1NK0A 1ASUA 5CYQA 3U3GA 3RMCA 3OYLA 5KRTA 1NKCA 4A4GA 4FK0A 2LRQA 4OVLA 4H8KA 5HLFA 4FW2A 4QAGA 1NJWA 3DLBA 1HPZA 1SL0A 4CK3A 1DTTA 4HCBA 1CXUA 1BCOA 4L59A 2MWPA 4Q5WA 2XRIA 3O4NA 1NOYA 4GMJB 3V6DA 1SKSA 1S1XA 1G5VA 1S6PA 3SQ1A 3FLGA 4OVAA 2DFFA 4BWJA 3QERA 1NOZA 2B5JA 2D0AA 4IFVA 3HP6A 2G8FA 4II1A 3OYKA 2BDPA 2P5OA 4M3WA 5KRSA 4KHNA 4FLZA 4LSLA 3C6UA 5FROA 3CG7A 2YNGA 3ZSVA 5HP1A 4J2BA 2O4IA 1YT3A 1HYZA 1X1PA 4KI4A 2X35A 1BGXT 2X78A 4Z4GA 2O4XB 3NGIA 4CF8A 3TABA 3IS9A 4CHPA 1JXEA 3OYBA 3LYIA 4N4IA 5KE3A 3QIPA 3V9XA 4DQPA 2NUBA 4ID5A 3QNNA 3NNQA 2R58A 4ZTJA 4IUPA 1BI4A 1JLEA 1JL2A 3NDKA 4FJHA 3DLEA 4AHRA 5E41A 2XY5A 4ELTA 3D45A 4LD6A 1F21A 3F70A 3TAMA 3LZIA 4CHQA 3DMJA 1XHZA 1T7PA 5CYMA 3EAEA 4CGHA 3AA4A 1FKOA 4IDKA 4BDZA 5KE2A 2HNDA 4C8NA 1BCMA 2FBYA 4CJTA 1TK8A 3ZSZA 3O3FA 4FLUA 3QEIA 3OYIA 4QVZA 4HHTA 2M0OA 4Z4HA 4DSJA 4W5TA 3LANA 3NF9A 4Z4EA 3SPZA 4I7FA 4JLHA 2HVIA 3QINA 2XO7A 4HVJA 4FLVA 1CZ9A 4F3OA 3E9GA 2MWOA 4AHVA 5SZTA 1U48A 1NJZA 2RO0A 2GUIA 1U49A 2PY5A 5J39A 2OPRA 1XHXA 2BUDA 3RRGA 3OS2A 4DTNA 3M8SA 3OYEA 4CHNA 4W5QA 3AVNA 4F4KA 2EFIA 5I3UA 1W0HA 4PL6A 1IKVA 2FHDA 1WJRA 2PYJA 1OZ2A 1BISA 2XHBA 2HHWA 1TL1A 4H4MA 3LP1A 3VQ6A 2YRVA 3OYFA 3ZSQA 3HPHA 3DLRA 4IKFA 4AHUA 4G1QA 4B3OA 1NKEA 3L3UA 3DLMA 3ZSWA 4DU4A 1TKXA 3THVA 4IUUA 1IKXA 4KREA 4L8RB 3LGLA 1ZBUA 2JGUA 1KTQA 2PQWA 3FFIA 3ZT3A 4CGGA 2RJCA 3KJVA 4DQQA 5J2PA 3KIOA 4BACA 4KI6A 4M3XA 2VG7A 2IG0A 3V1RA 5KH6A 3RR7A 1L3TA 1G15A 2RI2A 4DTXA 4RW8A 4DS5A 2R7YA 4Z02A 5T7BA 1RBVA 1N27A 4B9MA 5CZ1A 2RJFA 3QEXA 2B6AA 1JLFA 4BWMA 3MP1A 3AO3A 2DAQA 3HM9A 3KKRA 1TL3A 1Z26A 3KK3A 1NK8A 4Y1CA 2G8UA 3V9ZA 1KHCA 4CFAA 3L2WA 3SI6A 4CJSA 5C42A 1VSMA 2EQJA 3UWNA 3KD1E 4CJPA 4DSFA 1QHTA 1TK5A 2HNZA 2QKKA 4F3TA 4PQUA 4W5NA 3M8QA 3ME9A 2WONA 3S6WA 4PWDA 3K5OA 3HXMA 2B8AA 1TAQA 4CHYA 3P8HA 3VQ7A 3RMAA 3P8DA 4N41A 1ZBIA 1B92A 3PX6A 2RHUA 2RJEA 1C0TA 3HVRA 1NK6A 4A4FA 1QTMA 4DQIA 4FJLA 2W42A 2RHYA 1WJSA 4K8XA 3VA3A 1N6QA 4FZZA 1KLNA 4QCLA 1KCFA 1Z25A 3SD4A 4CEAA 2E6MA 4DSLA 3OB9A 3LPUA 3TARA 4OGCA 3VQ4A 4KHQA 3HJFA 1SL2A 3SUPA 4NZGA 1IKYA 4QQGA 3SQ0A 4PLLA 5I42A 4M3RA 1CZBA 2XY8A 3I0SA 3QJ6A 3MXJA 4O44A 2X4WA 4C5HA 1C6VA 4FLTA 5C6SA 4DF4A 4M3TA 4LSNA 2HQXA 1KFDA 1XI1A 2E6NA 1IKWA 4CESA 2DIQA 4M42A 1B9DA 4GVMA 2HNYA 3ZSRA 2EHGA 4CHZA 1KVCA 4KV8A 1KSPA 2BANA 4BE1A 1HJRA 3QKJA 1U04A 1YVUA 2Z1GA 5CY4A 4JRPA 2KFNA 2RF2A 3VQDA 3HYFA 3V9SA 4CF0A 3MEEA 1L3VA 1RBRA 3LP0A 3NTKA 4B9WA 1LAWA 3OYDA 3AV9A 4NYFA 2YHAA 2M16A 4CEEA 3VQAA 4CHOA 4B9LA 3F9KA 2RPIA 5KI6A 3MEVA 4DLEA 3C6TA 3QIIA 1VK0A 3LGFA 1TV6A 1RBTA 2HQEA 1LAVA 4PLIA 1RTJA 1S6QA 3QIOA 3SZ2A 4Q0BA 3SUQA 4Z4CA 4CJVA 2L3RA 3HPOA 1U4BA 1J9AA 2ZD1A 2GV9A 4CIGA 4EP4A 4FJ5A 4B9XA 4FLXA 4I2QA 4E1MA 1JLGA 3U3YA 3KK1A 3DLKA 2IOCA 2HHQA 3L2VA 1QQCA 3AVGA 4KAZA 1SSFA 1JL1A 3OYHA 3OY9A 4CK1A 4CF2A 4EDUA 1BQNA 1JXBA 3UIQA 4BD3A 4IFYA 4QQDA 4J2DA 1LW2A 3AVMA 4CGIA 4DU3A 3K5MA 2RHXA 1A5WA 1LWCA 2GBZA 3AVLA 3C95A 3NH0A 3F73A 4B9VA 4DSIA 4Z4IA 3AA5X 2RI3A 4N56A 1JLQA 3ZT4A 4E3SA 1LWEA 1ASWA 3TAEA 4QOZB 4B8CA 4N47A 2HB5A 2ITGA 3OYCA 1TKDA 1TKTA 1SKRA 2KQ2A 3DOLA 3SJJA 2IC3A 3MP8A 3LZJA 4K8ZA 3OS0A 3CM5A 1HYVA 5SWMA 4FK4A 4DLGA 3NF6A 1SUQA 1EX4A 3NHGA 3OMCA 2XK0A 4RG2A 3P1GA 4FJMA 4DTSA 3FC3A 3LP2A 2JLEA 5JS2A 3CFPA 2K3XA 4XIUA 4HUGA 2G8HA 1UA1A 2HHSA 3ZCMA 2QQSA 2DIGA 3HVTA 4PY5A 3UT1A 3S3MA 4GW6A 1J5OA 3C94A 4KTWA 5HRSA 2KZZA 1HRHA 1QE1A 4I9LA 1S9GA 1S9EA 3DI6A 4DS4A 4RW7A 3SCXA 3DRPA 3VA0A 4N4HA 1RT1A 3KKSA 4R5PA 3NH1A 3E9FA 4PUOA 1X9MA 4B08A 1IG9A 4IURA 3ITHA 1J53A 3KD5E 3KLIA 1JLBA 2LSNA 4C5GA 3E01A 3HSTB 1C0UA 4NCBA 3AVFA 4JS5A 3DRRA 2OPQA 4O5BA 3NE6A 3HO1A 1Y97A 4IG3A 4E89A 3TAGA 1ITGA 2QK9A 3FDRA 3LLRA 4DG1A 4FM2A 5M9OA 3V9WA 3MXIA 2KW4A 1LV5A 4FZYA 2F8TA 3OYGA 4C8OA 2GFAA 2VYTA 3GOXA 1RBSA 1A5VA 4W5OA 4DTJA 4M41A 3CM6A 3RRHA 4ELUA 3AO2A 1MHNA 3AO1A 3H08A 4KHSA 3AVCA 4RW9A 5D6WA 4DFKA 4BDPA 2R5MA 3QETA 1NK5A 1TVRA 3RR8A 2KTQA 3SPYA 3HPGA 1X9SA 3OJUA 3V81A 2VG6A 3A2FA 1SV5A 1ZBFA 3OYMA 2D0BA 4CJUA 3BDLA 1JLCA 3VQPA 5J2QA 4CRIA 3DYAA 4PA1A 3DB4A 3PFSA 2RKIA 3VQCA 5D6YA 1JLAA 1RDCA 3CQ8A 3TWHA 3META 2X6SA 4N4GA 3VN5A 2DTUA 3L42A 2O4XA 2XDPA 3EYZA 3QLHA 4CJWA 2VWJA 1R0AA 1C0MA 5C0MA 1VSKA 1QS4A 1RTDA 1RILA 4CFBA 3MAQA 1U47A 1QSSA 1I39A 4E19A 4CGJA 3M8RA 4HUEA 3QEVA 4DWIA 3MO8A 3OA6A 3VQQA 1OI1A 3IRXA 3V1QA 4FM0A 1RCHA 5HRNA 2AJQA 4J2EA 4ID1A 1VSIA 4OKEA 3NGZA 2WACA 3KLEA 3BGRA 3FEOA 4UC4A 2F96A 1T05A 4ICLA 2G8IA 4KB0A 1A5XA 4I2PA 1ZYQA 2BIVA 1EP4A 4WE1A 4J2AA 4FJXA 4FZXC 1MU2A 2Q3SA 3MEDA 3NF8A 3L3VA 5CZ2A 1RDBA 1CLQA 3SV3A 1WAJA 3OYAA 4NCAA 4CECA 3S3NA 4DQRA 4FL6A 4CIEA 3EY1A 3SV4A 4CEQA 4DU1A 1HQEA 3T19A 4CIFA 3K58A 