3S3OA

Crystal structure of the prototype foamy virus (pfv) n224h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor/dna
molecule keywords PFV integrase
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3oA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3oA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3oA03
4DWIA 1X9SA 3V9SA 3ASKA 3KKSA 3OYNA 3U3YA 1RDAA 3LP0A 4DSEA 1XI1A 1CZBA 1RT1A 3QIOA 4FJMA 2IDOA 2QXFA 3C6UA 1RTDA 5KRTA 1NKEA 4QQDA 2E6LA 2R5AA 1RT2A 5CIUA 3HYFA 2BDPA 3SJJA 5FRMA 5E41A 4CEAA 3M8SA 4CJSA 3ZT1A 3AV9A 5SWMA 2IOCA 1WN7A 4OKJA 4FJHA 3MECA 2RI3A 3LWMA 5KE2A 1KLNA 1CXQA 3G0ZA 4FJGA 2QQRA 4FJNA 5J2PA 1NOYA 4CFBA 3THVA 1YT3A 4E7KA 4BDPA 2G8VA 3VQEA 4OPJA 2L89A 2I5JA 3ZSOA 4KREA 2Y1IA 5M9OA 3HPHA 3VQAA 2EQMA 4I2PA 4HCBA 2G8UA 3K57A 3QIIA 3QJ6A 4KO0A 2OPPA 3QO9A 1BL3A 1NK9A 3KLIA 2RHXA 5J2NA 2KTQA 1S9EA 3RMCA 4FW2A 3M9QA 3PY8A 2ZE2A 4M3UA 3DOLA 1SL0A 5D6YA 4Z02A 1RBSA 1WAFA 1HQEA 3OJUA 5KI6A 1GOAA 1W0HA 2GFUA 5J26A 3KK3A 3EY1A 3ZT4A 4CJLA 1WSHA 4O44A 3NE6A 4N5SA 4I9QA 1Z26A 2XY8A 3KIOA 3TR8A 2XY7A 1RI0A 3RTVA 2NUBA 4IG3A 1TGOA 3NDKA 2R57A 2HHWA 1IKWA 4PUOA 2JGUA 1NKBA 1LAWA 1TK8A 1CXUA 2OA8A 4KTQA 2ATQA 2RJEA 3NF8A 3MXJA 3C94A 2X78A 1B9DA 5HRSA 2HHXA 3FC3A 2JLEA 1XC9A 3QEWA 4GVMA 3QEVA 1SL2A 2O4XB 4CFAA 3DI6A 4N47A 2MWPA 4E3SA 4DTMA 3RR7A 3P8DA 3E9GA 3RWUA 3S6WA 1KTQA 1ITGA 3DOKA 4B3OA 1LWCA 5KRSA 4I7FA 4DLEA 3TAGA 3OYKA 3MAQA 2KW4A 4IDKA 3NH1A 3NFAA 3ITHA 3OYIA 2FHDA 2DFHA 3OYDA 1QSSA 1JLBA 4N76A 3TABA 3JYTA 3ZT2A 4CJEA 2HHTA 2VG7A 1OI1A 2IC3A 4A4HA 1B92A 4BDYA 1GOCA 1RBUA 2VWJA 2LRQA 3NGZA 4DTUA 2X4WA 4M42A 3SUOA 2RI2A 1BQNA 1RT7A 3KTQA 5J2QA 2HMIA 1HJRA 3OYAA 3PO4A 3OVNA 2D0BA 1BQMA 2YNIA 3OMCA 2FBXA 1Q9XA 3KUFA 1J9AA 5C0MA 4QAGA 2XHBA 3ZSYA 4ELUA 3TWHA 3PMIA 3OQ5A 4A4FA 4CJ4A 4PWDA 3NAEA 3MEVA 4CK3A 4DTPA 4KHSA 4B8AB 4AILC 3E9FA 4DG1A 3SV4A 2HNZA 3HPOA 4KI4A 3PX0A 5HLFA 4PQUA 3HM9A 1VSIA 2Z1GA 3UIQA 4PA1A 2EHGA 3QEPA 4JRQA 3AVKA 3L3VA 3S9HA 1SUQA 1WSGA 4E1MA 2EQJA 3I0RA 3MEGA 2BUDA 4EP5A 4C5IA 2F96A 4FLUA 2RJFA 3U6FA 3CEYA 3M8PA 1VSEA 1JXEA 3FEOA 3FLGA 1IKXA 3PX4A 1VK0A 4CGIA 4B9LA 5C24A 1D5AA 3VQ7A 4NCGA 4L8RB 4JS4A 1SL1A 3I8DA 1ZBLA 4B9NA 3SZ2A 3VQ4A 4K8XA 4XIUA 2YNGA 4DTNA 3HVRA 1TAUA 4BDZA 1XNIA 3F70A 3PV8A 4PLIA 4OVLA 2OZSA 2O4IA 2IS3A 5FROA 1BIUA 3NCIA 3OYFA 4F3TA 4NCBA 5K14A 3E01A 1RTJA 3S3NA 2MWOA 4ZTJA 1GOBA 1U48A 2LDMA 3OS1A 4HUFA 4OLAA 3LP3A 2F8SA 3I0SA 3SQ4A 3OA6A 3U3GA 4OKEA 3NTHA 5D6WA 1G5VA 5D3GA 4Z4HA 4L59A 4H4OA 3MP8A 4C8OA 1N27A 3VQ9A 4HCCA 3MP1A 3AVNA 2X4XA 3VQDA 3ZSRA 3O4QA 2A1RA 3OYEA 4OGCA 3VQ8A 3LZIA 5CY4A 4M3TA 1NJYA 3L8BA 5CZ2A 5EU7A 3BDLA 4W5RA 3HSTB 1IKVA 3NNQA 3DLBA 3LPUA 3PMTA 3L2QA 4CHZA 2W42A 3C95A 1HNVA 1TV6A 3DRRA 3F9KA 5J1EA 4II1A 3MEEA 1HYZA 4HUGA 1OZ3A 1W9HA 3L3UA 4LD6A 1C1BA 2BE2A 4ZTFA 3LP1A 3SI6A 2YKNA 3AA4A 3V9ZA 4FLWA 4CJWA 3LAMA 2BKDN 3ALYA 1TKZA 2WONA 2A1SA 3LLRA 4Z4IA 4I2QA 3K5MA 4OVAA 2DFFA 1YTUA 1UOCA 3RMBA 4E19A 1UAXA 1WLJA 3DLRA 3KLGA 3ZSWA 4CJPA 1HNIA 4YNQA 4IKFA 4DTXA 2DIQA 1Q9YA 4DSKA 4OLBA 2HHSA 5HRPA 4FLVA 3JSMA 1TL1A 3CFPA 4DMNA 3BGRA 2HQXA 1RCHA 4KHNA 1RNHA 2QK9A 4PLLA 4CEOA 2PYLA 1KVBA 4CJVA 4FVMA 1NKCA 3H6ZA 5FRNA 3OS0A 4KFBA 3QNOA 4IFVA 4B9SA 3AO5A 3V9WA 3PO5A 3NGYA 4RW9A 3P1GA 2EFIA 3MXIA 3MEDA 3VQ5A 2YHBA 4DSFA 4FZXC 3H8ZA 4NS5A 4FM0A 2EQUA 3T19A 3SPYA 4LSLA 4J2EA 4AHTA 4DTOA 4AHSA 2PY5A 2FC0A 4CHOA 3V4IA 4C8NA 4DSLA 1HMVA 2WACA 4FJ9A 3NF7A 1JLFA 4CGFA 1KSPA 4B9XA 3L2VA 1JKHA 1SKRA 4IUUA 3D45A 2NLUA 1BCOA 4W5TA 1BGXT 4CCHA 1XHXA 3K5LA 3V81A 1U47A 2OPQA 3OYJA 3ZSXA 1REVA 4DFJA 1DTTA 4CIGA 3TAEA 3KD1E 4JRPA 1FXXA 1S1WA 4W5OA 3QLHA 5IAYA 4CF0A 2LSNA 4FCYA 3AVLA 4CF8A 3MP6A 3CM6A 4WE1A 4FJ7A 1LW2A 2EX3A 1I3AA 4F2SA 1RBVA 4B9VA 3NTKA 3WNHA 3OYHA 3KLFA 1SSFA 1B9FA 4DFMA 3O4NA 3QKJA 2RHZA 2BANA 1TKXA 2HNDA 2L8DA 5HRRA 4ICLA 4BD3A 3ZT3A 1C0MA 3QEXA 3Q1JA 2FBYA 4IUTA 3LPTA 1C1CA 3B6PA 3TARA 2P51A 1KFSA 3KLHA 1T7PA 1S9GA 4DU3A 4IFYA 4NYNA 3FFIA 4FU6A 4B9WA 3P83D 2KQ2A 5HRNA 4B8CA 4GW6A 1VSHA 4GY5A 4CIEA 4CJ5A 3OMGA 2B6AA 1NK0A 2HVIA 3K58A 1I39A 1J53A 1C0TA 3O3GA 4M3YA 1A5WA 1KCFA 5J39A 4OGEA 4CK1A 2BGGA 4G1QA 1QSLA 4FM1A 1WJQA 2P1JA 4CRIA 1ASVA 1CZ9A 3S3OA 4FK2A 2RJDA 4CGJA 2G8WA 1TAQA 3LH0A 3HVTA 3NH0A 1S5JA 2RHUA 3ZT0A 1OYXA 3LGLA 3SD4A 3A2FA 4W5NA 4A4GA 4FL6A 1J54A 1J5OA 1NK6A 4M45A 1C0UA 4RW4A 3OYCA 4CEEA 5C6SA 4BACA 5I42A 3H08A 1KHCA 2OYQA 1IH7A 3AVJA 2XRIA 4YFUA 1IO2A 1T05A 4E7HA 5HBMA 5J2MA 3SCXA 4KHYA 3MEUA 1RBTA 4FZYA 3CM5A 4RG8A 4CK2A 1LW0A 3CFRA 3OJSA 4CECA 4DQPA 2KZMA 1X1PA 2OPRA 3LAKA 3OYLA 1NK7A 3LANA 2E4LA 1VSDA 4CHPA 1BI4B 4AH9A 2IGIA 4C8MA 4RG2A 4E0DA 2O4GA 2XDPA 2PQWA 3AA3A 4O5BA 3VA3A 4CGDA 1QE1A 3WNFA 2YHAA 5IN1A 4LH4A 2YKMA 1SKSA 1KRPA 1YTAA 3M8QA 1T8EA 4QQGA 3SNNA 4QVZA 2AJQA 4IUPA 2B4JA 4C5HA 1TVRA 3WNGA 1WJSA 3O8VA 1T03A 4E89A 3SUNA 4FJXA 1TKTA 2RJCA 5I3UA 1U4BA 1S6PA 4DSIA 4QCLA 4DSJA 1RILA 1N6QA 4CJUA 1N5YA 4IURA 2RF2A 3UWNA 4M3WA 3KJVA 3DB4A 3DB3A 4KV8A 1NJXA 1JLAA 4MFBA 2X35A 