1KW2A

Crystal structure of uncomplexed vitamin d-binding protein
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
455
structure length
455
Chain Sequence
GRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPKELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the vitamin D-binding protein and its complex with actin: structural basis of the actin-scavenger system.
pubmed doi rcsb
molecule keywords Vitamin D-binding protein
molecule tags Transport protein
total genus 175
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00273 Serum_albumin Serum albumin family
A PF09164 VitD-bind_III Vitamin D binding protein, domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1kw2A02
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1kw2A03
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1kw2A01
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1kw2A04
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1kw2A05
4L9KA 4OT2A 3SQJA 3LU7A 1HK2A 2XW1A 2BXCA 2I2ZA 5IJFA 1KXPD 4LB9A 3A73A 4G04A 2XW0A 1TF0A 3LU8A 4IW2A 5FUOA 1BKEA 1E7HA 4N0FD 4ZBRA 2I30A 1BM0A 4E99A 1O9XA 1J78A 4N0UD 4PO0A 1E7IA 5ID9A 4OR0A 1HK5A 2BXKA 1N5UA 2BXHA 4LUFA 5IIXA 4L9QA 5HOZA 3JQZA 4K71A 1E7BA 2BXDA 2BXBA 1HK4A 2VDBA 2BXQA 2BXEA 2VUEA 4F5VA 1E7CA 1E78A 2XSIA 1GNJA 2BXGA 2BXMA 1H9ZA 2YDFA 1KW2A 3TDLA 2VUFA 4IW1A 2BXNA 2XVWA 4F5UA 3V09A 1E7GA 4F5TA 3B9MA 1LOTA 1UORA 3CX9A 3B9LA 2BXLA 1HA2A 1HK3A 1E7FA 5IFOA 2XVUA 4JK4A 1MA9A 4LA0A 5IJ5A 4HGMB 4Z69A 1AO6A 4EMXA 3UIVA 5ID7A 5IJEA 4S1YA 2BX8A 4LUHA 4K2CA 3V08A 1BJ5A 2BXOA 2BXFA 5DQFA 1E7EA 2BXAA 5DBYA 2XVQA 2BXPA 4G03A 4ZBQA 4F5SA 1GNIA 4L8UA 4LB2A 5GHKA 4J2VA 2XVVA 5IIHA 5IIUA 1E7AA 3LU6A 3V03A 2BXIA 4HGKA 3JRYA 1J7EA 1HK1A 4BKEA
chains in the Genus database with same CATH superfamily