3BDPA 3OYJA 5J2NA 4DFMA 3PY8A 1RBUA 1ASVA 1RNHA 1WSEA 4B8AB 4CJ3A 2P5GA 2X74A 4M3UA 4W5RA 2D0CA 4B9UA 2HHXA 3QNOA 1D8YA 4LH5A 2K3YA 3K2PA 3SUNA 3S3OA 2L89A 4NS5A 4Q5VA 3KLGA 2O4GA 4CK2A 2D9TA 3MEWA 2BKDN 4E7KA 4IUVA 3LALA 3LPTA 3MECA 4FW1A 5KCHA 4KTZA 3U6FA 1VSJA 1KVAA 3Q1JA 1Q8IA 2OPSA 5KGWA 2OZSA 1T8EA 4JRQA 4OGEA 3MEAA 4AHSA 4FLYA 4KRFA 3OMGA 3M8PA 1RTHA 3ZSXA 3PNWC 4FU6A 2YNIA 4HTUA 1QSLA 2EQUA 2KZMA 2WOMA 4FK2A 4NCGA 2HHUA 1FK9A 1VSHA 2YV0X 2OA8A 2RJDA 1WLJA 3AVHA 3NTIA 5HBMA 4IG0A 3V9UA 4F2SA 3ZEHA 4CEZA 1BQMA 3M9QA 2XY7A 1WGSA 2DFHA 3HL8A 1HNVA 3HK2A 2ETJA 4CF9A 3VQBA 3PUFA 3PV8A 3TAPA 4AHCA 3CFOA 4DTMA 4O55A 3TAFA 1WAFA 2LVMA 4KHYA 5FRMA 2LDMA 5FDLA 4CEFA 5D3GA 1GOCA 4TSXA 4LD0A 2ZQBA 3RMDA 3ISNC 3O4QA 4O4GA 3RTVA 3QEPA 1X9WA 1WNSA 3NBPA 5D6XA 3SNNA 2FBTA 4AILC 3DLGA 4DTUA 2Z1HA 3O3HA 1VRTA 3G0ZA 3QEWA 5C24A 1KFSA 3H8ZA 4F2RA 1RTIA 2D5RA 3JYTA 3D0PA 4KO0A 4H4OA 2PZSA 4KPYA 3C4SA 4FYDA 3NF7A 3VQ5A 3VQ9A 4CJRA 1U45A 3ZSOA 4Z4FA 3WNHA 4FJ8A 2PYLA 1XC9A 4YNQA 2A1RA 3NCIA 3G10A 3AVAA 3DOKA 1SL1A 1C1CA 1VSEA 1EETA 1WSIA 3NFAA 3L2RA 2ATQA 3ZT1A 1YTUA 4B9TA 3OJSA 1S1UA 4MQ3A 3T3FA 3PO5A 4X34A 1UA0A 2YKMA 4FJ7A 1GOAA 3MEUA 2IGIA 2Y1JA 1BL3A 4BE2A 2YNHA 4FCYA 4FLWA 4HCZA 1L5UA 4B9NA 2E5QA 3EZ5A 3CEYA 3PMIA 3MEGA 4M45A 4CE9A 4DF8A 2XY6A 2RHIA 3WNGA 4AHTA 3LWMA 4RW6A 2HW3A 3PO4A 2RN2A 3QO9A 2M1HA 3RWUA 3AA2A 2L8DA 3AVKA 4AH9A
chains in the Genus database with same CATH superfamily
4EJVA 4EW4A 2W04A 1Q82O 1EIFA 2DVEA 1YUWA 3U9ZA 2FZCB 3GLXA 3L2UA 2QTDA 3CMEI 2O5RA 2Z1JA 3QESA 4J9CA 2RQRA 1IG7A 4MMLA 1TUUA 5KVRA 3HSRA 3ASMA 2X4HA 4BRHA 3LH0A 2UXCK 5J8FA 4IL6C 3WNFA 3PX0A 5F6FA 4AI5A 3HP9A 2J06A 1MWKA 3CESA 3BCAA 2QWNA 2F5EA 3W2WA 2E41A 5J4VA 3P83D 3ZT2A 4J9GA 5AQPA 1I3AA 4WX9A 1N5ZA 3T7ZA 2LKPA 1SRMA 4RTTA 1ZR4A 1J54A 3HSEA 3E6MA 3MKYB 1RT5A 4FM4B 5JLFA 3DB3A 4N9IA 3L2QA 1KYWA 2KJCA 3K5LA 4HLYA 1ZBHA 3HOXJ 3K6GA 1MWMA 4BS9A 3OSGA 1XWLA 4C8LA 1EWRA 3LOCA 5EDNA 4P9FA 1F36A 3DU6A 4EZ6A 1B9FA 4GKKK 1O3RA 2ZJQL 1KG1A 4YDUC 2L3DA 1PU7A 3CPFA 3ZL7C 4WCIA 2EJ9A 1TT5B 2W1OA 5M1QA 4E1NA 4DFJA 4JK9A 3ASKA 4IUTA 3NARA 2A3ZA 1Q82C 1X69A 3QWLA 1AWXA 2WSCE 5EF6A 4FK0A 2OTJI 1SF9A 1OOTA 3VOVA 4HCBA 1HPZA 3NQOA 2DAOA 3KWGA 4NB4A 4F3QA 4IHXA 2ED0A 1LJOA 4V2SA 1K8KA 3I56I 3RMQA 4FLZA 2W84A 1TW2A 2E71A 4A3EJ 3A03A 3OSVA 2FSWA 4YTLA 1O57A 3HRUA 1VQ9T 3IDHA 2F2WA 4FJIA 4ZTJA 1JL2A 1KC8R 5DUKA 3R4KA 3TAMA 1F21A 4JLGA 2HU9A 4DIQA 2NOLA 2BGCA 3M5RA 3O3FA 5KN8A 4J6XA 3E9OA 4JLHA 3MWMA 3QINA 2ZC2A 3FIFA 4LOCA 1NM7A 2JWKA 2VUMJ 3RRGA 4H0EA 4J9DA 2K5LA 4GBQA 1HJDA 3GFLA 1D4XA 1VYTA 1NGNA 1BISA 5EYRA 2K9GA 4F7UE 2MC3A 3CTAA 3LDOA 1IKXA 2FPFA 2OJED 4M75E 2FPEA 3QQAA 2PTKA 3RMSA 4XH5A 4KRTA 1ZAOA 4CZCA 3N05A 1WZOA 1E7OA 3AO3A 3HM9A 4RGXA 1Z26A 1LCKA 3JCMb 2A40A 3BJOA 3M57A 4LNPA 4A2BA 1X1CA 3QYFA 2KZVA 2C0TA 4HTLA 1MH3A 2RHUA 4OPHA 4DQIA 1QTMA 4FJLA 3R8EA 1IBLK 2W42A 1WJSA 1AOJA 3WG7H 4QCLA 1SVMA 2KP6A 1BB9A 4Y4RA 2R7QA 5E8GA 2OTLI 2DMUA 4M7XA 2X6XA 1NGGA 3P31A 4GVMA 3DBHB 4FVUA 5HK0A 2X3XD 1OJLA 4R0KA 2RF2A 4KMUX 3CCUA 3FF5A 1XTAA 2M16A 1NGFA 5TKWA 1TU0B 1TC3C 1KG5A 1Y64A 3ENHA 4CJVA 1J9AA 2DA4A 2JA5J 5LJ3j 1SSFA 2DTHA 5HLTA 2CMPA 3TSWA 3Q3SA 2HB5A 3UKUB 3KVGA 2OCCH 4XKWA 1T95A 4DLGA 2EGAA 5EY4A 2XU8A 4DB3A 2JLEA 2WBMA 2DX1A 3ZCMA 4A0XA 2DIGA 3VEWA 1HKGA 4B3TK 3WE3A 1VQ7A 2DTOA 1A35A 3DI6A 3DRPA 3KYCB 3CCLA 1O75A 2CUEA 4XBFA 1E17A 4EAHD 5LMNK 3AVFA 1QO0D 2OPQA 1KD1U 3MXIA 3LLRA 4AD9A 2KW4A 2QGUA 3OYGA 2VJJA 3H08A 1XD7A 4RW9A 5D6WA 4XK4A 5FGMA 1HNZK 3BW1A 4RCBA 1X9SA 1CZAN 1UEBA 2MD5A 2GXGA 1JLCA 1T3SA 3VEPA 1B72B 4IX7A 1IW7F 2W7NA 3H0GJ 3QWXX 3OL4A 5DDGA 1GFCA 1NJIC 1LDDA 1SRLA 4KH0B 1RFQA 4WWCA 4LF8K 1HW5A 1A5XA 2BIVA 5GMKl 1EP4A 5C12A 4FZXC 5CZ2A 1RDBA 1VQNN 1HKCA 3VV0A 5HS8A 4HDUA 3DXJF 2O88A 4W5RA 3QNOA 3S3OA 3K9JA 4FOEA 2BKDN 1XMKA 1RKTA 3CJAA 5BRFA 1BJAA 3GMEA 1T8EA 3OMGA 2EYWA 2HNIA 4HTUA 2F4VK 1OULA 4IZZA 4EJOA 1VQPI 3EEQA 3AVHA 3F10A 3RI4A 4DV0K 4M78F 8AT1B 1V54H 1A04A 5ERIA 2QGGA 3PV8A 4AHCA 4BRKA 2AHQA 1K78B 2VC8A 1OPLA 1TWGJ 1WXBA 2JWTA 4KJZA 3QUIA 5D6XA 2FBTA 1TWAJ 2AO9A 3H8ZA 1UTIA 2DJQA 3ERMA 4JNEA 5E26A 2DO7A 3CCEN 4DKWA 1RGIA 3WHBA 1KC8O 2HFHA 3KYLA 4F04B 3OIOA 4FJ7A 2O9VA 3OW2S 5E17F 2Y1JA 1HOMA 2LX7A 4BDYA 1XTDA 3EQLF 2NRAC 5GAN7 4BKXA 3M3YJ 4KH4A 5IT9E 2EV6A 1OYXA 2O8CA 3WNEA 4WXHA 4EATA 1E3PA 2CUFA 4KHUA 4B9SA 4PGGA 3THXA 3HFNA 1HKTA 4DV7K 3EG1A 1VQOQ 1Q9YA 3X28B 1TP4A 2CH4W 4ENMA 3BJ6A 2P6TA 4X0GA 1NMDA 2IAJA 2FF3B 3AVJA 2HEQA 1MD0A 2E34A 3JW4A 1U6GA 1RT6A 3M0RA 2R57A 3MKDA 4XU3A 1UB4A 1QSYA 4PJOB 5JI6A 3BPVA 1QLYA 3PMTA 4M78C 2OQGA 3VPZA 2LT1A 1ZARA 2Z99A 3FGUA 1U0JA 3VESA 2M0MA 4CJEA 2P0KA 5HRPA 3DLLA 1D0XA 