1JLCA 4DFKA 4CEQA 2PZSA 3OYMA 3IS9A 2VG5A 4KRFA 2G3RA 2G8FA 1K6YA 4O0JA 1H3ZA 4OKKA 1MU2A 3HXMA 3B6OA 3D0PA 3VQPA 3RRHA 2O4XA 2ETJA 5KE3A 4M3RA 4KTZA 3OB9A 4CHQA 2GF7A 4B9TA 1U45A 3K5NA 4EP4A 2D0AA 3EZ5A 4QW2A 5C25A 3CG7A 1QS4A 4Q5WA 3DYAA 3ZSVA 4CJTA 2FBVA 1Y97A 1QQCA 3LYIA 4DF8A 4DLGA 4RW7A 1JXBA 4CF1A 3LGFA 4RW8A 1BISA 4M3XA 1HYVA 1EETA 3DLKA 3V9UA 3VQBA 3DLMA 1C1AA 1ZBIA 3MXMA 2XK0A 4C8LA 1QHTA 4PL6A 3GOXA 4NCAA 3DM2A 3VN5A 4NZGA 4M3ZA 4CERA 3C6TA 4W5QA 3LX7A 4B08A 4FLXA 3SUPA 2QQSA 2VG6A 3LWLA 3SPZA 4CJQA 3TAPA 4DFPA 1CLQA 4N56A 1L3UA 4KB1A 1X9MA 3LALA 4QQ6A 3AO1A 4F8RA 1X9WA 4HHTA 3PX6A 1BI4A 3NHGA 3OY9A 4M41A 1MHNA 4CEBA 4UC4A 4KB0A 4N4GA 2X6NA 4KHQA 1RT3A 4DTSA 4J2DA 1S6QA 3NBPA 3HO1A 1WAJA 1RTIA 2DY4A 3AVFA 2HHVA 1JL2A 1TK5A 1WSJA 4CFCA 4O4GA 1RDDA 2XO7A 4PY5A 3K2PA 2JTFA 2RHYA 4A4EA 3QEIA 4QOZB 1ASWA 2QKBA 1DLOA 3V9XA 3AO3A 4KI6A 4DF4A 3HP6A 1G15A 1SV5A 5C42A 3RR8A 1HQUA 5DMRA 1NK4A 2RPIA 4Q5VA 3NF9A 4Z4CA 4CE9A 3EYZA 4I9LA 1HPZA 2F5KA 5HROA 4H4MA 4N4HA 3PUFA 3AVAA 1HYSA 4HCZA 2M1HA 1NK8A 1VSMA 4J2BA 2YRVA 1RT6A 2DTUA 1BIZA 3KLEA 1JLGA 3VQ6A 4AHCA 3T1AA 1NJZA 3HP9A 4E7JA 2K3XA 2PYJA 1D9DA 3DLHA 1NOZA 1QTMA 4ELTA 1ASUA 2ZQBA 2LTOA 2ITGA 1NJWA 1VSJA 3K5OA 3L2RA 3QNNA 1YVUA 2QKKA 3CFOA 3HPGA 1R0AA 2EKOA 2D9TA 4FZZA 2D0CA 5KCOA 3G10A 3ZCMA 4F2RA 4C5GA 1ZBUA 1EP4A 4Q0BA 1ZBHA 3TAFA 3SV3A 4ELVA 4BE1A 3DRSA 4UQGA 4Z0UA 3SQ0A 2LCCA 4IUVA 3AVCA 2E6NA 5KGWA 1ZBFA 1IKYA 1LWEA 1ZYQA 3ZSQA 4FM2A 4CJRA 1L3TA 3ULDA 3QETA 1FKOA 1KVAA 1RDCA 4R5PA 4HVJA 2X6SA 3TI0A 3QBYA 4DQSA 3KKRA 4BWJA 3IG1A 4J2AA 3IAYA 3UT1A 1D8YA 4CFDA 3HJFA 3DMJA 3VQCA 3TAMA 5KGXA 4KTWA 2EQKA 1LV5A 1TKDA 1RDBA 2X4YA 4FJ8A 4BE0A 2KFNA 1XWLA 3VA0A 2XY6A 2E5QA 2LVMA 4E1NA 1RBRA 2RHIA 4CEZA 1L5UA 4N41A 1A5XA 3AVIA 4CESA 1JL1A 4DS4A 4FJJA 3LZJA 4CJKA 4CIFA 3ME9A 2R5MA 1OZ2A 1TK0A 3NF6A 4K8ZA 4DTJA 4CEDA 3FDRA 3ZEHA 1U49A 3NGIA 4Z4FA 1L3VA 4FW1A 3QESA 1F21A 3SQ2A 1WJRA 1U04A 3SQ1A 4CEFA 4FYDA 2YNHA 2E6MA 4BE2A 4DQIA 4KHUA 3V1RA 3TANA 2GBZA 2Z1IA 2BIVA 4LD0A 1S1VA 2DIGA 1EXQA 2R58A 3P8HA 2RN2A 4CGGA 1S1XA 1RTHA 2Q3SA 4IG0A 3QIPA 4FJIA 4O0IA 3AVHA 2VWKA 4FLYA 4Z4EA 4RW6A 4Y1CA 4Z4GA 3L42A 4AHRA 1L3SA 4LY7A 1WSFA 4B9MA 2X74A 1KFDA 3CYMA 3IRXA 3AO2A 3V1QA 2KZZA 3OYGA 1UWBA 3DLGA 2HNYA 1IG9A 1EX4A 3KD5E 4DTRA 4FJKA 1NK5A 2HW3A 2OPSA 2YV0X 1KLMA 3O3HA 4DQRA 2Z1JA 4DU1A 1WNSA 3AA2A 4Y1DA 3MEAA 1RT5A 4O55A 4DS5A 1O1WA 2KFZA 4F3OA 3LP2A 3NH2A 2HVHA 3TAQA 4E7LA 3PFSA 4CF2A 2IG0A 3QINA 3DRPA 4FK4A 1Q8IA 1JLEA 1FK9A 2HQEA 3ISNC 3T3FA 2WOMA 3WNEA 3RMDA 2R7YA 2OZMA 4IUQA 4MQ3A 3VQQA 3OYBA 1VSLA 4TSXA 3KK1A 2P5GA 4KHWA 4X34A 3LDSA 3EAEA 4C5EA 5FDLA 1XHZA 2DAQA 3MEWA 4DQQA 2Z1HA 2RKIA 1UA0A 2L3RA 4ID1A 2FBTA 5JS2A 3AA5X 2D5RA 5T7BA 2G8HA 1C6VA 5CZ1A 1VRUA 4FJLA 3NTIA 1FKPA 3V1OA 1RT4A 2G8KA 4OJRA 4KPYA 2M16A 4FLTA 3HK2A 3ZSZA 3RMAA 1WSIA 2DFEA 3AVMA 1HRHA 2IAJA 3AVGA 1EKEA 2M0OA 1WGSA 4BWMA 1WSEA 4AHVA 2ZD1A 3SYZA 2GV9A 2CKKA 4HUEA 4OPKA 4KKOA 1A5VA 3AVBA 3O3FA 5KH6A 2JZ2A 5HP1A 3RRGA 2RO0A 4C8KA 1DTQA 3V6DA 3L2WA 5JS1A 2XY5A 3QERA 1VRTA 4KAZA 4ID5A 4CJ3A 1JLQA 3C4SA 2YNFA 4GMJB 4AHUA 4FXDA 2GUIA 4FJ5A 3BDPA 4EZ6A 4LSNA 4LH5A 3SUQA 2B5JA 1BCMA 2P5OA 5KCHA 3META 2G8IA 4CHNA 4FLZA 4IBNA 4B9UA 3OS2A 4CHYA 4EZ9A 3AO4A 2HB5A 4CJFA 3ASMA 4FK0A 2F8TA 3HT3A 2HHQA 2HHUA 1S1TA 2B8AA 1VSFA 2RI5A 2K3YA 1LAVA 3P5JA 2VYTA 3F73A 3S3MA 3PNWC 3CQ8A 1LWFA 1SKWA 2GFAA 4H8KA 4HTUA 2P0KA 4ZHRA 1BHLA 3DLEA 4DU4A 4F4KA 5CYQA 4E7IA 3KK2A 1Z25A 3M8RA 5KTQA 5DK5A 4NYFA 1VSKA 5CYMA 2Y1JA 1D9FA 4N4IA 1UA1A 3L2UA 3K59A 4CGHA 5D6XA 5SZTA 1S1UA 1QSYA 4CF9A 4EDUA 3HL8A 4JLHA 1KVCA 1TL3A 3MO8A 4JS5A
chains in the Genus database with same CATH superfamily
2RNJA 1ODDA 3KP5A 5F64A 4RLFA 4JN4A 3KKSA 2HBPA 2JTMA 3U3YA 3LP0A 2RA2A 4DZJA 5DCFA 1SEUA 1H3HA 1VQ4Q 2DM1A 1N8RC 3ABMH 3VGMA 4WQ5A 1PM3A 2MABA 3C6UA 2CRGA 2IGMA 1WYXA 3S6IA 2DA9A 2W85A 3CETA 4CZCA 4X66K 2DK8A 2XGDA 3NAUA 2Q1ZB 3FIFA 1U06A 4ZDLA 5E41A 4GBQA 4Q47A 3L1PA 1G3SA 4AVZA 5C15A 1X75C 3FKJA 3PO2J 4OMQA 3IQLA 4DYQA 4FJHA 1QHAA 3MECA 2RI3A 1H1VA 4LMYA 5KE2A 2OA4A 5FU6C 4YG2F 4RTWA 3QP5A 1CXQA 1VNDA 2F5CA 4DA4A 4Z8AA 4AM7A 2H1LA 1B1BA 2ETHA 2MF2A 3THVA 1YT3A 4BDPA 4CCOA 1O3SA 5JVGF 5M9OA 5GPCA 4FWMA 2ASOA 3G1OA 3HPHA 3DTIA 5E17F 1YJ9A 1IBKK 4HCBA 2RPNA 3Q7BA 2O8EA 1FIPA 5FLXZ 1JGSA 4E1JA 3QIIA 3QJ6A 3ZMZA 2E41A 2NUPB 2OPPA 2QKLB 1BL3A 2HQAA 2KTQA 2ENMA 3RMCA 1I6XA 1L3LA 1W7AA 1LUJB 1XDUA 3ZQLA 1VI0A 2WB1N 2ZE2A 4M3UA 1SL0A 3G2BA 4Z02A 1YIJI 3D5SC 4B1UB 5M5YJ 1YJ9I 1KD1U 4M78G 1HQEA 3OJUA 3D2EB 1NGJA 3H45C 1M3AA 4QPQA 3CC7T 2KL4A 5J26A 3KK3A 3CCUT 4BNCA 2XGXA 5LGUA 1NPPA 2KVQG 1VAZA 1RAIB 2RAEA 1WSHA 4O44A 2MOXA 1BWFO 1XTAA 3BZCA 2O01E 4CCJA 5CQGA 3VSLA 1Y1VJ 3K1PA 3CD6T 1VQNN 3TR8A 3ZXSA 1TTYA 2NS0A 2NUBA 3F8MA 1M2OA 4XM3A 2R57A 2I0NA 2HHWA 1Z9QA 2MIOA 4DR2K 1E6GA 5H2FC 1LAWA 3PGGA 2QSFX 4I7HA 1VQ6N 4EJZA 4KTQA 1KHIA 1HJDA 1EWQA 5M5XJ 3C94A 1LKXA 1JB0E 2E2HJ 1SAXA 4Q4ZF 2HHXA 2HSEB 2P9LA 2JLEA 3CLOA 2DYIA 3QEWA 1YP5A 4BJ6C 