1MPGA

3-methyladenine dna glycosylase ii from escherichia coli
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-METHYLADENINE DNA GLYCOSYLASE II
publication title Structural basis for the excision repair of alkylation-damaged DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 1997-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1mpgA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 1mpgA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 1mpgA01
1KQJA 5DPKA 1YQRA 1N3CA 2NOHA 1YQLA 4UOBA 3N5NX 4AI4A 3CVTA 3FSPA 4B23A 1PU6A 3OH9A 4OFEA 4EW0A 3CWUA 1M3QA 2H56A 2ABKA 1N39A 3N0UA 1DIZA 1NGNA 1KEAA 3F0ZA 1LWVA 4EJYA 2YG9A 4YPHA 2JG6A 1KG7A 1YQMA 1MUDA 4E9EA 4B22A 1LMZA 2YG8A 4YPRA 1ORNA 3OGDA 3FHFA 3KNTA 3CWTA 4B24A 5CHZA 4AIAA 1KG5A 1M3HA 3S6IA 2I5WA 4OFAA 2NOBA 3IH7A 2NOIA 1P7MA 1MUYA 1VRLA 3CWSA 1N3AA 4B21A 3F10A 1PU7A 1XQOA 1KO9A 1LWWA 4YOQA 1MPGA 2NOLA 3CW7A 2JHJA 3D4VA 1KG4A 3IHOA 4PIIA 1XG7A 2OFKA 3I0XA 1FN7A 2NOZA 1PVSA 4E9GA 1HU0A 1KG6A 3FHGA 3CVSA 4OFHA 3G0QA 3I0WA 2NOFA 5KN8A 5AN4A 3OH6A 4E9HA 1NKUA 1KG2A 4EJZA 4HSBA 1EBMA 1LWYA 1PU8A 4UNFA 1YQKA 1RRSA 1RRQA 1WEFA 4AI5A 3CWAA 4E9FA 4DK9A 1ORPA 4EA5A 4EA4A 4EVVA 4EW4A 2OFIA 1WEGA 2JHNA 2XHIA 5KN9A 1XQPA 1P59A 3KTUA 1KG3A 1WEIA 1MUNA 2NOEA
chains in the Genus database with same CATH superfamily
4IKFA 3PMGA 1KQJA 5DPKA 4EAKA 4PY5A 2JOIA 2FKMX 3CVTA 4Q11A 1QTSA 2ABKA 1UT4A 2HZSA 3RPJA 1KEAA 3OSMA 1YQMA 5KL0A 1AISA 4YPRA 1K2YX 1VOKA 5CHZA 4AIAA 4ZTJA 4E7LA 1Q9UA 5F9CA 3OYMA 1MUYA 1N3AA 1W80A 1RM1A 1KY6A 3L2QA 1MPGA 3D4VA 3IHOA 5IYDP 2JPSA 4EAIA 1FN7A 1VTLE 4E9GA 1TGHA 3OYLA 3L2RA 4ROCB 4CFFA 3FHGA 5KN8A 1QN9A 4EAJA 3OCIA 3OSEA 4HSBA 1QTPA 1PU8A 4UNFA 1RRQA 1NVPA 3OYDA 1WEFA 2Y8LA 1P5DX 1UL7A 3OYKA 2Z8UA 3HS8A 4EA4A 4EVVA 2OFIA 2D0CA 3OYEA 4E7KA 2ZFDB 3KTUA 2OOYA 2V92A 2DKAA 1QN6A 2NOEA 1PCJX 3NNQA 3NA5A 4B23A 3OC3C 3ULXA 4ROEB 4OFEA 4EW0A 2NWVA 2NLVA 4WXAA 2OOXA 3N0UA 1DIZA 5HSHA 1LWVA 1PZDA 2YG9A 1QN3A 1TUOA 1MP9A 3OS2A 2IV9A 3H1ZA 2JG6A 4QG5A 1EUVA 4E9EA 1C47A 1K35A 3OY9A 1B9KA 2Y8QA 3OGDA 3VN5A 3OYNA 3I3WA 1KG5A 3S6IA 2I5WA 