1NGNA

Mismatch repair in methylated dna. structure of the mismatch-specific thymine glycosylase domain of methyl-cpg-binding protein mbd4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
144
structure length
144
Chain Sequence
KWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords methyl-CpG binding protein MBD4
publication title Mismatch repair in methylated DNA. Structure and activity of the mismatch-specific thymine glycosylase domain of methyl-CpG-binding protein MBD4
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1ngnA00
1LWVA 3F0ZA 3CVSA 1EBMA 3N0UA 1VRLA 1WEFA 1YQRA 2YG9A 1KEAA 2OFKA 1MUYA 1NGNA 2ABKA 1MUDA 4EA4A 3CVTA 1KG3A 1KG2A 3CWAA 4EVVA 4EJZA 3D4VA 2XHIA 4AI5A 1FN7A 1KG4A 2JHNA 5AN4A 2NOIA 3KTUA 4UOBA 4YOQA 3IHOA 1LWWA 2OFIA 1LMZA 1KO9A 2NOBA 3N5NX 1PU7A 2NOZA 1YQLA 3CWUA 1KG7A 1ORPA 1WEIA 2I5WA 3CWSA 4EJYA 4EW4A 2NOHA 1RRQA 1DIZA 4AI4A 4B21A 2JHJA 1M3QA 4YPRA 1NKUA 4HSBA 4EA5A 3G0QA 1PVSA 3I0XA 1N39A 2NOEA 1MUNA 2JG6A 3CWTA 5KN8A 4E9EA 2NOLA 1N3CA 1YQKA 5KN9A 5DPKA 3S6IA 1KG5A 1MPGA 1XQPA 4E9HA 1P59A 3FSPA 3KNTA 3IH7A 1LWYA 5CHZA 4B24A 1PU6A 4E9FA 1N3AA 4UNFA 4B22A 4B23A 1P7MA 3I0WA 2YG8A 2H56A 4PIIA 1M3HA 1RRSA 1XQOA 1KQJA 1YQMA 3OGDA 4OFHA 1XG7A 3FHFA 1WEGA 4EW0A 3OH9A 2NOFA 4OFAA 1HU0A 3OH6A 4E9GA 4AIAA 4OFEA 4YPHA 1KG6A 3F10A 3CW7A 3FHGA 1PU8A 1ORNA 4DK9A
chains in the Genus database with same CATH superfamily
4E7HA 3OYAA 1LWVA 3F0ZA 4BE1A 3CVSA 1EBMA 3N0UA 1VRLA 1WEFA 1YQRA 2YG9A 4E7JA 1KEAA 2OFKA 1MUYA 1NGNA 2ABKA 3OYGA 3OYDA 1MUDA 4EA4A 2W04A 3CVTA 1KG3A 1KG2A 3CWAA 4EVVA 4EJZA 3D4VA 2XHIA 4AI5A 1FN7A 1KG4A 2JHNA 5AN4A 2NOIA 3S3NA 3KTUA 4UOBA 4YOQA 3IHOA 3OYBA 5FRNA 4NZGA 3OYHA 1LWWA 2OFIA 1LMZA 1KO9A 3OS2A 3OYCA 2NOBA 3N5NX 1PU7A 3OYKA 3OYLA 2NOZA 1YQLA 3CWUA 1KG7A 3S3OA 1ORPA 1WEIA 3OYJA 3R2XC 2I5WA 3CWSA 4EJYA 4EW4A 2NOHA 1RRQA 3L2UA 1DIZA 4AI4A 3OS1A 5FROA 4B21A 4E7KA 3L2RA 2JHJA 4BACA 1M3QA 4YPRA 1NKUA 4HSBA 4EA5A 3G0QA 1PVSA 3I0XA 3VW4A 2JPSA 1N39A 2NOEA 1MUNA 4BDZA 2JG6A 3S3MA 3NNQA 3OYIA 3CWTA 4BE2A 5KN8A 4E9EA 3OYEA 2NOLA 5FRMA 1N3CA 1YQKA 5KN9A 3OYFA 5DPKA 3S6IA 3L2WA 1KG5A 1MPGA 1XQPA 4E9HA 1P59A 3FSPA 3KNTA 3IH7A 4ZTJA 1LWYA 5CHZA 4ZTFA 4B24A 3OS0A 1PU6A 4E9FA 1N3AA 4UNFA 4B22A 4B23A 1P7MA 3I0WA 2YG8A 2H56A 4PIIA 2W03A 1M3HA 2V75A 1RRSA 1XQOA 3OY9A 3OYNA 1KQJA 1YQMA 3OGDA 4OFHA 4BDYA 4E7IA 3L2VA 4BE0A 1XG7A 3FHFA 3OYMA 1WEGA 3LCNA 4EW0A 3L2QA 4IKFA 3OH9A 2NOFA 4OFAA 1HU0A 3OH6A 4E9GA 1U84A 4AIAA 4OFEA 4E7LA 4YPHA 1KG6A 3F10A 3CW7A 3FHGA 1PU8A 1ORNA 4DK9A
