1MPGA

3-methyladenine dna glycosylase ii from escherichia coli
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3-METHYLADENINE DNA GLYCOSYLASE II
publication title Structural basis for the excision repair of alkylation-damaged DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 1997-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1mpgA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 1mpgA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 1mpgA01
3CW7A 4OFHA 2NOEA 4OFAA 2NOFA 1KQJA 1P7MA 4B22A 1LWWA 1DIZA 1NGNA 4OFEA 3F0ZA 3FHGA 4UNFA 4UOBA 1XG7A 4B21A 1YQLA 1MPGA 3CVSA 3FSPA 4YPRA 4YPHA 5KN9A 1KG7A 2OFIA 1KG3A 4E9EA 3KTUA 1WEGA 1KG2A 1MUNA 1LWYA 2NOBA 5CHZA 3KNTA 4EW0A 1ORPA 1N3AA 2JHJA 4PIIA 5AN4A 3OH6A 1YQRA 3CWTA 4EW4A 2ABKA 1MUYA 2JHNA 1LMZA 5DPKA 2YG8A 1EBMA 1XQPA 1RRSA 1PU6A 2YG9A 3OH9A 1HU0A 1ORNA 3S6IA 2JG6A 2OFKA 4EA5A 4E9FA 5KN8A 1PVSA 3N5NX 1YQKA 1P59A 4EA4A 3IH7A 2NOZA 3G0QA 2I5WA 4AIAA 1VRLA 3IHOA 4AI4A 4DK9A 2XHIA 4YOQA 1KG6A 1KO9A 3CWSA 1M3QA 2NOHA 3F10A 4EJYA 1PU7A 1N39A 3N0UA 1KG4A 4B24A 3D4VA 4AI5A 3I0WA 4HSBA 1RRQA 3OGDA 1XQOA 4E9HA 1LWVA 3CVTA 1YQMA 4EVVA 1NKUA 3I0XA 4B23A 1FN7A 1PU8A 2NOIA 1KG5A 1MUDA 1WEIA 1M3HA 4E9GA 3FHFA 3CWAA 1WEFA 3CWUA 4EJZA 2NOLA 1N3CA 1KEAA 2H56A
chains in the Genus database with same CATH superfamily
1K2YX 2NOEA 1C47A 1T6AA 3R2XC 1KQJA 3OSMA 4B22A 2NWVA 4TPSA 4WXAA 3OYEA 2NVMA 4OFEA 5FRNA 1PCZA 2QREA 3CVSA 3FSPA 1P5GX 3L2UA 2OFIA 2QRCA 1MUNA 1W80A 1LWYA 1E42A 1ORPA 1VTOA 1TGHA 2JHJA 3OYDA 3OH6A 4BE0A 2W03A 3CWTA 4EW4A 1MUYA 4ZTFA 2JHNA 1EBMA 1NVPA 3ASMA 1J3MA 1RRSA 1RM1A 3D7QA 1HU0A 2JG6A 4EA5A 4E9FA 5KN8A 1P59A 4EA4A 4C7PA 2HZMA 3L2WA 3IHOA 5KL0A 1QN3A 4CFFA 1M3QA 3OS0A 4BDYA 2YH5A 3S3NA 3S3OA 1RRQA 1QN7A 1LWVA 3CVTA 1YQMA 2PWWA 5FROA 3OYJA 1M5Q1 1VOLB 1NKUA 3OYBA 3L2RA 3OYKA 1V5SA 1FN7A 1KYFA 2DKDA 4E7IA 4E9GA 3OYMA 3CWAA 3UW2A 3DPTA 3VN5A 2FKMX 2ZFDB 1KEAA 2H5AX 2V8QA 4OFHA 1QNAA 1QNEA 1C9BB 4BACA 3OY9A 4MRQA 3OSEA 4UNFA 4UOBA 1YQLA 1K35A 2IV9A 1MPGA 4YPRA 4E7KA 3ENOC 4NZGA 5KN9A 2QLVA 3OS2A 1KG3A 2DKAA 3HS9A 1EUVA 3KTUA 2Y8LA 