3FZLA 1QCNA 2COBA 3I56Q 4DTPA 2A6EF 1NJXA 1GCQA 3AAFA 3VS6A 4CEOA 1ZBLA 2FUG2 3FXJA 1NKBA 3V8JA 4JI6K 1YJNN 4KT0E 1X2NA 1H3ZA 4M3XA 3LA7A 2HMAA 1GLLO 4ZN1A 2E12A 4LIUA 3GPLA 4DMNA 1AU7A 1TXQA 1QZ5A 1VQ8T 4YFKF 4HCCA 1VQ8A 2K40A 3IAYA 2P51A 4XLCA 4BI8B 4G8XA 3KK7A 1S7OA 5HDKA 2V1NA 3OIQA 4Z0UA 2LP0A 3MP6A 2CP5A 4CCHA 4BRDA 2VI6A 4J00A 1Y7XA 1BIZA 4ZYHA 5AJ3K 3BTJA 2L02A 2W4SA 4G6TB 3D2EB 4JX4A 3CW7A 4KNYA 4FWLA 2X35A 2FL7A 5GADJ 5ILSA 4JI2K 3MX2A 1QGPA 1ZXOA 2M51A 4CO8A 4UV9A 4G6DA 5AQHA 1W1FA 2BE9B 1Q7YR 2VXFA 3AHUA 4LFAK 4XRMA 4GYIA 4RGRA 5JHUA 3CO7C 2V26A 4M9SA 1YJNQ 3SPZA 2HVIA 3KFWX 4F3OA 4BU2A 1S5LC 3K70D 2P5VA 3OS2A 4YOVA 1WJDA 1V4SA 1TWFJ 4LFBK 2JA8J 4AHUA 3L3UA 2HZDA 3ULQB 1TKXA 3H9QA 2MCNA 5DM7L 4PL7A 4L5JA 5IP7J 4IRGA 4BJ6C 1VQKI 2NNWA 4MLHA 3GOIA 3RR7A 2XRLA 2YS9A 1PUEE 1L3TA 4LB6B 3VS1A 4B9MA 3DEEA 2ZGWA 1JLFA 1A36A 1S3XA 1XCBA 4LK1F 1OU9A 1K83J 1H9GA 3KK3A 2W10A 3G0QA 1LOJA 3V9ZA 1SVOA 2W48A 3BROA 4M75B 5KN9A 4CJSA 2VB6A 1RUWA 5LHIA 3AKZA 1QHTA 4IJNA 4KN7X 5L3CA 3GFIA 3F72A 3EGXA 1VQKA 4HDVA 4C92E 2FRHA 1H0MA 3I4NJ 4I6ZA 1NK6A 1U06A 1UGRB 4B3AA 3OB9A 3CDIA 4K2EA 1RLPC 4M3RA 3MXJA 3AG4H 3IWFA 5I22A 4LGWA 4CHZA 2DBKA 2DMOA 4LIVA 1WJFA 3FHNA 1TQPA 3MEVA 1Z05A 4EV0A 1RBTA 2VQGA 3SZ2A 2X85A 3IMXA 3S15J 2HAXA 3HHGA 3B8AX 3N4MA 4XTUA 4KAZA 3V7CA 4EDUA 3UIQA 4CZGA 2F5VA 1T6SA 2E60A 2BY1A 4N56A 4KUMA 4E3SA 3KP6A 3LSIA 2KFDA 4FOIA 4B9QA 1S9HA 1M8VA 1SQKA 5J3LA 3U1KA 1HYVA 2E5NA 1QP3A 4RG2A 2KLOA 2MF2A 2K3XA 2WB1A 3CFPA 4LDVA 2AKKA 3LA2A 1W2BM 3HVTA 2VJIA 3VEZA 5FFXA 4IHVA 2LF8A 2RQUA 1Z6TA 2M02A 2R7FA 4BQZA 1MUDA 2EZIA 4IURA 1Y1VJ 4PCQA 3LAJA 5TKYA 4IG3A 2QYOA 1MV0B 4DG1A 1YRNB 4ZDOA 2LT4A 1ZRCA 4M41A 3AO2A 3K1NA 4II2A 1VQ6N 2DYRH 2PG4A 3CQTA 3HSBA 3I56N 2IIMA 3R1XA 4CJUA 2HTJA 3GXOA 3JS6A 3M58A 3D0SA 3R0JA 1OYYA 4XR6A 3TGNA 2X6SA 3ZRGA 2GXBA 3TTFA 3CMEQ 3RSEA 3H3UA 3MAQA 3CJRB 5DPKA 1M3QA 3JCMX 2HVSA 1N75A 3RDVA 5GAN3 2KDSA 4D9JA 1WB9A 3OYAA 2L3PA 5EZGA 1BG3A 3SV4A 3LQQA 4HX4A 3K58A 5J2NA 3ROUA 1BR4A 4CCNA 5FU6B 1BKBA 1QPMA 2XIGA 1W36D 2HTSA 4IUVA 3MECA 2VL8A 5AQTA 2P9IA 5GIOA 1YIOA 5C4XJ 4CZIA 2YNIA 1GRIA 2X1EA 1P8ZA 2AXLA 4UVBA 2CH6A 1R0BG 4LFCK 3HSFA 2QEXA 1V29B 3SAGA 1N32K 3BLYA 5HS9A 1VQMI 5FKOA 2A5YB 3H45C 3L9FA 1LVAA 2P9PA 2ZXHA 1ON1A 3EE8A 4OMOA 3CQYA 1Z1DA 3O3HA 2E64A 1BI0A 1KFSA 4D0PA 3CJ1A 3VQ5A 3ZSOA 3FZMA 2DT5A 4PJOD 2DZCA 3ZT1A 4ME7A 1SZ2A 4HV5A 5AIPA 4DEYA 1X3ZB 2IA2A 2H3JA 2RN2A 1W2BA 4IXCA 4CGDA 4FJNA 2FQ3A 5LMUK 4CJLA 3T0YA 5JHFA 3DU5A 3C1DA 1D9FA 3FBNB 2CQ7A 5AT1B 5ELZA 2PVOB 5AQMA 4M73A 2Q1NA 5LJ5g 4NC6A 1VQ5I 3SWNB 4M7AB 1K73O 2LD5A 1UGVA 3DM2A 1N33K 1NK4A 1HPMA 3ZQIA 4OPKA 1BW6A 1C0WA 3ENBA 2QDYB 4YFUA 4QSHA 3EFRA 2GF7A 2AP1A 3GZNB 3ZN0A 1UE9A 4FE7A 1TG0A 4XK8E 3CJNA 4B1XB 5HLHA 1JKHA 5F2RA 3UKRA 1K76A 4E1JA 1JTXA 1TGOA 3FX3A 1ARKA 4RBOA 2WAQN 3HRTA 1BC7C 4WQ4A 2LTPA 1ZTRA 2AIRB 1MNMC 3VFZA 1WEGA 2JOYA 3H41A 3L0QA 3F2KA 1SG5A 5L3GA 3JCMf 4G7OF 2L2OA 4D5FA 4JUVA 1D0ZA 3SHFA 2ABLA 1ETVA 5C44J 3K7AJ 2JN0A 2M8EA 3HOYJ 3LP3A 2G8WA 1WJCA 1O7FA 3SUOA 1LWFA 5J26A 5KTQA 1GHCA 2GBYA 2X4YA 3JCMV 3OTOK 3PIPF 1OX8A 1YI2N 1RI0A 2WTUA 1FMWA 4EZ9A 4OMQA 3FXUA 2ROLA 3ECOA 4EW0A 1TL8A 1P92A 5HLGA 2CGKA 3PO2J 5HODA 4KGVB 3F8BA 2KXCA 3X25B 3FHZA 3U23A 3BTLA 5F1RA 4EMSA 3HFOA 4DHYA 1EXQA 3Q5FA 2GNCA 5CYQA 1BIAA 2A69F 3IC7A 2PJPA 1HKQA 4GMJB 1G5VA 3E5QA 2F9TA 3CD6Q 2LP5A 2G9WA 2IA0A 3A8LB 5FPDA 2CH0A 3CG7A 4J2BA 3IH3A 1M1KR 1VQ9N 3ELKA 5B1AH 3JSOA 2R7UA 4XH4A 2NRZA 3IS9A 1E4GT 4KICA 4XQFA 2LC4A 4ID5A 4G6QA 3CCUN 3F70A 1FYNA 3DMJA 3HC7A 3RUXA 2K9QA 2E70A 1NMNA 3I59A 2E1MC 3FZVA 1D1AA 3INZA 2GUIA 4M77C 2FNAA 3OYEA 3AVNA 2YU9J 4MNUA 2NRWA 5I3UA 1P7MA 3WVEB 1M1GA 1H1VA 3QPTA 4ZYDA 1X1DA 1YVNA 3F3XA 4YELA 2UYTA 1NKEA 3OOPA 1KTQA 3DXKB 4B1WB 1KAXA 2VG7A 2RF0A 4K11A 4A5NA 1G15A 2L4MA 2KKZA 4NOYA 4Y1CA 4YOWA 2V9PA 2Y31A 1V55H 2D0NA 1EH7A 5JVTA 1QMCA 2ZFUA 1VQLN 2WONA 2DMQA 1Z7UA 1ZHFA 2LQWA 1SC7A 1JT6A 3HIFA 3P9IA 1H8AC 4N41A 4ILGB 3QP5A 1Z77A 1RABB 2LC2A 4X6AJ 2DFIA 2O9SA 1K9MO 5C4JJ 1Z25A 3CF2A 4NZGA 2X4WA 1T38A 4LSNA 2ZJQF 1KFDA 2DIQA 3ZGKA 4BREA 4BE1A 1YVUA 3H0DA 1EF4A 4JN4A 2GIVA 1FT9A 1N36K 2VKVA 1VK0A 1W7AA 3K4KA 4RM2A 3GTPJ 2VKNA 1O7LA 2Z2SB 3HDDA 4BRQA 3ZBDA 4FLXA 3L4QA 4G9ZA 3AVMA 4Z4IA 2GGRA 4GXOA 1KU9A 3I0TA 4BQNA 2OUMA 5F27A 2ITGA 1IXRC 2UUCK 4FK4A 4IXAA 4ZGDB 3L00A 3NHGA 4RMOA 1UJ8A 4FJMA 1KQ8A 3UDCA 3JR9A 2QQSA 2V52B 1J5OA 4Z8AA 1JI8A 1GT0C 4OIRF 1VQNQ 1ATNA 4A53A 4QVCA 3MN6A 5AQYA 4HBLA 3RTRA 4F16A 1XPXA 3A5MC 4E89A 4XRFA 3C2GA 5BN8A 1SEUA 3EUKL 4DTJA 4QWQA 4FTHA 3CJ7A 4JOMA 1VQ4N 2M7AA 5IT9O 3I33A 4DFKA 3QYGB 1PG5B 4A5BA 4LF7K 3BY5A 3JCMe 5L8RE 4N4GA 2H8RA 3MKLA 2YUPA 1PRMC 