chains in the Genus database with same CATH topology
1LWVA 3F0ZA 3CVSA 1EBMA 3N0UA 1VRLA 1WEFA 1YQRA 2YG9A 1KEAA 2OFKA 1MUYA 1NGNA 2ABKA 1MUDA 4EA4A 3CVTA 1KG3A 1KG2A 3CWAA 4EVVA 4EJZA 3D4VA 2XHIA 4AI5A 1FN7A 1KG4A 2JHNA 5AN4A 2NOIA 3KTUA 4UOBA 4YOQA 3IHOA 1LWWA 2OFIA 1LMZA 1KO9A 2NOBA 3N5NX 1PU7A 2NOZA 1YQLA 3CWUA 1KG7A 1ORPA 1WEIA 2I5WA 3CWSA 4EJYA 4EW4A 2NOHA 1RRQA 1DIZA 4AI4A 4B21A 2JHJA 1M3QA 4YPRA 1NKUA 4HSBA 4EA5A 3G0QA 1PVSA 3I0XA 1N39A 2NOEA 1MUNA 2JG6A 3CWTA 5KN8A 4E9EA 2NOLA 1N3CA 1YQKA 5KN9A 5DPKA 3S6IA 1KG5A 1MPGA 1XQPA 4E9HA 1P59A 3FSPA 3KNTA 3IH7A 1LWYA 5CHZA 4B24A 1PU6A 4E9FA 1N3AA 4UNFA 4B22A 4B23A 1P7MA 3I0WA 2YG8A 2H56A 4PIIA 1M3HA 1RRSA 1XQOA 1KQJA 1YQMA 3OGDA 4OFHA 1XG7A 3FHFA 1WEGA 4EW0A 3OH9A 2NOFA 4OFAA 1HU0A 3OH6A 4E9GA 4AIAA 4OFEA 4YPHA 1KG6A 3F10A 3CW7A 3FHGA 1PU8A 1ORNA 4DK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWV A;  3F0Z A;  3CVS A;  1EBM A;  3N0U A;  1VRL A;  1WEF A;  1YQR A;  2YG9 A;  1KEA A;  2OFK A;  1MUY A;  1NGN A;  2ABK A;  1MUD A;  4EA4 A;  3CVT A;  1KG3 A;  1KG2 A;  3CWA A;  4EVV A;  4EJZ A;  3D4V A;  2XHI A;  4AI5 A;  1FN7 A;  1KG4 A;  2JHN A;  5AN4 A;  2NOI A;  3KTU A;  4UOB A;  4YOQ A;  3IHO A;  1LWW A;  2OFI A;  1LMZ A;  1KO9 A;  2NOB A;  3N5N X;  1PU7 A;  2NOZ A;  1YQL A;  3CWU A;  1KG7 A;  1ORP A;  1WEI A;  2I5W A;  3CWS A;  4EJY A;  4EW4 A;  2NOH A;  1RRQ A;  1DIZ A;  4AI4 A;  4B21 A;  2JHJ A;  1M3Q A;  4YPR A;  1NKU A;  4HSB A;  4EA5 A;  3G0Q A;  1PVS A;  3I0X A;  1N39 A;  2NOE A;  1MUN A;  2JG6 A;  3CWT A;  5KN8 A;  4E9E A;  2NOL A;  1N3C A;  1YQK A;  5KN9 A;  5DPK A;  3S6I A;  1KG5 A;  1MPG A;  1XQP A;  4E9H A;  1P59 A;  3FSP A;  3KNT A;  3IH7 A;  1LWY A;  5CHZ A;  4B24 A;  1PU6 A;  4E9F A;  1N3A A;  4UNF A;  4B22 A;  4B23 A;  1P7M A;  3I0W A;  2YG8 A;  2H56 A;  4PII A;  1M3H A;  1RRS A;  1XQO A;  1KQJ A;  1YQM A;  3OGD A;  4OFH A;  1XG7 A;  3FHF A;  1WEG A;  4EW0 A;  3OH9 A;  2NOF A;  4OFA A;  1HU0 A;  3OH6 A;  4E9G A;  4AIA A;  4OFE A;  4YPH A;  1KG6 A;  3F10 A;  3CW7 A;  3FHG A;  1PU8 A;  1ORN A;  4DK9 A; 
#chains in the Genus database with same CATH topology
 4E7H A;  3OYA A;  1LWV A;  3F0Z A;  4BE1 A;  3CVS A;  1EBM A;  3N0U A;  1VRL A;  1WEF A;  1YQR A;  2YG9 A;  4E7J A;  1KEA A;  2OFK A;  1MUY A;  1NGN A;  2ABK A;  3OYG A;  3OYD A;  1MUD A;  4EA4 A;  2W04 A;  3CVT A;  1KG3 A;  1KG2 A;  3CWA A;  4EVV A;  4EJZ A;  3D4V A;  2XHI A;  4AI5 A;  1FN7 A;  1KG4 A;  2JHN A;  5AN4 A;  2NOI A;  3S3N A;  3KTU A;  4UOB A;  4YOQ A;  3IHO A;  3OYB A;  5FRN A;  4NZG A;  3OYH