1VZSA

Solution structure of subunit f6 from the peripheral stalk region of atp synthase from bovine heart mitochondria
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
NKELDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFEVVEKPQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE COUPLING FACTOR 6, MITOCHONDRIAL PRECURSOR
publication title Solution Structure of Subunit F(6) from the Peripheral Stalk Region of ATP Synthase from Bovine Heart Mitochondria
pubmed doi rcsb
source organism Bos taurus
molecule tags Synthase
total genus 13
structure length 76
sequence length 76
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.110 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1vzsA01
1VZSA
chains in the Genus database with same CATH superfamily
5IFOA 3NVIA 1AO6A 2BXKA 3G9KD 2VUEA 4WA6B 2BXPA 4GDXA 5IJFA 4G04A 1N5UA 2I30A 1HK4A 1BM0A 4ZBQA 3B9LA 1BJ5A 4FJCB 4OTTA 3MHHB 1MIYA 4ZUXV 4OTUA 1MIVA 4GDKB 4OR0A 2BXQA 2BXCA 1H9ZA 1HK3A 2BXLA 4K2CA 2XVVA 2LQHA 4DM0A 4C31B 5BPKA 3NVKA 4LUFA 5DQFA 2BXOA 1MA9A 4HGMB 3NMUA 2BXDA 1E7AA 4Z69A 1BKEA 4G03A 4E99A 1HK2A 4NAWB 4LUHA 5GHKA 2XMOA 1J78A 4LA0A 2XW0A 4ZBKA 4G01A 2DBWA 1E7HA 2Z8IA 3GA9L 4OT2A 3A73A 3KJLA 1KW2A 1VFIA 4N3ZA 2XW1A 3CX9A 3ICXA 1MUSA 3JQZA 2QM6A 4F5VA 2KWFA 3UIVA 3PLAA 3BPJA 2Z8JA 1HK1A 2XSIA 1H5WA 4JK4A 4Z9OA 1O9XA 5FUOA 4I9OA 3WHSA 4F5TA 4K71A 4IW1A 3LU6A 1VZSA 2V36A 4L9QA 2XVQA 3SQJA 3H37A 4MBEC 1IJGA 3V09A 4FK5B 1E7BA 1E7IA 2GUTA 3B9MA 4TQ0A 3V08A 1JNBA 1E78A 1NT2B 1SB0A 4L9KA 2EFEA 4FIPB 4BY9C 5IJEA 2ROHA 1LOTA 2DBXA 2Z8KA 2NNWA 3V03A 1HA2A 2BXFA 2LOQA 1KXPD 5D7GA 1MIWA 3SIVB 3SIUB 4S1YA 2DBUA 3WHRA 4ZC6A 4N0FD 3W1SA 1GNIA 5IJ5A 4GDLB 4W4UB 2BXMA 1FOUA 2DYOA 3WHQA 3GQXA 5GIPA 4LB2A 5IIUA 2YDFA 3LU7A 2BXBA 3JRYA 4IW2A 2VDBA 2VUFA 5GINA 3FWBC 5GIOA 2AGHB 2XVUA 1GNJA 2BXHA 2LQIA 1LNSA 5IIXA 1TF0A 2BX8A 3NVMA 2E0YA 4BKEA 3M99C 4TQ1A 4D7XA 2DG5A 2BXAA 1HK5A 2LXSA 2BXNA 2K0NA 5DBYA 2CKXA 5HOZA 3TDLA 3ECPA 3KIKA 4N0UD 1E7GA 3VQIA 5ID7A 3H3AA 4J2VA 1E7EA 2XVWA 1E7CA 1MUHA 1UORA 2EFHA 4GG2A 3A75A 4PO0A 5ID9A 4HGKA 1KDXA 3LU8A 2EFDA 4L8UA 2EFCA 4ZCGA 5IIHA 3MHSB 2QMCA 2BXIA 2E0XA 2NQOA 2I2ZA 4DHXB 1J7EA 2KBZA 5B5TA 2OT3A 4LB9A 2BXEA 2LXTA 2JUHA 3FNMA 2OZBB 4ZBRA 4M70B 2QHBA 1E7FA 3FWCC 2BXGA 4F5UA 1MM8A 2AJEA 4F5SA 1TXUA 4EMXA 2DYMA 3GQUA