3VQQA 3BC8A 1YQRA 2FSNA 2F5CA 3LL7A 5LJ3d 3CC7Q 1OVQA 4J2AA 3UATA 3BZCA 1WAJA 2ZM6K 4DQRA 1ERDA 1QCOA 1HQEA 2JMAA 4B8AB 2L7FP 4M3UA 4D7MA 1YI2I 2VQLA 2DD5A 4R1HA 4E7KA 3LL3A 4Y33A 2NS7A 2ZNZA 3JB9I 3DLAA 1RTHA 1XG7A 2HSEB 2DOFA 3ULRB 3HL8A 4HKEA 1S72Q 2YPRA 3DCFA 3CCMT 2LVMA 3BQZA 1VOMA 5D3GA 1WJBA 2VASA 3CJ9A 3CXCP 4M7DC 1NHAA 5LHGA 2BYVE 4BBSJ 3G0ZA 4F2RA 3CCJN 3DLLL 3IRQA 1XC9A 1BIBA 3NCIA 4IIOA 1C1CA 3T3FA 2ZB9A 2YNHA 4A62A 3EG2A 2XY6A 4Y13A 3WTUC 4NUBA 4AHTA 3QO9A 2PVGB 4CBXA 1RADB 2RGVA 1BI4B 4OLBA 3I5RA 3WU2C 2VBYA 4K42A 4CJQA 3C18A 4N5SA 1R1UA 3EG9B 5GANg 1YS6A 2YHBA 2DA9A 2DL3A 2OJ2A 4AIKA 2ABKA 1HMVA 1N9RA 1Z9ZA 2OTLT 1HR0K 3J7YJ 3WTVC 1R5GA 1VQ7I 1ZLJA 2EZKA 4M75G 4M3FA 2JHJA 4O0IA 1M5Q1 4DJAA 3Q0WA 5HL7L 2G8VA 3K4NA 2GTOA 4DBRA 1G83A 1Z21A 2OZUA 1PU6A 3OS1A 5GADP 8ATCB 3OVNA 2RB6A 1EFNA 4U7BA 1UAXA 5DD8A 3FZKA 4HXJA 3J80K 4NXNK 1S7AA 2QEXT 3BG7A 5FPEA 4FSSA 2CS7A 1Z9QA 4ZHRA 3FWEA 1HKBA 2UUAK 3VQEA 5J1YA 3BF3A 3AGKA 2QLZA 1K6YA 4QS8A 1S22A 4BRAA 1M3HA 4FWKA 2JTVA 3ISPA 1VQ8Q 5A2QZ 1MSEC 4FJ9A 4M75D 5E1ZB 2K4YA 1VSDA 5EX5A 3CCST 1BR1A 4HT9A 2FC0A 1IRFA 1ON2A 2NRRA 1NH3A 5LJWA 4FJKA 4I02A 2M0YA 4EMKB 2E88A 3CYMA 3LWLA 3TMOA 2MLGA 4DV2K 3I3LA 4DSKA 3SZTA 2JMCA 2FEZA 4H0VB 3IH4A 3WXKA 2BE2A 3OA9A 4A69C 4BG8A 4DBHA 2E1CA 2L7ZA 2XRIA 3E6DA 3V6DA 2B9SA 4J9EA 3FLGA 4EJTA 2D0AA 3MD2A 1ZSZB 2P5OA 5FO5A 1W5CC 3FMRA 1BGXT 1YIJT 4BGDA 3GG4A 4V19K 5GP9A 4OB2B 4MEYF 5E41A 3LA3A 1JGGA 4H5TA 1SVLA 1MUZA 3AA4A 2H1KA 4YFNF 2ZPHB 5GTIC 3ZSZA 1T39A 4DSJA 4DR3K 4I7FA 1NYFA 1YTYA 1NJZA 4YPHA 4DTNA 3W2AA 4IRHA 1RAHB 1M3BA 1UHFA 4X64K 4W1UA 4DU4A 4U88A 4AU7A 3KJVA 1P2FA 2LFBA 5J2PA 3A1PA 3V1RA 2ME0A 2R7YA 1MUYA 1RDUA 1H641 2DAQA 5LJ5d 5GANj 4EVIA 1NK8A 2LBFA 2F9WA 4C0GA 1VSMA 2I2LA 3E6CC 1B6AA 4S0HB 1HLVA 3HXMA 1IAWA 4JZ3A 5IOZA 3LM2A 1Q86R 1I27A 3PX6A 3TQ7P 4B44A 4C8QE 1VZ0A 2KYMA 2FO0A 2DXUA 3VQ4A 3HTRA 4PLLA 5C6SA 2EQIA 1IRGA 1XI1A 2E6NA 4M42A 1FTTA 4DEXA 4AWXB 2MK5A 3BJAA 3RZDJ 2KFNA 2Q36A 2K9SA 4JJDA 3M4GA 4CEEA 3C6TA 5GAHP 2V7YA 1T56A 1X4OA 1LAVA 1UJYA 3CC2A 1IZ6A 3GLLA 4HRIA 3P38A 3KK1A 1OR7A 3WG9A 2DU9A 2I5UA 3QYEA 4QQDA 3AVLA 4B9VA 1M1KC 1KG4A 3J7AP 3FE1A 3OYCA 2FZKB 3OS0A 2K85A 1EWQA 1WHUA 3A8OB 3P1GA 5LGNA 1HUXA 1WH7A 3NPFA 4M7DE 2QSFX 4Y52J 4PY5A 3L09A 1UG0A 3SEQA 2ENMA 5GAGP 1KXPA 3RYPA 4A3DJ 1X9MA 5C15A 2FPDA 3EGUA 2QA4I 4L18B 1XG1A 3ITHA 1ONVA 1J53A 4D1QA 2LSNA 3G7ZA 2DDBA 5CVJA 1PUFB 4PFOA 4JS5A 2R7SA 1WHKA 2OA4A 2JUCA 4XICA 3GOXA 2UXBK 1UHWA 3QOPA 2V1DA 2CT3A 4DQ2A 3HPGA 1LDKB 2CYYA 1OH5A 4DV1K 2SRCA 3RCOA 3JRCA 1RDCA 2DTUA 3EYYA 3KZBA 3EUHC 1GDTA 3GTMJ 1K61A 4B47A 1XSXA 4M77B 1SSHA 1OI1A 3D2FA 2XMFA 3A0IX 4TVRA 2Q2RA 2JMWA 1X19A 4FJXA 3IQLA 1M1EB 4A3BJ 2XKPA 2V7ZA 3GFJA 4CEQA 4GGGA 1BI1A 1OU8A 1RNHA 2KISA 1JCGA 2K3YA 2YCHA 1HQCA 3JCMd 3FR0A 1YWOA 2D9TA 3CP8A 2ZPIB 5FU7B 3V7SA 4EMHA 1K0SA 1YBYA 4JRQA 4J19A 2ZBKA 1QSLA 3GE1A 1T0JA 2EQUA 2LVSA 1TYQB 1NYGA 1RETA 1QWEA 1ZA2B 2QWOA 1I1GA 4OP0A 4IO9F 2ZPFB 3S93A 3FXQA 2A5WA 5M3MJ 1WAFA 4BY6B 1Q1HA 1TLHB 3ASNH 4OWRB 3ZETB 5GAMf 4JX6A 2VWFA 2DK3A 5IHKA 3DLGA 2A3LA 3ZQLA 1SKUB 1QVGA 5A2QE 4WFAL 2ZJPL 2HD0A 1U45A 2RM4A 3FM3A 3G6EA 3WNHA 1VQON 5AQIA 4LF4K 5K5RA 3PJRA 3FM5A 2K6DA 1SL1A 4MQ3A 1VQ5Q 5D4SA 1XB4A 4ATOA 2YRDA 4WK8F 3MZ8A 3EZ5A 4DF8A 1PDNC 2CV2A 2WSFE 4YEJA 4FE4A 3VS4A 3CJCA 4OLAA 4CCKA 1U3OA 4E7LA 4OFAA 4QW2A 4A3GJ 1AD5A 1M90C 3THWB 2QM1A 3ZSYA 5CQXA 5C25A 1R6RA 3I55T 4CEBA 2E7WA 3KLNA 4MZMA 3O3KA 4FJJA 2ZJRL 4C23A 1SPKA 3OQ5A 4CJ4A 2JG6A 3T1AA 1FEXA 1WNLA 3SWNC 2LKSA 3AFHA 4BQLA 3JCMc 2NOGA 1T03A 2VQCA 2DK5A 4IO9L 1Z3YA 4MLOA 2PFUA 1ETYA 1J5YA 3Q9SA 2NOJB 4E47A 1SANA 4C8KA 2LTOA 3AA3A 2VWJA 4XOTA 3P5JA 2ATCB 1M1KO 3GTQJ 2K5FA 4LF9K 2ESHA 1OH7A 2DA1A 1NJIU 5IN1A 4A93J 3MXMA 3HB9A 4M63C 4J7IA 4DUYK 2WAEA 4W97A 3I53A 3CJQB 1TQMA 1QZ6A 3RIRA 1YJWN 3B73A 2NVYJ 1BDGA 2VG5A 3A0HC 2MMPA 1GLCG 4EQQA 3A1YA 2KQRA 1A5JA 2GELA 1K8AC 3O9SA 2VJ5A 1G3SA 1HDPA 2D8HA 4KHWA 2YHTA 4A4HA 4RAFA 5IT3A 4BXUA 4OAYA 1K9MC 4BAYA 1G2HA 4XLAA 2X6OA 4X9CA 3H1QA 1N6AA 2V9KA 4MHGA 4BGAA 1DTTA 1ZK8A 5EOYA 3R61A 3AG2H 1ETXA 5KYWB 3WT0A 1NOZA 1XUPO 1UZCA 3ZMUA 5BRDA 2NWMA 2K79A 2L4AA 4Z4GA 4ESBA 4EIAA 4CH7A 1FP2A 3DKXA 1VQ6T 1IJWC 3HRMA 2O6GE 4XSXF 1E2XA 1NK2P 4CJTA 3FFKB 3VJPA 3OYIA 3PQKA 4Z4HA 5LL6Z 4ENKA 1Q81C 5ED4A 4DOWA 1U48A 5SZTA 2L2PA 1J09A 5D6FA 4XKBA 2R4GA 1U1TA 4GKJK 3ZMSA 3OYFA 4H5NA 3CD6T 4IKFA 1QU3A 1I5OB 3DLMA 1NK0A 3CCQQ 2OCEA 3W2VA 5KH6A 1KC8C 1N77A 3SJMA 3PIOL 1IB8A 3M1FA 4M78A 1MKMA 2E6ZA 3X20B 3KD1E 4PQUA 2COZA 1ITYA 4WF2A 4KFCA 3P8HA 1DUXC 2QBYA 4B1YB 4AQYK 1B92A 3A01A 4B3MK 2ZJPF 5FB2A 4OFHA 3F9MA 1N8RC 3BZ6A 1DU6A 3S1MJ 4DV5K 4E9HA 2L7MP 1O3TA 4HNTA 