1NGNA

Mismatch repair in methylated dna. structure of the mismatch-specific thymine glycosylase domain of methyl-cpg-binding protein mbd4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
144
structure length
144
Chain Sequence
KWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords methyl-CpG binding protein MBD4
publication title Mismatch repair in methylated DNA. Structure and activity of the mismatch-specific thymine glycosylase domain of methyl-CpG-binding protein MBD4
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 51
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1ngnA00
1HU0A 4EA5A 4OFAA 5CHZA 3FHFA 1FN7A 1NGNA 1YQKA 4PIIA 1EBMA 1PU8A 2NOIA 1P59A 3N0UA 1N3CA 3CVTA 1VRLA 1MPGA 2OFKA 4EJZA 1XQOA 4EW4A 5DPKA 2JHNA 3I0XA 4E9HA 2JHJA 4OFHA 2NOBA 3CWAA 1N39A 4EJYA 1PU6A 2JG6A 4B24A 1M3HA 4EA4A 1KG3A 5KN9A 1WEGA 2NOHA 3G0QA 3I0WA 1KQJA 1KEAA 1DIZA 2OFIA 3CWTA 3F0ZA 4B23A 4YPRA 1KG2A 2H56A 1MUNA 1MUYA 1PU7A 1LWYA 3KNTA 3S6IA 3IHOA 5AN4A 4E9FA 3D4VA 1KG4A 1YQLA 2I5WA 4AIAA 1ORPA 1ORNA 1RRQA 3F10A 1NKUA 2XHIA 1MUDA 2NOFA 2YG9A 4AI5A 1LMZA 1M3QA 1N3AA 4YPHA 1XQPA 3CVSA 1YQMA 4OFEA 5KN8A 3OH9A 2NOLA 3FSPA 1KG6A 3CWSA 2NOZA 4EW0A 1LWWA 4B22A 1YQRA 1PVSA 4EVVA 4AI4A 3IH7A 4UOBA 2ABKA 4B21A 4UNFA 4DK9A 1P7MA 4E9GA 3CWUA 1LWVA 1RRSA 2YG8A 1KO9A 1XG7A 1WEIA 3CW7A 2NOEA 1WEFA 4HSBA 1KG5A 3KTUA 1KG7A 4YOQA 3OH6A 3OGDA 3FHGA 3N5NX 4E9EA
chains in the Genus database with same CATH superfamily
1HU0A 4EA5A 4OFAA 4IKFA 5CHZA 3FHFA 4BACA 1FN7A 1NGNA 4BE0A 4BE2A 4BDZA 1YQKA 4PIIA 3OS0A 3NNQA 1EBMA 3L2RA 1PU8A 3OYKA 3S3OA 2NOIA 1P59A 3N0UA 1N3CA 3CVTA 1VRLA 1MPGA 2OFKA 4EJZA 3OYEA 1XQOA 4EW4A 5DPKA 3OY9A 2JHNA 3I0XA 3OYCA 2JPSA 4E9HA 2JHJA 4OFHA 2NOBA 3OYJA 3CWAA 1N39A 4EJYA 4NZGA 1PU6A 3OYHA 2JG6A 3L2UA 4B24A 1M3HA 4EA4A 3OYLA 1KG3A 5KN9A 3S3MA 1WEGA 2NOHA 2W04A 3G0QA 4BE1A 3I0WA 1KQJA 1KEAA 3OYMA 1DIZA 2OFIA 4ZTJA 3CWTA 3F0ZA 4B23A 4YPRA 1KG2A 2H56A 3OYGA 3VW4A 1MUNA 1MUYA 1PU7A 1LWYA 4E7KA 3OYBA 3KNTA 3S6IA 2V75A 3IHOA 5AN4A 4E9FA 3D4VA 1KG4A 1YQLA 2I5WA 3OYAA 4AIAA 1ORPA 1ORNA 1RRQA 3F10A 4E7JA 1NKUA 2XHIA 1MUDA 4BDYA 2NOFA 2W03A 2YG9A 4AI5A 1LMZA 1M3QA 1N3AA 4YPHA 5FROA 5FRMA 3L2QA 1XQPA 3CVSA 3OYNA 4E7LA 3L2WA 1YQMA 4OFEA 5KN8A 3OH9A 2NOLA 3FSPA 1KG6A 3CWSA 2NOZA 4EW0A 3R2XC 1LWWA 4B22A 1YQRA 1PVSA 4EVVA 5FRNA 4AI4A 3IH7A 4UOBA 1U84A 2ABKA 3OS2A 4B21A 4UNFA 4DK9A 1P7MA 4E9GA 3CWUA 1LWVA 1RRSA 3LCNA 2YG8A 1KO9A 1XG7A 3OYIA 1WEIA 3OYFA 3CW7A 2NOEA 1WEFA 3OYDA 4ZTFA 4HSBA 4E7IA 1KG5A 3KTUA 1KG7A 4YOQA 3OH6A 3OGDA 3FHGA 3L2VA 3S3NA 3N5NX 3OS1A 4E7HA 4E9EA