5L3EA 4B23A 2EZHA 3V7SA 3A01A 4CFAA 3B73A 4M7DD 3RPUD 4N47A 4DTMA 3RR7A 3LW5E 1DJ7B 3HJEA 1XQHA 3CPFA 3DOKA 2K5IA 1QZEA 1EBMA 3A0HC 1ULYA 2QG9B 5IYCJ 4DLEA 1Q7YR 3WE3A 1KQSP 5GAN6 2GBYA 4YEJA 2LZ6B 2M1BA 4J6XA 2EB7A 3OYIA 3RERA 3A8MB 1BU6O 1QSSA 1U2WA 3MWTA 3ZRGA 4N76A 4X9DA 3TABA 4OMPA 4HNTA 3ZT2A 3Q0UA 2Y69H 2FSKA 3K4BA 3S41A 2ZXWH 1HKSA 2RH2A 3CCRI 1A31A 3QPHA 2JW4A 4F16A 1OI1A 2FXUA 2CGLA 2GXAA 1MGTA 3G4SN 1YRNB 1RBUA 4M3EA 1YI2A 1SVLA 5A2QK 4UVCA 2X4WA 1YITN 2QENA 5EG2A 3UA6A 4ILGB 4UNOA 4L3QA 1JXSA 1RT7A 4CZZA 3UKGA 4OMOA 2AKKA 1YW8A 1HJRA 4M9XA 3OYAA 1IXCA 3OVNA 2VQLA 5D5XB 1EA3A 3QICA 4BQAA 2JA2A 3JCMQ 2KT0A 1YI2I 2XIDA 4DQ2A 1R00A 3O2PE 1REPC 4ELUA 2R7WA 3LMMA 3PSFA 3OQ5A 4KULA 2BZYA 2CH0A 3CCVA 2E1NA 4CK3A 2LSOA 2QM3A 4DTPA 4KHSA 1K1ZA 4ELYC 4AILC 4MZPA 5IHNA 3SV4A 2DU9A 2NUPA 4M7XA 4JPBW 5HLFA 4EQQA 1VSIA 4BRMA 2OJ2A 4VUBA 3FIWA 3A8HB 2EHGA 5KYNA 2VBZA 3QEPA 2YSQA 5HL7L 3K9KA 3BR3A 1X6OA 5F0CA 2IXSA 3FZVA 2NRVA 2KT1A 3J7AY 3DEEA 3P9KA 1O7LA 2XKOC 3CCVI 6AT1B 5IP9J 2L5QA 3I0RA 2P5VA 3REBB 2DOAA 2GA1A 2F9WA 2W00A 4A3JJ 2NNYA 3EGUA 2JUCA 4FSXA 3F9MA 1WXUA 5CAIA 1RI7A 2P9PB 2E1OA 3LA7A 2DL7A 5CCAA 4IRHA 4CGIA 3RCOA 1IB8A 3HTVA 2KKZA 4NCGA 1NHAA 3CUQC 2YDLA 3I8DA 1ZBLA 1I5LA 2BEOA 3M5AA 4B9NA 3K0LA 2KROA 1MNMC 3WTWC 2EFQA 2YNGA 1KGSA 1X43A 1TAUA 5CHIA 1F43A 4I0BA 1U78A 4HOBA 2OZSA 1T3SA 3R6MA 3JRAA 2E1MC 3OYFA 3KVGA 3MN7A 2Y75A 1RTJA 3S3NA 1LFBA 3N5BB 4Z6YA 2NS7A 2MWOA 5D5WB 4MFDA 1GOBA 2LDMA 3OS1A 3U2RA 3SQ4A 3OA6A 4E7ZA 3ZMSA 3OHRA 3NTHA 2EAYA 5CR2A 5D3GA 2IEKA 4UVAA 2QWOA 2BE5F 1VQOT 1OH8A 4G8XA 2ZJQF 3ZSRA 3CJ9A 2PAVA 1MZBA 1NGDA 1QQNA 2A1RA 2CP6A 1HUXA 1Q7YC 1DP3A 3HRGA 3LZIA 3CP8A 3WTVC 3K4NA 1IV0A 3CQZJ 4IF4A 1NJYA 5CZ2A 1JUSA 1ORNA 2GOMA 3CCLQ 5EU7A 4OX9K 3WUHA 4IDHA 3K0SA 2R92J 3FXQA 2RN7A 1YRNA 4FQGA 3CCQN 1SD7A 5KYXB 2ROLA 3PMTA 5C12A 4C3HJ 3CC4A 4AYBA 4Y15A 1S5LC 3DXKA 4AIKA 2V1NA 4YY3K 2OFKA 2E2OA 3DRRA 3O1WA 4M72A 4RCBA 3WVEB 2QTDA 2Q97A 4A5NA 2A3SA 4G6QA 1QPIA 4IHXA 1HYZA 1OZ3A 3FF5A 4H0EA 3RZOJ 4EHTA 3S1MJ 3E7LA 3M0TA 2R7FA 3ZCOA 4ZTFA 1X69A 3LOCA 3AHUA 2YKNA 5C4JJ 1VQ6T 2ZMEC 3R4KA 2UV1A 2BKDN 4BRIA 4LXCA 3GO5A 4M78A 3EKUA 1BA1A 4Z4IA 1GXQA 4I2QA 1Y0UA 2HHHK 3CC4I 2OANA 2K3BA 4CJ7A 1T8IA 3E9OA 3RMBA 4E19A 3KLGA 4EPCA 3OOPA 2O03A 1QWEA 2KI7A 4M77B 4CICA 1G3YA 4UUSA 1M8MA 1YXQA 2WUSA 3VKIA 4F7UG 5FKMA 5GAN5 3FXKA 4A4KA 1VQLI 3H0DA 1TL1A 1I8FA 3JCMP 2YUSA 4A3LJ 4NC6A 2Y0SA 4PLLA 4NXMK 1FBSA 4QKUA 3Q0WA 4A3BJ 3G1JA 2J5PA 3CPWP 1WA7A 4B9SA 4IIOA 4H0TB 1USTA 5CQYA 1I4K1 2BVLA 5D5UB 2QGUA 3GTMJ 3ESWB 3G4ST 2VJ4A 3VQ5A 5J47A 4BR0A 4FZXC 4NS5A 4KA4A 1Y0MA 1UJYA 3ZN1A 3K69A 1V29B 4IZ9A 2L9NA 4KH4A 5GIPA 1KQJA 4CSWA 5LFAA 2ZPGB 3OSVA 1QWFA 3DKYA 4J7FA 1CGPA 2SEMA 4CHOA 4F93B 5AQHA 2K4BA 4DSLA 2QW9A 2ZFWA 2P9PA 2H6CA 1ABQA 2OTJQ 3A98A 4FJ9A 1MUYA 4HCKA 3IP4B 2X6OA 5D5VB 4TVRA 2DOFA 3TW6A 4CGFA 1MMNA 4EAHD 3PVQA 3OSFA 4H0YB 1D5YA 4IUUA 2QK0A 3D45A 4RKUE 4M7AG 5GAOp 2FZCB 3OW2M 4CCHA 4MEXF 1ZRFA 5BPNA 1FPQA 4OO1J 1OKJA 1S1NA 3GF5A 4C2MJ 1IGUA 4IOAF 1ETQA 2HBMA 1OX8A 3ZSXA 1NJIU 1REVA 1MBKA 2WBMA 2NVXJ 2XPUA 3KD1E 2J5OA 3M59A 1U0JA 1KG3A 1S1WA 1R9TJ 4W5OA 1QHHD 3QLHA 2ZJRF 5CKBA 3RSEB 1V4RA 2MC4A 2D6FA 3AVLA 1W36C 1JEGA 3FZHA 4DUZK 2EZIA 2ZPBB 1UZCA 1W7PB 3LDQA 3KYDB 4OMLA 5GAN8 1I3AA 2O0YA 3L6QA 2CSIA 2DT5A 3SJHA 3WTSC 4AIAA 3EE8A 4F2SA 1KZHA 2KZGA 3BCBA 1UHWA 4F04B 3KLFA 1SSFA 2Z16A 2K7AA 1X3MA 4JYAK 3QKJA 2RHZA 1TKXA 3PIOF 2GLOA 5IXBA 5KYXA 1N9SA 3PSIA 1V4TA 3QEXA 1KU9A 1NGHA 4HYEA 2RV8A 3Q1JA 4EMKC 4IO8A 3AG1H 3QFUA 3JW4A 2WB1A 1M3HA 2A6HF 5E84A 1WQ2A 4ORZA 3KLHA 2GTJA 4IEJA 1S9GA 3U1DA 2JSCA 3D7SB 2X9DA 2LLKA 2EFNA 4JX6A 3UKUB 3VFZA 4JEPA 4FU6A 1M90O 2ESHA 1WHMA 3P83D 4AU7A 1DT9A 1A6QA 4HA8A 2DN0A 2VXZA 4A3CJ 2GCXA 1WUAA 3OMGA 3VUZA 4BRCA 5ILVA 1TZLA 3GLXA 4IOCL 2DLPA 1KC8R 3CC7Q 1VQNA 1J53A 1IGNA 1BOBA 1A5WA 3CCUQ 1ENHA 1XX5A 1EJ9A 3NMZC 1ZELA 4G1QA 3DXJF 1QSLA 4FX0A 3F22A 2RKHA 2FRHA 3S93A 1KU3A 5GAGJ 3GPLA 4W97A 1XC5A 2EV0A 3BCAA 1GCPA 3JSOA 3MJXA 1RIOH 3CD6Q 3VS5A 4M7AB 1TAQA 4ME7A 1UGPB 1Z7LA 4LF9K 3WE2A 3LGLA 3SD4A 3A2FA 3CXCM 5IOZA 2LVSA 1NK6A 4E7SA 1X19A 2HOSA 3RKYA 4CEEA 4H5WA 4JHDB 2OTLN 2EBIA 4IX7A 2KRMA 2E2QA 3T7ZA 3BY6A 1KHCA 1TNTA 2KT8A 4XLHA 2PNIA 2EK5A 1ILYA 3K9TA 3VS4A 3AVJA 3JAMK 4YFUA 2Z1DA 2XSJC 3JCMX 1MMDA 3THWA 2O5RA 4BC3A 2P84A 4CK2A 2Q36A 3E97A 1WCMJ 3RMSA 1P92A 4M77F 2HI3A 2V7ZA 4LFCK 3LAKA 1NK7A 1VQ5T 1GBQA 1BK2A 2IGIA 3FSPA 4RG2A 3VYHB 3RESA 4KBOA 4KRTA 2O4GA 3TEEA 3VEOA 2COMA 4MEYF 3WNFA 1YITA 1EO1A 1N8RO 2NYXA 1EV7A 4HV6A 3RSEA 4FM4B 2RK1A 2MI6A 4AVPA 3EUHC 2LYCA 2ABLA 1ZYRF 1T44A 2ZXHA 1MBGA 1DDNA 2ZXJA 1OFCX 2JT1A 4U67L 2BW3B 2CH4A 2CYZB 2ACJA 2PI0A 2B4JA 2KIFA 1TVRA 3WNGA 1YITI 1EH6A 3G1MA 2M7BA 5CKDA 4DBRA 3O8VA 1T03A 1MPGA 4DW6A 4F7UA 2E1CA 1KXPA 4C9YA 1K78A 4YTLA 3B6CA 1FJGK 1YQRA 2LX7A 2PMZA 1S6PA 1UAAA 4DSJA 1D0XA 1YS7A 2GXGA 4OAYA 4V19K 1ZLMA 5AQLA 4C30A 3KJVA 2KEAA 3O9TA 5DEQA 3GZ5A 3GTPJ 1QVGA 1WJFA 3K4CA 2YX7A 2HTSA 2E1ZA 3RJPA 3GBGA 