4D7QA 2QLVA 3IH7A 2W04A 2NOIA 1VRLA 3CWSA 4BE1A 4B21A 4NZGA 3DPUA 3TDHA 3OYFA 1PCMX 4BE2A 1CDWA 2OFKA 4BACA 1PVSA 1HU0A 1KG6A 3KRMA 3G0QA 3I0WA 1D3UA 5AN4A 1QN7A 3L2WA 5FRMA 2EHBD 3OYGA 1EBMA 2YH5A 3DPTA 3OSTA 3OS0A 2HKPA 4IL8A 3HS9A 1JFIC 2HZMA 4ZTFA 4HJHA 5KN9A 1XQPA 1KYDA 1UT7A 1WEIA 1MUNA 4B0AA 1YQRA 4C7PA 2NOHA 1YQLA 4UOBA 4AI4A 2W03A 3ENOC 1PU6A 3S3MA 3OYAA 3CWUA 1M3QA 2H56A 1N39A 1NGNA 4TPSA 2H5AX 5FRNA 2F7LA 4RODB 4WZSD 3PDKA 1J3MA 1VTOA 1XSZA 1KG7A 1MUDA 1LMZA 2YG8A 2QREA 1ORNA 4BJUA 1KY7A 3FHFA 2PWWA 2G30A 3CWTA 5JMVD 4B24A 1M3HA 2FGTA 2QR1A 2QRDA 2NOBA 3OYBA 2QRCA 1YTBA 1JDYA 4DULA 2VJ0A 3F10A 5BMPA 1V5SA 1LWWA 4E7JA 1QN4A 2NOLA 3C04A 3EAYA 3CW7A 4WX8A 2JHJA 1C9BB 1KG4A 3OLPA 1WJWA 4PIIA 3OYCA 2MZ8A 1E42A 3CVSA 4E7HA 5IYBP 1NGMA 3L2VA 5BMNA 1QN8A 3LCNA 1NKUA 3SNSA 1KG2A 4BDZA 4EJZA 2YA3A 2FUVA 4AI5A 3CWAA 4E9FA 4DK9A 3ENCA 1QNAA 3ASMA 4EW4A 3N89A 2JHNA 2XHIA 3OS1A 3BKQX 1KG3A 1TBPA 2FKFA 2H4LX 5FROA 3RSMA 1N3CA 4I8OA 2LAEA 3N5NX 3FSPA 1VKLA 3T4NA 3TE5A 3OH9A 5IYCP 3OYJA 3EIKA 1U84A 3F0ZA 2JPIA 4EJYA 1C4GA 1T6AA 2V9JA 4YPHA 3L2UA 1LXTA 2Z0FA 3OYHA 4B22A 2R5XA 2DKCA 1KYUA 3KNTA 3VW4A 1QNCA 1M5Q1 1PCZA 4OFAA 2HL8A 2D0BA 1QNBA 1P7MA 4BE0A 1PU7A 1XQOA 1KO9A 1VOLB 4YOQA 2IV8A 1XG7A 3I0XA 2NOZA 1TBAB 1P5GX 3UW2A 4EALA 5EPCA 4OFHA 2NOFA 4D7RA 3OYIA 2HL9A 3OH6A 2V75A 4E9HA 4MRQA 4EAGA 2NVMA 3D7QA 1NH2A 1LWYA 1YQKA 1RRSA 3R2XC 2O3OA 3S3OA 1QN5A 1ORPA 2V8QA 1KYFA 4EA5A 3S3NA 1R4XA 1WEGA 1KFQA 4E7IA 1WQAA 2D0AA 1QNEA 4BDYA 1P59A 5JN5A 2MJ7A 1KFIA 1YTFA 2DKDA
chains in the Genus database with same CATH topology
1KQJA 5DPKA 1YQRA 1N3CA 2NOHA 1YQLA 4UOBA 3N5NX 4AI4A 3CVTA 3FSPA 4B23A 1PU6A 3OH9A 4OFEA 4EW0A 3CWUA 1M3QA 2H56A 2ABKA 1N39A 3N0UA 1DIZA 1NGNA 1KEAA 3F0ZA 1LWVA 4EJYA 2YG9A 4YPHA 2JG6A 1KG7A 1YQMA 1MUDA 4E9EA 4B22A 1LMZA 2YG8A 4YPRA 1ORNA 3OGDA 3FHFA 3KNTA 3CWTA 4B24A 5CHZA 4AIAA 1KG5A 1M3HA 3S6IA 2I5WA 4OFAA 2NOBA 3IH7A 2NOIA 1P7MA 1MUYA 1VRLA 3CWSA 1N3AA 4B21A 3F10A 1PU7A 1XQOA 1KO9A 1LWWA 4YOQA 1MPGA 2NOLA 3CW7A 2JHJA 3D4VA 1KG4A 3IHOA 4PIIA 1XG7A 2OFKA 3I0XA 1FN7A 2NOZA 1PVSA 4E9GA 1HU0A 