2UV1A 3SHWA 3RESA 2EHGA 3CCRN 1HJRA 1QQNA 5JFRA 3VQDA 2IS4A 4J01A 4NYFA 4YRVA 4B9LA 5GMKh 4EEFG 2XB0X 2EIFA 4GV9A 1W70A 1NWKA 2CGHA 3MZYA 2UXNA 5AQNA 1NLPC 1A31A 2QKLB 1IXCA 4EP4A 1QQCA 3VYRB 3THYA 3VEYA 1YAGA 2P8TA 3EHRA 4QPOA 2P0PA 3OW2P 4DSIA 5K1YA 3T8TA 3TKYA 3S1RJ 5D5VB 2RC4A 3GTKJ 2V6EA 4K8ZA 1ABQA 2IC3A 1M27C 5IP6A 4XIUA 4XKVA 1VQNA 1X6BA 5L23A 4DUZK 3UT1A 4RW7A 4DA4A 3DWLE 2Q0OA 1G3WA 4NNJA 1WHLA 4C5GA 3E01A 3TP3A 1VYVA 3DRRA 1MUNA 1LQ1A 2F8TA 1Y71A 4Y3OA 3K4LA 3C7JA 4ELUA 4RB0A 3CCVN 4M77G 2YX6A 2JWLA 1T0FC 4MLEA 4EGYA 5CKHA 1LNXA 2D0BA 3BDLA 1P7IA 3FKIJ 5M3FJ 4CRIA 1VRLA 4LC9B 3VQCA 2GBQA 4WFBL 3LQRA 2EINH 4I01A 2HKNA 3IRXA 3V1QA 5GTHC 1RCHA 3I55A 4CBWA 4ID1A 1FW6A 3F6OA 2CZ7B 3FEOA 4RDUA 5AQKA 1GUUA 2DQRA 4A54A 4P5OA 4QS7A 3SV3A 5E84A 2RN8A 3WXLA 2CP0A 3BDPA 2QWWA 1WSEA 3F8MA 3CDLA 2X74A 4B9UA 4YOXA 2DA3A 4NS5A 2P9UB 2FVUA 2AK5A 1Y39A 2OX7A 3WVDB 1HCRA 3FK6A 3SBTA 2NNYA 1VSJA 4O6JA 3Q1JA 5KGWA 3H9GA 3HSCA 3WXMB 4M78E 1WJEA 3WODF 3LMMA 1ZQ3P 2ETJA 1PP7U 3P8BB 3PFIA 4BR4A 2ECCA 3TL4X 1WHJA 2Y30A 2PZSA 4IF4A 3ZMZA 1X2KA 4H4OA 4FYDA 4AVPA 1MIJA 2PFBA 3VTIA 2XGEA 3VRZA 3AVAA 3JRZA 3M3ZA 3G4SN 2IVWA 4X34A 1T6CA 3L6QA 5DLOA 1RAEB 3FDYA 3F5TA 2ZPBB 3N0UA 4CE9A 3LWMA 5JVGL 4RB1A 5FLXE 2CWEA 4CZEA 1W9HA 2IGOA 1AT1B 2QEXQ 4KB1A 2HHTA 4HUFA 3HBLA 3UPUA 2O31A 4CC3A 3ZX2A 3S9HA 1BIUA 2E3HA 3IG1A 4DBQA 4JI3K 3D5SC 1ZUKA 3QBYA 4Y1DA 1DPRA 2DA2A 3KTQA 4Y91A 2MD0A 2XPVA 1FKPA 2E2IJ 1RDDA 4IOAF 2WC9A 1VSLA 1WYXA 2AQEA 1GLJO 1XN7A 1OVYA 1UCRA 4M71A 4BROA 2DY4A 1FJLA 4UY8O 1BBYA 3SYZA 5EGOA 2W57A 4CC7A 1G6NA 4BB7A 3VF6A 5CPRB 1YIJI 4OMLA 1AHDP 1TQIA 3B02A 1UOCA 2A41A 4HW0A 2KEAA 4CGFA 2F8SA 3C0BA 3TANA 2DJNA 4FM1A 4JP0A 2IAIA 2P9PB 3FBIB 3L2CA 2R7ZJ 5FPMA 3IH7A 2EX3A 2JA7J 1HNWK 4UQGA 1K9MU 3KFVA 3BR5A 2VKDA 5HKCA 2FF4A 4JS4A 3DLHA 4FXDA 4BUPA 2L01A 4R79A 1HW1A 3JRAA 3CCSA 5CE3A 2HOAA 1WJQA 1X4PA 2CGPA 3KEOA 2E8AA 3FXMA 2EAYA 2IS3A 3M53A 1KLMA 4XH1A 3CUQC 2CQQA 2VQHA 1YJNT 3CXCM 2R7DA 5J3BA 3FRNA 1NOYA 1KU2A 1OQYA 2DYSH 1KG6A 1U8BA 3QERA 3WTSC 3WGHA 3ZLJA 4HA8A 5HP1A 4L3QA 4KI4A 5M5XJ 5DEQA 3LWFA 3J7AY 4BC4A 3IL2A 3C3WA 3LYIA 3TOBA 2OFKA 4EA4A 1X2MA 2HDCA 4CC2A 4BEHB 1I5LA 2HNDA 1UDLA 2X9DA 1WEFA 4L0ZB 2ELJA 4HF2A 5FPNA 2X1DA 3LH5A 2X6WA 3A02A 5CYVA 5HOOA 3J7AO 1OZ2A 4M75C 3WEEB 1X3WB 2NYSA 2PVDB 3QSUA 4DZPA 2QAZA 5IYBJ 1W4SA 1ZBUA 4HG2A 4DR5K 2FEIA 3C2HA 4M77D 4XN0A 2QXLA 1KQ0A 1YITT 1HJOA 1YITA 1KHCA 3UWNA 5GAMd 3KP2A 1TSFA 3HOVJ 2NOBA 4B43A 3JRGA 1WIEA 1W0TA 3EDPA 2DLPA 4BR2A 3VGMA 5M5YJ 2DXCA 3VUZA 1M9SA 4BJ5C 5HCKA 2R5YA 5AQXA 3K0LA 3A0BC 4DSLA 1HSJA 4OGCA 4LLLA 1TT0A 4QQGA 5I42A 2XY8A 3ULEB 3PTAA 4M3TA 1XQPA 3O80A 3OH6A 1KSPA 2BANA 3CC2Q 2Z1GA 1RI9A 1L3VA 4GRIA 1P4XA 1LAWA 4CHOA 2RPIA 3HOWJ 1NEGA 3C6HA 3Q9VA 4PLIA 1N8RU 4YOUA 4HVWA 3H0IA 3HPOA 3JCMQ 2M1BA 4FJ5A 2O8EB 3N4PA 2HHQA 3L2VA 5DM6F 3CVSA 2KTQA 1RAIB 2YJFA 4ZYAA 1W2BS 1QZZA 3TAEA 4DBFA 1QZEA 4LFUA 5AQSA 2O8BB 1JUMA 1VQMN 2MH2A 4OINF 4JX5A 4HUGA 2QYZA 1OKRA 2V7FA 4XU2A 4DS4A 2KRMA 2Y48A 1KQ9A 3QFPA 4FYWB 2YHWA 3EFOB 1ZH5A 2X0LA 3EPZA 1E6GA 2O8BA 4NCBA 4O5BA 3HUGB 2PJRA 2QK9A 2DI3A 1TWBA 3V9WA 1EJ9A 5M9OA 1MPGA 3HTSB 5K5OA 3G6EN 4HNUA 5B5EC 1MGQA 3AO1A 3CXCS 4BDPA 4I09A 2KDZA 3FLCO 1TVRA 1P9QC 3OJUA 4BXXJ 2J7IA 3QYBA 2O2OA 2BE7D 5CKBA 5D6YA 4Q5SF 3META 4ZGJB 2VBZA 1JQQA 2DD4A 2DEUA 2O4XA 3QLHA 1E6HA 1BOTO 4RUGA 1IN8A 2K7LA 2C6YA 4BRNA 3KLEA 4UC4A 2F96A 1T05A 1Z91A 2E5ZA 5IHIA 5A2QO 4HSRA 1X3MA 4DU1A 3GF2A 3LWIA 1I3QJ 4M7AD 2AT1B 4X1EA 2DNUA 3KLGA 3LPTA 1KD1O 1LEBA 2CGJA 5EJCA 5A0DA 4DV4K 2HL5C 1X43A 4PJNA 4P1WA 3HTVA 2H1LA 2LRDA 4L5EA 5KAIC 3ZETA 3A5LC 4Z89A 3UA6A 2CQNA 3TAPA 2H27A 2QENA 1KAYA 3JTHA 5GAOq 4XOPA 2ZQBA 3ISNC 5GAMj 1JBMA 1X9WA 1WNSA 5FFZA 4HZFA 1VRTA 3JYTA 4BBRJ 2J05A 2HQ5A 1D09B 5I2MA 1ETWA 3PIOA 5GMKi 1WSIA 2FOKA 3VS2A 5AN4A 2DTZA 3HPWA 1U84A 4ORZA 3VGKA 4B9NA 3OBWA 2NLXA 3RWUA 2EWSA 4UUTA 3LAPA 2JS2A 1S8NA 2W82A 1NBEB 2JZ2A 1Y56A 1J7KA 1SKWA 1YFHA 1M30A 3EFSA 3WTXC 4HQEA 4FVMA 1B1BA 3CCMQ 1Q86C 5GAN4 4RKUE 4DFPA 4CUGA 2DBMA 3VODA 3JCUC 1JCEA 1GOBA 2E1NA 5CKTA 1KIKA 1J2XA 2Q1ZB 1S5JA 1EZZB 2X6NA 4I99C 3HT3A 2P9SA 1H9TA 5LBQA 3EO3A 4OMNA 2NLUA 3I9QA 1L0OC 5BRHA 1B9MA 1XSVA 1TTHB 2X4JA 2CW7A 3TO9A 4E0DA 3CMAI 4ZTFA 5EU7A 4ISEA 4IFEA 4BY7J 3AO5A 3O8HA 2FA5A 2QWLA 1WSJA 2A28A 1N34K 2F5KA 1X27A 1K0XA 1VI0A 4ZNXA 1FYMA 1BW5A 4RLFA 9ANTA 1B07A 1U9OA 4JI7K 4DOVA 5GAN5 3SQ2A 1CF7B 1MNDA 3CMAA 1WSHA 2I5JA 2P9UA 2QXFA 1NGBA 4E7SA 3ZT0A 2BVMA 1IUYA 1S72I 3Q7CA 3W6VA 4MEXF 4C9YA 4PSXA 4Q4ZF 2HEOA 3KETA 1MH4A 1WZ2A 3BEXA 5D5UB 1BJZA 2P9LB 1QHGA 1WOQA 2NOHA 2GQIA 3NMZC 4B8XA 1CKAA 2KJBA 4YOTA 3EETA 3JB9H 2IS2A 1JHHA 5GANe 4QAGA 1ZSZC 