1WEGA 4WX8A 2NOBA 5CHZA 1QN9A 4EAIA 1QTPA 1N3AA 5IYBP 5AN4A 2JPSA 5DPKA 3KRMA 3OYIA 2D0AA 1XQPA 1PU6A 2YG9A 1VKLA 1ORNA 2DKCA 3ULXA 1YQKA 2NOZA 4AIAA 3ENCA 2H4LX 1QN6A 2MZ8A 2MJ7A 2H56A 4BE2A 4DULA 2XHIA 5IYCP 3CWSA 4BE1A 3F10A 4BDZA 2EHBD 4IKFA 3N0UA 1MP9A 3C04A 3D4VA 4AI5A 3L2QA 3I0WA 3TDHA 3N89A 5JN5A 1U84A 3OYFA 4E9HA 1KYUA 4EAGA 4EAKA 2FGTA 3EAYA 3RSMA 3OSTA 4B23A 1PU8A 5JMVD 2NOIA 4Q11A 4EALA 4D7RA 3OYHA 1PCMX 2V92A 1TBPA 2NOFA 3PDKA 1P7MA 1PCJX 1DIZA 3F0ZA 3FHGA 3LCNA 4B21A 4IL8A 2HZSA 5IYDP 2LAEA 4YPHA 1QN5A 2HKPA 3OLPA 4E9EA 1YTFA 2Y8QA 1KFIA 1D3UA 1TUOA 3KNTA 4EW0A 5F9CA 3OYCA 3I3WA 4E7JA 1YQRA 2ABKA 2QR1A 1LMZA 1QN4A 3OH9A 3OYLA 2R5XA 3S6IA 1LXTA 2OFKA 2O3OA 3OYNA 3IH7A 4PY5A 1VRLA 3DPUA 4AI4A 4DK9A 3NNQA 1JFIC 3PMGA 4YOQA 1KO9A 2G30A 1PU7A 1N39A 3SNSA 3NA5A 4B24A 2Z0FA 4ZTJA 1KYDA 1XQOA 2D0CA 3RPJA 1VTLE 3T4NA 4EVVA 5FRMA 1AISA 1UT7A 4BJUA 2V75A 4ROEB 2HL8A 4HJHA 1WEIA 2YA3A 1M3HA 4B0AA 1C4GA 1NGMA 4I8OA 3FHFA 1WEFA 3CWUA 1R4XA 4EJZA 2NOLA 1KFQA 5BMNA 1N3CA 1VOKA 1TBAB 3OC3C 3CW7A 5HSHA 4E7HA 4E7LA 1B9KA 1WQAA 4OFAA 1WJWA 1LWWA 1XSZA 5BMPA 3OCIA 1NGNA 1JDYA 1XG7A 2FKFA 1CDWA 3H1ZA 1P5DX 1KG7A 4QG5A 3BKQX 1KG2A 2Z8UA 1QNCA 1QN8A 4PIIA 3VW4A 4WZSD 2JPIA 2FUVA 1QTSA 1UT4A 2YG8A 4ROCB 2OOXA 4D7QA 3OYAA 1QNBA 4RODB 1YTBA 2VJ0A 1PVSA 3HS8A 3N5NX 2F7LA 3G0QA 2I5WA 2D0BA 3TE5A 2IV8A 2HL9A 1KG6A 2NOHA 1PZDA 4EJYA 5EPCA 1KG4A 3EIKA 2QRDA 2W04A 2OOYA 4HSBA 3OGDA 4EAJA 2V9JA 3OYGA 3S3MA 1Q9UA 1NH2A 1KY7A 3L2VA 3I0XA 2JOIA 1KG5A 1MUDA 1KY6A 3OS1A 1UL7A 2NLVA
chains in the Genus database with same CATH topology
3CW7A 4OFHA 2NOEA 4OFAA 2NOFA 1KQJA 1P7MA 4B22A 1LWWA 1DIZA 1NGNA 4OFEA 3F0ZA 3FHGA 4UNFA 4UOBA 1XG7A 4B21A 1YQLA 1MPGA 3CVSA 3FSPA 4YPRA 4YPHA 5KN9A 1KG7A 2OFIA 1KG3A 4E9EA 3KTUA 1WEGA 1KG2A 1MUNA 1LWYA 2NOBA 5CHZA 3KNTA 4EW0A 1ORPA 1N3AA 2JHJA 4PIIA 5AN4A 3OH6A 1YQRA 3CWTA 4EW4A 2ABKA 1MUYA 2JHNA 1LMZA 5DPKA 2YG8A 1EBMA 1XQPA 1RRSA 1PU6A 2YG9A 3OH9A 1HU0A 1ORNA 3S6IA 2JG6A 2OFKA 4EA5A 4E9FA 5KN8A 1PVSA 3N5NX 1YQKA 1P59A 4EA4A 3IH7A 2NOZA 3G0QA 2I5WA 4AIAA 1VRLA 3IHOA 4AI4A 4DK9A 2XHIA 4YOQA 