chains in the Genus database with same CATH topology
1HU0A 4EA5A 4OFAA 5CHZA 3FHFA 1FN7A 1NGNA 1YQKA 4PIIA 1EBMA 1PU8A 2NOIA 1P59A 3N0UA 1N3CA 3CVTA 1VRLA 1MPGA 2OFKA 4EJZA 1XQOA 4EW4A 5DPKA 2JHNA 3I0XA 4E9HA 2JHJA 4OFHA 2NOBA 3CWAA 1N39A 4EJYA 1PU6A 2JG6A 4B24A 1M3HA 4EA4A 1KG3A 5KN9A 1WEGA 2NOHA 3G0QA 3I0WA 1KQJA 1KEAA 1DIZA 2OFIA 3CWTA 3F0ZA 4B23A 4YPRA 1KG2A 2H56A 1MUNA 1MUYA 1PU7A 1LWYA 3KNTA 3S6IA 3IHOA 5AN4A 4E9FA 3D4VA 1KG4A 1YQLA 2I5WA 4AIAA 1ORPA 1ORNA 1RRQA 3F10A 1NKUA 2XHIA 1MUDA 2NOFA 2YG9A 4AI5A 1LMZA 1M3QA 1N3AA 4YPHA 1XQPA 3CVSA 1YQMA 4OFEA 5KN8A 3OH9A 2NOLA 3FSPA 1KG6A 3CWSA 2NOZA 4EW0A 1LWWA 4B22A 1YQRA 1PVSA 4EVVA 4AI4A 3IH7A 4UOBA 2ABKA 4B21A 4UNFA 4DK9A 1P7MA 4E9GA 3CWUA 1LWVA 1RRSA 2YG8A 1KO9A 1XG7A 1WEIA 3CW7A 2NOEA 1WEFA 4HSBA 1KG5A 3KTUA 1KG7A 4YOQA 3OH6A 3OGDA 3FHGA 3N5NX 4E9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HU0 A;  4EA5 A;  4OFA A;  5CHZ A;  3FHF A;  1FN7 A;  1NGN A;  1YQK A;  4PII A;  1EBM A;  1PU8 A;  2NOI A;  1P59 A;  3N0U A;  1N3C A;  3CVT A;  1VRL A;  1MPG A;  2OFK A;  4EJZ A;  1XQO A;  4EW4 A;  5DPK A;  2JHN A;  3I0X A;  4E9H A;  2JHJ A;  4OFH A;  2NOB A;  3CWA A;  1N39 A;  4EJY A;  1PU6 A;  2JG6 A;  4B24 A;  1M3H A;  4EA4 A;  1KG3 A;  5KN9 A;  1WEG A;  2NOH A;  3G0Q A;  3I0W A;  1KQJ A;  1KEA A;  1DIZ A;  2OFI A;  3CWT A;  3F0Z A;  4B23 A;  4YPR A;  1KG2 A;  2H56 A;  1MUN A;  1MUY A;  1PU7 A;  1LWY A;  3KNT A;  3S6I A;  3IHO A;  5AN4 A;  4E9F A;  3D4V A;  1KG4 A;  1YQL A;  2I5W A;  4AIA A;  1ORP A;  1ORN A;  1RRQ A;  3F10 A;  1NKU A;  2XHI A;  1MUD A;  2NOF A;  2YG9 A;  4AI5 A;  1LMZ A;  1M3Q A;  1N3A A;  4YPH A;  1XQP A;  3CVS A;  1YQM A;  4OFE A;  5KN8 A;  3OH9 A;  2NOL A;  3FSP A;  1KG6 A;  3CWS A;  2NOZ A;  4EW0 A;  1LWW A;  4B22 A;  1YQR A;  1PVS A;  4EVV A;  4AI4 A;  3IH7 A;  4UOB A;  2ABK A;  4B21 A;  4UNF A;  4DK9 A;  1P7M A;  4E9G A;  3CWU A;  1LWV A;  1RRS A;  2YG8 A;  1KO9 A;  1XG7 A;  1WEI A;  3CW7 A;  2NOE A;  1WEF A;  4HSB A;  1KG5 A;  3KTU A;  1KG7 A;  4YOQ A;  3OH6 A;  3OGD A;  3FHG A;  3N5N X;  4E9E A; 
#chains in the Genus database with same CATH topology
 1HU0 A;  4EA5 A;  4OFA A;  4IKF A;  5CHZ A;  3FHF A;  4BAC A;  1FN7 A;  1NGN A;  4BE0 A;  4BE2 A;  4BDZ A;  1YQK A;  4PII A;  3OS0 A;  3NNQ A;  1EBM A;  3L2R A;  1PU8 A;  3OYK A;  3S3O A;  2NOI A;  1P59 A;  3N0U A;  1N3C A;  3CVT A;  1VRL A;  1MPG A;  2OFK A;  4EJZ A;  3OYE A;  1XQO A;  4EW4 A;  5DPK A;  3OY9 A;  2JHN A;  3I0X A;  3OYC A;  2JPS A;  4E9H A;  2JHJ A;  4OFH A;  2NOB A;  3OYJ A;  3CWA A;  1N39 A;  4EJY A;  4NZG A;  1PU6 A;  3OYH A;  2JG6 A;  3L2U A;  4B24 A;  1M3H A;  4EA4 A;  3OYL A;  1KG3 A;  5KN9 A;  3S3M A;  1WEG A;  2NOH A;  2W04 A;  3G0Q A;  4BE1 A;  3I0W A;  1KQJ A;  1KEA A;  3OYM A;  1DIZ A;  2OFI A;  4ZTJ A;  3CWT A;  3F0Z A;  4B23 A;  4YPR A;  1KG2 A;  2H56 A;  3OYG A;  3VW4 A;  1MUN A;  1MUY A;  1PU7 A;  1LWY A;  4E7K A;  3OYB A;  3KNT A;  3S6I A;  2V75 A;  3IHO A;  5AN4 A;  4E9F A;  3D4V A;  1KG4 A;  1YQL A;  2I5W A;  3OYA A;  4AIA A;  1ORP A;  1ORN A;  1RRQ A;  3F10 A;  4E7J A;  1NKU A;  2XHI A;  1MUD A;  4BDY A;  2NOF A;  2W03 A;  2YG9 A;  4AI5 A;  1LMZ A;  1M3Q A;  1N3A A;  4YPH A;  5FRO A;  5FRM A;  3L2Q A;  1XQP A;  3CVS A;  3OYN A;  4E7L A;  3L2W A;  1YQM A;  4OFE A;  5KN8 A;  3OH9 A;  2NOL A;  3FSP A;  1KG6 A;  3CWS A;  2NOZ A;  4EW0 A;  3R2X C;  1LWW A;  4B22 A;  1YQR A;  1PVS A;  4EVV A;  5FRN A;  4AI4 A;  3IH7 A;  4UOB A;  1U84 A;  2ABK A;  3OS2 A;  4B21 A;  4UNF A;  4DK9 A;  1P7M A;  4E9G A;  3CWU A;  1LWV A;  1RRS A;  3LCN A;  2YG8 A;  1KO9 A;  1XG7 A;  3OYI A;  1WEI A;  3OYF A;  3CW7 A;  2NOE A;  1WEF A;  3OYD A;  4ZTF A;  4HSB A;  4E7I A;  1KG5 A;  3KTU A;  1KG7 A;  4YOQ A;  3OH6 A;  3OGD A;  3FHG A;  3L2V A;  3S3N A;  3N5N X;  3OS1 A;  4E7H A;  4E9E A; 
#chains in the Genus database with same CATH homology
 1HU0 A;  4EA5 A;  4OFA A;  5CHZ A;  3FHF A;  1FN7 A;  1NGN A;  1YQK A;  4PII A;  1EBM A;  1PU8 A;  2NOI A;  1P59 A;  3N0U A;  1N3C A;  3CVT A;  1VRL A;  1MPG A;  2OFK A;  4EJZ A;  1XQO A;  4EW4 A;  5DPK A;  2JHN A;  3I0X A;  4E9H A;  2JHJ A;  4OFH A;  2NOB A;  3CWA A;  1N39 A;  4EJY A;  1PU6 A;  2JG6 A;  4B24 A;  1M3H A;  4EA4 A;  1KG3 A;  5KN9 A;  1WEG A;  2NOH A;  3G0Q A;  3I0W A;  1KQJ A;  1KEA A;  1DIZ A;  2OFI A;  3CWT A;  3F0Z A;  4B23 A;  4YPR A;  1KG2 A;  2H56 A;  1MUN A;  1MUY A;  1PU7 A;  1LWY A;  3KNT A;  3S6I A;  3IHO A;  5AN4 A;  4E9F A;  3D4V A;  1KG4 A;  1YQL A;  2I5W A;  4AIA A;  1ORP A;  1ORN A;  1RRQ A;  3F10 A;  1NKU A;  2XHI A;  1MUD A;  2NOF A;  2YG9 A;  4AI5 A;  1LMZ A;  1M3Q A;  1N3A A;  4YPH A;  1XQP A;  3CVS A;  1YQM A;  4OFE A;  5KN8 A;  3OH9 A;  2NOL A;  3FSP A;  1KG6 A;  3CWS A;  2NOZ A;  4EW0 A;  1LWW A;  4B22 A;  1YQR A;  1PVS A;  4EVV A;  4AI4 A;  3IH7 A;  4UOB A;  2ABK A;  4B21 A;  4UNF A;  4DK9 A;  1P7M A;  4E9G A;  3CWU A;  1LWV A;  1RRS A;  2YG8 A;  1KO9 A;  1XG7 A;  1WEI A;  3CW7 A;  2NOE A;  1WEF A;  4HSB A;  1KG5 A;  3KTU A;  1KG7 A;  4YOQ A;  3OH6 A;  3OGD A;  3FHG A;  3N5N X;  4E9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...