1KG6A 3FHGA 3CVSA 4OFHA 3G0QA 3I0WA 2NOFA 5KN8A 5AN4A 3OH6A 4E9HA 1NKUA 1KG2A 4EJZA 4HSBA 1EBMA 1LWYA 1PU8A 4UNFA 1YQKA 1RRSA 1RRQA 1WEFA 4AI5A 3CWAA 4E9FA 4DK9A 1ORPA 4EA5A 4EA4A 4EVVA 4EW4A 2OFIA 1WEGA 2JHNA 2XHIA 5KN9A 1XQPA 1P59A 3KTUA 1KG3A 1WEIA 1MUNA 2NOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQJ A;  5DPK A;  1YQR A;  1N3C A;  2NOH A;  1YQL A;  4UOB A;  3N5N X;  4AI4 A;  3CVT A;  3FSP A;  4B23 A;  1PU6 A;  3OH9 A;  4OFE A;  4EW0 A;  3CWU A;  1M3Q A;  2H56 A;  2ABK A;  1N39 A;  3N0U A;  1DIZ A;  1NGN A;  1KEA A;  3F0Z A;  1LWV A;  4EJY A;  2YG9 A;  4YPH A;  2JG6 A;  1KG7 A;  1YQM A;  1MUD A;  4E9E A;  4B22 A;  1LMZ A;  2YG8 A;  4YPR A;  1ORN A;  3OGD A;  3FHF A;  3KNT A;  3CWT A;  4B24 A;  5CHZ A;  4AIA A;  1KG5 A;  1M3H A;  3S6I A;  2I5W A;  4OFA A;  2NOB A;  3IH7 A;  2NOI A;  1P7M A;  1MUY A;  1VRL A;  3CWS A;  1N3A A;  4B21 A;  3F10 A;  1PU7 A;  1XQO A;  1KO9 A;  1LWW A;  4YOQ A;  1MPG A;  2NOL A;  3CW7 A;  2JHJ A;  3D4V A;  1KG4 A;  3IHO A;  4PII A;  1XG7 A;  2OFK A;  3I0X A;  1FN7 A;  2NOZ A;  1PVS A;  4E9G A;  1HU0 A;  1KG6 A;  3FHG A;  3CVS A;  4OFH A;  3G0Q A;  3I0W A;  2NOF A;  5KN8 A;  5AN4 A;  3OH6 A;  4E9H A;  1NKU A;  1KG2 A;  4EJZ A;  4HSB A;  1EBM A;  1LWY A;  1PU8 A;  4UNF A;  1YQK A;  1RRS A;  1RRQ A;  1WEF A;  4AI5 A;  3CWA A;  4E9F A;  4DK9 A;  1ORP A;  4EA5 A;  4EA4 A;  4EVV A;  4EW4 A;  2OFI A;  1WEG A;  2JHN A;  2XHI A;  5KN9 A;  1XQP A;  1P59 A;  3KTU A;  1KG3 A;  1WEI A;  1MUN A;  2NOE A; 
#chains in the Genus database with same CATH topology
 4IKF A;  3PMG A;  1KQJ A;  5DPK A;  4EAK A;  4PY5 A;  2JOI A;  2FKM X;  3CVT A;  4Q11 A;  1QTS A;  2ABK A;  1UT4 A;  2HZS A;  3RPJ A;  1KEA A;  3OSM A;  1YQM A;  5KL0 A;  1AIS A;  4YPR A;  1K2Y X;  1VOK A;  5CHZ A;  4AIA A;  4ZTJ A;  4E7L A;  1Q9U A;  5F9C A;  3OYM A;  1MUY A;  1N3A A;  1W80 A;  1RM1 A;  1KY6 A;  3L2Q A;  1MPG A;  3D4V A;  3IHO A;  5IYD P;  2JPS A;  4EAI A;  1FN7 A;  1VTL E;  4E9G A;  1TGH A;  3OYL A;  3L2R A;  4ROC B;  4CFF A;  3FHG A;  5KN8 A;  1QN9 A;  4EAJ A;  3OCI A;  3OSE A;  4HSB A;  1QTP A;  