1KG6A 1KO9A 3CWSA 1M3QA 2NOHA 3F10A 4EJYA 1PU7A 1N39A 3N0UA 1KG4A 4B24A 3D4VA 4AI5A 3I0WA 4HSBA 1RRQA 3OGDA 1XQOA 4E9HA 1LWVA 3CVTA 1YQMA 4EVVA 1NKUA 3I0XA 4B23A 1FN7A 1PU8A 2NOIA 1KG5A 1MUDA 1WEIA 1M3HA 4E9GA 3FHFA 3CWAA 1WEFA 3CWUA 4EJZA 2NOLA 1N3CA 1KEAA 2H56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CW7 A;  4OFH A;  2NOE A;  4OFA A;  2NOF A;  1KQJ A;  1P7M A;  4B22 A;  1LWW A;  1DIZ A;  1NGN A;  4OFE A;  3F0Z A;  3FHG A;  4UNF A;  4UOB A;  1XG7 A;  4B21 A;  1YQL A;  1MPG A;  3CVS A;  3FSP A;  4YPR A;  4YPH A;  5KN9 A;  1KG7 A;  2OFI A;  1KG3 A;  4E9E A;  3KTU A;  1WEG A;  1KG2 A;  1MUN A;  1LWY A;  2NOB A;  5CHZ A;  3KNT A;  4EW0 A;  1ORP A;  1N3A A;  2JHJ A;  4PII A;  5AN4 A;  3OH6 A;  1YQR A;  3CWT A;  4EW4 A;  2ABK A;  1MUY A;  2JHN A;  1LMZ A;  5DPK A;  2YG8 A;  1EBM A;  1XQP A;  1RRS A;  1PU6 A;  2YG9 A;  3OH9 A;  1HU0 A;  1ORN A;  3S6I A;  2JG6 A;  2OFK A;  4EA5 A;  4E9F A;  5KN8 A;  1PVS A;  3N5N X;  1YQK A;  1P59 A;  4EA4 A;  3IH7 A;  2NOZ A;  3G0Q A;  2I5W A;  4AIA A;  1VRL A;  3IHO A;  4AI4 A;  4DK9 A;  2XHI A;  4YOQ A;  1KG6 A;  1KO9 A;  3CWS A;  1M3Q A;  2NOH A;  3F10 A;  4EJY A;  1PU7 A;  1N39 A;  3N0U A;  1KG4 A;  4B24 A;  3D4V A;  4AI5 A;  3I0W A;  4HSB A;  1RRQ A;  3OGD A;  1XQO A;  4E9H A;  1LWV A;  3CVT A;  1YQM A;  4EVV A;  1NKU A;  3I0X A;  4B23 A;  1FN7 A;  1PU8 A;  2NOI A;  1KG5 A;  1MUD A;  1WEI A;  1M3H A;  4E9G A;  3FHF A;  3CWA A;  1WEF A;  3CWU A;  4EJZ A;  2NOL A;  1N3C A;  1KEA A;  2H56 A; 
#chains in the Genus database with same CATH topology
 1K2Y X;  2NOE A;  1C47 A;  1T6A A;  3R2X C;  1KQJ A;  3OSM A;  4B22 A;  2NWV A;  4TPS A;  4WXA A;  3OYE A;  2NVM A;  4OFE A;  5FRN A;  1PCZ A;  2QRE A;  3CVS A;  3FSP A;  1P5G X;  3L2U A;  2OFI A;  2QRC A;  1MUN A;  1W80 A;  1LWY A;  1E42 A;  1ORP A;  1VTO A;  1TGH A;  2JHJ A;  3OYD A;  3OH6 A;  4BE0 A;  2W03 A;  3CWT A;  4EW4 A;  1MUY A;  4ZTF A;  2JHN A;  1EBM A;  1NVP A;  3ASM A;  1J3M A;  1RRS A;  1RM1 A;  3D7Q A;  1HU0 A;  2JG6 A;  4EA5 A;  4E9F A;  5KN8 A;  1P59 A;  4EA4 A;  4C7P A;  2HZM A;  3L2W A;  3IHO A;  