3R2XC

Crystal structure of the de novo designed binding protein hb36.3 in complex the the 1918 influenza virus hemagglutinin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
DGQQLNRLLLEWIGAWDPFGLGKDAYDVEAEAVLQAVYETESAFDLAMRIMWIYVFAFNRPIPFPHAQKLARRLLELKQAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Computational design of proteins targeting the conserved stem region of influenza hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/de novo protein
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.20 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Apc36109-like domain 3r2xC00
1U84A 3R2XC
chains in the Genus database with same CATH superfamily
1P59A 3IHOA 4UOBA 3R2XC 2H56A 1KG7A 4E9FA 4PIIA 1KO9A 4EA4A 3CWAA 4E7HA 1LWYA 1LWWA 3N5NX 1P7MA 4OFHA 5AN4A 3NNQA 3OYLA 1MPGA 1WEIA 4E7JA 3OS1A 1WEGA 3FHFA 3FHGA 4BE1A 5KN9A 4NZGA 3L2WA 1KG2A 4E9GA 3G0QA 1PU7A 2JHNA 3KNTA 3OYAA 4BE0A 3OS0A 1NKUA 4E7KA 1RRQA 5FRMA 1MUDA 4BE2A 1M3HA 1EBMA 2ABKA 3KTUA 5FROA 3OYKA 4EW0A 3OS2A 3OYGA 2NOLA 3OYJA 2JHJA 1PU6A 4UNFA 2YG8A 3L2RA 4AI4A 2OFKA 1ORNA 4EJZA 1KG5A 5CHZA 3OY9A 1MUYA 3S3MA 1HU0A 3OYCA 1NGNA 4YPHA 3S6IA 3OYEA 2XHIA 3CVTA 4DK9A 4EA5A 1U84A 3OH9A 1XQPA 1YQMA 3S3OA 4EJYA 1N39A 3LCNA 3L2UA 4E9HA 3D4VA 2W03A 4B24A 4E7IA 3OYHA 4EVVA 1WEFA 4BDYA 1KG3A 3F0ZA 3OYDA 4OFEA 3F10A 2OFIA 1ORPA 3OYBA 1PU8A 3CVSA 4B23A 3S3NA 3OYMA 4EW4A 1XG7A 3OYFA 2JG6A 1KG6A 2W04A 1KEAA 1LWVA 1PVSA 4AI5A 5DPKA 3OGDA 4B22A 1LMZA 4BACA 2I5WA 3I0XA 1N3AA 4B21A 3L2QA 4ZTFA 3OYNA 3L2VA 1VRLA 2NOFA 2NOIA 4E9EA 5FRNA 4OFAA 1N3CA 2JPSA 3OH6A 1YQRA 3FSPA 3IH7A 2NOEA 4YOQA 1XQOA 4HSBA 3CWSA 4IKFA 4ZTJA 1FN7A 1KQJA 5KN8A 2NOHA 3OYIA 4E7LA 1DIZA 3CW7A 3VW4A 2YG9A 1YQLA 1RRSA 2NOBA 3N0UA 3I0WA 4BDZA 4AIAA 1KG4A 1M3QA 3CWTA 1YQKA 2NOZA 1MUNA 2V75A 4YPRA 3CWUA
chains in the Genus database with same CATH topology
1U84A 3R2XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U84 A;  3R2X C; 
#chains in the Genus database with same CATH topology
 1P59 A;  3IHO A;  4UOB A;  3R2X C;  2H56 A;  1KG7 A;  4E9F A;  4PII A;  1KO9 A;  4EA4 A;  3CWA A;  4E7H A;  1LWY A;  1LWW A;  3N5N X;  1P7M A;  4OFH A;  5AN4 A;  3NNQ A;  3OYL A;  1MPG A;  1WEI A;  4E7J A;  3OS1 A;  1WEG A;  3FHF A;  3FHG A;  4BE1 A;  5KN9 A;  4NZG A;  3L2W A;  1KG2 A;  4E9G A;  3G0Q A;  1PU7 A;  2JHN A;  3KNT A;  3OYA A;  4BE0 A;  3OS0 A;  1NKU A;  4E7K A;  1RRQ A;  5FRM A;  1MUD A;  4BE2 A;  1M3H A;  1EBM A;  2ABK A;  3KTU A;  5FRO A;  3OYK A;  4EW0 A;  3OS2 A;  3OYG A;  2NOL A;  3OYJ A;  2JHJ A;  1PU6 A;  4UNF A;  2YG8 A;  3L2R A;  4AI4 A;  2OFK A;  1ORN A;  4EJZ A;  1KG5 A;  5CHZ A;  3OY9 A;  1MUY A;  3S3M A;  1HU0 A;  3OYC A;  1NGN A;  4YPH A;  3S6I A;  3OYE A;  2XHI A;  3CVT A;  4DK9 A;  4EA5 A;  1U84 A;  3OH9 A;  1XQP A;  1YQM A;  3S3O A;  4EJY A;  1N39 A;  3LCN A;  3L2U A;  4E9H A;  3D4V A;  2W03 A;  4B24 A;  4E7I A;  3OYH A;  4EVV A;  1WEF A;  4BDY A;  1KG3 A;  3F0Z A;  3OYD A;  4OFE A;  3F10 A;  2OFI A;  1ORP A;  3OYB A;  1PU8 A;  3CVS A;  4B23 A;  3S3N A;  3OYM A;  4EW4 A;  1XG7 A;  3OYF A;  2JG6 A;  1KG6 A;  2W04 A;  1KEA A;  1LWV A;  1PVS A;  4AI5 A;  5DPK A;  3OGD A;  4B22 A;  1LMZ A;  4BAC A;  2I5W A;  3I0X A;  1N3A A;  4B21 A;  3L2Q A;  4ZTF A;  3OYN A;  3L2V A;  1VRL A;  2NOF A;  2NOI A;  4E9E A;  5FRN A;  4OFA A;  1N3C A;  2JPS A;  3OH6 A;  1YQR A;  3FSP A;  3IH7 A;  2NOE A;  4YOQ A;  1XQO A;  4HSB A;  3CWS A;  4IKF A;  4ZTJ A;  1FN7 A;  1KQJ A;  5KN8 A;  2NOH A;  3OYI A;  4E7L A;  1DIZ A;  3CW7 A;  3VW4 A;  2YG9 A;  1YQL A;  1RRS A;  2NOB A;  3N0U A;  3I0W A;  4BDZ A;  4AIA A;  1KG4 A;  1M3Q A;  3CWT A;  1YQK A;  2NOZ A;  1MUN A;  2V75 A;  4YPR A;  3CWU A; 
#chains in the Genus database with same CATH homology
 1U84 A;  3R2X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...