chains in the Genus database with same CATH topology
5IFOA 3NVIA 1AO6A 2BXKA 3G9KD 2VUEA 4WA6B 2BXPA 4GDXA 5IJFA 4G04A 1N5UA 2I30A 1HK4A 1BM0A 4ZBQA 3B9LA 1BJ5A 4FJCB 4OTTA 3MHHB 1MIYA 4ZUXV 4OTUA 1MIVA 4GDKB 4OR0A 2BXQA 2BXCA 1H9ZA 1HK3A 2BXLA 4K2CA 2XVVA 4C31B 5BPKA 3NVKA 4LUFA 5DQFA 2BXOA 1MA9A 4HGMB 3NMUA 2BXDA 1E7AA 4Z69A 1BKEA 4G03A 4E99A 1HK2A 4NAWB 4LUHA 5GHKA 2XMOA 1J78A 4LA0A 2XW0A 4ZBKA 4G01A 2DBWA 1E7HA 2Z8IA 3GA9L 4OT2A 3A73A 3KJLA 1KW2A 1VFIA 4N3ZA 2XW1A 3CX9A 3ICXA 3JQZA 2QM6A 4F5VA 3PLAA 3UIVA 2Z8JA 1HK1A 2XSIA 1H5WA 4JK4A 4Z9OA 1O9XA 5FUOA 4F5TA 3WHSA 4K71A 4IW1A 3LU6A 1VZSA 2V36A 4L9QA 2XVQA 3SQJA 3H37A 4MBEC 1IJGA 3V09A 4FK5B 1E7BA 1E7IA 3B9MA 4TQ0A 3V08A 1JNBA 1E78A 1NT2B 4L9KA 2EFEA 4FIPB 4BY9C 5IJEA 2ROHA 1LOTA 2DBXA 2Z8KA 2NNWA 3V03A 1HA2A 2BXFA 2LOQA 1KXPD 5D7GA 1MIWA 3SIUB 4S1YA 2DBUA 3WHRA 4ZC6A 4N0FD 3W1SA 1GNIA 5IJ5A 4GDLB 4W4UB 2BXMA 1FOUA 2DYOA 3WHQA 3GQXA 5GIPA 4LB2A 5IIUA 2YDFA 3LU7A 2BXBA 3JRYA 4IW2A 2VDBA 2VUFA 5GINA 3FWBC 5GIOA 2XVUA 1GNJA 2BXHA 5IIXA 1LNSA 1TF0A 2BX8A 3NVMA 2E0YA 4BKEA 3M99C 4TQ1A 3SIVB 2DG5A 2BXAA 1HK5A 2BXNA 5DBYA 3TDLA 2CKXA 5HOZA 3KIKA 4N0UD 1E7GA 3VQIA 5ID7A 3H3AA 4J2VA 1E7EA 2XVWA 1E7CA 1UORA 2EFHA 4GG2A 3A75A 4PO0A 5ID9A 4HGKA 3LU8A 2EFDA 4L8UA 2EFCA 4ZCGA 5IIHA 3MHSB 2QMCA 2BXIA 2E0XA 2NQOA 2I2ZA 4DHXB 1J7EA 2KBZA 5B5TA 2OT3A 4LB9A 2BXEA 2JUHA 3FNMA 2OZBB 4ZBRA 4M70B 2QHBA 1E7FA 3FWCC 2BXGA 4F5UA 2AJEA 4F5SA 1TXUA 4EMXA 2DYMA 3GQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZS A; 
#chains in the Genus database with same CATH topology
 5IFO A;  3NVI A;  1AO6 A;  2BXK A;  3G9K D;  2VUE A;  4WA6 B;  2BXP A;  4GDX A;  5IJF A;  4G04 A;  1N5U A;  2I30 A;  1HK4 A;  1BM0 A;  4ZBQ A;  3B9L A;  1BJ5 A;  4FJC B;  4OTT A;  3MHH B;  1MIY A;  4ZUX V;  4OTU A;  1MIV A;  4GDK B;  4OR0 A;  2BXQ A;  2BXC A;  1H9Z A;  1HK3 A;  2BXL A;  4K2C A;  2XVV A;  2LQH A;  4DM0 A;  4C31 B;  5BPK A;  3NVK A;  4LUF A;  5DQF A;  2BXO A;  1MA9 A;  4HGM B;  3NMU A;  2BXD A;  1E7A A;  4Z69 A;  1BKE A;  4G03 A;  4E99 A;  1HK2 A;  4NAW B;  4LUH A;  5GHK A;  2XMO A;  1J78 A;  4LA0 A;  2XW0 A;  4ZBK A;  4G01 A;  2DBW A;  1E7H A;  2Z8I A;  3GA9 L;  4OT2 A;  3A73 A;  3KJL A;  1KW2 A;  1VFI A;  4N3Z A;  2XW1 A;  3CX9 A;  3ICX A;  1MUS A;  3JQZ A;  2QM6 A;  4F5V A;  2KWF A;  3UIV A;  3PLA A;  3BPJ A;  2Z8J A;  1HK1 A;  2XSI A;  1H5W A;  4JK4 A;  4Z9O A;  1O9X A;  5FUO A;  4I9O A;  3WHS A;  4F5T A;  4K71 A;  4IW1 A;  3LU6 A;  1VZS A;  2V36 A;  4L9Q A;  2XVQ A;  3SQJ A;  3H37 A;  4MBE C;  1IJG A;  3V09 A;  4FK5 B;  1E7B A;  1E7I A;  2GUT A;  3B9M A;  4TQ0 A;  3V08 A;  1JNB A;  1E78 A;  1NT2 B;  1SB0 A;  4L9K A;  2EFE A;  4FIP B;  4BY9 C;  5IJE A;  2ROH A;  1LOT A;  2DBX A;  2Z8K A;  2NNW A;  3V03 A;  1HA2 A;  2BXF A;  2LOQ A;  1KXP D;  5D7G A;  1MIW A;  3SIV B;  3SIU B;  4S1Y A;  2DBU A;  3WHR A;  4ZC6 A;  4N0F D;  3W1S A;  1GNI A;  5IJ5 A;  4GDL B;  4W4U B;  2BXM A;  1FOU A;  2DYO A;  3WHQ A;  3GQX A;  5GIP A;  4LB2 A;  5IIU A;  2YDF A;  3LU7 A;  2BXB A;  3JRY A;  4IW2 A;  2VDB A;  2VUF A;  5GIN A;  3FWB C;  5GIO A;  2AGH B;  2XVU A;  1GNJ A;  2BXH A;  2LQI A;  1LNS A;  5IIX A;  1TF0 A;  2BX8 A;  3NVM A;  2E0Y A;  4BKE A;  3M99 C;  4TQ1 A;  4D7X A;  2DG5 A;  2BXA A;  1HK5 A;  2LXS A;  2BXN A;  2K0N A;  5DBY A;  2CKX A;  5HOZ A;  3TDL A;  3ECP A;  3KIK A;  4N0U D;  1E7G A;  3VQI A;  5ID7 A;  3H3A A;  4J2V A;  1E7E A;  2XVW A;  1E7C A;  1MUH A;  1UOR A;  2EFH A;  4GG2 A;  3A75 A;  4PO0 A;  5ID9 A;  4HGK A;  1KDX A;  3LU8 A;  2EFD A;  4L8U A;  2EFC A;  4ZCG A;  5IIH A;  3MHS B;  2QMC A;  2BXI A;  2E0X A;  2NQO A;  2I2Z A;  4DHX B;  1J7E A;  2KBZ A;  5B5T A;  2OT3 A;  4LB9 A;  2BXE A;  2LXT A;  2JUH A;  3FNM A;  2OZB B;  4ZBR A;  4M70 B;  2QHB A;  1E7F A;  3FWC C;  2BXG A;  4F5U A;  1MM8 A;  2AJE A;  4F5S A;  1TXU A;  4EMX A;  2DYM A;  3GQU A; 
#chains in the Genus database with same CATH homology