2FX0A 3O4NA 5BPMA 1F5TA 3VPRA 1Q86O 1X3NA 3TO7A 1JGSA 1IHVA 1B59A 2OTJA 3OYKA 3ZSVA 2EBIA 3A4CA 1KHIA 1WXUA 1VQ4I 1KGSA 3M1CA 1J0RA 3TABA 3CPWS 1ULYA 2E5KA 4ESJA 1J75A 3EGXB 3V9XA 2NUBA 3D45A 4BI3A 3QBWA 5GAOp 2BZ8A 3JCMW 3R6SA 2GOXB 1C6VX 1TUDA 1KFZA 5HY6A 4YORA 5AQFA 3MKZA 2R7XA 3MCZA 1XHXA 4YG2F 5H2FC 1WX6A 4W5QA 2EFIA 2DZ9A 5M1PA 1TL1A 1QKWA 1FBQA 2P9IB 3THVA 4FYVB 5CKDA 2KMTA 2XAJA 2DT6A 2K5IA 1QVTA 4RW8A 2EYYA 4JJNK 1YIJA 1I50J 2HHHK 3I5UA 2CT4A 1K8AU 2VKEA 5K5QA 2QQ9A 2FBIA 1KD1R 4Z2YA 2L9SA 1R7JA 5LJ5j 1LNWA 2LF7A 4PJOC 1QA6A 3JRHA 4A4FA 3DLLF 2LJ1A 3EKUA 3OSFA 4MTDA 3PVLA 2R0QC 2K3BA 4O44A 2GCXA 2W6LA 4OU0A 2Y69H 3C6AA 2CO5A 3CCSI 4OMFB 2YU3A 1XMQK 3EUHA 2FJ1A 4DQ8A 2H3EB 5KI6A 4CJ7A 4Z6YA 1Q7YO 3CXCA 1UG1A 4F7ZA 4OB0B 3CCUI 5FU6C 2GV9A 2OBPA 3ZXSA 5AYFA 3RYRA 4IFYA 2Y4YA 5GAN6 4WCEL 1HA8A 1PNJA 1K4US 1NLVA 2W00A 1IXDA 5TJJA 2BXYA 1ZRDA 1S6LA 1QVGP 3ZX0A 5AQOA 3OBYA 4M72A 2EILH 1RUOA 4HT8A 3IRRA 2GTDA 3J7AF 2COMA 1Y0NA 3EN9A 2KYBA 3J7ZO 1PU8A 2ZZDA 3JRIA 5J4YA 3KZZA 2D0OA 4EHUA 5IP9J 3TAGA 2UWMA 2NYXA 3MN9A 2A07F 5M1FA 4B6MA 1ZGWA 1W4MA 1M90O 2W25A 3JB9D 4XTZA 1VQ6A 3QETA 1NK5A 5K7HA 1QP2A 3LCNA 2XAGA 2LG4A 2VONA 1OMIA 1JLAA 2GWKA 4OMMA 4UVAA 4ANJA 1R23A 5EC7A 3JB9G 5HRNA 3DEWA 4OKEA 3OR1C 3IAS2 2XAFA 3GP8A 3MDQA 1CLQA 3S1NJ 4CIEA 3EY1A 4E6KG 4HVUA 3T19A 4CJ3A 2YR2A 4MFDA 3SUNA 3JAMK 3O1BA 3SQNA 4DCHA 4JKGB 2ZXIA 1NLOC 1TBXA 5EXWA 4OGEA 3HG9A 2VE8A 1VQ5N 3CMEN 3BF1A 5GAMg 1VSHA 2N8GA 1U2WA 3FZHA 2OTLN 2BZXA 4N0AC 3VF2A 2NOEA 3M9QA 1HNVA 1FIAA 3IV5A 2ZJ2A 1R59O 4EA5A 2L7KA 4TSXA 3HHHA 4AFUC 2ZGYA 3GYHX 4DTUA 3GX4X 2ZGZA 3AG3H 1IGQA 4P9UA 2FSKA 3QJYA 3H3NO 4J8FA 4YNQA 4KH1B 3PIPA 4A0YA 1A0NB 4XNFA 1MV3A 4JYAK 1NBWA 4FSVA 4N0BA 2V75A 2EZHA 5LJ5f 2FYKA 2JW4A 2V8IA 4RW6A 2P0QA 4QQ6A 2EGCA 2QBYB 5CVVA 3KLHA 2OC6A 5KCOA 4K25A 2ZFWA 3J81E 1ETQA 1AWWA 5DM6L 1TNTA 3QYHB 2FBVA 1WRJA 3JV3A 1GXIE 4BC5A 4DTOA 1YW8A 3GTLJ 3BP8A 5ECAA 1HNIA 5CCAA 4KT6A 5JLHA 1FXXA 1UGQB 2LLKA 2BGGA 2FSJA 4IZ9A 2KZGA 1SS6A 2GX9A 5AZJA 4F8RA 2ZE2A 2Y1IA 3RKQA 1AKHA 2RQTA 1OYIA 3PM1A 4Y92A 3JRDA 2PAVA 1TZLA 4L5GA 5CO7A 2D45A 2F69A 3F8CA 2AKLA 2O01E 3TI0A 1IDZA 4ELYC 2LJ0A 1WN7A 4NQWB 5AFUA 3CMMA 3CERA 4LUEA 3CMET 1D5YA 3KK2A 2VC1A 4B1UB 2NUPB 2WA0A 5KYNA 2W24A 4GY5A 4HF0A 5FKLA 3TR8A 3N97A 2E3IA 4CC4B 1WSFA 4AF1A 2JRTA 5LL6S 2KGTA 3J7ZI 1P4AA 2LH9A 1C0FA 3VS7A 1WI7A 1OCPA 4Y7NJ 3SAHA 4JYKA 1OQKA 2BBYA 2KRSA 1DT9A 3HRGA 4CSWA 2EQKA 2VQFK 4HSBA 2YSRA 3CPWM 5C3EJ 3E3VA 4EGZA 1PYVA 1QHAA 1WBDA 2F4OB 4KIGA 4E70A 5D5WB 2MWPA 1S6PA 4JBAA 2V1XA 2KNBB 5K7FA 1ETOA 2HDDA 5BN9A 3M8FA 1KQ1A 2E19A 3QZ9B 2JUGA 2TDXA 3EKSA 4DQPA 4A63B 1XMXA 4ELTA 3CC2T 1IO6A 1T7PA 1PD1A 1UA0A 4BDZA 4IHWA 4FLUA 3BR2A 1M2VA 1LDJA 2STTA 1KO9A 3ZMTA 3CC2I 4BH9A 3GNGA 1CZ9A 2X1CA 2OPRA 2OTLQ 4IOCL 1IN6A 1IKVA 4HYEA 1LFUP 4OIPF 3LP1A 1QVFM 4H5WA 3K2ZA 4XAXB 2XHCA 1FMVA 4IUUA 2XGCA 3CC4Q 1UGSB 4DQQA 4MDWA 4M7YA 4I98B 1YITQ 2YUNA 4BEHA 1K7AA 3CCUQ 4JK8A 4WTOB 4GY2B 1VQLQ 4O8UA 4RCCA 4BQAA 3MCAB 1TL3A 3I54A 3SI6A 2HBMA 2K9LA 3UNGC 4F3TA 2ESNA 1JJ8C 1NJIO 3GW2A 3I4PA 3KP3A 3CCQI 1ZBIA 3P8DA 4DV6K 2Z16A 1ZG3A 2RJEA 1C0TA 1OCCH 1M4ZA 4FPAA 1RR8C 2NS0A 3VA3A 1TS9A 4R55A 2K4JA 5IPAA 2JZYA 4K43A 2CUZA 1WHHA 4C5HA 1C6VA 2E2PA 1SMYF 3E6BA 3M9AA 4F14A 4ISFA 5KPZA 5KHDA 2IVOA 4P5NA 4C92A 5E79C 3L7WA 3E97A 1TW3A 2QWMA 1F43A 3D4VA 5D5XB 1M8MA 3WTZA 1RACB 4M75A 3ABUA 3TTCA 1JLGA 4PKHA 3ZQFA 2A61A 3U1DA 1QNTA 3UB5A 3TSPA 4JI8K 4CGIA 1AA7A 1A5WA 1N3AA 1Z7LA 1W7PA 2JA2A 3F73A 2PMZA 4N47A 3RBBB 4J5YA 3SJJA 2XK0A 1GFDA 4DTSA 1UA1A 1Q81R 3SMSA 2B86A 1X1AA 2CQXA 2XHIA 4GW6A 5I21A 4E7ZA 5E20A 4OX9K 3CQZJ 3A5NC 2VGNA 1YP5A 1OX9A 1RT1A 3WQTA 3J7YP 4HPQA 2DPNA 4MO7A 2XDVA 3JRBA 4WQ4C 5DYMA 2EFPA 2D8JA 1Z0XA 3F22A 4AUXA 3O9TA 5LEJA 4BY1J 1X75C 2PQ8A 2VYTA 1QVGM 2EIJH 4A6EA 5KYUA 4B4CA 4KHSA 4YIIA 5DM7F 2LREA 2HKQB 1NEBA 1RNLA 3IWZA 4RAZA 4D7NA 3OYMA 2P9SB 4ZYEA 5FD5A 3VQPA 5CKEA 1K9MR 3Q7BA 5LJ5e 4PA1A 1FYKA 3E5XA 3CQ8A 3ZQCA 4DOZA 2WADA 3A01B 4CFBA 1I39A 3QEVA 4CGJA 4M7AA 1U3EM 5F1JA 3JSCA 4JEPA 3L4IA 2EZLA 4FX0A 3PT9A 2W41A 1ZYQA 1XGNA 5AIQA 1SHFA 4NCAA 2XAUA 1Y07A 4FL6A 2DA5A 4PJMA 3MN2A 3REAB 4JI1K 4CIFA 3PY8A 1AEYA 1PD0A 4ABZA 5C2FA 4AG1C 2Q0RA 1KVAA 4S04A 3B6CA 3RKXA 3HTUA 5D8LB 2HHUA 1FK9A 2QK0A 5HBMA 2ELKA 3QBXA 1VQNT 4RTWA 1FWZA 2R92J 3CFOA 5KYXA 4O55A 3U8XA 2Z5UA 1B9NA 1HD3A 4PZJA 1IUFA 4KULA 2A6AA 4BVOA 4DGWB 3BOQA 3M7GA 5GANd 3C4SA 2ICWG 2HMPA 3VYTB 2K9NA 2HPIA 4FJ8A 2K9MA 4PFPA 4IOCF 3FHFA 5JR3A 4ENJA 2YKMA 4BY6C 1GOAA 4HSTA 3M5AA 4BE2A 3TSZA 2A05A 1L5UA 1AZEA 2KE9A 1FOYA 2BV6A 1KQSS 2L8DA 1WKMA 1LPLA 3M0UA 3RPUD 1F1BB 3NTHA 4KT5C 1WA7A 2YKNA 3H5RA 1QKXA 2RHZA 1FMKA 5ICFA 