4CH7A 3IKTA 3WXKA 1AKHA 1K6YA 1KAYA 2VXEA 2Y9ZA 1SANA 2M8EA 4O0JA 4II3A 3HC7A 4I76A 1RETA 4RB2C 5DM7L 1MU2A 5TKYA 5FLXO 3D0PA 2ZMEB 3GBTA 1MDMB 5KE3A 2JG6A 5DUIA 3JRFA 2WY7Q 3OB9A 4CHQA 1Y64A 1U45A 3K5NA 1ZLKA 4L5GA 1FBUA 3S2DJ 2WTEA 1RFQA 4LDXA 3VS2A 3BR1A 3RZDJ 3D2FA 2K57A 3EZ5A 3AGRA 5C25A 4DYCA 2KLOA 2R7RA 3ZSVA 4EM0B 4CYCB 3K70D 4L6V5 4BXXJ 2FBVA 1KC8C 4M7AA 1QQCA 1O3RA 3VEVA 3EGDA 4BVPA 3LSGA 1NLVA 2MGQA 2ITMA 4KIGA 4KIBA 3RQIA 4LFUA 4IHTA 4E9HA 4RW7A 3M0SA 1S9HA 4PKHA 3LGFA 1KU7A 2JT4A 1BISA 4MQVA 2CDTA 5KYYB 2RF0A 3GFLA 1EETA 1FP1D 1Y71A 2E2IJ 3BTLA 1KQSM 3VQBA 1BU1A 2HDCA 5AQGA 5GP9A 3HGGA 2FEZA 5DCMB 2WA0A 1TU0B 4J8OA 5I21A 1K73O 2XKOA 4PL6A 1JKOC 1FZPB 3IKMA 4WQ4A 2X1EA 4XN0A 3HL2A 3RYPA 4NZGA 2RQTA 4PDKA 3C6TA 3LX7A 1FYMA 1PSFA 1ZK8A 5HOOA 4PJLA 1UTIA 5HK0A 1KQ2A 1ZSZB 2KJBA 5FLMJ 1HSQA 1VQOQ 1KD1R 1L3UA 4XORA 3LALA 1HLVA 2BV6A 3AO1A 3JCUC 2BHZA 2KZVA 3CCQA 4HHTA 4MDBA 3UDCA 1UGVA 2QI2A 3AAPA 4OINF 3NHGA 3OY9A 1YQMA 1P4XA 3CUQA 4M41A 2VQFK 1Y96B 5GINA 4RAFA 2LFBA 3J7ZI 3CJRB 4KH1B 1TBXA 5C3EJ 4M7AF 2WAEA 3R1XA 2D0OA 3H5NA 4KHQA 2A5XA 1ZA1B 2XKPA 2NOEA 4RTZA 4J2DA 2NVQJ 3G6EA 3TDZC 3HO1A 3J7AF 4YIRX 1U3OA 1RTIA 1F4KA 3ER0A 4CFCA 1UHCA 3BF3A 2DILA 2XO7A 3QWXX 2K3PA 5LJVA 2IGOA 3A5ZB 2K79A 2A61A 4FX4A 1VQ6Q 4XR6A 4KUDK 1H89C 1UHMA 2XG8D 3AO3A 2K7LA 1XUPO 2J6FA 2XAUA 3G6EI 1LWYA 3RMQA 2GUPA 4DJAA 1ZGAA 3WQTA 2HF4A 1B07A 5DMRA 4KBMB 1UJ8A 5J1RA 2RPIA 2Y48A 3FHFA 3NF9A 1O75A 4H0PA 4Z4CA 1N39A 4AFSC 5D8LB 4G9ZA 5CVVA 1TQIA 1YJWT 5EEGA 1A04A 1QVFS 1N3CA 5E1ZB 3HHHA 3AVAA 1LCKA 1HYSA 2VUBA 1TW2A 1MWMA 4J2BA 2YRVA 5DY9A 3WXIA 4PKGA 4RTFD 1K0SA 4XU3A 3KLEA 3BDUA 1IN5A 1NJZA 2CZ0B 4G7OF 4E7JA 2PYJA 2ZMEA 3G4SQ 2OU2A 1MDMA 5EF6A 4KH5A 2L4MA 5HVQC 2RQPA 1NJWA 3L2RA 4A54A 1GVDA 2EKOA 4CYCA 1K4SA 5KCOA 1HR0K 3G10A 1WOQA 3J7ZO 3ZCMA 4F2RA 3MKWB 1W7PD 2O8XA 2GQVA 4ENKA 1UB4A 3SV3A 3DRSA 1NYGA 3SQ0A 1FBQA 4IUVA 3H0GJ 2WV1A 3OYYA 4LN2A 5KGWA 1ZYQA 1IKYA 5I11A 1SKUB 4FM2A 4CJRA 3NVKA 2D8HA 1FKOA 4C1NI 3GEZA 4DV6K 4HVJA 2P0WA 5KYYA 1XCVA 4KJZA 4YDUC 3KKRA 4BWJA 2CREA 1QQOA 4J2AA 1GLBG 3E9LA 4G6TB 5CKEA 4FOIA 5DCMA 3VYRB 1N34K 3JCMg 4IEIA 1X1CA 2CFOA 2E64A 1N9RA 1N77A 2YU9J 2QBYA 3TAMA 2CT4A 5KGXA 1WJBA 4J8FA 2IVOA 3CBPA 1UE9A 1VQPT 3VENA 2X4YA 1J5YA 3BTIA 4FYXB 3VA0A 2WSEE 3CDLA 2E5QA 3C0BA 1TT0A 2DTZA 4E1NA 1RBRA 1L5UA 1ZGWA 3M0PA 3NFCA 4N41A 2O8DA 1ATNA 1VYTA 5GAMe 4J9CA 1HQCA 3ME9A 5BRFA 3L09A 1KD1C 3ZQGA 1ZSGA 4K8ZA 4M3GA 1WJ5A 3KEQA 5EXWA 2DMTA 4CEDA 1Q7YO 3ZEHA 4BQZA 3NGIA 3LSMA 4Q48A 1U1TA 3QESA 2KIMA 3G73A 2ZAEA 4XLEA 3FXOA 4FYDA 1ZG1A 4WXDA 4M7AD 1VQ9N 5CLSA 4DQIA 1R5HA 2A6EF 2Z5UA 2UXXA 3V1RA 2M34A 2GBZA 1EXQA 2NYSA 4CGGA 1VA7A 3CJCA 4J9IA 1RTHA 1KG6A 5AQZA 3RR6A 3KK7A 4IG0A 3WU1B 3V7CA 4L9JA 5HDGA 1SF9A 2XPVA 3PIPL 3ZQCA 3ELKA 3CMEI 2PVOB 4WXCA 3CERA 4KMUX 3E1SA 2EZKA 4BR7A 2VKDA 2VJJA 1JRIA 2XHKA 3CQYA 3WG9A 1WSFA 1WQWA 3OWTA 3VOVA 2MW8A 4B9MA 3F6OA 2HBWA 2X74A 1KFDA 1QMCA 3V1QA 1RADB 2KZZA 5C44J 2ZNZA 5FKOA 2RREA 1I5OB 2K86A 2M5WA 5ECAA 4EMKA 2FOWA 1IG9A 1YCSB 4BGAA 1EX4A 2OTLA 4JNEA 1GVJA 2OTJI 1JJ6C 1H8KA 2DW4A 2EGCA 4OMNA 4DU1A 3AA2A 3F23A 4Y1DA 1RT5A 1HW2A 2H27A 4BRKA 3D4VA 2OUMA 4F3OA 3NH2A 4X62K 2HVHA 3TAQA 4E7LA 4LDUA 3J7YJ 2Z9OA 3CCEN 2KMUA 3BZKA 4K43A 2DJIA 3DRPA 3H1CA 4OOIA 1FNNA 2ZPHB 4K2EA 2DJNA 3HRMA 3M8JA 4LF5K 5EJCA 3ISNC 3U8XA 3T3FA 2NVUB 2V8IA 4ETSA 3RMDA 2OZMA 2IPQX 4PHTX 1ZG3A 4MQ3A 1KG5A 2NOFA 3VQQA 4X9CA 1ZQ3P 2P5GA 2NRHA 1PWTA 2G6FX 1NG7A 2DMPA 1VQ5Q 2CUEA 3K7AJ 3LDSA 4I01A 3EAEA 5FDLA 1K76A 1UHSA 3I56T 2COBA 1IXDA 2RKIA 1Y6IA 3FLCO 2A69F 1HKGA 2FBTA 1KSWA 1MH4A 3AA5X 4RS8A 4FO0A 1AEYA 2TRTA 1VRLA 1OV3A 1ZHIA 1ZA2B 3RKXA 1TWHJ 1GFDA 4X1VA 5CZ1A 3EGXA 1YFHA 1VRUA 2W25A 3O1BA 2F4MB 2YUPA 3RDVA 2ASPA 1RT4A 4ON0A 3ERMA 2H8WA 3H36A 1RLQC 1OR7C 2M16A 5GAGP 3HG9A 5GAEJ 4BREA 2E5ZA 1POGA 3CBMA 2YX4A 3SK3A 3ZSZA 3RMAA 2DFEA 4JI0K 1KONA 3OW2S 3AVGA 1S72A 3C0CA 3EPZA 1V76A 4CYDA 2GWKA 3M6GA 3NHNA 2HZDA 4XKVA 2ZD1A 2MFZA 5GMKi 3CW7A 2A42A 4MLEA 2GV9A 2M0CA 4IHWA 1I5ZA 2IBDA 1QVGP 4LE9A 3O3FA 5KH6A 2DK5A 2KK4A 3K4JA 1DTQA 3V6DA 2F4VK 2XY5A 5B1AH 3K4LA 2E4HA 3CCMA 2RD1A 4XH4A 2XB0X 3CC7I 3FZMA 4JK9A 4FWKA 1S72I 1KG2A 2P6SA 2X6WA 4BRGA 3EUHA 4II2A 2WY8Q 4YHHK 3G1LA 4EZ6A 3I59B 2J6KA 4DQ8A 2L2PA 2B5JA 5FWCA 4JOMA 1WVRA 4A93J 4PKCC 4CXFA 2VBXA 3GTOJ 1RAHB 4BQLA 4M77E 1QZYA 1U1SA 2G8IA 2CQ7A 3SLCA 3CCMI 2DOEA 3S14J 2HNHA 2EGEA 2OAUA 4J83A 3OS2A 3J7AP 2VI6A 5HS9A 3WHCA 3S17J 4EZ9A 2NRAC 2A5YB 2MYSA 3KP4A 2PQ8A 4UHTA 2E2JJ 5CVUA 2HDWA 2VKNA 4CZJA 1FOYA 4QTRA 4PJJA 3WTXC 3ZQHA 1YQKA 2LR8A 2YG8A 1S1TA 2BY3A 4D5FA 3BQZA 4BXUA 2IVMA 1OCRH 2RI5A 2K3YA 1LAVA 3QMLA 3F73A 3PNWC 4ZC3A 3CQ8A 1LWFA 4G9YA 2AZSA 1K0XA 1QQJA 1IRZA 3C7JA 4AWXB 4ZHRA 3DLEA 4DU4A 1QQMA 3PNYA 3P8BB 5CYQA 3GFIA 3KK2A 5LEJA 3CCSN 1Z25A 2HKNA 1W1FA 2BH1A 1VQ9T 2JRMA 1QVFA 4JX5A 4QS9A 1HKQA 4BC4A 5KTQA 1N8RU 1JJ8C 4NYFA 2QGFB 2Y1JA 5E3OA 3FZFA 1K9MR 2XDBA 3WQUA 3WEEB 4JX4A 5SZTA 1S1UA 4HAMA 1QSYA 2W48A 4KIFA 2O8BB 3SB2A 