 5IFO A;  3NVI A;  1AO6 A;  2BXK A;  3G9K D;  2VUE A;  4WA6 B;  2BXP A;  4GDX A;  5IJF A;  4G04 A;  1N5U A;  2I30 A;  1HK4 A;  1BM0 A;  4ZBQ A;  3B9L A;  1BJ5 A;  4FJC B;  4OTT A;  3MHH B;  1MIY A;  4ZUX V;  4OTU A;  1MIV A;  4GDK B;  4OR0 A;  2BXQ A;  2BXC A;  1H9Z A;  1HK3 A;  2BXL A;  4K2C A;  2XVV A;  4C31 B;  5BPK A;  3NVK A;  4LUF A;  5DQF A;  2BXO A;  1MA9 A;  4HGM B;  3NMU A;  2BXD A;  1E7A A;  4Z69 A;  1BKE A;  4G03 A;  4E99 A;  1HK2 A;  4NAW B;  4LUH A;  5GHK A;  2XMO A;  1J78 A;  4LA0 A;  2XW0 A;  4ZBK A;  4G01 A;  2DBW A;  1E7H A;  2Z8I A;  3GA9 L;  4OT2 A;  3A73 A;  3KJL A;  1KW2 A;  1VFI A;  4N3Z A;  2XW1 A;  3CX9 A;  3ICX A;  3JQZ A;  2QM6 A;  4F5V A;  3PLA A;  3UIV A;  2Z8J A;  1HK1 A;  2XSI A;  1H5W A;  4JK4 A;  4Z9O A;  1O9X A;  5FUO A;  4F5T A;  3WHS A;  4K71 A;  4IW1 A;  3LU6 A;  1VZS A;  2V36 A;  4L9Q A;  2XVQ A;  3SQJ A;  3H37 A;  4MBE C;  1IJG A;  3V09 A;  4FK5 B;  1E7B A;  1E7I A;  3B9M A;  4TQ0 A;  3V08 A;  1JNB A;  1E78 A;  1NT2 B;  4L9K A;  2EFE A;  4FIP B;  4BY9 C;  5IJE A;  2ROH A;  1LOT A;  2DBX A;  2Z8K A;  2NNW A;  3V03 A;  1HA2 A;  2BXF A;  2LOQ A;  1KXP D;  5D7G A;  1MIW A;  3SIU B;  4S1Y A;  2DBU A;  3WHR A;  4ZC6 A;  4N0F D;  3W1S A;  1GNI A;  5IJ5 A;  4GDL B;  4W4U B;  2BXM A;  1FOU A;  2DYO A;  3WHQ A;  3GQX A;  5GIP A;  4LB2 A;  5IIU A;  2YDF A;  3LU7 A;  2BXB A;  3JRY A;  4IW2 A;  2VDB A;  2VUF A;  5GIN A;  3FWB C;  5GIO A;  2XVU A;  1GNJ A;  2BXH A;  5IIX A;  1LNS A;  1TF0 A;  2BX8 A;  3NVM A;  2E0Y A;  4BKE A;  3M99 C;  4TQ1 A;  3SIV B;  2DG5 A;  2BXA A;  1HK5 A;  2BXN A;  5DBY A;  3TDL A;  2CKX A;  5HOZ A;  3KIK A;  4N0U D;  1E7G A;  3VQI A;  5ID7 A;  3H3A A;  4J2V A;  1E7E A;  2XVW A;  1E7C A;  1UOR A;  2EFH A;  4GG2 A;  3A75 A;  4PO0 A;  5ID9 A;  4HGK A;  3LU8 A;  2EFD A;  4L8U A;  2EFC A;  4ZCG A;  5IIH A;  3MHS B;  2QMC A;  2BXI A;  2E0X A;  2NQO A;  2I2Z A;  4DHX B;  1J7E A;  2KBZ A;  5B5T A;  2OT3 A;  4LB9 A;  2BXE A;  2JUH A;  3FNM A;  2OZB B;  4ZBR A;  4M70 B;  2QHB A;  1E7F A;  3FWC C;  2BXG A;  4F5U A;  2AJE A;  4F5S A;  1TXU A;  4EMX A;  2DYM A;  3GQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...