5EG0A 2O8KA 2DPUA 4RW4A 1OCZH 3MX5A 1VQOT 1B34B 4MZTA 1LW0A 3CDHA 3GFMA 4MQVA 3CI5A 1W5TA 2GOMA 3LSPA 1VRUA 1HXDA 5HNFA 2K2VA 4C5EA 3G4SQ 3VYUB 4X65K 3GTGJ 3BDUA 1DEJA 4JKBA 4H0XB 3DJCA 5KYUB 3BWGA 5F08A 1ZR2A 4M3YA 1OFCX 1QZYA 1MMAA 2R7OA 2A5XA 5L3EA 5FRNA 5BQTA 2DPPB 3VYSB 5J8CA 1VQ4Q 2E4LA 4AYBA 4CZMA 4U0WA 3F8FA 4CF1A 2P9KB 2M45A 3P4IA 3AVIA 2BZYA 2BHYA 2KT1A 1WSGA 1FPQA 4C3HJ 1FN7A 4MGRA 3O8VA 1YOVB 4U7DA 2DVJA 3K69A 1VQPA 1Q18A 2D0QB 3CC7N 2QSGX 3F0ZA 1C1AA 3H35A 3RMBA 4WFNL 2XHKA 4FISA 3J80Z 1VQNI 4BC3A 3IHOA 4OB3B 1SD4A 3DWLA 1GBRA 3JCMP 3S32A 2QKBA 3ENOA 3VEOA 5KCMA 4IOAL 2OTJQ 4JD2B 4U67L 3U3GA 3OYLA 2GWJA 4A4GA 4QLCU 3DLBA 4FW2A 5GAOr 2HDAA 4L59A 3CMYA 2DCEA 4KUIA 3SQ1A 3DAWA 2R7TA 3KX2A 2B5JA 3CCQN 1AZGB 3C6UA 1YIJN 2F6CA 4ZYGA 2FLOA 2X78A 5GIPA 2PMZN 2NRVA 1VYUA 1T98A 1X1BA 5KE3A 4OIQF 1RR7A 4EM1A 1NK3P 2PNIA 1NG2A 3RKWA 1FKOA 5E1WA 2IGNA 5JLWA 3QDFA 2M0OA 1XNRK 3GDQA 4HVJA 4PKIA 1RDWX 2C0OA 3K9KA 1YQLA 1A6QA 3EYIA 4ILHA 1WJRA 1BA1A 3DBRB 3ONQA 3RNJA 4FYYB 3QPHA 1NU0A 1SMTA 1U5TB 1USTA 2DXTA 4GFBA 2K27A 1T3LA 1M3CA 4FWSA 2M2EA 1RPWA 3W0LA 2RJFA 1BL0A 3MP1A 2ESWA 3CCQT 2G8UA 3CQXA 4FPBA 3AARA 4DSFA 3H9NA 3SAFA 1K8AO 4A3CJ 3ME9A 5BREA 1U1SA 4L9NA 4HWIA 1TAQA 1NZ9A 4M77A 4BGBA 3OHRA 3RMAA 1K4TA 2ED1A 3VOEA 3VEXA 4K8XA 5EEAA 5KYYB 1UHSA 3SD4A 1SD5A 2G7UA 5CHIA 2FXAA 3JCMJ 3M8JA 1NE8A 4I7HA 2QA4A 2FQ4A 1B9DA 2HS5A 5HS7A 3QKJA 2L0AA 1SD7A 5JVGF 1NGHA 3LDLA 3MEEA 3R0AA 1LKXA 3KBGA 1GXPA 4GNIA 3IKTA 1ABOA 2Z9OA 2LJ3A 1TV6A 1S6QA 2BY2A 3BR1A 4XLEA 4CIGA 2DJZA 2W40A 3H36A 4NO7A 4M7DF 3RR6A 2E2HJ 2QZ8A 4ZH4F 5IT9K 3IKVA 2QKMB 2RI3A 2DK8A 1SKRA 1ZG5A 1WDXA 3MP8A 3MWTA 2YG8A 3JSPA 3CCLQ 3D7EO 2L0KA 4WQ5C 1NGJA 3M4YA 3FIWA 4M9ZA 2E35A 2K7AA 5A0GA 3NH1A 5EEHA 4PUOA 3JB9J 1LJ9A 3VU3C 1PVEA 3MMVA 3HO1A 2Q0UA 3RKYA 4FZYA 3AAQA 1W2BP 4RGUA 2P84A 4ESFA 1T0HA 1H88C 2F4MB 2OANA 4H5RA 2XKOC 1VQMQ 2JK3A 3SK3A 4GV6A 2LMJA 3DYAA 2LR8A 2V4JC 3OW2M 3TWHA 2FG0A 2DLLA 2RNGA 3L42A 3EYZA 1BWFO 1AHJB 1T08B 1HDDC 2QI2A 1QSSA 4E19A 4HUEA 3DTIA 4FM0A 2BY0A 4WXDA 1PVSA 2JT1A 2O8DA 1MBHA 2VOPA 2CG4A 4O5FA 3L3VA 4DW6A 3CCVT 2XG8D 4A59A 4CCOA 3O6WA 1EH6A 2DKGA 5J40A 4GCVA 1UHMA 1HK9A 2RE2A 3FB9A 4CK2A 2NZTA 4BR0A 2Q2EB 3G2BA 2YDLA 3CCRT 5CK9A 2CFXA 3LSRA 1ZYRF 2UXXA 2KT0A 4B3SK 3H3VK 4HNVA 3HRSA 1LWVA 2D0PA 5GINA 1FJGK 1XMAA 2YV0X 3ZFJA 4JDSA 1T8IA 2J6FA 4IG0A 4M7DG 2Y9YA 4CEZA 1BQMA 2VC0A 4AIJA 2XY7A 4KBMB 4E9EA 4FX4A 3ZQQA 2DDAA 4LD0A 1DKGD 1R5HA 4A57A 3QEPA 1MBEA 3NBPA 4O8KA 1RRQA 4FWNA 4KO0A 3BTCA 3NF7A 1O13A 2KI7A 3I55N 1MZBA 3TEDA 3G10A 4A3KJ 3H1CA 3H5NA 2XDDA 3ASOH 3FXKA 2YX4A 4B21A 4IJAA 4HCZA 3CCJI 2P6SA 1XDUA 1J3TA 1MDMB 1TWCJ 2R3SA 3AL0C 3AA2A 3KUFA 2A6HF 3QO3A 1Y1WJ 2M34A 5E3OA 2OPPA 4C1NI 1VQOA 4JJBA 2XF6A 2P1JA 2FU4A 3PX4A 4A4EA 3U9GA 2IIRA 1Q95G 2VWKA 4DR4K 3HBTA 5IH2A 2KLAA 4FO0A 1XNIA 2G3RA 5KPRA 1SFEA 2CJJA 3JB9F 2ZWHA 5DMRA 3O4WA 3KHYA 4H03B 1XS9A 1WFXA 2RK2A 1CXQA 1S72N 2MA3A 4BR7A 3K4MA 4NLCA 1NG9A 4JI0K 1IO2A 3V7RA 1XC5A 4FT8A 3NAEA 1RLQC 1DQUA 3VENA 4ILJA 3VQ8A 4HAMA 3ZPLA 2IT0A 4CZKA 4CCLA 3RTVA 2GAUA 1MMSA 1ZLMA 3A8GB 3BG6A 2UZKA 4H5VA 1YE9A 1P90A 3TW7A 3H3OB 5E1XA 2O8EA 4EPCA 3V8KA 1NK9A 3H46O 1MMGA 2FOWA 4P96A 3L8BA 3LSMA 3CD6A 3SDGA 1NPRA 3GF5A 4XONA 4X9DA 3HYIA 3ZCOA 2VQEK 3CETA 1YJWT 2X4XA 1WUAA 2XUBA 2QWRA 2LQKA 2OYQA 1G4DA 3T9NA 4EJUA 3VETA 2ZCWA 3M07A 1UWBA 4ETSA 5JS1A 3R9PA 4LB5A 3TREA 5AQVA 4DTRA 4LDWA 2K02A 4DQSA 3G73A 1YJ9Q 4IHYA 3K9TA 3HL2A 1QPIA 3RMCA 2LRQA 1KAZA 2VLAA 2E2JJ 1S1XA 3I56T 2XSJC 4OB1B 1KYZA 2VGMA 3G71Q 4PJOF 2H3GX 1W0UA 2OAZA 5KRSA 2KXDA 2QGFB 4L6V5 4HVVA 1KQSM 2FBHA 5DUIA 1YT3A 4M6VA 2FXUA 1FSEA 4ZJZA 4XTWA 2A3SA 1ETKA 1QHHD 4N4IA 4CXFA 2XIDA 3QNNA 2JPSA 2NOIA 3DLEA 4DR2K 3LZIA 4KYWA 1MW7A 5CYMA 3A8HB 4HX7A 2ZSIB 4LN2A 5EG2A 4HHTA 3E5UA 3NGPA 2JJ9A 4XEIA 2DA6A 1RI7A 2H09A 4XQ3A 2OI3A 4BRGA 5MLCQ 2CZ0B 4CHNA 3CC4A 2FHDA 3E9LA 2HHWA 3ZSQA 3CWAA 5IY5H 4RM3A 2R7VA 4B3OA 3ZSWA 2I10A 2V8JA 4CBUA 3CPWP 3LGLA 1Q86U 4CGGA 2RJCA 1VA7A 2D1HA 3C2BA 1I1SA 4FWQA 1BM9A 1KSWA 4A3MJ 2HXOA 4M6XA 2Y0SA 2PMHA 1QVUA 2VV5A 9ATCB 3S2DJ 2UUBK 1R58A 4YPRA 1WI9A 1EH8A 2VYPA 2K3PA 1RAFB 1R1VA 3VDXA 4BRIA 3ID6A 3OL3A 2Y4XA 5BPLA 1OISA 1LE8A 5GPCA 5BS6A 3MMYB 4FZZA 1KLNA 5IOYA 1BN5A 3KE2A 2QA4T 2NVTJ 4CZLA 4J9BA 4FLTA 3D5RC 1R5ID 2FNPA 3QAHA 2HNYA 5KYWA 1KVCA 4M78B 1G2BA 2CV0A 3RPUA 4RS8A 4HEA2 3LP0A 2DA7A 5EZHA 4DK9A 2O8FB 1YIJQ 2XC7A 1RTJA 2J5PA 1YW9A 2ZXWH 2LNVA 2WFBA 3QRFF 3DLKA 2BHZA 3M1EA 2I8DA 2RHXA 2DTIA 4A61A 1PC0A 4QOZB 4B8CA 1ZBXA 4PJJA 1SUQA 2QUFA 4F17A 3CUOA 2IPQX 3I4MJ 5BOXA 4CA0A 4C30A 3GVAA 4IIMA 3O08A 5HRSA 2KZZA 4LF5K 3RJPA 4KUDK 1OYWA 3C65A 4PL8A 3T5XA 1IG9A 3CCVI 4HV6A 