A;  1LWW A;  2OFI A;  1LMZ A;  1KO9 A;  3OS2 A;  3OYC A;  2NOB A;  3N5N X;  1PU7 A;  3OYK A;  3OYL A;  2NOZ A;  1YQL A;  3CWU A;  1KG7 A;  3S3O A;  1ORP A;  1WEI A;  3OYJ A;  3R2X C;  2I5W A;  3CWS A;  4EJY A;  4EW4 A;  2NOH A;  1RRQ A;  3L2U A;  1DIZ A;  4AI4 A;  3OS1 A;  5FRO A;  4B21 A;  4E7K A;  3L2R A;  2JHJ A;  4BAC A;  1M3Q A;  4YPR A;  1NKU A;  4HSB A;  4EA5 A;  3G0Q A;  1PVS A;  3I0X A;  3VW4 A;  2JPS A;  1N39 A;  2NOE A;  1MUN A;  4BDZ A;  2JG6 A;  3S3M A;  3NNQ A;  3OYI A;  3CWT A;  4BE2 A;  5KN8 A;  4E9E A;  3OYE A;  2NOL A;  5FRM A;  1N3C A;  1YQK A;  5KN9 A;  3OYF A;  5DPK A;  3S6I A;  3L2W A;  1KG5 A;  1MPG A;  1XQP A;  4E9H A;  1P59 A;  3FSP A;  3KNT A;  3IH7 A;  4ZTJ A;  1LWY A;  5CHZ A;  4ZTF A;  4B24 A;  3OS0 A;  1PU6 A;  4E9F A;  1N3A A;  4UNF A;  4B22 A;  4B23 A;  1P7M A;  3I0W A;  2YG8 A;  2H56 A;  4PII A;  2W03 A;  1M3H A;  2V75 A;  1RRS A;  1XQO A;  3OY9 A;  3OYN A;  1KQJ A;  1YQM A;  3OGD A;  4OFH A;  4BDY A;  4E7I A;  3L2V A;  4BE0 A;  1XG7 A;  3FHF A;  3OYM A;  1WEG A;  3LCN A;  4EW0 A;  3L2Q A;  4IKF A;  3OH9 A;  2NOF A;  4OFA A;  1HU0 A;  3OH6 A;  4E9G A;  1U84 A;  4AIA A;  4OFE A;  4E7L A;  4YPH A;  1KG6 A;  3F10 A;  3CW7 A;  3FHG A;  1PU8 A;  1ORN A;  4DK9 A; 
#chains in the Genus database with same CATH homology
 1LWV A;  3F0Z A;  3CVS A;  1EBM A;  3N0U A;  1VRL A;  1WEF A;  1YQR A;  2YG9 A;  1KEA A;  2OFK A;  1MUY A;  1NGN A;  2ABK A;  1MUD A;  4EA4 A;  3CVT A;  1KG3 A;  1KG2 A;  3CWA A;  4EVV A;  4EJZ A;  3D4V A;  2XHI A;  4AI5 A;  1FN7 A;  1KG4 A;  2JHN A;  5AN4 A;  2NOI A;  3KTU A;  4UOB A;  4YOQ A;  3IHO A;  1LWW A;  2OFI A;  1LMZ A;  1KO9 A;  2NOB A;  3N5N X;  1PU7 A;  2NOZ A;  1YQL A;  3CWU A;  1KG7 A;  1ORP A;  1WEI A;  2I5W A;  3CWS A;  4EJY A;  4EW4 A;  2NOH A;  1RRQ A;  1DIZ A;  4AI4 A;  4B21 A;  2JHJ A;  1M3Q A;  4YPR A;  1NKU A;  4HSB A;  4EA5 A;  3G0Q A;  1PVS A;  3I0X A;  1N39 A;  2NOE A;  1MUN A;  2JG6 A;  3CWT A;  5KN8 A;  4E9E A;  2NOL A;  1N3C A;  1YQK A;  5KN9 A;  5DPK A;  3S6I A;  1KG5 A;  1MPG A;  1XQP A;  4E9H A;  1P59 A;  3FSP A;  3KNT A;  3IH7 A;  1LWY A;  5CHZ A;  4B24 A;  1PU6 A;  4E9F A;  1N3A A;  4UNF A;  4B22 A;  4B23 A;  1P7M A;  3I0W A;  2YG8 A;  2H56 A;  4PII A;  1M3H A;  1RRS A;  1XQO A;  1KQJ A;  1YQM A;  3OGD A;  4OFH A;  1XG7 A;  3FHF A;  1WEG A;  4EW0 A;  3OH9 A;  2NOF A;  4OFA A;  1HU0 A;  3OH6 A;  4E9G A;  4AIA A;  4OFE A;  4YPH A;  1KG6 A;  3F10 A;  3CW7 A;  3FHG A;  1PU8 A;  1ORN A;  4DK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...