5GAHJ 1QVTA 1I27A 2V1XA 3M53A 4JLHA 3AAFA 1WI3A 1TL3A 1SRMA 3FHNA 4OU0A 1USSA 2L0AA 1X6GA 2YRCA 3ASKA 4ILHA 2X51A 4I99C 3JCMc 3OYNA 4GKKK 3HRTA 4PGGA 1B4AA 5D6FA 3T1YK 2ID3A 1Z21A 3I55T 3DJCA 1G3TA 3E5QA 3ERED 2A7YA 2QXFA 3JRZA 4ANJA 2P9IA 5AQFA 2FRWA 4BHCA 3AKZA 2E6LA 2OZ6A 1RT2A 5CIUA 2BDPA 2LF7A 3HSFA 5L3FA 3SJJA 2GXBA 4Y28E 4R79A 1SD6A 1XQOA 3M8SA 1BI2A 3A5LC 5ELZA 3DU6A 1TXQA 4XU0A 3VWBA 2RM4A 5J40A 3QPTA 5LJ3e 3LDPA 3KLOA 3CC2N 2QLZA 2Y2ZA 1NWKA 1ZREA 1LFPA 4OF1A 4HPQA 5AQOA 2XF5A 1EFNA 3JV3A 1NOYA 2A68F 4NL2A 3T5XA 1DP7P 3KZZA 1WIEA 1YJWQ 3R3LA 4E7KA 2E8AA 4AQYK 4OPJA 2O9LA 3ZSOA 4KREA 1X3NA 3QSUA 2JWLA 2O8CA 4XLCA 4FTHA 3VQAA 2EYQA 1OCZH 1JXOA 3M0RA 1MJ9A 1JTXA 3O5BA 3K57A 3RYRA 2DO3A 3BJOA 2NUZA 1U5TB 2X6XA 2LJ0A 3BQYA 5ICEA 1H9TA 1NK9A 2D1VA 3KLIA 1VQ8N 2RHXA 4M75C 5J2NA 5L3CA 3I59A 1B59A 2B0LA 4FW2A 3VW4A 3M9QA 1W97L 5D6YA 5F2RA 3QBXA 3HGYA 2E3IA 2ZZDA 2UXBK 1C6VX 3EFRA 1IG7A 4UNFA 3S2HJ 2VKEA 3K2ZA 4AFQC 1YJNT 2RVCA 2ICWG 3CJBA 1QBJA 2GFUA 5EEHA 2LH9A 4M9SA 5FPNA 3A2KA 4N5SA 2YS9A 2MK5A 4J9HA 4NQWB 1RI0A 3RTVA 3C6HA 4JJBA 4IG3A 1KC8O 1IKWA 4PUOA 2VWFA 2JGUA 2BZTA 5AZIB 2NS8A 1TK8A 1S8NA 1CXUA 3C7NA 2ATQA 1VQOI 2RJEA 2COZA 4BRLA 5GAMd 3MXJA 2X78A 4OB3B 3FC3A 2P4RA 1SHFA 3QEVA 1KU2A 2DRMA 3DI6A 3JXUA 4J9EA 4ZZLA 2HVSA 2MWPA 1VQPQ 3ID6A 1KAXA 5K7FA 2XDVA 2QWMA 4PJOG 4IHYA 1HCRA 1V5FA 1H88C 2O8BA 3S2WA 4ITVA 3CF2A 5KRSA 2V8JA 1QP2A 4GO1A 3O4WA 2JSPA 2R7XA 5FGMA 2FMYA 4KGXB 5BREA 1K9MC 3OYKA 3MAQA 1T0JA 1W1WE 1T95A 3EZWA 2FHDA 4C92C 2DNUA 3OYDA 4A5AA 2F48A 5DTDA 1MDUB 3X2QH 4JKFA 3QWLA 2LY9A 4MZTA 4FSSA 1NEGA 4YDUA 2KQWA 2LRDA 1OPKA 3CZ6A 5DS9A 1OCOH 2LMDA 1LNXA 4MO4A 2KE9A 4GV9A 1IV6A 1EZZB 4D9JA 1XGOA 1YHQT 2W4SA 2K6DA 2NOJB 2VBWA 3BW1A 2WWYA 3LQQA 4YOUA 3A0IX 2E5KA 2G9WA 2XAFA 5EGOA 3F10A 2LNVA 2QXLA 3KTQA 5J2QA 1JI8A 4ILJA 3HIFA 2HMIA 1QCOA 1BOAA 2DVJA 4D0PA 2D0BA 2JXBA 2YNIA 3OMCA 1W0UA 4V2SA 2CGHA 3TOBA 4HX7A 2UZKA 1J5EK 1J9AA 2VWBA 2K4YA 5C0MA 3JCMV 2DI3A 2XHBA 2R5ZB 3DFGA 3TU4K 2V75A 2LY2A 2EQRA 1Y07A 5DUKA 3BEXA 3TWHA 3FXRA 2Q2EA 1YVNA 1S3XA 3J81E 3KWIA 3MEVA 5J8FA 3VEWA 4EATA 3MWMA 3SYTA 3HPOA 1U5TA 4KI4A 1ZARA 3PX0A 5AQSA 4PQUA 1AD5A 2D4WA 3D0SA 4F91B 4XH5A 3UIQA 2M87A 5ERIA 4PA1A 4B1XB 1I07A 3CCJN 1MIJA 1PC0A 4XRFA 4YFNF 2QSGX 3I0TA 1QVUA 4JRQA 4C8QG 3CCEA 3CF5L 4N4NB 1MBFA 3VF6A 2PFBA 1R4NB 3I8BA 1E2XA 2MH2A 3S9HA 1SUQA 5ICFA 4GLKA 4RGXA 3DU5A 4ZGDB 2K9MA 4E1MA 2GWRA 1DGRM 2BUDA 2HFHA 4PJOB 3O80A 5MLCQ 2HQ5A 1PKTA 2F7TA 3BPXA 2HD0A 5BQTA 3RBBB 4E6KG 2HDDA 4YPHA 1XMXA 3CCEI 1JXEA 3PX4A 1IKXA 4NQWA 4B8XA 1TUGB 2NVYJ 5FU7C 5C24A 3OOUA 2RK2A 1SL1A 1RRQA 3D5RC 4Y13A 3F6VA 5AZIA 3SWNC 4BG8A 2WV0A 2QTVA 3SZ2A 3MPUB 1PRMC 4XIUA 5IT9E 3U21A 4DTNA 3QYEA 1SZ2A 4QSHA 4J01A 4BDZA 2DA1A 4OVLA 3SZGA 3I56Q 3BY5A 1YCYA 5JFRA 4U7DA 4JKBA 2HGCA 2BZXA 2D5VA 2EIJH 3G71N 3AFHA 1OH6A 5K14A 3E01A 1WJCA 2JZYA 3P7NA 2KAFA 4ESRA 1T33A 2Q2RA 2QDLA 1B9NA 2LKXA 3EO3A 2JN0A 4ISEA 3KYCB 2PMHA 4OKEA 4BI8B 3H3OB 1TW3A 2AT1B 5B5EC 2GEMA 2MSYA 1QKXA 1WEIA 1PP7U 2KR3A 2STWA 5KQDA 1N27A 4HCCA 2X4XA 1NYFA 4RCHA 3OYEA 2FSNA 1OLTA 1IF1A 1KG4A 4H5VA 4XLFA 1C0GA 4HSBA 1K79A 2QA4N 5DPKA 2JOYA 2YUNA 2IIMA 3ENOA 1IKVA 1KD1O 3H1QA 3NNQA 3DLBA 4CC4B 4EA4A 1W5CC 1X3UA 3L2QA 4AM6A 1TV6A 3F9KA 5J1EA 2QQ8A 2E20A 3JRDA 2DPPB 2W03A 3MEEA 4M9ZA 2FQ4A 2Z33A 3L3UA 1C1BA 4C8QB 4NB4A 2BE2A 3LP1A 3A8YA 3N05A 3V9ZA 4N4OB 3VETA 3HEFA 2RMOA 5EDNA 3CVSA 3ALYA 2IRFG 2WONA 4BY1J 1AWXA 4F7ZA 3HB9A 2HWVA 4JDSA 1W6XA 1I1JA 2R5ZA 3AARA 1UOCA 3OIOA 1T2KA 3ZSWA 3R60A 4M75E 2KDSA 9ATCB 2O9VA 4P9FA 2LJ1A 2IVNA 1HNWK 4YNQA 4IKFA 1FMWA 1XGMA 3SHFA 1TL8A 2Q0OA 4C92G 4DSKA 5M1PA 2X85A 2ZCWA 5HRPA 5E3NA 3I35A 4FLVA 4CA0A 1R5GA 2CQNA 4DMNA 3CFPA 3H9QA 1WJAA 2HQXA 2B86A 1RCHA 2DMOA 2FQ3A 3TBIA 3V8KA 5TISC 4CEOA 4Y4RA 4FVMA 4LD9K 4M3BA 2VQHA 4WX9A 3ENHA 3L2CA 3CCSA 4IFVA 4HG2A 3PO5A 3NGYA 4RW9A 5LJ5e 5GAEP 1QVFP 2EFIA 3F8CA 1GDTA 5EG0A 2HDAA 1N33K 2IA2A 4DSFA 3FDYA 4C0GA 3LSRA 3HXLA 4FM0A 1HYOA 2EQUA 3IRQA 4PJOA 4J6YA 3T19A 3ZOBA 1TWFJ 1JJ2A 1SQKA 4RTVA 1VQ9Q 1NPRA 3ZN0A 4K41A 4DTOA 1NBWA 5A2QZ 4AHSA 4B22A 4ISFA 2CP5A 4DR5K 2M3AA 3CCSI 2WACA 2O8FA 2D2WA 4ZYHA 1JO8A 4RTUA 2P7VB 5DYMA 4M6XA 1JLFA 4FPAA 4IJNA 3L2VA 1JKHA 4AG2C 1IHVA 4P9UA 2I5UA 1Q86U 1YIJN 3NWTA 3SXYA 3O6WA 2BXYA 2EVRA 1QHGA 1NKUA 2E1YA 3O8GA 4JI8K 2QGGA 1RUWA 4ZYAA 2HQHA 3PQKA 1S7EA 3TP3A 4BEHB 5E1WA 1U47A 2DA5A 4IRIA 3OYJA 4KMFA 3A5NC 2JTVA 1IXSB 3TEDA 1DTTA 2WBNA 1Y39A 3BWGA 3TAEA 1J75A 1ZBXA 4IJAA 3H9GA 2JUFA 3CWTA 5F6FA 5A0DA 3CC2A 1NU0A 1ON2A 2VE9A 4B43A 4B3RK 3I0XA 3ZQFA 4CF0A 1ACMB 2BE9B 4FCYA 3BTJA 3NRVA 4LOCA 1ZUUA 1I0CA 3MP6A 4HT9A 4WE1A 3JCMW 2EWSA 1QVGM 2QZ8A 2O8KA 1T6DA 2YX6A 1VQMT 2D0QB 4FWSA 4H0VB 4A5BA 4PJOF 3TU5A 3HBLA 1N5ZA 3MN2A 1RBVA 4BL0B 3S1NJ 2P5KA 2KYBA 2K9GA 5J6XA 4DV5K 2HEQA 1B9FA 2F5FA 3CC2I 2YLBA 3O4NA 4BR9A 2HNDA 1R36A 2YUQA 4MGRA 3E6MA 2DVEA 4BD3A 3ZT3A 2E6ZA 3E2UA 4H5RA 3FXMA 1VQ8A 2FBYA 2V4JC 3SFZA 5AIQA 3X20B 2QEXN 5LJ3j 2COWA 3TSQA 3TARA 1CSKA 3OMYA 3KP2A 