2EFDA 4L9KA 4BY9C 4N3ZA 2JUHA 2EFEA 4FIPB 1MIWA 3SIVB 2K0NA 4OT2A 3SQJA 3H37A 4NAWB 3LU7A 4GDKB 1HK2A 4FK5B 3WHQA 2XW1A 2BXCA 2DG5A 2I2ZA 5IJFA 3H3AA 2DBXA 1KXPD 2Z8KA 1FOUA 4LB9A 3A73A 4G04A 4ZUXV 2XW0A 1TF0A 3LU8A 2OT3A 2NQOA 4IW2A 3ICXA 4TQ1A 5FUOA 3NVIA 1MM8A 1BKEA 1E7HA 4N0FD 1MIYA 3FNMA 2LOQA 3NVMA 4GDXA 4ZBRA 4GDLB 4MBEC 2DBUA 2E0YA 2QMCA 2LQHA 3MHSB 2I30A 1BM0A 4E99A 1O9XA 1J78A 4N0UD 4PO0A 1E7IA 5ID9A 4OR0A 1HK5A 2AJEA 2BXKA 1N5UA 4TQ0A 2BXHA 4LUFA 4G01A 5IIXA 4L9QA 5HOZA 3KIKA 3JQZA 4K71A 3FWBC 1E7BA 2BXDA 1VZSA 1HK4A 2BXBA 2VDBA 5D7GA 2BXQA 5BPKA 2BXEA 2EFCA 3NMUA 4Z9OA 2VUEA 4F5VA 1E7CA 1E78A 2XSIA 3WHRA 2EFHA 3GA9L 1GNJA 2BXGA 2BXMA 1H9ZA 4D7XA 3A75A 4DM0A 1LNSA 2YDFA 4GG2A 1KW2A 3TDLA 4BKEA 2VUFA 4IW1A 2OZBB 2V36A 2BXNA 2XVWA 4F5UA 4M70B 3V09A 1E7GA 2DBWA 4F5TA 3B9MA 4ZC6A 1LOTA 1UORA 3BPJA 3CX9A 4W4UB 1MIVA 2GUTA 3B9LA 3VQIA 2BXLA 4OTUA 1MUSA 1HA2A 1HK3A 3MHHB 1E7FA 3W1SA 4C31B 3SIUB 1NT2B 2E0XA 5IFOA 2KBZA 2XVUA 2QHBA 4JK4A 2LQIA 2Z8IA 1JNBA 1MA9A 4LA0A 2DYOA 2KWFA 5IJ5A 4OTTA 2QM6A 3G9KD 1MUHA 4HGMB 4FJCB 4Z69A 1AO6A 4EMXA 3UIVA 5ID7A 5IJEA 3FWCC 5GIOA 4S1YA 2BX8A 1KDXA 4LUHA 4K2CA 3V08A 1BJ5A 2AGHB 2BXOA 2BXFA 5DQFA 1E7EA 2BXAA 5DBYA 2XVQA 3ECPA 2BXPA 5GINA 3PLAA 4G03A 3GQUA 3M99C 4ZBQA 2CKXA 4DHXB 2ROHA 1H5WA 3KJLA 1GNIA 4F5SA 5B5TA 1SB0A 3NVKA 4L8UA 4ZBKA 2Z8JA 4I9OA 4WA6B 5GIPA 4LB2A 5GHKA 4J2VA 1IJGA 2NNWA 3GQXA 2XVVA 5IIHA 2XMOA 5IIUA 1E7AA 2LXTA 3LU6A 3V03A 2BXIA 3WHSA 4HGKA 4ZCGA 1VFIA 2LXSA 3JRYA 1J7EA 1TXUA 1HK1A 2DYMA
chains in the Genus database with same CATH topology
2EFDA 4L9KA 4BY9C 4N3ZA 2JUHA 2EFEA 4FIPB 1MIWA 3SIVB 4OT2A 3SQJA 3H37A 4NAWB 3LU7A 4GDKB 1HK2A 4FK5B 3WHQA 2XW1A 2BXCA 2DG5A 2I2ZA 5IJFA 3H3AA 2DBXA 1KXPD 2Z8KA 1FOUA 4LB9A 3A73A 4G04A 4ZUXV 2XW0A 1TF0A 3LU8A 2OT3A 2NQOA 4IW2A 3ICXA 4TQ1A 5FUOA 3NVIA 1BKEA 1E7HA 4N0FD 1MIYA 3FNMA 2LOQA 3NVMA 4GDXA 4ZBRA 4GDLB 4MBEC 2DBUA 2E0YA 2QMCA 3MHSB 2I30A 1BM0A 4E99A 1O9XA 1J78A 4N0UD 4PO0A 1E7IA 5ID9A 4OR0A 1HK5A 2AJEA 2BXKA 1N5UA 4TQ0A 2BXHA 4LUFA 4G01A 5IIXA 4L9QA 5HOZA 3KIKA 3JQZA 4K71A 3FWBC 1E7BA 2BXDA 1VZSA 1HK4A 2BXBA 2VDBA 5D7GA 2BXQA 5BPKA 2BXEA 2EFCA 3NMUA 4Z9OA 2VUEA 4F5VA 1E7CA 1E78A 2XSIA 3WHRA 2EFHA 3GA9L 1GNJA 2BXGA 2BXMA 1H9ZA 3A75A 1LNSA 2YDFA 4GG2A 1KW2A 3TDLA 4BKEA 2VUFA 4IW1A 2OZBB 2V36A 2BXNA 2XVWA 4F5UA 4M70B 3V09A 1E7GA 2DBWA 4F5TA 3B9MA 4ZC6A 1LOTA 1UORA 4W4UB 3CX9A 1MIVA 3B9LA 3VQIA 2BXLA 