5KL0 A;  1QN3 A;  4CFF A;  1M3Q A;  3OS0 A;  4BDY A;  2YH5 A;  3S3N A;  3S3O A;  1RRQ A;  1QN7 A;  1LWV A;  3CVT A;  1YQM A;  2PWW A;  5FRO A;  3OYJ A;  1M5Q 1;  1VOL B;  1NKU A;  3OYB A;  3L2R A;  3OYK A;  1V5S A;  1FN7 A;  1KYF A;  2DKD A;  4E7I A;  4E9G A;  3OYM A;  3CWA A;  3UW2 A;  3DPT A;  3VN5 A;  2FKM X;  2ZFD B;  1KEA A;  2H5A X;  2V8Q A;  4OFH A;  1QNA A;  1QNE A;  1C9B B;  4BAC A;  3OY9 A;  4MRQ A;  3OSE A;  4UNF A;  4UOB A;  1YQL A;  1K35 A;  2IV9 A;  1MPG A;  4YPR A;  4E7K A;  3ENO C;  4NZG A;  5KN9 A;  2QLV A;  3OS2 A;  1KG3 A;  2DKA A;  3HS9 A;  1EUV A;  3KTU A;  2Y8L A;  1WEG A;  4WX8 A;  2NOB A;  5CHZ A;  1QN9 A;  4EAI A;  1QTP A;  1N3A A;  5IYB P;  5AN4 A;  2JPS A;  5DPK A;  3KRM A;  3OYI A;  2D0A A;  1XQP A;  1PU6 A;  2YG9 A;  1VKL A;  1ORN A;  2DKC A;  3ULX A;  1YQK A;  2NOZ A;  4AIA A;  3ENC A;  2H4L X;  1QN6 A;  2MZ8 A;  2MJ7 A;  2H56 A;  4BE2 A;  4DUL A;  2XHI A;  5IYC P;  3CWS A;  4BE1 A;  3F10 A;  4BDZ A;  2EHB D;  4IKF A;  3N0U A;  1MP9 A;  3C04 A;  3D4V A;  4AI5 A;  3L2Q A;  3I0W A;  3TDH A;  3N89 A;  5JN5 A;  1U84 A;  3OYF A;  4E9H A;  1KYU A;  4EAG A;  4EAK A;  2FGT A;  3EAY A;  3RSM A;  3OST A;  4B23 A;  1PU8 A;  5JMV D;  2NOI A;  4Q11 A;  4EAL A;  4D7R A;  3OYH A;  1PCM X;  2V92 A;  1TBP A;  2NOF A;  3PDK A;  1P7M A;  1PCJ X;  1DIZ A;  3F0Z A;  3FHG A;  3LCN A;  4B21 A;  4IL8 A;  2HZS A;  5IYD P;  2LAE A;  4YPH A;  1QN5 A;  2HKP A;  3OLP A;  4E9E A;  1YTF A;  2Y8Q A;  1KFI A;  1D3U A;  1TUO A;  3KNT A;  4EW0 A;  5F9C A;  3OYC A;  3I3W A;  4E7J A;  1YQR A;  2ABK A;  2QR1 A;  1LMZ A;  1QN4 A;  3OH9 A;  3OYL A;  2R5X A;  3S6I A;  1LXT A;  2OFK A;  2O3O A;  3OYN A;  3IH7 A;  4PY5 A;  1VRL A;  3DPU A;  4AI4 A;  4DK9 A;  3NNQ A;  1JFI C;  3PMG A;  4YOQ A;  1KO9 A;  2G30 A;  1PU7 A;  1N39 A;  3SNS A;  3NA5 A;  4B24 A;  2Z0F A;  4ZTJ A;  1KYD A;  1XQO A;  2D0C A;  3RPJ A;  1VTL E;  3T4N A;  4EVV A;  5FRM A;  1AIS A;  1UT7 A;  4BJU A;  2V75 A;  4ROE B;  2HL8 A;  4HJH A;  1WEI A;  2YA3 A;  1M3H A;  4B0A A;  1C4G A;  1NGM A;  4I8O A;  3FHF A;  1WEF A;  3CWU A;  1R4X A;  4EJZ A;  