2D0NA 2CUBA 1OISA 4XSZF 1UG0A 1T7PA 2YHXA 4AI5A 3BG5A 4L9TA 5GAHP 3QDKA 4NYNA 4B9WA 2UXCK 2BE7D 2LT4A 1QLYA 4A3IJ 1G2BA 3BT9A 2O88A 2KQ2A 4EGYA 1KYWA 1YLFA 3CCRN 4MO7A 4BRHA 4F14A 1VQ8I 3ULEB 4CIEA 4CJ5A 3KEOA 2XIGA 3T0YA 2HVIA 3J81O 2V26A 1C0TA 4M3YA 2QVOA 1KCFA 5J39A 3ZL7C 2P9KB 2DL4A 4FM1A 1O13A 1STZA 5GANd 1YWPA 4XU2A 4CRIA 1ASVA 3SAHA 2PBIA 2R3SA 4M7DB 4W1UA 1E3PA 2LQNA 3ZP5A 3NH0A 5LRSA 1OYXA 2OCCH 5GAN7 1NGBA 2YXYA 1VQKA 3OS5A 1J54A 3SFIA 2DFIA 1ZUKA 1Z9CA 3BLYA 3T69A 5A0LA 3GE1A 1TWCJ 5BN9A 1D09B 4RW4A 1G8XA 2B63J 2ZJPF 1BBZA 2HF3A 4MDWA 3JB9F 1LEAA 4C8QF 4XQ3A 4V2GA 2OYQA 5AZJB 2A6AA 2DF6A 4BRPA 1V4SA 2O2OA 4GYIA 3R6SA 2DKGA 2V51B 1LDKB 4E7HA 1VQKI 3H9NA 3EFOA 3SCXA 3W3DA 4A3MJ 1UFMA 3MEUA 4FZYA 3HBTA 2K4JA 5IT9O 3GZ6A 3H92A 1LW0A 2HXIA 3NPFA 4PFPA 1AU7A 1X1PA 1M3CA 5IY5H 2E4LA 5KYUB 1ESVA 1VSDA 1BI4B 5KPZA 5HKCA 4E6RA 3U9GA 2YRDA 4AM3A 3F3XA 1ATRA 2PQWA 4BAYA 3AA3A 4O5BA 1O4XA 2YHAA 1JUMA 5GMKh 4LLGF 4X0GA 3AY9A 1D1CA 1EH7A 1TUDA 1RPWA 1ABOA 4X64K 2D8JA 2W40A 1OCTC 1KRPA 1YHQQ 4F9OA 3HRUA 2DZ9A 3KP3A 2H3GX 4JD2A 2QYZA 3VRYA 4QQGA 3SNNA 3MQ0A 1D3BB 4QVZA 2KRSA 2AJQA 2V1QA 1TQPA 4BY7J 1A6IA 1IXRC 5I22A 3HOXJ 3GXOA 1X1AA 5E3MA 1E7OA 4N9HA 2YU3A 4JLIA 5DM6L 4PJOD 1TKTA 4LFBK 4C92A 4O6JA 4CBXA 2NRZA 2RJCA 1U4BA 2MD5A 4QCLA 1N6QA 3P9CA 2QF7A 4BY6C 3THXA 3DPUA 3QYFA 4M3WA 3CCJA 4DR7K 3MVPA 5GAOl 1WKMA 3DB4A 4HLXA 3GTJJ 3P38A 1NJXA 1JLAA 4U7BA 4MFBA 1MKMA 3M4YA 4L18B 3IS9A 2DJZA 1YJ9T 5KAFC 1KK7A 1OPLA 4IZZA 3VRZA 3S16J 3HDDA 3NWSA 4JI4K 3ULEA 2L9RA 2LP5A 3CCJI 3RRHA 2O4XA 3VERA 4M3RA 2M9HA 4RGUA 4KTZA 4YOTA 1R8OB 3I54A 2V9PA 5M3FJ 5L23A 1TWBA 1YS6A 3LAJA 3QOPA 3GBQA 2D0AA 1G3WA 4XRMA 1TYQA 1Z6RA 2P9KA 3WVDB 3CG7A 3A02A 3UKRA 2JUGA 2JMWA 4UVBA 3VPZA 3V7RA 2JWKA 5KPTA 3THYA 2M0MA 1VQPI 1SAUA 3E1YA 2GWJA 4DF8A 2JRTA 4XQFA 2NLXA 4CCLA 4C92F 2YHYA 4OMYA 4ZDOA 5I2MA 3CC4N 1XNQK 1KQ8A 3G71A 4RW8A 2LCLA 1JXMA 3KXTA 3R9PA 3VEZA 3BC8A 4RAZA 1RRJA 3DEWA 2VOPA 1OYIA 5E1XA 4JRIA 3IL2A 3IFRA 5LHGA 1JCFA 4LB5A 1C1AA 2HMAA 1ZBIA 4UV9A 5GTHC 2Q0RA 1VQLN 1WFWA 5I9EB 3MXMA 2XK0A 3M0UA 3ZGKA 1QHTA 4HRIA 1GUUA 3JB9D 4OWRB 4NCAA 4C8QD 3G71I 4CERA 3ABKH 4A69C 3EG3A 2LY1A 2YPRA 4W5QA 1T6SA 5FPDA 2H3EB 4FHTA 2QQSA 3LWLA 3WU0A 4CJQA 1CLQA 2DYSH 3QRFF 4KB1A 2QA4A 1X9MA 2XC7A 4IO9L 1VF9A 2C06A 2KRCA 5GADJ 2B7EA 1BI4A 4MHGA 1K9MO 3C2BA 3A8LB 1UG1A 3SWNA 1LWVA 4N4GA 3VODA 1PJRA 1QA6A 3UPUA 4M7DF 3MX2A 2X6NA 1KQ0A 3FGUA 3NBPA 1PUFA 3TTCA 3LNQA 1CKAA 3FJPA 3A1PA 3LSPA 2RQQA 4IWVA 1JL2A 1WSJA 1PDNC 2VPLA 1E4GT 1RDDA 3CCYA 1IDZA 3A01B 1D3BA 5JMVA 4XMYA 2EBPA 1IN6A 1YWOA 2JTFA 2OI3A 4PL8A 2RHYA 1ASWA 1IV8A 2CGPA 1YI2T 4KI6A 2VC1A 3CMAN 2A07F 1IC8A 3QWYA 2W0ZA 1XC3A 1MNEA 3TMOA 3M1FA 5DD4A 3BR5A 2FF6A 3CVTA 5BNGA 2DYRH 5C42A 2NWMA 3AAQA 2F69A 1NK4A 5CVIA 4Q5VA 2LKPA 5LJ5d 4CE9A 3S15J 3JSCA 4P5OA 4YOWA 3J80K 2JN6A 3T1HK 1RDUA 3AL0C 1IZ1A 2ZXIA 4U0VA 4BR4A 2M1HA 4C2TA 2RC4A 3EG2A 2E10A 3VS7A 2KXCA 1BIZA 4XBFA 1EIFA 3MKLA 3CCVT 3ZBDA 4AHCA 3H3ZA 3HP9A 5GJWB 2K3XA 4ISGA 5J3BA 5DM7R 4HZFA 2X1DA 2W24A 4WFAL 4UB6C 4XKCA 2H8RA 1LWWA 2VKVA 4ELTA 3R0AA 2EYWA 1LE8B 2EJGA 3M8FA 2LTOA 3MKZA 3K5OA 3JCMf 2HU9A 1YVUA 1M1EB 2CWEA 4IXCA 2OJED 4GV3A 1Z9ZA 3MMVA 5BS6A 4FZZA 5EY4A 2QKMB 2D0CA 2FL7A 2PMUA 1YIJA 1ZBUA 1RESA 4E2FB 3DTKA 3TAFA 3UNGC 4BE1A 3L1AA 4UQGA 3M8EA 1RACB 3EE9A 5LJ5j 3LWIA 3PLAA 4S04A 1ZBFA 5B1BH 3ZSQA 3M55A 2JVHA 4OMZA 1ERDA 1O7FA 3QETA 2CV1A 2XAGA 3LH5A 3SBGA 4R5PA 2X6SA 3SZTA 2DXIA 2FX0A 2K02A 4L9VA 3VMFB 5AQMA 5AYFA 4C92D 2IVWA 5GAOq 1BR4A 4JBAA 3M58A 3OL4A 2DERA 2A36A 1YUWA 3DMJA 5AT1B 3HSEA 5E79C 2W57A 4Z94A 4XLAA 2KIUA 1LV5A 2L9VA 5LHIA 3WT0A 5CK9A 1PCXA 4BE0A 2KFNA 1XWLA 3BFMA 1Q18A 2LVMA 4AIHA 4RMOA 4B24A 1WI7A 1VQMQ 1QU3A 1D5VA 1IJWC 3M57A 5LJ3f 2J7IA 2JS0A 4CJKA 5FLVA 1M5Q1 5F0XA 1OZ2A 3IUOA 1ZH5A 4BJTA 5BPLA 2QEXA 4DTJA 2HR3A 2CS7A 3FDRA 2X6YA 5IHKA 1VQ4N 1U49A 1MMAA 2P0QA 4JKAA 1BL0A 3ID8A 1Z3YA 5H6RA 2P6TA 3DKWA 3SQ2A 3A03A 1U04A 3P9IA 3SQ1A 4EMHA 2H8HA 4JKGA 4ZN1A 2PJPA 3U9DA 5BR8K 4XSXF 4BE2A 4YIFA 2HVQA 3MMYB 3CCRA 4H0XB 3TANA 2Z1IA 2QEXI 2XV4S 1MA9B 2RN2A 2TCTA 3MZ8A 4EM2A 1YAGA 3QIPA 4FJIA 4LF7K 2XF7A 4RTTA 3IV5A 4Y17A 2DLLA 2NXNB 4Z4EA 1WPYA 1KG7A 2KFDA 1OVYA 3JCMh 5GAOn 4RW6A 2X3WD 2OPTA 1RKWA 1PNJA 3JS6A 4FYYB 3OBWA 1T3VA 4Z4GA 1AOYA 1FOXA 1U6GA 4LY7A 4D8KA 4LFAK 3VS1A 5C0YA 1VQ7A 5F0FA 1QVFM 4DHYA 1FC3A 2F2VA 2AK5A 1NLOC 4H03B 3DXKB 3CMYA 2KNBB 1U8RA 5CJ9A 4P55A 4RAYA 3KD5E 1PHTA 4FJKA 4WWCA 5KQ8A 2UUBK 2XGEA 5BPIA 3QXEB 2QA4Q 3GW2A 2F1LA 4AG1C 1KLMA 4DQRA 2Z1JA 2VXFA 4C0FA 1T6CA 1LE8A 2EYXA 1VQ7I 4M78B 4NHJA 2FJ1A 3H0IA 2AA4A 2M51A 3P4IA 3I55I 1KO9A 3QINA 1VIFA 4FK4A 1W5TA 1BUPA 2NOIA 3L4QA 1WGXA 4WTOB 2XHIA 1PSEA 4UUSB 5HLTA 4A3GJ 2PTKA 3MN5A 3QZ9B 2WOMA 3DBRB 3WNEA 2K9QA 1D3YA 5FPMA 1M1KR 4DV4K 2CFXA 1H641 5LJ3h 2PMZN 4JI1K 3OYBA 5A2QO 4KHWA 4UV8A 3MFKA 2G0EA 4X34A 2VPRA 4R55A 4CBUA 1PD1A 4FOEA 1OCCH 3HOSA 2LQWA 2VASA 3I9V2 5F04A 3G0QA 2DAQA 2LT1A 3MEWA 2FSJA 2IS1A 4UUVA 4I6ZA 4ID1A 2W04A 1GLDG 