4OTUA 1HA2A 1HK3A 3MHHB 1E7FA 3W1SA 4C31B 3SIUB 1NT2B 2E0XA 5IFOA 2KBZA 2XVUA 2QHBA 4JK4A 2Z8IA 1JNBA 1MA9A 4LA0A 2DYOA 5IJ5A 4OTTA 2QM6A 3G9KD 4HGMB 4FJCB 4Z69A 1AO6A 4EMXA 3UIVA 5ID7A 5IJEA 3FWCC 5GIOA 4S1YA 2BX8A 4LUHA 4K2CA 3V08A 1BJ5A 2BXOA 2BXFA 5DQFA 1E7EA 2BXAA 5DBYA 2XVQA 2BXPA 5GINA 3PLAA 4G03A 3GQUA 3M99C 4ZBQA 2CKXA 4DHXB 2ROHA 1H5WA 3KJLA 1GNIA 4F5SA 5B5TA 3NVKA 4L8UA 4ZBKA 2Z8JA 5GIPA 4WA6B 4LB2A 5GHKA 4J2VA 1IJGA 2NNWA 3GQXA 2XVVA 5IIHA 2XMOA 5IIUA 1E7AA 3LU6A 3V03A 2BXIA 3WHSA 4HGKA 4ZCGA 1VFIA 3JRYA 1J7EA 1TXUA 1HK1A 2DYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9K A;  4OT2 A;  3SQJ A;  3LU7 A;  1HK2 A;  2XW1 A;  2BXC A;  2I2Z A;  5IJF A;  1KXP D;  4LB9 A;  3A73 A;  4G04 A;  2XW0 A;  1TF0 A;  3LU8 A;  4IW2 A;  5FUO A;  1BKE A;  1E7H A;  4N0F D;  4ZBR A;  2I30 A;  1BM0 A;  4E99 A;  1O9X A;  1J78 A;  4N0U D;  4PO0 A;  1E7I A;  5ID9 A;  4OR0 A;  1HK5 A;  2BXK A;  1N5U A;  2BXH A;  4LUF A;  5IIX A;  4L9Q A;  5HOZ A;  3JQZ A;  4K71 A;  1E7B A;  2BXD A;  2BXB A;  1HK4 A;  2VDB A;  2BXQ A;  2BXE A;  2VUE A;  4F5V A;  1E7C A;  1E78 A;  2XSI A;  1GNJ A;  2BXG A;  2BXM A;  1H9Z A;  2YDF A;  1KW2 A;  3TDL A;  2VUF A;  4IW1 A;  2BXN A;  2XVW A;  4F5U A;  3V09 A;  1E7G A;  4F5T A;  3B9M A;  1LOT A;  1UOR A;  3CX9 A;  3B9L A;  2BXL A;  1HA2 A;  1HK3 A;  1E7F A;  5IFO A;  2XVU A;  4JK4 A;  1MA9 A;  4LA0 A;  5IJ5 A;  4HGM B;  4Z69 A;  1AO6 A;  4EMX A;  3UIV A;  5ID7 A;  5IJE A;  4S1Y A;  2BX8 A;  4LUH A;  4K2C A;  3V08 A;  1BJ5 A;  2BXO A;  2BXF A;  5DQF A;  1E7E A;  2BXA A;  5DBY A;  2XVQ A;  2BXP A;  4G03 A;  4ZBQ A;  4F5S A;  1GNI A;  4L8U A;  4LB2 A;  5GHK A;  4J2V A;  2XVV A;  5IIH A;  5IIU A;  1E7A A;  3LU6 A;  3V03 A;  2BXI A;  4HGK A;  3JRY A;  1J7E A;  1HK1 A;  4BKE A; 
#chains in the Genus database with same CATH topology
