3R2XC

Crystal structure of the de novo designed binding protein hb36.3 in complex the the 1918 influenza virus hemagglutinin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
DGQQLNRLLLEWIGAWDPFGLGKDAYDVEAEAVLQAVYETESAFDLAMRIMWIYVFAFNRPIPFPHAQKLARRLLELKQAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Computational design of proteins targeting the conserved stem region of influenza hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/de novo protein
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.20 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Apc36109-like domain 3r2xC00
1U84A 3R2XC
chains in the Genus database with same CATH superfamily
2JPSA 5CHZA 1KG5A 1DIZA 3OYBA 3VW4A 3KTUA 3IH7A 4E7HA 1P59A 1LWVA 4BE0A 2JHJA 3OYHA 4EW0A 4PIIA 4E9FA 2NOLA 4EA5A 1NGNA 2ABKA 1WEFA 3L2VA 4B23A 1LMZA 4E9HA 5FROA 4BE1A 1KEAA 2NOHA 2W04A 4EJZA 3OYCA 1N3AA 1MPGA 3OYGA 3OGDA 1WEGA 4E7JA 3OS0A 1YQKA 1LWWA 1ORNA 4BDYA 1WEIA 3G0QA 4E9GA 2V75A 3L2WA 1KO9A 3S3MA 4AI4A 3N0UA 4YPHA 4E7KA 1VRLA 3S3NA 3CW7A 4EW4A 3L2RA 3OYAA 2I5WA 5DPKA 1PU7A 3F10A 5FRMA 4HSBA 3S6IA 4EVVA 3OYIA 3CWTA 3OYNA 4B21A 1HU0A 3I0WA 4AIAA 5KN8A 3KNTA 3S3OA 3OYJA 4B24A 1KG3A 3FHFA 2OFKA 1KQJA 3OY9A 1M3QA 4IKFA 4YPRA 2W03A 3OH9A 3CVTA 4YOQA 5AN4A 2YG8A 3LCNA 4NZGA 1YQLA 5FRNA 5KN9A 1MUYA 1LWYA 1KG4A 3OYFA 4E7LA 1MUDA 3CWAA 4BDZA 1EBMA 4BE2A 4AI5A 1XG7A 3OS2A 3FSPA 4OFEA 3F0ZA 1XQPA 1N39A 4E9EA 3OYKA 2NOZA 3CWSA 3OYDA 1U84A 1PU6A 1PU8A 4OFHA 1M3HA 4EJYA 3I0XA 1YQMA 1P7MA 3CVSA 1RRQA 3IHOA 3OH6A 2JHNA 1PVSA 1KG2A 4DK9A 1MUNA 1KG7A 4B22A 4UNFA 1NKUA 4ZTJA 1FN7A 3OYEA 4EA4A 2H56A 2NOFA 4UOBA 2JG6A 3N5NX 3CWUA 2OFIA 1XQOA 4ZTFA 1YQRA 3FHGA 1ORPA 1KG6A 3L2UA 1N3CA 2XHIA 3OYLA 3D4VA 4BACA 2NOEA 3L2QA 2YG9A 3R2XC 4OFAA 3OYMA 4E7IA 2NOBA 3OS1A 3NNQA 1RRSA 2NOIA
chains in the Genus database with same CATH topology
1U84A 3R2XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U84 A;  3R2X C; 
#chains in the Genus database with same CATH topology
 2JPS A;  5CHZ A;  1KG5 A;  1DIZ A;  3OYB A;  3VW4 A;  3KTU A;  3IH7 A;  4E7H A;  1P59 A;  1LWV A;  4BE0 A;  2JHJ A;  3OYH A;  4EW0 A;  4PII A;  4E9F A;  2NOL A;  4EA5 A;  1NGN A;  2ABK A;  1WEF A;  3L2V A;  4B23 A;  1LMZ A;  4E9H A;  5FRO A;  4BE1 A;  1KEA A;  2NOH A;  2W04 A;  4EJZ A;  3OYC A;  1N3A A;  1MPG A;  3OYG A;  3OGD A;  1WEG A;  4E7J A;  3OS0 A;  1YQK A;  1LWW A;  1ORN A;  4BDY A;  1WEI A;  3G0Q A;  4E9G A;  2V75 A;  3L2W A;  1KO9 A;  3S3M A;  4AI4 A;  3N0U A;  4YPH A;  4E7K A;  1VRL A;  3S3N A;  3CW7 A;  4EW4 A;  3L2R A;  3OYA A;  2I5W A;  5DPK A;  1PU7 A;  3F10 A;  5FRM A;  4HSB A;  3S6I A;  4EVV A;  3OYI A;  3CWT A;  3OYN A;  4B21 A;  1HU0 A;  3I0W A;  4AIA A;  5KN8 A;  3KNT A;  3S3O A;  3OYJ A;  4B24 A;  1KG3 A;  3FHF A;  2OFK A;  1KQJ A;  3OY9 A;  1M3Q A;  4IKF A;  4YPR A;  2W03 A;  3OH9 A;  3CVT A;  4YOQ A;  5AN4 A;  2YG8 A;  3LCN A;  4NZG A;  1YQL A;  5FRN A;  5KN9 A;  1MUY A;  1LWY A;  1KG4 A;  3OYF A;  4E7L A;  1MUD A;  3CWA A;  4BDZ A;  1EBM A;  4BE2 A;  4AI5 A;  1XG7 A;  3OS2 A;  3FSP A;  4OFE A;  3F0Z A;  1XQP A;  1N39 A;  4E9E A;  3OYK A;  2NOZ A;  3CWS A;  3OYD A;  1U84 A;  1PU6 A;  1PU8 A;  4OFH A;  1M3H A;  4EJY A;  3I0X A;  1YQM A;  1P7M A;  3CVS A;  1RRQ A;  3IHO A;  3OH6 A;  2JHN A;  1PVS A;  1KG2 A;  4DK9 A;  1MUN A;  1KG7 A;  4B22 A;  4UNF A;  1NKU A;  4ZTJ A;  1FN7 A;  3OYE A;  4EA4 A;  2H56 A;  2NOF A;  4UOB A;  2JG6 A;  3N5N X;  3CWU A;  2OFI A;  1XQO A;  4ZTF A;  1YQR A;  3FHG A;  1ORP A;  1KG6 A;  3L2U A;  1N3C A;  2XHI A;  3OYL A;  3D4V A;  4BAC A;  2NOE A;  3L2Q A;  2YG9 A;  3R2X C;  4OFA A;  3OYM A;  4E7I A;  2NOB A;  3OS1 A;  3NNQ A;  1RRS A;  2NOI A; 
#chains in the Genus database with same CATH homology
 1U84 A;  3R2X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...