5CVRA 1E3MA 4AIDA 2D5RA 5T7BA 3SZPA 2JQ7A 2NOLA 1QCNA 2G8HA 2EFPA 1VHXA 4BKXA 2HOTA 3IKVA 4XL9A 3QJYA 2BY1A 4X65K 1WHLA 2G8KA 4B1WB 2NOBA 1QGPA 3HOZJ 4A3EJ 3GIBA 2CS3A 1NM7A 4FLTA 2K40A 5C2DA 4CZFA 3SAFA 4RAGA 1EKEA 3FKIJ 2GNCA 1S7OA 2M0OA 3KLNA 3F21A 1WX6A 2JPCA 3DBHB 4B3XA 3HOVJ 8AT1B 1WSEA 4AHVA 4OMFB 3FISA 4C0DB 3TVTA 4X6AJ 4KKOA 1A5VA 3EYYA 5AQXA 1E17A 3HSCA 2JZ2A 5HP1A 4AUXA 3RRGA 1TG0A 3MWPA 1YX5A 1Q86R 2V7YA 3K10A 1I1SA 3QERA 2VT2A 2D45A 1N25A 4ID5A 3VESA 1YJNI 3HSRA 3K4MA 4NO7A 4PK4A 4CJ3A 1JLQA 1YIJQ 3SBTA 2OAZA 1YJ9Q 1QVGS 2GUIA 4FJ5A 4GGGA 1BIBA 3JAME 1WHKA 4A3KJ 4G7ZF 3BPVA 3I3LA 2YI1A 3SUQA 1GLNA 2AHJB 1Z05A 3VTIA 4FLZA 4XN3A 4YRVA 4IBNA 1QCFA 2L7KA 4CHYA 4CD3A 2IW5A 2E3HA 3AO4A 5HS7A 2CH4W 2FF3B 3I5SA 4CJFA 4FK0A 3EG9B 3HT3A 4HW0A 2W41A 4NBQA 1VQNT 3Q0VA 4PNOA 3QAHA 2PLYA 1E3OC 2B8AA 2BYVE 3G6EN 5F08A 3MCAB 5CYVA 3P5JA 1VQLA 2K5FA 3LM2A 4ZGJB 4DOZA 5BPDA 3S3MA 2AIRB 2ZPEB 1FYKA 3HOTA 3L9FA 1BI1A 3KE2A 3LA2A 5LBQA 1IGQA 5GAN2 2K85A 3K9JA 3S1QJ 1UECA 4Z2YA 4K25A 3SMSA 1LDJA 3ZETB 1R59O 1VSKA 1K83J 5FU6B 2VIXA 4N4IA 2F2XA 3D7EO 1ATSA 3PNTA 3ZMDA 3K59A 5D6XA 2GTOA 2YLCA 1IN7A 4WFNL 3LWHA 3MO8A 2P5LC 4DWIA 3WXMB 3V9SA 2PBDA 3GX4X 1YG2A 5H6QA 1MV0B 1NMDA 1P6RA 1M1KC 1RDAA 1N78A 4BRAA 3A4CA 2FZGB 4L9NA 5CKHA 1Q82U 3CTAA 1XI1A 2YG9A 2EYYA 1RT1A 1P8ZA 2CYYA 3JR9A 4MZMA 2HVRA 4Y52J 1Z0XA 2L54A 1ZUYA 2N8GA 1XCBA 5AQTA 5KRTA 3RQ4A 4HNVA 3WGHA 1HNXK 2LOOA 1NKEA 4QQDA 4CBWA 2X48A 2R5AA 1Z3XA 3FMSA 2ELJA 3HYFA 3CMAA 4K11A 5FRMA 1YITT 1KG1A 2E71A 3JTHA 4M78F 3BR2A 5HLGA 1FT9A 4CJSA 3BJ6A 2XGCA 1YI2Q 3E0JB 2P9UA 2IOCA 1WN7A 3THWB 3FXJA 4OKJA 2OF7A 1XD7A 3F0CA 2PJRA 4OIPF 2JS2A 2OBPA 2FB7A 3CJ1A 4EJWA 4CVNE 2IA0A 1KLNA 4JZ3A 3F8FA 1J0RA 3QYGB 5ICGA 2XDDA 3CMAI 4FJNA 3REAB 2XRLA 2F4OB 2XB5A 2LK2A 3Q7CA 2I5JA 2JTEA 2Y1IA 3LSTA 2QDYB 4PSXA 1JKRC 4I2PA 4YORA 4R56A 4KT5C 2G8UA 2LBFA 3DWLE 4EIKA 2EFWA 3L7WA 2JHNA 2UXNA 1Q86C 1IBLK 3I53A 1MMSA 3CCVQ 5AQUA 2RQVA 1YYVA 2VBYA 4UOBA 1KQ1A 4B3TK 4M63C 3WODF 2UU9K 4HF1A 3DOLA 3ZMVA 1XG7A 2QWRA 1RBSA 4FL9A 5GADP 2CH5A 1M3QA 2D1KA 4A59A 4LB6B 4F7UB 1GV2A 4LGWA 1MGQA 4F55A 1HNZK 2DQLA 5J1YA 3QPLA 1W0HA 2DPDA 1K78B 3EG9A 3EY1A 3ZT4A 1V55H 3AG2H 4RMNA 1HKTA 2LC2A 4M7DE 3NE6A 2FVUA 1Z26A 3TSPA 2XY8A 2Y4XA 3KIOA 5E3LA 2ZSHB 4Q5SF 5KYWA 1H92A 2IJLA 1X3WB 3NDKA 3CPEA 2AHQA 2KHMA 1NKBA 5ICCA 1ORPA 1NLPC 1E6HA 1JQQA 1RR7A 2KHOA 3CMEN 1K9MU 4ZH4F 1AKHB 4WCEL 2GM4A 2GOXB 2DXTA 2KYMA 1B9DA 5HRSA 3SMPA 4MIMA 1AOJA 4A62A 1XC9A 2L7FP 1BW6A 3ZETA 4WF2A 2GBQA 1DQUA 4GVMA 1SL2A 4A61A 3OV8A 5HLHA 4JKCA 2EILH 4E3SA 2QYOA 1UDLA 1WHHA 4CC3A 1KTQA 1ITGA 4F3QA 3CLQA 2PUOB 1LWCA 3D2FB 4LLLA 2OTJN 4I7FA 4CZLA 3TAGA 4CI0C 3NH1A 1TOVA 2KPMA 3NFAA 5D6EA 1QNTA 1GLAG 1VQ4A 3EGDB 1H8AC 2DFHA 2HCKA 1JLBA 1ETXA 5JI6A 2E34A 3JYTA 3B02A 4BRQA 1DGWY 2ELKA 2H6BA 3N4QA 4LITA 3CCQT 3N0UA 2VG7A 3SEZA 5JLHA 2CQKA 2FNAA 2WAQN 1BA5A 3TOAA 1W2BA 4B47A 3N5NX 2VWJA 1VQ4I 2LRQA 4QLCU 1WH5A 3NGZA 3G6ET 3CC4Q 4DTUA 3CO7C 2GA2A 3DLLL 2RI2A 3ZR8X 3SQNA 1WH7A 1BQNA 1PRLC 5CR4A 2L3PA 4M78D 3PO4A 4M73A 2L7ZA 2BUPA 1BQMA 1BR1A 2FBXA 3DLLA 1VQLQ 1B34A 1ZR4A 3T8RA 1FP2A 4RA2A 4IVNA 2M4KA 1C0WA 3CJNA 1BI0A 3CUQB 2R7QA 3PMIA 1OEBA 1JJ2M 1SS6A 4IOCF 5AQKA 4JI3K 3I5RA 4A4FA 2PN6A 2VB6A 3E5UA 2OCEA 4CJ4A 2Y0MA 4PWDA 2ESWA 5F1XA 1R6RA 2KY9A 2XUBA 5B8HA 1A36A 1XQSC 3K6GA 3JAMO 3PFYA 3PE0A 2E1MB 4RDUA 3HM9A 2NOZA 4HF2A 1WBDA 3FBNB 1P7JA 5GAMg 1HSJA 3L3VA 1WSGA 3LSJA 4NUBA 4FWOA 1PVEA 1A0NB 3AGKA 2IVPA 4EP5A 2DD5A 2F96A 1J9IA 1IN4A 3CC7N 3U6FA 3CEYA 1S72N 3HYIA 3CCUN 3M8PA 1BN5A 1VSEA 2ABKA 1SFEA 3FLGA 2CQXA 3M9AA 3VTHA 5C10A 3R2XC 3DLLF 1SFOJ 1D5AA 2P81A 3GZNB 4L8RB 2ISYA 3CD6N 1RABB 4D7NA 4DBFA 4HDVA 2TDXA 3VQ4A 4K8XA 3EETA 3HVRA 2L3DA 3CCMN 4K42A 2ZGWA 1ZBJA 1XNIA 4PLIA 5JR3A 4X1EA 1UGQB 2IS3A 3LSKA 3GVAA 3RPQA 2K2MA 4F3TA 3C18A 3CWSA 4NCBA 2IGKA 4BI3A 3RPUA 2DA4A 4ZTJA 1IRXA 2K5CA 2VOOA 1ZC6A 5F0HA 2VODA 2M9UA 3LP3A 2F8SA 5D8KB 3VDXA 2LDUA 3U3GA 4JYKA 2F4IA 4Z4HA 5KN9A 3HUGB 4F7UF 1HD3A 2EYZA 3U9ZA 2K5LA 1WHJA 3VQ9A 1ZLJA 5ILUA 2AS5F 5FJ8J 5AFUH 2RN8A 4M3TA 2NAZA 3FZKA 3L8BA 5L3GA 4BUGA 1LVAA 2VC8A 1R58A 4B09A 3BG3A 3E6DA 2QSHX 3BDLA 4W5RA 3HSTB 1MW7A 2LREA 5LRRA 2DT6A 2CV0A 3GTLJ 2ZJ2A 2Y31A 2W42A 3EQLF 3C95A 2K9NA 3R8EA 2QBYB 3ATUA 4II1A 2M45A 2ZPIB 1W9HA 3VU3C 1OJLA 1O9SA 4CJWA 3LAMA 4LDWA 4CW7B 1I94K 2QASA 4KISA 4ATOA 3O9UA 3TPQA 1Z77A 3O8MA 4MO5A 4A6DA 3LLRA 3K5MA 2O8DB 4YELA 3EFSA 4OVAA 4FPBA 3M3ZA 2P4TA 5J4VA 1M2VA 2DFFA 2CP3A 3CPWA 1YTUA 1T39A 5DM7F 4MDXA 1UG2A 3K70C 3DLRA 2L3QA 2IA1A 5JVGL 2H56A 4EFHA 4KUMA 3EG1A 1D0YA 1HNIA 2OAWA 1GLFO 3FMRA 3QG1A 5H20A 4LG3A 3F2KA 4YFXF 1WPKA 5J4YA 4GRIA 3VEXA 1VQNQ 1WSUA 3CI5A 4S0HB 3BGRA 2YR2A 4JQFA 4KHNA 1RNHA 2VJIA 4A2UA 1WXBA 2BGCA 5E8GA 2NUTA 4B9QA 3PO3J 1NE8A 2PYLA 1KVBA 1ZRDA 3H6ZA 4GFBA 4BROA 3HOUJ 3OS0A 1ZTRA 3QNOA 2LNBA 4PJMA 3AO5A 3K2AA 2Z2SB 1BYMA 3MXIA 2NOGA 3MEDA 2OTLT 2KRNA 4TV7A 4H0OA 2WSCE 1G2HA 2UUCK 3W2AA 3IDHA 4AIJA 2VGMA 1ONVA 3VOEA 2XASA 2CO5A 1KYZA 