 2EFD A;  4L9K A;  4BY9 C;  4N3Z A;  2JUH A;  2EFE A;  4FIP B;  1MIW A;  3SIV B;  2K0N A;  4OT2 A;  3SQJ A;  3H37 A;  4NAW B;  3LU7 A;  4GDK B;  1HK2 A;  4FK5 B;  3WHQ A;  2XW1 A;  2BXC A;  2DG5 A;  2I2Z A;  5IJF A;  3H3A A;  2DBX A;  1KXP D;  2Z8K A;  1FOU A;  4LB9 A;  3A73 A;  4G04 A;  4ZUX V;  2XW0 A;  1TF0 A;  3LU8 A;  2OT3 A;  2NQO A;  4IW2 A;  3ICX A;  4TQ1 A;  5FUO A;  3NVI A;  1MM8 A;  1BKE A;  1E7H A;  4N0F D;  1MIY A;  3FNM A;  2LOQ A;  3NVM A;  4GDX A;  4ZBR A;  4GDL B;  4MBE C;  2DBU A;  2E0Y A;  2QMC A;  2LQH A;  3MHS B;  2I30 A;  1BM0 A;  4E99 A;  1O9X A;  1J78 A;  4N0U D;  4PO0 A;  1E7I A;  5ID9 A;  4OR0 A;  1HK5 A;  2AJE A;  2BXK A;  1N5U A;  4TQ0 A;  2BXH A;  4LUF A;  4G01 A;  5IIX A;  4L9Q A;  5HOZ A;  3KIK A;  3JQZ A;  4K71 A;  3FWB C;  1E7B A;  2BXD A;  1VZS A;  1HK4 A;  2BXB A;  2VDB A;  5D7G A;  2BXQ A;  5BPK A;  2BXE A;  2EFC A;  3NMU A;  4Z9O A;  2VUE A;  4F5V A;  1E7C A;  1E78 A;  2XSI A;  3WHR A;  2EFH A;  3GA9 L;  1GNJ A;  2BXG A;  2BXM A;  1H9Z A;  4D7X A;  3A75 A;  4DM0 A;  1LNS A;  2YDF A;  4GG2 A;  1KW2 A;  3TDL A;  4BKE A;  2VUF A;  4IW1 A;  2OZB B;  2V36 A;  2BXN A;  2XVW A;  4F5U A;  4M70 B;  3V09 A;  1E7G A;  2DBW A;  4F5T A;  3B9M A;  4ZC6 A;  1LOT A;  1UOR A;  3BPJ A;  3CX9 A;  4W4U B;  1MIV A;  2GUT A;  3B9L A;  3VQI A;  2BXL A;  4OTU A;  1MUS A;  1HA2 A;  1HK3 A;  3MHH B;  1E7F A;  3W1S A;  4C31 B;  3SIU B;  1NT2 B;  2E0X A;  5IFO A;  2KBZ A;  2XVU A;  2QHB A;  4JK4 A;  2LQI A;  2Z8I A;  1JNB A;  1MA9 A;  4LA0 A;  2DYO A;  2KWF A;  5IJ5 A;  4OTT A;  2QM6 A;  3G9K D;  1MUH A;  4HGM B;  4FJC B;  4Z69 A;  1AO6 A;  4EMX A;  3UIV A;  5ID7 A;  5IJE A;  3FWC C;  5GIO A;  4S1Y A;  2BX8 A;  1KDX A;  4LUH A;  4K2C A;  3V08 A;  1BJ5 A;  2AGH B;  2BXO A;  2BXF A;  5DQF A;  1E7E A;  2BXA A;  5DBY A;  2XVQ A;  3ECP A;  2BXP A;  5GIN A;  3PLA A;  4G03 A;  3GQU A;  3M99 C;  4ZBQ A;  2CKX A;  4DHX B;  2ROH A;  1H5W A;  3KJL A;  1GNI A;  4F5S A;  5B5T A;  1SB0 A;  3NVK A;  4L8U A;  4ZBK A;  2Z8J A;  4I9O A;  4WA6 B;  5GIP A;  4LB2 A;  5GHK A;  4J2V A;  1IJG A;  2NNW A;  3GQX A;  2XVV A;  5IIH A;  2XMO A;  5IIU A;  1E7A A;  2LXT A;  3LU6 A;  3V03 A;  2BXI A;  3WHS A;  4HGK A;  4ZCG A;  1VFI A;  2LXS A;  3JRY A;  1J7E A;  1TXU A;  1HK1 A;  2DYM A; 
#chains in the Genus database with same CATH homology