5BPIA 1C0UA 1GLEG 1Y6IA 1YJWQ 3MFKA 2DRMA 1T3VA 2PN6A 4JKDA 3BQYA 4FM2A 5I2SA 1W7PB 2OPTA 2ROTA 2LY1A 1BYMA 5EEGA 5ICEA 4JKHA 4M3DA 1R71A 4GDFA 2CUBA 1W1WE 2O8FA 3BG3A 1R0AA 3D7SB 2RNJA 2AXTC 4HF1A 1S72A 3M6GA 1IJJA 1WPYA 3HXLA 2QM3A 3BGRA 3H5AA 3IUCA 2VUBA 3CMEA 2EYQA 3LSGA 4KGZB 1ENHA 2JVHA 2V9VA 3MAJA 1XX5A 4PIIA 4GO1A 4QKUA 3HM8A 3X24B 1ASVA 1BO5O 2P5GA 2HHXA 1N78A 4LH5A 3LFKA 3QDRB 1NGIA 1A6IA 2O4GA 4MZPA 2P5KA 2V8KA 4KA4A 4M74A 4H0YB 4FLYA 1MJBA 1QVPA 2Y75A 1ZHIA 1XGMA 3U4LA 2E4HA 1X9JA 2X48A 3R6NA 2Y0MA 4A2UA 3S1QJ 5FWCA 5ADXH 1FY7A 2VODA 4CEFA 1GOCA 4JJCA 4RTXA 3RMDA 4IHTA 2G6FX 1JKQC 2BE5F 1HW2A 2XAQA 1SAXA 2EJGA 4AILC 4OMYA 1PSFA 5C24A 3QZ5B 1RTIA 4KPYA 3VQ9A 4CJRA 1G59A 4C92B 2W6KA 3PSIA 2A1RA 1L3LA 4LF6K 3KEQA 3MN7A 3G4SI 4BRLA 3PO5A 4JRIA 3I58A 4CICA 5CHZA 4XTVA 4XMYA 1SD6A 4QVDA 3CCEQ 2HGCA 3HZ6A 4AYBN 3G1JA 2EB7A 1RT3A 4FT2A 2BY3A 4OF1A 3M59A 5GANf 5IAYA 4KGXB 3S16J 3LAMA 4HX8A 3CC4N 3ZEUB 2E6LA 2XROA 1QQJA 2BZTA 1N5YA 1KJWA 4AIDA 5B66C 1GLAG 3O9QA 1XGSA 1Q7YC 1BBZA 2K86A 3GWZA 4UXNA 1RT2A 5FW9A 1DP3A 2ME6A 2KK4A 4CJKA 3OYNA 1DGRM 2GQQA 3CJBA 5E3NA 3KLFA 2Z1DA 2VT3A 1VQ4A 4BL0B 1NJYA 4BG9A 2BUPA 2J6KA 4CFDA 1W97L 2K4BA 4B1VA 1GLFO 1VQ9Q 1HKSA 4EM0B 2VN2A 4DYRA 1IREB 2PJRB 3TAQA 2OTJN 5M1OA 1BC8C 1DJ7B 4B23A 2JSPA 1M2VB 3BE3A 5LD2C 4YHHK 2DO3A 3EE9A 2P7VB 4IHSA 2HBKA 2GFUA 5B8HA 3F23A 1TNSA 4I76A 1JHFA 4G7ZF 3SEZA 2WUSA 4G12A 1HQUA 4M9XA 2EGEA 1OPCA 2KRNA 2MH9A 1Q9XA 4C8QB 1S1VA 3HJFA 4C2MJ 4EMGA 5TGTA 3UKGA 4RTVA 1WH5A 2WV1A 1YHQT 4DSEA 3WGIA 1HF0A 1ASUA 3I56A 1G3TA 4LG3A 3SDBA 3TSUA 1D3BA 4H0TB 2BDPA 4LDUA 4RWTA 4KHNA 3CCMI 1MBJA 4LSLA 2V51B 2KIQA 1HYZA 2RKHA 5GAOm 3CVTA 3CCJA 4U0YA 3OYBA 4IUPA 2VBXA 1WHGA 4CHQA 1Q1VA 2MOXA 3JRFA 1KQSP 4IDKA 2MGQA 1TK8A 1NM1A 2ASOA 2QF7A 2GUPA 1M3AA 5GJVB 3QDKA 3NF9A 4W5TA 2DL7A 3J81K 2XO7A 3E9GA 4EFHA 2DE0X 3E1SA 1NGDA 4LG0A 2M8GX 5J39A 1XDSA 2QTVA 4IVNA 2QWQA 3M8SA 3SZGA 2RD1A 2PYJA 4C3IJ 2A0FB 1YHQA 1LUJB 1K79A 3M56A 3FKJA 4C92D 2BTFA 3VQ6A 1AVZC 4J8OA 2WBNA 2QEXN 5LJ3g 2JGUA 3KIOA 1TUYA 5CAIA 5HDNA 2RI2A 4CI0C 1N27A 2AZVA 3RZOJ 2CDTA 5A2QK 4BI4A 2FF6A 1IBKK 5ILVA 1VAZA 4ZDLA 1CKBA 1K8KB 1T2KA 3QU6A 3L2WA 4CZHA 1D3BB 2DQLA 1XQOA 3OOUA 2CV1A 1F9NA 4B1RA 3M8QA 4MO5A 2DJIA 1B4AA 2Q2EA 3K5OA 4CHYA 2F4IA 3SWNA 2RPNA 2HSPA 3AGRA 2E6MA 1YX5A 5GAEJ 1IKYA 3SQ0A 2IBDA 4AFSC 2L5QA 3PLAA 3KXTA 3JAME 5E8IA 2P7CB 3ZSRA 3HUGA 2E36A 1DP7P 2NUTB 1YO5C 1WJ5A 1V1CA 2DL4A 2XASA 3THWA 2YHAA 2DMTA 3WTTC 1ORNA 4RTZA 2EA4A 1IHWA 4I0AA 4PGHA 2L3SA 3GBQA 4Q0BA 3GUDA 4ZN3A 1U4BA 4E9GA 4F7UF 4LMYA 3SFZA 1HC8A 4YOQA 2IOCA 2P9NA 3TU4K 1P7JA 3AVGA 4X66K 3OY9A 4CK1A 1S7EA 4CF2A 3IP4B 4DU3A 1LWCA 3C95A 1FOWA 3NH0A 5FKKA 1M1KU 4XLPF 2CREA 2DODA 1TKTA 3LZJA 4ZZDA 4GYGA 1FOKA 1UFMA 1VIFA 3PL8A 3O6BB 4M77E 3CCLI 3C94A 1HRHA 3K70C 3M54A 3HKZN 4I6MB 3VRYA 3GBGA 3KD5E 1YS7A 1JLBA 3HSTB 1BR2A 3TCJA 4DYCA 1LFBA 5DCMB 2ZF5O 2RV8A 3G6ET 3D1NI 1JKOC 4XL9A 3TOAA 3HOZJ 3EG0A 1MHNA 2HSTA 5JICA 3RR8A 1YCSB 3MCPA 2VG6A 4NB5A 1SV5A 2QCOA 3DPTA 1ZUUA 1GCPA 1JEGA 2OF7A 4U0VA 2JHNA 2WY8Q 5DS9A 2XDPA 4CJWA 3O5ZA 1X58A 4F7UG 1QS4A 3K0SA 3E9PA 2ZXJA 4DWIA 2BW3A 3OA6A 4L9TA 4V19S 2STWA 3THXB 2WACA 1XOVA 2NXNB 2AZSA 3VTHA 2IS1A 2VE9A 1OEBA 2WAQA 3PNVA 3CF5L 3VWBA 2M0CA 4JKEA 4H0PA 4A5MA 2OV7A 1JRIA 4RMNA 4KISA 2L89A 3KZYA 5KYXB 2WTEA 3A98A 3J80O 3LALA 3VW4A 2HOTA 3WU1B 3U6FA 4L5IA 1ZG1A 4KRFA 4E6RA 4FU6A 4Y0WA 1V5GA 5AQJA 4BRFA 1R8OB 4A3LJ 3GZ5A 3HHTB 5AFUH 4RGSA 3H0HA 1WGSA 2FD5A 4CF9A 2QQAA 2K5CA 2MIOA 1ATSA 2DRKA 3QU3A 4MQ9F 5H1SQ 1ZSGA 2MC4A 2L3QA 2LKXA 2RH2A 3COAC 1STZA 1VSEA 1IF1A 1X3UA 3MEUA 3M0QA 7AT1B 2DYIA 4FLWA 4PNOA 4UV8A 4UNOA 2RHIA 2BTTA 3CCMN 1H3HA 3OSSC 3DP7A 1M90R 2F5DA 1TWHJ 2ECZA 3CD6N 4E7HA 2JM9A 2M5WA 3ESWB 2ID3A 1D5VA 2CUDA 4JV5K 2M3AA 3LDSA 5CVUA 1B72A 1R4MB 2OAWA 3DRSA 5J1EA 4JZ4A 1W6XA 2LZ6B 5FU7C 3M0PA 1L3SA 5AONA 4M6YA 1O1WA 4C8QD 3EFOA 4QIWN 5D8KB 4XLNF 3E2UA 4O0JA 4OKKA 4BRMA 4F7UA 3OMYA 1VTNC 3LFUA 3LWHA 2DTRA 3PQJA 4OMZA 3K4JA 3Q0VA 4II3A 2HVHA 1V4TA 2EFWA 4GLKA 4XORA 2IDOA 2RQPA 1KRPA 4OJRA 2BOLA 4CCMA 1ZQ1A 1PM3A 4BE0A 3T8RA 3KEYA 3KYDB 4FJGA 3VS0A 1YJ9I 3BR0A 4AG2C 1BUPA 2DEQA 2ZPGB 1TKZA 1QW1A 3CMAN 3ZQGA 2FE3A 2K3FA 1L3UA 4OO1J 2Z0WA 1NG6A 4NYNA 4DR6K 3G4SA 4C8MA 2ECBA 5I11A 2LOOA 4C3JJ 2VBWA 1AKHB 1O3SA 4HCKA 1VFCA 2NRXA 1SAUA 1UB9A 4J9HA 2X51A 1XQHA 2ETHA 2GWRA 2KIMA 2Y0SN 3RERA 1REVA 2P4WA 4ZDPA 1JXOA 1FX7A 2FZGB 1RDAA 4G9YA 2QASA 4CJ5A 2F2EA 2HF3A 2A36A 4KMFA 2RQQA 4LITA 4J9IA 2AQFA 5ICCA 3TW6A 2YSQA 4CK3A 4C0DB 1BCOA 3D2EA 1SKSA 1QQMA 4LLNA 4BYYA 2DBBA 3HP6A 1HYOA 5FROA 3TQNA 5M1NA 3S41A 3MJXA 4CHPA 3NVKA 1IV6A 1BU1A 4H4KC 2B63J 3QIPA 1PJRA 2IGMA 3NDKA 4Y17