2K9LA 2I2LA 4J2EA 3F72A 4WCGA 4PL7A 2MCNA 2M30A 5EC7A 1BJZA 2YJEA 4J5YA 2VXDA 2ZKZA 1XSXA 2FC0A 3E5XA 2MC3A 2QWPA 4GNIA 3V4IA 3O9QA 1HMVA 1R23A 4NC7A 1ZAOA 2RNGA 3MZYA 3K1NA 3QOEA 1V54H 2DD4A 2OZUA 2Q31A 1KSPA 4KFCA 3FHGA 2EFOA 4EMSA 4M77C 1U2VA 3TGNA 2NLUA 4EMKB 2JJ9A 4XTUA 3O5ZA 1AWJA 2OFIA 5ADXH 5FD5A 4N0BA 1GV5A 1D8JA 4EJUA 1QO0D 2KJCA 1RRSA 3BG9A 1R1UA 3CBOA 5HDKA 1JHFA 4A5MA 2B9SA 4NB5A 4DFJA 4Y92A 3IRRA 4DV2K 3CMMA 1FXXA 1M30A 5K5OA 2CH6A 4OB2B 1YITQ 1OPCA 3ZQIA 3REOA 4CF8A 3CM6A 3HUGA 4FJ7A 1HKBA 1R0CB 2EX3A 3GL1A 5CKFA 1NGGA 5ILSA 1BI3A 4G12A 4XLPF 1VQON 2CV2A 1KEAA 3CCLA 4BRFA 1M1FA 1ORKA 3NTKA 1IG8A 5E18F 3WHBA 3BUZB 2XPWA 2IT0A 1ZBSA 3WNHA 3VJPA 2DMUA 4M3DA 2VQCA 1NGNA 5L8RE 1BJAA 1SRLA 5IP6A 2L8DA 4ICLA 1S72T 1W4SA 5BR9A 2NNNA 4B44A 1SG5A 2DA6A 3VPRA 1SAZA 3HFNA 4JKEA 5GJVB 1FY7A 5KPRA 4BC5A 3A1YA 1Q81R 3DAWA 3CCLI 1C1CA 2P51A 1KFSA 2AKLA 1CQTA 1NEBA 4A12A 4IQ4A 4YOVA 4H4KC 2R7OA 3EGXB 2LMJA 3CCMT 4DU3A 1BKBA 1NG6A 3QBWA 3H0HA 3N4MA 3FRNA 2HYJA 2J05A 1A35A 3OH9A 4B8CA 1K73C 5AQQA 3F8NA 1VSHA 4GY5A 4GV6A 1LQ1A 1IRFA 5IYDJ 2PVGB 3C65A 4PCQA 3ASOH 2PU9B 2BVMA 3A0BC 1I39A 5M1KA 3O08A 3O3GA 2L4AA 2ZSIB 1XMAA 3CESA 3WTYC 1GHCA 4CK1A 1PG5B 2EQIA 3ML6A 2NRXA 2BGGA 1YW7A 1TSFA 2ZGZA 1PYVA 1XQPA 2P1JA 1OCPA 3CMEA 1CZ9A 2OQRA 4FK2A 2RJDA 4CGJA 5AQNA 4YOXA 1FSEA 1W5SA 3LH0A 1S5JA 1P7MA 5M1FA 2RHUA 3ZT0A 2CU7A 4W5NA 1X27A 4A4GA 2GX9A 4FL6A 1MH3A 1J5OA 1K7AA 4M78E 1LB2A 5LJ3g 1C0UA 1D4XA 3IWZA 1F36A 1XMKA 4GYGA 2V1UA 4ZNXA 5C6SA 4BACA 2VVKA 2DX1A 3IHOA 3H08A 2RNAA 4BB7A 1I3QJ 2JK3A 5FFXA 2OTJA 1BBYA 5JHFA 2HNIA 1YN8A 1IH7A 2NRRA 1OYYA 5HBMA 5JVHL 3PIPA 3AG3H 5J2MA 5EYRA 2ECCA 4CO8A 4XK4A 1RBTA 4C23A 4LIUA 4U0YA 4QVDA 4CECA 4DQPA 4QPOA 4EV0A 2KZMA 1IAWA 1LFUP 3OL3A 4CZIA 4OFEA 2C0TA 1MJAA 2OPRA 3OYLA 2WAQA 3CJ7A 4CHPA 1IUFA 2XVCA 3HHGA 4QWQA 1W2BP 2DA2A 2BBYA 3CCQQ 4E0DA 4DB3A 1M1KO 2JM8A 4M7AC 3M1EA 3E6BA 1NGEA 4CGDA 3KZBA 4NOYA 2Y90A 3EHRA 5IN1A 4LH4A 1FMVA 2YKMA 3QHSA 1SKSA 5AR0A 3M8QA 4YFKF 3G6EQ 2CZ7B 3V8LA 4AMCA 4Y91A 1RAAB 4DKWA 1T8EA 1FX7A 2AQFA 2MA3A 4BI4A 2ZJQL 3HZ6A 3NARA 3W6KB 4C5HA 2ATCB 1D0ZA 4LJZF 4D6WA 1WJSA 1Z91A 3UF4A 4E89A 4O5VA 3D2EA 4QIWN 1MUDA 1X2MA 1YE9A 1WHGA 4WQ4C 1YQAA 5AQJA 1SFUA 4BJ5C 3PIPF 2V79A 2I10A 4CJUA 4M77G 2A28A 4IURA 3LQRA 2RF2A 3UWNA 2MPXC 2ZPFB 2P9IB 5GANg 2FRYA 1Q82R 2GELA 1WZ2A 1X9JA 2AZVA 4JJNK 4FVUA 3OYMA 1Q81C 1AA7A 2QCOA 4DIQA 4KHPK 4KRFA 2G3RA 4NLBA 4AF1A 2G8FA 3M3YJ 4PIIA 1Q86O 4JLGA 3IAM2 1SD5A 1S29A 1FN7A 4Y3OA 3EL2A 1TC3C 3CC7A 2I7PA 3C1DA 3VQPA 1X3ZB 1XB4A 1GBRA 5EZGA 2H09A 3I9QA 3CCUA 4EM1A 2GF7A 1XTDA 1XG1A 2IGNA 4J19A 4XTYA 1A5JA 3SDGA 3EUAA 3CD6A 3IC7A 1Q1VA 3PJRA 3DYAA 2CW0F 1B72B 4CJTA 1RDWX 1BC7C 1Y97A 4DYRA 4JK7A 2O8CB 4JKHA 2R0QC 1LPQA 4CZEA 3IAS2 3EH1A 2V52B 4EJOA 4DLGA 1N6AA 3CCUI 4CF1A 1S22A 3J81Z 4A6EA 4RCCA 3ENBA 2XICA 4M3XA 1OH5A 1R77A 3RIRA 1HYVA 1X2NA 3CD6I 1HU0A 2K2VA 3GFJA 1F1BB 3V9UA 2LTPA 3OSGA 2XU8A 3DLMA 5JLWA 4DOVA 3BR0A 1Y8RB 4C8LA 1N32K 1MNDA 2I8DA 2FBHA 5EZHA 3BG6A 2M4GA 2RE2A 3DM2A 3VN5A 4A53A 4CDGA 3KP7A 4R0KA 4C3JJ 4B08A 4FLXA 3SUPA 2IIRA 2QM1A 4KNYA 2HYGD 3TAPA 4QQ6A 5IHIA 4DCHA 4FETA 2PG4A 2MH9A 3PX6A 1T08B 1QVPA 4IOAL 4NC8A 3FXLA 3M4OJ 1VQ5N 1QP3A 5K5RA 5FLXE 1WFXA 4KB0A 3IHUA 2QWQA 3C7NB 4DGWB 1TT5B 5K5QA 2DBKA 1RT3A 3HTRA 4RB3C 1S6QA 1WAJA 5AQVA 3LAPA 2CW8A 4O8KA 2ZJRL 3CWUA 5GAOr 5LMNK 5HLIA 5IT9Z 3D1NI 1KJWA 5M1OA 2VGNA 1XOVA 4O4GA 3JSPA 1AZEA 3K2PA 2YCHA 4E9EA 5AONA 3QEIA 2ZB9A 3MAJA 3CMEQ 1SC7A 3LDNA 2QKBA 3V9XA 3WXLA 3FZLA 4RBOA 5GTIC 3UE5A 5JLFA 2UWMA 4DF4A 2P4WA 4LD5A 1W36D 3HP6A 2GAUA 3FHZA 3LSHA 1G15A 2CP0A 2DO7A 1SV5A 1J2XA 1QRYA 3DLAA 1W0TA 3W6VA 3PIOL 4B48A 1ZX6A 1HQUA 2DE0X 2O9SA 1ZSZC 1FTTA 3VS3A 2UUZA 4B1VA 3EYZA 4I9LA 5HDNA 1HW5A 1HPZA 5HROA 2FXAA 2ED0A 2W7NA 1X58A 3PIOA 2ME6A 1RL2A 3QZ5B 3PUFA 3ZQ7A 2IP2A 3HKSA 3SJMA 4FT8A 1NK8A 1VSMA 1IDYA 4A57A 1RT6A 3HZJA 1JLGA 1GLEG 3VQ6A 1ITYA 1F5TA 4CZMA 1Q82C 3T1AA 2HOAA 3DP7A 2X3XD 3PNVA 2XD0A 1T0FC 5EGOB 3LFUA 1NOZA 2OTLQ 4F7UE 1P2FA 2DDBA 3KX2A 1ASUA 5IOYA 3CCET 1IZ6A 2ITGA 1VSJA 1XNRK 4NL3A 2V6EA 2QKKA 3HPGA 2KRHA 2D9TA 1JJ2S 1B72A 3IH7A 1P90A 2JHJA 2QTXA 1TTHB 2KMTA 1EP4A 4Q0BA 2FBIA 1ZBHA 3OA9A 2Q2EB 4ELVA 4Z0UA 4DUYK 4ZZDA 3AVCA 5TJJA 2FEIA 3HOYJ 1KFZA 1LWEA 4CC7A 3P39A 3RVCA 1VFCA 1R49A 1L3TA 1W70A 2E19A 3A8OB 1KVAA 2O3FA 1RDCA 1G6NA 3URGA 5K1YA 1YX3A 3QBYA 3RNJA 2FBKA 4DQSA 4DNCA 3IG1A 1DKGD 1HW1A 1RAFB 1K8AU 4LUDA 4F52A 3VQCA 2F6CA 1M8VA 5IT3A 2KRFA 2EQKA 3G3ZA 1S7AA 1TKDA 3KFWX 3BOQA 4FIBA 2A08A 3TSWA 4J9FA 1VQOA 4HQEA 2G7HA 3A5MC 2XY6A 1TNSA 4M7AE 3QYBA 3FFKB 1X01A 2ZF5O 1PUEE 2KKOA 4LDVA 2OD5A 2O6GE 1X2QA 1J7KA 2Y9YA 4CESA 2EW3A 4LC9B 4DS4A 1B8IB 1JCEA 4DV1K 1TK0A 4OIOF 3NF6A 4M77A 1HXDA 1SHGA 3KNTA 5DDGA 2EZLA 4DR1K 1J59A 4JUVA 1YTYA 5LJ5g 4Z4FA 1WBBA 1S72Q 1L3VA 1HPMA 1IREB 1HA8A 2H94A 3TL4X 1AT1B 1I6HJ 3OIPA 3MN9A 2ZC2A 3QQAA 1RUOA 3M5RA 1VQKN 1FIAA 5GANe 4PFZA 1BA0A 1VQ6A 4CZHA 2YNHA 4XLNF 2E6MA 4YOQA 2DJQA 3VS6A 1YO5C 4KHUA 2XI9A