3R2XC

Crystal structure of the de novo designed binding protein hb36.3 in complex the the 1918 influenza virus hemagglutinin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
DGQQLNRLLLEWIGAWDPFGLGKDAYDVEAEAVLQAVYETESAFDLAMRIMWIYVFAFNRPIPFPHAQKLARRLLELKQAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/de novo protein
molecule keywords Hemagglutinin
publication title Computational design of proteins targeting the conserved stem region of influenza hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.20 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Apc36109-like domain 3r2xC00
3R2XC 1U84A
chains in the Genus database with same CATH superfamily
1M3HA 4B24A 2YG8A 1XQOA 4YPRA 1KG2A 5KN9A 5FRNA 2V75A 4EW4A 2H56A 4ZTJA 4IKFA 3L2WA 1KQJA 4YPHA 4OFAA 1KG7A 1PU7A 1PU8A 3OYNA 1YQRA 5FRMA 1KG3A 1MUYA 3CVTA 1M3QA 3L2VA 3S3MA 4BE0A 4BDZA 2JPSA 2W04A 4BDYA 1LWWA 1MUDA 1PVSA 3OS1A 3KTUA 3OH6A 3OYLA 3OH9A 1WEIA 3D4VA 2NOEA 4PIIA 1HU0A 4NZGA 5FROA 1KO9A 1YQKA 4B21A 1KG5A 4UOBA 1PU6A 3CWSA 3R2XC 4E7JA 3NNQA 4E9EA 1MUNA 2ABKA 4E7LA 4ZTFA 4E9GA 1KG6A 2JHJA 1NKUA 1FN7A 5CHZA 4AIAA 2JHNA 1DIZA 3OYEA 3N0UA 4E7KA 4BACA 4EJYA 4E9FA 1NGNA 3OYHA 3CWUA 5DPKA 2NOFA 3CVSA 3N5NX 3G0QA 1MPGA 1EBMA 4B23A 1ORNA 3OS2A 2W03A 3FHGA 4B22A 4BE1A 1LMZA 4OFHA 1N39A 4E7HA 3OYKA 3F10A 1WEGA 4E9HA 3S3NA 2NOZA 3LCNA 3S3OA 4OFEA 1KG4A 4HSBA 2NOIA 3L2QA 2XHIA 3OYCA 5KN8A 4EA4A 4EW0A 2NOHA 4AI5A 4E7IA 3CW7A 1N3CA 3IHOA 1P7MA 3OYAA 2JG6A 4EJZA 1YQLA 3OYDA 1XG7A 1LWVA 1ORPA 3F0ZA 4AI4A 1RRQA 3OYFA 3I0WA 3I0XA 4YOQA 3L2RA 2I5WA 1WEFA 3OYGA 2YG9A 3L2UA 1KEAA 4EVVA 2OFIA 1XQPA 4UNFA 2NOBA 4BE2A 3IH7A 3S6IA 3OS0A 1LWYA 3OYBA 3OYMA 3FSPA 5AN4A 3OY9A 3OGDA 3CWTA 4DK9A 3OYIA 1P59A 3KNTA 1YQMA 2NOLA 3CWAA 3OYJA 1RRSA 3FHFA 3VW4A 4EA5A 1N3AA 2OFKA 1U84A 1VRLA
chains in the Genus database with same CATH topology
3R2XC 1U84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2X C;  1U84 A; 
#chains in the Genus database with same CATH topology
 1M3H A;  4B24 A;  2YG8 A;  1XQO A;  4YPR A;  1KG2 A;  5KN9 A;  5FRN A;  2V75 A;  4EW4 A;  2H56 A;  4ZTJ A;  4IKF A;  3L2W A;  1KQJ A;  4YPH A;  4OFA A;  1KG7 A;  1PU7 A;  1PU8 A;  3OYN A;  1YQR A;  5FRM A;  1KG3 A;  1MUY A;  3CVT A;  1M3Q A;  3L2V A;  3S3M A;  4BE0 A;  4BDZ A;  2JPS A;  2W04 A;  4BDY A;  1LWW A;  1MUD A;  1PVS A;  3OS1 A;  3KTU A;  3OH6 A;  3OYL A;  3OH9 A;  1WEI A;  3D4V A;  2NOE A;  4PII A;  1HU0 A;  4NZG A;  5FRO A;  1KO9 A;  1YQK A;  4B21 A;  1KG5 A;  4UOB A;  1PU6 A;  3CWS A;  3R2X C;  4E7J A;  3NNQ A;  4E9E A;  1MUN A;  2ABK A;  4E7L A;  4ZTF A;  4E9G A;  1KG6 A;  2JHJ A;  1NKU A;  1FN7 A;  5CHZ A;  4AIA A;  2JHN A;  1DIZ A;  3OYE A;  3N0U A;  4E7K A;  4BAC A;  4EJY A;  4E9F A;  1NGN A;  3OYH A;  3CWU A;  5DPK A;  2NOF A;  3CVS A;  3N5N X;  3G0Q A;  1MPG A;  1EBM A;  4B23 A;  1ORN A;  3OS2 A;  2W03 A;  3FHG A;  4B22 A;  4BE1 A;  1LMZ A;  4OFH A;  1N39 A;  4E7H A;  3OYK A;  3F10 A;  1WEG A;  4E9H A;  3S3N A;  2NOZ A;  3LCN A;  3S3O A;  4OFE A;  1KG4 A;  4HSB A;  2NOI A;  3L2Q A;  2XHI A;  3OYC A;  5KN8 A;  4EA4 A;  4EW0 A;  2NOH A;  4AI5 A;  4E7I A;  3CW7 A;  1N3C A;  3IHO A;  1P7M A;  3OYA A;  2JG6 A;  4EJZ A;  1YQL A;  3OYD A;  1XG7 A;  1LWV A;  1ORP A;  3F0Z A;  4AI4 A;  1RRQ A;  3OYF A;  3I0W A;  3I0X A;  4YOQ A;  3L2R A;  2I5W A;  1WEF A;  3OYG A;  2YG9 A;  3L2U A;  1KEA A;  4EVV A;  2OFI A;  1XQP A;  4UNF A;  2NOB A;  4BE2 A;  3IH7 A;  3S6I A;  3OS0 A;  1LWY A;  3OYB A;  3OYM A;  3FSP A;  5AN4 A;  3OY9 A;  3OGD A;  3CWT A;  4DK9 A;  3OYI A;  1P59 A;  3KNT A;  1YQM A;  2NOL A;  3CWA A;  3OYJ A;  1RRS A;  3FHF A;  3VW4 A;  4EA5 A;  1N3A A;  2OFK A;  1U84 A;  1VRL A; 
#chains in the Genus database with same CATH homology
 3R2X C;  1U84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...