1PU8 A;  4UNF A;  1RRQ A;  1NVP A;  3OYD A;  1WEF A;  2Y8L A;  1P5D X;  1UL7 A;  3OYK A;  2Z8U A;  3HS8 A;  4EA4 A;  4EVV A;  2OFI A;  2D0C A;  3OYE A;  4E7K A;  2ZFD B;  3KTU A;  2OOY A;  2V92 A;  2DKA A;  1QN6 A;  2NOE A;  1PCJ X;  3NNQ A;  3NA5 A;  4B23 A;  3OC3 C;  3ULX A;  4ROE B;  4OFE A;  4EW0 A;  2NWV A;  2NLV A;  4WXA A;  2OOX A;  3N0U A;  1DIZ A;  5HSH A;  1LWV A;  1PZD A;  2YG9 A;  1QN3 A;  1TUO A;  1MP9 A;  3OS2 A;  2IV9 A;  3H1Z A;  2JG6 A;  4QG5 A;  1EUV A;  4E9E A;  1C47 A;  1K35 A;  3OY9 A;  1B9K A;  2Y8Q A;  3OGD A;  3VN5 A;  3OYN A;  3I3W A;  1KG5 A;  3S6I A;  2I5W A;  4D7Q A;  2QLV A;  3IH7 A;  2W04 A;  2NOI A;  1VRL A;  3CWS A;  4BE1 A;  4B21 A;  4NZG A;  3DPU A;  3TDH A;  3OYF A;  1PCM X;  4BE2 A;  1CDW A;  2OFK A;  4BAC A;  1PVS A;  1HU0 A;  1KG6 A;  3KRM A;  3G0Q A;  3I0W A;  1D3U A;  5AN4 A;  1QN7 A;  3L2W A;  5FRM A;  2EHB D;  3OYG A;  1EBM A;  2YH5 A;  3DPT A;  3OST A;  3OS0 A;  2HKP A;  4IL8 A;  3HS9 A;  1JFI C;  2HZM A;  4ZTF A;  4HJH A;  5KN9 A;  1XQP A;  1KYD A;  1UT7 A;  1WEI A;  1MUN A;  4B0A A;  1YQR A;  4C7P A;  2NOH A;  1YQL A;  4UOB A;  4AI4 A;  2W03 A;  3ENO C;  1PU6 A;  3S3M A;  3OYA A;  3CWU A;  1M3Q A;  2H56 A;  1N39 A;  1NGN A;  4TPS A;  2H5A X;  5FRN A;  2F7L A;  4ROD B;  4WZS D;  3PDK A;  1J3M A;  1VTO A;  1XSZ A;  1KG7 A;  1MUD A;  1LMZ A;  2YG8 A;  2QRE A;  1ORN A;  4BJU A;  1KY7 A;  3FHF A;  2PWW A;  2G30 A;  3CWT A;  5JMV D;  4B24 A;  1M3H A;  2FGT A;  2QR1 A;  2QRD A;  2NOB A;  3OYB A;  2QRC A;  1YTB A;  1JDY A;  4DUL A;  2VJ0 A;  3F10 A;  5BMP A;  1V5S A;  1LWW A;  4E7J A;  1QN4 A;  2NOL A;  3C04 A;  3EAY A;  3CW7 A;  4WX8 A;  2JHJ A;  1C9B B;  1KG4 A;  3OLP A;  1WJW A;  4PII A;  3OYC A;  2MZ8 A;  1E42 A;  3CVS A;  4E7H A;  5IYB P;  1NGM A;  3L2V A;  5BMN A;  1QN8 A;  3LCN A;  1NKU A;  3SNS A;  1KG2 A;  4BDZ A;  4EJZ A;  2YA3 A;  2FUV A;  4AI5 A;  3CWA A;  4E9F A;  4DK9 A;  3ENC A;  1QNA A;  3ASM A;  4EW4 A;  3N89 A;  2JHN A;  2XHI A;  3OS1 A;  3BKQ X;  1KG3 A;  1TBP A;  2FKF A;  2H4L X;  5FRO A;  3RSM A;  1N3C A;  4I8O A;  2LAE A;  3N5N X;  3FSP A;  