 2EFD A;  4L9K A;  4BY9 C;  4N3Z A;  2JUH A;  2EFE A;  4FIP B;  1MIW A;  3SIV B;  4OT2 A;  3SQJ A;  3H37 A;  4NAW B;  3LU7 A;  4GDK B;  1HK2 A;  4FK5 B;  3WHQ A;  2XW1 A;  2BXC A;  2DG5 A;  2I2Z A;  5IJF A;  3H3A A;  2DBX A;  1KXP D;  2Z8K A;  1FOU A;  4LB9 A;  3A73 A;  4G04 A;  4ZUX V;  2XW0 A;  1TF0 A;  3LU8 A;  2OT3 A;  2NQO A;  4IW2 A;  3ICX A;  4TQ1 A;  5FUO A;  3NVI A;  1BKE A;  1E7H A;  4N0F D;  1MIY A;  3FNM A;  2LOQ A;  3NVM A;  4GDX A;  4ZBR A;  4GDL B;  4MBE C;  2DBU A;  2E0Y A;  2QMC A;  3MHS B;  2I30 A;  1BM0 A;  4E99 A;  1O9X A;  1J78 A;  4N0U D;  4PO0 A;  1E7I A;  5ID9 A;  4OR0 A;  1HK5 A;  2AJE A;  2BXK A;  1N5U A;  4TQ0 A;  2BXH A;  4LUF A;  4G01 A;  5IIX A;  4L9Q A;  5HOZ A;  3KIK A;  3JQZ A;  4K71 A;  3FWB C;  1E7B A;  2BXD A;  1VZS A;  1HK4 A;  2BXB A;  2VDB A;  5D7G A;  2BXQ A;  5BPK A;  2BXE A;  2EFC A;  3NMU A;  4Z9O A;  2VUE A;  4F5V A;  1E7C A;  1E78 A;  2XSI A;  3WHR A;  2EFH A;  3GA9 L;  1GNJ A;  2BXG A;  2BXM A;  1H9Z A;  3A75 A;  1LNS A;  2YDF A;  4GG2 A;  1KW2 A;  3TDL A;  4BKE A;  2VUF A;  4IW1 A;  2OZB B;  2V36 A;  2BXN A;  2XVW A;  4F5U A;  4M70 B;  3V09 A;  1E7G A;  2DBW A;  4F5T A;  3B9M A;  4ZC6 A;  1LOT A;  1UOR A;  4W4U B;  3CX9 A;  1MIV A;  3B9L A;  3VQI A;  2BXL A;  4OTU A;  1HA2 A;  1HK3 A;  3MHH B;  1E7F A;  3W1S A;  4C31 B;  3SIU B;  1NT2 B;  2E0X A;  5IFO A;  2KBZ A;  2XVU A;  2QHB A;  4JK4 A;  2Z8I A;  1JNB A;  1MA9 A;  4LA0 A;  2DYO A;  5IJ5 A;  4OTT A;  2QM6 A;  3G9K D;  4HGM B;  4FJC B;  4Z69 A;  1AO6 A;  4EMX A;  3UIV A;  5ID7 A;  5IJE A;  3FWC C;  5GIO A;  4S1Y A;  2BX8 A;  4LUH A;  4K2C A;  3V08 A;  1BJ5 A;  2BXO A;  2BXF A;  5DQF A;  1E7E A;  2BXA A;  5DBY A;  2XVQ A;  2BXP A;  5GIN A;  3PLA A;  4G03 A;  3GQU A;  3M99 C;  4ZBQ A;  2CKX A;  4DHX B;  2ROH A;  1H5W A;  3KJL A;  1GNI A;  4F5S A;  5B5T A;  3NVK A;  4L8U A;  4ZBK A;  2Z8J A;  5GIP A;  4WA6 B;  4LB2 A;  5GHK A;  4J2V A;  1IJG A;  2NNW A;  3GQX A;  2XVV A;  5IIH A;  2XMO A;  5IIU A;  1E7A A;  3LU6 A;  3V03 A;  2BXI A;  3WHS A;  4HGK A;  4ZCG A;  1VFI A;  3JRY A;  1J7E A;  1TXU A;  1HK1 A;  2DYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...