2NOL A;  1KFQ A;  5BMN A;  1N3C A;  1VOK A;  1TBA B;  3OC3 C;  3CW7 A;  5HSH A;  4E7H A;  4E7L A;  1B9K A;  1WQA A;  4OFA A;  1WJW A;  1LWW A;  1XSZ A;  5BMP A;  3OCI A;  1NGN A;  1JDY A;  1XG7 A;  2FKF A;  1CDW A;  3H1Z A;  1P5D X;  1KG7 A;  4QG5 A;  3BKQ X;  1KG2 A;  2Z8U A;  1QNC A;  1QN8 A;  4PII A;  3VW4 A;  4WZS D;  2JPI A;  2FUV A;  1QTS A;  1UT4 A;  2YG8 A;  4ROC B;  2OOX A;  4D7Q A;  3OYA A;  1QNB A;  4ROD B;  1YTB A;  2VJ0 A;  1PVS A;  3HS8 A;  3N5N X;  2F7L A;  3G0Q A;  2I5W A;  2D0B A;  3TE5 A;  2IV8 A;  2HL9 A;  1KG6 A;  2NOH A;  1PZD A;  4EJY A;  5EPC A;  1KG4 A;  3EIK A;  2QRD A;  2W04 A;  2OOY A;  4HSB A;  3OGD A;  4EAJ A;  2V9J A;  3OYG A;  3S3M A;  1Q9U A;  1NH2 A;  1KY7 A;  3L2V A;  3I0X A;  2JOI A;  1KG5 A;  1MUD A;  1KY6 A;  3OS1 A;  1UL7 A;  2NLV A; 
#chains in the Genus database with same CATH homology
 3CW7 A;  4OFH A;  2NOE A;  4OFA A;  2NOF A;  1KQJ A;  1P7M A;  4B22 A;  1LWW A;  1DIZ A;  1NGN A;  4OFE A;  3F0Z A;  3FHG A;  4UNF A;  4UOB A;  1XG7 A;  4B21 A;  1YQL A;  1MPG A;  3CVS A;  3FSP A;  4YPR A;  4YPH A;  5KN9 A;  1KG7 A;  2OFI A;  1KG3 A;  4E9E A;  3KTU A;  1WEG A;  1KG2 A;  1MUN A;  1LWY A;  2NOB A;  5CHZ A;  3KNT A;  4EW0 A;  1ORP A;  1N3A A;  2JHJ A;  4PII A;  5AN4 A;  3OH6 A;  1YQR A;  3CWT A;  4EW4 A;  2ABK A;  1MUY A;  2JHN A;  1LMZ A;  5DPK A;  2YG8 A;  1EBM A;  1XQP A;  1RRS A;  1PU6 A;  2YG9 A;  3OH9 A;  1HU0 A;  1ORN A;  3S6I A;  2JG6 A;  2OFK A;  4EA5 A;  4E9F A;  5KN8 A;  1PVS A;  3N5N X;  1YQK A;  1P59 A;  4EA4 A;  3IH7 A;  2NOZ A;  3G0Q A;  2I5W A;  4AIA A;  1VRL A;  3IHO A;  4AI4 A;  4DK9 A;  2XHI A;  4YOQ A;  1KG6 A;  1KO9 A;  3CWS A;  1M3Q A;  2NOH A;  3F10 A;  4EJY A;  1PU7 A;  1N39 A;  3N0U A;  1KG4 A;  4B24 A;  3D4V A;  4AI5 A;  3I0W A;  4HSB A;  1RRQ A;  3OGD A;  1XQO A;  4E9H A;  1LWV A;  3CVT A;  1YQM A;  4EVV A;  1NKU A;  3I0X A;  4B23 A;  1FN7 A;  1PU8 A;  2NOI A;  1KG5 A;  1MUD A;  1WEI A;  1M3H A;  4E9G A;  3FHF A;  3CWA A;  1WEF A;  3CWU A;  4EJZ A;  2NOL A;  1N3C A;  1KEA A;  2H56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...