1VKL A;  3T4N A;  3TE5 A;  3OH9 A;  5IYC P;  3OYJ A;  3EIK A;  1U84 A;  3F0Z A;  2JPI A;  4EJY A;  1C4G A;  1T6A A;  2V9J A;  4YPH A;  3L2U A;  1LXT A;  2Z0F A;  3OYH A;  4B22 A;  2R5X A;  2DKC A;  1KYU A;  3KNT A;  3VW4 A;  1QNC A;  1M5Q 1;  1PCZ A;  4OFA A;  2HL8 A;  2D0B A;  1QNB A;  1P7M A;  4BE0 A;  1PU7 A;  1XQO A;  1KO9 A;  1VOL B;  4YOQ A;  2IV8 A;  1XG7 A;  3I0X A;  2NOZ A;  1TBA B;  1P5G X;  3UW2 A;  4EAL A;  5EPC A;  4OFH A;  2NOF A;  4D7R A;  3OYI A;  2HL9 A;  3OH6 A;  2V75 A;  4E9H A;  4MRQ A;  4EAG A;  2NVM A;  3D7Q A;  1NH2 A;  1LWY A;  1YQK A;  1RRS A;  3R2X C;  2O3O A;  3S3O A;  1QN5 A;  1ORP A;  2V8Q A;  1KYF A;  4EA5 A;  3S3N A;  1R4X A;  1WEG A;  1KFQ A;  4E7I A;  1WQA A;  2D0A A;  1QNE A;  4BDY A;  1P59 A;  5JN5 A;  2MJ7 A;  1KFI A;  1YTF A;  2DKD A; 
#chains in the Genus database with same CATH homology
 1KQJ A;  5DPK A;  1YQR A;  1N3C A;  2NOH A;  1YQL A;  4UOB A;  3N5N X;  4AI4 A;  3CVT A;  3FSP A;  4B23 A;  1PU6 A;  3OH9 A;  4OFE A;  4EW0 A;  3CWU A;  1M3Q A;  2H56 A;  2ABK A;  1N39 A;  3N0U A;  1DIZ A;  1NGN A;  1KEA A;  3F0Z A;  1LWV A;  4EJY A;  2YG9 A;  4YPH A;  2JG6 A;  1KG7 A;  1YQM A;  1MUD A;  4E9E A;  4B22 A;  1LMZ A;  2YG8 A;  4YPR A;  1ORN A;  3OGD A;  3FHF A;  3KNT A;  3CWT A;  4B24 A;  5CHZ A;  4AIA A;  1KG5 A;  1M3H A;  3S6I A;  2I5W A;  4OFA A;  2NOB A;  3IH7 A;  2NOI A;  1P7M A;  1MUY A;  1VRL A;  3CWS A;  1N3A A;  4B21 A;  3F10 A;  1PU7 A;  1XQO A;  1KO9 A;  1LWW A;  4YOQ A;  1MPG A;  2NOL A;  3CW7 A;  2JHJ A;  3D4V A;  1KG4 A;  3IHO A;  4PII A;  1XG7 A;  2OFK A;  3I0X A;  1FN7 A;  2NOZ A;  1PVS A;  4E9G A;  1HU0 A;  1KG6 A;  3FHG A;  3CVS A;  4OFH A;  3G0Q A;  3I0W A;  2NOF A;  5KN8 A;  5AN4 A;  3OH6 A;  4E9H A;  1NKU A;  1KG2 A;  4EJZ A;  4HSB A;  1EBM A;  1LWY A;  1PU8 A;  4UNF A;  1YQK A;  1RRS A;  1RRQ A;  1WEF A;  4AI5 A;  3CWA A;  4E9F A;  4DK9 A;  1ORP A;  4EA5 A;  4EA4 A;  4EVV A;  4EW4 A;  2OFI A;  1WEG A;  2JHN A;  2XHI A;  5KN9 A;  1XQP A;  1P59 A;  3KTU A;  1KG3 A;  1WEI A;  1MUN A;  2NOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...